2G4TA

Anomalous substructure of porcine pancreatic elastase (na)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase-1
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
total genus 66
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g4tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g4tA01
1GCDA 4X2XA 4H42U 2BTCE 2Q6FA 4AYYB 1ZRBA 4Y71A 3U1JB 3A88A 1BTUA 2QV1A 2J92A 5DG6A 5GWZA 2W7SA 5EQQA 1YCPH 1GBBA 1LKAA 2BLWA 2FOGA 3KCGH 5C3NA 1XXFA 1F0RA 1XUFA 2VIOA 5JBCS 3GDSA 1V2OT 4B2AA 2J94A 1KSNA 2UUYA 1GDNA 1G32B 5CHAB 1O2QA 3HGNA 5T6DA 3U8RH 3ATIA 3F68H 4JZEH 3K9XB 1EKBB 3MH5A 4CH2B 3SZNA 3V0XA 3TK6A 2ZDLA 1A46H 1C1PA 2B8OH 2H5DA 2QGRA 1ELAA 1S6FA 2CF8H 1OS8A 1DWEH 4GVUA 1SGPE 3M7UA 5A8ZA 4YOIA 2GCTB 1C5ZB 1O3DA 1FNIA 5JYIA 2ZTZA 3P8OA 1GMCG 2G8TA 2P3TB 2VIVA 2LNCA 3FZZA 5LPRA 1GBHA 4NSVA 2VWMA 1O2YA 2ZFFH 2ZFPH 2ULLA 1FPCH 3GY8A 3A83A 3HK6B 2BVSH 1HAYB 1P2JA 1WQVH 4MTBA 2VIPA 1O31A 3GCTG 1E37B 1THRH 2GVFA 4DVAU 3GDUA 2ZU5A 1Y5AT 1Y3XA 2OUAA 2F9BH 2AERH 2NU2E 2BD2A 1OP2A 2AMQA 4FU9A 1O39A 2HOBA 2PV9B 3MNSA 1MKXH 1E36B 2ZHQH 1C1WH 4HZHA 2WV4A 2PR3A 1K9OE 1W0YH 2BXTH 2ZGCA 6CHAB 2C8YB 2A31A 1KYNA 5FX6A 1NU9A 1TX6A 3UNRA 4JMYA 4MPXA 1FY4A 1C2KA 2A4QA 2IOTA 1GI9B 1V2UT 1CU1A 1IQIA 4DIHH 1FQ3A 2WUCA 1F2SE 4A7IB 1CA8B 2DUCA 1XUHA 2BZ6H 3LGVA 2Z94A 1U6QA 1DY8A 3ZYEA 4JYUH 4ABFA 1UTPA 4WF8A 2LPRA 1BHXB 4U30A 3SNEA 3QZQA 4MNVA 1C2HA 1ETTH 2XW9A 2AEIH 3SV7A 1MKWH 2G00A 1AHTH 3RXCA 2XBVA 3E91A 3BSQA 1LHCH 4XBCA 2F9OA 1J15A 1P0SH 3A80A 1TA6A 1TWXB 2A7CA 2FO9A 3CP7A 1KDQA 3ZZ4A 1EJMA 2QXJA 2A4RA 2SGDE 2ZDKA 1WAYB 1W11U 1G3CA 1JRSA 4Q7YA 1AI8H 1O3HA 2RA0A 1TGTA 4K69A 1TX7A 1BCUH 4K3JA 2EI8A 1OXGA 4AGJA 3KF2A 4BAQB 3M3TA 2H5CA 5DP5A 1QJ1B 2BQ6B 3QX5H 2A45B 3RDZA 2FPZA 1HYLA 4D7GA 2AS9A 4RKJB 1HPGA 2IJOB 3E6PH 1PPFE 1CA0C 1O2GH 3M5OA 3RXRA 1GPZA 4JZ1A 3HATH 5GCHG 1ABJH 1YCPK 5G4BA 1TBQH 2ZFQH 3PMJA 3AAUA 1GJAB 3SU2A 1B0EA 1AB9C 3NPSA 3SV9A 4I31A 1SVPA 1O2UA 3MH7A 2ZFRH 3BF6H 2AIQA 3DA9B 2HNTF 5E0GA 5C2ZA 1SFIA 1O2KA 1GHWH 4YT7H 2Z9KA 4WVPE 1O2IA 1KXDA 1K21H 2GCHG 1AUTC 4KP0A 2VGCC 3MNBA 1ZLRA 1SOTA 1QL7A 3SI4H 3RXAA 1GMCF 2VVCA 1ZZZA 3V13A 2SGEE 4CR5A 1NT1A 1TX8A 4FU7A 1V2VT 3NZIA 1Z8JB 1DWCH 1CT2E 1O5BB 2C8XB 2ZZUH 3SI3H 3SJ9A 1EATA 1NS3A 3A7VA 1BA8B 1KXAA 3GCTF 1IOEA 3VB7A 1UTLM 4A5TS 2VB0A 3P6ZB 1QGFA 1SGTA 3N7OA 3RXVA 3A8AA 3PWBA 1NPMA 1WTGH 1V2KT 3Q3KA 4M7GA 3BEIB 1RTKA 1P2QA 2VVUA 1AZZA 2G5VA 1N8OC 1GJBB 1O3LA 3CENA 1P8VC 1EAWA 2Z3EA 1MKXK 1OYQA 2V35A 2V3OH 4YZUA 3DFJA 2WPJS 2R2WU 1EJNA 1FIWA 3MYWA 3P17H 2Y5HA 5EW1H 1W14U 1VR1H 1WYKA 3TNSA 1P3CA 4K2YA 1C2MA 4ISOA 3A7XA 1PQAA 4XDEA 3F6UH 4CRGA 2XC4A 1SGYE 3MNCA 2ZDAH 3OY6U 1EAIA 4TPYA 2FS8A 4R8TB 2GKVE 2OINA 3TITA 3RXUA 3URCA 1VZQH 4CREA 1VGCC 1NRSH 2VH0A 1J16A 1C9PA 1A5IA 1ZRKA 3M36A 1BTXA 8GCHF 2QF0A 4DCDA 3BTWE 5EXLA 1HAGE 1K1LA 2ASUB 2Z9JA 3SJIA 1TNHA 2F9NA 2JETC 4BAKB 1GL0E 3RU4E 3T29A 1AVXA 1O2ZA 1MKWK 4INLA 3RC6A 1BHXF 1K22H 3A85A 1HJ8A 1S0QA 5A8XA 1FAKH 5F8ZA 1YPLH 2Y5FA 1ETSH 3A81A 2FI5E 4ISHH 1UTKA 4H6TA 3ZZAA 1GMHG 1V2RT 3LT3A 1UO6A 3LKWA 1HAVA 3RP2A 1A61H 2QXHA 1BTYA 1AU8A 4BOHA 1SGIB 1FV9A 1VITG 2G4UA 2J9NA 4NIXA 1P11E 4FUEA 1CA0B 1O3IA 1W3CA 2YNAA 5F6MA 4X1QU 3UUZA 3BTQE 1GG6C 1OYTH 3QK1A 1YF4A 3M61U 1C4V2 2BB4A 2PHBA 3KQCA 2NU1E 3PO1C 3ZZ5A 1TRMA 2J4IA 5GCHF 1O3OA 1AB9B 3UY9A 4YOJA 2ZGJA 1TPPA 2UUKB 1G2LA 5A0AE 1C4Y2 1ZPCA 1GI6A 1IQEA 3PLKA 3LGUA 2FLRH 1T8MA 1IQGA 4NA9H 4UEHH 1Z8RA 4DIIH 2GT8A 2K1QA 3JZ2B 1CGIE 2HNTE 2VGCB 3VEQB 1SGQE 2GV7A 2Z9LA 1KXEA 3NWUA 4U32A 2RA3A 4NZLA 1VITH 5L2YH 1YPGH 3BG8A 2GCHF 4FUBA 3RLWH 3QTOH 2GTBA 3M35A 4LXBH 1OX1A 1LMWB 1P2NA 1N6YA 2I6SA 3GY6A 4Y79A 1YM0A 1KLJH 1C5OH 3BEFB 3ESTA 3HK3B 2TRMA 1SGEE 2FOAA 3S0NA 4GSOA 1LQEA 4BXSA 4YESB 1UTNA 3S7KB 1C1NA 5EPNA 1C9TA 2BYAX 2A2QH 1RD3B 3HKJB 1FN8A 1N8OB 3GICB 4X8UH 2BM2A 1L1NA 3QDZB 1P3EA 3RM2H 1Z71A 1HIAA 1THPB 3A84A 1O2SA 1P06A 3AASA 3ZZ9A 3K2UA 3TU7H 1C5RA 1RS0A 3SJ8A 1GI4A 1SLWB 1HAZB 2F9UA 1TRYA 1GI7B 1TE0A 4IS5A 3PB1E 3VB6A 7GCHF 4JK6A 5FBIA 3SUDA 3DFLA 2ZI2H 3RXBA 3O8BA 5ESBA 1NESE 2ZQ2A 4AYVB 2W5EA 2FX4A 2O8WA 1W7GH 4NSYA 3RMLH 3L6PA 3ZZBA 1TGSZ 1RIWC 1EZSC 4KKDA 4AB8A 1ZTLA 2Q1JA 1F0UA 1EOLA 1W13U 1VGCB 1JRTA 3NK8A 4OS7A 3UQVA 1NM6A 1QRZA 1ZHMA 2VWLA 1YBWA 3SJOA 3PMBB 3AW1A 2PSYA 2ODPA 1SFQB 3QWCH 3MOCA 1K1OA 3MNXA 4AZ2B 1C1QA 2JETB 3AW0A 2PLXA 1VJ9U 5HXFA 2WYGA 1GJCB 4TY7A 3RU4D 2FESH 4NA8A 2D26C 1C5LH 3DUXH 4FUGA 4A1XA 1T32A 2ANWA 4OGYA 1O2WA 3ZVFA 1BMMH 2SFAA 3S9AA 1W7XH 4D76A 3QTVH 1J9CH 3FP8E 3U9AH 3VXFH 2GT7A 1C2EA 3E90B 1LPKB 5EGMA 4IC5A 3L33A 1ZYOA 1DWBH 1GMHF 1O2TA 4AG2A 4GUXA 1UTJA 1DXWA 1A5HA 2OP9A 2VWNA 5E2PA 1VITF 1GG6B 1GBIA 4K1TA 2ZU3A 1C2DA 3RXJA 4A6LA 5C67A 1C4U2 3QZRA 5FCRA 1EAXA 3PO1B 2ZC9H 3SORA 3M7QA 4ABAA 3MU0A 4YLUA 4BNRA 3P70B 3RXPA 3F9EA 3MO3A 1YPEH 3B9FH 4CHAC 1UVUH 1T7CA 1JBUH 1GJ4H 3DT0H 4AFSA 1D3DB 3SJKA 4MG3A 1H9LB 4YTAA 1Y5BT 2BDBA 1MTNC 1O3KA 1V6DA 1Z7KA 3T2NA 1DX5M 1L4DA 5EOKA 2OLGA 2ZCKP 4XBDA 2F9VA 2BLOA 1PPHE 3RXSA 2ZHEH 1ESAA 4K8YA 4MQAA 3LH1A 6LPRA 1L1GA 3RXGA 4RKOB 5DP7A 5EG4A 5EW2H 3NUMA 1F0SA 3QGNB 3TK9A 1IQJA 1HAIH 1NFWA 1V3XA 2VVVA 1FAXA 5C1YA 1C1RA 5AFZH 1WUNH 1B7XB 1AZ8A 4XSKU 1ACBE 1C2GA 1X7AC 1DICA 4Z6AH 1C5SA 3F9HA 1QB1A 1C2JA 4ZH8A 4X1NU 1DS2E 1O5CB 1Q3XA 2SNWA 3A87A 2H9TH 1ZGVA 2WINI 3GY2A 3ZVCA 1F5LA 1EP5A 5C1XA 4BTUB 3KQBA 3M5NA 3PLBA 2GGVB 1ELGA 2OC0A 2ZFSA 1BTPA 5CE1A 4Q2KA 2Y7XA 1ANBA 1SG8B 2PKAA 2A7HA 1TNJA 1S82A 3MH6A 4IN2A 1G37A 1BJUA 3SU3A 1PYTC 4ZMAH 1KLIH 2WV5A 1OOKB 1MBQA 2UWPA 1LPGB 1RIWB 3E16B 1DXPA 2UUJB 1QL9A 1EJAA 5DKMA 4AX9H 1G3EA 4THNH 2QY0B 1AQ7A 1T8OA 2ZIQH 2BQWB 2VIDA 2ZU1A 3LGTA 4E05H 1AE5A 3LDXH 3GOVB 4ASHA 4WXIA 2R3UA 3P95A 1BTZA 5IYTA 3F9GA 3TH4H 3GY5A 1NRPH 1QBVH 3UNSA 4OS2A 4DJZB 5JDUB 1O3EA 2VIQA 1O3NA 1EASA 1D3QB 4ZHMU 1M9UA 3UREA 3TJNA 3B23B 1OWKA 3T62A 3ZVDA 1NTPA 3LGIA 1SLUB 2ZPSA 2NU0E 2ESTE 2FYQA 1PFXC 3PTNA 1MAYA 1GBDA 3PWCA 3SU0A 5C1UA 1EZQA 5EQRA 4A1VA 1LHGH 2AGIX 2W3KA 1A0JA 1W8BH 2FLBH 4SGAE 4OS1A 2ZF0H 7LPRA 3KGPA 3I29A 2CGAA 3Q76A 3FAOA 2AYWA 4ZKSU 3UQOA 4Q7XA 1QRWA 1XUKA 1O3GA 2UWOA 4IBLH 1OP8A 3RXFA 1C1SA 1ANEA 1BITA 1P01A 1C1MA 1S81A 1TQ0B 1PPZA 1A0HB 4K1EA 3STIA 1ELVA 4Z0KA 4QT8C 2R0KA 5L6NH 4GHTA 1ELFA 3F9FA 1LHDH 4CHAB 3SUEA 4TWWA 1SB1H 3FVFB 3WY8A 2F9PA 1AGJA 1GMDF 1PPGE 2QC2A 3SW2B 5ETXA 4I8JA 2CN0H 1FUJA 3DD2H 2OC1A 4Y76A 2XNIA 2V0BA 4X2VA 1MTNB 3M5LA 2ZA5A 3SGAE 1ANCA 1UK2A 3MU4A 1HRTH 1TAWA 1AFQC 1YCPM 2BZAA 2FI3E 3BIUH 4CRDA 1UVSH 1ELDE 1T4UH 4Q80A 1GBKA 2XC5A 2A5KA 1TIOA 1A3BH 5BRRE 3MWIU 3Q77A 2BDYA 2P59A 4ZKNU 1O3PB 1FI8A 3T5FH 4Y8YA 2F3CE 1P9SA 2XBXA 5JPMH 1BZXE 4I8KA 3RM0H 1TONA 4TPIZ 1ZHRA 1ZSJA 2ZP0H 2GMTC 4WXVA 1NN6A 4CBOA 4H4FA 2BDCA 1GI8B 3KQEA 1P57B 4Y11E 1P2OA 3VGCC 1YC0A 1NZQH 4B2CA 4F49A 3SGBE 3KNXA 1KDQB 4IC6A 2PUXB 1O5EH 1GJ8B 3V3MA 3BV9B 1TOMH 1CHOG 3EQ0H 4Y7BA 2R9PA 2HVXA 3ZVEA 2V6NA 4DG4A 1ZOMA 1TRNA 4D7FA 3UOUA 3E0NB 3SNDA 4FUCA 2FDAA 4DURA 2HGTH 1TB6H 1Q2WA 1GJDB 1WOFA 1RRKA 3LU9B 1AO5A 1GBAA 1O2VA 3K6YA 2B9LA 2QF3A 4MLFB 4J1YA 2O8TA 1ZTKA 1GHAG 3E3TA 4O3TA 4WMFA 2PFEA 5FBEA 2ILNA 1DSTA 3GCHC 4O3UA 2PUQH 4Y8ZA 2FODA 3UTUH 4CRBA 3M3VA 1MTSA 2BVXH 3MU8A 2Y82A 1F92A 5J4SA 3SV2H 2FTMA 3PLPA 1HJAC 3RU4T 1AN1E 1Y5UT 1GI0A 3BTEE 1UCYH 1QBNA 2J38A 3TK5A 1C5VA 1HDTH 2OQUA 2PTNA 4ISNA 1N6XA 1BMLA 1TGBA 3QUMP 1V2NT 2D8WA 3MH4A 1H8DH 1JIMA 1O30A 1DDJA 1INCA 1QA7A 4MPVA 1SOZA 2WPIS 2O9QA 2BY9X 2OQ5A 4MPWA 1GHVH 4RN6A 2P94A 1QB6A 1GBFA 2B5TB 1E38B 3VB3A 4NFFA 4OS5A 5JBBS 3K6ZA 5JBTA 5K0HA 3CS7A 1HJ9A 1RTFB 3E1XB 3EA7A 1H9HE 3ATKA 1SGDE 3KL6A 3RLYH 3SNCA 2QCYA 1LVMA 1BJVA 1Z1JA 4K8BA 2FOFA 2W3IA 3BTTE 3EDXB 5GDSH 3UWJH 1ESBA 4GPGA 2I6QA 4X1SU 1SGCA 2HPPH 1OWHA 5DK1A 4WH6A 1BQYA 1CE5A 2EC9H 5A09A 1E35B 2FZZA 2P3UB 1QCPA 2OBQA 2WPMS 3SUFA 4JCNA 5IDKA 1WU1A 1UHBB 3HGPA 1AFQB 1BTHH 1D6WA 1O3AA 4U01A 2PSXA 1V2TT 1ZJDA 1XXDA 4FUIA 4OS4A 1MTWA 2CXVA 1D4PB 1SLVB 1C2LA 1ZJKA 3PMAB 2ZCLP 1P03A 5FAHA 4X2YA 1DSUA 1P10A 5SGAE 4Y7AA 1QR3E 2FXRA 2WYJA 1QIXB 2QA9E 1G9IE 3LPRA 1ARBA 4JZFH 1J17T 1GCTC 5DGJA 1O2NA 1QQ4A 2Y80A 1A2CH 2GMTB 4UE7H 5A0CA 2W7UA 3ZYDA 4AOQA 2BVRH 3RXKA 2OBOA 3KQDA 1HLTH 3A8BA 1AE8H 2YNBA 1YYY1 5GIBA 5I25A 1BDAA 1O38A 3U1IB 2JH0D 1FY3A 4WMDA 3VGCB 4AGKA 1TFXA 4BTTB 4X1RU 1KY9A 3M37A 3PV4A 4BANB 2W26A 1MTUA 1V2LT 9LPRA 2BOKA 4ZKOU 3A89A 1OPHB 3A7TA 1IHSH 2ZFTA 1CHOF 1GBMA 2BY8X 4CRCA 1JIRA 1HAVB 2AH4X 2TGAA 1SLXB 1WTHD 4K1SA 2BX4A 4ABBA 1O3JA 5K7RA 1ZSLA 3MU1A 1J8AA 2TIOA 3O8DA 1P04A 1IQFA 2TBSA 4XBBA 3GCHB 1GHAF 4ESTE 1EZUC 4X6MA 1GBCA 2C8WB 2FP7B 1O3FA 3NXPA 5L30H 1C2IA 2EA3A 2ZDNA 2BD9A 2ANMH 1SR5C 3QLPH 5J4QA 3ODDA 1HJAB 3MO6A 1NU7B 2SGAA 1S0RA 3TJUA 1O3MA 3K65B 3C27B 4I32A 2OC7A 8LPRA 1Y59T 3DHKH 5ABWA 3BG4C 5FPSA 1YGCH 3QO6A 1DWDH 4MNWA 3LJJA 3ZVBA 1FY5A 4YLQH 2THFB 4WH8A 2ALVA 5C5OA 1F5KU 1A7SA 1UCYK 4DW2U 1FONA 1O5FH 1ID5H 2ZDMA 2ZECA 3T26A 2ZHFH 1FIZA 4Y0ZE 4MNYA 1DUEA 2PKSC 3Q00A 2VWOA 4Y0YE 2STBE 4A92A 1JXPA 4IN1A 5I46H 3F1SB 1NO9H 3LC3A 1AKSA 3Q3XA 1D6RA 1EB2A 3BTFE 1L4ZA 1GI3A 1AWFH 1MCVA 2SNVA 2ZTXA 4BAMB 7ESTE 1HIAB 2ANYA 3H5CB 4D9RA 4AFUA 4NA7A 1JWTA 2BD8A 3LIWA 3TLOA 3ZZ3A 1UTOA 2BDHA 2FOHA 1K1IA 3OY5U 1WSSH 4ZKRU 2VJ1A 1TNLA 2FOMB 1V2PT 2Q6GA 1UK3A 1Z6JH 5JB9S 1CO7E 1O3BA 1V2ST 1GBEA 1A1RA 3PTBA 1FLEE 1TPOA 1QL8A 1S6HA 1DITH 1PQ7A 2GZ8A 1YKTA 1GCTB 1PPBH 2XCNA 2AGGX 1ORFA 4UFEH 1ESTA 4B76A 1EQ9A 1EPTA 1VCPA 1ZMLA 3A7WA 1BMNH 1GBJA 3PMHB 3KN2A 2IN2A 1P09A 2FS9A 4E06H 2STAE 2NU4E 3RC4A 2XYAA 4JYTA 1VCQA 1C5YB 1BOQA 2IPHA 2R0LA 3GY4A 5BPEA 1TGNA 2PGQB 1UTMA 1QRXA 1L1JA 3R3GB 4UDWH 3P8NA 1ETRH 4DOQA 3OSYA 3MHWU 3V12A 3RXEA 1NFXA 1DANH 1HAPH 1BRUP 1UCYE 3R0FA 1SGFA 4F4OC 3I78A 1EOJA 1SHYA 1T8NA 3ZZ8A 1XUJA 2FOEA 1RTLA 1ZR0A 1H9IE 3BIVH 3MI4A 4UFDH 4R0IA 3VXEH 2ZWLH 1BRAA 2D1JA 1S84A 2AMPA 3ZVGA 1XUIA 1C5XB 2ZCHP 2BY5X 4JZDH 4DY7B 2FEQH 2ZU2A 1C5NH 1UVOA 1XKBC 1XVOA 1RXPA 2Y81A 4JYVH 2A1DB 1MZAA 4X8SH 2OTVA 3SV6A 3TH3H 4CRAA 4ISLA 3BG4B 1H1BA 5AHGH 4X1PU 1EP6A 1KXBA 2TGPZ 1QBOA 4KTCA 2A4OA 4MDSA 3S69A 1HBTH 1LTOA 4Q7ZA 2XBWA 4X0WU 2EI6A 1GBTA 1KTSB 4IMZA 5EODA 1LHEH 1C5PA 4B71A 3UIRA 1TNGA 4TYDA 4KGAA 2ZEBA 1O5DH 2A4GA 3D62A 1K1JA 2PKSB 2O8LA 2BD4A 3ZVAA 2XWBI 4YM9A 2PW8H 3VPKA 4ZUHA 1MUEB 1Z6EA 2P95A 1BIOA 1NFUA 2BMGB 2Z7FE 2BY6X 3AAVA 1ARCA 3RMNH 1KTTB 2VINA 1HNEE 1IHTH 3GYLB 3A8CA 5FX5A 4Y6DA 4HI3A 1TNIA 1S85A 1MZDA 5JBAS 4ISIH 2CV3A 2TGDA 1MCTA 3H7TA 2A32A 4SGBE 2WUBA 2KAIA 2JKHA 1GI2A 3RMMH 2Y5GA 4DGJA 1C1TA 1PQ5A 3UR6A 1NC6A 1IAUA 1WBGB 3LJOA 2QAAA 3EAJA 2Z3DA 4NZQA 2WPHS 1BRBE 3SN8A 3TGJE 1D9IA 2HWLB 2BHGA 3TJOA 3BTDE 3A7YA 4FUHA 3UR9A 1LO6A 4YO9A 1LKBA 1GI5A 1ZTJA 3TGKE 2DE9A 1MH0A 5A2MH 5E8EH 4ABHA 1UVTH 2CHAC 4JZIA 8KME2 2UUFB 1T8LA 2B7DH 2RG3A 1ELBA 3EYDA 4NIYA 2P16A 5T6FA 1F7ZA 2BDAA 2O8UA 1SGRE 2CMYA 2GZ7A 3OTJE 1O34A 1NROH 1O2MA 5TCCA 4BTIB 4CBNA 4RSPA 3LONA 5JB8S 2VU8E 3M7TA 3LC5A 2J2UA 1K1MA 4X8VH 1GJ6A 2QN5T 4I8HA 1C5QA 1Z8GA 2FTLE 2H1UA 3RXMA 1ZHPA 4K5ZA 1P02A 2BXUH 1HAXB 1P12E 4KTSA 1AVWA 1GGDC 5FXLA 2ZO3H 1SC8U 3BTME 5HYOA 2PWXA 1O5GH 2GV6A 1G2MA 5EXNA 2BX3A 1BMAA 1ANDA 1G30B 1V2MT 3GDVA 4AORA 3SQEE 3A7ZA 8ESTE 3URDA 1JOUB 2BD3A 4AG1A 1TMUH 1YPHC 2P93A 2B0FA 2XWAA 3ELAH 1TABE 2H9HA 1MBMA 2A5AA 1HFDA 2QXGA 3FFGA 2FI4E 3RMOH 3UFAA 1O2LA 1D3TB 3SUGA 1AUJA 2Z6BD 2QYIA 1FMGA 2CF9H 1XM1A 3SU4A 2FYRA 3ZZ7A 1KIGH 1SGNE 2C3SA 1PYTD 1AIXH 3ATLA 1C1OA 1W0ZU 2GD4B 1G36A 3VB4A 4NFEA 2P8OC 5DP4A 5LPFA 1EXFA 2BQ7B 5TCAA 5EXMA 5HGGA 1GDUA 2ALPA 2ZTYA 1BRCE 1XX9A 2EI7A 1GBLA 1CGHA 1EX3A 1HCGA 3KEEA 1C5UA 1GHYH 1O2PA 3O8CA 4ABIA 5EPYA 1GHXH 4MVNA 1O0DH 4HTCH 1C1VH 5F8TA 4IMQA 3GCOA 3ZZCA 1C5MD 3RXOA 2QIQA 1O36A 1TMTH 3U8TH 1Y8TA 1TPAE 3A86A 3LH3A 3TPIZ 5DP8A 4ZXYH 1K28D 4CR9A 1O5AB 1MMJN 1H8IH 1ZPZA 1SQOA 1ZMJA 2BDGA 3H7OA 2V3HH 6GCHG 1ZMNA 1ABIH 3EA8A 2AFQB 1L0ZA 2Z9GA 1GVZA 5FHTA 1IQHA 3SBKA 1EB1H 2BLQA 1QTFA 2ZU4A 1W10U 2FMJA 1XMNB 1WV7H 3SOSA 8GCHG 1O2RA 2AIPA 4X6NA 1HGTH 4O97A 2FM2A 2BOHB 1HV7A 1DLKB 1SHHB 2WPKS 1H4WA 1AY6H 2CHAB 2OXSA 3BEUA 1EZXC 3QN7A 3SGQE 2OCVB 2FX6A 1SQAA 2Y7ZA 1LVBA 5E0HA 1SBWA 1G3DA 2RCEA 3D65E 4H6SB 1FJSA 2JH5D 2CJIA 2NU3E 3FANA 2Z3CA 3TIUA 2M5TA 2GZ9A 1RJXB 3TJVA 4IW4E 1RGQA 1GGDB 3B8JA 4AN7A 3IG6B 3ZV8A 2HRVA 2ZHDA 3RXTA 1T4VH 1NY22 1FZZA 3E8LA 4HGCA 3S9BA 4FU8A 4I8GA 4WY3A 3ODFA 3TVJB 4ZROA 4FVBA 4GCHG 1P2IA 1FY8E 2SGPE 2ZHWH 1ELTA 4X6OA 1UMAH 1MU6B 1MQ5A 5DP9A 3BN9A 2WPLS 3SO3A 1DM4B 1BBRH 4JK5A 5CMXH 1NFYA 1DLEA 3FP7E 4I7YH 4B75A 5FPYA 1YPJH 5E0JA 1QURH 1A3EH 3L3TA 1UJ1A 1YPMH 7KMEH 1TLDA 3HKIB 4NIVA 1MD7A 3BTGE 2D2DA 1OWIA 1OWJA 1QB9A 2P8OB 3FZDA 1LVYA 2TPIZ 4OGXA 3KHVA 4B1TA 1L2EA 4X8TH 1LVOA 2ZGHA 5AFYH 4LZ4B 2XTTB 1QJ6B 1MD8A 3CS0A 2AMDA 1HB0B 2J34A 1GWAA 1TBZH 2H6MA 1GHBG 1O32A 1SI5H 5GXPA 1BUIA 2BD5A 4KTUA 1CT4E 1Z1IA 4WJG2 3VFEA 4E7NA 5GPIB 1F0TA 1QQUA 4ZXXH 1J14A 2VH6A 3UPEA 4Y10E 4ABEA 4AFQA 2SGFE 4K60A 3C1KA 4CH8B 1EPTC 7GCHG 1UHBA 1EAUA 2C4FH 2DE8A 1ELCA 2O8MA 4PROA 4O9VA 3VB5A 1LCYA 3RUOA 3RXLA 1GJ5H 3PYHA 3P8FA 4TWYA 4FUFA 5L2ZH 1DPOA 1QFKH 5LPEA 4VGCC 1KXFA 3SV8A 2ZPQA 3GY7A 1O3CA 3ATMA 2G81E 1QJ7B 1DVAH 6GCHF 1ZGIA 3EA9A 3ENSB 1P9UA 4GAWA 5C20A 2ZDVH 4FVDA 4HFPB 1C1UH 1HAHH 4D8NA 1IQNA 3IWMA 4OS6A 1F5RA 3SHCH 2BDIA 3SU1A 1AVGH 1OWEA 3TGIE 1VJAU 3HPTB 1IQLA 1E0FD 1AMHA 1TALA 2GX4A 2G51A 6ESTA 5HMAA 4B73A 4X6PA 2A7JA 2FOBA 1C2FA 3ATWA 1GVLA 2C93B 4ZHAA 1CVWH 4A1TA 1YLCA 2BD7A 1V2JT 2UWLA 1B5GH 1T31A 2Q6DA 2ZPRA 1OWDA 5HM9A 3Q3YA 2HALA 3D49H 1YPKH 1CQQA 3QGJA 1CHGA 1Y3VA 3SNBA 3PROA 3O8RA 1E34B 1RFNA 1CBWC 1GL1A 4TY6A 1OSSA 5LH8A 3GISB 2GDDA 1OP0A 3V7TA 1YLDA 1CGJE 2ZKSA 1DE7H 4MNXA 1WQSA 4GCHF 1UVPA 3UNQA 2GP9B 1AKSB 3GCNA 1HUTH 1QHRB 2AGEX 9ESTA 4NG9H 3TNTA 4WWYA 4INHA 3U69H 1A5GH 1QNJA 5C5NA 2J95A 2GDEH 3W95A 2P3FH 3EE0B 3KIDU 3RXQA 1GHZA 1BBRK 5A0BA 1GVKB 2FOCA 1ELEE 2C90B 1Q31A 1C5WB 2VIWA 2XCFA 1KXCA 1LQDB 4WMEA 1TBRH 4GHQA 4YOGA 4AFZA 1LDTT 4B74A 1BB0B 2H9EH 1K1NA 5T6GA 1P05A 2ZNKH 3RC5A 1HAOH 5T3HA 3U98H 1SL3A 4Y8XA 2A5IA 3S9CA 1MTVA 1OKXA 3LGYA 1MU8B 1FY1A 4ABJA 2BLVA 1O35A 1GHBF 4GLYA 4X2WA 4NWKA 4FUDA 1DFPA 4ABGA 1KLTA 2G5NA 3T28A 1AFEH 1TOCB 3P8GA 2R3YA 5LGOA 1Z8IB 1EPTB 4BAOB 3BTHE 1C5TA 1XKAC 1P2MA 1BTWA 4UONA 1O37A 1DT2A 1QA0A 1S83A 3E0PB 3UWIA 4D9QA 2VNTA 1SMFE 2XRCA 4J2YB 1O2XA 2ODYB 2ODQA 4UFGH 3GYMA 4I8LA 3M3SA 1GDQA 2PGBB 1FN6A 4VGCB 1V2WT 1PJPA 1PPCE 1MQ6A 1CT0E 5AF9H 4ZAEA 4UFFH 1SPJA 3PM3A 5F03A 1D3PB 4IGDA 2HNTC 3TH2H 5EQSA 2FWWA 5A8YA 5HM2A 1SQTA 1ZSKA 3NCLA 2JH6D 4BXWA 1IQKA 4MPUA 5CHAC 1SSXA 5FCKA 1LHFH 3OX7U 1ZPBA 4FUJA 2C8ZB 3RXIA 2A2XH 1MAXA 3W94A 1FPHH 1TNKA 1AD8H 2A0QB 4LK4A 1O2JA 3SNAA 3STJA 5E2OA 4U2WA 1TMBH 1O2HA 4NGAH 1FDPA 4LOYH 1SGFG 2FIRH 1DUAA 1IQMA 3MMGA 4KELA 2GCTC 1K1PA 2G52A 3SU6A 3ZV9A 3ITIA 2H2ZA 1G3BA 1TPSA 1B0FA 2QXIA 3RXDA 1BBRE 1QY6A 3SQHE 1CBWB 4XE4A 2EEKA 1TGCA 5TJXA 2TGTA 1TQ7B 1K2I1 4B2BA 2G4TA 4CRFA 2ZGXH 1W2KH 4ZHLU 3M5MA 1TYNA 1Y3WA 2ZQ1A 1DY9A 5PTPA 4YT6H 3UOPA 5F8XA 4AB9A 1GMDG 1VCWA 2XBYA 2Z9IA 3ZZDA 1S5SA 2NWNA 3SHAH 2ANKH 2F91A 3D23A 1A4WH 5DJ7A 3P92A 5ESTE 1HXFH 2ZG0H 5FPTA 1XVMA 1NRRH 3T25A 5H4IB 5DPAA 5DO4H 2XC0A 1NRNH 4NWLA 1PPEE 2G55A 3A8DA 6CHAC 1JMOH 1DOJA 5DP6A 3AVZA 2ZGBH 2HLCA 3I77A 4XFQA 1UTQA 3MO9A 4E7RG 2OC8A 2Y6TA 3GY3A 2F83A 5EU8A 1TA2A 1O33A 1AWHB 1A0LA 1V2QT 2KAIB 1NRQH 3LGWA 4NCYA 3BTKE 2XXLA 1YPHE 2HPQH 2OD3B 1GI1A 3A82A 1BT7A 1GJ9B 2RDLA 3EGKH 1FXYA 4FXGH 3U8OH 4LZ1H 2PKAB 2YOLA 5DP3A 3T27A 3FP6E 3G01A 3RXHA 5AVDA 1P2KA 1EUFA 4BAHB 1THSH 3SU5A 1YP9A 4ABDA 4DT7B 1Y3YA 3LOXA 3OYPA 5B6OA 1HXEH 2BY7X 4O03A 1PQ8A 1UK4A 4NIWA 1O2OA 2SGQE 1LPZB 3MFJA 3S7HB 3MTYA 4XOJA 3ZZ6A 2PTCE 3OU0A 1GJ7B 1W12U 2R2MB 1XUGA 3MU5A 3IITA 3JZ1B 4UD9H 1Y3UA 4I33A 3NKKA 1N1LA 1CSOE 1WCZA 5GJ4B 4INKA
chains in the Genus database with same CATH superfamily
2CK3D 1GCDA 4X2XA 4H42U 2BTCE 2Q6FA 4AYYB 1ZRBA 4Y71A 3U1JB 3A88A 1BTUA 2QV1A 2J92A 5DG6A 5GWZA 2W7SA 5EQQA 1YCPH 1GBBA 1LKAA 2BLWA 2FOGA 3KCGH 5EJLA 1XXFA 1F0RA 5C3NA 1XUFA 2VIOA 5JBCS 3GDSA 1V2OT 4B2AA 2J94A 1KSNA 2UUYA 1GDNA 4M9FA 1G32B 5CHAB 1O2QA 3HGNA 5T6DA 3U8RH 3ATIA 3F68H 4JZEH 3K9XB 1EKBB 3MH5A 4CH2B 3SZNA 3V0XA 2M2AA 3TK6A 2ZDLA 1A46H 1C1PA 2B8OH 2H5DA 2QGRA 1ELAA 1S6FA 2CF8H 1OS8A 1DWEH 4GVUA 1SGPE 3M7UA 5A8ZA 4YOIA 2GCTB 1C5ZB 1O3DA 1FNIA 5JYIA 2ZTZA 3P8OA 1GMCG 2G8TA 2P3TB 2VIVA 2LNCA 3FZZA 5LPRA 1GBHA 4NSVA 2VWMA 1O2YA 2ZFFH 2ZFPH 2ULLA 1FPCH 3GY8A 3A83A 3HK6B 2BVSH 1HAYB 1P2JA 1WQVH 4MTBA 2VIPA 1O31A 2LELA 3GCTG 1E37B 1THRH 2GVFA 4DVAU 3GDUA 2ZU5A 1Y5AT 1Y3XA 2OUAA 2F9BH 2AERH 2NU2E 2BD2A 1OP2A 2AMQA 4FU9A 1O39A 2HOBA 2PV9B 3MNSA 1MKXH 1E36B 2ZHQH 2KCAA 2KX4A 1C1WH 4HZHA 2WV4A 2PR3A 1K9OE 1W0YH 2BXTH 2ZGCA 3OEHD 6CHAB 2C8YB 2A31A 1KYNA 5FX6A 1NU9A 1TX6A 3UNRA 4JMYA 4MPXA 1FY4A 1C2KA 2A4QA 2IOTA 1GI9B 1V2UT 1YY3A 1CU1A 1IQIA 4DIHH 1FQ3A 2WUCA 1F2SE 4A7IB 3N7EA 1CA8B 2DUCA 1XUHA 2BZ6H 3LGVA 2WV9A 2Z94A 1U6QA 1DY8A 3ZYEA 4JYUH 4ABFA 1UTPA 4WF8A 2LPRA 1BHXB 4U30A 3SNEA 3QZQA 4MNVA 1C2HA 1ETTH 2XW9A 5C0UA 2AEIH 1NBMD 3SV7A 1MKWH 2G00A 2KR7A 1AHTH 3RXCA 2XBVA 2KCPA 3E91A 3BSQA 1LHCH 4XBCA 2F9OA 1J15A 1P0SH 3A80A 1TA6A 1TWXB 2A7CA 2FO9A 3CP7A 1KDQA 1EFRD 3ZZ4A 1EJMA 2QXJA 2A4RA 2SGDE 2ZDKA 1WAYB 1W11U 1G3CA 1JRSA 4Q7YA 1AI8H 1O3HA 2RA0A 1TGTA 4K69A 1TX7A 1BCUH 4K3JA 2EI8A 1OXGA 4AGJA 3KF2A 4BAQB 3M3TA 2H5CA 5DP5A 1QJ1B 2BQ6B 3QX5H 2A45B 3RDZA 2FPZA 1HYLA 4D7GA 2AS9A 4RKJB 1HPGA 2IJOB 3E6PH 1PPFE 1CA0C 1O2GH 3M5OA 3RXRA 1GPZA 4JZ1A 3HATH 5GCHG 1ABJH 1YCPK 5G4BA 1TBQH 2ZFQH 3PMJA 3F2FA 3AAUA 1GJAB 3SU2A 3OE7D 1B0EA 1AB9C 3NPSA 3SV9A 4I31A 1SVPA 1O2UA 3MH7A 2ZFRH 3BF6H 2AIQA 3DA9B 2HNTF 5E0GA 5C2ZA 1SFIA 1O2KA 5IK2D 1GHWH 4YT7H 2Z9KA 4WVPE 1O2IA 1KXDA 1K21H 2GCHG 1AUTC 4KP0A 2VGCC 3MNBA 1ZLRA 1SOTA 1QL7A 3SI4H 3RXAA 1GMCF 2VVCA 1ZZZA 3V13A 2SGEE 4CR5A 1NT1A 1TX8A 4FU7A 1V2VT 2RDEA 3NZIA 1Z8JB 1DWCH 1CT2E 1O5BB 2C8XB 2ZZUH 3SI3H 3SJ9A 1EATA 1NS3A 3A7VA 1BA8B 1KXAA 3GCTF 1IOEA 3FO8D 3VB7A 1UTLM 4B6FA 4A5TS 2VB0A 3P6ZB 1QGFA 3OAAD 1SGTA 3N7OA 3RXVA 3A8AA 3PWBA 1NPMA 1WTGH 1V2KT 3Q3KA 4M7GA 3BEIB 1RTKA 1P2QA 2VVUA 1AZZA 2G5VA 1N8OC 1GJBB 1O3LA 3CENA 1P8VC 1EAWA 2Z3EA 1MKXK 1OYQA 2V35A 2V3OH 4YZUA 5HKKD 3DFJA 2WPJS 2R2WU 1EJNA 1FIWA 3MYWA 3P17H 2Y5HA 5EW1H 1W14U 1VR1H 1WYKA 3TNSA 1P3CA 4K2YA 1C2MA 4ISOA 3A7XA 1PQAA 4XDEA 3F6UH 4CRGA 2XC4A 1SGYE 3MNCA 2ZDAH 2EQNA 3OY6U 1EAIA 4TPYA 2FS8A 4R8TB 2GKVE 2OINA 3TITA 3RXUA 3URCA 1VZQH 2W6ID 4CREA 1VGCC 1NRSH 2VH0A 1J16A 1C9PA 1A5IA 1ZRKA 3M36A 1BTXA 8GCHF 2QF0A 4DCDA 3BTWE 5EXLA 1HAGE 1K1LA 2ASUB 2Z9JA 3SJIA 1TNHA 2F9NA 2JETC 4BAKB 1GL0E 3RU4E 3T29A 1AVXA 1O2ZA 1MKWK 4INLA 3RC6A 1BHXF 1K22H 3A85A 1HJ8A 1S0QA 5A8XA 1FAKH 5F8ZA 1YPLH 2Y5FA 1ETSH 3A81A 4I86A 2FI5E 4ISHH 2J5UA 1UTKA 4H6TA 3ZZAA 1GMHG 1V2RT 3LT3A 1UO6A 3LKWA 1HAVA 3RP2A 1A61H 2QXHA 1BTYA 1AU8A 4BOHA 1SGIB 1FV9A 1VITG 2G4UA 2J9NA 4NIXA 1P11E 4FUEA 1CA0B 1O3IA 1W3CA 2YNAA 5F6MA 4X1QU 3UUZA 3BTQE 1GG6C 1OYTH 3QK1A 1YF4A 3M61U 1C4V2 2BB4A 2PHBA 3KQCA 2NU1E 3NRLA 3PO1C 3ZZ5A 1TRMA 2J4IA 5GCHF 1O3OA 4FETA 2KCYA 1AB9B 3UY9A 4YOJA 2ZGJA 1TPPA 2UUKB 1G2LA 5A0AE 1C4Y2 1ZPCA 1GI6A 1IQEA 3PLKA 3LGUA 2FLRH 1T8MA 1IQGA 4NA9H 4UEHH 1Z8RA 4DIIH 3FKSD 2GT8A 2K1QA 3JZ2B 1CGIE 2HNTE 2VGCB 3VEQB 1SGQE 2GV7A 3GS9A 2Z9LA 1KXEA 3NWUA 4U32A 2RA3A 4NZLA 1VITH 5L2YH 1YPGH 3BG8A 2GCHF 4FUBA 3RLWH 3QTOH 2GTBA 3M35A 4LXBH 5KEDA 1OX1A 1LMWB 1P2NA 1N6YA 2I6SA 3GY6A 1E1QD 4Y79A 1E79D 1YM0A 1KLJH 1C5OH 3BEFB 3ESTA 3HK3B 2TRMA 1SGEE 2FOAA 3S0NA 4ACAA 4GSOA 5GNDA 1LQEA 4BXSA 4YESB 1UTNA 3S7KB 1C1NA 5EPNA 1C9TA 2BYAX 2A2QH 1RD3B 3HKJB 4ASUD 1FN8A 1N8OB 3GICB 4X8UH 2BM2A 1L1NA 3QDZB 1P3EA 3RM2H 1Z71A 1HIAA 1THPB 3A84A 1O2SA 1P06A 3AASA 3ZZ9A 3K2UA 3TU7H 1C5RA 1RS0A 3SJ8A 1GI4A 1SLWB 1HAZB 2F9UA 1TRYA 1GI7B 1TE0A 4IS5A 3PB1E 3VB6A 7GCHF 4JK6A 5FBIA 3SUDA 3DFLA 2ZI2H 3RXBA 3O8BA 5ESBA 1NESE 2ZQ2A 4AYVB 2W5EA 2FX4A 2O8WA 1W7GH 4NSYA 3RMLH 3L6PA 3ZZBA 1TGSZ 1RIWC 1EZSC 4KKDA 4AB8A 1ZTLA 2Q1JA 1F0UA 1EOLA 1W13U 1VGCB 1JRTA 3NK8A 4OS7A 3UQVA 1NM6A 1QRZA 1ZHMA 2VWLA 1YBWA 3SJOA 3PMBB 3AW1A 2PSYA 2ODPA 1SFQB 3QWCH 3MOCA 1K1OA 3MNXA 4AZ2B 1C1QA 2JETB 3AW0A 2PLXA 1VJ9U 5HXFA 2WYGA 1GJCB 4TY7A 3RU4D 2FESH 4NA8A 2D26C 1C5LH 1SQRA 3DUXH 4FUGA 4A1XA 1H8HD 1T32A 2ANWA 4OGYA 1O2WA 3ZVFA 5CDFE 1BMMH 2SFAA 3S9AA 1W7XH 4D76A 3QTVH 1J9CH 3FP8E 3U9AH 3VXFH 2GT7A 1C2EA 3E90B 1LPKB 5T1VA 5EGMA 4IC5A 3L33A 1ZYOA 1DWBH 1GMHF 1O2TA 4AG2A 4GUXA 1UTJA 1DXWA 1A5HA 2OP9A 2VWNA 5E2PA 1VITF 1GG6B 1GBIA 4K1TA 2ZU3A 1C2DA 3RXJA 4A6LA 5C67A 1C4U2 3QZRA 5FCRA 1EAXA 3PO1B 2ZC9H 3SORA 3M7QA 4ABAA 3MU0A 4YLUA 4BNRA 3P70B 3RXPA 3F9EA 2JJ2D 3MO3A 5KGOA 1YPEH 3B9FH 4CHAC 1UVUH 1T7CA 1JBUH 1GJ4H 3DT0H 4AFSA 1D3DB 3SJKA 4MG3A 1H9LB 4YTAA 1Y5BT 2BDBA 1MTNC 1O3KA 1V6DA 1Z7KA 3T2NA 1DX5M 1L4DA 5EOKA 2OLGA 2ZCKP 3FOAA 4XBDA 2F9VA 2BLOA 1PPHE 3RXSA 2ZHEH 1ESAA 4K8YA 4MQAA 3LH1A 6LPRA 1L1GA 3RXGA 4RKOB 5DP7A 5EG4A 5EW2H 3NUMA 1F0SA 3QGNB 3TK9A 1IQJA 1HAIH 1NFWA 1V3XA 2VVVA 1FAXA 5C1YA 1C1RA 2VBCA 5AFZH 1WUNH 1B7XB 2HVYB 1AZ8A 4XSKU 1ACBE 1C2GA 1X7AC 1DICA 4Z6AH 1C5SA 3F9HA 1QB1A 1C2JA 4ZH8A 4X1NU 1DS2E 1O5CB 1Q3XA 2SNWA 3A87A 2H9TH 1ZGVA 2WINI 3GY2A 3ZVCA 1F5LA 3DSOA 1EP5A 5C1XA 4BTUB 3KQBA 3M5NA 3PLBA 2GGVB 1ELGA 2OC0A 2ZFSA 1BTPA 5CE1A 4Q2KA 2Y7XA 1ANBA 1SG8B 2PKAA 2A7HA 1TNJA 1S82A 3MH6A 4IN2A 1G37A 3DSPA 1COWD 1BJUA 4HG6A 3SU3A 1PYTC 4ZMAH 1KLIH 2WV5A 1OOKB 1MBQA 2UWPA 1LPGB 1RIWB 3E16B 1DXPA 2UUJB 1QL9A 1EJAA 5DKMA 4AX9H 1G3EA 4THNH 2QY0B 1AQ7A 1T8OA 2ZIQH 2BQWB 2VIDA 2ZU1A 3LGTA 4E05H 1AE5A 3LDXH 3GOVB 4ASHA 4WXIA 2R3UA 3P95A 1BTZA 5IYTA 3F9GA 3TH4H 3GY5A 1NRPH 1QBVH 3UNSA 4OS2A 4DJZB 5JDUB 1O3EA 2VIQA 1O3NA 1EASA 1D3QB 4ZHMU 1M9UA 3UREA 3TJNA 3B23B 1OWKA 3T62A 3ZVDA 1NTPA 3LGIA 1SLUB 2ZPSA 2NU0E 2ESTE 2FYQA 1PFXC 3PTNA 1MAYA 1GBDA 3PWCA 3SU0A 5C1UA 1EZQA 5EQRA 4A1VA 1LHGH 2AGIX 2W3KA 1A0JA 1W8BH 2FLBH 4SGAE 4OS1A 2ZF0H 7LPRA 3PV5A 3KGPA 3I29A 2CGAA 3Q76A 3FAOA 2AYWA 4ZKSU 3UQOA 4Q7XA 1QRWA 1XUKA 1O3GA 2UWOA 4IBLH 1OP8A 3RXFA 1C1SA 1ANEA 1BITA 1P01A 1C1MA 1S81A 1TQ0B 1PPZA 1A0HB 4K1EA 3STIA 1ELVA 4Z0KA 4QT8C 2R0KA 5L6NH 4GHTA 1ELFA 3F9FA 1LHDH 4CHAB 3SUEA 4TWWA 1SB1H 3FVFB 3WY8A 2F9PA 1AGJA 1GMDF 1PPGE 2QC2A 3SW2B 5ETXA 4I8JA 2CN0H 1FUJA 3DD2H 2OC1A 4Y76A 2XNIA 2V0BA 4X2VA 2F43B 1MTNB 3M5LA 2ZA5A 3SGAE 1ANCA 1UK2A 3MU4A 1HRTH 1TAWA 1AFQC 1YCPM 2BZAA 2FI3E 3BIUH 4CRDA 1UVSH 1ELDE 1T4UH 4Q80A 1GBKA 2XC5A 2A5KA 1TIOA 1A3BH 5BRRE 3MWIU 3Q77A 2BDYA 2P59A 4ZKNU 1O3PB 1FI8A 3T5FH 4Y8YA 2F3CE 1P9SA 4YXWD 2XBXA 5JPMH 1BZXE 4I8KA 3RM0H 1TONA 4TPIZ 1ZHRA 1ZSJA 2ZP0H 2GMTC 4WXVA 1NN6A 4CBOA 4H4FA 2BDCA 1GI8B 3KQEA 1P57B 4Y11E 1P2OA 3VGCC 1YC0A 1NZQH 4B2CA 4F49A 3SGBE 3KNXA 1KDQB 2WSSD 4IC6A 2PUXB 1O5EH 1GJ8B 3V3MA 3BV9B 1TOMH 1CHOG 3EQ0H 4Y7BA 2R9PA 2HVXA 3ZVEA 2V6NA 4F55A 4DG4A 1ZOMA 1TRNA 4D7FA 3UOUA 3E0NB 3SNDA 4FUCA 2FDAA 4DURA 2HGTH 1TB6H 1Q2WA 1GJDB 1WOFA 1RRKA 3LU9B 1AO5A 1GBAA 1O2VA 3K6YA 2B9LA 2QF3A 4MLFB 4J1YA 2O8TA 1ZTKA 1GHAG 2KM0A 3E3TA 4O3TA 4WMFA 2PFEA 5FBEA 2ILNA 1DSTA 2K0QA 3GCHC 4O3UA 2PUQH 4Y8ZA 2FODA 3UTUH 4CRBA 3M3VA 1MTSA 2BVXH 3MU8A 2Y82A 3CNRA 1F92A 5J4SA 3SV2H 2FTMA 3PLPA 1HJAC 3RU4T 1AN1E 1Y5UT 1GI0A 3BTEE 1UCYH 1QBNA 2J38A 3TK5A 3F2HA 1C5VA 1HDTH 2OQUA 2PTNA 4ISNA 1N6XA 3WWFA 1BMLA 1TGBA 3QUMP 1V2NT 2D8WA 3MH4A 1H8DH 1JIMA 1O30A 1DDJA 1INCA 1QA7A 4MPVA 1SOZA 2WPIS 2O9QA 2BY9X 2OQ5A 4MPWA 3PRDA 1GHVH 4RN6A 2KZ4A 2P94A 1QB6A 1GBFA 2B5TB 1E38B 3VB3A 4NFFA 4OS5A 5JBBS 3K6ZA 5C0TA 5JBTA 5K0HA 3CS7A 1HJ9A 3U28C 1RTFB 3E1XB 3EA7A 1H9HE 3ATKA 1SGDE 3KL6A 3RLYH 3SNCA 2QCYA 1LVMA 1BJVA 1Z1JA 1W0JD 3OFND 4K8BA 2FOFA 2W3IA 3BTTE 3EDXB 5GDSH 3UWJH 1ESBA 5KECA 1W0KD 4GPGA 2I6QA 5DSFA 4X1SU 1SGCA 2HPPH 1OWHA 5DK1A 2GJGA 4WH6A 1BQYA 1CE5A 2EC9H 5A09A 1E35B 2FZZA 2P3UB 1QCPA 2OBQA 2WPMS 3SUFA 4JCNA 5IDKA 1WU1A 1UHBB 3HGPA 1AFQB 1BTHH 1D6WA 1O3AA 1OHHD 4U01A 2PSXA 1V2TT 1ZJDA 1XXDA 4FUIA 4OS4A 1MTWA 2CXVA 1D4PB 1SLVB 1C2LA 1ZJKA 3PMAB 2ZCLP 1P03A 5FAHA 4X2YA 1DSUA 1P10A 5SGAE 4TT3D 4Y7AA 1QR3E 2FXRA 2WYJA 1QIXB 2QA9E 1G9IE 3LPRA 1ARBA 4JZFH 1J17T 1GCTC 5DGJA 1O2NA 1QQ4A 2Y80A 1A2CH 2GMTB 4UE7H 5A0CA 2W7UA 3ZYDA 4AOQA 2BVRH 3RXKA 2OBOA 3KQDA 1HLTH 2V7QD 3A8BA 1AE8H 2YNBA 1YYY1 5GIBA 5I25A 1BDAA 1O38A 3U1IB 2JH0D 1FY3A 4WMDA 3VGCB 4AGKA 1TFXA 4BTTB 4X1RU 1KY9A 3M37A 3PV4A 4BANB 2W26A 1YWUA 1MTUA 1V2LT 9LPRA 2BOKA 3F2GA 4ZKOU 3A89A 1OPHB 3A7TA 1IHSH 2ZFTA 1CHOF 1GBMA 5C94A 2BY8X 4CRCA 1JIRA 1HAVB 2AH4X 2TGAA 1SLXB 3F0PA 1WTHD 2YMSD 4K1SA 2BX4A 4ABBA 1O3JA 5K7RA 1ZSLA 3H09A 3MU1A 1J8AA 2TIOA 3O8DA 1P04A 1IQFA 2TBSA 4XBBA 3GCHB 1GHAF 4ESTE 1EZUC 4X6MA 1GBCA 2C8WB 2FP7B 1O3FA 3NXPA 5L30H 1C2IA 2EA3A 2ZDNA 2BD9A 2ANMH 1SR5C 3QLPH 5J4QA 3ODDA 1HJAB 3MO6A 1K0HA 3KYGA 1NU7B 2SGAA 1S0RA 3TJUA 1O3MA 3K65B 3C27B 2KCOA 4I32A 2OC7A 8LPRA 1Y59T 3DHKH 5ABWA 3BG4C 5FPSA 1YGCH 3QO6A 1DWDH 4MNWA 3LJJA 3ZVBA 1FY5A 4YLQH 2THFB 4WH8A 2ALVA 5C5OA 1F5KU 1A7SA 1UCYK 4DW2U 3PRBA 1FONA 1O5FH 1ID5H 2ZDMA 2ZECA 3T26A 2ZHFH 1FIZA 5DN6D 4Y0ZE 2L6OA 4MNYA 1DUEA 2PKSC 4XD7D 3Q00A 2VWOA 4Y0YE 5HIYA 2STBE 4A92A 2QE7D 1JXPA 4IN1A 5I46H 3F1SB 1NO9H 3LC3A 1AKSA 3Q3XA 3N7DA 1D6RA 1EB2A 3BTFE 1L4ZA 1GI3A 1AWFH 1MCVA 2SNVA 2ZTXA 4BAMB 7ESTE 1HIAB 2ANYA 3H5CB 4D9RA 4AFUA 4NA7A 1JWTA 2BD8A 3LIWA 3TLOA 3ZZ3A 1UTOA 2BDHA 2FOHA 1K1IA 2L74A 3OY5U 1WSSH 4ZKRU 2VJ1A 1TNLA 2FOMB 1V2PT 2Q6GA 1UK3A 1Z6JH 5JB9S 1CO7E 1O3BA 1V2ST 1GBEA 1A1RA 3PTBA 1FLEE 4RI0A 1TPOA 1QL8A 1S6HA 2WZQA 3SZEA 1DITH 2J98A 1PQ7A 2GZ8A 1YKTA 1GCTB 1PPBH 1MABB 2XCNA 2AGGX 1ORFA 4UFEH 1ESTA 4B76A 2JIZD 1EQ9A 1EPTA 1VCPA 1ZMLA 3A7WA 1BMNH 1GBJA 3PMHB 3KN2A 2IN2A 1P09A 2FS9A 4E06H 2STAE 4ACBA 2NU4E 3RC4A 2XYAA 4JYTA 1VCQA 1C5YB 1BOQA 2IPHA 2R0LA 3GY4A 5BPEA 1TGNA 2PGQB 1UTMA 1QRXA 1L1JA 3R3GB 4UDWH 3P8NA 1ETRH 4DOQA 3OSYA 3UAIC 3MHWU 3V12A 3EE7A 3RXEA 1NFXA 1DANH 1HAPH 1BRUP 1UCYE 3R0FA 3DCLA 1SGFA 3FN8A 3I78A 1EOJA 1SHYA 1T8NA 3ZZ8A 4F4OC 1XUJA 2FOEA 1RTLA 1ZR0A 1H9IE 3N99A 3BIVH 3MI4A 4UFDH 4R0IA 3VXEH 2ZWLH 1BRAA 2D1JA 1S84A 2AMPA 3ZVGA 1XUIA 1C5XB 2ZCHP 2BY5X 1SKYE 4JZDH 4DY7B 2FEQH 2ZU2A 4FOUC 1C5NH 1UVOA 1XKBC 1XVOA 1RXPA 2Y81A 4JYVH 2A1DB 1MZAA 4X8SH 2OTVA 3SV6A 4F48B 3TH3H 4CRAA 4ISLA 3BG4B 1H1BA 5AHGH 4X1PU 1EP6A 1KXBA 2TGPZ 4P02A 1QBOA 4KTCA 2A4OA 4MDSA 3S69A 1HBTH 1LTOA 4Q7ZA 3PV2A 2XBWA 4X0WU 2EI6A 1KMHB 1GBTA 1KTSB 4IMZA 5EODA 1LHEH 1C5PA 4B71A 3UIRA 1TNGA 4TYDA 4KGAA 2ZEBA 1O5DH 2A4GA 3D62A 3DSGA 1K1JA 2PKSB 2O8LA 2BD4A 3ZVAA 2XWBI 4YM9A 2PW8H 3VPKA 4ZUHA 1MUEB 1Z6EA 2P95A 1BIOA 1NFUA 2BMGB 2Z7FE 2BY6X 3AAVA 1ARCA 3RMNH 1KTTB 2VINA 5F53A 1HNEE 1IHTH 3GYLB 3A8CA 5FX5A 5EJ1A 4Y6DA 4HI3A 1TNIA 1S85A 1MZDA 5JBAS 4ISIH 2CV3A 2TGDA 2KFWA 1MCTA 3H7TA 2A32A 4SGBE 2WUBA 2KAIA 2JKHA 1GI2A 3RMMH 2Y5GA 4DGJA 1C1TA 1PQ5A 3UR6A 1NC6A 1IAUA 1WBGB 3LJOA 2QAAA 3EAJA 2Z3DA 4NZQA 2WPHS 1BRBE 3SN8A 3TGJE 1D9IA 2HWLB 2BHGA 3TJOA 3BTDE 3A7YA 4FUHA 3UR9A 1LO6A 4YO9A 1LKBA 2PP6A 1GI5A 1ZTJA 3TGKE 2DE9A 1MH0A 5A2MH 5E8EH 4ABHA 4B6EA 1UVTH 2CHAC 3MQKC 4JZIA 8KME2 2UUFB 1T8LA 2B7DH 2RG3A 1ELBA 3EYDA 4NIYA 2P16A 5T6FA 1F7ZA 2BDAA 2O8UA 1SGRE 2CMYA 2GZ7A 3OTJE 1O34A 1NROH 1O2MA 5TCCA 4BTIB 4CBNA 4RSPA 3LONA 5JB8S 2VU8E 3M7TA 3LC5A 2J2UA 1K1MA 4X8VH 1GJ6A 2QN5T 4I8HA 1C5QA 1Z8GA 4AC9A 4XRNA 2FTLE 2H1UA 3RXMA 1ZHPA 4K5ZA 1P02A 2BXUH 1HAXB 1P12E 4KTSA 1AVWA 1GGDC 5FXLA 2ZO3H 1SC8U 3BTME 5HYOA 5B6LA 2PWXA 1O5GH 1WXRA 2GV6A 1G2MA 5EXNA 2BX3A 1BMAA 1ANDA 1G30B 1V2MT 3GDVA 4AORA 3SQEE 3A7ZA 8ESTE 3URDA 1JOUB 2BD3A 4AG1A 2JDID 1TMUH 1YPHC 1H8ED 2P93A 2B0FA 2XWAA 3ELAH 1TABE 2H9HA 1MBMA 2A5AA 1HFDA 2QXGA 3FFGA 2FI4E 3RMOH 5HIZA 1O2LA 3UFAA 1D3TB 3SUGA 1AUJA 2Z6BD 2QYIA 1FMGA 2CF9H 1XM1A 3SU4A 2EY4C 2FYRA 3ZZ7A 1KIGH 1SGNE 2C3SA 1PYTD 1AIXH 4RT0A 3ATLA 1C1OA 1W0ZU 2GD4B 4Q63A 1G36A 3VB4A 4NFEA 2P8OC 5DP4A 5LPFA 1EXFA 2BQ7B 5TCAA 5EXMA 5HGGA 1GDUA 2ALPA 1QZ8A 2ZTYA 1BRCE 1XX9A 1WDIA 2EI7A 3WWBA 3KQ5A 1GBLA 1CGHA 1EX3A 1HCGA 3KEEA 1C5UA 1GHYH 1O2PA 3O8CA 1FX0B 4ABIA 5EPYA 1GHXH 4MVNA 1O0DH 4HTCH 1C1VH 5F8TA 4IMQA 3GCOA 3ZZCA 1C5MD 3RXOA 2QF4A 2QIQA 1O36A 1TMTH 3U8TH 1Y8TA 1TPAE 3A86A 3LH3A 3TPIZ 5DP8A 4ZXYH 1K28D 4CR9A 3SYJA 1O5AB 1MMJN 1H8IH 1ZPZA 1SQOA 1ZMJA 2BDGA 3H7OA 4Q4LA 2V3HH 6GCHG 1ZMNA 1ABIH 3EA8A 2AFQB 1L0ZA 2Z9GA 1GVZA 5FHTA 1IQHA 3SBKA 1EB1H 2BLQA 1QTFA 2ZU4A 1W10U 2FMJA 1XMNB 1WV7H 3SOSA 8GCHG 1O2RA 2AIPA 4X6NA 1HGTH 4O97A 2FM2A 2BOHB 1HV7A 1DLKB 1SHHB 2WPKS 1H4WA 1AY6H 2CHAB 2OXSA 4DT4A 3BEUA 1EZXC 3QN7A 3F0OA 3SGQE 2OCVB 2FX6A 1SQAA 2Y7ZA 1LVBA 5E0HA 1SBWA 1E1RD 1G3DA 2RCEA 3D65E 4H6SB 1FJSA 2JH5D 4RT1A 2CJIA 2NU3E 3FANA 2Z3CA 3TIUA 2M5TA 2GZ9A 1RJXB 3TJVA 2RFKC 4IW4E 1RGQA 1GGDB 3B8JA 4AN7A 3IG6B 3ZV8A 2HRVA 2ZHDA 3RXTA 1T4VH 1NY22 1FZZA 3E8LA 4HGCA 3S9BA 4FU8A 4I8GA 1UW7A 4WY3A 3ODFA 3TVJB 4ZROA 4FVBA 4GCHG 1P2IA 1FY8E 2SGPE 2ZHWH 1ELTA 4X6OA 1UMAH 1MU6B 1MQ5A 2XOKD 5DP9A 3BN9A 2WPLS 3SO3A 1DM4B 1BBRH 4JK5A 5CMXH 1NFYA 1DLEA 3FP7E 4I7YH 4B75A 5FPYA 1YPJH 5E0JA 1QURH 1A3EH 3L3TA 1UJ1A 1YPMH 7KMEH 1TLDA 3HKIB 4NIVA 1MD7A 3BTGE 2D2DA 1OWIA 1OWJA 1QB9A 2P8OB 3FZDA 1LVYA 2AHME 2WHXA 2TPIZ 4OGXA 2IJD1 3KHVA 4B1TA 1L2EA 4X8TH 1LVOA 2ZGHA 5EIYA 5AFYH 4LZ4B 2XTTB 1QJ6B 1MD8A 3CS0A 2AMDA 1HB0B 2J34A 1GWAA 1TBZH 2H6MA 1GHBG 1O32A 1SI5H 2YMSC 5GXPA 1BUIA 2BD5A 4KTUA 1CT4E 1Z1IA 4WJG2 3VFEA 4E7NA 5GPIB 1F0TA 1QQUA 4ZXXH 1J14A 5CHBA 2VH6A 3UPEA 4Y10E 4ABEA 4AFQA 2SGFE 4K60A 3C1KA 4CH8B 4Z1MD 1EPTC 7GCHG 1UHBA 1EAUA 2C4FH 2DE8A 1ELCA 2O8MA 4PROA 4O9VA 2K8IA 3VB5A 1LCYA 3RUOA 3RXLA 1GJ5H 3PYHA 3P8FA 4TWYA 4FUFA 5L2ZH 1DPOA 1QFKH 5LPEA 4VGCC 1KXFA 3SV8A 2IPQX 2ZPQA 3GY7A 1O3CA 3ATMA 2G81E 1QJ7B 1DVAH 6GCHF 3OEED 1ZGIA 3EA9A 3ENSB 1P9UA 4GAWA 5C20A 2ZDVH 4FVDA 4HFPB 4TSFD 3OTPA 1BMFD 1C1UH 1HAHH 4D8NA 1IQNA 3IWMA 4OS6A 1F5RA 3SHCH 2BDIA 2LP6A 3SU1A 1AVGH 1OWEA 3TGIE 1VJAU 3HPTB 1IQLA 1E0FD 3W1EA 2OK5A 1AMHA 1TALA 2GX4A 2G51A 6ESTA 5HMAA 4B73A 4X6PA 4OM9A 2A7JA 2FOBA 1C2FA 3ATWA 1GVLA 2C93B 1S6LA 4ZHAA 1CVWH 4A1TA 1YLCA 2BD7A 1V2JT 2UWLA 1B5GH 1T31A 2Q6DA 2ZPRA 1OWDA 5HM9A 3Q3YA 2HALA 3D49H 1YPKH 2JJ1D 1CQQA 3QGJA 1CHGA 1Y3VA 3SNBA 3PROA 3O8RA 1E34B 1RFNA 1CBWC 1GL1A 4TY6A 1OSSA 5LH8A 3GISB 2GDDA 1OP0A 3V7TA 1YLDA 1CGJE 2ZKSA 3VG8A 2J97A 1DE7H 4MNXA 3AK5A 1WQSA 4GCHF 1UVPA 3UNQA 2GP9B 1AKSB 3GCNA 1HUTH 1QHRB 2AGEX 9ESTA 4NG9H 3TNTA 4WWYA 4INHA 3U69H 1VKYA 1A5GH 1QNJA 5C5NA 2J95A 2GDEH 3W95A 2P3FH 3EE0B 3KIDU 3RXQA 1GHZA 1BBRK 5A0BA 1GVKB 2FOCA 1ELEE 2C90B 1Q31A 1C5WB 2VIWA 2XCFA 1KXCA 1LQDB 4WMEA 1TBRH 4GHQA 4YOGA 4AFZA 1LDTT 4B74A 1BB0B 2H9EH 1K1NA 5T6GA 1P05A 2ZNKH 3RC5A 1HAOH 5T3HA 3U98H 1SL3A 4Y8XA 2A5IA 3S9CA 1MTVA 1OKXA 3LGYA 2YMSB 1MU8B 1FY1A 2J98B 4ABJA 2BLVA 1O35A 1GHBF 4GLYA 4X2WA 4NWKA 4FUDA 1DFPA 4ABGA 1KLTA 2G5NA 3T28A 1AFEH 1TOCB 3P8GA 2R3YA 5LGOA 1Z8IB 1EPTB 4BAOB 3BTHE 1C5TA 1XKAC 1P2MA 1BTWA 4UONA 1O37A 2WPDD 1DT2A 1QA0A 1S83A 3ZIAD 3E0PB 3UWIA 4D9QA 2VNTA 1SMFE 2XRCA 4J2YB 1O2XA 2ODYB 2ODQA 4UFGH 3GYMA 4I8LA 3M3SA 1GDQA 2PGBB 1FN6A 4VGCB 1V2WT 1PJPA 1PPCE 1MQ6A 1CT0E 5AF9H 4ZAEA 4UFFH 1SPJA 3PM3A 5F03A 1D3PB 4IGDA 2HNTC 3TH2H 5EQSA 2FWWA 5A8YA 5HM2A 1SQTA 1ZSKA 3NCLA 2JH6D 4BXWA 1IQKA 4MPUA 5CHAC 1SSXA 5C17A 5FCKA 1LHFH 3OX7U 1ZPBA 4FUJA 2C8ZB 3RXIA 2A2XH 1MAXA 3W94A 4P00A 1FPHH 1TNKA 3KYFA 1AD8H 2A0QB 4LK4A 1O2JA 5EJZA 3SNAA 3STJA 2HLDD 5E2OA 1YLNA 4U2WA 1TMBH 1O2HA 4NGAH 1FDPA 4LOYH 1SGFG 2FIRH 1DUAA 1IQMA 3MMGA 4KELA 2GCTC 1K1PA 2G52A 3SU6A 3ZV9A 3ITIA 2H2ZA 2F4LA 1G3BA 1TPSA 1B0FA 2QXIA 3RXDA 1BBRE 1QY6A 3SQHE 2QF5A 1CBWB 4XE4A 2EEKA 1TGCA 5TJXA 2TGTA 1TQ7B 1K2I1 4B2BA 2G4TA 4CRFA 2ZGXH 1W2KH 4ZHLU 3M5MA 1TYNA 1Y3WA 2ZQ1A 1DY9A 5PTPA 4YT6H 3UOPA 5F8XA 4AB9A 1GMDG 1VCWA 2XBYA 2Z9IA 3ZZDA 2XNDD 1S5SA 2NWNA 3SHAH 2ANKH 2F91A 3D23A 1A4WH 5DJ7A 3WW7A 3P92A 5ESTE 1HXFH 2ZG0H 5FPTA 1XVMA 1NRRH 3T25A 5H4IB 5DPAA 5DO4H 2XC0A 1NRNH 4NWLA 1PPEE 2G55A 3A8DA 6CHAC 1JMOH 1DOJA 5DP6A 5FL7D 3AVZA 2ZGBH 2HLCA 3I77A 4XFQA 1UTQA 3MO9A 4E7RG 2OC8A 2Y6TA 3GY3A 2F83A 5EU8A 1TA2A 1O33A 1AWHB 1A0LA 1V2QT 2KAIB 1NRQH 3LGWA 4NCYA 3BTKE 2XXLA 1YPHE 2HPQH 2OD3B 4ZCNA 1GI1A 3A82A 1BT7A 1GJ9B 2RDLA 3EGKH 1FXYA 4FXGH 3U8OH 4LZ1H 2PKAB 2YOLA 5DP3A 3T27A 3FP6E 3G01A 3RXHA 5AVDA 1P2KA 1EUFA 4BAHB 1THSH 3SU5A 1YP9A 4ABDA 4DT7B 1Y3YA 3LOXA 3OYPA 5B6OA 1HXEH 2BY7X 1NBME 4O03A 1PQ8A 1UK4A 4NIWA 1O2OA 2SGQE 1LPZB 3MFJA 3S7HB 3MTYA 4XOJA 3ZZ6A 2PTCE 3OU0A 3F3BA 1GJ7B 3UB0A 1W12U 2R2MB 1XUGA 3MU5A 2W6JD 3IITA 3JZ1B 4UD9H 1Y3UA 4I33A 3NKKA 1N1LA 2V3MA 1CSOE 1WCZA 5GJ4B 4INKA
chains in the Genus database with same CATH topology
1GCDA 4X2XA 4H42U 2BTCE 2Q6FA 4AYYB 1ZRBA 4Y71A 3U1JB 3A88A 1BTUA 2QV1A 2J92A 5DG6A 5GWZA 2W7SA 5EQQA 1YCPH 1GBBA 1LKAA 2BLWA 2FOGA 3KCGH 5C3NA 1XXFA 1F0RA 1XUFA 2VIOA 5JBCS 3GDSA 1V2OT 4B2AA 2J94A 1KSNA 2UUYA 1GDNA 1G32B 5CHAB 1O2QA 3HGNA 5T6DA 3U8RH 3ATIA 3F68H 4JZEH 3K9XB 1EKBB 3MH5A 4CH2B 3SZNA 3V0XA 3TK6A 2ZDLA 1A46H 1C1PA 2B8OH 2H5DA 2QGRA 1ELAA 1S6FA 2CF8H 1OS8A 1DWEH 4GVUA 1SGPE 3M7UA 5A8ZA 4YOIA 2GCTB 1C5ZB 1O3DA 1FNIA 5JYIA 2ZTZA 3P8OA 1GMCG 2G8TA 2P3TB 2VIVA 2LNCA 3FZZA 5LPRA 1GBHA 4NSVA 2VWMA 1O2YA 2ZFFH 2ZFPH 2ULLA 1FPCH 3GY8A 3A83A 3HK6B 2BVSH 1HAYB 1P2JA 1WQVH 4MTBA 2VIPA 1O31A 3GCTG 1E37B 1THRH 2GVFA 4DVAU 3GDUA 2ZU5A 1Y5AT 1Y3XA 2OUAA 2F9BH 2AERH 2NU2E 2BD2A 1OP2A 2AMQA 4FU9A 1O39A 2HOBA 2PV9B 3MNSA 1MKXH 1E36B 2ZHQH 1C1WH 4HZHA 2WV4A 2PR3A 1K9OE 1W0YH 2BXTH 2ZGCA 6CHAB 2C8YB 2A31A 1KYNA 5FX6A 1NU9A 1TX6A 3UNRA 4JMYA 4MPXA 1FY4A 1C2KA 2A4QA 2IOTA 1GI9B 1V2UT 1CU1A 1IQIA 4DIHH 1FQ3A 2WUCA 1F2SE 4A7IB 1CA8B 2DUCA 1XUHA 2BZ6H 3LGVA 2Z94A 1U6QA 1DY8A 3ZYEA 4JYUH 4ABFA 1UTPA 4WF8A 2LPRA 1BHXB 4U30A 3SNEA 3QZQA 4MNVA 1C2HA 1ETTH 2XW9A 2AEIH 3SV7A 1MKWH 2G00A 1AHTH 3RXCA 2XBVA 3E91A 3BSQA 1LHCH 4XBCA 2F9OA 1J15A 1P0SH 3A80A 1TA6A 1TWXB 2A7CA 2FO9A 3CP7A 1KDQA 3ZZ4A 1EJMA 2QXJA 2A4RA 2SGDE 2ZDKA 1WAYB 1W11U 1G3CA 1JRSA 4Q7YA 1AI8H 1O3HA 2RA0A 1TGTA 4K69A 1TX7A 1BCUH 4K3JA 2EI8A 1OXGA 4AGJA 3KF2A 4BAQB 3M3TA 2H5CA 5DP5A 1QJ1B 2BQ6B 3QX5H 2A45B 3RDZA 2FPZA 1HYLA 4D7GA 2AS9A 4RKJB 1HPGA 2IJOB 3E6PH 1PPFE 1CA0C 1O2GH 3M5OA 3RXRA 1GPZA 4JZ1A 3HATH 5GCHG 1ABJH 1YCPK 5G4BA 1TBQH 2ZFQH 3PMJA 3AAUA 1GJAB 3SU2A 1B0EA 1AB9C 3NPSA 3SV9A 4I31A 1SVPA 1O2UA 3MH7A 2ZFRH 3BF6H 2AIQA 3DA9B 2HNTF 5E0GA 5C2ZA 1SFIA 1O2KA 1GHWH 4YT7H 2Z9KA 4WVPE 1O2IA 1KXDA 1K21H 2GCHG 1AUTC 4KP0A 2VGCC 3MNBA 1ZLRA 1SOTA 1QL7A 3SI4H 3RXAA 1GMCF 2VVCA 1ZZZA 3V13A 2SGEE 4CR5A 1NT1A 1TX8A 4FU7A 1V2VT 3NZIA 1Z8JB 1DWCH 1CT2E 1O5BB 2C8XB 2ZZUH 3SI3H 3SJ9A 1EATA 1NS3A 3A7VA 1BA8B 1KXAA 3GCTF 1IOEA 3VB7A 1UTLM 4A5TS 2VB0A 3P6ZB 1QGFA 1SGTA 3N7OA 3RXVA 3A8AA 3PWBA 1NPMA 1WTGH 1V2KT 3Q3KA 4M7GA 3BEIB 1RTKA 1P2QA 2VVUA 1AZZA 2G5VA 1N8OC 1GJBB 1O3LA 3CENA 1P8VC 1EAWA 2Z3EA 1MKXK 1OYQA 2V35A 2V3OH 4YZUA 3DFJA 2WPJS 2R2WU 1EJNA 1FIWA 3MYWA 3P17H 2Y5HA 5EW1H 1W14U 1VR1H 1WYKA 3TNSA 1P3CA 4K2YA 1C2MA 4ISOA 3A7XA 1PQAA 4XDEA 3F6UH 4CRGA 2XC4A 1SGYE 3MNCA 2ZDAH 3OY6U 1EAIA 4TPYA 2FS8A 4R8TB 2GKVE 2OINA 3TITA 3RXUA 3URCA 1VZQH 4CREA 1VGCC 1NRSH 2VH0A 1J16A 1C9PA 1A5IA 1ZRKA 3M36A 1BTXA 8GCHF 2QF0A 4DCDA 3BTWE 5EXLA 1HAGE 1K1LA 2ASUB 2Z9JA 3SJIA 1TNHA 2F9NA 2JETC 4BAKB 1GL0E 3RU4E 3T29A 1AVXA 1O2ZA 1MKWK 4INLA 3RC6A 1BHXF 1K22H 3A85A 1HJ8A 1S0QA 5A8XA 1FAKH 5F8ZA 1YPLH 2Y5FA 1ETSH 3A81A 2FI5E 4ISHH 1UTKA 4H6TA 3ZZAA 1GMHG 1V2RT 3LT3A 1UO6A 3LKWA 1HAVA 3RP2A 1A61H 2QXHA 1BTYA 1AU8A 4BOHA 1SGIB 1FV9A 1VITG 2G4UA 2J9NA 4NIXA 1P11E 4FUEA 1CA0B 1O3IA 1W3CA 2YNAA 5F6MA 4X1QU 3UUZA 3BTQE 1GG6C 1OYTH 3QK1A 1YF4A 3M61U 1C4V2 2BB4A 2PHBA 3KQCA 2NU1E 3PO1C 3ZZ5A 1TRMA 2J4IA 5GCHF 1O3OA 1AB9B 3UY9A 4YOJA 2ZGJA 1TPPA 2UUKB 1G2LA 5A0AE 1C4Y2 1ZPCA 1GI6A 1IQEA 3PLKA 3LGUA 2FLRH 1T8MA 1IQGA 4NA9H 4UEHH 1Z8RA 4DIIH 2GT8A 2K1QA 3JZ2B 1CGIE 2HNTE 2VGCB 3VEQB 1SGQE 2GV7A 2Z9LA 1KXEA 3NWUA 4U32A 2RA3A 4NZLA 1VITH 5L2YH 1YPGH 3BG8A 2GCHF 4FUBA 3RLWH 3QTOH 2GTBA 3M35A 4LXBH 1OX1A 1LMWB 1P2NA 1N6YA 2I6SA 3GY6A 4Y79A 1YM0A 1KLJH 1C5OH 3BEFB 3ESTA 3HK3B 2TRMA 1SGEE 2FOAA 3S0NA 4GSOA 1LQEA 4BXSA 4YESB 1UTNA 3S7KB 1C1NA 5EPNA 1C9TA 2BYAX 2A2QH 1RD3B 3HKJB 1FN8A 1N8OB 3GICB 4X8UH 2BM2A 1L1NA 3QDZB 1P3EA 3RM2H 1Z71A 1HIAA 1THPB 3A84A 1O2SA 1P06A 3AASA 3ZZ9A 3K2UA 3TU7H 1C5RA 1RS0A 3SJ8A 1GI4A 1SLWB 1HAZB 2F9UA 1TRYA 1GI7B 1TE0A 4IS5A 3PB1E 3VB6A 7GCHF 4JK6A 5FBIA 3SUDA 3DFLA 2ZI2H 3RXBA 3O8BA 5ESBA 1NESE 2ZQ2A 4AYVB 2W5EA 2FX4A 2O8WA 1W7GH 4NSYA 3RMLH 3L6PA 3ZZBA 1TGSZ 1RIWC 1EZSC 4KKDA 4AB8A 1ZTLA 2Q1JA 1F0UA 1EOLA 1W13U 1VGCB 1JRTA 3NK8A 4OS7A 3UQVA 1NM6A 1QRZA 1ZHMA 2VWLA 1YBWA 3SJOA 3PMBB 3AW1A 2PSYA 2ODPA 1SFQB 3QWCH 3MOCA 1K1OA 3MNXA 4AZ2B 1C1QA 2JETB 3AW0A 2PLXA 1VJ9U 5HXFA 2WYGA 1GJCB 4TY7A 3RU4D 2FESH 4NA8A 2D26C 1C5LH 3DUXH 4FUGA 4A1XA 1T32A 2ANWA 4OGYA 1O2WA 3ZVFA 1BMMH 2SFAA 3S9AA 1W7XH 4D76A 3QTVH 1J9CH 3FP8E 3U9AH 3VXFH 2GT7A 1C2EA 3E90B 1LPKB 5EGMA 4IC5A 3L33A 1ZYOA 1DWBH 1GMHF 1O2TA 4AG2A 4GUXA 1UTJA 1DXWA 1A5HA 2OP9A 2VWNA 5E2PA 1VITF 1GG6B 1GBIA 4K1TA 2ZU3A 1C2DA 3RXJA 4A6LA 5C67A 1C4U2 3QZRA 5FCRA 1EAXA 3PO1B 2ZC9H 3SORA 3M7QA 4ABAA 3MU0A 4YLUA 4BNRA 3P70B 3RXPA 3F9EA 3MO3A 1YPEH 3B9FH 4CHAC 1UVUH 1T7CA 1JBUH 1GJ4H 3DT0H 4AFSA 1D3DB 3SJKA 4MG3A 1H9LB 4YTAA 1Y5BT 2BDBA 1MTNC 1O3KA 1V6DA 1Z7KA 3T2NA 1DX5M 1L4DA 5EOKA 2OLGA 2ZCKP 4XBDA 2F9VA 2BLOA 1PPHE 3RXSA 2ZHEH 1ESAA 4K8YA 4MQAA 3LH1A 6LPRA 1L1GA 3RXGA 4RKOB 5DP7A 5EG4A 5EW2H 3NUMA 1F0SA 3QGNB 3TK9A 1IQJA 1HAIH 1NFWA 1V3XA 2VVVA 1FAXA 5C1YA 1C1RA 5AFZH 1WUNH 1B7XB 1AZ8A 4XSKU 1ACBE 1C2GA 1X7AC 1DICA 4Z6AH 1C5SA 3F9HA 1QB1A 1C2JA 4ZH8A 4X1NU 1DS2E 1O5CB 1Q3XA 2SNWA 3A87A 2H9TH 1ZGVA 2WINI 3GY2A 3ZVCA 1F5LA 1EP5A 5C1XA 4BTUB 3KQBA 3M5NA 3PLBA 2GGVB 1ELGA 2OC0A 2ZFSA 1BTPA 5CE1A 4Q2KA 2Y7XA 1ANBA 1SG8B 2PKAA 2A7HA 1TNJA 1S82A 3MH6A 4IN2A 1G37A 1BJUA 3SU3A 1PYTC 4ZMAH 1KLIH 2WV5A 1OOKB 1MBQA 2UWPA 1LPGB 1RIWB 3E16B 1DXPA 2UUJB 1QL9A 1EJAA 5DKMA 4AX9H 1G3EA 4THNH 2QY0B 1AQ7A 1T8OA 2ZIQH 2BQWB 2VIDA 2ZU1A 3LGTA 4E05H 1AE5A 3LDXH 3GOVB 4ASHA 4WXIA 2R3UA 3P95A 1BTZA 5IYTA 3F9GA 3TH4H 3GY5A 1NRPH 1QBVH 3UNSA 4OS2A 4DJZB 5JDUB 1O3EA 2VIQA 1O3NA 1EASA 1D3QB 4ZHMU 1M9UA 3UREA 3TJNA 3B23B 1OWKA 3T62A 3ZVDA 1NTPA 3LGIA 1SLUB 2ZPSA 2NU0E 2ESTE 2FYQA 1PFXC 3PTNA 1MAYA 1GBDA 3PWCA 3SU0A 5C1UA 1EZQA 5EQRA 4A1VA 1LHGH 2AGIX 2W3KA 1A0JA 1W8BH 2FLBH 4SGAE 4OS1A 2ZF0H 7LPRA 3KGPA 3I29A 2CGAA 3Q76A 3FAOA 2AYWA 4ZKSU 3UQOA 4Q7XA 1QRWA 1XUKA 1O3GA 2UWOA 4IBLH 1OP8A 3RXFA 1C1SA 1ANEA 1BITA 1P01A 1C1MA 1S81A 1TQ0B 1PPZA 1A0HB 4K1EA 3STIA 1ELVA 4Z0KA 4QT8C 2R0KA 5L6NH 4GHTA 1ELFA 3F9FA 1LHDH 4CHAB 3SUEA 4TWWA 1SB1H 3FVFB 3WY8A 2F9PA 1AGJA 1GMDF 1PPGE 2QC2A 3SW2B 5ETXA 4I8JA 2CN0H 1FUJA 3DD2H 2OC1A 4Y76A 2XNIA 2V0BA 4X2VA 1MTNB 3M5LA 2ZA5A 3SGAE 1ANCA 1UK2A 3MU4A 1HRTH 1TAWA 1AFQC 1YCPM 2BZAA 2FI3E 3BIUH 4CRDA 1UVSH 1ELDE 1T4UH 4Q80A 1GBKA 2XC5A 2A5KA 1TIOA 1A3BH 5BRRE 3MWIU 3Q77A 2BDYA 2P59A 4ZKNU 1O3PB 1FI8A 3T5FH 4Y8YA 2F3CE 1P9SA 2XBXA 5JPMH 1BZXE 4I8KA 3RM0H 1TONA 4TPIZ 1ZHRA 1ZSJA 2ZP0H 2GMTC 4WXVA 1NN6A 4CBOA 4H4FA 2BDCA 1GI8B 3KQEA 1P57B 4Y11E 1P2OA 3VGCC 1YC0A 1NZQH 4B2CA 4F49A 3SGBE 3KNXA 1KDQB 4IC6A 2PUXB 1O5EH 1GJ8B 3V3MA 3BV9B 1TOMH 1CHOG 3EQ0H 4Y7BA 2R9PA 2HVXA 3ZVEA 2V6NA 4DG4A 1ZOMA 1TRNA 4D7FA 3UOUA 3E0NB 3SNDA 4FUCA 2FDAA 4DURA 2HGTH 1TB6H 1Q2WA 1GJDB 1WOFA 1RRKA 3LU9B 1AO5A 1GBAA 1O2VA 3K6YA 2B9LA 2QF3A 4MLFB 4J1YA 2O8TA 1ZTKA 1GHAG 3E3TA 4O3TA 4WMFA 2PFEA 5FBEA 2ILNA 1DSTA 3GCHC 4O3UA 2PUQH 4Y8ZA 2FODA 3UTUH 4CRBA 3M3VA 1MTSA 2BVXH 3MU8A 2Y82A 1F92A 5J4SA 3SV2H 2FTMA 3PLPA 1HJAC 3RU4T 1AN1E 1Y5UT 1GI0A 3BTEE 1UCYH 1QBNA 2J38A 3TK5A 1C5VA 1HDTH 2OQUA 2PTNA 4ISNA 1N6XA 1BMLA 1TGBA 3QUMP 1V2NT 2D8WA 3MH4A 1H8DH 1JIMA 1O30A 1DDJA 1INCA 1QA7A 4MPVA 1SOZA 2WPIS 2O9QA 2BY9X 2OQ5A 4MPWA 1GHVH 4RN6A 2P94A 1QB6A 1GBFA 2B5TB 1E38B 3VB3A 4NFFA 4OS5A 5JBBS 3K6ZA 5JBTA 5K0HA 3CS7A 1HJ9A 1RTFB 3E1XB 3EA7A 1H9HE 3ATKA 1SGDE 3KL6A 3RLYH 3SNCA 2QCYA 1LVMA 1BJVA 1Z1JA 4K8BA 2FOFA 2W3IA 3BTTE 3EDXB 5GDSH 3UWJH 1ESBA 4GPGA 2I6QA 4X1SU 1SGCA 2HPPH 1OWHA 5DK1A 4WH6A 1BQYA 1CE5A 2EC9H 5A09A 1E35B 2FZZA 2P3UB 1QCPA 2OBQA 2WPMS 3SUFA 4JCNA 5IDKA 1WU1A 1UHBB 3HGPA 1AFQB 1BTHH 1D6WA 1O3AA 4U01A 2PSXA 1V2TT 1ZJDA 1XXDA 4FUIA 4OS4A 1MTWA 2CXVA 1D4PB 1SLVB 1C2LA 1ZJKA 3PMAB 2ZCLP 1P03A 5FAHA 4X2YA 1DSUA 1P10A 5SGAE 4Y7AA 1QR3E 2FXRA 2WYJA 1QIXB 2QA9E 1G9IE 3LPRA 1ARBA 4JZFH 1J17T 1GCTC 5DGJA 1O2NA 1QQ4A 2Y80A 1A2CH 2GMTB 4UE7H 5A0CA 2W7UA 3ZYDA 4AOQA 2BVRH 3RXKA 2OBOA 3KQDA 1HLTH 3A8BA 1AE8H 2YNBA 1YYY1