1KXFA

Sindbis virus capsid, (wild-type) residues 1-264, tetragonal crystal form (form ii)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
159
structure length
159
Chain Sequence
MALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
total genus 34
structure length 159
sequence length 159
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxfA01
1O31A 1Y5BT 1BB0B 1SHYA 2A7HA 3FANA 3SUFA 1UO6A 2BZ6H 1MTUA 3LC3A 1TX7A 3A8AA 3GCHB 1C1PA 1GMDG 4YLUA 1HAPH 1FN6A 3RUOA 1DPOA 1ETSH 3PTNA 4B73A 2PUQH 2R2MB 1E37B 4FUEA 1DDJA 2ZF0H 5C5OA 4CHAB 3P8FA 2VWNA 3A80A 1N6XA 2J92A 4NSVA 3MU8A 4OS6A 4JYVH 1FNIA 1GJ8B 1GL1A 4NWKA 3EQ0H 1SGFA 4KELA 4YZUA 4A7IB 2RCEA 2FDAA 3PMJA 1P2MA 1O2ZA 2ZFQH 4DOQA 1EJNA 1S83A 3KCGH 1WOFA 1Z6JH 1AHTH 1GI7B 4ABDA 3SOSA 1V2TT 2ZU3A 1EOLA 5GWZA 1W0YH 2QC2A 1XUJA 2VIQA 2HOBA 1SQTA 4AFSA 5A8ZA 1C1NA 1O2WA 1O2PA 1VGCB 4CRGA 1GMDF 2BDAA 1T8NA 2BLWA 3ODDA 8ESTE 1LQEA 4U30A 1A4WH 1SB1H 2SGFE 3K6ZA 1UHBB 4WMDA 3QZQA 5HM9A 3SU1A 1S5SA 1CGJE 1LQDB 4AOQA 2WPMS 3GY2A 3SHCH 4Y11E 2QV1A 1GVZA 5LH8A 1NROH 2F9PA 2XTTB 2R0LA 3LGYA 3KQDA 2GCHG 3QTOH 1P9SA 3BTDE 1F0UA 1GBTA 3UPEA 3CS0A 3TGJE 2BLVA 1O2LA 2HVXA 3SU5A 4IN2A 1HAVB 1XUFA 5EQRA 2AYWA 2P8OB 5TCAA 2XBXA 1K28D 3C1KA 1WV7H 1OYTH 1FONA 1TGBA 3UOPA 5DO4H 3BIUH 3V0XA 3LJJA 5EPNA 1AUJA 1P04A 1SLWB 1FIWA 1SMFE 1TBRH 2A5AA 4YOGA 2QXJA 2NU3E 5DP4A 3T5FH 4KTCA 4AFQA 1ELBA 4AYYB 2WYJA 3P95A 4ZXYH 5E2PA 1F0SA 3ZZCA 1C1QA 2XNIA 1AGJA 1KLJH 2XC5A 1KY9A 3A81A 1C1WH 2FI5E 3A7YA 1YF4A 1SLVB 2ZKSA 4BAHB 2P95A 1XVMA 4FUHA 3I78A 1HXEH 2GCHF 1OP2A 3QDZB 2EC9H 3TK6A 2BDYA 1JOUB 2TGDA 2W3IA 1IQHA 1BOQA 3HATH 1PQ5A 3TJUA 1ZHPA 1O2MA 2OC7A 2WPIS 1O3KA 2XC0A 3PO1B 1W12U 3ZVEA 2Y5GA 1ESBA 5E0JA 1QJ6B 3SU2A 1EAXA 2GKVE 1UK3A 2ZGBH 3LGIA 2IJOB 5L30H 3FVFB 4SGBE 3GOVB 3M35A 2GGVB 5HGGA 1ELEE 1AKSA 2D8WA 2G4UA 4RN6A 1AY6H 1K2I1 4H42U 2BQWB 1C5LH 1HFDA 4A1XA 4I8GA 1YPKH 1DY9A 2VGCC 4RSPA 1SQAA 1Y3VA 2ZU5A 5T6GA 4AB8A 3SHAH 4X2VA 4AGJA 1LKBA 2A4QA 4BAQB 2WINI 3KQCA 3Q77A 1EZSC 3SJ8A 3M3TA 3E90B 3LJOA 3STJA 3LT3A 3O8DA 2BTCE 1ZSLA 3P70B 3RXSA 1UVTH 1A2CH 3BTGE 2FX4A 3T62A 1QJ1B 1GBKA 1Z7KA 3RXHA 2BD2A 1TIOA 4HZHA 1TPPA 1NRNH 1TNKA 1LHCH 1SGDE 1Y3YA 1RTLA 2NWNA 4FU8A 1DANH 5K7RA 2ZIQH 3ODFA 1JIMA 4WWYA 1A0HB 3NPSA 1FDPA 5JBBS 1GL0E 1LCYA 1MMJN 4NIXA 5GPIB 2GV7A 1K1OA 1XUKA 2C93B 2OC1A 1CT2E 1MUEB 2J38A 1XUGA 2VWOA 3PMHB 2NU2E 1TRNA 2QA9E 5J4QA 2VIWA 1K1MA 3K9XB 1QGFA 3UREA 3BF6H 1GCDA 3H7TA 4MPWA 4U01A 3URDA 4BTUB 1TBZH 1O2GH 3SV7A 1GJAB 1GHVH 1LVOA 2EA3A 1CVWH 1KDQA 4Z0KA 1BBRE 5T6DA 2QXIA 3ZVCA 1H9HE 4IW4E 1P0SH 2ZFFH 3M5NA 5F8ZA 1SOZA 3UWIA 1HLTH 2NU4E 4GUXA 1PQ8A 1C1RA 1HAXB 4XOJA 1CHOG 1BBRK 1GDNA 2D1JA 3GDSA 2AMQA 1O5GH 3MO6A 1O3DA 3FP6E 1FAKH 3D62A 3TH2H 1TGNA 2H2ZA 1YPLH 3PWCA 2V6NA 5BRRE 2ZP0H 1AZZA 5JPMH 4MNVA 2BOKA 3MI4A 2ZGHA 3WY8A 4X8SH 1C4Y2 1K21H 2O8LA 1AN1E 1CU1A 3NWUA 1RTKA 4WF8A 4CRCA 2R9PA 3AVZA 4I8JA 1DFPA 1QL7A 1G30B 1HAHH 4B76A 4AYVB 4DURA 3SZNA 1C2MA 1SPJA 1NRRH 3LDXH 4X1RU 1TGTA 1NT1A 1JMOH 2OP9A 1EJAA 6CHAB 3F9FA 3UY9A 5EXMA 1TBQH 2O8WA 3RXCA 4NIYA 2C8WB 4NIWA 2QY0B 4Y6DA 1ZJDA 4YT7H 1CHOF 2TRMA 4LZ4B 3FFGA 3A7WA 1P10A 3A7VA 1B0EA 1MQ6A 7ESTE 3GY4A 1QA0A 2H9TH 2OLGA 5L2ZH 4DIHH 2BDIA 2FOEA 2B9LA 5AFYH 1C1MA 3RXVA 3QGJA 3E16B 1KYNA 2BQ7B 1EZQA 3GY5A 4UFEH 4ABIA 2A7JA 1BMAA 1GJBB 1QRXA 2AGGX 4HFPB 1P11E 2BD4A 2ZHQH 3ZZ8A 1XXFA 4THNH 3T26A 1DX5M 3ZZ5A 1YM0A 4X0WU 1YKTA 4DGJA 1GBDA 5JBTA 3VB6A 5FCKA 1B5GH 1O2XA 4CRFA 2W26A 3RU4D 1DS2E 2XBVA 6ESTA 5E0HA 3TH3H 4JK5A 2A4OA 1J15A 2BD9A 3U69H 1Y59T 1BHXB 1MTWA 3RXKA 3PTBA 2HNTC 4NA7A 1A61H 1W8BH 2SGDE 4KTUA 1T4UH 5EPYA 1C2FA 1J9CH 1S0QA 1WQVH 2ALVA 3DA9B 1NESE 1TNJA 2Z7FE 1O5AB 3O8CA 2SFAA 1QQ4A 2FXRA 2ZDMA 2CHAB 4AG1A 2HPPH 3RP2A 2PV9B 4TPYA 1G32B 2PFEA 3M61U 4UDWH 3H7OA 3P6ZB 3W94A 5CHAC 1GCTB 1OWEA 1BRBE 2VWMA 1GPZA 1TRMA 1O2NA 1LHDH 2Q6DA 2FYQA 2BY7X 1K1LA 3LC5A 1W11U 2F9BH 2GDEH 2ZPRA 1IQIA 2Y6TA 2BD3A 2ZGXH 2RG3A 3H5CB 5HM2A 1UJ1A 1V6DA 2VH6A 1K1NA 2BVXH 1IQEA 3A7ZA 4F49A 1QR3E 3U8TH 3KIDU 1BRAA 1V2QT 1ANEA 5A0CA 1BTWA 1FY3A 2OCVB 5DGJA 2BD5A 2A31A 1QNJA 1NFWA 2BQ6B 1ABIH 2PLXA 3BG4C 5A0AE 2BDHA 2BD7A 1RIWB 4E06H 3F9HA 1G3EA 1FQ3A 1OOKB 1VITG 2ODQA 5ABWA 2RDLA 5E8EH 5I46H 1P2JA 2A1DB 4FUBA 3E3TA 1RGQA 2UUKB 2Y7ZA 1Z1IA 4A1TA 5FBIA 2QGRA 2Q1JA 4DIIH 7LPRA 4ABGA 2XRCA 3MNSA 3ZZ7A 1G36A 4X6PA 3RXQA 1CE5A 1UMAH 4CBOA 1LTOA 7GCHG 2ZTXA 1AUTC 2HLCA 1DWDH 3ZV9A 4LXBH 3HKIB 1PPHE 3PROA 2ZCLP 2ZDVH 4FXGH 2OQUA 1AMHA 1AO5A 5DP3A 4D9QA 3NXPA 3L33A 3BG8A 4XBBA 4UFFH 1UTOA 2VVVA 1KXCA 4DCDA 1VITF 4JK6A 4UFGH 1KLIH 1DVAH 1O2OA 4INHA 3RMNH 1OWKA 3M5OA 2SGAA 5FPTA 3HK3B 1O3PB 2W3KA 2CXVA 4GSOA 1WYKA 3RXDA 3A8CA 4CRBA 2J94A 5A0BA 1TA6A 1AWHB 1NC6A 4LK4A 7GCHF 2A4RA 1C9TA 1LO6A 2FWWA 3PLBA 3HKJB 5DP7A 1GI4A 3MU0A 3SJ9A 2D26C 1BUIA 3MO9A 2V3OH 2AMPA 5DP5A 3F9EA 1HGTH 2AFQB 2CJIA 3BV9B 2IOTA 2FTMA 3VXEH 1OWDA 4ZH8A 2FI4E 2ZPQA 1EQ9A 1CHGA 1SGEE 2ZHEH 1CBWB 3PV4A 1E0FD 1O2YA 1S0RA 1GJ9B 3FZDA 1O3FA 3GICB 1BTPA 3ZZ9A 4X1PU 1YP9A 5GDSH 2PW8H 4K8BA 1OPHB 3GCNA 4TWWA 1ZTKA 1ZGVA 1YBWA 1INCA 1YYY1 1C5WB 3MH6A 5F03A 3UFAA 1S6FA 3BN9A 3KGPA 2FOFA 1C5PA 3IG6B 4MTBA 1T8OA 4GCHG 3OY5U 1O2JA 1ELFA 3PYHA 2GZ7A 2QCYA 1C5VA 1YPGH 4CR9A 4GPGA 1HIAB 2TGTA 4MPXA 3V3MA 4X8UH 2OC0A 5JB9S 5EU8A 1N8OC 2V3HH 4ABFA 4AG2A 3BTHE 1PYTD 2C8XB 1IQKA 4FUFA 2GX4A 3CENA 3S7KB 4PROA 2G52A 3RDZA 3ZZ6A 3RM2H 1TA2A 1TX6A 5FX5A 2PKSB 3M37A 3FP7E 2TPIZ 6GCHG 3SO3A 3E8LA 2ZHFH 4U32A 2QXGA 3SI4H 2OBOA 1JRSA 4RKOB 1MTNB 1XMNB 3SNAA 1OP0A 2ZG0H 2Z3CA 4GCHF 1RS0A 1LVBA 1IQMA 2VNTA 3LPRA 1SFIA 4X8TH 1FUJA 4GAWA 2NU1E 2KAIA 2BOHB 1V2OT 1AU8A 2WPLS 2M5TA 1WAYB 2R2WU 1O3IA 2VB0A 1O3GA 3ZVGA 1ACBE 3UWJH 4I8KA 1ZPZA 2BDGA 2G55A 1ZSJA 1NN6A 1HYLA 5ETXA 3TPIZ 3K6YA 1T7CA 4Q2KA 5L6NH 1GBMA 3A87A 4XDEA 1F0RA 1UVOA 4ASHA 1A0JA 2ZTZA 1UTNA 1EUFA 1TWXB 2GT7A 1FMGA 3Q00A 1VJ9U 3ZVDA 2VVCA 1G3CA 3EDXB 3E1XB 3GYMA 4R8TB 2P93A 3GISB 4RKJB 1UTJA 2BXTH 2SGPE 1DOJA 4Y8YA 1LVYA 2SGQE 1C2JA 1L2EA 2WYGA 5JBCS 1HAZB 1A46H 1DY8A 3C27B 1ANBA 2VIPA 1BZXE 3FAOA 1J16A 2VIDA 1QB1A 1GBBA 1PPEE 1VCPA 1SGFG 1TOMH 2BHGA 3MYWA 2EEKA 2THFB 3LGVA 1KTTB 2AGEX 3SUEA 1ZPBA 1GMHG 4O9VA 3RXBA 2GZ8A 2WV5A 1EZUC 1EP5A 2UUFB 1FIZA 3LGTA 2A45B 1MTVA 1AQ7A 1BMMH 4ABAA 2OBQA 2AH4X 4WH6A 2UWOA 1BTXA 4NG9H 2G5VA 2GD4B 2QAAA 3EA7A 1FPCH 4ISOA 1TOCB 1DUEA 1BTZA 2WPJS 1W3CA 4DJZB 1K1IA 1TPOA 1C5SA 4AFZA 2WPKS 5DP8A 4ZHAA 1ZR0A 4X8VH 1GDQA 2Q6FA 2ZCKP 3DHKH 1LMWB 1O37A 1A3EH 1Q2WA 3RU4T 2GV6A 3TGIE 2FYRA 3IWMA 3P8NA 1DSTA 4MNWA 1SGNE 1C9PA 3LOXA 2F83A 3SJKA 1GMHF 1MD7A 3FZZA 2GZ9A 4MQAA 3DFLA 4CRDA 3BTKE 4KKDA 4OS4A 3KF2A 2ESTE 4K8YA 1EAWA 1WTHD 1OS8A 3T28A 4BOHA 3DUXH 1ANCA 3AW1A 5C5NA 1S81A 4OS5A 4JZFH 1SG8B 1NPMA 3Q3YA 5EODA 2HALA 4IN1A 1EASA 3OU0A 1OX1A 5GCHG 5HMAA 4AX9H 1C2IA 1E34B 2XC4A 3VB3A 2ZI2H 8GCHG 3SV9A 1ID5H 1TQ7B 4WVPE 3GY6A 5AHGH 1EX3A 1QHRB 2QXHA 1Z8RA 2Z3DA 3ZZDA 1HRTH 1TNIA 3S9CA 2BDCA 2QF3A 1SGIB 1L4DA 1MKWH 1MCTA 1IHTH 3U9AH 1BITA 1TE0A 1YLDA 4NCYA 4GLYA 4XE4A 2AIPA 2W7UA 1GBHA 1Y3WA 3RXUA 2UWPA 1IAUA 4X6OA 1EOJA 2AEIH 4ISHH 4F4OC 2AERH 4MPVA 3OX7U 3VXFH 1DWBH 1TGCA 1AVGH 1IQLA 1TX8A 2J4IA 1BQYA 2VGCB 4ABBA 1GBAA 5FBEA 3RMOH 1XM1A 1FY8E 1O3LA 4X2YA 1ZHRA 4I8HA 1NU7B 8GCHF 2PUXB 1UTMA 4IMQA 1GJ7B 5FPSA 1Q3XA 1ESTA 4IBLH 1LDTT 4YLQH 2G4TA 4AGKA 2PTCE 1AIXH 2P3UB 1JRTA 3PMBB 1Z8GA 3P17H 2H9EH 3UR9A 2BM2A 2XBWA 4Y71A 2BY5X 3LONA 1CGIE 1IHSH 2BX4A 1IQFA 3E91A 1S84A 3PLKA 1V2RT 2GP9B 4D9RA 2QYIA 4FUJA 1SFQB 1F5RA 3E0NB 5DG6A 1LPZB 2QN5T 3A86A 4MPUA 4A1VA 2CF8H 3QGNB 3FP8E 5CMXH 3OY6U 1MKXH 1HJ8A 1CA0C 1Y8TA 1W10U 1QBVH 1O2RA 4K1SA 5C20A 1EJMA 1AE5A 3RXPA 1O3BA 3OTJE 3HGPA 1EPTA 1O32A 1GJDB 2TGPZ 1ETRH 3A82A 3SU4A 3GY8A 1AFQC 3U98H 4DY7B 3O8RA 3E6PH 4KP0A 1GI8B 1O30A 2TGAA 1SSXA 3UNRA 1QRWA 1A5GH 1DITH 4I33A 5J4SA 3LGWA 2O8UA 4Q7YA 1Z8IB 2G81E 5C2ZA 4ESTE 2PWXA 4TPIZ 1T32A 1F5KU 2ZGCA 5JBAS 1V2WT 2F9UA 3MU4A 3GY7A 1O5CB 2C4FH 2VVUA 4M7GA 1HCGA 3T27A 1LHGH 2H6MA 2GMTC 3U8RH 1ZRBA 4IC6A 1XKBC 3QX5H 1GBIA 1YCPK 3OSYA 1NO9H 2ZNKH 2JH5D 2HNTE 4I32A 2Z9JA 1BHXF 1K22H 1GI9B 1GHYH 5AFZH 1YGCH 2CN0H 4YM9A 5A8XA 5JDUB 3SV6A 1FV9A 1BJUA 3SV8A 4JZ1A 3EAJA 2FOCA 3ELAH 1A7SA 4TYDA 4Y7AA 1AKSB 1FJSA 1D6RA 1VCQA 1LPGB 3L6PA 3BTME 1O5FH 2B0FA 5EOKA 1KXDA 2C8ZB 1TFXA 4UD9H 1NRQH 1C1OA 2ZU4A 2UUYA 2PHBA 3SUGA 2H5DA 2GTBA 2ZCHP 5ESBA 1MD8A 1M9UA 1SGRE 3B9FH 3NUMA 3ZZ3A 2EI7A 3SGAE 3I77A 2QIQA 3T2NA 2IPHA 2XXLA 1S85A 3MNCA 5A2MH 1IQNA 4JZIA 4OGYA 4XBCA 4NIVA 1GI1A 1G3BA 2CMYA 1J14A 3VGCC 4K5ZA 2PSYA 4HTCH 1DXWA 2ZFRH 2P3TB 4GHQA 2P94A 1RJXB 4I31A 2J9NA 2IN2A 2O8TA 1E38B 3RXIA 1H1BA 1GI5A 3W95A 1GVKB 3EYDA 1B0FA 3RMMH 1LVMA 1C5XB 1HAGE 1P03A 1LHFH 3GCOA 1A3BH 2FTLE 1EB2A 3CS7A 1GHXH 1C2HA 1C5TA 3RMLH 5HXFA 3E0PB 2B7DH 2H1UA 1HXFH 1ELVA 3IITA 1EPTC 4XBDA 1ETTH 3ZZBA 3QK1A 2W7SA 3RLYH 4BAKB 2BY8X 1DE7H 1W13U 2JH0D 1P2IA 1P09A 2FESH 3L3TA 1KDQB 1HDTH 5C1YA 2VINA 3N7OA 2ALPA 4LOYH 3BTTE 1ESAA 1SL3A 1GI0A 1D4PB 2P16A 1NRPH 1XX9A 1GHZA 2HRVA 5FCRA 1MCVA 3BEUA 1YPHE 4Y0ZE 1ZMNA 4CH8B 5ESTE 2ZFTA 4OS1A 1HAYB 1GJ5H 1QBNA 1AI8H 4DT7B 2BXUH 3P8OA 8LPRA 1O2HA 1D3PB 1HAOH 3DD2H 3T25A 1NFXA 5CHAB 2PKAA 1TALA 1ZOMA 4MG3A 1YCPM 2ZHDA 4K3JA 1F92A 1AB9C 1P9UA 3SGBE 3BTQE 3LU9B 2ZPSA 3LGUA 1MTSA 2A5IA 2FPZA 3F9GA 2YOLA 2BDBA 1K1JA 1GI3A 4I7YH 5H4IB 2ZA5A 5EGMA 4Y79A 4B1TA 2PTNA 3EE0B 4KGAA 1SGQE 2ZFSA 1BT7A 1TPAE 1VCWA 2DE8A 3BG4B 3ESTA 2BD8A 4Y7BA 4INLA 4BTIB 1QL9A 4DG4A 1YCPH 3B23B 4FU7A 4X1QU 3ATWA 3PLPA 2JKHA 2V35A 1PQ7A 3NCLA 4E7RG 1PQAA 1O3EA 1RD3B 1U6QA 3B8JA 4J2YB 4K2YA 3KEEA 1QB9A 2A4GA 4X1SU 2RA0A 7KMEH 3QUMP 4HGCA 1GG6C 1KXFA 1P8VC 3RXOA 5I25A 3RXEA 4WH8A 1ZTJA 2WV4A 1YPHC 1G37A 6LPRA 3EGKH 1QRZA 1ZZZA 1CSOE 3M36A 1BJVA 4D7GA 2P59A 2AMDA 3A8BA 2BVSH 1EATA 4JMYA 1QA7A 4YESB 4ZHMU 3TLOA 3ZVFA 2BYAX 2A0QB 1GGDC 1V2KT 1OXGA 1UHBA 4Z6AH 3HGNA 3SJOA 3KQBA 1RRKA 1UVSH 2FOBA 2JETC 1L4ZA 1V2NT 4B2CA 3QLPH 2YNAA 1GJ4H 1ZLRA 1IQGA 4WJG2 1Z6EA 4A92A 1E36B 5LPRA 2DUCA 1ORFA 4U2WA 1GJCB 3MU5A 4FUGA 3GCTG 1O35A 1BRUP 3TJVA 3R3GB 2H9HA 4VGCC 1TABE 3F68H 1C1SA 1MU6B 1CT4E 3K2UA 4X1NU 1L1GA 2I6QA 2BB4A 5DKMA 4UEHH 1C5NH 1B7XB 3ATIA 1MBQA 1DM4B 1DUAA 1VZQH 1V2VT 3RC5A 1O3JA 1Q31A 2PGBB 1UCYK 1DSUA 2R0KA 1TRYA 1C5RA 2FO9A 1AFEH 1C1VH 1NS3A 3MH4A 3RU4E 1YPJH 3VFEA 2FI3E 5JYIA 2ODPA 1PPFE 4H6SB 1DLKB 2WUCA 1KTSB 4UE7H 1D6WA 1QIXB 2XYAA 1HJAC 5FPYA 3OYPA 2ZDKA 1GHWH 1XVOA 1AD8H 1JIRA 1P57B 1C1TA 1WU1A 4E05H 4YTAA 3AAVA 4AZ2B 1A0LA 3GCHC 4OS2A 1SBWA 1QBOA 3QZRA 2GDDA 3BEIB 2A2XH 1ZSKA 1SI5H 1X7AC 1J8AA 1A1RA 5FX6A 3VB4A 1MKWK 4INKA 1O5DH 4CHAC 4XFQA 3GDUA 1N8OB 3RXMA 1ZHMA 1EP6A 4O03A 2ZDLA 3V7TA 1ARCA 4BAOB 1TNLA 1O34A 1KLTA 3TGKE 1XKAC 3KN2A 4ABEA 1MH0A 1LHEH 1UTKA 1YPEH 3RC4A 3TNTA 2Z6BD 3NZIA 1PPGE 2C8YB 4H4FA 2Y82A 1O2KA 1CA8B 3S0NA 1EKBB 2OC8A 2VU8E 4ZKRU 1GHBG 2FS9A 2OTVA 3RXFA 1VGCC 3KQEA 4ABHA 2CF9H 1C5MD 3ENSB 2BY9X 3A85A 2Q6GA 2B8OH 6GCHF 2ZGJA 2HPQH 5GJ4B 4E7NA 2OUAA 1Z1JA 1C5QA 4IS5A 1O0DH 3M5LA 1YPMH 2FOMB 1SOTA 1DT2A 2XW9A 2CGAA 1C2LA 1VITH 1SLUB 1O39A 3SGQE 2VWLA 1H9LB 1C2GA 4GVUA 4DVAU 1IQJA 1MKXK 3NKKA 1JWTA 3Q76A 3UNQA 1SGTA 1ELDE 3RLWH 1FN8A 1Y3XA 1L1JA 4XSKU 4CH2B 3M3SA 1HPGA 3M5MA 1SQOA 4WXVA 1S82A 2G00A 2P8OC 5LPEA 1VR1H 1THSH 1K9OE 1ABJH 3BSQA 1O2SA 5T3HA 3Q3XA 1W0ZU 1GHBF 4IGDA 3S9BA 4MVNA 3NK8A 5F8XA 1EXFA 1KXBA 3TITA 3KHVA 1G2MA 3DT0H 4ISIH 1S6HA 1TPSA 4FUIA 4ISNA 3MO3A 4I8LA 3UR6A 1CQQA 4WMEA 1F0TA 3BEFB 1FI8A 4ABJA 1EAUA 4MLFB 4D7FA 1BTUA 4BXSA 4LZ1H 4MNXA 4ZAEA 4Y8XA 2ANKH 2BX3A 3BTFE 4OS7A 4A5TS 1ELTA 1HB0B 2EI8A 2XBYA 4NSYA 1CGHA 1UCYH 2F9NA 3F1SB 1KXEA 1G2LA 2A32A 4R0IA 3SQHE 5C67A 3GY3A 4IC5A 4GHTA 4ZXXH 1VJAU 2C3SA 3PO1C 2ZDNA 3ZVAA 5HYOA 3CP7A 1ZMJA 4K60A 5AF9H 2I6SA 2Z9KA 2GVFA 3HK6B 4NGAH 3VB7A 3SU0A 3LH1A 5EW1H 4JYTA 4BANB 5FHTA 3TK5A 1HBTH 3STIA 1GBFA 3G01A 3RXJA 3MH7A 4X2WA 4FUDA 1MZDA 1H9IE 3SBKA 4UONA 3AASA 4OGXA 5EG4A 4JCNA 3RXAA 1F7ZA 1HAIH 1A5IA 3RXRA 4IMZA 5GXPA 3A8DA 1UK2A 3ATMA 3S69A 4YOJA 2SNWA 3MHWU 1THPB 1H4WA 1OWHA 1WQSA 4JZEH 2YNBA 3P92A 2W5EA 5JB8S 1GMCG 4Q7XA 1O36A 1BMLA 4CRAA 2VIVA 2VJ1A 3MU1A 3PB1E 4MDSA 3M7QA 1TQ0B 1ZGIA 1DWEH 3QN7A 3TVJB 1C5OH 2LPRA 5E2OA 2ODYB 2KAIB 3M7TA 1Y5AT 1UK4A 2A5KA 1QFKH 5EXLA 3T29A 1JXPA 1ZMLA 5GCHF 2HWLB 5PTPA 1XXDA 1BMNH 2HGTH 3D65E 1QY6A 1Z71A 2XCFA 1BTYA 4K1EA 1H8DH 2J2UA 3U8OH 3O8BA 1QQUA 3SU3A 2ZECA 1TNHA 3TJOA 2PGQB 2ULLA 1FXYA 3U1IB 4K69A 1GBLA 1P01A 4WMFA 2DE9A 1C2KA 1N1LA 4KTSA 1QCPA 1THRH 3RC6A 1O3HA 1XUHA 1GMCF 1O2QA 1C5ZB 1TAWA 2FLBH 1P2NA 1UVPA 1PJPA 4NA9H 1O2TA 1ZRKA 5G4BA 1GBJA 4X6NA 3ZYEA 1T31A 3F6UH 5L2YH 4CBNA 1UVUH 4D8NA 1C4U2 1C2DA 2TIOA 4CREA 1P3CA 2R3UA 1UTLM 1C1UH 3HPTB 3M3VA 1BDAA 1ZTLA 4Q80A 1D3QB 3A88A 2CV3A 2OD3B 9LPRA 5F6MA 1V2ST 1BIOA 2ILNA 1BCUH 5EXNA 3KL6A 1TYNA 1PYTC 5FXLA 4JZDH 2Z9LA 1P05A 5DP9A 3UQVA 3BTWE 4BAMB 5A8YA 2BZAA 5DPAA 2ZZUH 1GVLA 1YLCA 3RXGA 1D3DB 2ZDAH 2STAE 3RXLA 4A6LA 1CA0B 3RM0H 2P3FH 2FOGA 4YOIA 2Z9IA 1TONA 2BLQA 3I29A 3QTVH 6CHAC 1YC0A 1RFNA 3PM3A 4AB9A 3A84A 2V0BA 3TH4H 1GHAG 1O2VA 1AFQB 3JZ1B 4B75A 1C4V2 5DK1A 4Y10E 3ZVBA 2FOHA 1MBMA 1O2UA 2FZZA 4NFFA 1ANDA 1SGCA 5TCCA 1ZJKA 1UTPA 1KXAA 3SV2H 1QURH 2ZO3H 4Y76A 3MOCA 3UUZA 1RTFB 2TBSA 1SGYE 3SUDA 1DLEA 1OSSA 2F91A 2GMTB 1O3OA 2OINA 1V2PT 1E35B 4HI3A 3TNSA 4B71A 3MH5A 4H6TA 2ZC9H 4O97A 1T8MA 2HNTF 3VB5A 1LKAA 5IDKA 4B2AA 1K1PA 3SU6A 5EQQA 4Q7ZA 1GHAF 1T4VH 3A89A 2A7CA 2O8MA 1D9IA 1FZZA 1H8IH 2D2DA 1Y5UT 1KIGH 1KSNA 4Y0YE 4AFUA 2FM2A 1DWCH 4K1TA 2FLRH 2C90B 3KNXA 3URCA 1TNGA 4TY7A 1NFUA 1SVPA 2VH0A 3ZV8A 1FPHH 1PFXC 4J1YA 2G8TA 4D76A 3AAUA 3UIRA 2ANWA 1V2LT 3M7UA 4O3TA 1D3TB 1P2QA 5EQSA 1AE8H 2ZU2A 1PPBH 4TY6A 3ATKA 3MMGA 2G5NA 2K1QA 2GCTC 3A7TA 5LPFA 1LPKB 1V3XA 1MZAA 1GBCA 5CE1A 4X2XA 3RXTA 1EZXC 1W2KH 3TJNA 2CHAC 2F3CE 4NWLA 2AIQA 4WY3A 4Y8ZA 2FODA 2O9QA 1MAXA 1AWFH 2VIOA 1GCTC 2J34A 3UTUH 1L0ZA 1L1NA 3VGCB 2EI6A 1V2JT 2XWAA 5T6FA 2BLOA 1ZPCA 3PWBA 3R0FA 5F8TA 1MU8B 2ZTYA 4BNRA 1P06A 2GCTB 1O38A 2Y81A 5TJXA 4BTTB 5IYTA 5SGAE 1NU9A 5EW2H 1TLDA 4TWYA 4NFEA 3S7HB 3K65B 1MQ5A 1O2IA 3GDVA 3A7XA 3P8GA 1P2OA 3ZYDA 5C1XA 3A83A 1F2SE 2ZHWH 1RIWC 3LKWA 1EPTB 2Y80A 1DICA 5DP6A 1HIAA 2JH6D 1AVWA 1O33A 1W7GH 1SHHB 3V12A 3VEQB 3SORA 3LIWA 1V2UT 3DFJA 2ANYA 1V2MT 3UOUA 1ZYOA 2J95A 2GT8A 4YT6H 2F9VA 2H5CA 1BRCE 4ZUHA 3D23A 5AVDA 1NFYA 3U1JB 3VPKA 1EB1H 4FUCA 5K0HA 3MNXA 4BXWA 1BBRH 3QWCH 2F9OA 2FP7B 2SGEE 1P3EA 4B74A 5BPEA 4O3UA 2AGIX 4FVBA 1TMUH 1NY22 2ZWLH 1GI2A 1ELAA 1WBGB 4ZKOU 1J17T 5C1UA 1WSSH 1TB6H 4ZROA 2FIRH 5E0GA 3SW2B 3BTEE 4MNYA 1O5EH 4ZHLU 1AVXA 2BVRH 1AB9B 2XCNA 2UUJB 4YO9A 2WPHS 2LNCA 1OP8A 1TMBH 1W7XH 1G9IE 3Q3KA 4B2BA 1QTFA 1HNEE 1HUTH 2FOAA 1OYQA 3S9AA 1FY1A 1HJ9A 5GIBA 1CO7E 2FEQH 4NZLA 1O3MA 4X6MA 1PPZA 3UNSA 4QT8C 1QL8A 2FMJA 1O3AA 4AORA 2Y5FA 2OXSA 1P02A 4ZMAH 3V13A 3SNDA 2QF0A 1GBEA 1MAYA 1P2KA 9ESTA 1RXPA 1SLXB 1GG6B 2BMGB 3QO6A 2Z3EA 3TK9A 8KME2 3SN8A 1F5LA 1GWAA 3EA8A 4ISLA 1PPCE 3ZZAA 5FAHA 1FY4A 2OQ5A 3ITIA 3AW0A 4ZKSU 1Z8JB 3SNEA 1OKXA 1BA8B 2PR3A 1CBWC 3SI3H 1TGSZ 2WUBA 1NTPA 2Y7XA 3ATLA 1Y3UA 1FAXA 3SNCA 1UCYE 2B5TB 1XUIA 1WUNH 1GGDB 3MTYA 2FX6A 2G51A 1JBUH 1HAVA 3SNBA 1P12E 1SGPE 1UTQA 2ZQ2A 2SNVA 1GDUA 1NZQH 4JYUH 1C2EA 2JETB 2ZQ1A 3TIUA 1SR5C 2ZU1A 1O3CA 4AN7A 2PSXA 2Y5HA 1T8LA 2NU0E 2ZEBA 3UQOA 1N6YA 1ELCA 1BTHH 2AS9A 1TMTH 4SGAE 4NA8A 1FLEE 3BIVH 1HV7A 2BY6X 3MFJA 4VGCB 5DJ7A 5B6OA 1ELGA 1W14U 2Z94A 1QB6A 3MWIU 3SJIA 2Z9GA 3MNBA 1GI6A 1WTGH 4FVDA 1O5BB 3PMAB 2FS8A 3GCTF 3GYLB 2ZFPH 3EA9A 2A2QH 1FY5A 1AZ8A 3SQEE 1SC8U 2PKSC 2UWLA 3ZZ4A 3JZ2B 1C5UA 2XWBI 4FU9A 1DXPA 1NRSH 4CR5A 1G3DA 1NM6A 1EAIA 1GJ6A 1A5HA 1C5YB 1QJ7B 2STBE 3TU7H 1OWJA 3LH3A 1ARBA 1OWIA 2PKAB 4NZQA 4DW2U 1CT0E 1MTNC 4WXIA 2R3YA 3D49H 2ANMH 4UFDH 1HJAB 5C3NA 1IOEA 1WCZA 1O3NA 5A09A 4ZKNU 2RA3A 2ASUB 5LGOA
chains in the Genus database with same CATH superfamily
1O31A 1Y5BT 2WPDD 1BB0B 1SHYA 2A7HA 3FANA 3PRBA 3SUFA 1UO6A 2BZ6H 1MTUA 3LC3A 1TX7A 3A8AA 3GCHB 1C1PA 3WWFA 1GMDG 4YLUA 1HAPH 1FN6A 3RUOA 1FX0B 1DPOA 3KYGA 1ETSH 3PTNA 4B73A 2PUQH 2R2MB 1E37B 4FUEA 1DDJA 2ZF0H 5C5OA 4CHAB 3P8FA 2VWNA 3F2FA 3A80A 1N6XA 2J92A 4NSVA 3MU8A 4OS6A 4JYVH 1FNIA 1GJ8B 1GL1A 4NWKA 3EQ0H 1SGFA 4KELA 4YZUA 4A7IB 2RCEA 2FDAA 3PMJA 1P2MA 3EE7A 1O2ZA 2ZFQH 4DOQA 1EJNA 1S83A 3KCGH 1WOFA 1Z6JH 1AHTH 1GI7B 4ABDA 3SOSA 1V2TT 2ZU3A 1EOLA 5GWZA 1W0YH 2QC2A 1XUJA 5FL7D 2VIQA 2HOBA 1SQTA 4AFSA 5A8ZA 1C1NA 1O2WA 1O2PA 1VGCB 4CRGA 1GMDF 2BDAA 1T8NA 2BLWA 2KCPA 3ODDA 3H09A 8ESTE 1LQEA 4U30A 1A4WH 1SB1H 2SGFE 3K6ZA 1UHBB 4WMDA 3QZQA 5HM9A 3SU1A 1S5SA 1CGJE 1LQDB 3F0PA 4AOQA 2WPMS 3GY2A 3SHCH 4Y11E 2QV1A 1GVZA 5LH8A 1NROH 2LP6A 2F9PA 2XTTB 2R0LA 3LGYA 2QF5A 2XNDD 3KQDA 2GCHG 3QTOH 4B6EA 1P9SA 3BTDE 1F0UA 2RFKC 1GBTA 3UPEA 3CS0A 3TGJE 2BLVA 1O2LA 2HVXA 3SU5A 4IN2A 1HAVB 1XUFA 5EQRA 2AYWA 2P8OB 5TCAA 2XBXA 1K28D 3C1KA 1WV7H 1OYTH 1FONA 1TGBA 3UOPA 5DO4H 3BIUH 3V0XA 3LJJA 5EPNA 1AUJA 1P04A 1SLWB 1FIWA 1SMFE 1TBRH 2A5AA 4YOGA 2QXJA 2NU3E 5DP4A 3T5FH 4KTCA 4AFQA 1ELBA 4AYYB 2WYJA 3P95A 4ZXYH 5E2PA 1F0SA 3ZZCA 1C1QA 2XNIA 1AGJA 1KLJH 2XC5A 1KY9A 3A81A 1C1WH 2FI5E 3A7YA 1YF4A 1SLVB 2ZKSA 4BAHB 2P95A 1XVMA 4FUHA 1W0KD 1HXEH 3I78A 2GCHF 1OP2A 3QDZB 2EC9H 3TK6A 2BDYA 1JOUB 2TGDA 2W3IA 1IQHA 1BOQA 3HATH 1PQ5A 2XOKD 3TJUA 1ZHPA 1O2MA 2OC7A 2WPIS 1E79D 1O3KA 2XC0A 3PO1B 1W12U 3ZVEA 2Y5GA 1ESBA 5E0JA 1QJ6B 3SU2A 1EAXA 2GKVE 1UK3A 2ZGBH 3LGIA 2IJOB 1YLNA 5L30H 3FVFB 4SGBE 3GOVB 3M35A 2GGVB 5HGGA 1ELEE 1AKSA 2D8WA 2G4UA 4RN6A 1AY6H 1K2I1 4H42U 2BQWB 1C5LH 1HFDA 4A1XA 4I8GA 1YPKH 1DY9A 2VGCC 4RSPA 1SQAA 1Y3VA 2ZU5A 5T6GA 4AB8A 3SHAH 4X2VA 4AGJA 1LKBA 2A4QA 4BAQB 2WINI 3KQCA 3Q77A 1EZSC 3SJ8A 3M3TA 3E90B 3LJOA 3STJA 3LT3A 3O8DA 2BTCE 1ZSLA 3P70B 3RXSA 1UVTH 1A2CH 3BTGE 2FX4A 3T62A 1QJ1B 1GBKA 1Z7KA 3RXHA 2BD2A 1TIOA 4HZHA 1TPPA 1NRNH 1TNKA 1LHCH 1SGDE 1Y3YA 1RTLA 2NWNA 4FU8A 1DANH 5K7RA 2ZIQH 2YMSB 1E1RD 2W6ID 3ODFA 2KR7A 1JIMA 4WWYA 1A0HB 3NPSA 1FDPA 5JBBS 1GL0E 1MABB 1LCYA 1MMJN 4NIXA 5GPIB 2GV7A 1K1OA 1XUKA 2C93B 2OC1A 2L6OA 1CT2E 1MUEB 2J38A 1XUGA 2VWOA 3PMHB 2NU2E 1TRNA 2QA9E 5J4QA 2VIWA 1K1MA 3K9XB 1QGFA 3UREA 3BF6H 4Q4LA 1GCDA 3H7TA 4MPWA 4U01A 3URDA 4BTUB 1TBZH 1O2GH 3SV7A 1GJAB 1GHVH 1LVOA 2EA3A 1CVWH 1KDQA 4Z0KA 1BBRE 1OHHD 2QXIA 5T6DA 1H9HE 4IW4E 3ZVCA 1P0SH 2ZFFH 3M5NA 5F8ZA 1SOZA 3UWIA 1HLTH 2NU4E 4GUXA 1PQ8A 4FOUC 4XD7D 1C1RA 1HAXB 4XOJA 1CHOG 1BBRK 3F0OA 1GDNA 2D1JA 3GDSA 2AMQA 1O5GH 3MO6A 1O3DA 3FP6E 1FAKH 3D62A 3TH2H 1TGNA 2H2ZA 1YPLH 3PWCA 2V6NA 5BRRE 2ZP0H 1AZZA 5JPMH 5EIYA 4MNVA 2BOKA 3MI4A 3PRDA 2ZGHA 3WY8A 4X8SH 1C4Y2 1K21H 2O8LA 1AN1E 1CU1A 3NWUA 1RTKA 4WF8A 4CRCA 2R9PA 3AVZA 2KZ4A 4I8JA 1DFPA 1QL7A 1G30B 1HAHH 4B76A 4AYVB 4DURA 3SZNA 1C2MA 1SPJA 1NRRH 3LDXH 4X1RU 1TGTA 1NT1A 1JMOH 2OP9A 1EJAA 3UAIC 6CHAB 3F9FA 3UY9A 5EXMA 1TBQH 2O8WA 3RXCA 4NIYA 2C8WB 4NIWA 2QY0B 4Y6DA 1ZJDA 4YT7H 1CHOF 2TRMA 4LZ4B 3FFGA 3A7WA 5CHBA 1P10A 3A7VA 1B0EA 1MQ6A 7ESTE 3GY4A 1QA0A 2H9TH 2OLGA 5L2ZH 4DIHH 2BDIA 2FOEA 2B9LA 5AFYH 1C1MA 3RXVA 3QGJA 3E16B 1KYNA 2BQ7B 1EZQA 3GY5A 4UFEH 4ABIA 2A7JA 1BMAA 1GJBB 1QRXA 2AGGX 3KQ5A 4HFPB 1P11E 2BD4A 2ZHQH 3ZZ8A 1XXFA 4THNH 3T26A 1DX5M 3ZZ5A 1YM0A 4X0WU 2WSSD 1YKTA 4DGJA 1GBDA 5JBTA 3VB6A 5FCKA 1B5GH 3F2HA 1O2XA 4CRFA 2V7QD 2W26A 3RU4D 1DS2E 2XBVA 6ESTA 5E0HA 3TH3H 1UW7A 4JK5A 2A4OA 3DSPA 1J15A 2BD9A 3U69H 1Y59T 1BHXB 1MTWA 3RXKA 3PTBA 2HNTC 4NA7A 1A61H 1W8BH 2SGDE 4KTUA 1T4UH 5EPYA 1C2FA 2HVYB 1J9CH 1S0QA 1WQVH 2ALVA 3DA9B 1NESE 1TNJA 2Z7FE 3KYFA 1O5AB 3O8CA 2SFAA 1QQ4A 2FXRA 2ZDMA 2CHAB 4AG1A 2HPPH 3RP2A 2PV9B 4TPYA 1G32B 2PFEA 3M61U 4UDWH 3H7OA 3P6ZB 3W94A 5CHAC 1GCTB 1OWEA 1BRBE 2CK3D 2VWMA 1GPZA 1TRMA 1O2NA 1LHDH 2Q6DA 2FYQA 2BY7X 1K1LA 3LC5A 1W11U 2F9BH 2GDEH 2ZPRA 1IQIA 2Y6TA 2BD3A 2ZGXH 2RG3A 3H5CB 5HM2A 1UJ1A 1V6DA 2VH6A 1K1NA 2BVXH 1IQEA 3A7ZA 4F49A 1QR3E 3U8TH 3KIDU 2K8IA 1BRAA 1V2QT 1ANEA 5A0CA 1BTWA 1FY3A 2OCVB 5DGJA 2BD5A 2A31A 1QNJA 1NFWA 2BQ6B 1ABIH 2PLXA 3BG4C 5A0AE 2BDHA 2BD7A 1RIWB 4E06H 3F9HA 1G3EA 1FQ3A 1OOKB 1VITG 2ODQA 5ABWA 2RDLA 5E8EH 5I46H 1P2JA 2A1DB 4FUBA 3E3TA 1RGQA 2UUKB 2Y7ZA 1Z1IA 4A1TA 5FBIA 2QGRA 2Q1JA 4DIIH 7LPRA 4ABGA 2XRCA 3MNSA 3ZZ7A 1G36A 4X6PA 3RXQA 1CE5A 1UMAH 4CBOA 1LTOA 7GCHG 2ZTXA 1AUTC 2HLCA 4ASUD 1DWDH 3ZV9A 4LXBH 3HKIB 1PPHE 3PROA 2ZCLP 2ZDVH 4FXGH 2OQUA 1AMHA 1AO5A 5DP3A 4D9QA 3NXPA 3L33A 3GS9A 3BG8A 4XBBA 4UFFH 1UTOA 2VVVA 1KXCA 4DCDA 1VITF 4JK6A 4UFGH 1KLIH 1DVAH 1O2OA 4INHA 3RMNH 1OWKA 3M5OA 2SGAA 5FPTA 3HK3B 1O3PB 2W3KA 2CXVA 4GSOA 1WYKA 3RXDA 3A8CA 4CRBA 2J94A 5A0BA 1TA6A 1AWHB 2GJGA 1NC6A 2KM0A 4LK4A 7GCHF 2A4RA 1C9TA 1LO6A 2FWWA 3PLBA 3HKJB 5DP7A 1GI4A 1NBMD 3MU0A 3SJ9A 2D26C 1BUIA 3MO9A 2V3OH 2AMPA 5DP5A 3F9EA 1HGTH 2AFQB 2CJIA 3BV9B 2IOTA 2FTMA 3VXEH 1OWDA 4ZH8A 2FI4E 2ZPQA 3OE7D 1EQ9A 1CHGA 1SGEE 2ZHEH 1CBWB 3PV4A 1E0FD 1O2YA 1S0RA 1GJ9B 3FZDA 4Z1MD 1O3FA 3GICB 1BTPA 3ZZ9A 4X1PU 1YP9A 1W0JD 5GDSH 2PW8H 4K8BA 1SQRA 1OPHB 3GCNA 4TWWA 1ZTKA 1ZGVA 1YBWA 1INCA 1YYY1 3UB0A 1C5WB 3MH6A 5F03A 3UFAA 1S6FA 3BN9A 3KGPA 2FOFA 1C5PA 3IG6B 4MTBA 1T8OA 4GCHG 3OY5U 1O2JA 1ELFA 3PYHA 2GZ7A 2QCYA 1C5VA 1YPGH 4CR9A 4GPGA 1HIAB 2TGTA 4MPXA 3V3MA 4X8UH 2OC0A 5JB9S 5EU8A 1N8OC 2V3HH 4ABFA 4AG2A 3BTHE 1PYTD 2C8XB 1IQKA 4FUFA 2GX4A 3CENA 3S7KB 4PROA 2G52A 3RDZA 3ZZ6A 3RM2H 1TA2A 1TX6A 5FX5A 3WW7A 3SYJA 2PKSB 3M37A 3FP7E 2TPIZ 6GCHG 3SO3A 3E8LA 2ZHFH 4U32A 2QXGA 3SZEA 3SI4H 2OBOA 1JRSA 4RKOB 1MTNB 1XMNB 3SNAA 2LELA 1OP0A 2ZG0H 2Z3CA 4GCHF 1RS0A 1LVBA 1IQMA 2VNTA 3LPRA 1SFIA 4X8TH 1FUJA 4GAWA 2NU1E 2KAIA 2BOHB 1V2OT 1AU8A 2WPLS 2M5TA 1WAYB 2R2WU 1O3IA 2VB0A 1O3GA 3ZVGA 1ACBE 3UWJH 4I8KA 1ZPZA 2BDGA 2G55A 1ZSJA 1NN6A 1HYLA 5ETXA 3TPIZ 3K6YA 1T7CA 4Q2KA 5L6NH 1GBMA 3A87A 4XDEA 1K0HA 1F0RA 1UVOA 4ASHA 1A0JA 2ZTZA 1UTNA 1EUFA 1TWXB 2GT7A 1FMGA 3Q00A 1VJ9U 3ZVDA 2JJ1D 2VVCA 1G3CA 3EDXB 3E1XB 3GYMA 4R8TB 2P93A 3GISB 4RKJB 1UTJA 2KFWA 2BXTH 2SGPE 1DOJA 4Y8YA 1LVYA 2SGQE 1C2JA 1L2EA 2WYGA 5JBCS 1HAZB 1A46H 1DY8A 4ACBA 3C27B 1ANBA 2VIPA 1BZXE 3FAOA 1J16A 2VIDA 1QB1A 1GBBA 1PPEE 1VCPA 1SGFG 1TOMH 2BHGA 3MYWA 2EEKA 2THFB 3LGVA 1KTTB 2AGEX 3SUEA 1ZPBA 1GMHG 4O9VA 3RXBA 2GZ8A 2WV5A 1EZUC 1EP5A 2UUFB 1FIZA 1H8HD 3LGTA 2A45B 4RI0A 1MTVA 1AQ7A 1BMMH 4ABAA 2OBQA 2AH4X 4WH6A 2UWOA 1BTXA 4NG9H 2G5VA 2GD4B 2QAAA 3EA7A 1FPCH 4ISOA 1TOCB 1DUEA 1BTZA 4HG6A 2WPJS 1W3CA 4DJZB 1K1IA 1TPOA 1C5SA 4AFZA 2WPKS 5DP8A 4ZHAA 1ZR0A 4X8VH 1GDQA 2Q6FA 4P02A 2ZCKP 3DHKH 1LMWB 1O37A 1A3EH 1Q2WA 2F4LA 3RU4T 2GV6A 3TGIE 2FYRA 3IWMA 3P8NA 1DSTA 4MNWA 1SGNE 1C9PA 3LOXA 2F83A 3SJKA 1GMHF 1MD7A 3FZZA 2GZ9A 4MQAA 3DFLA 4CRDA 3BTKE 4KKDA 4OS4A 3KF2A 2ESTE 4K8YA 1EAWA 1WTHD 1OS8A 3T28A 4BOHA 3DUXH 1ANCA 3AW1A 5C5NA 1S81A 2V3MA 4OS5A 4JZFH 4DT4A 1SG8B 1NPMA 3Q3YA 5C0TA 5EODA 2HALA 4IN1A 1EASA 3OU0A 1OX1A 5GCHG 5HMAA 1WXRA 4AX9H 1C2IA 1E34B 2XC4A 3VB3A 4AC9A 2ZI2H 8GCHG 3SV9A 1ID5H 1TQ7B 4WVPE 3GY6A 5AHGH 1EX3A 1QHRB 2IJD1 2JJ2D 2QXHA 1Z8RA 2Z3DA 3ZZDA 1HRTH 1TNIA 3S9CA 2BDCA 2KCOA 2QF3A 2AHME 1SGIB 1L4DA 1MKWH 1MCTA 1IHTH 3U9AH 1BITA 1TE0A 2KCYA 1YLDA 4NCYA 4GLYA 4XE4A 2AIPA 2W7UA 1GBHA 1Y3WA 2J98A 3RXUA 2UWPA 5EJZA 1IAUA 4X6OA 1EOJA 2AEIH 4ISHH 4F4OC 2AERH 4MPVA 3OX7U 3VXFH 1DWBH 1TGCA 1AVGH 1IQLA 1TX8A 2J4IA 1BQYA 2VGCB 4ABBA 1GBAA 5FBEA 3RMOH 1XM1A 1FY8E 1O3LA 4X2YA 1H8ED 1ZHRA 4I8HA 1NU7B 8GCHF 2PUXB 1UTMA 4IMQA 1GJ7B 5FPSA 1Q3XA 1ESTA 4IBLH 1LDTT 4YLQH 2G4TA 4AGKA 2PTCE 1AIXH 2P3UB 1JRTA 3PMBB 1Z8GA 3P17H 2H9EH 3UR9A 2BM2A 2XBWA 4Y71A 2BY5X 3LONA 1CGIE 1IHSH 2BX4A 1IQFA 3E91A 1S84A 3PLKA 1V2RT 2GP9B 4D9RA 2QYIA 4FUJA 1SFQB 1F5RA 3E0NB 5DG6A 1LPZB 2QN5T 3A86A 4MPUA 4A1VA 2CF8H 3QGNB 3FP8E 5CMXH 3OY6U 1MKXH 1HJ8A 1CA0C 1Y8TA 1W10U 5KGOA 1QBVH 1O2RA 4K1SA 5C20A 1EJMA 1AE5A 3RXPA 1O3BA 3OTJE 3HGPA 1EPTA 1O32A 1GJDB 2TGPZ 1ETRH 3A82A 3SU4A 5HIYA 1COWD 3GY8A 1AFQC 3U98H 4DY7B 3O8RA 3E6PH 4KP0A 1GI8B 1O30A 2TGAA 1SSXA 3UNRA 1QRWA 1A5GH 1DITH 4I33A 5J4SA 5DSFA 3LGWA 2O8UA 4Q7YA 3PV5A 1Z8IB 2G81E 5C2ZA 4ESTE 2PWXA 4TPIZ 1T32A 1F5KU 2ZGCA 5JBAS 1V2WT 2F9UA 3MU4A 3GY7A 1O5CB 2C4FH 2OK5A 2VVUA 4M7GA 1HCGA 3T27A 1LHGH 2H6MA 2GMTC 3U8RH 1ZRBA 4IC6A 1XKBC 3QX5H 1GBIA 3DSOA 3MQKC 1YCPK 3OSYA 1NO9H 2ZNKH 2JH5D 2HNTE 4I32A 2Z9JA 1BHXF 1K22H 1GI9B 1GHYH 5AFZH 1YGCH 2CN0H 4YM9A 5A8XA 5JDUB 3SV6A 1FV9A 1BJUA 3SV8A 4JZ1A 3EAJA 2FOCA 3ELAH 1A7SA 4TYDA 4Y7AA 1AKSB 1FJSA 1D6RA 1VCQA 4F48B 1LPGB 3L6PA 3BTME 1O5FH 2B0FA 5EOKA 1KXDA 2C8ZB 1TFXA 4UD9H 1NRQH 1C1OA 2ZU4A 2UUYA 2PHBA 5B6LA 3SUGA 2H5DA 2GTBA 2ZCHP 3DCLA 5ESBA 1MD8A 1M9UA 1SGRE 3B9FH 3NUMA 3ZZ3A 2EI7A 3SGAE 3I77A 2QIQA 3T2NA 2IPHA 2XXLA 1S85A 3MNCA 5A2MH 1IQNA 4JZIA 4OGYA 4XBCA 4NIVA 1GI1A 1G3BA 2CMYA 1J14A 3VGCC 4K5ZA 2PSYA 4HTCH 1DXWA 2ZFRH 2P3TB 4GHQA 2P94A 1RJXB 4I31A 2J9NA 2IN2A 2O8TA 1E38B 3RXIA 1H1BA 1GI5A 3W95A 1GVKB 3EYDA 1B0FA 3RMMH 1LVMA 1C5XB 1HAGE 1P03A 1LHFH 3GCOA 1A3BH 2FTLE 1EB2A 3CS7A 1GHXH 1C2HA 1C5TA 3RMLH 5HXFA 3E0PB 2B7DH 2H1UA 1HXFH 1ELVA 3IITA 1EPTC 4XBDA 1ETTH 3ZZBA 3QK1A 2W7SA 3RLYH 4BAKB 2BY8X 1DE7H 1W13U 2JH0D 1P2IA 1P09A 2FESH 3L3TA 1KDQB 1HDTH 5C1YA 2VINA 5C0UA 3OTPA 3N7OA 2ALPA 4LOYH 3BTTE 1ESAA 1SL3A 3ZIAD 1GI0A 1D4PB 2P16A 1NRPH 1XX9A 1GHZA 2HRVA 5FCRA 1MCVA 3BEUA 1WDIA 3DSGA 1YPHE 4Y0ZE 1ZMNA 4CH8B 5ESTE 2ZFTA 4OS1A 1HAYB 1GJ5H 1QBNA 1AI8H 4DT7B 2BXUH 3P8OA 8LPRA 1O2HA 1D3PB 1HAOH 3DD2H 3T25A 1NFXA 5CHAB 2PKAA 1TALA 1ZOMA 4MG3A 1YCPM 2ZHDA 2RDEA 3FN8A 4K3JA 1F92A 1AB9C 1P9UA 3SGBE 3BTQE 3LU9B 4OM9A 2ZPSA 3LGUA 1MTSA 3OEED 2A5IA 2FPZA 3F9GA 2YOLA 2BDBA 1K1JA 1KMHB 1GI3A 4I7YH 5H4IB 2ZA5A 5EGMA 4Y79A 4B1TA 2PTNA 3EE0B 4KGAA 1SGQE 2ZFSA 1BT7A 1TPAE 1VCWA 2DE8A 3BG4B 3ESTA 2BD8A 4Y7BA 4INLA 3OFND 4BTIB 1QL9A 4DG4A 1YCPH 3B23B 4FU7A 4X1QU 3ATWA 3PLPA 2JKHA 2V35A 1PQ7A 3NCLA 4E7RG 5F53A 1PQAA 1O3EA 1RD3B 1U6QA 3B8JA 4J2YB 4K2YA 3KEEA 1QB9A 2A4GA 4X1SU 2RA0A 7KMEH 3F3BA 3QUMP 4HGCA 1GG6C 1KXFA 1P8VC 3RXOA 5I25A 2EQNA 3RXEA 4WH8A 3PV2A 1ZTJA 2WV4A 2WHXA 1YPHC 1G37A 6LPRA 3EGKH 1QRZA 1ZZZA 4I86A 1CSOE 3M36A 1BJVA 4D7GA 2P59A 2AMDA 3A8BA 2BVSH 1EATA 4JMYA 1QA7A 4YESB 4ZHMU 3TLOA 3ZVFA 2BYAX 2YMSD 2A0QB 1GGDC 1V2KT 4XRNA 1OXGA 1UHBA 4Z6AH 3HGNA 3SJOA 3KQBA 1RRKA 1UVSH 2FOBA 2JETC 1L4ZA 1V2NT 4B2CA 3QLPH 3OEHD 2QF4A 2YNAA 1GJ4H 1ZLRA 1IQGA 4TT3D 4WJG2 1Z6EA 4A92A 1E36B 5LPRA 2DUCA 1ORFA 4U2WA 1GJCB 3MU5A 4FUGA 3GCTG 1O35A 1BRUP 3TJVA 3R3GB 2H9HA 4VGCC 1TABE 3F68H 1C1SA 1MU6B 1CT4E 3K2UA 4X1NU 1L1GA 2I6QA 2BB4A 5DKMA 4UEHH 1C5NH 1B7XB 3ATIA 3W1EA 1MBQA 5EJ1A 1DM4B 1DUAA 1VZQH 1V2VT 3RC5A 1O3JA 1Q31A 2PGBB 1UCYK 1DSUA 2R0KA 1TRYA 1C5RA 3AK5A 2FO9A 1AFEH 1C1VH 1NS3A 3MH4A 5CDFE 3RU4E 1YPJH 3VFEA 5KECA 2FI3E 2KCAA 5JYIA 2ODPA 1PPFE 4H6SB 1DLKB 2WUCA 1KTSB 4UE7H 1D6WA 1QIXB 2XYAA 1HJAC 5FPYA 3OYPA 2ZDKA 1GHWH 1XVOA 1AD8H 1JIRA 1P57B 1C1TA 1WU1A 4E05H 4YTAA 3AAVA 4AZ2B 1A0LA 3GCHC 4OS2A 1SBWA 1QBOA 3QZRA 2GDDA 3BEIB 2A2XH 2JIZD 1ZSKA 1SI5H 1X7AC 1J8AA 1A1RA 5FX6A 3VB4A 1MKWK 4INKA 4FETA 1O5DH 4CHAC 4XFQA 3GDUA 1N8OB 3RXMA 2HLDD 1ZHMA 1EP6A 4O03A 2ZDLA 3V7TA 1ARCA 5GNDA 4BAOB 1TNLA 1O34A 1KLTA 3TGKE 1XKAC 3KN2A 4ABEA 1MH0A 1LHEH 1UTKA 1YPEH 3RC4A 3TNTA 2Z6BD 3NZIA 1PPGE 2C8YB 4H4FA 2Y82A 1O2KA 2J5UA 1CA8B 3S0NA 1EKBB 2OC8A 2VU8E 4ZKRU 1GHBG 2FS9A 2OTVA 3RXFA 1VGCC 3KQEA 4ABHA 2CF9H 1C5MD 3ENSB 2BY9X 3A85A 2Q6GA 2B8OH 6GCHF 2ZGJA 2HPQH 5GJ4B 4E7NA 2OUAA 1Z1JA 1C5QA 4IS5A 1O0DH 3M5LA 1YPMH 2FOMB 1SOTA 1DT2A 2XW9A 2CGAA 1C2LA 1VITH 5IK2D 5HKKD 1SLUB 1O39A 3SGQE 2VWLA 1H9LB 3VG8A 1C2GA 4GVUA 4DVAU 1IQJA 1MKXK 3NKKA 1JWTA 3Q76A 3UNQA 1SGTA 1ELDE 3RLWH 1FN8A 1Y3XA 1L1JA 3CNRA 4XSKU 4CH2B 3M3SA 1HPGA 2WZQA 3M5MA 1SQOA 4WXVA 1S82A 2G00A 2P8OC 5LPEA 1VR1H 1THSH 1K9OE 1ABJH 3BSQA 1O2SA 5T3HA 3Q3XA 1W0ZU 1GHBF 4B6FA 4IGDA 3S9BA 4MVNA 3NK8A 5F8XA 3F2GA 1EXFA 1KXBA 3TITA 3KHVA 1G2MA 3DT0H 5C17A 4ISIH 1S6HA 1TPSA 4FUIA 4ISNA 3MO3A 4I8LA 2KX4A 3UR6A 1CQQA 4WMEA 1F0TA 3BEFB 1FI8A 4ABJA 1EAUA 4MLFB 4D7FA 1BTUA 4BXSA 4LZ1H 4MNXA 4ZAEA 4Y8XA 2ANKH 2BX3A 3BTFE 4OS7A 4A5TS 1NBME 1ELTA 1HB0B 2EI8A 2XBYA 4NSYA 1CGHA 1UCYH 2F9NA 3F1SB 3FO8D 1KXEA 1G2LA 2A32A 4R0IA 3SQHE 4RT0A 5C67A 3GY3A 4IC5A 4GHTA 4ZXXH 1VJAU 2C3SA 3PO1C 2ZDNA 3ZVAA 5HYOA 3CP7A 1ZMJA 4K60A 5AF9H 2I6SA 2Z9KA 2GVFA 3HK6B 4NGAH 3VB7A 3SU0A 3LH1A 5EW1H 4JYTA 4BANB 5FHTA 3TK5A 1HBTH 3STIA 1GBFA 3G01A 3RXJA 3MH7A 4X2WA 4FUDA 1MZDA 1H9IE 1BMFD 3SBKA 4UONA 3AASA 4OGXA 5EG4A 4JCNA 3RXAA 1F7ZA 1HAIH 1A5IA 3RXRA 4IMZA 5GXPA 3A8DA 1UK2A 3ATMA 3S69A 4YOJA 2SNWA 3MHWU 1THPB 1H4WA 1OWHA 1WQSA 4JZEH 2YNBA 3P92A 2JDID 2W5EA 5JB8S 1GMCG 4Q7XA 1O36A 1BMLA 4CRAA 2VIVA 2VJ1A 3MU1A 3PB1E 5KEDA 4MDSA 3M7QA 1TQ0B 1ZGIA 1DWEH 3QN7A 3TVJB 1C5OH 2LPRA 5E2OA 2YMSC 2ODYB 2KAIB 3M7TA 1Y5AT 1UK4A 2A5KA 1QFKH 1SKYE 5EXLA 3T29A 1JXPA 1ZMLA 5GCHF 2HWLB 5PTPA 1S6LA 1XXDA 1BMNH 2HGTH 3D65E 1QY6A 1Z71A 2XCFA 1BTYA 4K1EA 1H8DH 2J2UA 3U8OH 3O8BA 1QQUA 3SU3A 2ZECA 1TNHA 3TJOA 2PGQB 2ULLA 1FXYA 3U1IB 4K69A 1GBLA 1P01A 4WMFA 2DE9A 1C2KA 1N1LA 4KTSA 1QCPA 1THRH 3RC6A 1O3HA 1XUHA 1GMCF 1O2QA 1C5ZB 1TAWA 2FLBH 3N7DA 1P2NA 1UVPA 1PJPA 4NA9H 1O2TA 1ZRKA 5G4BA 1GBJA 4X6NA 3ZYEA 1T31A 3F6UH 5L2YH 4CBNA 1UVUH 4D8NA 1C4U2 1C2DA 2TIOA 4CREA 1P3CA 2EY4C 1UTLM 1C1UH 2R3UA 3HPTB 3M3VA 1BDAA 1ZTLA 4Q80A 1D3QB 3A88A 2CV3A 2OD3B 3N7EA 9LPRA 5F6MA 1V2ST 1BIOA 2ILNA 1BCUH 2WV9A 5EXNA 3KL6A 1TYNA 1PYTC 5FXLA 4JZDH 2Z9LA 1EFRD 1P05A 5DP9A 3UQVA 3BTWE 4BAMB 5A8YA 2BZAA 5DPAA 2ZZUH 1GVLA 1YLCA 3RXGA 1D3DB 2ZDAH 2STAE 3RXLA 4A6LA 1CA0B 3RM0H 2P3FH 2FOGA 4YOIA 2Z9IA 1TONA 2BLQA 3I29A 3QTVH 6CHAC 1YC0A 1E1QD 1RFNA 3PM3A 4AB9A 3A84A 2V0BA 3TH4H 1GHAG 1O2VA 1AFQB 3JZ1B 4B75A 1C4V2 5DK1A 4Y10E 3ZVBA 2FOHA 1MBMA 1O2UA 1YWUA 2FZZA 4NFFA 1ANDA 1SGCA 4YXWD 4M9FA 5TCCA 1ZJKA 1UTPA 1KXAA 3SV2H 1QURH 2ZO3H 4Y76A 3MOCA 3UUZA 1RTFB 2TBSA 1SGYE 3SUDA 1DLEA 1OSSA 2F91A 2GMTB 1O3OA 2OINA 1V2PT 1E35B 4HI3A 3TNSA 4B71A 3MH5A 4H6TA 2ZC9H 4O97A 1T8MA 2HNTF 3VB5A 1LKAA 5IDKA 4B2AA 4F55A 1K1PA 3SU6A 5EQQA 4Q7ZA 1GHAF 1T4VH 3A89A 2A7CA 2O8MA 1D9IA 1FZZA 1H8IH 2D2DA 1Y5UT 2J97A 1KIGH 5C94A 1KSNA 4Y0YE 4AFUA 2FM2A 1DWCH 4K1TA 2FLRH 2C90B 2J98B 3KNXA 3URCA 1TNGA 4TY7A 1NFUA 1SVPA 2VBCA 2VH0A 3ZV8A 1FPHH 1PFXC 4J1YA 2G8TA 4D76A 3AAUA 3UIRA 2ANWA 1V2LT 3M7UA 4O3TA 1D3TB 2QE7D 1P2QA 5EQSA 1AE8H 2ZU2A 1PPBH 4TY6A 3ATKA 3MMGA 2G5NA 2K1QA 2GCTC 3A7TA 5LPFA 1LPKB 1V3XA 1MZAA 1GBCA 5CE1A 4X2XA 3RXTA 1EZXC 1W2KH 3TJNA 2CHAC 2F3CE 4NWLA 2AIQA 4WY3A 4Y8ZA 2FODA 2O9QA 1MAXA 1AWFH 2VIOA 1GCTC 3NRLA 2J34A 3UTUH 1L0ZA 1L1NA 3VGCB 2EI6A 1V2JT 2XWAA 5T6FA 1VKYA 2BLOA 1ZPCA 3PWBA 3R0FA 5F8TA 1MU8B 2ZTYA 4BNRA 1P06A 2GCTB 1O38A 2Y81A 5TJXA 4BTTB 5IYTA 5SGAE 1NU9A 5EW2H 1TLDA 4TWYA 4NFEA 3S7HB 3U28C 3K65B 1MQ5A 1O2IA 3GDVA 3A7XA 3P8GA 1P2OA 3ZYDA 5C1XA 3A83A 1F2SE 2ZHWH 1RIWC 3LKWA 1EPTB 2Y80A 1DICA 5DP6A 1HIAA 2JH6D 1AVWA 1O33A 2L74A 1W7GH 1SHHB 3V12A 3VEQB 3SORA 3LIWA 1V2UT 4ACAA 3DFJA 2ANYA 3FOAA 1V2MT 3UOUA 1ZYOA 2J95A 1YY3A 2GT8A 4YT6H 2F9VA 2H5CA 1BRCE 4ZUHA 3D23A 5AVDA 1NFYA 3U1JB 3VPKA 1EB1H 4FUCA 5K0HA 3MNXA 4BXWA 1BBRH 3QWCH 2F9OA 2FP7B 2SGEE 1P3EA 4B74A 5BPEA 4O3UA 2K0QA 2AGIX 4FVBA 1TMUH 1NY22 2ZWLH 1GI2A 1ELAA 1WBGB 4ZKOU 1J17T 5C1UA 3N99A 1WSSH 1TB6H 4ZROA 2FIRH 5E0GA 3SW2B 3BTEE 4MNYA 1O5EH 4ZHLU 1AVXA 2BVRH 1AB9B 2XCNA 3WWBA 2UUJB 4YO9A 2WPHS 2LNCA 3FKSD 1OP8A 1TMBH 1W7XH 1G9IE 2F43B 3Q3KA 4B2BA 1QTFA 1HNEE 1HUTH 2FOAA 1OYQA 3S9AA 5EJLA 1FY1A 1HJ9A 5GIBA 1CO7E 2FEQH 4NZLA 1O3MA 4X6MA 1PPZA 3UNSA 4QT8C 1QL8A 2FMJA 1O3AA 4AORA 2Y5FA 4P00A 2OXSA 1P02A 4ZMAH 3V13A 3SNDA 2QF0A 1GBEA 1MAYA 1P2KA 9ESTA 1RXPA 1SLXB 1GG6B 2BMGB 3QO6A 2Z3EA 3TK9A 8KME2 3SN8A 1F5LA 1GWAA 3EA8A 4ISLA 1PPCE 3ZZAA 5FAHA 1FY4A 2OQ5A 3ITIA 3AW0A 4ZKSU 1Z8JB 3SNEA 1OKXA 1BA8B 4TSFD 2PR3A 1CBWC 3SI3H 1TGSZ 2WUBA 1NTPA 2Y7XA 3ATLA 1Y3UA 1FAXA 3SNCA 1UCYE 2B5TB 1XUIA 1WUNH 1GGDB 3MTYA 2FX6A 2G51A 1JBUH 2M2AA 1HAVA 3SNBA 1P12E 1SGPE 1UTQA 2ZQ2A 3OAAD 2SNVA 1GDUA 1NZQH 4Q63A 4JYUH 1C2EA 2JETB 2ZQ1A 3TIUA 1SR5C 2ZU1A 1O3CA 4AN7A 2PSXA 2Y5HA 1T8LA 2NU0E 2ZEBA 3UQOA 4ZCNA 1N6YA 5HIZA 1ELCA 1BTHH 2AS9A 1TMTH 4SGAE 4NA8A 1FLEE 3BIVH 1HV7A 2BY6X 3MFJA 4VGCB 5DJ7A 5B6OA 1ELGA 1W14U 2Z94A 1QB6A 3MWIU 3SJIA 2Z9GA 3MNBA 1GI6A 1WTGH 4FVDA 1O5BB 3PMAB 2FS8A 3GCTF 3GYLB 2ZFPH 3EA9A 2A2QH 1FY5A 1AZ8A 3SQEE 1SC8U 2PKSC 2UWLA 3ZZ4A 3JZ2B 1C5UA 5DN6D 2XWBI 4FU9A 1DXPA 1NRSH 4CR5A 1G3DA 1NM6A 1EAIA 1GJ6A 2IPQX 1A5HA 1C5YB 1QJ7B 2STBE 3TU7H 1OWJA 3LH3A 1ARBA 1OWIA 2PKAB 4NZQA 4DW2U 1CT0E 1MTNC 4RT1A 2W6JD 2PP6A 4WXIA 2R3YA 3D49H 2ANMH 4UFDH 5T1VA 1HJAB 5C3NA 1IOEA 1WCZA 1O3NA 5A09A 4ZKNU 2RA3A 2ASUB 1QZ8A 5LGOA
chains in the Genus database with same CATH topology
1O31A 1Y5BT 1BB0B 1SHYA 2A7HA 3FANA 3SUFA 1UO6A 2BZ6H 1MTUA 3LC3A 1TX7A 3A8AA 3GCHB 1C1PA 1GMDG 4YLUA 1HAPH 1FN6A 3RUOA 1DPOA 1ETSH 3PTNA 4B73A 2PUQH 2R2MB 1E37B 4FUEA 1DDJA 2ZF0H 5C5OA 4CHAB 3P8FA 2VWNA 3A80A 1N6XA 2J92A 4NSVA 3MU8A 4OS6A 4JYVH 1FNIA 1GJ8B 1GL1A 4NWKA 3EQ0H 1SGFA 4KELA 4YZUA 4A7IB 2RCEA 2FDAA 3PMJA 1P2MA 1O2ZA 2ZFQH 4DOQA 1EJNA 1S83A 3KCGH 1WOFA 1Z6JH 1AHTH 1GI7B 4ABDA 3SOSA 1V2TT 2ZU3A 1EOLA 5GWZA 1W0YH 2QC2A 1XUJA 2VIQA 2HOBA 1SQTA 4AFSA 5A8ZA 1C1NA 1O2WA 1O2PA 1VGCB 4CRGA 1GMDF 2BDAA 1T8NA 2BLWA 3ODDA 8ESTE 1LQEA 4U30A 1A4WH 1SB1H 2SGFE 3K6ZA 1UHBB 4WMDA 3QZQA 5HM9A 3SU1A 1S5SA 1CGJE 1LQDB 4AOQA 2WPMS 3GY2A 3SHCH 4Y11E 2QV1A 1GVZA 5LH8A 1NROH 2F9PA 2XTTB 2R0LA 3LGYA 3KQDA 2GCHG 3QTOH 1P9SA 3BTDE 1F0UA 1GBTA 3UPEA 3CS0A 3TGJE 2BLVA 1O2LA 2HVXA 3SU5A 4IN2A 1HAVB 1XUFA 5EQRA 2AYWA 2P8OB 5TCAA 2XBXA 1K28D 3C1KA 1WV7H 1OYTH 1FONA 1TGBA 3UOPA 5DO4H 3BIUH 3V0XA 3LJJA 5EPNA 1AUJA 1P04A 1SLWB 1FIWA 1SMFE 1TBRH 2A5AA 4YOGA 2QXJA 2NU3E 5DP4A 3T5FH 4KTCA 4AFQA 1ELBA 4AYYB 2WYJA 3P95A 4ZXYH 5E2PA 1F0SA 3ZZCA 1C1QA 2XNIA 1AGJA 1KLJH 2XC5A 1KY9A 3A81A 1C1WH 2FI5E 3A7YA 1YF4A 1SLVB 2ZKSA 4BAHB 2P95A 1XVMA 4FUHA 3I78A 1HXEH 2GCHF 1OP2A 3QDZB 2EC9H 3TK6A 2BDYA 1JOUB 2TGDA 2W3IA 1IQHA 1BOQA 3HATH 1PQ5A 3TJUA 1ZHPA 1O2MA 2OC7A 2WPIS 1O3KA 2XC0A 3PO1B 1W12U 3ZVEA 2Y5GA 1ESBA 5E0JA 1QJ6B 3SU2A 1EAXA 2GKVE 1UK3A 2ZGBH 3LGIA 2IJOB 5L30H 3FVFB 4SGBE 3GOVB 3M35A 2GGVB 5HGGA 1ELEE 1AKSA 2D8WA 2G4UA 4RN6A 1AY6H 1K2I1 4H42U 2BQWB 1C5LH 1HFDA 4A1XA 4I8GA 1YPKH 1DY9A 2VGCC 4RSPA 1SQAA 1Y3VA 2ZU5A 5T6GA 4AB8A 3SHAH 4X2VA 4AGJA 1LKBA 2A4QA 4BAQB 2WINI 3KQCA 3Q77A 1EZSC 3SJ8A 3M3TA 3E90B 3LJOA 3STJA 3LT3A 3O8DA 2BTCE 1ZSLA 3P70B 3RXSA 1UVTH 1A2CH 3BTGE 2FX4A 3T62A 1QJ1B 1GBKA 1Z7KA 3RXHA 2BD2A 1TIOA 4HZHA 1TPPA 1NRNH 1TNKA 1LHCH 1SGDE 1Y3YA 1RTLA 2NWNA 4FU8A 1DANH 5K7RA 2ZIQH 3ODFA 1JIMA 4WWYA 1A0HB 3NPSA 1FDPA 5JBBS 1GL0E 1LCYA 1MMJN 4NIXA 5GPIB 2GV7A 1K1OA 1XUKA 2C93B 2OC1A 1CT2E 1MUEB 2J38A 1XUGA 2VWOA 3PMHB 2NU2E 1TRNA 2QA9E 5J4QA 2VIWA 1K1MA 3K9XB 1QGFA 3UREA 3BF6H 1GCDA 3H7TA 4MPWA 4U01A 3URDA 4BTUB 1TBZH 1O2GH 3SV7A 1GJAB 1GHVH 1LVOA 2EA3A 1CVWH 1KDQA 4Z0KA 1BBRE 5T6DA 2QXIA 3ZVCA 1H9HE 4IW4E 1P0SH 2ZFFH 3M5NA 5F8ZA 1SOZA 3UWIA 1HLTH 2NU4E 4GUXA 1PQ8A 1C1RA 1HAXB 4XOJA 1CHOG 1BBRK 1GDNA 2D1JA 3GDSA 2AMQA 1O5GH 3MO6A 1O3DA 3FP6E 1FAKH 3D62A 3TH2H 1TGNA 2H2ZA 1YPLH 3PWCA 2V6NA 5BRRE 2ZP0H 1AZZA 5JPMH 4MNVA 2BOKA 3MI4A 2ZGHA 3WY8A 4X8SH 1C4Y2 1K21H 2O8LA 1AN1E 1CU1A 3NWUA 1RTKA 4WF8A 4CRCA 2R9PA 3AVZA 4I8JA 1DFPA 1QL7A 1G30B 1HAHH 4B76A 4AYVB 4DURA 3SZNA 1C2MA 1SPJA 1NRRH 3LDXH 4X1RU 1TGTA 1NT1A 1JMOH 2OP9A 1EJAA 6CHAB 3F9FA 3UY9A 5EXMA 1TBQH 2O8WA 3RXCA 4NIYA 2C8WB 4NIWA 2QY0B 4Y6DA 1ZJDA 4YT7H 1CHOF 2TRMA 4LZ4B 3FFGA 3A7WA 1P10A 3A7VA 1B0EA 1MQ6A 7ESTE 3GY4A 1QA0A 2H9TH 2OLGA 5L2ZH 4DIHH 2BDIA 2FOEA 2B9LA 5AFYH 1C1MA 3RXVA 3QGJA 3E16B 1KYNA 2BQ7B 1EZQA 3GY5A 4UFEH 4ABIA 2A7JA 1BMAA 1GJBB 1QRXA 2AGGX 4HFPB 1P11E 2BD4A 2ZHQH 3ZZ8A 1XXFA 4THNH 3T26A 1DX5M 3ZZ5A 1YM0A 4X0WU 1YKTA 4DGJA 1GBDA 5JBTA 3VB6A 5FCKA 1B5GH 1O2XA 4CRFA 2W26A 3RU4D 1DS2E 2XBVA 6ESTA 5E0HA 3TH3H 4JK5A 2A4OA 1J15A 2BD9A 3U69H 1Y59T 1BHXB 1MTWA 3RXKA 3PTBA 2HNTC 4NA7A 1A61H 1W8BH 2SGDE 4KTUA 1T4UH 5EPYA 1C2FA 1J9CH 1S0QA 1WQVH 2ALVA 3DA9B 1NESE 1TNJA 2Z7FE 1O5AB 3O8CA 2SFAA 1QQ4A 2FXRA 2ZDMA 2CHAB 4AG1A 2HPPH 3RP2A 2PV9B 4TPYA 1G32B 2PFEA 3M61U 4UDWH 3H7OA 3P6ZB 3W94A 5CHAC 1GCTB 1OWEA 1BRBE 2VWMA 1GPZA 1TRMA 1O2NA 1LHDH 2Q6DA 2FYQA 2BY7X 1K1LA 3LC5A 1W11U 2F9BH 2GDEH 2ZPRA 1IQIA 2Y6TA 2BD3A 2ZGXH 2RG3A 3H5CB 5HM2A 1UJ1A 1V6DA 2VH6A 1K1NA 2BVXH 1IQEA 3A7ZA 4F49A 1QR3E 3U8TH 3KIDU 1BRAA 1V2QT 1ANEA 5A0CA 1BTWA 1FY3A 2OCVB 5DGJA 2BD5A 2A31A 1QNJA 1NFWA 2BQ6B 1ABIH 2PLXA 3BG4C 5A0AE 2BDHA 2BD7A 1RIWB 4E06H 3F9HA 1G3EA 1FQ3A 1OOKB 1VITG 2ODQA 5ABWA 2RDLA 5E8EH 5I46H 1P2JA 2A1DB 4FUBA 3E3TA 1RGQA 2UUKB 2Y7ZA 1Z1IA 4A1TA 5FBIA 2QGRA 2Q1JA 4DIIH 7LPRA 4ABGA 2XRCA 3MNSA 3ZZ7A 1G36A 4X6PA 3RXQA 1CE5A 1UMAH 4CBOA 1LTOA 7GCHG 2ZTXA 1AUTC 2HLCA 1DWDH 3ZV9A 4LXBH 3HKIB 1PPHE 3PROA 2ZCLP 2ZDVH 4FXGH 2OQUA 1AMHA 1AO5A 5DP3A 4D9QA 3NXPA 3L33A 3BG8A 4XBBA 4UFFH 1UTOA 2VVVA 1KXCA 4DCDA 1VITF 4JK6A 4UFGH 1KLIH 1DVAH 1O2OA 4INHA 3RMNH 1OWKA 3M5OA 2SGAA 5FPTA 3HK3B 1O3PB 2W3KA 2CXVA 4GSOA 1WYKA 3RXDA 3A8CA 4CRBA 2J94A 5A0BA 1TA6A 1AWHB 1NC6A 4LK4A 7GCHF 2A4RA 1C9TA 1LO6A 2FWWA 3PLBA 3HKJB 5DP7A 1GI4A 3MU0A 3SJ9A 2D26C 1BUIA 3MO9A 2V3OH 2AMPA 5DP5A 3F9EA 1HGTH 2AFQB 2CJIA 3BV9B 2IOTA 2FTMA 3VXEH 1OWDA 4ZH8A 2FI4E 2ZPQA 1EQ9A 1CHGA 1SGEE 2ZHEH 1CBWB 3PV4A 1E0FD 1O2YA 1S0RA 1GJ9B 3FZDA 1O3FA 3GICB 1BTPA 3ZZ9A 4X1PU 1YP9A 5GDSH 2PW8H 4K8BA 1OPHB 3GCNA 4TWWA 1ZTKA 1ZGVA 1YBWA 1INCA 1YYY1 1C5WB 3MH6A 5F03A 3UFAA 1S6FA 3BN9A 3KGPA 2FOFA 1C5PA 3IG6B 4MTBA 1T8OA 4GCHG 3OY5U 1O2JA 1ELFA 3PYHA 2GZ7A 2QCYA 1C5VA 1YPGH 4CR9A 4GPGA 1HIAB 2TGTA 4MPXA 3V3MA 4X8UH 2OC0A 5JB9S 5EU8A 1N8OC 2V3HH 4ABFA 4AG2A 3BTHE 1PYTD 2C8XB 1IQKA 4FUFA 2GX4A 3CENA 3S7KB 4PROA 2G52A 3RDZA 3ZZ6A 3RM2H 1TA2A 1TX6A 5FX5A 2PKSB 3M37A 3FP7E 2TPIZ 6GCHG 3SO3A 3E8LA 2ZHFH 4U32A 2QXGA 3SI4H 2OBOA 1JRSA 4RKOB 1MTNB 1XMNB 3SNAA 1OP0A 2ZG0H 2Z3CA 4GCHF 1RS0A 1LVBA 1IQMA 2VNTA 3LPRA 1SFIA 4X8TH 1FUJA 4GAWA 2NU1E 2KAIA 2BOHB 1V2OT 1AU8A 2WPLS 2M5TA 1WAYB 2R2WU 1O3IA 2VB0A 1O3GA 3ZVGA 1ACBE 3UWJH 4I8KA 1ZPZA 2BDGA 2G55A 1ZSJA 1NN6A 1HYLA 5ETXA 3TPIZ 3K6YA 1T7CA 4Q2KA 5L6NH 1GBMA 3A87A 4XDEA 1F0RA 1UVOA 4ASHA 1A0JA 2ZTZA 1UTNA 1EUFA 1TWXB 2GT7A 1FMGA 3Q00A 1VJ9U 3ZVDA 2VVCA 1G3CA 3EDXB 3E1XB 3GYMA 4R8TB 2P93A 3GISB 4RKJB 1UTJA 2BXTH 2SGPE 1DOJA 4Y8YA 1LVYA 2SGQE 1C2JA 1L2EA 2WYGA 5JBCS 1HAZB 1A46H 1DY8A 3C27B 1ANBA 2VIPA 1BZXE 3FAOA 1J16A 2VIDA 1QB1A 1GBBA 1PPEE 1VCPA 1SGFG 1TOMH 2BHGA 3MYWA 2EEKA 2THFB 3LGVA 1KTTB 2AGEX 3SUEA 1ZPBA 1GMHG 4O9VA 3RXBA 2GZ8A 2WV5A 1EZUC 1EP5A 2UUFB 1FIZA 3LGTA 2A45B 1MTVA 1AQ7A 1BMMH 4ABAA 2OBQA 2AH4X 4WH6A 2UWOA 1BTXA 4NG9H 2G5VA 2GD4B 2QAAA 3EA7A 1FPCH 4ISOA 1TOCB 1DUEA 1BTZA 2WPJS 1W3CA 4DJZB 1K1IA 1TPOA 1C5SA 4AFZA 2WPKS 5DP8A 4ZHAA 1ZR0A 4X8VH 1GDQA 2Q6FA 2ZCKP 3DHKH 1LMWB 1O37A 1A3EH 1Q2WA 3RU4T 2GV6A 3TGIE 2FYRA 3IWMA 3P8NA 1DSTA 4MNWA 1SGNE 1C9PA 3LOXA 2F83A 3SJKA 1GMHF 1MD7A 3FZZA 2GZ9A 4MQAA 3DFLA 4CRDA 3BTKE 4KKDA 4OS4A 3KF2A 2ESTE 4K8YA 1EAWA 1WTHD 1OS8A 3T28A 4BOHA 3DUXH 1ANCA 3AW1A 5C5NA 1S81A 4OS5A 4JZFH 1SG8B 1NPMA 3Q3YA 5EODA 2HALA 4IN1A 1EASA 3OU0A 1OX1A 5GCHG 5HMAA 4AX9H 1C2IA 1E34B 2XC4A 3VB3A 2ZI2H 8GCHG 3SV9A 1ID5H 1TQ7B 4WVPE 3GY6A 5AHGH 1EX3A 1QHRB 2QXHA 1Z8RA 2Z3DA 3ZZDA 1HRTH 1TNIA 3S9CA 2BDCA 2QF3A 1SGIB 1L4DA 1MKWH 1MCTA 1IHTH 3U9AH 1BITA 1TE0A 1YLDA 4NCYA 4GLYA 4XE4A 2AIPA 2W7UA 1GBHA 1Y3WA 3RXUA 2UWPA 1IAUA 4X6OA 1EOJA 2AEIH 4ISHH 4F4OC 2AERH 4MPVA 3OX7U 3VXFH 1DWBH 1TGCA 1AVGH 1IQLA 1TX8A 2J4IA 1BQYA 2VGCB 4ABBA 1GBAA 5FBEA 3RMOH 1XM1A 1FY8E 1O3LA 4X2YA 1ZHRA 4I8HA 1NU7B 8GCHF 2PUXB 1UTMA 4IMQA 1GJ7B 5FPSA 1Q3XA 1ESTA 4IBLH 1LDTT 4YLQH 2G4TA 4AGKA 2PTCE 1AIXH 2P3UB 1JRTA 3PMBB 1Z8GA 3P17H 2H9EH 3UR9A 2BM2A 2XBWA 4Y71A 2BY5X 3LONA 1CGIE 1IHSH 2BX4A 1IQFA 3E91A 1S84A 3PLKA 1V2RT 2GP9B 4D9RA 2QYIA 4FUJA 1SFQB 1F5RA 3E0NB 5DG6A 1LPZB 2QN5T 3A86A 4MPUA 4A1VA 2CF8H 3QGNB 3FP8E 5CMXH 3OY6U 1MKXH 1HJ8A 1CA0C 1Y8TA 1W10U 1QBVH 1O2RA 4K1SA 5C20A 1EJMA 1AE5A 3RXPA 1O3BA 3OTJE 3HGPA 1EPTA 1O32A 1GJDB 2TGPZ 1ETRH 3A82A 3SU4A 3GY8A 1AFQC 3U98H 4DY7B 3O8RA 3E6PH 4KP0A 1GI8B 1O30A 2TGAA 1SSXA 3UNRA 1QRWA 1A5GH 1DITH 4I33A 5J4SA 3LGWA 2O8UA 4Q7YA 1Z8IB 2G81E 5C2ZA 4ESTE 2PWXA 4TPIZ 1T32A 1F5KU 2ZGCA 5JBAS 1V2WT 2F9UA 3MU4A 3GY7A 1O5CB 2C4FH 2VVUA 4M7GA 1HCGA 3T27A 1LHGH 2H6MA 2GMTC 3U8RH 1ZRBA 4IC6A 1XKBC 3QX5H 1GBIA 1YCPK 3OSYA 1NO9H 2ZNKH 2JH5D 2HNTE 4I32A 2Z9JA 1BHXF 1K22H 1GI9B 1GHYH 5AFZH 1YGCH 2CN0H 4YM9A 5A8XA 5JDUB 3SV6A 1FV9A 1BJUA 3SV8A 4JZ1A 3EAJA 2FOCA 3ELAH 1A7SA 4TYDA 4Y7AA 1AKSB 1FJSA 1D6RA 1VCQA 1LPGB 3L6PA 3BTME 1O5FH 2B0FA 5EOK