2W5EA

Structural and biochemical analysis of human pathogenic astrovirus serine protease at 2.0 angstrom resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
162
structure length
162
Chain Sequence
KHHHHHHIKPGALCVIDTPEGKGTGFFSGNDIVTAAHVVGNNTFVNVCYEGLMYEAKVRYMPEKDIAFITCPGDLHPTARLKLSKNPDYSCVTVMAYVNEDLVVSTAAAMVYGNTLSYAVRTQDGMSGAPVCDKYCRVLAVHQTNTGYTGGAVIIDPTDFHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PUTATIVE SERINE PROTEASE
publication title Structural and Biochemical Analysis of Human Pathogenic Astrovirus Serine Protease at 2.0 A Resolution.
pubmed doi rcsb
source organism Human astrovirus 1
molecule tags Hydrolase
total genus 34
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2w5eA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2w5eA01
3EE0B 1IHTH 3Q3YA 4NIWA 2BD2A 1GBTA 2P8OB 3GDUA 2ZEBA 1TWXB 1SC8U 2QV1A 3RXCA 4WH8A 2F9UA 3U8RH 2HPQH 1P06A 2ZDNA 3RXOA 5JB9S 1A2CH 1BOQA 1WSSH 2VIQA 1O5DH 1ELGA 4WY3A 1HFDA 2ZNKH 4IN1A 1O2TA 4I8LA 3LGTA 4KELA 3EGKH 1GL0E 1LO6A 2J94A 2VGCB 3BEUA 4B74A 2A5AA 1X7AC 1C2HA 2FI4E 1H8DH 2XC4A 1OP2A 4AG2A 4X6PA 1OSSA 2BD9A 1TBZH 2FTLE 1VJ9U 3RXDA 2VIWA 5EPNA 1PJPA 3SNAA 2OINA 4YOGA 5DP5A 2ZU4A 2ZTXA 3RP2A 3W94A 2FM2A 4DY7B 3SI4H 2WPIS 5T6FA 1EX3A 2ZDMA 1GI3A 4MTBA 1EASA 4WJG2 4E05H 3STIA 2BDAA 3BTQE 1XUGA 4UD9H 1MBQA 2ZDKA 1GBBA 2GCTB 2ZI2H 1GHBF 1W10U 2F9NA 5DPAA 5EPYA 2F9PA 4AFSA 1WV7H 5GWZA 2XWAA 3PB1E 2GX4A 1IQJA 1ZHPA 1XUIA 2H9EH 4Y8ZA 3SU3A 2BVRH 3Q00A 1LTOA 3LPRA 2D2DA 3UR9A 2A7CA 5TCCA 1EKBB 4MVNA 5A8YA 3A83A 7GCHF 1P3EA 3UQVA 3ZZ4A 1FNIA 3PWBA 1BT7A 4YO9A 3I78A 1KXBA 5EODA 1TNGA 2TGAA 2XBVA 4B76A 2PUXB 1GI6A 4IMZA 1FY1A 1NO9H 1CBWB 3Q3KA 5T6GA 2FOAA 2F9VA 3GISB 3L6PA 3P8GA 5ESBA 3GICB 1AY6H 1F5KU 1QB9A 4Q7YA 1V2UT 4WWYA 1CHGA 4Y0YE 3FAOA 3D65E 3F9FA 1W12U 1LHGH 1P12E 1RIWC 3GCHB 5LGOA 3ESTA 2JH0D 3LGIA 4KTSA 1D3PB 1HPGA 2UWOA 1N6XA 3ATLA 3CENA 1ZHMA 1HJ9A 2QN5T 1CA8B 1C5TA 1BRCE 1BJVA 4GCHG 4E7RG 4RKJB 3F6UH 2FOGA 1F0SA 4JYVH 2GV7A 4K1TA 1EQ9A 1NFXA 1EAWA 2J38A 5J4QA 1T8OA 5E0HA 1E34B 2F9BH 3QTOH 1H9IE 3TITA 2QAAA 4XE4A 5ESTE 1QQ4A 3UNRA 1E0FD 1HBTH 1O2OA 2W7SA 1CGHA 1XVMA 2FZZA 1OKXA 1NU9A 1GCTC 3SV9A 1GHWH 1WOFA 2H9TH 1MAXA 1K21H 3RDZA 4BOHA 4NSVA 1AB9C 5A0CA 1ZYOA 5GXPA 3RLWH 1EPTA 5FPTA 1GI4A 2F9OA 3RXPA 5C5OA 3E0NB 1MZAA 1EOJA 2A2QH 1E37B 2J4IA 1VCQA 3ZZ6A 1DWEH 4JZ1A 3HPTB 1OPHB 1HAVB 1SB1H 2ZA5A 1W7XH 1ZTLA 1C5QA 1G2LA 3KNXA 1GDUA 4ISHH 1DANH 2XC5A 3QWCH 5EQSA 3T2NA 4U30A 2A2XH 1UTQA 4ABGA 4NFFA 1TQ7B 1XUFA 2VB0A 1GJ9B 1DOJA 3FP8E 1WQVH 2TRMA 1AIXH 1TYNA 1Y3VA 2GP9B 2QYIA 3BSQA 2C90B 1GHYH 3SNDA 3TJNA 2AS9A 1O3IA 1O2MA 1VCWA 2FWWA 2A4QA 2VH6A 1ABJH 1FZZA 1H4WA 2PKAB 3OX7U 3URDA 1EP6A 3AASA 1SGRE 2OC8A 4CBNA 2ILNA 2WPMS 3JZ1B 1WYKA 1ZLRA 5GPIB 4Q2KA 3NPSA 3ZZDA 1P01A 1TOCB 4FXGH 4BAOB 1BITA 1ID5H 2P3UB 1ELFA 2WV5A 4UFFH 3P17H 3KGPA 1MBMA 1C2EA 1QY6A 4TYDA 3RMLH 1BTXA 4BANB 1TPOA 4ISNA 3SGBE 1LCYA 1SPJA 1GMHG 1OWKA 3SV6A 4I31A 2YNAA 1KLTA 1GGDB 4Y0ZE 4KKDA 5K7RA 4WMFA 3SV2H 1GCTB 4HGCA 4ISLA 4CREA 2FMJA 1C2LA 1AMHA 1LPGB 2Y5HA 3QO6A 4NCYA 1SGDE 4JK6A 1IQIA 1AB9B 3E90B 2ZPQA 2WPHS 2ZFFH 1AUTC 1DLKB 3MOCA 1BHXB 3LC3A 8KME2 4OS1A 3MNSA 1TRNA 1EZXC 3VB4A 1XXDA 4NA9H 1O2JA 2Q6GA 1MQ6A 4MPWA 1B0EA 4FUCA 1IQEA 1GMCF 2ZPSA 2ZGHA 2A4RA 4Z0KA 3S7KB 1GJ5H 2A7HA 1QL9A 2ZFQH 4ZHMU 5EU8A 3O8BA 3GYLB 1NPMA 1OWIA 3KL6A 1K1PA 2XRCA 3GY6A 2UWLA 4WH6A 2BVSH 1BBRH 1UTLM 1GBMA 2ODYB 1FY3A 1NM6A 1C5PA 1ZTJA 5B6OA 2XTTB 3AAUA 2VIOA 2HNTF 4Z6AH 5F6MA 2GCHG 2ZQ2A 2SNVA 2Y7ZA 1DUAA 1BQYA 3OSYA 1TMUH 2C93B 2Y7XA 2O8WA 1O2QA 5FAHA 4ABHA 5AVDA 1JRSA 2R9PA 3VGCB 2GMTB 2QGRA 1O2IA 1OWEA 1DFPA 4YT6H 2ZHQH 1FXYA 1EJMA 3GY3A 1FI8A 1VR1H 2ZTYA 1Z1IA 1CU1A 4MNYA 1LVYA 3ATMA 1KXEA 1CHOF 4OS5A 2H2ZA 2AERH 3SUFA 4R8TB 2FESH 1FPHH 4AX9H 4OGXA 1OXGA 2ZGBH 1G2MA 1V2ST 3MNBA 5JBAS 3M5MA 3BTGE 2AIQA 1OWJA 4CH8B 2G00A 1AFQB 1V2MT 1BMAA 1UTPA 1NT1A 1C1SA 1EB1H 1QURH 3M5OA 3NXPA 4O03A 5AFZH 1DWDH 4D9RA 2B8OH 1U6QA 4X1RU 3SO3A 3UY9A 1H1BA 1K1IA 1F0TA 2R2MB 4AOQA 4B2AA 2FYRA 3RXHA 4A6LA 3SGQE 1MTNC 5H4IB 1GI0A 1O39A 2ULLA 1ZRBA 2Z9LA 1WCZA 3A8CA 1BMLA 1C1UH 1YGCH 5I25A 1F5LA 1QA7A 1LVOA 3RMNH 2XYAA 4YLUA 2BHGA 1DS2E 2NWNA 1W14U 2ALVA 2ZG0H 1RTKA 3S7HB 1PQ5A 1DSUA 4OS7A 4K69A 4WMEA 3VB6A 4KTUA 1SSXA 4DT7B 1OX1A 3DHKH 3EA7A 1A5GH 3ATKA 1NFWA 4FVDA 2FXRA 6ESTA 2FODA 1V2WT 4I32A 3V12A 3BTME 4IN2A 5FX6A 2EC9H 2ZZUH 4AZ2B 3UR6A 4DURA 1ELVA 1H9HE 1NRRH 1O2KA 3AW1A 5TCAA 5C1YA 4FU7A 3M5LA 1S6FA 1DUEA 2GZ9A 2B7DH 2WV4A 5DP3A 2UWPA 1O2ZA 3E16B 5EXNA 4ABAA 4TWYA 3RMMH 2D1JA 5A09A 5FCKA 3KF2A 3PLPA 3MO3A 1ESTA 4WXIA 4Q7ZA 1L0ZA 1PYTD 1BA8B 1TONA 1YCPM 2FOBA 4JMYA 2IN2A 4MNXA 1P2IA 1TGSZ 2FX4A 2GTBA 4XFQA 1P9SA 4Y7BA 3QGJA 1TX6A 4NZLA 1FLEE 1Y3WA 7GCHG 1ANCA 1A61H 1MTNB 2PW8H 4DGJA 2BY9X 3LT3A 1N6YA 1YPEH 3N7OA 4NWLA 1KY9A 1FN8A 5HGGA 2PWXA 2O8UA 2ANWA 1W2KH 1VITH 1GG6C 2OQ5A 5CE1A 3FANA 3MH6A 4FUGA 1BJUA 1O3FA 2A32A 2DE9A 2RA0A 1YPHC 4HFPB 2TBSA 1UVTH 1SQTA 5SGAE 4AYYB 1INCA 2PV9B 1H9LB 3UQOA 3GY4A 4GUXA 3SHCH 4UDWH 2FOCA 1P05A 3BEFB 4J1YA 2G5VA 3NCLA 1K28D 1ZJDA 3UNSA 1SLUB 2FIRH 1QRWA 3A8DA 2KAIB 3M36A 1TGCA 5E2PA 3SJ9A 1CVWH 1AN1E 2BB4A 3RUOA 1NRPH 1ZHRA 3UTUH 3GOVB 1C1TA 2V0BA 2D8WA 4OS4A 1SBWA 2C8ZB 2BLOA 2Z94A 3RM0H 5DP6A 4I33A 4IMQA 4B2CA 1ZMJA 1TRMA 2FOEA 2VWLA 1IQKA 1MCVA 3SW2B 3MU8A 2UUFB 1G9IE 1Y5UT 1IQHA 2OTVA 5E0GA 1YLCA 4FUJA 2PKSC 1GBFA 1NC6A 3SJ8A 3VB3A 3RXSA 1C2KA 1GBDA 1T4VH 4KTCA 4AYVB 5IDKA 3A87A 4E7NA 1V2PT 1GJ4H 3P8OA 2W7UA 2Z9IA 3MI4A 1G32B 4HZHA 1Y3YA 1W0ZU 3MMGA 3MNXA 2BDIA 1MKWH 1MUEB 3S0NA 1KTSB 3L3TA 3ODFA 3LGYA 4X6NA 1G36A 3UWJH 3NUMA 1OOKB 4B75A 1S5SA 2JETC 2H6MA 1EAXA 3FVFB 3HATH 3QZQA 3SI3H 3VB5A 5C20A 1OWDA 1Z8RA 3OY5U 1BRUP 4WMDA 4CRBA 1YCPH 3FZZA 1T8MA 3KQDA 3Q76A 1UHBA 3SU5A 3MH5A 2AMQA 3EA8A 2AMPA 1V2QT 2Y5FA 1AKSB 5IYTA 1ZMNA 1Y5AT 2PKAA 4GSOA 1DX5M 2VVVA 3OYPA 4CH2B 1VZQH 3MU0A 1QGFA 4I8GA 5JB8S 3E3TA 3RMOH 1SGQE 1O3OA 3KQEA 1GJ8B 1P2NA 3V13A 2R3UA 2QF0A 3DT0H 1PQ7A 3QK1A 2O8TA 1PQAA 3RXTA 4ABIA 4ABDA 2ZDVH 1IQFA 2BLWA 1NY22 1S0QA 2V3OH 1D3DB 4NIYA 1K1LA 4XBDA 3K6ZA 4FUHA 1TALA 5C67A 4IW4E 5CHAC 2C8XB 2BLVA 2FS9A 2UUJB 3A7XA 1D6WA 5L2ZH 1J14A 1ZMLA 3ZVDA 4ISIH 3F1SB 1RRKA 1DY9A 1A4WH 2PKSB 4B2BA 4BTIB 4DIIH 1O5CB 3ZVCA 1P2KA 3QUMP 2QXJA 3BG4C 4NA8A 5DP4A 2RCEA 2OC7A 3STJA 1HAOH 3ZZ7A 4VGCC 3RC4A 4A1TA 1LMWB 2BVXH 1GMCG 1P2MA 2OXSA 3R0FA 4NIXA 1N8OC 1KLJH 2M5TA 3RC5A 3RXEA 3MU1A 4BTTB 2JETB 1A0LA 1DT2A 1O2GH 2ODQA 4ZUHA 3B9FH 2G52A 1O3PB 2R3YA 2HALA 4Y8XA 3A82A 1C1NA 4Y79A 1TBRH 3VEQB 1T8NA 5DK1A 2TGPZ 1Z8GA 4XDEA 2VWNA 3A84A 9LPRA 2VU8E 1TFXA 1P2QA 2Z3CA 4YT7H 5GCHF 5CMXH 1K1MA 3M35A 1FIWA 3LJOA 2NU4E 2BY5X 1KXCA 5DP7A 4A1XA 1GI5A 1WAYB 4AB9A 4ZKRU 2BQWB 1LVBA 2W3KA 4QT8C 4B71A 4RN6A 1QB1A 1MTSA 5HMAA 3KQBA 4THNH 3K2UA 2BD5A 3LJJA 1KDQA 1SOTA 6LPRA 1TLDA 1AWFH 1HJAC 5CHAB 4AFUA 3SU0A 3LOXA 1SLVB 3K9XB 1CT0E 2AGGX 3C27B 2D26C 1W13U 2QY0B 1V2OT 2AIPA 1DPOA 1ZR0A 3MWIU 2ZCKP 1QFKH 3GCTF 5FBEA 1BTWA 1S6HA 1TE0A 2BX3A 1MTWA 1HNEE 1SI5H 1UVPA 2P3FH 1KTTB 1G3BA 1AD8H 1PPGE 3BG4B 1SLXB 2GD4B 2Z3EA 2ZGXH 1XM1A 1C5ZB 2SGDE 3TPIZ 1T32A 1NFUA 3ZVFA 4BNRA 1QRXA 4FU8A 4X1SU 1MD7A 3ZZBA 2BX4A 4TY6A 4GVUA 5EQRA 1BMNH 1C5RA 2ZHDA 1EOLA 1TGTA 4UFGH 4LZ4B 1QBNA 3OTJE 3A7TA 2VINA 1OS8A 3SV8A 1VJAU 5FXLA 3L33A 1VCPA 3QTVH 1P04A 2PUQH 4MNWA 2G8TA 5A2MH 5F8TA 3O8CA 3AW0A 1KIGH 1WU1A 1G3DA 3HGPA 3TJVA 4O3TA 3V7TA 1YLDA 4X8TH 1O2YA 2GKVE 3A7ZA 3VXEH 3MH7A 3RXFA 1S83A 2QA9E 4H4FA 2ZPRA 3UOUA 1IQNA 4ASHA 1UK4A 3AAVA 3ZVEA 1QIXB 3NKKA 2BQ7B 4NSYA 1GJCB 1QL8A 2ZFTA 5DP8A 1J8AA 2HNTC 1HJAB 1GHXH 1GMDF 1NRSH 1RIWB 3MU5A 2ZU2A 3DUXH 4I8JA 3LKWA 4ZXYH 3RXMA 2HOBA 2HGTH 1C5YB 1YPHE 3QZRA 3RXBA 2IPHA 2Z7FE 5JDUB 1SG8B 1C5WB 1O5BB 1V6DA 4MDSA 1W0YH 2ZHEH 3TH2H 1E35B 4BTUB 3SNCA 1QTFA 2P59A 1TX8A 2B5TB 4UFEH 1FIZA 1NRQH 1DXWA 4X1QU 2FYQA 1HXFH 2WPJS 4ZKOU 1ZTKA 1V2NT 1ZSKA 5HM2A 2GVFA 2BDBA 1FPCH 3I29A 1BZXE 2BM2A 2NU0E 8GCHF 5K0HA 1C5NH 3DA9B 3LH1A 1O37A 3HKIB 1Y3XA 1IAUA 2O8LA 1ELBA 3A80A 1TB6H 1BMMH 9ESTA 1Z71A 1HIAA 1GBJA 3QDZB 1O33A 1UTJA 1TX7A 4X6MA 2CXVA 4A1VA 1JXPA 3MHWU 3EYDA 1VGCC 2Q6DA 1H8IH 5F8XA 2XNIA 1ZGVA 2FOMB 2WYJA 3BF6H 1O38A 2ZTZA 1HB0B 1LHDH 1C1WH 1WTHD 4ZAEA 3B23B 1FMGA 1W7GH 4AGJA 4K1EA 1LDTT 1T31A 4PROA 2LNCA 2SGPE 2KAIA 1EB2A 3UOPA 3SNEA 4D76A 6GCHF 1FY8E 2BXTH 5EG4A 1VITF 5E2OA 2ZQ1A 1V2JT 1BTYA 1C5MD 2ANYA 4A92A 1P57B 3PMJA 5DG6A 1DWBH 1QBVH 1SFIA 4OS2A 2PSXA 2XXLA 2BYAX 3SZNA 4DG4A 3A86A 2ALPA 2BTCE 3HKJB 4I8KA 4CRFA 3MNCA 4NIVA 5F03A 1Z1JA 1CSOE 1BBRK 2V6NA 3NWUA 5FX5A 5LH8A 3VB7A 1AE5A 4DVAU 1DXPA 1JBUH 1SL3A 1TNJA 2WPLS 2G51A 1EPTC 1O35A 4JCNA 2A45B 3JZ2B 2STAE 1S81A 2YNBA 3I77A 1FUJA 1P11E 1O3EA 4LZ1H 1XUHA 1JIMA 5FHTA 1HAGE 1UTOA 2A31A 4INKA 2EI8A 1YP9A 2OD3B 2SGAA 3F9EA 1TRYA 4SGAE 4KGAA 5A8ZA 4DW2U 1O0DH 1FJSA 1GJ6A 3E91A 2A1DB 1LHCH 1DM4B 2DE8A 1UTKA 5C1UA 3TGIE 1L4DA 2XBYA 4YOJA 4Y76A 4CR5A 4MLFB 3SUGA 4TPYA 3SU4A 1E38B 3F9HA 3P8FA 1P03A 1A5HA 5JPMH 4MPXA 3TGKE 2BD8A 3A8BA 1THPB 3ZZ9A 1CGIE 2Q1JA 1CQQA 2ZFSA 3RXVA 4WF8A 3RXQA 1C1QA 4FVBA 3E1XB 3SUEA 1GI7B 1P0SH 2HLCA 3V0XA 2OQUA 1UO6A 3RXAA 4ZMAH 1A3EH 5E0JA 4CHAC 5FPYA 3FP7E 1ELEE 4BAQB 1C1MA 4AN7A 3ZYDA 2VVUA 3TNSA 5JBCS 1MH0A 2JH6D 1W3CA 4D9QA 1D9IA 8LPRA 1V2KT 2LPRA 3ZV9A 1J16A 2BDHA 4X1PU 1IQLA 1A46H 2Z6BD 3BTHE 2ZFRH 3BTWE 1JMOH 1UCYK 1GJ7B 4Y71A 3PTBA 4X2WA 2HWLB 4X0WU 3ZV8A 5T6DA 5A0AE 3IITA 1XUJA 2BDYA 2SFAA 3E8LA 2FLBH 4JZEH 5EW2H 4X2VA 1BTHH 1B7XB 4NZQA 4K8YA 1YYY1 1AFEH 4X1NU 2ZCLP 2HRVA 5AFYH 1UCYE 2AYWA 2JKHA 2ZECA 5G4BA 1NESE 1EPTB 4D8NA 1WBGB 1UJ1A 3M61U 3D49H 1GI1A 1GPZA 5EOKA 1DITH 5T3HA 1BUIA 4ZKNU 1WTGH 2OBQA 4ZHAA 4OS6A 2GDEH 2GT7A 3PMHB 1ESBA 1O31A 3A7YA 1ZPCA 3MYWA 5LPEA 1FV9A 4JYTA 1GHVH 1QR3E 3S9CA 3ATIA 3PM3A 1RJXB 1GHBG 2A0QB 1O2VA 2FI5E 4Q7XA 5TJXA 2FOFA 1O2XA 2J34A 1TPSA 3BTKE 4HI3A 2ASUB 5AHGH 4CHAB 4UE7H 1UK2A 1C5XB 1Q3XA 4AG1A 4IS5A 3CS7A 1TGBA 3RM2H 2FS8A 1UTMA 3U98H 1PPFE 1SLWB 3H7TA 1YPKH 4LOYH 1SFQB 2WYGA 3SGAE 1D6RA 5L6NH 5A8XA 5LPFA 3ZVBA 5JBBS 4JZFH 1K1JA 1DICA 4JYUH 3TNTA 1D3QB 1GMHF 2OCVB 1C2JA 1IQMA 1A3BH 3TVJB 4CRCA 3IWMA 1P10A 1B5GH 1DDJA 2AH4X 1Q31A 2ZDLA 2TGDA 2VWOA 1ESAA 2FO9A 1BRAA 2VVCA 1K22H 1FN6A 2J92A 1LPZB 3RXKA 1QB6A 1L2EA 4NGAH 2A5KA 3BEIB 3A88A 2XBWA 1MKXH 2FDAA 2ZWLH 1MQ5A 1O34A 3MH4A 1GVZA 1K9OE 2Z9JA 3PYHA 4SGBE 1L1GA 1OWHA 3W95A 1D4PB 3A81A 1O5EH 1XXFA 2ZC9H 5BPEA 4I8HA 2PTNA 3UREA 1MZDA 1SGTA 4LK4A 1BIOA 4BXSA 1ANEA 1ELAA 5JBTA 3TK6A 2PHBA 4IC5A 1GJAB 2P8OC 3MO9A 3SORA 1HAVA 1P2OA 4O9VA 1FY4A 5BRRE 4B73A 2CV3A 5EGMA 3M37A 2CGAA 3RXRA 1MMJN 1LHFH 3A7VA 1SVPA 1J15A 1XKAC 2ZO3H 4JZIA 3LIWA 4CR9A 3TK5A 1P02A 1QJ6B 1TGNA 2PGQB 2VIPA 3SU1A 1ANDA 1GG6B 3K65B 1XUKA 4DCDA 3S69A 2VJ1A 1C5SA 1QA0A 3LONA 2IOTA 4X6OA 1ETSH 1O3MA 1ANBA 1SGIB 2H5DA 1EATA 2BDGA 1J17T 1T8LA 1ZSJA 2XC0A 3TU7H 2STBE 3ZVGA 1LHEH 3B8JA 2G5NA 1SGFA 3ZZAA 3ZZCA 2GCTC 3PTNA 1DE7H 1S82A 1EJNA 3C1KA 1A0HB 1GBHA 1RS0A 3TH4H 1EJAA 2R0KA 3A7WA 2BOHB 1MU6B 1YBWA 1Z6EA 4HTCH 3MU4A 1GI9B 1TPPA 2PR3A 1ZJKA 3RXJA 2HVXA 1CGJE 2QXHA 1BTZA 1HAZB 2UUYA 2A5IA 4XOJA 2O8MA 2WINI 1PPBH 1ZGIA 4AB8A 2OLGA 3M7QA 2WPKS 2QCYA 5L30H 1SR5C 2ZGJA 2OUAA 4K8BA 3EAJA 2C3SA 4XBCA 1P2JA 3PROA 4ZKSU 3LC5A 3SU6A 5JYIA 1CBWC 1GI2A 1G37A 1SQAA 1ZPZA 1AZ8A 3TJOA 2ZHWH 3SN8A 3BTFE 4INHA 1K1OA 3GCHC 1Z7KA 3LH3A 3OY6U 4YLQH 1MCTA 2ANMH 1C5OH 4H42U 3U1IB 1SGCA 1L1NA 1CT2E 3T29A 1MTUA 4ABJA 3T62A 1TQ0B 6GCHG 5L2YH 1SGPE 4X8VH 1F2SE 1F92A 2BLQA 1EAUA 5ABWA 1VITG 5F8ZA 1O5FH 4U2WA 3S9AA 1LQDB 3CS0A 2QC2A 2A4GA 1QJ7B 3M3TA 2J2UA 5DKMA 1HAIH 1V2RT 3UFAA 4DJZB 4A7IB 3SUDA 1PFXC 3G01A 2H1UA 2ZGCA 2BXUH 2V35A 1EZQA 1THRH 2ZU1A 4UFDH 4TWWA 4DIHH 1C4U2 2VIDA 4ZHLU 1Z8IB 4X2YA 1AI8H 1Q2WA 3O8DA 2G55A 4XBBA 1HAHH 4K60A 3RU4D 1AUJA 1HAPH 1T7CA 1YPGH 1TBQH 1RD3B 1GBIA 3MFJA 2CMYA 3T28A 3QN7A 3TGJE 1ZPBA 1CHOG 1LKBA 1QQUA 1FONA 1TNHA 2Z9GA 4WXVA 6CHAC 3VXFH 1JOUB 2ZCHP 1GVKB 4E06H 2TPIZ 5DP9A 1GHZA 1RTLA 1PPEE 1ARBA 2SGQE 4Y6DA 4J2YB 1TMBH 2FI3E 2XCFA 1O2NA 1O5GH 2QF3A 2H5CA 3A8AA 3ZVAA 4AORA 2ESTE 4XSKU 3TIUA 1O2LA 3KEEA 2GV6A 4VGCB 3SJKA 1L4ZA 1KXAA 1CA0C 1SQOA 4UEHH 3H7OA 1Y59T 4NA7A 1N8OB 1NN6A 1NROH 1SGEE 3PMBB 1Y3UA 1PQ8A 1KYNA 1NS3A 1HLTH 1LQEA 3BIUH 3U9AH 1K1NA 1BCUH 4Y8YA 1S84A 3SQEE 4MPUA 4WVPE 3DFLA 4I7YH 1F7ZA 2VH0A 3M7TA 1V2VT 3CP7A 3U69H 4H6TA 1GGDC 2QXIA 1GCDA 1ETTH 1AVXA 5C3NA 1O3CA 1OP0A 1EUFA 2J9NA 2FEQH 2XBXA 1FQ3A 1V2LT 2BZAA 2OC1A 3FZDA 4X8UH 1HJ8A 3QX5H 1TA6A 4YESB 1O3HA 3O8RA 5EW1H 1FAKH 1GBLA 3PLKA 5DO4H 1UVSH 5LPRA 1V3XA 2W5EA 3Q3XA 2G4UA 2OC0A 3GY7A 2JH5D 4Y7AA 3R3GB 1TNLA 4U32A 1O3DA 3DD2H 4MQAA 4NWKA 1NFYA 1NRNH 2ANKH 6CHAB 4JK5A 2EI6A 4IGDA 1GHAF 3TJUA 3RLYH 2Z9KA 2BY6X 4GHTA 1A5IA 1YF4A 1HV7A 3PMAB 1UHBB 1C9TA 3KN2A 2RDLA 1BB0B 1M9UA 1O36A 3ZZ5A 2VIVA 3Q77A 1XKBC 2CF9H 3ELAH 1W11U 2FTMA 1SOZA 3UNQA 1O2RA 1TA2A 1CA0B 1YPJH 1O3JA 4F49A 2WUBA 3U8OH 3TH3H 5DJ7A 1O3GA 4TY7A 1O3LA 1QHRB 1UVUH 5HYOA 1BTUA 1QJ1B 2K1QA 1NTPA 3P70B 3VGCC 4BXWA 1AQ7A 2R2WU 2GMTC 5J4SA 3RC6A 1ARCA 1SHHB 4NFEA 3GYMA 1LVMA 1YKTA 1XX9A 2B0FA 3BTEE 1HCGA 1AVWA 2ZKSA 1P8VC 2GZ8A 3E6PH 1DWCH 1C9PA 1UK3A 4BAKB 4TPIZ 4NG9H 1P09A 2P16A 2R0LA 2GGVB 2UUKB 1ZRKA 3HK3B 3QLPH 1C5VA 2EA3A 2GDDA 4FUBA 1RTFB 2ZFPH 1SMFE 3WY8A 1AFQC 2EEKA 4R0IA 4A5TS 1OYQA 1UTNA 3GY2A 1Y5BT 1SGYE 1EXFA 1BHXF 5C5NA 1C2GA 3H5CB 1HDTH 3T25A 2TGTA 3KIDU 1EP5A 1GDNA 3T5FH 2AGEX 1JRTA 3RXIA 4IBLH 1O32A 1Z8JB 2C8WB 4INLA 1O3BA 1BTPA 4MPVA 3EA9A 1OP8A 3A89A 1WQSA 2J95A 2F83A 3PO1C 4ESTE 3M3VA 2CHAC 1FDPA 1CT4E 2WUCA 4FUIA 3D62A 2BY7X 1ELCA 2ZF0H 4O3UA 1ZOMA 4K5ZA 1GI8B 3OU0A 1FY5A 1C5LH 1UMAH 1A1RA 1BBRE 3EQ0H 1OYTH 5DGJA 2RA3A 4AFQA 4MNVA 1AE8H 3T27A 2GZ7A 3MO6A 1GBEA 4FUFA 1TOMH 1GL1A 3BV9B 3ZZ8A 2AMDA 1C1RA 3FP6E 1AKSA 1HAXB 1YPLH 1NU7B 2W26A 2SNWA 4JZDH 2A7JA 3BTDE 1C1OA 1JWTA 2P93A 2C4FH 1DLEA 3ENSB 1VGCB 2TIOA 1O30A 3KCGH 2G4TA 2XWBI 1KDQB 3SHAH 2Y80A 2P94A 1KLIH 1GBAA 1L1JA 1RFNA 3SJIA 2DUCA 3RU4E 3UIRA 1HYLA 1AHTH 4MG3A 4YM9A 1Z6JH 2OP9A 4GCHF 1DY8A 3EDXB 2BD7A 1DSTA 1GVLA 2BY8X 3QGNB 2OBOA 2BD4A 2PTCE 4Y10E 1P9UA 1C5UA 1TAWA 3VFEA 3LGWA 1F0UA 4U01A 1PPCE 2BDCA 2AFQB 5HXFA 2BMGB 7LPRA 5C1XA 3UUZA 4ZH8A 3PWCA 4D7GA 1YPMH 1UCYH 5EQQA 2Z3DA 2BD3A 1XVOA 1ETRH 1GBCA 4FUDA 1AVGH 4BAMB 1AWHB 3PO1B 2I6SA 1PYTC 3NZIA 3HK6B 7ESTE 4RKOB 1HUTH 2F3CE 3M5NA 2CHAB 3UWIA 1O2SA 1JIRA 1GWAA 4AGKA 3SU2A 1G30B 3VPKA 1O5AB 3RXGA 1Y8TA 3SQHE 1PPHE 2G81E 2Y81A 3V3MA 1TNIA 2CN0H 3M3SA 4BAHB 1O3NA 1C2MA 1F0RA 3M7UA 2PGBB 3RXUA 1BRBE 2V3HH 5HM9A 1ABIH 3KHVA 3IG6B 1QRZA 3F68H 1N1LA 3HGNA 5E8EH 5C2ZA 1IQGA 3P8NA 5FCRA 2B9LA 1HXEH 5EXMA 4D7FA 3GY5A 3ZZ3A 2PSYA 1O2WA 3PV4A 3D23A 1TPAE 2AGIX 2QXGA 5GCHG 1TABE 4Q80A 1PPZA 4CRDA 4LXBH 1TNKA 1A0JA 1KXFA 5PTPA 2PLXA 2Y6TA 3GDSA 4CBOA 1TMTH 1C4Y2 4FU9A 1HRTH 1MD8A 3U1JB 1GDQA 1D3TB 2ZU3A 1XMNB 3ZYEA 1SGNE 1AO5A 2FLRH 4UONA 1IOEA 1GJDB 1RGQA 3P92A 3SV7A 4ABEA 4B1TA 8ESTE 3ATWA 3NK8A 4DOQA 1A7SA 2QIQA 1QNJA 2ZDAH 4ABFA 1ORFA 2ZHFH 1GJBB 2W3IA 2FP7B 1G3EA 1AZZA 3GCTG 2O9QA 3AVZA 1O2HA 2NU1E 4K1SA 2SGFE 2P95A 2Y5GA 1C2IA 2BQ6B 3LGUA 2ODPA 3P95A 1HIAB 2ZIQH 5AF9H 1C1PA 7KMEH 2H9HA 4FUEA 1E36B 3BTTE 1AGJA 1SHYA 2NU2E 2NU3E 1KXDA 1QBOA 1YM0A 2ZU5A 1J9CH 3TLOA 5GJ4B 3UPEA 1DVAH 1WUNH 1MKXK 4K2YA 1YC0A 1HGTH 2ZP0H 5A0BA 1HAYB 1ELTA 3K6YA 1ACBE 1T4UH 1RXPA 1O2PA 2VNTA 1S0RA 2HNTE 1O3KA 1CE5A 4ZROA 2AEIH 1QL7A 5GDSH 3RXLA 1ZZZA 3F9GA 3GY8A 1NZQH 3RU4T 2YOLA 3URCA 1CO7E 4AFZA 3SOSA 1G3CA 1LKAA 3LGVA 1THSH 3GDVA 1TIOA 2HPPH 2IJOB 4M7GA 4CRGA 1C2DA 1ZSLA 4GHQA 2F91A 4F4OC 3LDXH 2GCHF 2VWMA 2VGCC 2Q6FA 3ODDA 2EI7A 1MKWK 1C2FA 3LU9B 4YOIA 3KQCA 4ZXXH 3SJOA 5EXLA 3S9BA 4KP0A 1IHSH 2XW9A 2XCNA 1C4V2 3BIVH 1B0FA 3BN9A 2PFEA 1BDAA 4GPGA 4Y11E 3T26A 3SBKA 1YCPK 2C8YB 3A85A 1O3AA 3E0PB 5I46H 1FAXA 4GAWA 1EZUC 1GMDG 1V2TT 3MTYA 1S85A 1QCPA 3GCOA 5GIBA 4YTAA 1GHAG 4X8SH 4OGYA 3DFJA 4GLYA 4IC6A 2FPZA 1EZSC 5FBIA 2RG3A 1GBKA 3ITIA 5FPSA 4O97A 1P3CA 3P6ZB 1W8BH 1F5RA 2FX6A 4ABBA 1EAIA 2GT8A 4H6SB 2CJIA 4K3JA 1MAYA 2Y82A 4ISOA 1C1VH 2P3TB 2CF8H 1LPKB 2BZ6H 3FFGA 1O2UA 3U8TH 1KSNA 1MU8B 2FOHA 2SGEE 3SNBA 4RSPA 8GCHG 2I6QA 1ELDE 4CRAA 2BOKA 4YZUA 3BG8A 1K2I1 3GCNA 1UVOA 3PLBA 5ETXA 1AU8A 1SGFG 1MTVA 4X2XA 2THFB 2A4OA 3TK9A
chains in the Genus database with same CATH superfamily
3EE0B 1IHTH 3Q3YA 4NIWA 2BD2A 1GBTA 2P8OB 3GDUA 2ZEBA 1TWXB 1SC8U 2QV1A 3RXCA 4WH8A 2F9UA 3U8RH 2HPQH 1P06A 2ZDNA 3RXOA 5JB9S 1A2CH 1BOQA 1WSSH 2VIQA 1O5DH 1ELGA 5CHBA 4WY3A 1HFDA 2ZNKH 4IN1A 1O2TA 4I8LA 3LGTA 4KELA 3EGKH 1GL0E 1LO6A 2F4LA 2J94A 2VGCB 1YLNA 3BEUA 4B74A 2A5AA 1X7AC 1C2HA 2FI4E 1H8DH 2XC4A 1OP2A 4AG2A 4X6PA 1OSSA 2BD9A 1TBZH 2FTLE 1VJ9U 3RXDA 2VIWA 5EPNA 1PJPA 3SNAA 2OINA 4YOGA 5DP5A 2ZU4A 2ZTXA 3RP2A 3F0OA 3W94A 2FM2A 4DY7B 3SI4H 2WPIS 5T6FA 1EX3A 2ZDMA 1GI3A 1YY3A 4MTBA 1EASA 4WJG2 4E05H 2XNDD 2BDAA 3STIA 3BTQE 1XUGA 4UD9H 1MBQA 2ZDKA 1GBBA 2GCTB 2ZI2H 1GHBF 1W10U 2F9NA 2KR7A 5DPAA 5EPYA 2F9PA 4AFSA 1WV7H 5GWZA 2XWAA 3PB1E 2GX4A 1IQJA 1ZHPA 1XUIA 4TT3D 2H9EH 4Y8ZA 3SU3A 2BVRH 3Q00A 1LTOA 3LPRA 5FL7D 2D2DA 3UR9A 2A7CA 5TCCA 1EKBB 4MVNA 5A8YA 2JJ2D 3A83A 7GCHF 1P3EA 3UQVA 3ZZ4A 1FNIA 1SKYE 3PWBA 1BT7A 4YO9A 3I78A 1KXBA 5EODA 1TNGA 2TGAA 2XBVA 4B76A 2PUXB 1GI6A 4IMZA 1FY1A 1NO9H 1CBWB 3Q3KA 5T6GA 2FOAA 2F9VA 3GISB 3L6PA 3P8GA 5ESBA 3GICB 1AY6H 1F5KU 1QB9A 4Q7YA 1V2UT 4WWYA 1CHGA 4Y0YE 3FAOA 3D65E 3F9FA 1W12U 1LHGH 1P12E 1RIWC 3GCHB 5LGOA 3ESTA 2JH0D 3LGIA 4KTSA 1D3PB 1HPGA 2UWOA 1N6XA 3ATLA 3CENA 1ZHMA 1HJ9A 2QN5T 1CA8B 1C5TA 1BRCE 1BJVA 4GCHG 2J97A 4E7RG 4RKJB 3F6UH 2FOGA 1F0SA 4JYVH 2GV7A 4K1TA 1EQ9A 1NFXA 1EAWA 2J38A 5J4QA 1T8OA 5E0HA 1E34B 2F9BH 3QTOH 1H9IE 3TITA 2K0QA 2QAAA 4XE4A 5ESTE 1QQ4A 3UNRA 1E0FD 1HBTH 1O2OA 2W7SA 1CGHA 1XVMA 2FZZA 1OKXA 1NU9A 1GCTC 3SV9A 1GHWH 1WOFA 2H9TH 1MAXA 1K21H 3RDZA 4BOHA 4NSVA 1AB9C 5A0CA 1ZYOA 5GXPA 3RLWH 1EPTA 5FPTA 1GI4A 2F9OA 3RXPA 5C5OA 3E0NB 1MZAA 1EOJA 2A2QH 1E37B 2J4IA 1VCQA 3ZZ6A 1DWEH 4JZ1A 3HPTB 1OPHB 1HAVB 1SB1H 2ZA5A 4OM9A 1W7XH 1ZTLA 1C5QA 1G2LA 3KNXA 1GDUA 4ISHH 1DANH 2XC5A 3QWCH 5EQSA 3T2NA 4U30A 2A2XH 1UTQA 4ABGA 4NFFA 1TQ7B 1XUFA 2VB0A 1GJ9B 1DOJA 3FP8E 1WQVH 2TRMA 1AIXH 1TYNA 3WW7A 1Y3VA 2JIZD 2GP9B 2QYIA 3BSQA 2C90B 1GHYH 3SNDA 3TJNA 2AS9A 1O3IA 1O2MA 1VCWA 2FWWA 2A4QA 2VH6A 1ABJH 1FZZA 1H4WA 2PKAB 3OX7U 3URDA 5EIYA 1EP6A 3AASA 1SGRE 2OC8A 4CBNA 2ILNA 2WPMS 3JZ1B 1WYKA 1ZLRA 5GPIB 4Q2KA 3NPSA 3ZZDA 1P01A 1TOCB 4FXGH 4BAOB 1BITA 1ID5H 2P3UB 1ELFA 2WV5A 4UFFH 3P17H 2V7QD 3KGPA 4RT0A 1MBMA 1C2EA 1QY6A 4TYDA 3RMLH 1BTXA 4BANB 1TPOA 4ISNA 3SGBE 1LCYA 1SPJA 1GMHG 2WV9A 1OWKA 3SV6A 4I31A 2YNAA 1KLTA 1GGDB 4Y0ZE 4KKDA 5K7RA 4WMFA 3SV2H 1GCTB 4HGCA 4ISLA 4CREA 2FMJA 1C2LA 1AMHA 1LPGB 2Y5HA 3QO6A 4NCYA 1SGDE 2W6JD 4JK6A 1IQIA 1AB9B 3E90B 2ZPQA 2WPHS 2ZFFH 1AUTC 1DLKB 3MOCA 1BHXB 3LC3A 8KME2 4OS1A 3MNSA 1TRNA 1EZXC 2JDID 3VB4A 1XXDA 2KCOA 4NA9H 1O2JA 2Q6GA 1MQ6A 4MPWA 1B0EA 4FUCA 1IQEA 1GMCF 2ZPSA 2ZGHA 2A4RA 4Z0KA 3S7KB 1GJ5H 2AHME 2A7HA 2JJ1D 1QL9A 2ZFQH 4ZHMU 2YMSD 5EU8A 3O8BA 3GYLB 1NPMA 1OWIA 3KL6A 1K1PA 2XRCA 3GY6A 2UWLA 4WH6A 2BVSH 1BBRH 1UTLM 1GBMA 2ODYB 1FY3A 1NM6A 1C5PA 1ZTJA 5B6OA 2XTTB 3AAUA 2VIOA 2HNTF 4Z6AH 5F6MA 2GCHG 2ZQ2A 2SNVA 2Y7ZA 1DUAA 1BQYA 3OSYA 1TMUH 2C93B 2Y7XA 2YMSB 2O8WA 1O2QA 5FAHA 4ABHA 5AVDA 1JRSA 2R9PA 3VGCB 2GMTB 2QGRA 2KFWA 1O2IA 1OWEA 1DFPA 4YT6H 2ZHQH 1FXYA 1EJMA 5C0UA 2IPQX 3GY3A 1FI8A 1VR1H 2ZTYA 1Z1IA 1CU1A 4MNYA 1LVYA 3ATMA 1KXEA 5HIYA 1CHOF 4OS5A 4XRNA 2H2ZA 2AERH 3SUFA 4R8TB 2FESH 1FPHH 4AX9H 4OGXA 1OXGA 2ZGBH 1G2MA 1V2ST 3MNBA 3SZEA 5JBAS 3M5MA 3BTGE 2AIQA 1OWJA 2GJGA 4CH8B 2G00A 1AFQB 1V2MT 1BMAA 1UTPA 1NT1A 1C1SA 1EB1H 1QURH 3F0PA 3M5OA 3NXPA 4O03A 1DWDH 4D9RA 2B8OH 1U6QA 4X1RU 3SO3A 3UY9A 1H1BA 1K1IA 1F0TA 2R2MB 4AOQA 4B2AA 2FYRA 3RXHA 4A6LA 3SGQE 1MTNC 5H4IB 1GI0A 1O39A 2ULLA 1ZRBA 2Z9LA 1WCZA 3A8CA 1BMLA 1C1UH 1YGCH 4ASUD 5I25A 2LP6A 1F5LA 1QA7A 1LVOA 3RMNH 2XYAA 4YLUA 2BHGA 1DS2E 2NWNA 3FOAA 1W14U 2ALVA 2ZG0H 1RTKA 3S7HB 1PQ5A 1DSUA 4OS7A 4K69A 4WMEA 3VB6A 4KTUA 1SSXA 4DT7B 1OX1A 3DHKH 1W0JD 3EA7A 1A5GH 3ATKA 1K0HA 1NFWA 4FVDA 2FXRA 6ESTA 2FODA 1V2WT 4I32A 3V12A 3BTME 4IN2A 5FX6A 2EC9H 2ZZUH 4AZ2B 3UR6A 4DURA 1ELVA 1H9HE 1NRRH 1O2KA 3AW1A 5C17A 5TCAA 5C1YA 4FU7A 3M5LA 1S6FA 1DUEA 2GZ9A 2B7DH 1WXRA 3DSOA 2WV4A 5DP3A 2UWPA 1O2ZA 3E16B 5EXNA 4ABAA 4TWYA 3RMMH 2D1JA 5A09A 5FCKA 3KF2A 3PLPA 3MO3A 1ESTA 4WXIA 4Q7ZA 1L0ZA 3DSGA 1PYTD 1BA8B 1TONA 1YCPM 2FOBA 4B6FA 4JMYA 2IN2A 4MNXA 1P2IA 1TGSZ 2FX4A 2GTBA 4XFQA 1P9SA 4Y7BA 3QGJA 1TX6A 4NZLA 1FLEE 1Y3WA 7GCHG 1ANCA 1A61H 1MTNB 2PW8H 4DGJA 2BY9X 3LT3A 1N6YA 1YPEH 3N7OA 4NWLA 1KY9A 1FN8A 5HGGA 2PWXA 2O8UA 2ANWA 1W2KH 1VITH 1GG6C 2OQ5A 5CE1A 3FANA 3MH6A 4FUGA 1BJUA 1O3FA 2A32A 2DE9A 2RA0A 1YPHC 4HFPB 2TBSA 1UVTH 2OK5A 1SQTA 5SGAE 4AYYB 1INCA 2PV9B 1H9LB 3UQOA 3GY4A 4GUXA 3SHCH 4UDWH 2FOCA 5HKKD 1W0KD 3VG8A 1P05A 3BEFB 3OTPA 4J1YA 2G5VA 3NCLA 1K28D 1ZJDA 3UNSA 1SLUB 2FIRH 1QRWA 3A8DA 2KAIB 3M36A 1TGCA 5E2PA 3SJ9A 1CVWH 1AN1E 2BB4A 3RUOA 1NRPH 1ZHRA 3UTUH 3GOVB 1C1TA 2V0BA 2D8WA 4OS4A 1SBWA 2C8ZB 2BLOA 2Z94A 3RM0H 5DP6A 4I33A 4IMQA 4B2CA 3F2FA 1ZMJA 1TRMA 2FOEA 2VWLA 1IQKA 1MCVA 3SW2B 3MU8A 2UUFB 1G9IE 1Y5UT 1IQHA 2OTVA 5E0GA 1YLCA 4FUJA 2PKSC 1GBFA 1NC6A 3KQ5A 3SJ8A 3VB3A 3RXSA 1C2KA 1GBDA 1T4VH 4KTCA 4AYVB 5IDKA 3A87A 4E7NA 1V2PT 1GJ4H 3P8OA 2W7UA 2Z9IA 3MI4A 5F53A 1G32B 4HZHA 1Y3YA 1W0ZU 3MMGA 3MNXA 2BDIA 1MKWH 1MUEB 3S0NA 1KTSB 3L3TA 3ODFA 3LGYA 4X6NA 1G36A 3UWJH 3NUMA 1OOKB 4B75A 1S5SA 2JETC 2H6MA 1EAXA 3FVFB 3HATH 3QZQA 3SI3H 3VB5A 5C20A 1OWDA 1Z8RA 3OY5U 1BRUP 4WMDA 4CRBA 1YCPH 3FZZA 1T8MA 3KQDA 3Q76A 1UHBA 2QF4A 3SU5A 3MH5A 3ZIAD 2AMQA 3EA8A 2AMPA 1V2QT 2Y5FA 1AKSB 5IYTA 1ZMNA 1Y5AT 2HLDD 2PKAA 4GSOA 1DX5M 2VVVA 3OYPA 4CH2B 1VZQH 3MU0A 2KZ4A 1QGFA 3PV5A 4I8GA 5JB8S 3E3TA 3RMOH 1SGQE 1O3OA 3KQEA 4Q63A 1GJ8B 1P2NA 3V13A 2R3UA 2QF0A 3DT0H 1PQ7A 3QK1A 2O8TA 1PQAA 3RXTA 4ABIA 4ABDA 2ZDVH 1IQFA 2BLWA 1NY22 1S0QA 2V3OH 1D3DB 4NIYA 1K1LA 4XBDA 3K6ZA 4FUHA 1TALA 5C67A 4IW4E 5CHAC 2C8XB 2BLVA 2FS9A 2UUJB 3A7XA 1D6WA 5L2ZH 1J14A 1ZMLA 3ZVDA 4ISIH 3F1SB 1RRKA 1DY9A 1A4WH 2PKSB 4B2BA 4BTIB 4DIIH 1O5CB 3ZVCA 3EE7A 1P2KA 5HIZA 3QUMP 2QXJA 3BG4C 4NA8A 5DP4A 2RCEA 2OC7A 3STJA 1HAOH 3ZZ7A 4VGCC 3RC4A 4A1TA 1LMWB 2BVXH 1GMCG 1P2MA 2OXSA 3R0FA 4NIXA 1N8OC 1KLJH 2M5TA 3DCLA 3RC5A 3MU1A 3RXEA 4BTTB 2JETB 1A0LA 1DT2A 1O2GH 2ODQA 4ZUHA 3B9FH 4ACAA 2G52A 1O3PB 2R3YA 2HALA 4Y8XA 3A82A 1C1NA 4Y79A 1TBRH 3VEQB 1T8NA 3OAAD 4F48B 5DK1A 2TGPZ 1Z8GA 4XDEA 2VWNA 3A84A 9LPRA 3UAIC 2VU8E 1TFXA 1P2QA 2Z3CA 4YT7H 5GCHF 5CMXH 1K1MA 3M35A 1FIWA 3LJOA 2NU4E 2BY5X 1KXCA 5DP7A 4A1XA 1GI5A 1WAYB 4AB9A 4ZKRU 2BQWB 1LVBA 2W3KA 4QT8C 4B71A 4RN6A 1QB1A 1MTSA 5HMAA 3KQBA 4THNH 3K2UA 2BD5A 3LJJA 1KDQA 1SOTA 6LPRA 1TLDA 1AWFH 1HJAC 5CHAB 1E1RD 4AFUA 3SU0A 3LOXA 1SLVB 3K9XB 1CT0E 2AGGX 3C27B 2D26C 1W13U 2QY0B 1V2OT 2AIPA 1DPOA 1ZR0A 3MWIU 2ZCKP 1QFKH 3GCTF 5FBEA 1BTWA 1S6HA 1TE0A 2BX3A 1MTWA 1HNEE 1SI5H 1UVPA 2P3FH 1KTTB 1G3BA 2HVYB 1AD8H 1PPGE 3BG4B 1SLXB 2GD4B 2Z3EA 2ZGXH 1XM1A 1C5ZB 2SGDE 3TPIZ 1T32A 1NFUA 3ZVFA 4BNRA 1QRXA 2WSSD 4FU8A 4X1SU 1MD7A 3ZZBA 2BX4A 4TY6A 3UB0A 4GVUA 5EQRA 1BMNH 1C5RA 2ZHDA 1EOLA 1TGTA 4UFGH 4LZ4B 1QBNA 3OTJE 3A7TA 2VINA 1OS8A 3SV8A 1VJAU 5FXLA 3L33A 1VCPA 3QTVH 1P04A 2PUQH 4MNWA 2G8TA 5A2MH 5F8TA 3O8CA 3AW0A 1KIGH 1WU1A 1UW7A 1G3DA 3HGPA 3TJVA 4O3TA 3V7TA 1YLDA 4RT1A 4X8TH 1O2YA 2GKVE 3A7ZA 3VXEH 3MH7A 3RXFA 5IK2D 1S83A 2QA9E 4H4FA 2QE7D 2ZPRA 3UOUA 1IQNA 4ASHA 1UK4A 3AAVA 3ZVEA 1QIXB 3NKKA 2BQ7B 3OE7D 4NSYA 1GJCB 1QL8A 2ZFTA 5DP8A 1J8AA 2HNTC 1HJAB 1GHXH 1GMDF 1NRSH 1RIWB 3MU5A 2ZU2A 3DUXH 4I8JA 3LKWA 4ZXYH 3RXMA 2HOBA 2HGTH 1YWUA 1C5YB 1YPHE 3QZRA 3RXBA 2IPHA 2QF5A 2Z7FE 5JDUB 1SG8B 1C5WB 1O5BB 1V6DA 5DSFA 4MDSA 1W0YH 2ZHEH 3TH2H 1E35B 4BTUB 3SNCA 1QTFA 2P59A 1TX8A 2B5TB 4UFEH 1FIZA 1NRQH 4Q4LA 1DXWA 4X1QU 2FYQA 1HXFH 2WPJS 4ZKOU 5C94A 1ZTKA 1V2NT 1ZSKA 5HM2A 2GVFA 2BDBA 1FPCH 3I29A 1BZXE 2BM2A 2NU0E 8GCHF 5K0HA 1C5NH 3DA9B 3LH1A 1O37A 3HKIB 1Y3XA 1IAUA 2O8LA 1ELBA 3A80A 1TB6H 1BMMH 9ESTA 1Z71A 2KCYA 1HIAA 1GBJA 4TSFD 3QDZB 1O33A 1UTJA 1TX7A 4X6MA 2CXVA 4A1VA 1JXPA 3MHWU 3EYDA 1VGCC 2Q6DA 1H8IH 2WZQA 5F8XA 2XNIA 1ZGVA 2FOMB 2WYJA 3BF6H 1O38A 2ZTZA 1HB0B 1LHDH 1C1WH 1WTHD 4ZAEA 3B23B 1FMGA 1W7GH 4AGJA 4K1EA 1LDTT 1T31A 3KYGA 2LNCA 4PROA 2SGPE 2KAIA 1EB2A 3UOPA 3SNEA 4D76A 6GCHF 4AC9A 1COWD 1FY8E 2BXTH 5EG4A 1VITF 5E2OA 2ZQ1A 1V2JT 1BTYA 1C5MD 2ANYA 1E79D 4A92A 1P57B 3PMJA 5DG6A 1DWBH 1QBVH 1SFIA 4OS2A 2PSXA 2XXLA 2BYAX 3SZNA 4DG4A 3A86A 2ALPA 2BTCE 3HKJB 5GNDA 4I8KA 4CRFA 3MNCA 4NIVA 5F03A 1Z1JA 1CSOE 4P00A 1BBRK 2V6NA 3NWUA 5FX5A 2KM0A 5LH8A 3VB7A 2EQNA 1AE5A 4DVAU 1DXPA 1JBUH 1SL3A 1TNJA 2WPLS 2G51A 1EPTC 1O35A 4JCNA 2A45B 3JZ2B 2STAE 1S81A 2YNBA 3I77A 1FUJA 1P11E 1O3EA 4LZ1H 1XUHA 1JIMA 5FHTA 1HAGE 1UTOA 2A31A 4INKA 2EI8A 1YP9A 2OD3B 2SGAA 3F9EA 1TRYA 4SGAE 4KGAA 5A8ZA 4DW2U 1O0DH 1FJSA 1GJ6A 3E91A 2A1DB 1LHCH 1DM4B 2DE8A 1UTKA 5C1UA 3TGIE 1L4DA 2XBYA 4YOJA 4Y76A 4CR5A 4MLFB 3SUGA 4TPYA 3SU4A 1E38B 3F9HA 3P8FA 1P03A 1A5HA 5JPMH 4MPXA 3TGKE 2BD8A 3A8BA 1THPB 3ZZ9A 1CGIE 2Q1JA 1CQQA 2ZFSA 3RXVA 4WF8A 3RXQA 1C1QA 4FVBA 3E1XB 3SUEA 1GI7B 1P0SH 2HLCA 3V0XA 2OQUA 1UO6A 3RXAA 4ZMAH 1A3EH 2F43B 5E0JA 5FPYA 4CHAC 3FP7E 1ELEE 4BAQB 1C1MA 4AN7A 2VBCA 3ZYDA 2VVUA 3TNSA 5JBCS 3N7DA 4B6EA 1MH0A 2JH6D 1W3CA 2J98A 4D9QA 1D9IA 8LPRA 1V2KT 2LPRA 3ZV9A 1J16A 2BDHA 4X1PU 2J5UA 1IQLA 1A46H 2Z6BD 3BTHE 3GS9A 2ZFRH 3BTWE 1JMOH 1UCYK 1GJ7B 4Y71A 3PTBA 4X2WA 2HWLB 4X0WU 3ZV8A 5T6DA 5A0AE 3IITA 1XUJA 2BDYA 2SFAA 3E8LA 2FLBH 4JZEH 5EW2H 4X2VA 3FKSD 1BTHH 1B7XB 4NZQA 4K8YA 1YYY1 1AFEH 4X1NU 4ACBA 2ZCLP 2HRVA 5AFYH 1UCYE 4YXWD 2AYWA 2JKHA 2ZECA 5G4BA 1NESE 1EPTB 4D8NA 1WBGB 1UJ1A 3M61U 3D49H 1GI1A 1GPZA 5EOKA 1DITH 1S6LA 3FN8A 5T3HA 1BUIA 4ZKNU 1WTGH 2OBQA 4ZHAA 4OS6A 2GDEH 2GT7A 3PMHB 1ESBA 1O31A 3A7YA 1ZPCA 3MYWA 5LPEA 1FV9A 3W1EA 4JYTA 1GHVH 1QR3E 3S9CA 3ATIA 3PM3A 1RJXB 1GHBG 2A0QB 4M9FA 1O2VA 2FI5E 4Q7XA 2WHXA 5TJXA 2FOFA 4DT4A 1H8ED 1O2XA 2J34A 1TPSA 3BTKE 4HI3A 2ASUB 5AHGH 4CHAB 4UE7H 1UK2A 1C5XB 1Q3XA 4AG1A 4IS5A 3CS7A 1TGBA 3RM2H 2FS8A 1UTMA 3U98H 3CNRA 1PPFE 1SLWB 3H7TA 1YPKH 4LOYH 1SFQB 2WYGA 3SGAE 1D6RA 5L6NH 5A8XA 5LPFA 3ZVBA 5JBBS 4JZFH 1K1JA 1DICA 4JYUH 3TNTA 1D3QB 1GMHF 2OCVB 1C2JA 1IQMA 1A3BH 3TVJB 5AFZH 4CRCA 3IWMA 2PP6A 1P10A 1B5GH 1DDJA 2AH4X 1Q31A 2ZDLA 2TGDA 2VWOA 1ESAA 2FO9A 1BRAA 2VVCA 1K22H 1FN6A 2J92A 1LPZB 3RXKA 1QB6A 1L2EA 4NGAH 2A5KA 3BEIB 3A88A 2XBWA 1MKXH 2FDAA 2ZWLH 1MQ5A 1O34A 3MH4A 1GVZA 1K9OE 2Z9JA 3PYHA 4SGBE 1L1GA 1OWHA 3W95A 1D4PB 3A81A 1O5EH 1XXFA 2ZC9H 5BPEA 4I8HA 2PTNA 3UREA 1MZDA 1SGTA 4LK4A 1BIOA 4BXSA 1ANEA 1ELAA 5JBTA 3TK6A 2PHBA 4IC5A 1GJAB 2P8OC 3MO9A 3SORA 1HAVA 1P2OA 4O9VA 1FY4A 2KCPA 5KGOA 4B73A 5BRRE 2CV3A 5EGMA 3M37A 2CGAA 3RXRA 1MMJN 1LHFH 3A7VA 1SVPA 1J15A 1XKAC 2ZO3H 4JZIA 3LIWA 4CR9A 3TK5A 1P02A 1QJ6B 1TGNA 2PGQB 2VIPA 3SU1A 1ANDA 2RFKC 1GG6B 3K65B 1XUKA 4DCDA 3S69A 2VJ1A 1C5SA 1QA0A 3LONA 2IOTA 2KCAA 4X6OA 1ETSH 1O3MA 1ANBA 1SGIB 2H5DA 1EATA 2BDGA 1J17T 1T8LA 1ZSJA 2XC0A 2EY4C 3TU7H 2STBE 3ZVGA 1LHEH 3B8JA 2G5NA 1SGFA 3ZZAA 3ZZCA 2GCTC 3PTNA 1DE7H 1S82A 1EJNA 3C1KA 3WWBA 1A0HB 1GBHA 1RS0A 3TH4H 1EJAA 2R0KA 3A7WA 2BOHB 1MU6B 1YBWA 1Z6EA 4HTCH 3MU4A 1GI9B 1TPPA 2PR3A 1ZJKA 3RXJA 2HVXA 3PRDA 3PV2A 1CGJE 2QXHA 1BTZA 1HAZB 2UUYA 2A5IA 4XD7D 4XOJA 2O8MA 2WINI 1PPBH 1ZGIA 4AB8A 2OLGA 3M7QA 2WPKS 2QCYA 5L30H 1SR5C 2ZGJA 2OUAA 4K8BA 3EAJA 2C3SA 4XBCA 1P2JA 3PROA 4ZKSU 3MQKC 3LC5A 3SU6A 5JYIA 2K8IA 1CBWC 1GI2A 1G37A 1SQAA 1ZPZA 1AZ8A 3TJOA 2ZHWH 3SN8A 3BTFE 2W6ID 1K1OA 4INHA 3GCHC 1Z7KA 3LH3A 3OY6U 4YLQH 1MCTA 2ANMH 1C5OH 4H42U 3U1IB 1SGCA 1L1NA 2L74A 1CT2E 1NBME 1MTUA 3T29A 4ABJA 3T62A 1TQ0B 6GCHG 5L2YH 1SGPE 4X8VH 1F2SE 1F92A 2BLQA 1EAUA 5ABWA 1VITG 5F8ZA 1O5FH 4U2WA 3S9AA 1LQDB 3CS0A 2QC2A 2A4GA 1QJ7B 3M3TA 2J2UA 5DKMA 1HAIH 1V2RT 3UFAA 4DJZB 4A7IB 3SUDA 1PFXC 2V3MA 3G01A 2H1UA 2ZGCA 2BXUH 2V35A 1EZQA 1THRH 4HG6A 2ZU1A 4UFDH 4TWWA 4DIHH 1C4U2 2VIDA 4ZHLU 3DSPA 1Z8IB 4X2YA 1AI8H 1Q2WA 3O8DA 2G55A 4XBBA 1HAHH 4K60A 3RU4D 3SYJA 1AUJA 1HAPH 1T7CA 1YPGH 4F55A 1TBQH 1RD3B 1GBIA 3MFJA 2CMYA 3T28A 3QN7A 3TGJE 1ZPBA 1CHOG 1LKBA 5C0TA 1QQUA 1FONA 1TNHA 2Z9GA 4WXVA 6CHAC 3VXFH 1JOUB 2ZCHP 1GVKB 4E06H 2TPIZ 5DP9A 1GHZA 4RI0A 1RTLA 1PPEE 1ARBA 2SGQE 4Y6DA 4J2YB 1TMBH 2FI3E 2XCFA 1O2NA 1O5GH 2QF3A 2H5CA 3A8AA 3ZVAA 4AORA 2ESTE 4XSKU 3TIUA 1O2LA 3KEEA 2GV6A 4VGCB 2XOKD 3SJKA 1L4ZA 1KXAA 1CA0C 1SQOA 4UEHH 3H7OA 1Y59T 4NA7A 1N8OB 1NN6A 1NROH 1SGEE 3PMBB 1Y3UA 1PQ8A 1KYNA 1NS3A 3FO8D 1HLTH 1LQEA 3BIUH 3U9AH 1K1NA 1BCUH 4Y8YA 1S84A 3SQEE 4MPUA 4WVPE 3DFLA 4I7YH 1F7ZA 2VH0A 3M7TA 1V2VT 3CP7A 3U69H 4H6TA 1GGDC 2QXIA 1GCDA 1ETTH 1AVXA 5C3NA 1O3CA 1OP0A 1EUFA 2J9NA 2FEQH 2XBXA 1FQ3A 1V2LT 2BZAA 2OC1A 3FZDA 2RDEA 4X8UH 1HJ8A 3QX5H 1TA6A 4YESB 1O3HA 3O8RA 5EW1H 1FAKH 1GBLA 3PLKA 1E1QD 5DO4H 1UVSH 5LPRA 1V3XA 2W5EA 3Q3XA 2M2AA 2G4UA 2OC0A 3GY7A 2JH5D 4Y7AA 3R3GB 1TNLA 4U32A 1O3DA 3DD2H 4MQAA 4NWKA 1NFYA 1NRNH 2ANKH 6CHAB 4JK5A 2EI6A 4IGDA 1GHAF 3TJUA 3RLYH 2Z9KA 2BY6X 4GHTA 1A5IA 1YF4A 1HV7A 3PMAB 1UHBB 1C9TA 3KN2A 2RDLA 1BB0B 1M9UA 1O36A 3ZZ5A 2VIVA 1FX0B 3Q77A 1XKBC 2CF9H 3ELAH 1W11U 3OEHD 2FTMA 1SOZA 3UNQA 1O2RA 1TA2A 1CA0B 1YPJH 1O3JA 4F49A 2WUBA 3U8OH 3TH3H 5DJ7A 1O3GA 2YMSC 4TY7A 1MABB 1O3LA 1QHRB 1H8HD 1UVUH 5HYOA 1BTUA 1QJ1B 2K1QA 1NTPA 3P70B 3VGCC 4BXWA 1AQ7A 2R2WU 2GMTC 5J4SA 3RC6A 1ARCA 1SHHB 4NFEA 4Z1MD 3GYMA 1LVMA 1YKTA 3H09A 1XX9A 4FETA 2B0FA 3BTEE 1HCGA 1AVWA 2ZKSA 1P8VC 2GZ8A 3E6PH 3OEED 1DWCH 1C9PA 1UK3A 4BAKB 4TPIZ 4NG9H 1P09A 2P16A 2R0LA 2GGVB 2UUKB 1ZRKA 3HK3B 3QLPH 1C5VA 2EA3A 2GDDA 4FUBA 1RTFB 2ZFPH 5KECA 1SMFE 3WY8A 1AFQC 2EEKA 3N7EA 4R0IA 4A5TS 1OYQA 1UTNA 3GY2A 1Y5BT 1SGYE 1EXFA 1BHXF 5C5NA 1C2GA 3H5CB 2KX4A 1HDTH 3T25A 2TGTA 3KIDU 1EP5A 1GDNA 3T5FH 2AGEX 1JRTA 3RXIA 4IBLH 1O32A 1Z8JB 1OHHD 2C8WB 4INLA 1O3BA 1BTPA 4MPVA 3EA9A 1OP8A 3A89A 1WQSA 2J95A 2F83A 3PO1C 4ESTE 3M3VA 2CHAC 1FDPA 4P02A 1CT4E 2WUCA 4FUIA 3D62A 2BY7X 1ELCA 2ZF0H 4O3UA 1ZOMA 4K5ZA 1GI8B 3OU0A 1FY5A 1C5LH 1UMAH 1A1RA 1BBRE 3EQ0H 1OYTH 5DGJA 2RA3A 4AFQA 4MNVA 1AE8H 3T27A 2GZ7A 3MO6A 1GBEA 4FUFA 1TOMH 1GL1A 3BV9B 3ZZ8A 2AMDA 1C1RA 1BMFD 3FP6E 1AKSA 1HAXB 1YPLH 1NU7B 2W26A 2SNWA 1QZ8A 4JZDH 2A7JA 3BTDE 1C1OA 1JWTA 2P93A 2C4FH 1DLEA 3ENSB 1VGCB 2TIOA 1O30A 3KCGH 2G4TA 2XWBI 1KDQB 3SHAH 2Y80A 2P94A 1KLIH 1GBAA 1L1JA 1RFNA 3SJIA 2DUCA 3RU4E 3UIRA 1HYLA 3PRBA 1AHTH 4MG3A 4YM9A 1Z6JH 2OP9A 4GCHF 1DY8A 3EDXB 2BD7A 1DSTA 1GVLA 2BY8X 3QGNB 2OBOA 2BD4A 2PTCE 4Y10E 1P9UA 1C5UA 1TAWA 3N99A 3VFEA 3F2GA 3LGWA 1F0UA 4U01A 1WDIA 1PPCE 1NBMD 2BDCA 2AFQB 5HXFA 2BMGB 7LPRA 5C1XA 3UUZA 4ZH8A 2IJD1 3PWCA 2L6OA 4D7GA 5CDFE 1YPMH 1UCYH 5EQQA 2Z3DA 2BD3A 1XVOA 1ETRH 5DN6D 1GBCA 4FUDA 1AVGH 4BAMB 1AWHB 3PO1B 2I6SA 1PYTC 3NZIA 3HK6B 7ESTE 4RKOB 1HUTH 2F3CE 3M5NA 2CHAB 3UWIA 1O2SA 1JIRA 1GWAA 4AGKA 3SU2A 1G30B 3VPKA 1O5AB 3RXGA 1Y8TA 3SQHE 1PPHE 2G81E 2Y81A 3V3MA 1TNIA 2CN0H 3M3SA 4BAHB 3AK5A 1O3NA 1C2MA 1F0RA 3M7UA 1VKYA 4ZCNA 2PGBB 3RXUA 3F2HA 1BRBE 2V3HH 5HM9A 1ABIH 3KHVA 3IG6B 1QRZA 3F68H 1N1LA 3HGNA 5E8EH 5C2ZA 1IQGA 3P8NA 5FCRA 2B9LA 1HXEH 5EXMA 3OFND 4D7FA 3GY5A 3ZZ3A 2PSYA 1O2WA 3PV4A 3D23A 1TPAE 2AGIX 2QXGA 5GCHG 1TABE 4Q80A 1PPZA 4CRDA 4LXBH 1TNKA 1A0JA 1KXFA 5PTPA 2PLXA 2Y6TA 3GDSA 4CBOA 5EJ1A 1TMTH 1C4Y2 4FU9A 1HRTH 1MD8A 3U1JB 1GDQA 1D3TB 2ZU3A 1XMNB 3WWFA 1SGNE 1AO5A 2FLRH 3ZYEA 1IOEA 1GJDB 1RGQA 3P92A 3SV7A 4ABEA 4B1TA 4UONA 8ESTE 3ATWA 3NK8A 4DOQA 1A7SA 2WPDD 2QIQA 1QNJA 2ZDAH 4ABFA 1ORFA 2ZHFH 1GJBB 2LELA 2W3IA 2FP7B 1G3EA 1AZZA 3GCTG 2O9QA 3AVZA 1O2HA 2NU1E 4K1SA 2SGFE 2P95A 2Y5GA 1C2IA 2BQ6B 3LGUA 2ODPA 3KYFA 3P95A 1HIAB 2ZIQH 5AF9H 1C1PA 7KMEH 2H9HA 4FUEA 1E36B 3BTTE 1AGJA 1SHYA 2NU2E 2NU3E 1KXDA 1QBOA 1YM0A 2ZU5A 1J9CH 3TLOA 5GJ4B 3UPEA 4I86A 1DVAH 1WUNH 1MKXK 4K2YA 1YC0A 3NRLA 1HGTH 2ZP0H 5A0BA 1HAYB 1ELTA 3K6YA 1ACBE 5EJLA 1T4UH 1RXPA 1O2PA 2VNTA 3U28C 1S0RA 2HNTE 1O3KA 1CE5A 4ZROA 2AEIH 1EFRD 1QL7A 5GDSH 3RXLA 1ZZZA 5KEDA 3F9GA 3GY8A 1NZQH 3RU4T 2YOLA 3URCA 1CO7E 4AFZA 3SOSA 1G3CA 1LKAA 3LGVA 1THSH 3GDVA 1TIOA 2HPPH 2IJOB 4M7GA 2CK3D 4CRGA 1C2DA 1ZSLA 4GHQA 2F91A 4F4OC 3LDXH 2GCHF 2VWMA 2VGCC 2Q6FA 3ODDA 2EI7A 1MKWK 1C2FA 3LU9B 4YOIA 3KQCA 4ZXXH 3SJOA 5EXLA 3S9BA 4KP0A 1IHSH 2XW9A 2XCNA 5EJZA 1C4V2 3BIVH 1B0FA 3BN9A 2PFEA 1BDAA 4GPGA 4Y11E 3T26A 3SBKA 1YCPK 2C8YB 3A85A 1O3AA 3E0PB 5I46H 1FAXA 4GAWA 1EZUC 1GMDG 1V2TT 3MTYA 1S85A 1QCPA 3GCOA 5GIBA 4YTAA 1GHAG 4X8SH 4OGYA 3DFJA 4GLYA 4IC6A 2FPZA 1KMHB 1EZSC 5FBIA 2RG3A 4FOUC 1GBKA 3ITIA 5FPSA 4O97A 1P3CA 3P6ZB 1W8BH 1F5RA 2FX6A 4ABBA 1EAIA 2GT8A 4H6SB 2CJIA 4K3JA 1MAYA 2Y82A 4ISOA 5T1VA 1C1VH 2P3TB 2CF8H 1LPKB 2BZ6H 5B6LA 3FFGA 1O2UA 3U8TH 1KSNA 3F3BA 1MU8B 2FOHA 2SGEE 3SNBA 4RSPA 8GCHG 2I6QA 1ELDE 4CRAA 2BOKA 2J98B 4YZUA 3BG8A 1K2I1 3GCNA 1UVOA 3PLBA 5ETXA 1AU8A 1SGFG 1MTVA 4X2XA 2THFB 2A4OA 3TK9A 1SQRA
chains in the Genus database with same CATH topology
3EE0B 1IHTH 3Q3YA 4NIWA 2BD2A 1GBTA 2P8OB 3GDUA 2ZEBA 1TWXB 1SC8U 2QV1A 3RXCA 4WH8A 2F9UA 3U8RH 2HPQH 1P06A 2ZDNA 3RXOA 5JB9S 1A2CH 1BOQA 1WSSH 2VIQA 1O5DH 1ELGA 4WY3A 1HFDA 2ZNKH 4IN1A 1O2TA 4I8LA 3LGTA 4KELA 3EGKH 1GL0E 1LO6A 2J94A 2VGCB 3BEUA 4B74A 2A5AA 1X7AC 1C2HA 2FI4E 1H8DH 2XC4A 1OP2A 4AG2A 4X6PA 1OSSA 2BD9A 1TBZH 2FTLE 1VJ9U 3RXDA 2VIWA 5EPNA 1PJPA 3SNAA 2OINA 4YOGA 5DP5A 2ZU4A 2ZTXA 3RP2A 3W94A 2FM2A 4DY7B 3SI4H 2WPIS 5T6FA 1EX3A 2ZDMA 1GI3A 4MTBA 1EASA 4WJG2 4E05H 3STIA 2BDAA 3BTQE 1XUGA 4UD9H 1MBQA 2ZDKA 1GBBA 2GCTB 2ZI2H 1GHBF 1W10U 2F9NA 5DPAA 5EPYA 2F9PA 4AFSA 1WV7H 5GWZA 2XWAA 3PB1E 2GX4A 1IQJA 1ZHPA 1XUIA 2H9EH 4Y8ZA 3SU3A 2BVRH 3Q00A 1LTOA 3LPRA 2D2DA 3UR9A 2A7CA 5TCCA 1EKBB 4MVNA 5A8YA 3A83A 7GCHF 1P3EA 3UQVA 3ZZ4A 1FNIA 3PWBA 1BT7A 4YO9A 3I78A 1KXBA 5EODA 1TNGA 2TGAA 2XBVA 4B76A 2PUXB 1GI6A 4IMZA 1FY1A 1NO9H 1CBWB 3Q3KA 5T6GA 2FOAA 2F9VA 3GISB 3L6PA 3P8GA 5ESBA 3GICB 1AY6H 1F5KU 1QB9A 4Q7YA 1V2UT 4WWYA 1CHGA 4Y0YE 3FAOA 3D65E 3F9FA 1W12U 1LHGH 1P12E 1RIWC 3GCHB 5LGOA 3ESTA 2JH0D 3LGIA 4KTSA 1D3PB 1HPGA 2UWOA 1N6XA 3ATLA 3CENA 1ZHMA 1HJ9A 2QN5T 1CA8B 1C5TA 1BRCE 1BJVA 4GCHG 4E7RG 4RKJB 3F6UH 2FOGA 1F0SA 4JYVH 2GV7A 4K1TA 1EQ9A 1NFXA 1EAWA 2J38A 5J4QA 1T8OA 5E0HA 1E34B 2F9BH 3QTOH 1H9IE 3TITA 2QAAA 4XE4A 5ESTE 1QQ4A 3UNRA 1E0FD 1HBTH 1O2OA 2W7SA 1CGHA 1XVMA 2FZZA 1OKXA 1NU9A 1GCTC 3SV9A 1GHWH 1WOFA 2H9TH 1MAXA 1K21H 3RDZA 4BOHA 4NSVA 1AB9C 5A0CA 1ZYOA 5GXPA 3RLWH 1EPTA 5FPTA 1GI4A 2F9OA 3RXPA 5C5OA 3E0NB 1MZAA 1EOJA 2A2QH 1E37B 2J4IA 1VCQA 3ZZ6A 1DWEH 4JZ1A 3HPTB 1OPHB 1HAVB 1SB1H 2ZA5A 1W7XH 1ZTLA 1C5QA 1G2LA 3KNXA 1GDUA 4ISHH 1DANH 2XC5A 3QWCH 5EQSA 3T2NA 4U30A 2A2XH 1UTQA 4ABGA 4NFFA 1TQ7B 1XUFA 2VB0A 1GJ9B 1DOJA 3FP8E 1WQVH 2TRMA 1AIXH 1TYNA 1Y3VA 2GP9B 2QYIA 3BSQA 2C90B 1GHYH 3SNDA 3TJNA 2AS9A 1O3IA 1O2MA 1VCWA 2FWWA 2A4QA 2VH6A 1ABJH 1FZZA 1H4WA 2PKAB 3OX7U 3URDA 1EP6A 3AASA 1SGRE 2OC8A 4CBNA 2ILNA 2WPMS 3JZ1B 1WYKA 1ZLRA 5GPIB 4Q2KA 3NPSA 3ZZDA 1P01A 1TOCB 4FXGH 4BAOB 1BITA 1ID5H 2P3UB 1ELFA 2WV5A 4UFFH 3P17H 3KGPA 1MBMA 1C2EA 1QY6A 4TYDA 3RMLH 1BTXA 4BANB 1TPOA 4ISNA 3SGBE 1LCYA 1SPJA 1GMHG 1OWKA 3SV6A 4I31A 2YNAA 1KLTA 1GGDB 4Y0ZE 4KKDA 5K7RA 4WMFA 3SV2H 1GCTB 4HGCA 4ISLA 4CREA 2FMJA 1C2LA 1AMHA 1LPGB 2Y5HA 3QO6A 4NCYA 1SGDE 4JK6A 1IQIA 1AB9B 3E90B 2ZPQA 2WPHS 2ZFFH 1AUTC 1DLKB 3MOCA 1BHXB 3LC3A 8KME2 4OS1A 3MNSA 1TRNA 1EZXC 3VB4A 1XXDA 4NA9H 1O2JA 2Q6GA 1MQ6A 4MPWA 1B0EA 4FUCA 1IQEA 1GMCF 2ZPSA 2ZGHA 2A4RA 4Z0KA 3S7KB 1GJ5H 2A7HA 1QL9A 2ZFQH 4ZHMU 5EU8A 3O8BA 3GYLB 1NPMA 1OWIA 3KL6A 1K1PA 2XRCA 3GY6A 2UWLA 4WH6A 2BVSH 1BBRH 1UTLM 1GBMA 2ODYB 1FY3A 1NM6A 1C5PA 1ZTJA 5B6OA 2XTTB 3AAUA 2VIOA 2HNTF 4Z6AH 5F6MA 2GCHG 2ZQ2A 2SNVA 2Y7ZA 1DUAA 1BQYA 3OSYA 1TMUH 2C93B 2Y7XA 2O8WA 1O2QA 5FAHA 4ABHA 5AVDA 1JRSA 2R9PA 3VGCB 2GMTB 2QGRA 1O2IA 1OWEA 1DFPA 4YT6H 2ZHQH 1FXYA 1EJMA 3GY3A 1FI8A 1VR1H 2ZTYA 1Z1IA 1CU1A 4MNYA 1LVYA 3ATMA 1KXEA 1CHOF 4OS5A 2H2ZA 2AERH 3SUFA 4R8TB 2FESH 1FPHH 4AX9H 4OGXA 1OXGA 2ZGBH 1G2MA 1V2ST 3MNBA 5JBAS 3M5MA 3BTGE 2AIQA 1OWJA 4CH8B 2G00A 1AFQB 1V2MT 1BMAA 1UTPA 1NT1A 1C1SA 1EB1H 1QURH 3M5OA 3NXPA 4O03A 5AFZH 1DWDH 4D9RA 2B8OH 1U6QA 4X1RU 3SO3A 3UY9A 1H1BA 1K1IA 1F0TA 2R2MB 4AOQA 4B2AA 2FYRA 3RXHA 4A6LA 3SGQE 1MTNC 5H4IB 1GI0A 1O39A 2ULLA 1ZRBA 2Z9LA 1WCZA 3A8CA 1BMLA 1C1UH 1YGCH 5I25A 1F5LA 1QA7A 1LVOA 3RMNH 2XYAA 4YLUA 2BHGA 1DS2E 2NWNA 1W14U 2ALVA 2ZG0H 1RTKA 3S7HB 1PQ5A 1DSUA 4OS7A 4K69A 4WMEA 3VB6A 4KTUA 1SSXA 4DT7B 1OX1A 3DHKH 3EA7A 1A5GH 3ATKA 1NFWA 4FVDA 2FXRA 6ESTA 2FODA 1V2WT 4I32A 3V12A 3BTME 4IN2A 5FX6A 2EC9H 2ZZUH 4AZ2B 3UR6A 4DURA 1ELVA 1H9HE 1NRRH 1O2KA 3AW1A 5TCAA 5C1YA 4FU7A 3M5LA 1S6FA 1DUEA 2GZ9A 2B7DH 2WV4A 5DP3A 2UWPA 1O2ZA 3E16B 5EXNA 4ABAA 4TWYA 3RMMH 2D1JA 5A09A 5FCKA 3KF2A 3PLPA 3MO3A 1ESTA 4WXIA 4Q7ZA 1L0ZA 1PYTD 1BA8B 1TONA 1YCPM 2FOBA 4JMYA 2IN2A 4MNXA 1P2IA 1TGSZ 2FX4A 2GTBA 4XFQA 1P9SA 4Y7BA 3QGJA 1TX6A 4NZLA 1FLEE 1Y3WA 7GCHG 1ANCA 1A61H 1MTNB 2PW8H 4DGJA 2BY9X 3LT3A 1N6YA 1YPEH 3N7OA 4NWLA 1KY9A 1FN8A 5HGGA 2PWXA 2O8UA 2ANWA 1W2KH 1VITH 1GG6C 2OQ5A 5CE1A 3FANA 3MH6A 4FUGA 1BJUA 1O3FA 2A32A 2DE9A 2RA0A 1YPHC 4HFPB 2TBSA 1UVTH 1SQTA 5SGAE 4AYYB 1INCA 2PV9B 1H9LB 3UQOA 3GY4A 4GUXA 3SHCH 4UDWH 2FOCA 1P05A 3BEFB 4J1YA 2G5VA 3NCLA 1K28D 1ZJDA 3UNSA 1SLUB 2FIRH 1QRWA 3A8DA 2KAIB 3M36A 1TGCA 5E2PA 3SJ9A 1CVWH 1AN1E 2BB4A 3RUOA 1NRPH 1ZHRA 3UTUH 3GOVB 1C1TA 2V0BA 2D8WA 4OS4A 1SBWA 2C8ZB 2BLOA 2Z94A 3RM0H 5DP6A 4I33A 4IMQA 4B2CA 1ZMJA 1TRMA 2FOEA 2VWLA 1IQKA 1MCVA 3SW2B 3MU8A 2UUFB 1G9IE 1Y5UT 1IQHA 2OTVA 5E0GA 1YLCA 4FUJA 2PKSC 1GBFA 1NC6A 3SJ8A 3VB3A 3RXSA 1C2KA 1GBDA 1T4VH 4KTCA 4AYVB 5IDKA 3A87A 4E7NA 1V2PT 1GJ4H 3P8OA 2W7UA 2Z9IA 3MI4A 1G32B 4HZHA 1Y3YA 1W0ZU 3MMGA 3MNXA 2BDIA 1MKWH 1MUEB 3S0NA 1KTSB 3L3TA 3ODFA 3LGYA 4X6NA 1G36A 3UWJH 3NUMA 1OOKB 4B75A 1S5SA 2JETC 2H6MA 1EAXA 3FVFB 3HATH 3QZQA 3SI3H 3VB5A 5C20A 1OWDA 1Z8RA 3OY5U 1BRUP 4WMDA 4CRBA 1YCPH 3FZZA 1T8MA 3KQDA 3Q76A 1UHBA 3SU5A 3MH5A 2AMQA 3EA8A 2AMPA 1V2QT 2Y5FA 1AKSB 5IYTA 1ZMNA 1Y5AT 2PKAA 4GSOA 1DX5M 2VVVA 3OYPA 4CH2B 1VZQH 3MU0A 1QGFA 4I8GA 5JB8S 3E3TA 3RMOH 1SGQE 1O3OA 3KQEA 1GJ8B 1P2NA 3V13A 2R3UA 2QF0A 3DT0H 1PQ7A 3QK1A 2O8TA 1PQAA 3RXTA 4ABIA 4ABDA 2ZDVH 1IQFA 2BLWA 1NY22 1S0QA 2V3OH 1D3DB 4NIYA 1K1LA 4XBDA 3K6ZA 4FUHA 1TALA 5C67A 4IW4E 5CHAC 2C8XB 2BLVA 2FS9A 2UUJB 3A7XA 1D6WA 5L2ZH 1J14A 1ZMLA 3ZVDA 4ISIH 3F1SB 1RRKA 1DY9A 1A4WH 2PKSB 4B2BA 4BTIB 4DIIH 1O5CB 3ZVCA 1P2KA 3QUMP 2QXJA 3BG4C 4NA8A 5DP4A 2RCEA 2OC7A 3STJA 1HAOH 3ZZ7A 4VGCC 3RC4A 4A1TA 1LMWB 2BVXH 1GMCG 1P2MA 2OXSA 3R0FA 4NIXA 1N8OC 1KLJH 2M5TA 3RC5A 3RXEA 3MU1A 4BTTB 2JETB 1A0LA 1DT2A 1O2GH 2ODQA 4ZUHA 3B9FH 2G52A 1O3PB 2R3YA 2HALA 4Y8XA 3A82A 1C1NA 4Y79A 1TBRH 3VEQB 1T8NA 5DK1A 2TGPZ 1Z8GA 4XDEA 2VWNA 3A84A 9LPRA 2VU8E 1TFXA 1P2QA 2Z3CA 4YT7H 5GCHF 5CMXH 1K1MA 3M35A 1FIWA 3LJOA 2NU4E 2BY5X 1KXCA 5DP7A 4A1XA 1GI5A 1WAYB 4AB9A 4ZKRU 2BQWB 1LVBA 2W3KA 4QT8C 4B71A 4RN6A 1QB1A 1MTSA 5HMAA 3KQBA 4THNH 3K2UA 2BD5A 3LJJA 1KDQA 1SOTA 6LPRA 1TLDA 1AWFH 1HJAC 5CHAB 4AFUA 3SU0A 3LOXA 1SLVB 3K9XB 1CT0E 2AGGX 3C27B 2D26C 1W13U 2QY0B 1V2OT 2AIPA 1DPOA 1ZR0A 3MWIU 2ZCKP 1QFKH 3GCTF 5FBEA 1BTWA 1S6HA 1TE0A 2BX3A 1MTWA 1HNEE 1SI5H 1UVPA 2P3FH 1KTTB 1G3BA 1AD8H 1PPGE 3BG4B 1SLXB 2GD4B 2Z3EA 2ZGXH 1XM1A 1C5ZB 2SGDE 3TPIZ 1T32A 1NFUA 3ZVFA 4BNRA 1QRXA 4FU8A 4X1SU 1MD7A 3ZZBA 2BX4A 4TY6A 4GVUA 5EQRA 1BMNH 1C5RA 2ZHDA 1EOLA 1TGTA 4UFGH 4LZ4B 1QBNA 3OTJE 3A7TA 2VINA 1OS8A 3SV8A 1VJAU 5FXLA 3L33A 1VCPA 3QTVH 1P04A 2PUQH 4MNWA 2G8TA 5A2MH 5F8TA 3O8CA 3AW0A 1KIGH 1WU1A 1G3DA 3HGPA 3TJVA 4O3TA 3V7TA 1YLDA 4X8TH 1O2YA 2GKVE 3A7ZA 3VXEH 3MH7A 3RXFA 1S83A 2QA9E 4H4FA 2ZPRA 3UOUA 1IQNA 4ASHA 1UK4A 3AAVA 3ZVEA 1QIXB 3NKKA 2BQ7B 4NSYA 1GJCB 1QL8A 2ZFTA 5DP8A 1J8AA 2HNTC 1HJAB 1GHXH 1GMDF 1NRSH 1RIWB 3MU5A 2ZU2A 3DUXH 4I8JA 3LKWA 4ZXYH 3RXMA 2HOBA 2HGTH 1C5YB 1YPHE 3QZRA 3RXBA 2IPHA 2Z7FE 5JDUB 1SG8B 1C5WB 1O5BB 1V6DA 4MDSA 1W0YH 2ZHEH 3TH2H 1E35B 4BTUB 3SNCA 1QTFA 2P59A 1TX8A 2B5TB 4UFEH 1FIZA 1NRQH 1DXWA 4X1QU 2FYQA 1HXFH 2WPJS 4ZKOU 1ZTKA 1V2NT 1ZSKA 5HM2A 2GVFA 2BDBA 1FPCH 3I29A 1BZXE 2BM2A 2NU0E 8GCHF 5K0HA 1C5NH 3DA9B 3LH1A 1O37A 3HKIB 1Y3XA 1IAUA 2O8LA 1ELBA 3A80A 1TB6H 1BMMH 9ESTA 1Z71A 1HIAA 1GBJA 3QDZB 1O33A 1UTJA 1TX7A 4X6MA 2CXVA 4A1VA 1JXPA 3MHWU 3EYDA 1VGCC 2Q6DA 1H8IH 5F8XA 2XNIA 1ZGVA 2FOMB 2WYJA 3BF6H 1O38A 2ZTZA 1HB0B 1LHDH 1C1WH 1WTHD 4ZAEA 3B23B 1FMGA 1W7GH 4AGJA 4K1EA 1LDTT 1T31A 4PROA 2LNCA 2SGPE 2KAIA 1EB2A 3UOPA 3SNEA 4D76A 6GCHF 1FY8E 2BXTH 5EG4A 1VITF 5E2OA 2ZQ1A 1V2JT 1BTYA 1C5MD 2ANYA 4A92A 1P57B 3PMJA 5DG6A 1DWBH 1QBVH 1SFIA 4OS2A 2PSXA 2XXLA 2BYAX 3SZNA 4DG4A 3A86A 2ALPA 2BTCE 3HKJB 4I8KA 4CRFA 3MNCA 4NIVA 5F03A 1Z1JA 1CSOE 1BBRK 2V6NA 3NWUA 5FX5A 5LH8A 3VB7A 1AE5A 4DVAU 1DXPA 1JBUH 1SL3A 1TNJA 2WPLS 2G51A 1EPTC 1O35A 4JCNA 2A45B 3JZ2B 2STAE 1S81A 2YNBA 3I77A 1FUJA 1P11E 1O3EA 4LZ1H 1XUHA 1JIMA 5FHTA 1HAGE 1UTOA 2A31A 4INKA