1KXFA

Sindbis virus capsid, (wild-type) residues 1-264, tetragonal crystal form (form ii)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
159
structure length
159
Chain Sequence
MALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein
total genus 34
structure length 159
sequence length 159
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxfA01
5FCRA 1VR1H 1D3QB 4ABEA 1O2XA 1TBQH 1C2FA 1P9SA 3ZVBA 2G4UA 3SNDA 4ZHMU 5GCHF 2FI5E 3TVJB 2XBWA 4GCHF 1BJVA 1ZR0A 4NZQA 2FZZA 1K2I1 2OC1A 2WPLS 2F3CE 2GVFA 1JWTA 1NRQH 2AGEX 1SLUB 1CGHA 3BEIB 3M7TA 1MKWH 4JZEH 3MNCA 4ZKOU 1Z8IB 4LXBH 3M7QA 4YO9A 1CT0E 2F9VA 3MU5A 2W5EA 2DUCA 4BTIB 2FS9A 2ZFSA 1FY5A 1IQHA 1OWKA 3SJIA 1F5KU 4AZ2B 4GUXA 3F68H 4VGCB 4A92A 3P8GA 1MCTA 3GY7A 1ZZZA 2EI6A 3SO3A 3UREA 2LNCA 1UCYH 1C5PA 1LQEA 1OWEA 2PR3A 3Q00A 1A5IA 3VB4A 3KCGH 2PUQH 1SGRE 4NFFA 4BAHB 4UE7H 1Z1JA 2VGCB 1SSXA 3O8BA 1Z8GA 3U8TH 2D2DA 2OD3B 2A45B 1A3BH 2ZDVH 1O37A 2A5IA 1FIWA 2VIVA 1S82A 4AORA 4X1PU 1XKAC 3RU4D 1BDAA 1CBWC 2FX6A 1GDQA 2GCTC 2QV1A 2TPIZ 3A7ZA 1G3BA 1XUFA 5ESBA 5GPIB 1ETTH 1BCUH 2XXLA 3E0NB 4OS4A 1UVUH 1DY9A 2ZDNA 4ISNA 2Y7ZA 4BAKB 2D8WA 1GI2A 1OS8A 4HFPB 1NC6A 3A7YA 2BVSH 2XC5A 2W7UA 2ZNKH 3L33A 1YPEH 5DP3A 1P05A 4GHTA 4KTCA 1ELCA 1GVZA 3OY5U 5HGGA 2ZHEH 2J2UA 1DWCH 3GOVB 1G32B 1CGIE 3TNSA 5C3NA 1GJ6A 4Q80A 8ESTE 1LHFH 1T8NA 1GBHA 3UFAA 5JB8S 1WBGB 1QBOA 1QBNA 4O03A 5F8TA 3LGTA 5C20A 1UMAH 3M3SA 3H7OA 1WTHD 4ZHAA 1LPGB 3IITA 3BTGE 2FTMA 4DIHH 3LKWA 1SPJA 2DE8A 3T27A 3A7TA 1V2OT 2CJIA 1GMHF 2Z9IA 3RC4A 1A5HA 3OSYA 5FAHA 4WMEA 2OP9A 4IMQA 1Y59T 3RXLA 3GYLB 2V3OH 3UPEA 4CREA 3ZVEA 1C5SA 1EQ9A 5ABWA 2ZCLP 2PLXA 1DITH 1FPCH 2ZGXH 4K1EA 4O3TA 1CA8B 2ASUB 2ZEBA 3GDVA 3GY2A 4JCNA 4NIVA 3TJUA 2HPQH 5C1XA 1V2QT 4BTUB 2UUFB 1A0LA 1KXEA 1V6DA 3SNCA 1QL9A 1A2CH 3PROA 3SU1A 1A7SA 2BD2A 1D3DB 1Z1IA 4XFQA 4JYTA 1L1NA 2ZG0H 4YLUA 2GT7A 2TIOA 3FP7E 1ABIH 1XX9A 2BD3A 2DE9A 4OS6A 1PPGE 3IG6B 4KKDA 1T8MA 1WCZA 3V0XA 4NIWA 4KTSA 4K60A 4NIXA 2BY8X 1ARBA 3ODDA 2GMTC 4CRCA 2XBYA 4R8TB 4WVPE 2WINI 1GVLA 1YPJH 1SL3A 3UWIA 4ABGA 1O31A 2AMQA 4IN1A 1OPHB 2WPKS 5L2ZH 4ESTE 3MFJA 4TY7A 1MMJN 4XBCA 4Q7YA 1N8OB 4WJG2 1O39A 4IBLH 2BQ7B 6LPRA 5LPRA 1QA0A 1TPPA 1V3XA 2BYAX 2Z3CA 1OYQA 2BD5A 1QCPA 2TGTA 4ABAA 3MU8A 1OP0A 1KSNA 2GCHF 1BA8B 4UD9H 4BAMB 3T26A 1HIAB 1QJ6B 4JZDH 3BTME 4WH8A 2PWXA 1VCPA 2YNBA 2FMJA 3ZYDA 4I8JA 5FBIA 2BM2A 1BBRK 4U2WA 3TIUA 2ZU2A 2PSYA 1UTNA 3BEFB 4I8KA 2V0BA 1FV9A 2WYJA 1C5RA 1GBBA 3Q3YA 6CHAB 4QT8C 1ZGIA 1KLJH 1B7XB 2EI8A 2A2QH 3AW1A 3Q3KA 4J2YB 1EATA 4A1XA 5T6FA 1HAIH 1HBTH 3RC6A 4AOQA 2J9NA 3RLYH 5BRRE 1CHGA 2HOBA 1TPAE 3KGPA 1D6RA 1ZPBA 1JMOH 1GGDC 1ANBA 2ESTE 3ZZ8A 1AB9C 1P09A 1GBJA 1GG6C 1XVMA 1TRNA 1TNLA 2NWNA 1OSSA 1C5TA 2F9NA 1E34B 3RMNH 1O34A 1C1NA 1P2QA 1T4UH 4U30A 2FS8A 1TAWA 4NA7A 4I32A 1O3BA 5EQRA 2J38A 1CT4E 3BTWE 4ASHA 3GCHB 1BT7A 1GI6A 1THPB 1C4U2 2V6NA 2CV3A 2FP7B 2R0KA 2A7JA 4LK4A 4OGYA 1TGNA 4TY6A 1ZTLA 1V2ST 1HXFH 1V2RT 4XSKU 3HKJB 1O2JA 1OWDA 2A4GA 2OQUA 3F9GA 4AYVB 2PKAB 1QIXB 1S6FA 1Q3XA 1ZHRA 1UHBB 3SV2H 1Y5BT 5JBCS 3BEUA 1HAGE 3SV9A 2STBE 1UTPA 3RXMA 3SHAH 1EAXA 2BTCE 2VIOA 1NRRH 3RXEA 1FMGA 1V2UT 1W10U 1XXDA 1ELTA 3VPKA 8LPRA 4ZMAH 2FIRH 2FX4A 5E2OA 1JXPA 1TB6H 4GLYA 3TH2H 4AGKA 1FAKH 4IS5A 2VWMA 3A81A 1GL0E 1F0SA 2QXHA 3R3GB 4TPYA 2XC4A 7GCHF 1Y3WA 2FPZA 3FANA 2R3YA 2Y81A 2BVXH 1G3CA 1L4ZA 1EP6A 3TGKE 4E7NA 4ZXYH 4SGBE 1V2KT 5JBTA 2FXRA 1YPMH 3U9AH 3UQOA 3SV7A 3RMMH 1TOMH 3LC5A 1O2VA 1OP8A 2J92A 3MO3A 1TNIA 3NK8A 4CR5A 1G9IE 3SGQE 2ODYB 4X1QU 1P2NA 1G2MA 2ZZUH 2FLRH 4CHAB 3OTJE 1VITF 2CN0H 4LZ4B 1AFEH 4VGCC 1J14A 2RG3A 4ZUHA 1HJAB 4X2YA 3UNRA 2IJOB 3A84A 1C5YB 2JH0D 1P3EA 2C4FH 5K7RA 1GBMA 3U1IB 3GICB 2WPIS 4FUIA 1THSH 1MCVA 2XWAA 1T4VH 3F9FA 2W3IA 2VGCC 3QK1A 1C1SA 1F0TA 1THRH 2Z9JA 4MQAA 1L1GA 3SV6A 2VVUA 1PQ8A 1CQQA 2HPPH 3HKIB 4NG9H 4X8UH 3RXCA 4UONA 1SLVB 2ZDMA 1BRCE 1GI8B 3RU4T 3QO6A 2BDIA 4M7GA 4J1YA 2J94A 2ZQ1A 1O2LA 4Q7XA 5A2MH 3S9BA 1G30B 1VCWA 1EPTB 1VZQH 2EC9H 1SBWA 1NFXA 1DDJA 1ZSJA 2VH6A 3LGIA 3P92A 3GCOA 1TWXB 3PYHA 4RKOB 1P10A 1B5GH 4O97A 4CRGA 1O3EA 1GDNA 4D7GA 4Q7ZA 1T8OA 1F2SE 2BQWB 4IC6A 1AVXA 5AVDA 4JYUH 2P95A 3KIDU 1DE7H 3T2NA 2ZHQH 3SGBE 1F0RA 4X6PA 2ZFTA 3JZ1B 1C1WH 1C1TA 4YT7H 1FUJA 1CVWH 4MPWA 1O3AA 4DY7B 4DURA 1NO9H 2BDAA 1C5XB 3MOCA 3RXPA 4H6TA 2PKSB 4K2YA 2G4TA 5HMAA 3PLBA 4CH2B 1PFXC 3WY8A 2BLQA 3BTFE 2BOHB 1GMCG 1PYTD 4MVNA 1PQAA 1YLDA 1QR3E 2ZDKA 4H6SB 1O2KA 2WV4A 2FEQH 1O33A 4OGXA 3GISB 1T31A 2HWLB 4Y79A 3NZIA 2PW8H 3RXHA 2ZPSA 1C2DA 1FXYA 3LGWA 1HNEE 2ZHWH 2NU4E 1Z8RA 1BMAA 3KF2A 1C9TA 6GCHF 3MU1A 3TJOA 4NA9H 1ZLRA 2FYQA 3UIRA 1PPHE 3LGVA 1ARCA 3SU3A 4I7YH 1P3CA 1ESBA 1QRWA 8GCHF 1GI4A 1F5LA 1KYNA 1F5RA 1MTVA 1O2WA 1ZMNA 4MNYA 2ZGBH 1Y5UT 1EZXC 2XNIA 4AFZA 3ZVAA 3RLWH 1C5LH 3HATH 3P8OA 2QAAA 1ID5H 1XUKA 2BD7A 3GCTF 2XCFA 2TBSA 5E0JA 1W2KH 5J4SA 2GZ9A 1Q31A 1ESAA 1N8OC 1V2JT 1KXBA 1O3GA 3RXAA 4CH8B 1P2KA 1UTOA 1ELVA 2ZI2H 2BMGB 1GHAF 2XC0A 2FM2A 1T8LA 1TNJA 3ITIA 3F1SB 1CA0C 3OX7U 4A1VA 3LC3A 2ZC9H 1DT2A 1CGJE 1TGBA 5C1UA 1CO7E 1D4PB 1K1IA 2TRMA 1P11E 4H42U 1O38A 1F0UA 4AYYB 1ELDE 2XRCA 3AASA 5C1YA 1GVKB 2SGEE 4KP0A 1C4V2 2ANYA 1C1QA 1WOFA 4ABFA 2WUBA 1IHSH 5C2ZA 2G55A 4DIIH 1GJAB 1G3DA 1K21H 1HAPH 2GT8A 1GWAA 2ZCHP 2W7SA 3GYMA 3HK3B 2J4IA 4UFDH 3D65E 3VXFH 6CHAC 4K69A 1GPZA 2ODPA 1KLTA 1FDPA 1P2JA 1SGFA 3K65B 3QTOH 5LH8A 1NM6A 1QL8A 2F83A 3H5CB 1GI3A 4CRDA 1EZSC 1ZPCA 1P12E 5DGJA 1V2PT 3MH5A 3LJOA 3TITA 1MTNC 3KNXA 1AUJA 4GHQA 4K3JA 3KQBA 2ZU5A 1Z6EA 5FCKA 1TPSA 4Q2KA 3QLPH 4ISHH 3VB6A 1K9OE 3L3TA 1IQJA 1XUHA 2JH5D 4MG3A 1WV7H 4DG4A 2B7DH 1W7XH 3ZZ4A 1UTQA 3GCHC 2IOTA 5EQQA 5A09A 1S0RA 3TNTA 1HAVB 1LHGH 1TOCB 1KTSB 5BPEA 1BQYA 3V13A 1LHCH 5F8ZA 1GJBB 4AB9A 3K2UA 3JZ2B 2ZTZA 1YF4A 1M9UA 4E7RG 2F9BH 1DICA 3ENSB 2AIQA 1ELGA 1SQAA 2GKVE 1HAZB 5A8YA 2A7CA 3EGKH 2HLCA 3M36A 3VGCB 5JPMH 1QL7A 1OXGA 1V2VT 1O36A 3BN9A 3GY3A 4WH6A 1IQKA 4A5TS 2BY7X 3SI4H 3CP7A 1UK3A 2YNAA 2F9UA 3QWCH 4X8TH 4MPVA 2W3KA 1GI5A 2AERH 3LJJA 1GBDA 1GJ5H 1HYLA 3BIVH 1SGYE 1GI1A 3SNAA 4UFEH 2VWOA 5FHTA 1TX6A 2SGQE 3PTBA 5E0HA 4X6NA 4DOQA 5HYOA 1Q2WA 3F9EA 1J9CH 3SHCH 2A1DB 5FPTA 5LPFA 5E2PA 2C8WB 2FOHA 2BXUH 2QIQA 1NFYA 3BTDE 1CT2E 3PMHB 5A8XA 2BX3A 4DW2U 1BRAA 3TJVA 2VWLA 5GWZA 3A7VA 2QYIA 1UCYE 2J95A 4CRBA 4NCYA 1KDQB 1XUGA 4XE4A 2LPRA 3I77A 1GHWH 1TX8A 4Y0YE 2ALVA 1C5VA 1PQ5A 4GPGA 4UEHH 4ISIH 2PSXA 1EP5A 1MD8A 3UY9A 2VJ1A 3W94A 1FAXA 3DUXH 4U32A 2OTVA 3E1XB 1GJ9B 3S7KB 2Q6FA 1OWJA 1T7CA 3U98H 1GBFA 3F6UH 1S81A 1DX5M 2FLBH 1IOEA 1KTTB 2OXSA 1C2GA 1W3CA 1ZHMA 4KGAA 2PGBB 3GDUA 4O3UA 1W7GH 2ZO3H 1PPBH 1HIAA 3NWUA 2PGQB 1RIWB 1NT1A 1QB6A 2BY9X 3PB1E 1QJ1B 1AUTC 3BG8A 2VVCA 4NSVA 3RUOA 4GVUA 1RXPA 5CHAB 1NROH 3SU5A 3RXTA 1IQIA 1AN1E 5B6OA 2OQ5A 2Y6TA 1FPHH 1WTGH 3A80A 3A87A 1EZUC 1TONA 4K1TA 1EPTC 2ZHDA 4ABHA 3PLPA 3RXSA 1A0HB 1DS2E 4INKA 1K1LA 4NWKA 2G51A 1IQMA 1BITA 1C1UH 3STIA 3I78A 1HLTH 4WMDA 1AZZA 4XBDA 3OYPA 2B8OH 3A8AA 3KHVA 4XBBA 1S85A 4DJZB 1O5FH 3LH3A 3A7XA 2NU1E 1GMHG 1UK2A 4TYDA 2OINA 2G00A 4AFSA 3KQEA 1FY8E 1SGFG 1WYKA 1C2MA 5AFZH 1C5NH 4AFUA 1C9PA 2TGPZ 5E8EH 2FTLE 3QZRA 4UFGH 4A6LA 2M5TA 1CHOF 3U69H 3PMAB 4YT6H 2ZFFH 5HM2A 3FVFB 3SI3H 4AG2A 4LZ1H 2HGTH 1Z8JB 4KTUA 2EEKA 5DP4A 4K5ZA 3SQHE 2A4RA 1CU1A 1NFUA 3SJ8A 1CE5A 1C1PA 1NN6A 2VIWA 3C1KA 3PLKA 2PKAA 1ZRBA 5TCCA 3B23B 1UHBA 2OC8A 2PHBA 4NZLA 1BTZA 1V2NT 4Y7BA 4O9VA 2WPMS 4WWYA 6ESTA 3RXIA 2PTCE 2A0QB 1OOKB 3RU4E 5SGAE 1MU6B 3BTTE 2ANKH 4BANB 4INLA 2R2WU 4CR9A 2ZPQA 2HRVA 3V12A 1SGIB 1FIZA 1FNIA 4H4FA 2CMYA 2ZDLA 3BTEE 2VNTA 2QCYA 2VIDA 1TX7A 3MH7A 2XYAA 1OX1A 4Y7AA 3PO1C 2C8YB 5DG6A 2C93B 3ODFA 1XUIA 1P06A 1O2NA 2BLWA 1TGCA 3KN2A 2AGGX 1DUEA 2GCHG 4ABDA 3MYWA 1TBRH 3EA8A 5EW2H 3SV8A 5FPSA 2ANWA 4FUCA 4IW4E 4YM9A 2ALPA 3ZZ7A 1S83A 1EB2A 1S84A 4BXWA 1YCPM 5FPYA 2SNVA 4RN6A 2OCVB 3AW0A 3C27B 2ZWLH 1IQFA 2P59A 1BIOA 2O8UA 5AHGH 2Z6BD 1DLEA 3RP2A 1BMLA 1ELEE 5T6GA 1Y8TA 1YCPK 3URDA 1KIGH 2EA3A 1GBIA 2ZA5A 1P04A 1RTKA 3BV9B 3EA9A 1RTLA 4X8VH 1A46H 3GY5A 4X2VA 1GI9B 4ZKSU 1O3FA 4TWYA 5F8XA 1Y3VA 4ZKRU 4IC5A 1H4WA 1ETRH 1NFWA 2P8OC 1A0JA 1FN6A 2THFB 3MNBA 3RXBA 3ATKA 1TMTH 1CBWB 4R0IA 3A83A 9ESTA 4FU8A 3SU2A 1GBLA 1BMNH 1MKWK 1QFKH 2GCTB 2PUXB 1GCTB 4K8BA 1P2IA 1OWIA 1EPTA 1TA2A 1N1LA 1BMMH 3A86A 3T62A 1T32A 1HFDA 1XVOA 4ZH8A 2FOFA 1MU8B 3LT3A 1SGQE 1HCGA 2RA3A 4ZHLU 1GMDF 2RDLA 2FOBA 3NPSA 1O2SA 3UNSA 1XM1A 1LO6A 1EAUA 1UCYK 1DFPA 3R0FA 1IQGA 1GBEA 1KXAA 1O3PB 4XDEA 1LKAA 4JK6A 1LDTT 3SJKA 1C1RA 4NWLA 1YLCA 3ZZDA 2PFEA 1ABJH 5EXNA 1SLWB 4I8GA 1K1OA 2HALA 3V7TA 1O3JA 1JOUB 1P8VC 1WUNH 4MNXA 1LPKB 4A7IB 3ZV8A 7GCHG 2ZTYA 2GZ7A 4B71A 4FUFA 2BDYA 2H9HA 1F92A 1ZTKA 2UUYA 2NU0E 1W8BH 3S7HB 2QGRA 4ZXXH 5L30H 1TNKA 3T25A 1GBAA 3QX5H 4FU7A 1NY22 3D62A 3FP6E 3SQEE 2UWPA 3ATMA 3N7OA 1SGPE 1GJCB 1AMHA 2SGAA 5GIBA 2B0FA 1P0SH 2BLVA 2FWWA 1LVOA 1V2TT 5G4BA 1DPOA 1E36B 4OS2A 1ZOMA 4NGAH 3E8LA 1LVYA 2A32A 4F4OC 3U1JB 3LU9B 2IN2A 1BTPA 3TK6A 1UTLM 2FESH 4JMYA 1D3TB 5FBEA 1VITG 1GMCF 2Z9GA 2Y5HA 3FZZA 1GBTA 2GTBA 1IQNA 4JZ1A 5JYIA 1MTSA 2BVRH 1WAYB 3ESTA 1RTFB 1GHVH 1DM4B 4HGCA 1Y3XA 1ELBA 1TPOA 1MUEB 1JIMA 1B0EA 3EE0B 2ODQA 4X2XA 4MLFB 3W95A 5JBBS 5F03A 4E05H 4F49A 2ZGJA 1XUJA 2KAIB 4JZIA 3E6PH 4YOJA 1ZPZA 3A8DA 4AX9H 1GBKA 2B5TB 1WSSH 5T6DA 1G36A 3ZVCA 8KME2 1TQ7B 2G5NA 4X8SH 3PTNA 3UQVA 3ATWA 1SFIA 4FUJA 2BZAA 3SU4A 2H1UA 3BG4B 1DWEH 4X0WU 1O0DH 2OBOA 2OC7A 4FUHA 3A88A 2SGPE 3OY6U 1AZ8A 4MDSA 2BD4A 2K1QA 1GJDB 4Y71A 5EXLA 3TH4H 1RIWC 1L0ZA 2P16A 2BQ6B 5E0GA 1VGCB 1NRNH 5AFYH 2QF0A 1ZYOA 2Z3DA 3ATIA 3E3TA 3O8CA 3RXQA 1BHXB 2ZU1A 1ZTJA 3K6ZA 2TGDA 1RD3B 1Y3YA 3RXKA 5ESTE 1HGTH 1V2LT 1Y3UA 1PPZA 3GCNA 3BSQA 3RMLH 3RXUA 3TGJE 1BRBE 1DSUA 1AGJA 1JIRA 5EW1H 1K1PA 1ZMJA 2ZCKP 3ZVFA 1EOJA 2ZTXA 1S5SA 1NS3A 2G8TA 2NU2E 1C1VH 2ZU4A 3SNEA 3DFLA 4D76A 1UVSH 3ZV9A 4RSPA 5FXLA 3O8DA 1BBRH 2Z7FE 1E37B 2GV7A 3SNBA 4CRAA 3UNQA 3Q76A 4UFFH 3NCLA 1O5BB 5LPEA 1FLEE 4HZHA 4WXIA 1OWHA 5JDUB 3VB3A 2R3UA 7ESTE 4THNH 3BTHE 3CS7A 2JETB 2CF8H 3B8JA 1P57B 1TA6A 4DGJA 4IMZA 1HAVA 2O9QA 1GHBG 2QXGA 1X7AC 3ZZ6A 1JRSA 2O8WA 5J4QA 2GDEH 4K8YA 3BTKE 5AF9H 1O5AB 1FI8A 4HI3A 3M5LA 1QQUA 3DFJA 1VJ9U 3UUZA 1EAIA 3B9FH 2H5DA 1BHXF 2GDDA 1W0ZU 2WUCA 2FOCA 3UOPA 2H6MA 1QTFA 6GCHG 5GJ4B 1ANDA 2A7HA 3VB5A 4NIYA 2VVVA 2ZP0H 5JB9S 2GZ8A 1O2IA 3NKKA 3M5MA 5A0BA 3DA9B 1NRSH 1V2WT 3SU6A 4Y10E 4Y11E 1P03A 4E06H 8GCHG 1P2OA 2ZFRH 1DWBH 1NU7B 1JRTA 1MKXK 4BTTB 4B73A 1G37A 2PV9B 3P8FA 1MQ5A 3MTYA 3QGJA 1FY4A 1C5UA 3F9HA 2BXTH 1TLDA 4B2CA 5FX5A 4D7FA 2ZECA 1GJ8B 1H8IH 1SGNE 3S9CA 2FODA 1MBMA 2AYWA 3VFEA 3U8OH 4WY3A 4I8HA 1BZXE 3ZZ9A 1LQDB 1O2RA 2ZKSA 5DJ7A 4D9RA 2Y80A 4X6MA 1NU9A 2ZHFH 2SFAA 3A8CA 4AN7A 1DOJA 1C1OA 1SGCA 1O3IA 1GHAG 3MO9A 2XTTB 1ZJKA 5T3HA 1YP9A 1B0FA 1TBZH 2JH6D 2VIPA 1K22H 1KDQA 4BAOB 1O3MA 5H4IB 1UVTH 3ELAH 4Y8XA 1J17T 2GGVB 2W26A 1DUAA 3PM3A 1IQLA 1W12U 1NZQH 1MZAA 1AHTH 3S9AA 3TGIE 1EJNA 4AG1A 1O30A 1O2GH 1WU1A 4Y76A 1AIXH 1S0QA 1YM0A 3PWCA 2BD9A 1EKBB 3RXGA 5HM9A 1P2MA 1KXCA 2QA9E 1AQ7A 2BDCA 2P3FH 1QURH 2O8TA 1DVAH 3FZDA 1AKSB 1WQSA 1MZDA 3PWBA 1UJ1A 2OC0A 5GCHG 3LGYA 1C5WB 7LPRA 4TWWA 4GCHG 1ZSKA 5K0HA 4WXVA 1YPKH 3SUFA 1SFQB 3K9XB 1KXFA 3VXEH 2CXVA 1QY6A 1YYY1 2PTNA 2VIQA 2BDGA 4A1TA 2CHAB 3ZZBA 2BD8A 1HAHH 1GCTC 2HVXA 3KQCA 4DT7B 4XOJA 2Y5GA 5IDKA 2VINA 1EJAA 2C8ZB 1K28D 1AE8H 1FJSA 1SB1H 1ZRKA 1BOQA 5PTPA 3QN7A 5F6MA 1AWHB 1QB1A 1AI8H 2A2XH 3P70B 1QNJA 1TNHA 3RXRA 1O5EH 3I29A 1AVWA 4GAWA 2C3SA 1DSTA 3SJOA 3G01A 4CHAC 1FZZA 1LCYA 3QDZB 4ABBA 2HNTF 1XKBC 1LVBA 1HJAC 1SLXB 3SUEA 1RRKA 3LGUA 1DXPA 1NRPH 1O32A 3RXDA 2QXJA 3SN8A 2FDAA 1TYNA 2AGIX 2IPHA 1TRMA 2ULLA 2GP9B 3E91A 2V3HH 2FOMB 3L6PA 1YGCH 1UO6A 1SI5H 1KLIH 1MBQA 5TJXA 1A61H 2UWLA 4ABIA 2ILNA 1P9UA 2GD4B 4BXSA 2Q6GA 1AFQB 1J16A 3CS0A 1K1NA 5DP6A 2Y5FA 1IQEA 2V35A 3SORA 5C5NA 2D1JA 1PJPA 2XBVA 1C2KA 1K1MA 2QY0B 1QBVH 4OS1A 2XBXA 2GV6A 3D49H 3P6ZB 3RXVA 2A5KA 2TGAA 3ZZCA 1AO5A 2FO9A 2C90B 2ZFQH 2A31A 4CBNA 5DPAA 4BOHA 1O2QA 4X6OA 1LPZB 4Y0ZE 1C5OH 3M37A 2BX4A 2A5AA 2HNTE 4X1SU 1HAXB 1YPHE 3EYDA 1DANH 1RJXB 5EPNA 1L1JA 1C2HA 1QB9A 3SJ9A 2WPHS 1YC0A 2BLOA 1MD7A 2FI4E 5LGOA 1HJ9A 5ETXA 3VB7A 5CE1A 1GHZA 1L4DA 1SMFE 1Z7KA 2R2MB 3RMOH 1EB1H 1SGDE 2WV5A 4IGDA 2FI3E 1SHHB 3FAOA 4FUBA 3BF6H 3EAJA 2VH0A 1N6XA 4FVBA 2I6QA 4PROA 4X1NU 1C1MA 2AFQB 2R9PA 1O5DH 2PKSC 3A7WA 3MHWU 4JK5A 1N6YA 2SGFE 1LMWB 5DK1A 1G3EA 1O5GH 1O3HA 5A8ZA 3BG4C 5DKMA 1C4Y2 1AY6H 9LPRA 3HPTB 3RC5A 2Z94A 3RDZA 3CENA 1W14U 1P01A 5EGMA 2H9EH 1LHEH 3GDSA 2ZU3A 4JZFH 2OLGA 5DO4H 1CA0B 2G81E 1VGCC 3TLOA 1LTOA 1O2HA 4X1RU 1C5ZB 2WPJS 2C8XB 2F9PA 1PPFE 4FVDA 5EOKA 1ESTA 1TGTA 1MQ6A 1GL1A 4I33A 2J34A 4D9QA 1H8DH 4AB8A 1QRXA 1EAWA 1SOTA 1W13U 5EQSA 1NESE 1UTMA 2XW9A 2Q1JA 2OUAA 3ZYEA 1D3PB 1ETSH 1LHDH 2BDHA 3HGNA 3T28A 2R0LA 3AVZA 2GX4A 1EUFA 1CHOG 1PYTC 3NXPA 4B76A 1C2IA 1HB0B 1MTNB 2RCEA 1YPLH 1SGTA 1HDTH 2VWNA 1ELAA 3MH6A 4K1SA 1MAYA 3U8RH 4Z6AH 1MKXH 2JETC 1FQ3A 1BJUA 3LH1A 1LKBA 3LPRA 3A89A 3K6YA 2QF3A 4FU9A 3A85A 1FY3A 3KQDA 3TPIZ 1D9IA 1DWDH 1IAUA 2Z9LA 3PV4A 4TPIZ 3Q3XA 2FOGA 1ANEA 4FXGH 4BAQB 1O3KA 3VEQB 4RKJB 3ATLA 5C67A 4UDWH 1ELFA 1TABE 1UVPA 1TFXA 1SQTA 1C5QA 1A1RA 1GHYH 2P94A 4Y8YA 5I25A 4B75A 4I31A 1O2UA 1O3OA 1O3LA 2ZIQH 3PMBB 1YBWA 3SUGA 3RM0H 1TALA 4FUEA 3SU0A 1H9LB 1A5GH 5GXPA 1O5CB 2FOAA 2Q6DA 3E90B 1TMUH 1GI7B 2I6SA 4YOIA 1INCA 3UWJH 1AE5A 3A8BA 1ZMLA 5GDSH 1Z6JH 2AIPA 4CRFA 1TMBH 2Z9KA 2VB0A 2ZGCA 3TK9A 3RXJA 1C2EA 4YZUA 5TCAA 2ZQ2A 2G52A 3EA7A 2QN5T 3DHKH 1GJ4H 3T5FH 3MU4A 3KL6A 1O35A 1P02A 3EQ0H 2ZFPH 1J8AA 2BDBA 1SOZA 4ZAEA 1ZHPA 1W0YH 1W11U 1SHYA 2AEIH 4FUDA 1TNGA 5JBAS 4B1TA 3RXFA 3HGPA 1EJMA 5CMXH 2ZGHA 1O3NA 2BOKA 4YOGA 2SGDE 2F9OA 1AD8H 3MH4A 4WMFA 2KAIA 3S69A 3QGNB 1C5MD 1RGQA 3AAVA 3MNSA 1FONA 2D26C 3MMGA 4DVAU 1VITH 1G2LA 1WQVH 1VJAU 1HV7A 3H7TA 3UOUA 2ZDAH 1ACBE 1PPCE 4U01A 3GY8A 1PQ7A 4NSYA 3O8RA 2HNTC 4Y6DA 1YPHC 1SGEE 7KMEH 1QJ7B 4WF8A 1TQ0B 3MWIU 1SQOA 1O2MA 3VGCC 3ZZ5A 2O8LA 3OU0A 2AS9A 1MAXA 1O2OA 2G5VA 3P95A 3GY4A 1MTWA 1A3EH 3P17H 1TE0A 3S0NA 3SW2B 1GBCA 3STJA 2CGAA 2JKHA 5DP5A 4FUGA 3SZNA 4LOYH 1GMDG 1ZGVA 2NU3E 3BTQE 2YOLA 2CHAC 3SOSA 1QA7A 1EXFA 1L2EA 2FYRA 4Z0KA 1NPMA 1TRYA 1NTPA 1SR5C 4IN2A 1KXDA 2OBQA 2ANMH 3IWMA 3AAUA 3PMJA 2BZ6H 1BUIA 2VU8E 1ORFA 4MNVA 1OP2A 1GCDA 5DP9A 2BY5X 5A0AE 4B2AA 2ZF0H 5A0CA 4JYVH 1D6WA 1XXFA 3DT0H 1DLKB 2H2ZA 1QRZA 3LIWA 5HXFA 1O3CA 3MU0A 3LDXH 3TH3H 1BTXA 4DCDA 5DP7A 4NA8A 3UR9A 2GMTB 2Y82A 3GY6A 2FOEA 3LONA 1PPEE 2O8MA 1HXEH 1O3DA 3M3VA 1QQ4A 1VCQA 1K1JA 5EG4A 1O2PA 4AGJA 3LOXA 1O2ZA 3QTVH 3UTUH 4B74A 1OKXA 4YTAA 1HAYB 1GI0A 1SG8B 1ANCA 4KELA 2Z3EA 3NUMA 1TGSZ 2BHGA 1LVMA 1E0FD 2P93A 1QHRB 2CF9H 1SC8U 3URCA 1MH0A 3DD2H 4MTBA 5EXMA 2BB4A 4GSOA 5I46H 1AFQC 1UVOA 3ZZAA 5CHAC 1HUTH 3TJNA 4CBOA 4B2BA 1GDUA 1FN8A 1HJ8A 4OS7A 3HK6B 1Z71A 4OS5A 4ZROA 5L6NH 1BRUP 1YPGH 1GHBF 2XWBI 1EZQA 3SUDA 1C2LA 1U6QA 1BTUA 1EOLA 3SBKA 1GHXH 1E38B 4D8NA 3RXOA 2H9TH 5EODA 3RM2H 1AU8A 1H9IE 1J15A 2BY6X 3E0PB 3P8NA 3M35A 3M5NA 2XCNA 3MI4A 4SGAE 1HRTH 1JBUH 4BNRA 3M7UA 2F91A 3QUMP 1Y5AT 1QGFA 1H9HE 2ZPRA 3ZVGA 4ABJA 2AMPA 1GGDB 1S6HA 1MTUA 1V2MT 1HPGA 1AB9B 3PO1B 3V3MA 1XMNB 1GG6B 5DP8A 1RS0A 3TK5A 2A4QA 2Y7XA 3M61U 3TU7H 1BTHH 5IYTA 1AVGH 2AH4X 2QXIA 5C5OA 3D23A 1F7ZA 2WYGA 1UTKA 2EI7A 3SGAE 1DY8A 1GJ7B 4ISOA 1YKTA 1C2JA 3ZVDA 2UUKB 4MNWA 4Y8ZA 3M5OA 4I8LA 5EPYA 3ZZ3A 3MO6A 2STAE 3T29A 1ZJDA 1O2TA 1OYTH 1BTWA 1O2YA 2RA0A 1AWFH 1H1BA 3M3TA 4INHA 4MPUA 1A4WH 1UTJA 2UWOA 1E35B 2P3TB 3FFGA 4YLQH 2A4OA 1SVPA 1BB0B 4YESB 3MNXA 4NFEA 1RFNA 1UK4A 2QC2A 1DXWA 1KY9A 1BTYA 3A82A 1AKSA 5L2YH 2P3UB 5EU8A 1FY1A 4MPXA 5FX6A 3FP8E 2SNWA 2AMDA 3KEEA 2H5CA 1EX3A 4ISLA 1BBRE 1TIOA 3UR6A 1CSOE 2UUJB 3E16B 3Q77A 3GCTG 1ZSLA 3EDXB 1IHTH 2B9LA 4HTCH 3QZQA 4AFQA 1HAOH 4ZKNU 4X2WA 1EASA 3BIUH 2P8OB 1YCPH
chains in the Genus database with same CATH superfamily
5FCRA 1VR1H 1D3QB 4ABEA 1O2XA 1TBQH 1C2FA 4ASUD 1P9SA 3ZVBA 2G4UA 3SNDA 4ZHMU 5GCHF 2FI5E 3TVJB 2XBWA 4GCHF 1BJVA 1ZR0A 3N7EA 2FZZA 4NZQA 1K2I1 2OC1A 2WPLS 2F3CE 2GVFA 1JWTA 1NRQH 2AGEX 1SLUB 1YWUA 1CGHA 3BEIB 3M7TA 1MKWH 4JZEH 3MNCA 4ZKOU 1Z8IB 4LXBH 3M7QA 4YO9A 1CT0E 2F9VA 3MU5A 2W5EA 2DUCA 4BTIB 2FS9A 2ZFSA 1FY5A 1IQHA 1OWKA 3SJIA 1F5KU 4AZ2B 4GUXA 3F68H 4VGCB 4A92A 3P8GA 1MCTA 3GY7A 1ZZZA 2EI6A 3SO3A 3UREA 1W0JD 2LNCA 1UCYH 1C5PA 1LQEA 1OWEA 2PR3A 3Q00A 1A5IA 3VB4A 3KCGH 2PUQH 1SGRE 4NFFA 4BAHB 4UE7H 1Z1JA 2VGCB 1SSXA 3O8BA 1Z8GA 3U8TH 2D2DA 2OD3B 2A45B 1A3BH 2ZDVH 1O37A 2A5IA 1FIWA 2VIVA 1S82A 4AORA 4X1PU 1XKAC 3RU4D 1BDAA 1CBWC 2FX6A 5C0UA 1GDQA 2GCTC 2QV1A 2TPIZ 3A7ZA 1G3BA 1XUFA 5ESBA 5GPIB 1ETTH 1BCUH 2XXLA 3E0NB 4OS4A 1UVUH 4HG6A 1DY9A 2ZDNA 4ISNA 2Y7ZA 4BAKB 2D8WA 4F55A 1GI2A 1OS8A 4HFPB 1NC6A 3A7YA 2BVSH 2JIZD 2XC5A 2W7UA 2ZNKH 3L33A 1YPEH 5DP3A 1P05A 4GHTA 4KTCA 1ELCA 1GVZA 3OY5U 5HGGA 2ZHEH 2J2UA 1DWCH 3GOVB 1G32B 1CGIE 3TNSA 5C3NA 1GJ6A 4Q80A 8ESTE 1LHFH 1EFRD 1T8NA 1GBHA 3NRLA 3UFAA 5JB8S 1WBGB 1QBOA 1QBNA 4O03A 5F8TA 3LGTA 5C20A 1UMAH 3FN8A 3M3SA 3H7OA 1WTHD 4ZHAA 1LPGB 3IITA 3BTGE 2FTMA 4DIHH 3LKWA 1SPJA 2DE8A 3T27A 3A7TA 1V2OT 2CJIA 1GMHF 2Z9IA 3RC4A 1A5HA 3OSYA 5FAHA 4WMEA 2OP9A 4IMQA 1Y59T 3RXLA 3GYLB 2V3OH 3UPEA 4CREA 3DSOA 3ZVEA 1C5SA 1EQ9A 5ABWA 2ZCLP 2PLXA 1DITH 4I86A 1FPCH 2ZGXH 4K1EA 4O3TA 1CA8B 2ASUB 2ZEBA 3GDVA 3GY2A 4JCNA 4NIVA 3TJUA 2HPQH 5C1XA 1V2QT 4BTUB 2UUFB 1A0LA 1KXEA 1V6DA 3SNCA 1QL9A 1A2CH 3PROA 3SU1A 1A7SA 2BD2A 1D3DB 1Z1IA 1SKYE 4XFQA 4JYTA 3F0OA 1L1NA 2ZG0H 4YLUA 2GT7A 2TIOA 3FP7E 1ABIH 1XX9A 2BD3A 2DE9A 4OS6A 1PPGE 3IG6B 4KKDA 1T8MA 1WCZA 3V0XA 4NIWA 4TT3D 4KTSA 4K60A 4NIXA 5B6LA 2BY8X 1ARBA 3ODDA 2GMTC 4CRCA 2XBYA 1MABB 4R8TB 4WVPE 2WINI 1GVLA 1YPJH 5HIYA 3GS9A 1SL3A 3UWIA 1KMHB 4ABGA 1O31A 2AMQA 4IN1A 1OPHB 2WPKS 5L2ZH 4ESTE 3MFJA 3UAIC 4TY7A 1MMJN 1NBME 4XBCA 4Q7YA 1N8OB 4WJG2 1O39A 4IBLH 2BQ7B 6LPRA 5LPRA 1QA0A 1TPPA 1V3XA 2BYAX 2Z3CA 1OYQA 2BD5A 1QCPA 2TGTA 4ABAA 3MU8A 1OP0A 1KSNA 2GCHF 1BA8B 4UD9H 4BAMB 3T26A 1HIAB 1QJ6B 4JZDH 3BTME 4WH8A 2PWXA 1VCPA 2YNBA 2FMJA 1K0HA 3ZYDA 5EJ1A 4I8JA 5FBIA 2BM2A 1BBRK 4U2WA 4XRNA 3TIUA 2ZU2A 2PSYA 1UTNA 3BEFB 4I8KA 2V0BA 1WXRA 1FV9A 2WYJA 1C5RA 1GBBA 3Q3YA 6CHAB 2L6OA 4QT8C 1ZGIA 1KLJH 1B7XB 2EI8A 2A2QH 3AW1A 3Q3KA 4J2YB 4Z1MD 1EATA 4A1XA 5T6FA 1HAIH 1HBTH 3RC6A 4AOQA 2J9NA 3RLYH 5BRRE 1CHGA 2HOBA 1TPAE 3KGPA 1D6RA 1ZPBA 1JMOH 1GGDC 1ANBA 2ESTE 3ZZ8A 1AB9C 1P09A 1GBJA 1GG6C 1XVMA 1TRNA 1TNLA 2NWNA 1OSSA 1C5TA 2F9NA 1E34B 3RMNH 1O34A 1C1NA 1P2QA 1T4UH 4U30A 5CHBA 2FS8A 1TAWA 4NA7A 2J98B 4I32A 1O3BA 5EQRA 2J38A 1CT4E 3BTWE 2OK5A 4ASHA 3GCHB 1BT7A 1GI6A 1THPB 1C4U2 2V6NA 2CV3A 2FP7B 2R0KA 2A7JA 4LK4A 4OGYA 1TGNA 2F4LA 4TY6A 1ZTLA 1V2ST 1HXFH 1V2RT 4XSKU 3HKJB 1O2JA 1OWDA 2A4GA 2OQUA 3F9GA 4AYVB 2PKAB 1QIXB 1S6FA 1Q3XA 1ZHRA 1UHBB 2KCAA 1Y5BT 3SV2H 5JBCS 3BEUA 1HAGE 3SV9A 2STBE 3FO8D 1UTPA 3RXMA 3SHAH 1EAXA 2BTCE 2VIOA 1NRRH 3RXEA 1FMGA 1V2UT 1W10U 1XXDA 3WW7A 1ELTA 3VPKA 8LPRA 4ZMAH 2FIRH 2FX4A 5E2OA 1JXPA 1TB6H 4GLYA 3TH2H 4AGKA 1FAKH 4IS5A 2VWMA 3A81A 1GL0E 1F0SA 2QXHA 3R3GB 4TPYA 2XC4A 7GCHF 1Y3WA 3OAAD 5DN6D 2FPZA 3FANA 2R3YA 2Y81A 3KQ5A 4P02A 2BVXH 1G3CA 1L4ZA 1EP6A 3TGKE 4E7NA 4ZXYH 4SGBE 1V2KT 5JBTA 3H09A 2FXRA 1YPMH 3U9AH 3UQOA 3SV7A 3RMMH 1TOMH 3LC5A 1O2VA 1OP8A 2J92A 3MO3A 1TNIA 3NK8A 4CR5A 2QF4A 1G9IE 3SGQE 2ODYB 4X1QU 3PRBA 1P2NA 1G2MA 2ZZUH 2FLRH 4CHAB 3OTJE 1VITF 2CN0H 3F0PA 4LZ4B 1AFEH 4VGCC 1J14A 2RG3A 4ZUHA 1HJAB 4X2YA 3UNRA 2IJOB 3A84A 1C5YB 2JH0D 1P3EA 2C4FH 5K7RA 1GBMA 3U1IB 3VG8A 3GICB 2PP6A 2WPIS 4FUIA 1THSH 1MCVA 2XWAA 1T4VH 3F9FA 2W3IA 4FETA 2VGCC 3QK1A 1C1SA 1F0TA 1THRH 2Z9JA 4MQAA 1L1GA 3SV6A 3U28C 2VVUA 1PQ8A 1CQQA 2HPPH 3HKIB 4NG9H 4X8UH 3RXCA 4UONA 1SLVB 1FX0B 2ZDMA 1BRCE 1GI8B 3RU4T 3QO6A 3DCLA 2BDIA 4M7GA 4J1YA 2J94A 2ZQ1A 1O2LA 4FOUC 4Q7XA 5A2MH 3S9BA 1G30B 1VCWA 1EPTB 1VZQH 4Q4LA 2EC9H 1SBWA 1NFXA 1DDJA 1ZSJA 2VH6A 3LGIA 3P92A 3GCOA 1TWXB 3PYHA 4RKOB 1P10A 1B5GH 2KCYA 4O97A 4CRGA 1O3EA 5FL7D 1GDNA 4D7GA 4Q7ZA 1T8OA 1F2SE 2BQWB 4IC6A 1AVXA 5AVDA 4JYUH 2P95A 3KIDU 1DE7H 3T2NA 2ZHQH 3SGBE 1F0RA 4X6PA 2ZFTA 3JZ1B 1C1WH 1C1TA 4YT7H 1FUJA 1CVWH 4MPWA 1O3AA 4DY7B 4DURA 1NO9H 2BDAA 1C5XB 3MOCA 3RXPA 4H6TA 2PKSB 4K2YA 2G4TA 5HMAA 3PLBA 4CH2B 2WV9A 1PFXC 3WY8A 2BLQA 3BTFE 2BOHB 1GMCG 1PYTD 4MVNA 1PQAA 1YLDA 3F2HA 1QR3E 2ZDKA 4H6SB 1O2KA 2WV4A 2FEQH 1O33A 5EJLA 4OGXA 3GISB 1T31A 5KEDA 2EY4C 2HWLB 4Y79A 3NZIA 2PW8H 3RXHA 2ZPSA 1C2DA 1FXYA 3OTPA 3LGWA 1HNEE 2ZHWH 2NU4E 1Z8RA 1BMAA 3KF2A 1C9TA 6GCHF 3MU1A 1E1QD 3TJOA 4NA9H 1ZLRA 2FYQA 3UIRA 1PPHE 3LGVA 1ARCA 3SU3A 4I7YH 1P3CA 1ESBA 1QRWA 3UB0A 8GCHF 1GI4A 1F5LA 1KYNA 2CK3D 1F5RA 1MTVA 1O2WA 1ZMNA 4MNYA 3FKSD 2ZGBH 1Y5UT 1EZXC 2XNIA 4AFZA 3ZVAA 3RLWH 1C5LH 3HATH 3P8OA 2QAAA 1ID5H 1XUKA 2BD7A 3GCTF 2XCFA 2TBSA 5E0JA 1W2KH 5J4SA 2GZ9A 1Q31A 1ESAA 4XD7D 1N8OC 1W0KD 1V2JT 1KXBA 1O3GA 2K8IA 3F3BA 3RXAA 4CH8B 2M2AA 1P2KA 1UTOA 1ELVA 2ZI2H 2BMGB 1GHAF 2XC0A 2FM2A 1T8LA 1TNJA 3ITIA 3F1SB 1CA0C 3OX7U 4A1VA 3LC3A 2ZC9H 1DT2A 1CGJE 1TGBA 5C1UA 1CO7E 1D4PB 1K1IA 2TRMA 1P11E 4H42U 1O38A 5DSFA 1F0UA 4AYYB 1ELDE 2RDEA 2XRCA 3AASA 5C1YA 1GVKB 2SGEE 4KP0A 1C4V2 2ANYA 1C1QA 1WOFA 4ABFA 2WUBA 1IHSH 5C2ZA 2G55A 4DIIH 1GJAB 1G3DA 1K21H 1HAPH 2GT8A 1GWAA 2ZCHP 2W7SA 3GYMA 3HK3B 2J4IA 4UFDH 3D65E 3VXFH 6CHAC 4K69A 1GPZA 2ODPA 1KLTA 1FDPA 1P2JA 1SGFA 3K65B 3QTOH 5LH8A 1NM6A 1QL8A 2F83A 3H5CB 2F43B 1GI3A 4CRDA 1EZSC 1ZPCA 1P12E 5DGJA 1V2PT 3MH5A 3LJOA 3TITA 1MTNC 3KNXA 2KM0A 1AUJA 4GHQA 4K3JA 3KQBA 2ZU5A 1Z6EA 5FCKA 1TPSA 4Q2KA 3QLPH 4ISHH 3VB6A 1K9OE 3L3TA 1IQJA 1XUHA 2JH5D 4MG3A 1WV7H 4DG4A 2B7DH 1W7XH 3ZZ4A 1UTQA 3GCHC 2IOTA 5EQQA 5A09A 1S0RA 3TNTA 1HAVB 1LHGH 1TOCB 1KTSB 5BPEA 1BQYA 3V13A 1LHCH 4M9FA 5F8ZA 1GJBB 1YLNA 4AB9A 4RT0A 3K2UA 3JZ2B 2ZTZA 2QE7D 1YF4A 1M9UA 4E7RG 2F9BH 1DICA 3ENSB 2AIQA 1ELGA 1SQAA 2GKVE 1HAZB 5A8YA 2A7CA 3EGKH 2HLCA 3M36A 3VGCB 5JPMH 1QL7A 1OXGA 1V2VT 1O36A 3BN9A 3GY3A 4WH6A 1IQKA 4A5TS 2BY7X 3SI4H 3CP7A 1UK3A 2YNAA 2F9UA 3QWCH 4X8TH 4MPVA 2W3KA 1GI5A 2AERH 3LJJA 1GBDA 1GJ5H 1HYLA 3BIVH 1SGYE 1GI1A 3SNAA 4UFEH 2WZQA 2VWOA 5FHTA 1TX6A 5HIZA 2SGQE 1OHHD 3PTBA 4X6NA 5E0HA 4DOQA 5HYOA 1Q2WA 3F9EA 1J9CH 3SHCH 2A1DB 5FPTA 5LPFA 5E2PA 2C8WB 2FOHA 2BXUH 2QIQA 1NFYA 3BTDE 1CT2E 3PMHB 5A8XA 2BX3A 4DW2U 1BRAA 3TJVA 2VWLA 5HKKD 5GWZA 3A7VA 2QYIA 1UCYE 2J95A 4CRBA 4NCYA 1KDQB 1XUGA 4Q63A 4XE4A 2LPRA 3I77A 1GHWH 1TX8A 4RI0A 4Y0YE 2ALVA 1C5VA 1PQ5A 4GPGA 4UEHH 4ISIH 2PSXA 1EP5A 1MD8A 3UY9A 2VJ1A 3W94A 1FAXA 3DUXH 4U32A 2OTVA 3E1XB 1GJ9B 3S7KB 2Q6FA 1OWJA 2V3MA 1T7CA 3U98H 1GBFA 3F6UH 1S81A 1DX5M 2FLBH 1IOEA 2VBCA 1KTTB 2OXSA 1C2GA 1W3CA 1ZHMA 4KGAA 2PGBB 3GDUA 4O3UA 1W7GH 2ZO3H 1PPBH 1HIAA 2QF5A 3NWUA 2PGQB 1RIWB 1NT1A 1QB6A 2BY9X 3PB1E 1QJ1B 1AUTC 3BG8A 2VVCA 4NSVA 3RUOA 2LP6A 4GVUA 1RXPA 5CHAB 1NROH 3SU5A 3RXTA 1IQIA 1AN1E 5B6OA 2OQ5A 2Y6TA 1FPHH 2YMSC 1WTGH 3A80A 3A87A 1EZUC 1TONA 4K1TA 1EPTC 2ZHDA 4ABHA 3PLPA 3RXSA 2HLDD 1A0HB 1DS2E 4INKA 1K1LA 4NWKA 2G51A 4ACAA 1IQMA 1BITA 1C1UH 3STIA 3I78A 1HLTH 4WMDA 1AZZA 4XBDA 3OYPA 2B8OH 3A8AA 3KHVA 4XBBA 1S85A 4DJZB 1O5FH 3LH3A 3A7XA 2NU1E 1GMHG 1UK2A 4TYDA 2OINA 2G00A 4AFSA 3KQEA 1FY8E 1SGFG 1WYKA 2J98A 3DSPA 1C2MA 5AFZH 4YXWD 2HVYB 1C5NH 4AFUA 1C9PA 2TGPZ 5E8EH 2FTLE 3QZRA 4UFGH 4A6LA 2M5TA 1CHOF 3U69H 3PMAB 4YT6H 2ZFFH 5HM2A 3FVFB 3SI3H 4AG2A 4LZ1H 2HGTH 1Z8JB 4KTUA 2EEKA 5DP4A 4K5ZA 3SQHE 2A4RA 1CU1A 1NFUA 3SJ8A 1CE5A 1C1PA 1NN6A 2VIWA 3C1KA 3PLKA 2PKAA 1ZRBA 5TCCA 3B23B 1UHBA 2OC8A 2PHBA 5C94A 4NZLA 1BTZA 1V2NT 4Y7BA 4O9VA 2WPMS 4WWYA 6ESTA 3EE7A 3RXIA 2PTCE 2A0QB 1OOKB 3RU4E 5SGAE 1MU6B 3BTTE 2ANKH 4BANB 2WHXA 4INLA 2R2WU 4CR9A 2ZPQA 2HRVA 3V12A 1SGIB 1FIZA 1FNIA 4H4FA 2CMYA 2ZDLA 3BTEE 2VNTA 2QCYA 2VIDA 1TX7A 3MH7A 2XYAA 1OX1A 4Y7AA 3PO1C 2C8YB 5DG6A 2C93B 3KYGA 3ODFA 1XUIA 1P06A 1O2NA 2BLWA 1TGCA 3KN2A 2AGGX 1DUEA 2GCHG 4ABDA 3MYWA 1TBRH 3EA8A 5EW2H 3SV8A 5FPSA 2ANWA 4FUCA 4IW4E 4YM9A 2ALPA 3ZZ7A 1S83A 1EB2A 1S84A 5EIYA 4BXWA 1YCPM 5FPYA 2SNVA 4RN6A 2OCVB 3AW0A 3C27B 2ZWLH 1IQFA 2P59A 1BIOA 2O8UA 5AHGH 2Z6BD 1DLEA 3RP2A 1BMLA 1ELEE 5T6GA 1Y8TA 1YCPK 3URDA 1KIGH 2EA3A 1GBIA 2ZA5A 1P04A 1RTKA 3BV9B 3EA9A 1RTLA 4X8VH 1A46H 3GY5A 4X2VA 1GI9B 4ZKSU 1O3FA 4ZCNA 4TWYA 5F8XA 1Y3VA 4ZKRU 4IC5A 1H4WA 1ETRH 1NFWA 2P8OC 1A0JA 1FN6A 2THFB 3MNBA 3RXBA 3ATKA 1TMTH 3PV5A 1CBWB 4R0IA 3A83A 9ESTA 4FU8A 3SU2A 1GBLA 1BMNH 1MKWK 1QFKH 2GCTB 2PUXB 1GCTB 2WPDD 1P2IA 4K8BA 1OWIA 1EPTA 1H8HD 1TA2A 1N1LA 1BMMH 3A86A 3T62A 1T32A 1HFDA 1XVOA 4ZH8A 2FOFA 1MU8B 3LT3A 1SGQE 1HCGA 2RA3A 2KZ4A 4ZHLU 1GMDF 2RDLA 2FOBA 3NPSA 1O2SA 3UNSA 1XM1A 1LO6A 1EAUA 1UCYK 1DFPA 3R0FA 1IQGA 1VKYA 1GBEA 1KXAA 1O3PB 4XDEA 1LKAA 3F2FA 4JK6A 1LDTT 3SJKA 1C1RA 4NWLA 1YLCA 2YMSD 2PFEA 3ZZDA 1ABJH 5EXNA 1SLWB 4I8GA 3OEHD 1K1OA 2HALA 3V7TA 1O3JA 1JOUB 1P8VC 3W1EA 1WUNH 4MNXA 1LPKB 4A7IB 3ZV8A 7GCHG 2ZTYA 2GJGA 2GZ7A 4B71A 4FUFA 2BDYA 2H9HA 1F92A 1ZTKA 2UUYA 2NU0E 1W8BH 3S7HB 2QGRA 4ZXXH 5L30H 1TNKA 1E79D 3T25A 1GBAA 3QX5H 4FU7A 1NY22 3D62A 3FP6E 4AC9A 3SQEE 2UWPA 3ATMA 3N7OA 1SGPE 1GJCB 1E1RD 1AMHA 2SGAA 5GIBA 2B0FA 1P0SH 2BLVA 2FWWA 1LVOA 1V2TT 5G4BA 1DPOA 5GNDA 1E36B 4OS2A 1ZOMA 4NGAH 3E8LA 1LVYA 2A32A 4F4OC 3U1JB 3LU9B 2IN2A 1BTPA 3TK6A 1UTLM 2FESH 4JMYA 1D3TB 5FBEA 1VITG 3OFND 1GMCF 2Z9GA 2Y5HA 5T1VA 3FZZA 1GBTA 2GTBA 1IQNA 4JZ1A 5CDFE 5JYIA 1MTSA 2BVRH 1WAYB 3ESTA 1RTFB 1GHVH 1DM4B 4HGCA 1Y3XA 1ELBA 1TPOA 1MUEB 1JIMA 1B0EA 3EE0B 2ODQA 4X2XA 4MLFB 3W95A 5JBBS 5F03A 4E05H 4F49A 2ZGJA 1XUJA 2KAIB 4JZIA 3E6PH 4YOJA 1ZPZA 3A8DA 4AX9H 1GBKA 1SQRA 2B5TB 1WSSH 5T6DA 1G36A 3ZVCA 8KME2 1TQ7B 2G5NA 4X8SH 3PTNA 3UQVA 3ATWA 1SFIA 4FUJA 2BZAA 3SU4A 2H1UA 3BG4B 4P00A 1DWEH 4X0WU 1O0DH 2OBOA 2OC7A 4FUHA 3A88A 2SGPE 3OY6U 1AZ8A 4MDSA 2BD4A 2K1QA 1GJDB 4Y71A 5EXLA 5C17A 3TH4H 1RIWC 1L0ZA 2P16A 2BQ6B 5E0GA 1VGCB 4DT4A 1NRNH 5AFYH 2QF0A 1ZYOA 2Z3DA 3ATIA 3E3TA 3O8CA 3RXQA 1BHXB 2IJD1 2ZU1A 1ZTJA 3K6ZA 2TGDA 1UW7A 3N99A 1RD3B 2KFWA 1Y3YA 3RXKA 5ESTE 1HGTH 1V2LT 1Y3UA 1PPZA 3GCNA 3BSQA 3RMLH 3RXUA 3TGJE 4TSFD 1BRBE 1DSUA 1AGJA 1JIRA 5C0TA 5EW1H 1K1PA 1ZMJA 2ZCKP 3ZVFA 1EOJA 2ZTXA 1S5SA 1NS3A 2G8TA 2NU2E 1C1VH 2ZU4A 3PRDA 3DFLA 3SNEA 1UVSH 3ZV9A 4RSPA 5FXLA 4D76A 2V7QD 3O8DA 1BBRH 2Z7FE 1E37B 2GV7A 3SNBA 4CRAA 3UNQA 3Q76A 4UFFH 3NCLA 1O5BB 5LPEA 1FLEE 2XOKD 4HZHA 4WXIA 1OWHA 5JDUB 3VB3A 2R3UA 7ESTE 4THNH 3BTHE 3CS7A 2JETB 2CF8H 3B8JA 1P57B 1H8ED 1TA6A 4DGJA 4IMZA 1HAVA 2O9QA 1GHBG 2QXGA 1X7AC 3ZZ6A 1JRSA 2O8WA 5J4QA 2GDEH 4K8YA 3BTKE 5AF9H 1O5AB 2IPQX 1FI8A 4HI3A 3M5LA 1QQUA 3DFJA 1VJ9U 3UUZA 1EAIA 3B9FH 2H5DA 3ZIAD 1BHXF 2GDDA 1W0ZU 2WUCA 2FOCA 3UOPA 2H6MA 1QTFA 2J97A 6GCHG 5GJ4B 1ANDA 2A7HA 3VB5A 4NIYA 2VVVA 2ZP0H 5JB9S 2GZ8A 1O2IA 3NKKA 3M5MA 5A0BA 3DA9B 1NRSH 1V2WT 3SU6A 4Y10E 4Y11E 1P03A 4E06H 8GCHG 1P2OA 2ZFRH 1DWBH 1NU7B 1JRTA 1MKXK 4BTTB 4B73A 1G37A 2PV9B 3P8FA 1MQ5A 3MTYA 3QGJA 1FY4A 1C5UA 3F9HA 2BXTH 1TLDA 4B2CA 5FX5A 4D7FA 2ZECA 1GJ8B 1H8IH 1SGNE 3S9CA 2FODA 1MBMA 2AYWA 3VFEA 3U8OH 4WY3A 4I8HA 4ACBA 1BZXE 3ZZ9A 1LQDB 1O2RA 2ZKSA 5DJ7A 4D9RA 2Y80A 4X6MA 1NU9A 2ZHFH 2SFAA 3A8CA 4AN7A 1DOJA 1C1OA 1SGCA 1O3IA 1GHAG 3MO9A 2XTTB 1ZJKA 5T3HA 1YP9A 1B0FA 1TBZH 2JH6D 2VIPA 1K22H 2KR7A 1KDQA 4BAOB 1O3MA 5H4IB 1UVTH 3ELAH 4Y8XA 1J17T 2GGVB 2W26A 1DUAA 3PM3A 1IQLA 1W12U 1NZQH 1MZAA 1AHTH 3S9AA 3TGIE 1EJNA 1NBMD 4AG1A 1O30A 1O2GH 1WU1A 4Y76A 1AIXH 1S0QA 1YM0A 3PWCA 2BD9A 1EKBB 3RXGA 5HM9A 1P2MA 1KXCA 2QA9E 1AQ7A 2BDCA 2P3FH 1QURH 2O8TA 1DVAH 3FZDA 1AKSB 1WQSA 1MZDA 3PWBA 1UJ1A 2OC0A 5GCHG 3LGYA 1C5WB 3WWFA 7LPRA 4TWWA 4GCHG 1ZSKA 5K0HA 4WXVA 1YPKH 3SUFA 1SFQB 3K9XB 1KXFA 3VXEH 2CXVA 1QY6A 1YYY1 2PTNA 2VIQA 2BDGA 4A1TA 2CHAB 3ZZBA 2BD8A 1HAHH 1GCTC 2HVXA 3KQCA 4DT7B 4XOJA 2Y5GA 5IDKA 2JJ1D 2VINA 1EJAA 2C8ZB 1K28D 1AE8H 1FJSA 1SB1H 1ZRKA 1BOQA 5PTPA 3QN7A 5F6MA 1AWHB 1QB1A 1AI8H 2A2XH 3P70B 1QNJA 1TNHA 3RXRA 1O5EH 3I29A 1AVWA 4GAWA 2C3SA 1DSTA 3SJOA 3G01A 4CHAC 1FZZA 1LCYA 3QDZB 4ABBA 2HNTF 1XKBC 1LVBA 1HJAC 1SLXB 3FOAA 3SUEA 1RRKA 3LGUA 1DXPA 1NRPH 1O32A 3RXDA 2QXJA 3SN8A 2FDAA 1TYNA 2AGIX 2IPHA 1TRMA 2ULLA 2GP9B 1BMFD 3E91A 2V3HH 2FOMB 3L6PA 1YGCH 1UO6A 2W6ID 1SI5H 1KLIH 1MBQA 5TJXA 1S6LA 1A61H 2UWLA 4ABIA 2ILNA 1P9UA 2GD4B 3WWBA 4BXSA 2Q6GA 1AFQB 1J16A 3CS0A 1K1NA 5DP6A 2Y5FA 1IQEA 2V35A 3SORA 5C5NA 2D1JA 1PJPA 2XBVA 1C2KA 1YY3A 1K1MA 2QY0B 1QBVH 4OS1A 2XBXA 2GV6A 3D49H 3P6ZB 3RXVA 2A5KA 2TGAA 3ZZCA 1AO5A 2FO9A 2C90B 2ZFQH 2A31A 4CBNA 5DPAA 4BOHA 1O2QA 4X6OA 1LPZB 4Y0ZE 1C5OH 3M37A 2BX4A 2A5AA 2HNTE 4X1SU 1HAXB 1YPHE 1WDIA 3EYDA 1DANH 1RJXB 5EPNA 1L1JA 1C2HA 1QB9A 3SJ9A 2WPHS 1YC0A 2BLOA 1MD7A 2FI4E 5LGOA 1HJ9A 5ETXA 3VB7A 5CE1A 1GHZA 1L4DA 1SMFE 1Z7KA 2R2MB 3RMOH 1EB1H 1SGDE 2WV5A 4IGDA 2FI3E 1SHHB 3FAOA 4FUBA 3BF6H 3EAJA 2VH0A 1N6XA 4FVBA 2I6QA 4PROA 4X1NU 1C1MA 2AFQB 2R9PA 1O5DH 2PKSC 3A7WA 3MHWU 4JK5A 1N6YA 2SGFE 1LMWB 5DK1A 1G3EA 1O5GH 1O3HA 5A8ZA 3BG4C 5DKMA 1C4Y2 1AY6H 9LPRA 3HPTB 3RC5A 4B6FA 2Z94A 3RDZA 3CENA 1W14U 1P01A 5EGMA 2H9EH 1LHEH 3GDSA 2ZU3A 4JZFH 2OLGA 5DO4H 1CA0B 2G81E 1VGCC 3TLOA 1LTOA 1O2HA 4X1RU 1C5ZB 2WPJS 2C8XB 2F9PA 1PPFE 4FVDA 5EOKA 1ESTA 1TGTA 1MQ6A 1GL1A 4I33A 2J34A 4D9QA 1H8DH 4AB8A 1QRXA 1EAWA 1SOTA 1W13U 5EQSA 1NESE 1UTMA 3OEED 2XW9A 2Q1JA 2OUAA 3ZYEA 1D3PB 1ETSH 1LHDH 2BDHA 3HGNA 3T28A 2R0LA 3AVZA 2GX4A 2J5UA 1EUFA 1CHOG 1PYTC 3NXPA 4B76A 1C2IA 1HB0B 1MTNB 2RCEA 1YPLH 1SGTA 1HDTH 2VWNA 1ELAA 3CNRA 3MH6A 4K1SA 1MAYA 3U8RH 4Z6AH 1MKXH 2JETC 1FQ3A 3KYFA 1BJUA 2AHME 1COWD 3LH1A 1LKBA 3LPRA 3A89A 3K6YA 2QF3A 4FU9A 3OE7D 3A85A 1FY3A 3KQDA 2KX4A 3TPIZ 1D9IA 1DWDH 1IAUA 2Z9LA 3PV4A 4TPIZ 3Q3XA 2FOGA 1ANEA 4FXGH 4BAQB 1O3KA 3VEQB 4RKJB 3ATLA 5C67A 4UDWH 4OM9A 1ELFA 1TABE 1UVPA 1TFXA 2WSSD 1SQTA 1C5QA 1A1RA 1GHYH 2P94A 4Y8YA 5I25A 4B75A 4I31A 1O2UA 1O3OA 1O3LA 2ZIQH 3PMBB 1YBWA 3SUGA 3RM0H 1TALA 4FUEA 3SU0A 1H9LB 1A5GH 5GXPA 1O5CB 3SYJA 2FOAA 2Q6DA 3E90B 1TMUH 1GI7B 2I6SA 4YOIA 1INCA 3UWJH 1AE5A 3A8BA 1ZMLA 3AK5A 5GDSH 1Z6JH 2AIPA 4CRFA 1TMBH 2Z9KA 2VB0A 2ZGCA 3TK9A 3RXJA 1C2EA 4YZUA 5TCAA 2ZQ2A 2G52A 3EA7A 2QN5T 3DHKH 1GJ4H 3T5FH 3MU4A 3KL6A 1O35A 1P02A 3EQ0H 2ZFPH 2BDBA 1J8AA 1SOZA 4ZAEA 5KECA 1ZHPA 1W0YH 1W11U 1SHYA 2AEIH 4FUDA 1TNGA 5JBAS 2JDID 4B1TA 3RXFA 3HGPA 1EJMA 5CMXH 2EQNA 2ZGHA 1O3NA 2BOKA 4YOGA 2SGDE 2F9OA 1AD8H 3MH4A 4WMFA 2KAIA 2K0QA 3QGNB 3S69A 1C5MD 1RGQA 3AAVA 3MNSA 1FONA 2D26C 3MMGA 4DVAU 1VITH 1G2LA 1WQVH 1VJAU 1HV7A 3H7TA 3UOUA 2ZDAH 1ACBE 1PPCE 4U01A 3GY8A 1PQ7A 4NSYA 3O8RA 2HNTC 4Y6DA 1YPHC 1SGEE 7KMEH 1QJ7B 4WF8A 1TQ0B 3MWIU 1SQOA 1O2MA 3VGCC 3ZZ5A 2O8LA 3OU0A 2AS9A 1MAXA 1O2OA 2G5VA 3P95A 2KCOA 3GY4A 1MTWA 1A3EH 3P17H 1TE0A 3S0NA 3SW2B 1GBCA 3STJA 2CGAA 2JKHA 5DP5A 4FUGA 3SZNA 4LOYH 1GMDG 1ZGVA 4B6EA 2NU3E 3BTQE 2YOLA 5EJZA 2CHAC 4RT1A 3SOSA 1QA7A 1EXFA 1L2EA 2FYRA 2YMSB 4Z0KA 1NPMA 1TRYA 1NTPA 1SR5C 2W6JD 4IN2A 1KXDA 2OBQA 2ANMH 2KCPA 3IWMA 3AAUA 3PMJA 2BZ6H 1BUIA 2VU8E 1ORFA 4MNVA 1OP2A 1GCDA 5DP9A 2BY5X 5A0AE 4B2AA 2ZF0H 5A0CA 4JYVH 1D6WA 1XXFA 3DT0H 1DLKB 2H2ZA 3DSGA 1QRZA 3LIWA 5HXFA 1O3CA 3MU0A 3LDXH 3TH3H 1BTXA 4DCDA 5DP7A 4NA8A 3UR9A 2GMTB 2Y82A 3GY6A 2FOEA 3LONA 1PPEE 2O8MA 1HXEH 1O3DA 3M3VA 1QQ4A 1VCQA 1K1JA 5EG4A 1O2PA 4AGJA 3LOXA 1O2ZA 2XNDD 3QTVH 3UTUH 4B74A 1OKXA 4YTAA 1HAYB 1GI0A 1SG8B 1ANCA 4KELA 2Z3EA 3NUMA 1TGSZ 2BHGA 1LVMA 1E0FD 2P93A 1QHRB 2CF9H 4F48B 1SC8U 3URCA 1MH0A 3DD2H 4MTBA 5EXMA 3MQKC 2RFKC 2BB4A 4GSOA 5I46H 1AFQC 1UVOA 3ZZAA 5CHAC 1HUTH 3TJNA 4CBOA 4B2BA 1GDUA 1FN8A 1HJ8A 4OS7A 3HK6B 1Z71A 4OS5A 4ZROA 5L6NH 1BRUP 1YPGH 1GHBF 2XWBI 1EZQA 3SUDA 1C2LA 1U6QA 1BTUA 1EOLA 3SBKA 1GHXH 1E38B 4D8NA 5F53A 5IK2D 3RXOA 2H9TH 5EODA 3RM2H 1AU8A 1H9IE 1J15A 1QZ8A 2BY6X 3E0PB 3P8NA 3M35A 3M5NA 2XCNA 3MI4A 4SGAE 1HRTH 1JBUH 4BNRA 3M7UA 2F91A 3QUMP 1Y5AT 1QGFA 1H9HE 2ZPRA 3ZVGA 4ABJA 2AMPA 1GGDB 1S6HA 1MTUA 1V2MT 1HPGA 1AB9B 3PO1B 3V3MA 2LELA 1XMNB 1GG6B 5DP8A 5KGOA 1RS0A 3TK5A 2A4QA 2Y7XA 3M61U 3TU7H 1BTHH 5IYTA 1AVGH 2AH4X 2QXIA 5C5OA 3D23A 1F7ZA 2WYGA 1UTKA 2EI7A 3SGAE 1DY8A 1GJ7B 4ISOA 1YKTA 1C2JA 3ZVDA 2UUKB 4MNWA 4Y8ZA 3M5OA 4I8LA 5EPYA 3ZZ3A 3MO6A 2STAE 3T29A 1ZJDA 1O2TA 1OYTH 1BTWA 1O2YA 2RA0A 3F2GA 1AWFH 1H1BA 3M3TA 4INHA 4MPUA 1A4WH 1UTJA 2UWOA 1E35B 2P3TB 3FFGA 4YLQH 2A4OA 1SVPA 1BB0B 3N7DA 3PV2A 4YESB 3MNXA 4NFEA 1RFNA 1UK4A 2QC2A 1DXWA 1KY9A 1BTYA 3A82A 1AKSA 5L2YH 2JJ2D 2P3UB 5EU8A 1FY1A 4MPXA 5FX6A 3FP8E 2SNWA 2AMDA 3KEEA 3SZEA 2H5CA 2L74A 1EX3A 4ISLA 1BBRE 1TIOA 3UR6A 1CSOE 2UUJB 3E16B 3Q77A 3GCTG 1ZSLA 3EDXB 1IHTH 2B9LA 4HTCH 3QZQA 4AFQA 1HAOH 4ZKNU 4X2WA 1EASA 3BIUH 2P8OB 1YCPH
chains in the Genus database with same CATH topology
5FCRA 1VR1H 1D3QB 4ABEA 1O2XA 1TBQH 1C2FA 1P9SA 3ZVBA 2G4UA 3SNDA 4ZHMU 5GCHF 2FI5E 3TVJB 2XBWA 4GCHF 1BJVA 1ZR0A 4NZQA 2FZZA 1K2I1 2OC1A 2WPLS 2F3CE 2GVFA 1JWTA 1NRQH 2AGEX 1SLUB 1CGHA 3BEIB 3M7TA 1MKWH 4JZEH 3MNCA 4ZKOU 1Z8IB 4LXBH 3M7QA 4YO9A 1CT0E 2F9VA 3MU5A 2W5EA 2DUCA 4BTIB 2FS9A 2ZFSA 1FY5A 1IQHA 1OWKA 3SJIA 1F5KU 4AZ2B 4GUXA 3F68H 4VGCB 4A92A 3P8GA 1MCTA 3GY7A 1ZZZA 2EI6A 3SO3A 3UREA 2LNCA 1UCYH 1C5PA 1LQEA 1OWEA 2PR3A 3Q00A 1A5IA 3VB4A 3KCGH 2PUQH 1SGRE 4NFFA 4BAHB 4UE7H 1Z1JA 2VGCB 1SSXA 3O8BA 1Z8GA 3U8TH 2D2DA 2OD3B 2A45B 1A3BH 2ZDVH 1O37A 2A5IA 1FIWA 2VIVA 1S82A 4AORA 4X1PU 1XKAC 3RU4D 1BDAA 1CBWC 2FX6A 1GDQA 2GCTC 2QV1A 2TPIZ 3A7ZA 1G3BA 1XUFA 5ESBA 5GPIB 1ETTH 1BCUH 2XXLA 3E0NB 4OS4A 1UVUH 1DY9A 2ZDNA 4ISNA 2Y7ZA 4BAKB 2D8WA 1GI2A 1OS8A 4HFPB 1NC6A 3A7YA 2BVSH 2XC5A 2W7UA 2ZNKH 3L33A 1YPEH 5DP3A 1P05A 4GHTA 4KTCA 1ELCA 1GVZA 3OY5U 5HGGA 2ZHEH 2J2UA 1DWCH 3GOVB 1G32B 1CGIE 3TNSA 5C3NA 1GJ6A 4Q80A 8ESTE 1LHFH 1T8NA 1GBHA 3UFAA 5JB8S 1WBGB 1QBOA 1QBNA 4O03A 5F8TA 3LGTA 5C20A 1UMAH 3M3SA 3H7OA 1WTHD 4ZHAA 1LPGB 3IITA 3BTGE 2FTMA 4DIHH 3LKWA 1SPJA 2DE8A 3T27A 3A7TA 1V2OT 2CJIA 1GMHF 2Z9IA 3RC4A 1A5HA 3OSYA 5FAHA 4WMEA 2OP9A 4IMQA 1Y59T 3RXLA 3GYLB 2V3OH 3UPEA 4CREA 3ZVEA 1C5SA 1EQ9A 5ABWA 2ZCLP 2PLXA 1DITH 1FPCH 2ZGXH 4K1EA 4O3TA 1CA8B 2ASUB 2ZEBA 3GDVA 3GY2A 4JCNA 4NIVA 3TJUA 2HPQH 5C1XA 1V2QT 4BTUB 2UUFB 1A0LA 1KXEA 1V6DA 3SNCA 1QL9A 1A2CH 3PROA 3SU1A 1A7SA 2BD2A 1D3DB 1Z1IA 4XFQA 4JYTA 1L1NA 2ZG0H 4YLUA 2GT7A 2TIOA 3FP7E 1ABIH 1XX9A 2BD3A 2DE9A 4OS6A 1PPGE 3IG6B 4KKDA 1T8MA 1WCZA 3V0XA 4NIWA 4KTSA 4K60A 4NIXA 2BY8X 1ARBA 3ODDA 2GMTC 4CRCA 2XBYA 4R8TB 4WVPE 2WINI 1GVLA 1YPJH 1SL3A 3UWIA 4ABGA 1O31A 2AMQA 4IN1A 1OPHB 2WPKS 5L2ZH 4ESTE 3MFJA 4TY7A 1MMJN 4XBCA 4Q7YA 1N8OB 4WJG2 1O39A 4IBLH 2BQ7B 6LPRA 5LPRA 1QA0A 1TPPA 1V3XA 2BYAX 2Z3CA 1OYQA 2BD5A 1QCPA 2TGTA 4ABAA 3MU8A 1OP0A 1KSNA 2GCHF 1BA8B 4UD9H 4BAMB 3T26A 1HIAB 1QJ6B 4JZDH 3BTME 4WH8A 2PWXA 1VCPA 2YNBA 2FMJA 3ZYDA 4I8JA 5FBIA 2BM2A 1BBRK 4U2WA 3TIUA 2ZU2A 2PSYA 1UTNA 3BEFB 4I8KA 2V0BA 1FV9A 2WYJA 1C5RA 1GBBA 3Q3YA 6CHAB 4QT8C 1ZGIA 1KLJH 1B7XB 2EI8A 2A2QH 3AW1A 3Q3KA 4J2YB 1EATA 4A1XA 5T6FA 1HAIH 1HBTH 3RC6A 4AOQA 2J9NA 3RLYH 5BRRE 1CHGA 2HOBA 1TPAE 3KGPA 1D6RA 1ZPBA 1JMOH 1GGDC 1ANBA 2ESTE 3ZZ8A 1AB9C 1P09A 1GBJA 1GG6C 1XVMA 1TRNA 1TNLA 2NWNA 1OSSA 1C5TA 2F9NA 1E34B 3RMNH 1O34A 1C1NA 1P2QA 1T4UH 4U30A 2FS8A 1TAWA 4NA7A 4I32A 1O3BA 5EQRA 2J38A 1CT4E 3BTWE 4ASHA 3GCHB 1BT7A 1GI6A 1THPB 1C4U2 2V6NA 2CV3A 2FP7B 2R0KA 2A7JA 4LK4A 4OGYA 1TGNA 4TY6A 1ZTLA 1V2ST 1HXFH 1V2RT 4XSKU 3HKJB 1O2JA 1OWDA 2A4GA 2OQUA 3F9GA 4AYVB 2PKAB 1QIXB 1S6FA 1Q3XA 1ZHRA 1UHBB 3SV2H 1Y5BT 5JBCS 3BEUA 1HAGE 3SV9A 2STBE 1UTPA 3RXMA 3SHAH 1EAXA 2BTCE 2VIOA 1NRRH 3RXEA 1FMGA 1V2UT 1W10U 1XXDA 1ELTA 3VPKA 8LPRA 4ZMAH 2FIRH 2FX4A 5E2OA 1JXPA 1TB6H 4GLYA 3TH2H 4AGKA 1FAKH 4IS5A 2VWMA 3A81A 1GL0E 1F0SA 2QXHA 3R3GB 4TPYA 2XC4A 7GCHF 1Y3WA 2FPZA 3FANA 2R3YA 2Y81A 2BVXH 1G3CA 1L4ZA 1EP6A 3TGKE 4E7NA 4ZXYH 4SGBE 1V2KT 5JBTA 2FXRA 1YPMH 3U9AH 3UQOA 3SV7A 3RMMH 1TOMH 3LC5A 1O2VA 1OP8A 2J92A 3MO3A 1TNIA 3NK8A 4CR5A 1G9IE 3SGQE 2ODYB 4X1QU 1P2NA 1G2MA 2ZZUH 2FLRH 4CHAB 3OTJE 1VITF 2CN0H 4LZ4B 1AFEH 4VGCC 1J14A 2RG3A 4ZUHA 1HJAB 4X2YA 3UNRA 2IJOB 3A84A 1C5YB 2JH0D 1P3EA 2C4FH 5K7RA 1GBMA 3U1IB 3GICB 2WPIS 4FUIA 1THSH 1MCVA 2XWAA 1T4VH 3F9FA 2W3IA 2VGCC 3QK1A 1C1SA 1F0TA 1THRH 2Z9JA 4MQAA 1L1GA 3SV6A 2VVUA 1PQ8A 1CQQA 2HPPH 3HKIB 4NG9H 4X8UH 3RXCA 4UONA 1SLVB 2ZDMA 1BRCE 1GI8B 3RU4T 3QO6A 2BDIA 4M7GA 4J1YA 2J94A 2ZQ1A 1O2LA 4Q7XA 5A2MH 3S9BA 1G30B 1VCWA 1EPTB 1VZQH 2EC9H 1SBWA 1NFXA 1DDJA 1ZSJA 2VH6A 3LGIA 3P92A 3GCOA 1TWXB 3PYHA 4RKOB 1P10A 1B5GH 4O97A 4CRGA 1O3EA 1GDNA 4D7GA 4Q7ZA 1T8OA 1F2SE 2BQWB 4IC6A 1AVXA 5AVDA 4JYUH 2P95A 3KIDU 1DE7H 3T2NA 2ZHQH 3SGBE 1F0RA 4X6PA 2ZFTA 3JZ1B 1C1WH 1C1TA 4YT7H 1FUJA 1CVWH 4MPWA 1O3AA 4DY7B 4DURA 1NO9H 2BDAA 1C5XB 3MOCA 3RXPA 4H6TA 2PKSB 4K2YA 2G4TA 5HMAA 3PLBA 4CH2B 1PFXC 3WY8A 2BLQA 3BTFE 2BOHB 1GMCG 1PYTD 4MVNA 1PQAA 1YLDA 1QR3E 2ZDKA 4H6SB 1O2KA 2WV4A 2FEQH 1O33A 4OGXA 3GISB 1T31A 2HWLB 4Y79A 3NZIA 2PW8H 3RXHA 2ZPSA 1C2DA 1FXYA 3LGWA 1HNEE 2ZHWH 2NU4E 1Z8RA 1BMAA 3KF2A 1C9TA 6GCHF 3MU1A 3TJOA 4NA9H 1ZLRA 2FYQA 3UIRA 1PPHE 3LGVA 1ARCA 3SU3A 4I7YH 1P3CA 1ESBA 1QRWA 8GCHF 1GI4A 1F5LA 1KYNA 1F5RA 1MTVA 1O2WA 1ZMNA 4MNYA 2ZGBH 1Y5UT 1EZXC 2XNIA 4AFZA 3ZVAA 3RLWH 1C5LH 3HATH 3P8OA 2QAAA 1ID5H 1XUKA 2BD7A 3GCTF 2XCFA 2TBSA 5E0JA 1W2KH 5J4SA 2GZ9A 1Q31A 1ESAA 1N8OC 1V2JT 1KXBA 1O3GA 3RXAA 4CH8B 1P2KA 1UTOA 1ELVA 2ZI2H 2BMGB 1GHAF 2XC0A 2FM2A 1T8LA 1TNJA 3ITIA 3F1SB 1CA0C 3OX7U 4A1VA 3LC3A 2ZC9H 1DT2A 1CGJE 1TGBA 5C1UA 1CO7E 1D4PB 1K1IA 2TRMA 1P11E 4H42U 1O38A 1F0UA 4AYYB 1ELDE 2XRCA 3AASA 5C1YA 1GVKB 2SGEE 4KP0A 1C4V2 2ANYA 1C1QA 1WOFA 4ABFA 2WUBA 1IHSH 5C2ZA 2G55A 4DIIH 1GJAB 1G3DA 1K21H 1HAPH 2GT8A 1GWAA 2ZCHP 2W7SA 3GYMA 3HK3B 2J4IA 4UFDH 3D65E 3VXFH 6CHAC 4K69A 1GPZA 2ODPA 1KLTA 1FDPA 1P2JA 1SGFA 3K65B 3QTOH 5LH8A 1NM6A 1QL8A 2F83A 3H5CB 1GI3A 4CRDA 1EZSC 1ZPCA 1P12E 5DGJA 1V2PT 3MH5A 3LJOA 3TITA 1MTNC 3KNXA 1AUJA 4GHQA 4K3JA 3KQBA 2ZU5A 1Z6EA 5FCKA 1TPSA 4Q2KA 3QLPH 4ISHH 3VB6A 1K9OE 3L3TA 1IQJA 1XUHA 2JH5D 4MG3A 1WV7H 4DG4A 2B7DH 1W7XH 3ZZ4A 1UTQA 3GCHC 2IOTA 5EQQA 5A09A 1S0RA 3TNTA 1HAVB 1LHGH 1TOCB 1KTSB 5BPEA 1BQYA 3V13A 1LHCH 5F8ZA 1GJBB 4AB9A 3K2UA 3JZ2B 2ZTZA 1YF4A 1M9UA 4E7RG 2F9BH 1DICA 3ENSB 2AIQA 1ELGA 1SQAA 2GKVE 1HAZB 5A8YA 2A7CA 3EGKH 2HLCA 3M36A 3VGCB 5JPMH 1QL7A 1OXGA 1V2VT 1O36A 3BN9A 3GY3A 4WH6A 1IQKA 4A5TS 2BY7X 3SI4H 3CP7A 1UK3A 2YNAA 2F9UA 3QWCH 4X8TH 4MPVA 2W3KA 1GI5A 2AERH 3LJJA 1GBDA 1GJ5H 1HYLA 3BIVH 1SGYE 1GI1A 3SNAA 4UFEH 2VWOA 5FHTA 1TX6A 2SGQE 3PTBA 5E0HA 4X6NA 4DOQA 5HYOA 1Q2WA 3F9EA 1J9CH 3SHCH 2A1DB 5FPTA 5LPFA 5E2PA 2C8WB 2FOHA 2BXUH 2QIQA 1NFYA 3BTDE 1CT2E 3PMHB 5A8XA 2BX3A 4DW2U 1BRAA 3TJVA 2VWLA 5GWZA 3A7VA 2QYIA 1UCYE 2J95A 4CRBA 4NCYA 1KDQB 1XUGA 4XE4A 2LPRA 3I77A 1GHWH 1TX8A 4Y0YE 2ALVA 1C5VA 1PQ5A 4GPGA 4UEHH 4ISIH 2PSXA 1EP5A 1MD8A 3UY9A 2VJ1A 3W94A 1FAXA 3DUXH 4U32A 2OTVA 3E1XB 1GJ9B 3S7KB 2Q6FA 1OWJA 1T7CA 3U98H 1GBFA 3F6UH 1S81A 1DX5M 2FLBH 1IOEA 1KTTB 2OXSA 1C2GA 1W3CA 1ZHMA 4KGAA 2PGBB 3GDUA 4O3UA 1W7GH 2ZO3H 1PPBH 1HIAA 3NWUA 2PGQB 1RIWB 1NT1A 1QB6A 2BY9X 3PB1E 1QJ1B 1AUTC 3BG8A 2VVCA 4NSVA 3RUOA 4GVUA 1RXPA 5CHAB 1NROH 3SU5A 3RXTA 1IQIA 1AN1E 5B6OA 2OQ5A 2Y6TA 1FPHH 1WTGH 3A80A 3A87A 1EZUC 1TONA 4K1TA 1EPTC 2ZHDA 4ABHA 3PLPA 3RXSA 1A0HB 1DS2E 4INKA 1K1LA 4NWKA 2G51A 1IQMA 1BITA 1C1UH 3STIA 3I78A 1HLTH 4WMDA 1AZZA 4XBDA 3OYPA 2B8OH 3A8AA 3KHVA 4XBBA 1S85A 4DJZB 1O5FH 3LH3A 3A7XA 2NU1E 1GMHG 1UK2A 4TYDA 2OINA 2G00A 4AFSA 3KQEA 1FY8E 1SGFG 1WYKA 1C2MA 5AFZH 1C5NH 4AFUA 1C9PA 2TGPZ 5E8EH 2FTLE 3QZRA 4UFGH 4A6LA 2M5TA 1CHOF 3U69H 3PMAB 4YT6H 2ZFFH 5HM2A 3FVFB 3SI3H 4AG2A 4LZ1H 2HGTH 1Z8JB 4KTUA 2EEKA 5DP4A 4K5ZA 3SQHE 2A4RA 1CU1A 1NFUA 3SJ8A 1CE5A 1C1PA 1NN6A 2VIWA 3C1KA 3PLKA 2PKAA 1ZRBA 5TCCA 3B23B 1UHBA 2OC8A 2PHBA 4NZLA 1BTZA 1V2NT 4Y7BA 4O9VA 2WPMS 4WWYA 6ESTA 3RXIA 2PTCE 2A0QB 1OOKB 3RU4E 5SGAE 1MU6B 3BTTE 2ANKH 4BANB 4INLA 2R2WU 4CR9A 2ZPQA 2HRVA 3V12A 1SGIB 1FIZA 1FNIA 4H4FA 2CMYA 2ZDLA 3BTEE 2VNTA 2QCYA 2VIDA 1TX7A 3MH7A 2XYAA 1OX1A 4Y7AA 3PO1C 2C8YB 5DG6A 2C93B 3ODFA 1XUIA 1P06A 1O2NA 2BLWA 1TGCA 3KN2A 2AGGX 1DUEA 2GCHG 4ABDA 3MYWA 1TBRH 3EA8A 5EW2H 3SV8A 5FPSA 2ANWA 4FUCA 4IW4E 4YM9A 2ALPA 3ZZ7A 1S83A 1EB2A 1S84A 4BXWA 1YCPM 5FPYA 2SNVA 4RN6A 2OCVB 3AW0A 3C27B 2ZWLH 1IQFA 2P59A 1BIOA 2O8UA 5AHGH 2Z6BD 1DLEA 3RP2A 1BMLA 1ELEE 5T6GA 1Y8TA 1YCPK 3URDA 1KIGH 2EA3A 1GBIA 2ZA5A 1P04A 1RTKA 3BV9B 3EA9A 1RTLA 4X8VH 1A46H 3GY5A 4X2VA 1GI9B 4ZKSU 1O3FA 4TWYA 5F8XA 1Y3VA 4ZKRU 4IC5A 1H4WA 1ETRH 1NFWA 2P8OC 1A0JA 1FN6A 2THFB 3MNBA 3RXBA 3ATKA 1TMTH 1CBWB 4R0IA 3A83A 9ESTA 4FU8A 3SU2A 1GBLA 1BMNH 1MKWK 1QFKH 2GCTB 2PUXB 1GCTB 4K8BA 1P2IA 1OWIA 1EPTA 1TA2A 1N1LA 1BMMH 3A86A 3T62A