1KXFA

Sindbis virus capsid, (wild-type) residues 1-264, tetragonal crystal form (form ii)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
159
structure length
159
Chain Sequence
MALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein
total genus 34
structure length 159
sequence length 159
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxfA01
2C8ZB 3QTOH 1V2KT 1TBQH 2ZTYA 4TYDA 1C5QA 1UK3A 3STJA 2STBE 2GCHG 2HGTH 5K0HA 3KQCA 2BDIA 1THPB 2G81E 3TNTA 4D76A 3MH5A 5EQRA 1NFXA 4AB8A 1O5FH 1LQEA 2Y5GA 2ZG0H 1RD3B 1FY8E 3BEUA 5DK1A 1VJAU 3BTTE 2YOLA 3T25A 8GCHF 3QZRA 1IQNA 4A7IB 1ESTA 1C5WB 1OPHB 2XBYA 3MU8A 3SV6A 1YPHE 1O2JA 5F03A 1EATA 3P6ZB 2AS9A 3K6ZA 1KLIH 4WMFA 1CHOF 1O37A 1SFQB 3KQBA 4ABEA 3VGCC 2SGDE 1BMNH 1TX8A 4BXWA 4F4OC 1CQQA 2BZ6H 2NU4E 4AGJA 1ZJDA 2VVCA 2GGVB 5E0JA 3SV8A 4AFUA 1SGEE 3ZVAA 2NU0E 3LH1A 4IC5A 2V3OH 1Z1IA 3DD2H 2ZWLH 3K9XB 1NS3A 3D65E 2CV3A 3PTBA 2AERH 4WXVA 5HM2A 3RMNH 4CHAB 1BRAA 1T4VH 4Y8ZA 2W3KA 3SJ9A 3A84A 3RXQA 5AF9H 1Y3WA 2FEQH 1DPOA 5ETXA 3AW1A 2VWNA 1KTTB 1SR5C 1TX6A 2B9LA 3M7UA 1HAIH 3ZZ9A 3SHAH 1Z6JH 2WPJS 2FO9A 1SQAA 1A2CH 5TCCA 1SGTA 2B8OH 2C4FH 5EW2H 5DG6A 3T5FH 3E1XB 3Q00A 1C1PA 9LPRA 3SO3A 5E0HA 3A88A 3FAOA 1ZSJA 4IW4E 1BMLA 1Y5BT 1O2ZA 1SGYE 2Z9LA 5L2ZH 1SQTA 1MTUA 1TNGA 2BDYA 1G2LA 1C1SA 4MQAA 5TJXA 1YC0A 3GYMA 2ODQA 3A87A 1O3GA 1LO6A 1LTOA 1YCPK 8LPRA 1SL3A 1H9LB 1SLUB 3FP8E 3RXGA 1GBTA 3N7OA 4U2WA 5E2OA 4FUJA 2W5EA 3UQVA 1OX1A 1TIOA 2BD4A 5DP8A 3BG4C 3MOCA 2HPQH 2RA3A 4ABAA 4MPUA 3LKWA 2C93B 1L0ZA 3VEQB 3BSQA 3SN8A 1NZQH 3VPKA 3PO1C 1P0SH 2AGEX 1A5GH 1ANEA 4FU8A 2FPZA 1Q3XA 4XFQA 1GBJA 4D9RA 3LH3A 2QC2A 4CRBA 3UOUA 1GI5A 1DY8A 1DSTA 3GCTG 1Y59T 3ATIA 3IG6B 3SGAE 1EASA 1SLWB 2WYGA 1GJBB 4O97A 4QT8C 3BTKE 4BANB 2Z3EA 1MTNC 3M5LA 1GBFA 1HAOH 1PPCE 1QNJA 4Z6AH 1IQMA 3FP6E 3H7TA 1EZSC 3GICB 2QXIA 2DUCA 3A7XA 3QN7A 4KTCA 5C67A 2UUYA 1JRTA 1RS0A 1IQHA 4RKOB 2FWWA 1XKBC 1GGDB 4WWYA 1OWKA 3SU4A 1UTLM 2VGCB 1C2JA 1HAXB 1HAYB 2STAE 2WPLS 3KHVA 4AORA 1FDPA 1IQFA 1W10U 2C8WB 4NSYA 2AIPA 1UVTH 2JH5D 5EOKA 4UD9H 1EPTA 5DGJA 1ZMNA 1CA0C 1C2LA 1PPHE 2DE9A 3Q76A 5EG4A 1HUTH 2ZHEH 2F9OA 2Z7FE 1CBWB 2FOAA 5GDSH 2XBVA 2SNVA 3URDA 2ZHFH 1AHTH 1OWHA 3KGPA 2WPHS 1ANCA 2AGGX 3U69H 3Q3KA 2XC5A 2QGRA 4GLYA 1P02A 1EAWA 3BF6H 4XOJA 1ANDA 1C5YB 1UCYH 1O5EH 3RXEA 4GCHG 1ABJH 3UTUH 3A82A 2PW8H 4X2YA 3PM3A 6CHAB 4ZXYH 4JZ1A 5JB8S 1O2WA 4CRGA 1TMUH 2SGPE 2J38A 2NU1E 2DE8A 2FS9A 1ZHMA 1BIOA 1DITH 4B2BA 3UQOA 4B71A 1GJ5H 4I8JA 1QBOA 1MU6B 4I31A 2A4QA 2GMTB 1C5VA 4FUIA 5DJ7A 4FXGH 2FOHA 2Y80A 1E38B 1VR1H 2J95A 1DX5M 1ETRH 4ZUHA 2XXLA 1V3XA 1HPGA 1DM4B 1PPFE 3HKIB 1SHYA 1BTXA 2VIQA 2ZU1A 3MNSA 3AVZA 3FZZA 3E0PB 4VGCC 4AZ2B 5TCAA 1GI3A 2H9TH 3EAJA 1MD8A 3U1JB 1O3OA 2Q1JA 3VB6A 2GZ8A 1F0SA 4MTBA 1LHDH 1NU7B 1GHAG 4H6SB 4ABFA 1DS2E 1G9IE 4ZKOU 1TPSA 3LDXH 1FAXA 3RC6A 1TRMA 3M3SA 1TOMH 2RA0A 5AVDA 3PLBA 4D7FA 1CGJE 1K1NA 5F8XA 2ZTZA 1C5OH 3SNBA 1TE0A 2PTNA 2BB4A 2THFB 3LGWA 2VU8E 4XBBA 1GWAA 2FOBA 1SI5H 1BJUA 1GBEA 3W94A 1XUIA 1O2YA 4Q80A 3HATH 1RTLA 3P8GA 3PLPA 4AX9H 3QK1A 2W7SA 3A7VA 1EOJA 3MWIU 1MBMA 3KQDA 5GJ4B 4FVDA 2ESTE 2BD8A 1A5IA 1C1RA 3D23A 1QB1A 1OWDA 2HLCA 2H1UA 4D8NA 1FY4A 4JK5A 1QTFA 1XUKA 1O5DH 2ANYA 1HAPH 2AIQA 3HGPA 1S0QA 1THRH 1A1RA 1SGFA 5F8ZA 3GY4A 3VB5A 1W0YH 3RXKA 5SGAE 2GKVE 1V2JT 3G01A 1YPLH 2Y82A 2PKSC 1P57B 3D62A 1YKTA 1OP2A 2ZHDA 3LGIA 4Z0KA 2QIQA 4X6OA 2FOMB 5E2PA 1BRCE 1LVYA 1ETSH 3LOXA 3UNQA 1V2MT 1XMNB 3LC5A 1BZXE 4WF8A 4AB9A 2ZFFH 1HJAC 2A4RA 1S84A 2ZQ2A 3E8LA 1A4WH 1NN6A 2BZAA 1BHXB 3RXDA 1FPCH 1P2QA 3M37A 3RM2H 2H2ZA 5CHAB 1ZGIA 3U8RH 1VCQA 2PSXA 1EB1H 1P8VC 2FI5E 3T28A 2Y5FA 1D3QB 3E16B 3RXRA 3T62A 1YPEH 4H42U 1C5LH 3V12A 1MQ5A 2VINA 5C1XA 1D9IA 3RXVA 3MFJA 4K8YA 1P06A 4CBNA 3TJVA 2XNIA 2F9VA 1MBQA 3ATMA 3RXJA 2PHBA 3EQ0H 4Y8XA 3SU6A 1UTMA 5DP9A 4WJG2 1PQ5A 1J16A 2GT7A 1WUNH 4H6TA 1P12E 2VB0A 4K1TA 3QTVH 4NFEA 2UUFB 3UNRA 2ILNA 2F3CE 1JOUB 2HNTE 4D7GA 4Y76A 1FY5A 4DY7B 1TGSZ 2JKHA 2R0LA 1LVMA 5AHGH 1O3HA 1ZPBA 3E91A 1NRNH 1SGDE 2XCFA 3S9AA 2ZDAH 3UR9A 3QUMP 1A0HB 3LONA 1GGDC 1WOFA 2V3HH 4NWLA 2YNAA 3UUZA 2VGCC 1QA7A 1LDTT 3STIA 2B5TB 4Y0ZE 3LGYA 2Y81A 3A8DA 1DLEA 1C1QA 3V3MA 4WXIA 1WQVH 3BV9B 2ALVA 1O2OA 1S82A 4E06H 4NCYA 1CSOE 2V0BA 5DKMA 5DP3A 4CH8B 4JZIA 1J15A 4ZMAH 1UK4A 2VWLA 1CBWC 1OOKB 4NA8A 3SJKA 1H8IH 5LGOA 3LU9B 3RMLH 1SQOA 2BX3A 3GY7A 1M9UA 5DP7A 1S0RA 3A7ZA 1Y8TA 2OBQA 1CA8B 3UWIA 4ABJA 2ZU5A 1O2RA 4UFFH 3TGIE 1O2XA 1Y5UT 6CHAC 2GV7A 1O5AB 1B7XB 2A45B 3A7TA 2G51A 4MNYA 2AFQB 4O03A 3VXFH 1OSSA 9ESTA 2SGEE 3PMHB 1P3EA 1SLXB 2XYAA 2BVXH 3RXFA 1AVXA 1QBVH 1TNHA 2QAAA 2BDHA 4MNVA 1KXDA 1C2EA 4NIYA 1ABIH 2O8UA 2GMTC 1W13U 1S83A 2ZDMA 2QA9E 4INLA 3A89A 1W8BH 1YBWA 1O31A 1CHGA 2ZCKP 1H9IE 1QFKH 1LPGB 4X8SH 1ELGA 5E8EH 1EJAA 1ETTH 1PQ8A 1VGCC 1YF4A 1MZDA 1SMFE 2CXVA 1HGTH 3BN9A 3TJUA 1PJPA 1OXGA 2G5NA 1PFXC 1LHEH 2IN2A 3BIVH 5T6FA 3ZZ5A 3TK5A 1YLCA 3MU4A 3GY6A 3SNCA 3SU2A 5LPRA 2Z3CA 1QIXB 1EAXA 1UTKA 3TJOA 1P01A 2ZC9H 4GUXA 1C1OA 1HJ9A 2FDAA 1GBLA 4CH2B 1C2DA 4J1YA 5DP5A 3KEEA 1HAVB 3LPRA 4CRDA 2ZFRH 1G3CA 1HXEH 3SGQE 2BLOA 1AFQB 3ZZ7A 4MPVA 4CREA 1Z7KA 5EXMA 4DURA 1K1MA 2A4GA 1BMAA 2XWBI 1Y3XA 3U9AH 2BX4A 3AAUA 1ZZZA 2WV4A 2QF3A 3RC4A 1GL1A 2BQWB 2I6SA 1SLVB 1QBNA 2J2UA 2GCTB 1C1VH 4B76A 1MKXK 1O2IA 5FPTA 1O30A 4UFDH 1O33A 1RTKA 2BDAA 2OXSA 4XBCA 1ARBA 2JH6D 2A0QB 1YYY1 1AY6H 2R0KA 1GMHF 3OX7U 4NZLA 1D6RA 2UWPA 2ZQ1A 1A61H 3U8OH 3SNDA 2Z6BD 1WV7H 3S7HB 1ELDE 1CHOG 1QB6A 1LKBA 1J14A 1L1JA 1C1UH 1UVPA 1C1TA 1VITF 3GY2A 1O2VA 1U6QA 2ZKSA 2EI7A 4YO9A 3KQEA 5A0BA 5L2YH 1HLTH 4U01A 5HXFA 5GXPA 3DFJA 2F9BH 4HFPB 4E05H 1NRRH 1OKXA 1KDQB 3PLKA 3UR6A 2Q6DA 5EXNA 1P2JA 3ENSB 4X2XA 2UWLA 3S69A 4YZUA 1ZRKA 1A5HA 2PR3A 1BTPA 2ZU3A 1MTVA 3TLOA 5CHAC 1UO6A 1H8DH 1JMOH 3RLYH 2O9QA 3LIWA 2P8OB 2ZGCA 3PYHA 1DWCH 3OSYA 1BRUP 3DA9B 2RCEA 4DW2U 1TBRH 1FY1A 1C2HA 1P09A 4DGJA 4B73A 1C4U2 2AEIH 2ZFQH 1OYQA 4KELA 1SBWA 1Q31A 1V2NT 3K6YA 1BTWA 1YPKH 1W11U 2F9NA 2Y7XA 2VH6A 1WQSA 1QCPA 4XDEA 1V2ST 2FM2A 2V6NA 3M35A 3ZVCA 2FXRA 1V2WT 2FP7B 7GCHF 3PMAB 4ZHMU 1GBAA 4IGDA 1O32A 1W3CA 5J4SA 2GZ9A 2HNTC 3VB4A 1BHXF 2QF0A 1AN1E 3MU1A 1F7ZA 4NG9H 5EQSA 1ZOMA 1A3BH 1T8LA 1C2FA 4INHA 2ZPRA 1ZPCA 1AU8A 2PLXA 1D4PB 1GJDB 2GDEH 1BA8B 4D9QA 2VIDA 1GI7B 1XXFA 4SGBE 3RXHA 2BMGB 1ZLRA 4ZH8A 1MKWH 2TRMA 1SFIA 3S9BA 2J34A 1C5PA 1P04A 1Z71A 3L6PA 4ZXXH 1C2MA 3V13A 1AUJA 3ATWA 4IMQA 4X1NU 5C5NA 1ELFA 2G00A 1GJ7B 2PV9B 2QY0B 1WTGH 1AVGH 3IITA 1FLEE 1QURH 3RM0H 1Z6EA 2HNTF 1XUJA 3RP2A 1FIZA 3CENA 1BBRK 1GJ6A 2R3YA 2A2QH 1UHBB 3RXUA 3A7YA 4H4FA 2SFAA 1F2SE 2WYJA 3Q77A 1HDTH 2Z3DA 1KTSB 2ZPSA 2R9PA 1O3IA 1UTQA 2ZPQA 5DP4A 1DWEH 2O8MA 1PQ7A 1EKBB 3RC5A 1GVZA 1V2RT 5G4BA 3W95A 1Z1JA 4MG3A 1TLDA 2Y5HA 2P16A 3M3TA 4AN7A 2RG3A 4OGXA 2Z9JA 2H9HA 2P3FH 2B7DH 1QRWA 1XKAC 4ZHAA 3TVJB 5JPMH 1O2GH 2AGIX 1A0LA 1YPJH 1XVMA 4JZFH 1XUHA 1O35A 3TITA 1F92A 1C5NH 4X8TH 4AG2A 1EPTC 2BM2A 2FMJA 3ZZ3A 1GHZA 4Y79A 2BTCE 3P92A 3RU4T 2VVVA 4X1QU 1T7CA 1ID5H 1MTWA 1GG6C 3F9EA 3TU7H 4X6MA 2ZGHA 1W7GH 5H4IB 4B2AA 3SV7A 3S0NA 1QA0A 1SGPE 1T4UH 1OWEA 1O38A 2ZGJA 2R2MB 1GHYH 1V2PT 4CR9A 5GWZA 1AQ7A 4OS5A 1BQYA 2BVRH 1TNKA 2CHAB 4M7GA 4CRAA 1WBGB 1MAXA 4GPGA 2JETC 4UDWH 2GVFA 1HAVA 1AFQC 2A4OA 2KAIB 5ABWA 3HGNA 3MHWU 3EGKH 1KY9A 4O3TA 1FJSA 1TGBA 4TY7A 4DOQA 4DVAU 1TPOA 1GI2A 4Y8YA 2BOHB 2ZHWH 3MO6A 4I8HA 3ZVGA 2OP9A 1T8NA 4I8GA 1QJ7B 2ZDLA 1FMGA 1FV9A 4JYUH 1V2LT 2C8YB 2ZDKA 2IPHA 2GCTC 2ZIQH 3RXBA 4YOGA 1GDQA 3IWMA 3CS0A 3CP7A 5AFZH 1HAHH 1W12U 4F49A 8ESTE 5FPSA 3O8RA 1G3BA 1TNJA 1V2TT 1P2OA 4RSPA 1HBTH 1OWIA 1VCWA 1O39A 3QDZB 3M7TA 3T27A 5C1YA 3SJOA 3T2NA 1CE5A 4BAQB 1IAUA 2XRCA 1SB1H 3LJJA 3RXIA 2OC1A 5JBTA 1ELEE 5FX6A 1B0EA 8KME2 1S6HA 1K1IA 3MNCA 1QB9A 1FN6A 3VB7A 5T3HA 4IC6A 1D3DB 2C90B 7LPRA 1Z8GA 1YLDA 3RXAA 1TRNA 3PTNA 4Y7AA 5PTPA 4Q7ZA 3KIDU 4X1SU 1KDQA 3B23B 3ZYDA 1NPMA 1P11E 3UNSA 1GCDA 1YPHC 3F68H 1EUFA 3ZZ4A 2QXHA 2FYQA 3E3TA 1S5SA 3VFEA 4CR5A 2O8WA 1H1BA 1S81A 3SZNA 1HRTH 2ZDNA 1L4ZA 2BY7X 4DIIH 2P8OC 2OLGA 1MAYA 1W0ZU 4BNRA 1TGNA 1A46H 1FNIA 1QJ1B 2BDBA 2A31A 5FPYA 1RJXB 2CF8H 1MZAA 1MCTA 1V2VT 2BDGA 1GVLA 3OY6U 2G52A 1T8OA 2ZTXA 3EA7A 2FI3E 4YM9A 3RXLA 4FUEA 1NY22 5JYIA 3F9HA 1GHAF 4CHAC 4BOHA 1C2IA 1XUGA 1DANH 3A85A 2H9EH 4XBDA 2WPIS 4IS5A 1FONA 2ALPA 1OYTH 4GHTA 2FLRH 2GX4A 4MVNA 4FUDA 2D2DA 3RLWH 1ZTJA 3DFLA 3K2UA 3NCLA 1TPAE 3ATKA 1T32A 1SGQE 1DWBH 2ZGBH 2QXGA 2ZO3H 3TH3H 1P2MA 1QRXA 1SGRE 1TA2A 2ZHQH 4KTUA 1GHBG 1N6YA 1HAGE 2RDLA 3V7TA 1SOZA 1SGFG 1AVWA 1PQAA 1F5LA 1VJ9U 1UK2A 1WAYB 3P8NA 4DJZB 1O3KA 5J4QA 2A1DB 3T26A 2FLBH 2GV6A 3HKJB 2EI6A 2CJIA 3PWBA 2J9NA 1OWJA 2HWLB 2VWMA 1TNLA 1J8AA 1T31A 2WPKS 1LMWB 1LKAA 3NZIA 4DT7B 5A8YA 3SU1A 2W3IA 3TPIZ 2EEKA 3GCNA 4X6PA 1XUFA 2OBOA 1P9UA 1YCPH 4ZKNU 2BY6X 4UFEH 2QXJA 1GJ4H 2F83A 3ZVBA 2Q6FA 2G55A 1AMHA 5DO4H 5A0CA 4I33A 4A1XA 1EJNA 3MH7A 5FXLA 1AGJA 1TGTA 4NWKA 4ABHA 4WH6A 1NFUA 1QQUA 2ZZUH 1UHBA 3M5OA 3SV9A 1C1NA 1C4V2 4R0IA 1DUEA 3NK8A 2BD5A 3GY5A 3SQEE 1FPHH 3OY5U 3QO6A 1Q2WA 3P70B 1GHWH 1GBDA 1ZGVA 3I29A 4I7YH 2Z9KA 3R0FA 1TBZH 2UWOA 3H7OA 2ZDVH 4TPIZ 1L1NA 3A8BA 1L1GA 1LVOA 4NZQA 1Z8IB 3TGJE 1Z8JB 3MU0A 2VH0A 1RGQA 1KXBA 1HYLA 1QJ6B 3B9FH 3MO3A 1LHGH 3M61U 2FYRA 4X8UH 4OS7A 1PPEE 3AW0A 3MU5A 1PYTD 1KSNA 5LPEA 4NA7A 1NFWA 1DFPA 2A32A 5CE1A 3QLPH 1ZSLA 4Y11E 1K2I1 1TOCB 2HPPH 3RUOA 4A1TA 1TQ7B 3DHKH 1FIWA 2XW9A 1RXPA 2BLQA 1EOLA 1C5XB 3I78A 4XE4A 3ODDA 4WMDA 3BTGE 1BJVA 1G36A 2PSYA 1LPZB 2FODA 5F6MA 1O2HA 3BTDE 2AYWA 1UVSH 4WMEA 2NWNA 3A7WA 4MLFB 1ZHRA 3M5MA 2G4TA 4R8TB 2BYAX 1UJ1A 1C4Y2 3NWUA 5GIBA 1LVBA 4Q7YA 1GMCG 1MQ6A 4HI3A 4X2VA 2ZCHP 2KAIA 2BXTH 1C5RA 1K22H 1SSXA 3I77A 2D1JA 2IJOB 3E6PH 3P17H 3ZZDA 4AFSA 6GCHF 1Z8RA 3BG4B 1A3EH 2IOTA 1YM0A 2F91A 3TH4H 3GCHB 2QN5T 1C5MD 5JBAS 1SVPA 1EJMA 1N6XA 3C27B 3ODFA 2P3TB 1WYKA 1HCGA 1JXPA 4HZHA 3F6UH 2OD3B 1GI8B 1N8OB 4FUBA 1ARCA 3SU3A 3TGKE 4X8VH 3RU4E 1T8MA 3JZ2B 3RMOH 2EC9H 1QRZA 3S9CA 1MTNB 1QR3E 1VITH 3OTJE 5C5OA 1G2MA 3BEIB 1SC8U 3F9GA 4AGKA 7KMEH 3UREA 1O5CB 1KLTA 5LH8A 1P2KA 2Y7ZA 3M5NA 2OC7A 1HNEE 2BLVA 1AZ8A 2ZA5A 4GAWA 4BAHB 1NC6A 4B1TA 2BD2A 1PPZA 2PGBB 1YP9A 1WCZA 2BXUH 2LPRA 3LC3A 4MPXA 1NO9H 4ZKSU 4FU9A 4U32A 4MDSA 2BVSH 1SOTA 4ABDA 4FUGA 4JYTA 1NESE 3QX5H 1GBBA 1HFDA 4TWWA 2UUKB 1K1LA 4YOJA 4ISOA 3F9FA 4JYVH 4NIXA 3SORA 3LGUA 1THSH 2TGPZ 1AFEH 5A2MH 3RXTA 5EODA 1UCYK 3BEFB 1MH0A 2VIVA 3BG8A 4PROA 1F0RA 2SNWA 2ZECA 1FAKH 4XSKU 1AB9B 1D3TB 2OC8A 1AI8H 1NROH 1CT4E 2BLWA 1IQGA 4LXBH 1NRPH 1L4DA 1O2PA 2CF9H 1ZTKA 1VITG 4AOQA 2SGFE 2A5AA 1D3PB 3UIRA 8GCHG 3O8CA 1N1LA 1ZRBA 3SV2H 1DXWA 1UTNA 1O2UA 1CO7E 1O3AA 1ZJKA 3A81A 1GJ8B 3LT3A 3SU0A 2XC4A 1Y5AT 5JDUB 1G37A 3PWCA 4JZEH 1GL0E 1DXPA 1ANBA 2ZF0H 4OS1A 1O3BA 1AD8H 1P03A 4K1EA 5AFYH 3GISB 2NU2E 3H5CB 3QGJA 3SJ8A 2VIOA 1CVWH 1BTYA 1CGHA 2OC0A 1ESBA 1RRKA 1GMDF 1K9OE 1SHHB 1EXFA 1IQLA 3DT0H 3FP7E 3MH4A 3A86A 1SGNE 4VGCB 5GCHF 1QY6A 4K8BA 1BDAA 1P05A 1DT2A 2FOFA 2TGAA 1IQJA 3BTHE 4Q7XA 4IN1A 3E0NB 1RTFB 4Y71A 1O3DA 1G32B 1O3MA 2EI8A 2GTBA 3RXSA 2OINA 2GCHF 4Q2KA 7GCHG 1HJ8A 1EB2A 1KXCA 1EAUA 4WY3A 3SUDA 1E0FD 1EZQA 3UY9A 4HTCH 1MTSA 2BY9X 2FTLE 5E0GA 1GI0A 1KXEA 1MU8B 3BIUH 5C3NA 3BTEE 1NRSH 2P93A 1P2IA 1TYNA 1BITA 1SPJA 3ZV8A 2WUBA 1XVOA 1E34B 1TA6A 3AAVA 1TFXA 2HALA 2FX4A 4NFFA 1GI6A 1QQ4A 1CT0E 1OP8A 1BUIA 1F0UA 1TWXB 1AUTC 3B8JA 3GYLB 1LPKB 2Z9IA 3ZV9A 4KKDA 2VJ1A 1DY9A 4LOYH 3PV4A 4U30A 4X2WA 4DCDA 4SGAE 2R2WU 3SBKA 1BT7A 4GVUA 1Y3VA 3RMMH 4AFQA 2W26A 2PUXB 1Y3UA 3P8FA 1C9TA 1GDUA 5EQQA 2BY5X 4OGYA 1ZTLA 4MNWA 1AIXH 1ESAA 1HB0B 4ZAEA 1J17T 1B5GH 2P94A 4AYVB 2VIPA 1KLJH 3MNXA 5FX5A 4O3UA 3KCGH 1F0TA 1GI1A 5A09A 2XC0A 1A7SA 3P95A 4FVBA 4GHQA 5I46H 1O5BB 2M5TA 3PMBB 1AWFH 2ANKH 4TY6A 2O8TA 2PKSB 1C5ZB 4THNH 5FBIA 3E90B 2CN0H 2Y6TA 5DP6A 1EQ9A 2ZP0H 4YT7H 5FCKA 2HRVA 1ELTA 1HJAB 1KXFA 1HIAB 3VXEH 1XX9A 4BAOB 1AZZA 1K1PA 2J94A 5F8TA 4MPWA 3OYPA 2GDDA 3URCA 1BTZA 2A7HA 3FFGA 1FXYA 3LGVA 1K1JA 1UVOA 2J4IA 1O2KA 5FBEA 2XTTB 2ZU4A 1IQEA 1O2LA 2ZCLP 3D49H 1GVKB 1VCPA 2VVUA 5FAHA 2A2XH 1IOEA 1C2GA 1H4WA 1CT2E 4GSOA 4JMYA 3ZVFA 4E7NA 1BB0B 1ZR0A 1G30B 1BCUH 3RXMA 2ZGXH 1YPMH 2XWAA 6LPRA 3GCHC 1GBIA 2HOBA 3MTYA 1TMBH 3SNAA 5JBCS 1O2QA 6ESTA 4IMZA 4A5TS 2LNCA 3PROA 2G5VA 1E36B 3SHCH 3Q3YA 1SG8B 4LZ4B 5EW1H 1DSUA 1TALA 4K2YA 2Q6GA 1N8OC 3TK9A 2B0FA 1BOQA 5EPNA 3KNXA 3TIUA 1AKSB 3RXPA 1JRSA 4K1SA 2K1QA 3O8DA 1EZXC 1O2TA 2ZEBA 1LHFH 4YOIA 3M3VA 1IQIA 1K21H 1VZQH 3KF2A 1GBHA 5C2ZA 3ZZCA 2V35A 1ZMJA 3EYDA 1BBRE 2I6QA 1XM1A 1TRYA 4ASHA 1EP6A 1C1WH 1OS8A 1TPPA 3QWCH 3SGBE 3GCTF 3SJIA 3SNEA 1PPBH 3GDUA 3FZDA 2OQ5A 3L3TA 3U98H 4I8LA 2PWXA 1WU1A 2G8TA 5JBBS 2WPMS 1NU9A 1O0DH 1KXAA 2BHGA 3ZZAA 4JK6A 2C8XB 2EA3A 2FTMA 1PYTC 4FUHA 1IQKA 4UE7H 4NIWA 1BRBE 2BDCA 2HVXA 1C1MA 4X1RU 1GBMA 3EE0B 1AB9C 5DPAA 2OCVB 1UTPA 1ELCA 4KP0A 1DUAA 1RIWB 3S7KB 2WV5A 1YGCH 1O3LA 5K7RA 2F9PA 3SI3H 3BTQE 3M36A 1QL8A 1FUJA 2PGQB 4NSVA 1O3CA 1TMTH 4TWYA 1BMMH 5A8ZA 2ZU2A 2H5CA 1PPGE 2AMQA 2OQUA 3U8TH 4ZHLU 1B0FA 2ANWA 1MKXH 2OTVA 4CBOA 1QGFA 3C1KA 1O3PB 3NPSA 4CRFA 1F5RA 1GHVH 1GPZA 1XXDA 1C5TA 2TGTA 4KTSA 1FI8A 4UFGH 1E35B 1W7XH 4GCHF 3VB3A 1KYNA 4YLQH 1BTUA 2ANMH 1GJ9B 2VWOA 3RDZA 3LGTA 1G3DA 1L2EA 1UVUH 5C1UA 2UUJB 2AMDA 1J9CH 3ZVEA 3OU0A 3RXOA 1O3NA 4FUFA 4WVPE 1VGCB 3PB1E 2QCYA 4ISHH 4INKA 3U1IB 1DLKB 4RN6A 4ABGA 3GOVB 2PKAB 2TPIZ 4MNXA 3KL6A 2FOGA 3O8BA 4NGAH 4FU7A 2TGDA 1C9PA 2GP9B 1ELAA 2D26C 2A5KA 4BAMB 1P10A 1X7AC 2TIOA 5IDKA 1CGIE 1LCYA 1GJAB 4NA9H 3P8OA 2VNTA 5I25A 2GZ7A 2FI4E 3SUGA 4DIHH 1MUEB 3QGNB 2BD9A 1EX3A 3UWJH 2OUAA 3M7QA 3SU5A 4AYYB 1O2NA 1G3EA 4DG4A 3MO9A 4Y0YE 2D8WA 5A0AE 3BTME 7ESTE 5EPYA 2ZFTA 1V2QT 3ZZ6A 1A0JA 3HK6B 4WH8A 5LPFA 5HYOA 2FIRH 4NIVA 4E7RG 5HM9A 1GCTB 4O9VA 1K28D 3MNBA 5FHTA 1FZZA 2FS8A 2R3UA 3GDVA 4K3JA 3EDXB 3BTFE 3LJOA 4Y6DA 3TJNA 3GCOA 2A5IA 1MMJN 1D6WA 4Y10E 1AWHB 1O36A 1DVAH 4RKJB 2FZZA 1JIMA 1LHCH 2JH0D 1IHSH 4K60A 1GBCA 4UONA 3KN2A 4ISNA 3SI4H 2Z9GA 3T29A 1EP5A 5L30H 1FN8A 1KIGH 2P3UB 3GDSA 2P95A 3SW2B 3FANA 5A8XA 1OP0A 3BTWE 1W14U 1HIAA 1NRQH 4K69A 5EXLA 1C5UA 3EA9A 5EGMA 5EU8A 4UEHH 1O34A 2CGAA 4OS2A 2QYIA 3VGCB 1SGIB 1O2SA 3RU4D 1GBKA 2BQ7B 4JZDH 2O8LA 1AE5A 2ZNKH 3A8AA 4FUCA 1GHBF 1QL9A 1AO5A 5BPEA 3FVFB 4J2YB 4I8KA 4YTAA 2BY8X 2GT8A 3MH6A 1CU1A 4X1PU 3ZYEA 2ASUB 5C20A 4ISIH 3L33A 5GPIB 4BAKB 1UMAH 3MYWA 1BBRH 2XCNA 4B2CA 4YT6H 1ZSKA 2BD3A 1GI4A 2AMPA 4BXSA 5JB9S 1GDNA 3RXCA 1NT1A 3SUFA 3NXPA 2W7UA 1DOJA 1INCA 2SGQE 1AKSA 2ZI2H 1ELVA 3SUEA 2H6MA 5ESTE 3TK6A 1ZMLA 4OS4A 4LZ1H 3MMGA 5T6GA 4A92A 5FCRA 1JIRA 3TH2H 3A83A 2TBSA 1MKWK 2Z94A 3HK3B 1TGCA 2BOKA 4HGCA 4B75A 6GCHG 3EA8A 1F5KU 2C3SA 1O3EA 4BTUB 1K1OA 3QZQA 1DDJA 4OS6A 2ZFPH 1TX7A 2FESH 4JCNA 2ODPA 1QHRB 3WY8A 3ZVDA 2GD4B 3NUMA 3GY8A 1EAIA 2BQ6B 3V0XA 3F1SB 1RFNA 2CHAC 2WUCA 1H9HE 1V6DA 3AASA 4Y7BA 2FOEA 3ZZ8A 4K5ZA 2A7JA 1HV7A 3A8CA 1DICA 3CS7A 4X0WU 1W2KH 2G4UA 3PMJA 4AFZA 2ODYB 1P2NA 4LK4A 1RIWC 5IYTA 1DE7H 1NTPA 1P3CA 1TABE 2BD7A 3MI4A 2PUQH 3PO1B 4IBLH 4YLUA 3Q3XA 1FQ3A 1UTOA 2AH4X 2PTCE 2CMYA 4CRCA 2VIWA 2FOCA 5L6NH 5HGGA 1O3JA 3UFAA 1GI9B 2QV1A 1EZUC 5BRRE 4A1VA 1ELBA 1TB6H 2J92A 3TNSA 2FX6A 1GJCB 4ABBA 3K65B 5CMXH 1E37B 3ZZBA 4BTIB 4BTTB 1JBUH 1LQDB 1YCPM 3HPTB 1MD7A 3ATLA 1GMCF 4ISLA 1TAWA 3SOSA 1WSSH 2NU3E 5HMAA 3ITIA 1MCVA 1P9SA 1NM6A 4I32A 5T6DA 1DWDH 1WTHD 3UPEA 4YESB 1S85A 2A7CA 4AG1A 2PFEA 1EPTB 1TQ0B 3DUXH 1S6FA 3UOPA 2PKAA 1CA0B 2H5DA 2ZFSA 5B6OA 1V2UT 1V2OT 4A6LA 2XBWA 4B74A 1GG6B 1Y3YA 1GHXH 1O5GH 1ZPZA 1GMHG 5ESBA 1C2KA 3SQHE 1IHTH 1BTHH 1O3FA 2YNBA 1HAZB 1ACBE 4ESTE 1ORFA 4X6NA 3R3GB 4ZKRU 1UTJA 3GY3A 1NFYA 2ULLA 1FY3A 4TPYA 2WINI 1SGCA 3ELAH 2JETB 4ZROA 1GMDG 4KGAA 1O2MA 3NKKA 2P59A 3A80A 3JZ1B 3ESTA 2F9UA 5GCHG 1YPGH 4ABIA 2SGAA 1ZYOA 1HXFH 4IN2A 1TNIA 2XBXA 1C5SA 1ZHPA 1GCTC 1JWTA 1TONA 1AE8H 1QL7A 1UCYE
chains in the Genus database with same CATH superfamily
2C8ZB 2JDID 3QTOH 1V2KT 1TBQH 2ZTYA 4TYDA 1C5QA 1UK3A 3STJA 2STBE 2GCHG 2HGTH 5K0HA 3KQCA 2BDIA 1THPB 2G81E 3TNTA 2KR7A 4D76A 3MH5A 5EQRA 3WWFA 1NFXA 4AB8A 1O5FH 1LQEA 2Y5GA 2ZG0H 1RD3B 4RT1A 1FY8E 3BEUA 5DK1A 1VJAU 3BTTE 2YOLA 3T25A 8GCHF 2F43B 3QZRA 5KECA 1IQNA 4A7IB 1ESTA 1C5WB 1OPHB 2XBYA 3MU8A 3SV6A 1YPHE 1O2JA 5F03A 1EATA 3P6ZB 2AS9A 3K6ZA 1KLIH 4WMFA 1CHOF 1O37A 1SFQB 3KQBA 4ABEA 3VGCC 2SGDE 1BMNH 1TX8A 4BXWA 4F4OC 1CQQA 2BZ6H 2NU4E 4AGJA 1ZJDA 2VVCA 2GGVB 5E0JA 3SV8A 4AFUA 1SGEE 3ZVAA 2NU0E 3LH1A 4IC5A 2V3OH 1Z1IA 3DD2H 2ZWLH 3K9XB 1NS3A 3D65E 2CV3A 3PTBA 2AERH 4WXVA 5HM2A 3RMNH 4CHAB 1BRAA 1T4VH 4Y8ZA 2W3KA 3SJ9A 3A84A 3RXQA 5AF9H 1Y3WA 2FEQH 1DPOA 5ETXA 3AW1A 2VWNA 1KTTB 1SR5C 1TX6A 2B9LA 3M7UA 1HAIH 4B6EA 3ZZ9A 3SHAH 1Z6JH 2WPJS 2FO9A 1SQAA 1A2CH 5TCCA 1SGTA 2B8OH 2C4FH 5EW2H 5DG6A 3T5FH 3E1XB 3Q00A 1C1PA 9LPRA 3SO3A 5E0HA 3A88A 3FAOA 1ZSJA 4IW4E 1BMLA 1Y5BT 1O2ZA 1SGYE 2Z9LA 5L2ZH 1SQTA 1MTUA 1TNGA 2BDYA 1G2LA 1C1SA 4MQAA 5TJXA 1YC0A 3GYMA 2ODQA 3A87A 1O3GA 4P00A 1LO6A 1K0HA 1LTOA 1YCPK 2HVYB 8LPRA 1SL3A 1H9LB 1SLUB 3FP8E 3RXGA 1GBTA 3N7OA 4U2WA 5E2OA 4FUJA 2W5EA 3UQVA 1OX1A 2M2AA 1TIOA 2BD4A 5DP8A 3BG4C 3MOCA 2HPQH 2RA3A 4ABAA 4MPUA 3LKWA 2C93B 1L0ZA 3VEQB 3BSQA 3SN8A 1NZQH 3VPKA 3PO1C 1P0SH 2AGEX 1A5GH 1ANEA 4FU8A 2FPZA 1Q3XA 4XFQA 1GBJA 4D9RA 3LH3A 2QC2A 4CRBA 3UOUA 1GI5A 1DY8A 1DSTA 3GCTG 2J5UA 1Y59T 4ACBA 3ATIA 3IG6B 3SGAE 1EASA 1SLWB 2WYGA 1GJBB 4O97A 4QT8C 3BTKE 4BANB 2Z3EA 1MTNC 3M5LA 1GBFA 1HAOH 1PPCE 1QNJA 4Z6AH 1IQMA 3FP6E 3H7TA 1EZSC 3GICB 2QXIA 2DUCA 3A7XA 3QN7A 4KTCA 5C67A 2UUYA 1JRTA 1RS0A 1IQHA 4RKOB 2FWWA 1XKBC 1GGDB 4WWYA 1OWKA 2WPDD 1UTLM 3SU4A 2VGCB 1C2JA 1HAXB 1HAYB 2STAE 2WPLS 3KHVA 4AORA 1FDPA 1IQFA 1W10U 2C8WB 4NSYA 5EJZA 2AIPA 1UVTH 2JH5D 5EOKA 4UD9H 1EPTA 5DGJA 1ZMNA 1CA0C 3OFND 1C2LA 1PPHE 2DE9A 3Q76A 5EG4A 1HUTH 2ZHEH 2F9OA 2Z7FE 1CBWB 2FOAA 5GDSH 2XBVA 2SNVA 3URDA 2ZHFH 1AHTH 1OWHA 3KGPA 2WPHS 1ANCA 2AGGX 3U69H 3Q3KA 2XC5A 2QGRA 4GLYA 1P02A 1EAWA 3BF6H 4XOJA 1ANDA 3WW7A 1C5YB 1UCYH 1O5EH 3RXEA 4GCHG 1ABJH 3UTUH 3A82A 2PW8H 4X2YA 3PM3A 6CHAB 4ZXYH 4JZ1A 5JB8S 1O2WA 4CRGA 4HG6A 1TMUH 2SGPE 2J38A 2NU1E 2DE8A 2FS9A 1ZHMA 1BIOA 1DITH 2W6ID 4B2BA 3UQOA 4B71A 1GJ5H 4I8JA 1QBOA 1MU6B 4I31A 2A4QA 2GMTB 1C5VA 4FUIA 5DJ7A 4FXGH 2FOHA 2J98A 2Y80A 1E38B 1YLNA 1VR1H 2J95A 1DX5M 1ETRH 4ZUHA 2XXLA 1V3XA 1HPGA 1DM4B 1PPFE 3FOAA 2L74A 3HKIB 1SHYA 1BTXA 2VIQA 2ZU1A 3MNSA 3AVZA 3FZZA 3E0PB 4VGCC 4AZ2B 5TCAA 1GI3A 2H9TH 2LP6A 3EAJA 5C17A 1COWD 1MD8A 3U1JB 1O3OA 2Q1JA 3VB6A 2GZ8A 1F0SA 4MTBA 1LHDH 5CHBA 1NU7B 1GHAG 4H6SB 4ABFA 1DS2E 3GS9A 1G9IE 4ZKOU 1TPSA 3LDXH 1FAXA 3RC6A 1TRMA 3M3SA 1TOMH 2RA0A 5AVDA 3PLBA 5F53A 4D7FA 1CGJE 1K1NA 5F8XA 2ZTZA 1C5OH 3SNBA 1TE0A 2PTNA 2BB4A 2THFB 3LGWA 2VU8E 4XBBA 1GWAA 2FOBA 1SI5H 1BJUA 1GBEA 3W94A 1XUIA 3F2GA 1O2YA 4Q80A 3HATH 1RTLA 3P8GA 3PLPA 4AX9H 3QK1A 2W7SA 3A7VA 1EOJA 3MWIU 1MBMA 3KQDA 5GJ4B 3N7EA 4FVDA 2ESTE 2BD8A 1A5IA 1C1RA 3D23A 1QB1A 1OWDA 2HLCA 2H1UA 4D8NA 1FY4A 4JK5A 1QTFA 1W0KD 1XUKA 1O5DH 2ANYA 1HAPH 2AIQA 3HGPA 1S0QA 1THRH 1A1RA 1SGFA 5F8ZA 3GY4A 3VB5A 1W0YH 3RXKA 5SGAE 2GKVE 1V2JT 3G01A 1YPLH 2Y82A 2PKSC 1P57B 3D62A 1YKTA 1OP2A 2ZHDA 3LGIA 4Z0KA 2QIQA 4X6OA 2FOMB 5E2PA 1BRCE 1LVYA 1ETSH 3LOXA 1SQRA 3UNQA 1V2MT 1XMNB 3LC5A 1BZXE 4WF8A 4AB9A 2ZFFH 1HJAC 3ZIAD 2A4RA 1S84A 2ZQ2A 3E8LA 1A4WH 1NN6A 2BZAA 1BHXB 3RXDA 1FPCH 1P2QA 3M37A 3RM2H 2H2ZA 5CHAB 1ZGIA 3U8RH 1VCQA 2PSXA 1EB1H 1P8VC 2FI5E 3T28A 2Y5FA 1D3QB 3E16B 2K0QA 3RXRA 3T62A 1YPEH 4H42U 1C5LH 4P02A 3V12A 1MQ5A 2IPQX 2VINA 2OK5A 5C1XA 1D9IA 3RXVA 3MFJA 4K8YA 1P06A 4CBNA 3TJVA 2XNIA 2F9VA 1MBQA 5EJ1A 3ATMA 2YMSD 3RXJA 2PHBA 3EQ0H 4Y8XA 3SU6A 1UTMA 5DP9A 4WJG2 1PQ5A 1J16A 2GT7A 1WUNH 4H6TA 1P12E 2VB0A 4K1TA 3QTVH 4NFEA 2UUFB 3UNRA 2ILNA 2F3CE 2KZ4A 1JOUB 2HNTE 4D7GA 4Y76A 1FY5A 4DY7B 1TGSZ 2JKHA 2R0LA 1LVMA 5AHGH 1O3HA 1ZPBA 3E91A 1NRNH 1SGDE 2XCFA 3S9AA 2ZDAH 3UR9A 3QUMP 1A0HB 3LONA 1GGDC 1WOFA 2V3HH 4NWLA 2YNAA 3UUZA 2VGCC 1QA7A 1LDTT 3STIA 2B5TB 4Y0ZE 3LGYA 2Y81A 3A8DA 1DLEA 1C1QA 3V3MA 4WXIA 1WQVH 3BV9B 2ALVA 1O2OA 1S82A 4E06H 4NCYA 1CSOE 2V0BA 5DKMA 5DP3A 4CH8B 2QF4A 4JZIA 1J15A 4ZMAH 1UK4A 2VWLA 1CBWC 1OOKB 4NA8A 3SJKA 1H8IH 5LGOA 3LU9B 3RMLH 1SQOA 2BX3A 3GY7A 1M9UA 5DP7A 1S0RA 3A7ZA 1Y8TA 2OBQA 3PV2A 2L6OA 1CA8B 3UWIA 4ABJA 2ZU5A 1O2RA 4UFFH 3TGIE 1O2XA 1Y5UT 6CHAC 2GV7A 1O5AB 1B7XB 2A45B 3A7TA 2G51A 4MNYA 2AFQB 4O03A 3VXFH 1OSSA 9ESTA 3W1EA 2SGEE 3PMHB 1P3EA 1SLXB 2XYAA 2BVXH 3RXFA 1AVXA 1QBVH 1TNHA 2QAAA 2BDHA 4MNVA 1KXDA 1C2EA 4NIYA 1ABIH 2O8UA 2GMTC 1W13U 2WZQA 1S83A 2ZDMA 2QA9E 2V7QD 3A89A 1W8BH 1YBWA 1O31A 4INLA 1CHGA 2ZCKP 2K8IA 1H9IE 1QFKH 1LPGB 4X8SH 1ELGA 5E8EH 1EJAA 1ETTH 1PQ8A 1VGCC 1YF4A 1MZDA 1SMFE 2CXVA 1HGTH 2YMSB 3BN9A 3TJUA 1PJPA 1OXGA 2G5NA 1PFXC 1LHEH 2IN2A 3BIVH 5T6FA 3OTPA 3ZZ5A 4ASUD 3TK5A 1YLCA 3MU4A 4YXWD 3GY6A 3F0PA 3SNCA 1E1RD 3SU2A 5LPRA 2Z3CA 1QIXB 1WXRA 1EAXA 1UTKA 3TJOA 1P01A 2ZC9H 4GUXA 1C1OA 1HJ9A 2FDAA 1GBLA 3FKSD 4CH2B 1C2DA 4J1YA 5DP5A 3KEEA 1HAVB 3LPRA 4CRDA 2ZFRH 1G3CA 1HXEH 3SGQE 2BLOA 1AFQB 3ZZ7A 4MPVA 4CREA 1Z7KA 5EXMA 4DURA 3KYFA 1K1MA 2A4GA 1BMAA 2XWBI 1Y3XA 3U9AH 2BX4A 3AAUA 1ZZZA 2WV4A 2QF3A 3RC4A 1GL1A 2BQWB 2I6SA 1SLVB 1QBNA 2J2UA 2GCTB 1C1VH 4B76A 1MKXK 1O2IA 5FPTA 2RFKC 1O30A 3PRDA 1O33A 1RTKA 2BDAA 2OXSA 4UFDH 4XBCA 1ARBA 2JH6D 2A0QB 1YYY1 1AY6H 2R0KA 1GMHF 3OX7U 4NZLA 1D6RA 2UWPA 2ZQ1A 1A61H 3U8OH 3SNDA 2Z6BD 1WV7H 4AC9A 3S7HB 1ELDE 1CHOG 1QB6A 1LKBA 1J14A 1L1JA 1C1UH 1UVPA 1C1TA 1VITF 3GY2A 1O2VA 1U6QA 2ZKSA 2EI7A 4YO9A 3KQEA 5A0BA 3EE7A 5L2YH 1HLTH 4U01A 5HXFA 5GXPA 3DFJA 2F9BH 4OM9A 4HFPB 4E05H 1NRRH 1OKXA 1KDQB 3PLKA 3UR6A 2Q6DA 5EXNA 1P2JA 3ENSB 4X2XA 2UWLA 3S69A 4YZUA 1ZRKA 1A5HA 2PR3A 1BTPA 2ZU3A 1MTVA 3TLOA 5CHAC 1UO6A 1H8DH 1JMOH 3FO8D 3RLYH 2O9QA 3LIWA 2P8OB 2ZGCA 3PYHA 1DWCH 3OSYA 1BRUP 3DA9B 2RCEA 4DW2U 1TBRH 1FY1A 1C2HA 1P09A 4DGJA 4B73A 1C4U2 2AEIH 2ZFQH 5T1VA 1OYQA 4KELA 1SBWA 1Q31A 1V2NT 3K6YA 1BTWA 3KYGA 1YPKH 1W11U 2F9NA 2Y7XA 1H8ED 2VH6A 1WQSA 1QCPA 4XDEA 1V2ST 2FM2A 1SKYE 2V6NA 3M35A 3ZVCA 2FXRA 1V2WT 2FP7B 7GCHF 2WV9A 3PMAB 4ZHMU 1GBAA 4IGDA 1O32A 1W3CA 5J4SA 2GZ9A 2HNTC 3VB4A 1BHXF 2QF0A 1AN1E 3MU1A 1F7ZA 4Q63A 4NG9H 5EQSA 2KCPA 1ZOMA 1A3BH 1T8LA 1C2FA 4INHA 2ZPRA 1ZPCA 1AU8A 3CNRA 2PLXA 1D4PB 1GJDB 2GDEH 1BA8B 4D9QA 2VIDA 1S6LA 1GI7B 1XXFA 4RI0A 4SGBE 3RXHA 2BMGB 1ZLRA 4ZH8A 1MKWH 2TRMA 1SFIA 2CK3D 3S9BA 2J34A 1C5PA 1P04A 1Z71A 3L6PA 4ZXXH 1C2MA 3V13A 4FOUC 1AUJA 3ATWA 4IMQA 4X1NU 5C5NA 1ELFA 2G00A 1GJ7B 2PV9B 2WSSD 2QY0B 1WTGH 4F48B 2GJGA 1AVGH 3IITA 1FLEE 1QURH 3RM0H 5C94A 1Z6EA 2HNTF 1XUJA 3RP2A 1FIZA 3CENA 1BBRK 1GJ6A 2R3YA 2A2QH 1UHBB 3RXUA 3A7YA 4H4FA 2SFAA 1F2SE 2WYJA 3Q77A 2XNDD 1HDTH 2Z3DA 1KTSB 2ZPSA 2R9PA 2XOKD 1O3IA 1UTQA 2ZPQA 5DP4A 1DWEH 2O8MA 1PQ7A 1EKBB 3RC5A 1GVZA 1V2RT 5G4BA 3W95A 1Z1JA 4MG3A 1TLDA 2Y5HA 2P16A 3M3TA 4AN7A 2RG3A 4OGXA 2Z9JA 4F55A 2H9HA 2P3FH 2B7DH 1QRWA 1XKAC 1E1QD 4ZHAA 3TVJB 5JPMH 1O2GH 2AGIX 1A0LA 1YPJH 1XVMA 2YMSC 4JZFH 1XUHA 1O35A 3TITA 1F92A 1C5NH 4XD7D 4X8TH 4AG2A 3N99A 1EPTC 2BM2A 2FMJA 3ZZ3A 1GHZA 4Y79A 2BTCE 3P92A 3RU4T 2VVVA 4X1QU 1WDIA 1T7CA 1ID5H 1MTWA 1GG6C 3F9EA 3TU7H 4X6MA 2ZGHA 1W7GH 5H4IB 4B2AA 3SV7A 3S0NA 1QA0A 1SGPE 1T4UH 1OWEA 1O38A 2ZGJA 2R2MB 1GHYH 1V2PT 4CR9A 5GWZA 1AQ7A 4OS5A 1BQYA 2BVRH 1TNKA 2CHAB 4M7GA 4CRAA 1WBGB 1MAXA 4GPGA 2JETC 4UDWH 2GVFA 1HAVA 1AFQC 2A4OA 2KAIB 5ABWA 3HGNA 3MHWU 3EGKH 1KY9A 4O3TA 1FJSA 1TGBA 4TY7A 4DOQA 4DVAU 1TPOA 1GI2A 4Y8YA 2BOHB 2ZHWH 3MO6A 4I8HA 3ZVGA 2OP9A 1T8NA 4I8GA 1QJ7B 2ZDLA 1FMGA 1FV9A 4JYUH 1V2LT 2C8YB 2JJ1D 2ZDKA 2IPHA 2GCTC 2ZIQH 3RXBA 4YOGA 1GDQA 3IWMA 1YY3A 3CP7A 3CS0A 5AFZH 3PRBA 1HAHH 1W12U 4F49A 8ESTE 5FPSA 3O8RA 1G3BA 1TNJA 1V2TT 1P2OA 4RSPA 1HBTH 1OWIA 1VCWA 1O39A 3QDZB 3M7TA 3T27A 5C1YA 3SJOA 3T2NA 1CE5A 4BAQB 1IAUA 2XRCA 1BMFD 1SB1H 3LJJA 3RXIA 2OC1A 5JBTA 1ELEE 5FX6A 1B0EA 8KME2 1S6HA 1K1IA 3MNCA 1QB9A 1FN6A 3VB7A 5T3HA 4IC6A 1D3DB 2C90B 7LPRA 1Z8GA 1YLDA 3RXAA 1TRNA 3PTNA 4Y7AA 5PTPA 4Q7ZA 2KCAA 3KIDU 4X1SU 1KDQA 3B23B 3ZYDA 1NPMA 1P11E 3UNSA 1GCDA 1YPHC 3F68H 1EUFA 3ZZ4A 2QXHA 2FYQA 3E3TA 1S5SA 3VFEA 4CR5A 2O8WA 1H1BA 1S81A 3SZNA 1HRTH 2ZDNA 1L4ZA 2BY7X 4DIIH 2P8OC 2OLGA 1MAYA 1W0ZU 4BNRA 1TGNA 1A46H 1FNIA 1QJ1B 2BDBA 2A31A 5FPYA 3MQKC 2LELA 1RJXB 2CF8H 1MZAA 1MCTA 1V2VT 2BDGA 1GVLA 3OY6U 2G52A 1T8OA 2ZTXA 3EA7A 2FI3E 4YM9A 3RXLA 4FUEA 1NY22 5JYIA 3F9HA 1GHAF 2VBCA 4CHAC 5HIZA 4BOHA 1C2IA 1XUGA 1DANH 3A85A 2H9EH 4XBDA 2WPIS 4IS5A 1FONA 2ALPA 1OYTH 4GHTA 2FLRH 2GX4A 4MVNA 4FUDA 2D2DA 3RLWH 1ZTJA 3DFLA 3K2UA 3NCLA 1TPAE 3ATKA 1T32A 1SGQE 1DWBH 3PV5A 2ZGBH 2QXGA 2ZO3H 3TH3H 1P2MA 1QRXA 1SGRE 1TA2A 2ZHQH 4KTUA 1GHBG 1N6YA 1HAGE 2RDLA 3V7TA 1SOZA 1SGFG 1AVWA 1PQAA 1F5LA 1VJ9U 1H8HD 2KCOA 1UK2A 1WAYB 3P8NA 4DJZB 1O3KA 5J4QA 2A1DB 3T26A 2FLBH 2GV6A 3HKJB 2EI6A 2CJIA 3PWBA 2J9NA 1OWJA 2HWLB 2VWMA 1TNLA 1J8AA 1T31A 2WPKS 1LMWB 1LKAA 3NZIA 4DT7B 5A8YA 5EIYA 3VG8A 3SU1A 2W3IA 2V3MA 3TPIZ 2EEKA 3GCNA 4X6PA 1XUFA 2OBOA 1P9UA 1YCPH 4ZKNU 2BY6X 4UFEH 2QXJA 1GJ4H 2F83A 3ZVBA 2Q6FA 2G55A 1AMHA 5DO4H 5A0CA 4I33A 4A1XA 1EJNA 3MH7A 5FXLA 1AGJA 1TGTA 4NWKA 4ABHA 4WH6A 1NFUA 1QQUA 2ZZUH 5EJLA 1UHBA 3M5OA 3SV9A 2KX4A 1C1NA 1C4V2 4R0IA 1DUEA 3NK8A 2BD5A 3GY5A 3SQEE 1FPHH 3OY5U 3QO6A 1Q2WA 3P70B 1GHWH 1GBDA 1ZGVA 3I29A 4I7YH 2Z9KA 3R0FA 1TBZH 2UWOA 3H7OA 2ZDVH 4TPIZ 1L1NA 1E79D 1L1GA 1LVOA 3A8BA 4NZQA 1Z8IB 3TGJE 2EY4C 1Z8JB 3MU0A 2VH0A 1RGQA 1KXBA 1HYLA 1QJ6B 3B9FH 3MO3A 1LHGH 3M61U 2FYRA 4X8UH 4OS7A 3OEHD 1PPEE 3AW0A 3MU5A 2RDEA 1PYTD 1KSNA 5LPEA 4NA7A 1NFWA 1DFPA 2A32A 5CE1A 3QLPH 1ZSLA 4Y11E 1K2I1 1TOCB 2HPPH 3RUOA 4A1TA 1TQ7B 3DHKH 1FIWA 2XW9A 1RXPA 2BLQA 1EOLA 1C5XB 3I78A 5C0TA 4XE4A 3ODDA 4WMDA 3BTGE 1BJVA 1G36A 2QE7D 2PP6A 2PSYA 1LPZB 2FODA 5F6MA 1O2HA 3BTDE 2AYWA 2HLDD 1UVSH 4WMEA 2NWNA 3A7WA 4MLFB 1ZHRA 3M5MA 2G4TA 4R8TB 2BYAX 1UJ1A 1C4Y2 3NWUA 5GIBA 1LVBA 4Q7YA 1GMCG 1UW7A 1MQ6A 4HI3A 4X2VA 2ZCHP 2KAIA 2BXTH 1C5RA 1K22H 1SSXA 3I77A 2D1JA 2IJOB 3E6PH 3P17H 3ZZDA 4AFSA 6GCHF 1Z8RA 3BG4B 1A3EH 2IOTA 1YM0A 2F91A 3TH4H 3GCHB 2QN5T 1C5MD 5JBAS 3OE7D 1SVPA 1VKYA 1EJMA 1N6XA 3C27B 3ODFA 2P3TB 1WYKA 1HCGA 1JXPA 4HZHA 3F6UH 2OD3B 1GI8B 1N8OB 4FUBA 1ARCA 3SU3A 3TGKE 4X8VH 3RU4E 1T8MA 3JZ2B 3RMOH 2EC9H 1QRZA 3S9CA 1MTNB 1QR3E 1VITH 3OTJE 5C5OA 1G2MA 3BEIB 2F4LA 1SC8U 3F9GA 4AGKA 7KMEH 3UREA 1O5CB 1KLTA 5LH8A 1P2KA 2Y7ZA 3M5NA 2OC7A 1HNEE 2BLVA 1AZ8A 2ZA5A 3FN8A 4GAWA 5C0UA 4BAHB 1NC6A 4B1TA 2BD2A 1PPZA 2PGBB 1YP9A 1WCZA 2BXUH 2LPRA 3LC3A 4MPXA 1NO9H 4ZKSU 4FU9A 4U32A 4MDSA 2BVSH 1SOTA 4ABDA 4FUGA 1MABB 5FL7D 4JYTA 1NESE 3QX5H 1GBBA 1HFDA 4TWWA 2UUKB 1K1LA 4YOJA 4FETA 4ISOA 3F9FA 4JYVH 4NIXA 3SORA 3LGUA 1THSH 2TGPZ 1AFEH 5A2MH 3RXTA 5EODA 4I86A 1UCYK 3BEFB 1MH0A 2VIVA 3BG8A 4PROA 1F0RA 2SNWA 2ZECA 1FAKH 4XSKU 1AB9B 1D3TB 2OC8A 1AI8H 1NROH 1CT4E 2BLWA 3DSPA 3F0OA 1IQGA 4LXBH 1NRPH 1L4DA 2AHME 1O2PA 2CF9H 1ZTKA 1VITG 4AOQA 2SGFE 2A5AA 1D3PB 3UIRA 8GCHG 3O8CA 1N1LA 1ZRBA 3SV2H 1DXWA 1UTNA 1O2UA 1CO7E 1O3AA 1ZJKA 3A81A 1GJ8B 3LT3A 3SU0A 2XC4A 1Y5AT 5JDUB 1G37A 3PWCA 4JZEH 1GL0E 1DXPA 1ANBA 2ZF0H 4OS1A 1O3BA 1AD8H 1P03A 4K1EA 5AFYH 3GISB 2NU2E 3H5CB 3QGJA 3SJ8A 2VIOA 1CVWH 1BTYA 1CGHA 2OC0A 3OEED 1ESBA 1RRKA 1GMDF 1K9OE 1SHHB 1EXFA 1IQLA 3DT0H 3FP7E 5HKKD 3MH4A 3A86A 1SGNE 4VGCB 5GCHF 1QY6A 4K8BA 1BDAA 1P05A 1DT2A 2FOFA 2TGAA 1IQJA 3BTHE 4Q7XA 4IN1A 3E0NB 1RTFB 4Y71A 1O3DA 1G32B 1O3MA 2EI8A 2GTBA 3RXSA 2OINA 2GCHF 4Q2KA 7GCHG 1HJ8A 1EB2A 1KXCA 1EAUA 4WY3A 3SUDA 1E0FD 1EZQA 3UY9A 4HTCH 1MTSA 2BY9X 2FTLE 5E0GA 1GI0A 1KXEA 1MU8B 3BIUH 5C3NA 3BTEE 1NRSH 1TYNA 1P2IA 2P93A 1BITA 1SPJA 3ZV8A 2WUBA 1XVOA 1E34B 1TA6A 3AAVA 1TFXA 2HALA 2FX4A 4NFFA 1GI6A 1QQ4A 1CT0E 1OP8A 1BUIA 1F0UA 1TWXB 1AUTC 3B8JA 3GYLB 1LPKB 2Z9IA 3ZV9A 5KEDA 4KKDA 2VJ1A 1DY9A 4LOYH 3PV4A 4U30A 4X2WA 4DCDA 4SGAE 2R2WU 3SBKA 1BT7A 4GVUA 1Y3VA 3RMMH 4AFQA 2W26A 2PUXB 1Y3UA 3P8FA 1C9TA 1GDUA 5EQQA 2BY5X 4OGYA 1ZTLA 4MNWA 1AIXH 1ESAA 1HB0B 4ZAEA 1J17T 1B5GH 2P94A 4AYVB 2VIPA 1KLJH 3MNXA 5FX5A 4O3UA 3KCGH 1F0TA 1GI1A 5A09A 2XC0A 1A7SA 3P95A 4FVBA 4GHQA 5I46H 1O5BB 2M5TA 3PMBB 1AWFH 2ANKH 4TY6A 2O8TA 4M9FA 2PKSB 1C5ZB 4THNH 5FBIA 3E90B 2CN0H 4Z1MD 2Y6TA 5DP6A 1EQ9A 2ZP0H 3KQ5A 4YT7H 5FCKA 2HRVA 1ELTA 2EQNA 1HJAB 1KXFA 1HIAB 3VXEH 1XX9A 4BAOB 1AZZA 1K1PA 3WWBA 2J94A 5F8TA 4MPWA 3OYPA 2GDDA 3URCA 1BTZA 2A7HA 3FFGA 1FXYA 3LGVA 1K1JA 1UVOA 2J4IA 1O2KA 5FBEA 2XTTB 2ZU4A 1IQEA 1O2LA 2ZCLP 3D49H 1GVKB 3F3BA 1VCPA 2VVUA 5FAHA 2A2XH 1IOEA 1C2GA 1H4WA 1CT2E 4GSOA 4JMYA 2QF5A 3ZVFA 4E7NA 1BB0B 1ZR0A 1G30B 1BCUH 3RXMA 2ZGXH 1YPMH 2XWAA 3U28C 6LPRA 3GCHC 1GBIA 2HOBA 3MTYA 1TMBH 3SNAA 5JBCS 1O2QA 6ESTA 4IMZA 4A5TS 2LNCA 3PROA 2G5VA 1E36B 1QZ8A 3SHCH 3Q3YA 1SG8B 4LZ4B 5EW1H 1DSUA 1TALA 4K2YA 2Q6GA 1N8OC 3TK9A 2B0FA 1BOQA 5EPNA 3KNXA 3TIUA 1AKSB 3RXPA 1JRSA 4K1SA 2K1QA 3O8DA 1EZXC 1O2TA 2ZEBA 1LHFH 4YOIA 3M3VA 1IQIA 1K21H 1VZQH 3KF2A 1GBHA 5C2ZA 3ZZCA 2V35A 1ZMJA 3EYDA 1BBRE 2I6QA 1XM1A 1TRYA 4ASHA 1EP6A 1C1WH 1OS8A 1TPPA 3QWCH 3SGBE 3GCTF 3SJIA 3SNEA 1PPBH 3GDUA 2JIZD 3FZDA 2OQ5A 3L3TA 3N7DA 3U98H 4I8LA 2PWXA 1WU1A 2G8TA 2KM0A 3DCLA 5JBBS 2WPMS 1NU9A 1O0DH 1KXAA 4RT0A 2BHGA 3ZZAA 4JK6A 2C8XB 2EA3A 2FTMA 2KCYA 1PYTC 4FUHA 1IQKA 4UE7H 4NIWA 1BRBE 2BDCA 2HVXA 1C1MA 4X1RU 1GBMA 3EE0B 1AB9C 5DPAA 2OCVB 1UTPA 1ELCA 4KP0A 1DUAA 1RIWB 3S7KB 2WV5A 1YGCH 1O3LA 5K7RA 2F9PA 3SI3H 5IK2D 3BTQE 3M36A 1QL8A 1FUJA 2PGQB 5HIYA 4NSVA 1O3CA 1TMTH 4TWYA 1BMMH 2W6JD 2ZU2A 5A8ZA 2H5CA 3F2FA 1PPGE 3UB0A 4ACAA 2AMQA 2OQUA 3U8TH 4ZHLU 1B0FA 2ANWA 1MKXH 2OTVA 4CBOA 1QGFA 3C1KA 1O3PB 3NPSA 4CRFA 1F5RA 1GHVH 1GPZA 1XXDA 1C5TA 2TGTA 4KTSA 1FI8A 4UFGH 1E35B 1W7XH 4GCHF 3VB3A 1KYNA 4YLQH 1BTUA 2ANMH 1GJ9B 2VWOA 3RDZA 3LGTA 4Q4LA 1G3DA 1L2EA 1UVUH 5C1UA 2UUJB 2AMDA 1J9CH 3ZVEA 3OU0A 3RXOA 1O3NA 4FUFA 4WVPE 1VGCB 3PB1E 2QCYA 4B6FA 4ISHH 4INKA 3U1IB 1DLKB 4RN6A 4ABGA 3GOVB 2PKAB 2TPIZ 4MNXA 3KL6A 2FOGA 3O8BA 4NGAH 4FU7A 4DT4A 2TGDA 1C9PA 2GP9B 1ELAA 2D26C 2A5KA 4BAMB 1P10A 1X7AC 2TIOA 5IDKA 1CGIE 1LCYA 1GJAB 4NA9H 3P8OA 2VNTA 5I25A 2GZ7A 2FI4E 3SUGA 4DIHH 1MUEB 3QGNB 2BD9A 1EX3A 3UWJH 2OUAA 3M7QA 1W0JD 4ZCNA 3SU5A 4AYYB 1O2NA 1G3EA 4DG4A 3MO9A 4Y0YE 2D8WA 5A0AE 3BTME 7ESTE 5EPYA 2ZFTA 1V2QT 3ZZ6A 1YWUA 1A0JA 3HK6B 4WH8A 5LPFA 5HYOA 2FIRH 3H09A 4NIVA 4E7RG 4TT3D 5HM9A 1GCTB 4O9VA 1K28D 3MNBA 5FHTA 1FZZA 2FS8A 2R3UA 3GDVA 4K3JA 3EDXB 3BTFE 3LJOA 4Y6DA 3TJNA 3GCOA 2A5IA 1MMJN 2KFWA 1D6WA 4Y10E 1AWHB 1O36A 1EFRD 1DVAH 4RKJB 3F2HA 2FZZA 1JIMA 1LHCH 2JH0D 1IHSH 3OAAD 4K60A 1GBCA 4UONA 2WHXA 3KN2A 4ISNA 3SI4H 2Z9GA 3T29A 1EP5A 5L30H 1FN8A 1KIGH 2P3UB 3GDSA 2J97A 2P95A 3FANA 3SW2B 5A8XA 1OP0A 3BTWE 3SYJA 1W14U 1HIAA 2IJD1 1NRQH 4K69A 5EXLA 5DSFA 1C5UA 3EA9A 5EGMA 5EU8A 4UEHH 1O34A 2CGAA 4OS2A 2QYIA 3VGCB 1SGIB 1O2SA 3RU4D 1GBKA 2BQ7B 4JZDH 2O8LA 1AE5A 2ZNKH 3A8AA 4FUCA 1GHBF 1QL9A 1AO5A 5BPEA 3FVFB 4J2YB 4I8KA 4YTAA 5GNDA 2BY8X 2GT8A 3MH6A 1CU1A 4X1PU 3ZYEA 2ASUB 5C20A 4ISIH 3L33A 5GPIB 4BAKB 1UMAH 3MYWA 1BBRH 2XCNA 4B2CA 4TSFD 4YT6H 1ZSKA 2BD3A 1GI4A 2AMPA 4BXSA 5JB9S 1GDNA 3RXCA 1FX0B 1NT1A 3SUFA 3NXPA 2W7UA 1DOJA 3DSOA 1INCA 2SGQE 1AKSA 2ZI2H 1ELVA 3SUEA 2H6MA 5ESTE 3TK6A 1ZMLA 3DSGA 4OS4A 4LZ1H 3MMGA 5T6GA 4A92A 5FCRA 1JIRA 3TH2H 3A83A 2TBSA 1MKWK 2Z94A 3HK3B 1TGCA 2BOKA 4HGCA 4B75A 3UAIC 6GCHG 3EA8A 1F5KU 2C3SA 1O3EA 3AK5A 4BTUB 1K1OA 3QZQA 1DDJA 4OS6A 2ZFPH 1TX7A 2FESH 4JCNA 2ODPA 1QHRB 3WY8A 3ZVDA 2GD4B 3NUMA 3GY8A 1EAIA 2BQ6B 3V0XA 3F1SB 1RFNA 2CHAC 2WUCA 1H9HE 1V6DA 3AASA 4Y7BA 2FOEA 3ZZ8A 4K5ZA 1NBMD 2A7JA 1HV7A 3A8CA 1DICA 3CS7A 4X0WU 1W2KH 2G4UA 3PMJA 4AFZA 2ODYB 1P2NA 4LK4A 1RIWC 5IYTA 1KMHB 1DE7H 1NTPA 1P3CA 1TABE 2BD7A 3MI4A 2PUQH 3PO1B 4IBLH 4YLUA 3Q3XA 1FQ3A 1UTOA 2AH4X 5DN6D 2PTCE 2CMYA 4CRCA 2VIWA 2FOCA 5L6NH 5HGGA 1O3JA 3UFAA 1GI9B 2QV1A 1EZUC 3NRLA 5CDFE 5BRRE 4A1VA 1ELBA 1TB6H 2J92A 3TNSA 2FX6A 1GJCB 4ABBA 3K65B 5CMXH 1E37B 3ZZBA 4BTIB 4BTTB 1JBUH 1LQDB 1YCPM 3HPTB 1MD7A 3ATLA 1GMCF 4ISLA 1TAWA 3SOSA 1WSSH 2NU3E 5HMAA 3ITIA 5KGOA 1MCVA 1P9SA 1NM6A 4I32A 5T6DA 2JJ2D 1DWDH 1WTHD 3UPEA 4YESB 1S85A 2A7CA 4AG1A 2PFEA 1EPTB 4XRNA 1TQ0B 3DUXH 1S6FA 3UOPA 2PKAA 1CA0B 2H5DA 2ZFSA 5B6OA 1V2UT 1V2OT 4A6LA 2XBWA 4B74A 1GG6B 1Y3YA 1GHXH 1O5GH 1ZPZA 1GMHG 5ESBA 5B6LA 1C2KA 3SQHE 1IHTH 1BTHH 1O3FA 2YNBA 1HAZB 1ACBE 4ESTE 1ORFA 4X6NA 3R3GB 4ZKRU 1UTJA 3GY3A 3SZEA 1NFYA 2ULLA 1FY3A 1OHHD 4TPYA 2WINI 1SGCA 3ELAH 2JETB 4ZROA 1GMDG 4KGAA 1O2MA 3NKKA 2P59A 3A80A 3JZ1B 3ESTA 2F9UA 5GCHG 1YPGH 4ABIA 2SGAA 1ZYOA 1NBME 1HXFH 4IN2A 1TNIA 2XBXA 1C5SA 2J98B 1ZHPA 1GCTC 1JWTA 1TONA 1AE8H 1QL7A 1UCYE
chains in the Genus database with same CATH topology
2C8ZB 3QTOH 1V2KT 1TBQH 2ZTYA 4TYDA 1C5QA 1UK3A 3STJA 2STBE 2GCHG 2HGTH 5K0HA 3KQCA 2BDIA 1THPB 2G81E 3TNTA 4D76A 3MH5A 5EQRA 1NFXA 4AB8A 1O5FH 1LQEA 2Y5GA 2ZG0H 1RD3B 1FY8E 3BEUA 5DK1A 1VJAU 3BTTE 2YOLA 3T25A 8GCHF 3QZRA 1IQNA 4A7IB 1ESTA 1C5WB 1OPHB 2XBYA 3MU8A 3SV6A 1YPHE 1O2JA 5F03A 1EATA 3P6ZB 2AS9A 3K6ZA 1KLIH 4WMFA 1CHOF 1O37A 1SFQB 3KQBA 4ABEA 3VGCC 2SGDE 1BMNH 1TX8A 4BXWA 4F4OC 1CQQA 2BZ6H 2NU4E 4AGJA 1ZJDA 2VVCA 2GGVB 5E0JA 3SV8A 4AFUA 1SGEE 3ZVAA 2NU0E 3LH1A 4IC5A 2V3OH 1Z1IA 3DD2H 2ZWLH 3K9XB 1NS3A 3D65E 2CV3A 3PTBA 2AERH 4WXVA 5HM2A 3RMNH 4CHAB 1BRAA 1T4VH 4Y8ZA 2W3KA 3SJ9A 3A84A 3RXQA 5AF9H 1Y3WA 2FEQH 1DPOA 5ETXA 3AW1A 2VWNA 1KTTB 1SR5C 1TX6A 2B9LA 3M7UA 1HAIH 3ZZ9A 3SHAH 1Z6JH 2WPJS 2FO9A 1SQAA 1A2CH 5TCCA 1SGTA 2B8OH 2C4FH 5EW2H 5DG6A 3T5FH 3E1XB 3Q00A 1C1PA 9LPRA 3SO3A 5E0HA 3A88A 3FAOA 1ZSJA 4IW4E 1BMLA 1Y5BT 1O2ZA 1SGYE 2Z9LA 5L2ZH 1SQTA 1MTUA 1TNGA 2BDYA 1G2LA 1C1SA 4MQAA 5TJXA 1YC0A 3GYMA 2ODQA 3A87A 1O3GA 1LO6A 1LTOA 1YCPK 8LPRA 1SL3A 1H9LB 1SLUB 3FP8E 3RXGA 1GBTA 3N7OA 4U2WA 5E2OA 4FUJA 2W5EA 3UQVA 1OX1A 1TIOA 2BD4A 5DP8A 3BG4C 3MOCA 2HPQH 2RA3A 4ABAA 4MPUA 3LKWA 2C93B 1L0ZA 3VEQB 3BSQA 3SN8A 1NZQH 3VPKA 3PO1C 1P0SH 2AGEX 1A5GH 1ANEA 4FU8A 2FPZA 1Q3XA 4XFQA 1GBJA 4D9RA 3LH3A 2QC2A 4CRBA 3UOUA 1GI5A 1DY8A 1DSTA 3GCTG 1Y59T 3ATIA 3IG6B 3SGAE 1EASA 1SLWB 2WYGA 1GJBB 4O97A 4QT8C 3BTKE 4BANB 2Z3EA 1MTNC 3M5LA 1GBFA 1HAOH 1PPCE 1QNJA 4Z6AH 1IQMA 3FP6E 3H7TA 1EZSC 3GICB 2QXIA 2DUCA 3A7XA 3QN7A 4KTCA 5C67A 2UUYA 1JRTA 1RS0A 1IQHA 4RKOB 2FWWA 1XKBC 1GGDB 4WWYA 1OWKA 3SU4A 1UTLM 2VGCB 1C2JA 1HAXB 1HAYB 2STAE 2WPLS 3KHVA 4AORA 1FDPA 1IQFA 1W10U 2C8WB 4NSYA 2AIPA 1UVTH 2JH5D 5EOKA 4UD9H 1EPTA 5DGJA 1ZMNA 1CA0C 1C2LA 1PPHE 2DE9A 3Q76A 5EG4A 1HUTH 2ZHEH 2F9OA 2Z7FE 1CBWB 2FOAA 5GDSH 2XBVA 2SNVA 3URDA 2ZHFH 1AHTH 1OWHA 3KGPA 2WPHS 1ANCA 2AGGX 3U69H 3Q3KA 2XC5A 2QGRA 4GLYA 1P02A 1EAWA 3BF6H 4XOJA 1ANDA 1C5YB 1UCYH 1O5EH 3RXEA 4GCHG 1ABJH 3UTUH 3A82A 2PW8H 4X2YA 3PM3A 6CHAB 4ZXYH 4JZ1A 5JB8S 1O2WA 4CRGA 1TMUH 2SGPE 2J38A 2NU1E 2DE8A 2FS9A 1ZHMA 1BIOA 1DITH 4B2BA 3UQOA 4B71A 1GJ5H 4I8JA 1QBOA 1MU6B 4I31A 2A4QA 2GMTB 1C5VA 4FUIA 5DJ7A 4FXGH 2FOHA 2Y80A 1E38B 1VR1H 2J95A 1DX5M 1ETRH 4ZUHA 2XXLA 1V3XA 1HPGA 1DM4B 1PPFE 3HKIB 1SHYA 1BTXA 2VIQA 2ZU1A 3MNSA 3AVZA 3FZZA 3E0PB 4VGCC 4AZ2B 5TCAA 1GI3A 2H9TH 3EAJA 1MD8A 3U1JB 1O3OA 2Q1JA 3VB6A 2GZ8A 1F0SA 4MTBA 1LHDH 1NU7B 1GHAG 4H6SB 4ABFA 1DS2E 1G9IE 4ZKOU 1TPSA 3LDXH 1FAXA 3RC6A 1TRMA 3M3SA 1TOMH 2RA0A 5AVDA 3PLBA 4D7FA 1CGJE 1K1NA 5F8XA 2ZTZA 1C5OH 3SNBA 1TE0A 2PTNA 2BB4A 2THFB 3LGWA 2VU8E 4XBBA 1GWAA 2FOBA 1SI5H 1BJUA 1GBEA 3W94A 1XUIA 1O2YA 4Q80A 3HATH 1RTLA 3P8GA 3PLPA 4AX9H 3QK1A 2W7SA 3A7VA 1EOJA 3MWIU 1MBMA 3KQDA 5GJ4B 4FVDA 2ESTE 2BD8A 1A5IA 1C1RA 3D23A 1QB1A 1OWDA 2HLCA 2H1UA 4D8NA 1FY4A 4JK5A 1QTFA 1XUKA 1O5DH 2ANYA 1HAPH 2AIQA 3HGPA 1S0QA 1THRH 1A1RA 1SGFA 5F8ZA 3GY4A 3VB5A 1W0YH 3RXKA 5SGAE 2GKVE 1V2JT 3G01A 1YPLH 2Y82A 2PKSC 1P57B 3D62A 1YKTA 1OP2A 2ZHDA 3LGIA 4Z0KA 2QIQA 4X6OA 2FOMB 5E2PA 1BRCE 1LVYA 1ETSH 3LOXA 3UNQA 1V2MT 1XMNB 3LC5A 1BZXE 4WF8A 4AB9A 2ZFFH 1HJAC 2A4RA 1S84A 2ZQ2A 3E8LA 1A4WH 1NN6A 2BZAA 1BHXB 3RXDA 1FPCH 1P2QA 3M37A 3RM2H 2H2ZA 5CHAB 1ZGIA 3U8RH 1VCQA 2PSXA 1EB1H 1P8VC 2FI5E 3T28A 2Y5FA 1D3QB 3E16B 3RXRA 3T62A 1YPEH 4H42U 1C5LH 3V12A 1MQ5A 2VINA 5C1XA 1D9IA 3RXVA 3MFJA 4K8YA 1P06A 4CBNA 3TJVA 2XNIA 2F9VA 1MBQA 3ATMA 3RXJA 2PHBA 3EQ0H 4Y8XA 3SU6A 1UTMA 5DP9A 4WJG2 1PQ5A 1J16A 2GT7A 1WUNH 4H6TA 1P12E 2VB0A 4K1TA 3QTVH 4NFEA 2UUFB 3UNRA 2ILNA 2F3CE 1JOUB 2HNTE 4D7GA 4Y76A 1FY5A 4DY7B 1TGSZ 2JKHA 2R0LA 1LVMA 5AHGH 1O3HA 1ZPBA 3E91A 1NRNH 1SGDE 2XCFA 3S9AA 2ZDAH 3UR9A 3QUMP 1A0HB 3LONA 1GGDC 1WOFA 2V3HH 4NWLA 2YNAA 3UUZA 2VGCC 1QA7A 1LDTT 3STIA 2B5TB 4Y0ZE 3LGYA 2Y81A 3A8DA 1DLEA 1C1QA 3V3MA 4WXIA 1WQVH 3BV9B 2ALVA 1O2OA 1S82A 4E06H 4NCYA 1CSOE 2V0BA 5DKMA 5DP3A 4CH8B 4JZIA 1J15A 4ZMAH 1UK4A 2VWLA 1CBWC 1OOKB 4NA8A 3SJKA 1H8IH 5LGOA 3LU9B 3RMLH 1SQOA 2BX3A 3GY7A 1M9UA 5DP7A 1S0RA 3A7ZA 1Y8TA 2OBQA 1CA8B 3UWIA 4ABJA 2ZU5A 1O2RA 4UFFH 3TGIE 1O2XA 1Y5UT 6CHAC 2GV7A 1O5AB 1B7XB 2A45B 3A7TA 2G51A 4MNYA 2AFQB 4O03A 3VXFH 1OSSA 9ESTA 2SGEE 3PMHB 1P3EA 1SLXB 2XYAA 2BVXH 3RXFA 1AVXA 1QBVH 1TNHA 2QAAA 2BDHA 4MNVA 1KXDA 1C2EA 4NIYA 1ABIH 2O8UA 2GMTC 1W13U 1S83A 2ZDMA 2QA9E 4INLA 3A89A 1W8BH 1YBWA 1O31A 1CHGA 2ZCKP 1H9IE 1QFKH 1LPGB 4X8SH 1ELGA 5E8EH 1EJAA 1ETTH 1PQ8A 1VGCC 1YF4A 1MZDA 1SMFE 2CXVA 1HGTH 3BN9A 3TJUA 1PJPA 1OXGA 2G5NA 1PFXC 1LHEH 2IN2A 3BIVH 5T6FA 3ZZ5A 3TK5A 1YLCA 3MU4A 3GY6A 3SNCA 3SU2A 5LPRA 2Z3CA 1QIXB 1EAXA 1UTKA 3TJOA 1P01A 2ZC9H 4GUXA 1C1OA 1HJ9A 2FDAA 1GBLA 4CH2B 1C2DA 4J1YA 5DP5A 3KEEA 1HAVB 3LPRA 4CRDA 2ZFRH 1G3CA 1HXEH 3SGQE 2BLOA 1AFQB 3ZZ7A 4MPVA 4CREA 1Z7KA 5EXMA 4DURA 1K1MA 2A4GA 1BMAA 2XWBI 1Y3XA 3U9AH 2BX4A 3AAUA 1ZZZA 2WV4A 2QF3A 3RC4A 1GL1A 2BQWB 2I6SA 1SLVB 1QBNA 2J2UA 2GCTB 1C1VH 4B76A 1MKXK 1O2IA 5FPTA 1O30A 4UFDH 1O33A 1RTKA 2BDAA 2OXSA 4XBCA 1ARBA 2JH6D 2A0QB 1YYY1 1AY6H 2R0KA 1GMHF 3OX7U 4NZLA 1D6RA 2UWPA 2ZQ1A 1A61H 3U8OH 3SNDA 2Z6BD 1WV7H 3S7HB 1ELDE 1CHOG 1QB6A 1LKBA 1J14A 1L1JA 1C1UH 1UVPA 1C1TA 1VITF 3GY2A 1O2VA 1U6QA 2ZKSA 2EI7A 4YO9A 3KQEA 5A0BA 5L2YH 1HLTH 4U01A 5HXFA 5GXPA 3DFJA 2F9BH 4HFPB 4E05H 1NRRH 1OKXA 1KDQB 3PLKA 3UR6A 2Q6DA 5EXNA 1P2JA 3ENSB 4X2XA 2UWLA 3S69A 4YZUA 1ZRKA 1A5HA 2PR3A 1BTPA 2ZU3A 1MTVA 3TLOA 5CHAC 1UO6A 1H8DH 1JMOH 3RLYH 2O9QA 3LIWA 2P8OB 2ZGCA 3PYHA 1DWCH 3OSYA 1BRUP 3DA9B 2RCEA 4DW2U 1TBRH 1FY1A 1C2HA 1P09A 4DGJA 4B73A 1C4U2 2AEIH 2ZFQH 1OYQA 4KELA 1SBWA 1Q31A 1V2NT 3K6YA 1BTWA 1YPKH 1W11U 2F9NA 2Y7XA 2VH6A 1WQSA 1QCPA 4XDEA 1V2ST 2FM2A 2V6NA 3M35A 3ZVCA 2FXRA 1V2WT 2FP7B 7GCHF 3PMAB 4ZHMU 1GBAA 4IGDA 1O32A 1W3CA 5J4SA 2GZ9A 2HNTC 3VB4A 1BHXF 2QF0A 1AN1E 3MU1A 1F7ZA 4NG9H 5EQSA 1ZOMA 1A3BH 1T8LA 1C2FA 4INHA 2ZPRA 1ZPCA 1AU8A 2PLXA 1D4PB 1GJDB 2GDEH 1BA8B 4D9QA 2VIDA 1GI7B 1XXFA 4SGBE 3RXHA 2BMGB 1ZLRA 4ZH8A 1MKWH 2TRMA 1SFIA 3S9BA 2J34A 1C5PA 1P04A 1Z71A 3L6PA 4ZXXH 1C2MA 3V13A 1AUJA 3ATWA 4IMQA 4X1NU 5C5NA 1ELFA 2G00A 1GJ7B 2PV9B 2QY0B 1WTGH 1AVGH 3IITA 1FLEE 1QURH 3RM0H 1Z6EA 2HNTF 1XUJA 3RP2A 1FIZA 3CENA 1BBRK 1GJ6A 2R3YA 2A2QH 1UHBB 3RXUA 3A7YA 4H4FA 2SFAA 1F2SE 2WYJA 3Q77A 1HDTH 2Z3DA 1KTSB 2ZPSA 2R9PA 1O3IA 1UTQA 2ZPQA 5DP4A 1DWEH 2O8MA 1PQ7A 1EKBB 3RC5A 1GVZA 1V2RT 5G4BA 3W95A 1Z1JA 4MG3A 1TLDA 2Y5HA 2P16A 3M3TA 4AN7A 2RG3A 4OGXA 2Z9JA 2H9HA 2P3FH 2B7DH 1QRWA 1XKAC 4ZHAA 3TVJB 5JPMH 1O2GH 2AGIX 1A0LA 1YPJH 1XVMA 4JZFH 1XUHA 1O35A 3TITA 1F92A 1C5NH 4X8TH 4AG2A 1EPTC 2BM2A 2FMJA 3ZZ3A 1GHZA 4Y79A 2BTCE 3P92A 3RU4T 2VVVA 4X1QU 1T7CA 1ID5H 1MTWA 1GG6C 3F9EA 3TU7H 4X6MA 2ZGHA 1W7GH 5H4IB 4B2AA 3SV7A 3S0NA 1QA0A 1SGPE 1T4UH 1OWEA 1O38A 2ZGJA 2R2MB 1GHYH 1V2PT 4CR9A 5GWZA 1AQ7A 4OS5A 1BQYA 2BVRH 1TNKA 2CHAB 4M7GA 4CRAA 1WBGB 1MAXA 4GPGA 2JETC 4UDWH 2GVFA 1HAVA 1AFQC 2A4OA 2KAIB 5ABWA 3HGNA 3MHWU 3EGKH 1KY9A 4O3TA 1FJSA 1TGBA 4TY7A 4DOQA 4DVAU 1TPOA 1GI2A 4Y8YA 2BOHB 2ZHWH 3MO6A 4I8HA 3ZVGA 2OP9A 1T8NA 4I8GA 1QJ7B 2ZDLA 1FMGA 1FV9A 4JYUH 1V2LT 2C8YB 2ZDKA 2IPHA 2GCTC 2ZIQH 3RXBA 4YOGA 1GDQA 3IWMA 3CS0A 3CP7A 5AFZH 1HAHH 1W12U 4F49A 8ESTE 5FPSA 3O8RA 1G3BA 1TNJA 1V2TT 1P2OA 4RSPA 1HBTH 1OWIA 1VCWA 1O39A 3QDZB 3M7TA 3T27A 5C1YA 3SJOA 3T2NA 1CE5A 4BAQB 1IAUA 2XRCA 1SB1H 3LJJA 3RXIA 2OC1A 5JBTA 1ELEE 5FX6A 1B0EA 8KME2 1S6HA 1K1IA 3MNCA 1QB9A 1FN6A 3VB7A 5T3HA 4IC6A 1D3DB 2C90B 7LPRA 1Z8GA 1YLDA 3RXAA 1TRNA 3PTNA 4Y7AA 5PTPA 4Q7ZA 3KIDU 4X1SU 1KDQA 3B23B 3ZYDA 1NPMA 1P11E 3UNSA 1GCDA 1YPHC 3F68H 1EUFA 3ZZ4A 2QXHA 2FYQA 3E3TA 1S5SA 3VFEA 4CR5A 2O8WA 1H1BA 1S81A 3SZNA 1HRTH 2ZDNA 1L4ZA 2BY7X 4DIIH 2P8OC 2OLGA 1MAYA 1W0ZU 4BNRA 1TGNA 1A46H 1FNIA 1QJ1B 2BDBA 2A31A 5FPYA 1RJXB 2CF8H 1MZAA 1MCTA 1V2VT 2BDGA 1GVLA 3OY6U 2G52A 1T8OA 2ZTXA 3EA7A 2FI3E 4YM9A 3RXLA 4FUEA 1NY22 5JYIA 3F9HA 1GHAF 4CHAC 4BOHA 1C2IA 1XUGA 1DANH 3A85A 2H9EH 4XBDA 2WPIS 4IS5A 1FONA