2W5EA

Structural and biochemical analysis of human pathogenic astrovirus serine protease at 2.0 angstrom resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
162
structure length
162
Chain Sequence
KHHHHHHIKPGALCVIDTPEGKGTGFFSGNDIVTAAHVVGNNTFVNVCYEGLMYEAKVRYMPEKDIAFITCPGDLHPTARLKLSKNPDYSCVTVMAYVNEDLVVSTAAAMVYGNTLSYAVRTQDGMSGAPVCDKYCRVLAVHQTNTGYTGGAVIIDPTDFHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PUTATIVE SERINE PROTEASE
publication title Structural and Biochemical Analysis of Human Pathogenic Astrovirus Serine Protease at 2.0 A Resolution.
pubmed doi rcsb
source organism Human astrovirus 1
total genus 34
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2w5eA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2w5eA01
4A1TA 2BX4A 1GI3A 4AN7A 2WPLS 2VINA 4O3TA 3U1JB 5E0HA 1EOJA 1HIAB 1CQQA 2WPMS 1O3MA 1QL7A 3ODDA 4IN1A 2AS9A 1WBGB 3RM2H 1L2EA 2RA0A 3NWUA 4INHA 2O8MA 4CR5A 1T8OA 4JYVH 1DDJA 4ZHAA 3QZRA 2PWXA 3Q3XA 4WWYA 3TGJE 1EB2A 1MD8A 4ISNA 2SGPE 4M7GA 3UREA 5PTPA 1AO5A 4ZAEA 2ZDLA 1DY9A 4HFPB 4ABBA 1O3JA 1GJDB 1SGCA 4JZ1A 2AGEX 2BD8A 1GGDB 3MU4A 1J15A 2WPIS 2ANMH 3RXKA 2BY6X 4WXIA 1Y3UA 1KY9A 2BYAX 1C1RA 3HK6B 1YBWA 1QL8A 1UVPA 4U01A 3T26A 2OP9A 3SBKA 1INCA 1KXDA 1C4U2 1L4DA 3TK9A 2UWLA 4A1XA 2FYQA 3RXSA 1VGCB 2P94A 1OWDA 1CHOG 1KXEA 1AWHB 2ZFSA 2B0FA 3VB6A 1K2I1 2F9BH 2A7CA 5JDUB 1ELCA 1F7ZA 4YTAA 1G9IE 2SGEE 1O2NA 1OWJA 1D9IA 3SGBE 1TBZH 3BEIB 5T6DA 3T29A 4BTTB 1P01A 1ZRBA 3PO1C 3NPSA 3UR9A 2FPZA 1GBBA 3LJJA 1QCPA 2GX4A 4I8KA 1O2HA 1GJCB 2VU8E 2R9PA 1FPHH 1ZLRA 2QXIA 3N7OA 5K0HA 2TGPZ 3PTNA 3BV9B 5FX6A 2OLGA 5DP3A 3AAUA 3ZZ6A 2UUJB 1Z1JA 1EB1H 3V13A 1W7XH 1O39A 3NK8A 4OS2A 2AERH 3QTVH 3UWIA 1MKXK 4ABDA 2AIPA 2RG3A 3SJKA 4HTCH 1P05A 1L4ZA 2XBWA 1SG8B 1SQAA 2Z9KA 4AORA 3M5LA 2A32A 2GDDA 1C5SA 2ZDVH 1W0YH 2DE9A 5EPYA 3SO3A 3ITIA 5EGMA 2ZDNA 2BY5X 2HLCA 1LVBA 2W7UA 1AE8H 3A88A 3EE0B 3STJA 2A4RA 3SJ9A 2PKAB 2PKSB 2ANKH 3E0PB 3BTQE 3RXFA 1GHAF 1QIXB 1EPTA 4X6NA 4KTSA 1KDQA 2VH0A 3CS7A 4B73A 1J8AA 1TBRH 1ELBA 3V0XA 1F2SE 1GMHF 3HK3B 3HPTB 1GJ4H 1ZGVA 4LZ1H 3M3TA 1OWHA 3QTOH 4ZXXH 2W3KA 4JK5A 4AB8A 1T7CA 3HATH 6ESTA 1TNLA 4E05H 1RIWB 2QY0B 2A0QB 1OOKB 2QYIA 1C2MA 3MNXA 1AB9B 3GY7A 1P2MA 2VJ1A 2H5CA 3LU9B 3SUEA 1GMDG 1C5OH 1O2VA 1Z6JH 1PYTD 4MQAA 1DVAH 4YOJA 4IMQA 4MNXA 2A4QA 5FCKA 1OWKA 5JYIA 2B5TB 1V2NT 3SI3H 4NIWA 1YLDA 3SNAA 2PSXA 4TY7A 1MUEB 2ILNA 1OX1A 1ZOMA 5I25A 4IW4E 2Y7ZA 3TH3H 2ZTYA 1HAVA 1IQLA 2KAIB 1Y3WA 1UK4A 4GCHF 1G3BA 4X0WU 4YT7H 2HWLB 5JBTA 3MO3A 2GV6A 1G3EA 1AUTC 1O2OA 1MKWK 1CU1A 4SGBE 1AVWA 1O32A 1FY4A 1W7GH 1TBQH 5LPFA 3ATMA 3GY8A 5HM9A 5J4SA 2Z3EA 1NFWA 3RMMH 1UVTH 3F9FA 4I8HA 4AFZA 2ZCLP 5DJ7A 4Y11E 1O35A 1GJAB 4ZKSU 1ZPBA 1FJSA 5E2OA 1O2LA 1AZ8A 1UTKA 1O2MA 1ZTJA 4NSVA 3DFLA 4NA8A 1FXYA 5T3HA 1AGJA 4D76A 1WTHD 5TJXA 4CR9A 1O30A 2ZFTA 3A83A 1O2IA 5AVDA 3QWCH 1C2JA 3SJ8A 1A7SA 1NU9A 1PPBH 1QR3E 2BDGA 4FUDA 1IAUA 2AEIH 2W26A 2G00A 3DUXH 3KCGH 1BRCE 3E16B 2WINI 1O3FA 1PPCE 1TAWA 3Q3KA 1TX6A 4J2YB 5E0JA 2SNVA 2VIDA 2FDAA 1PQ5A 3T27A 4ABGA 4MVNA 3MOCA 4JYTA 1LHFH 4NWLA 5FPTA 2QA9E 1SGPE 4X2VA 1C5PA 3GCTG 1C5UA 2A4GA 1C2EA 1DLEA 3C27B 4O97A 4X8TH 2XCNA 1TNJA 3SUDA 3PLPA 2DUCA 5EW2H 2PUQH 1PJPA 1BBRK 2QXGA 1GJ8B 2CMYA 3CENA 2OC7A 3HGNA 3ELAH 3S69A 1ANDA 1NFUA 2OD3B 2R0KA 3I78A 1GMCG 3ZZ3A 4GHTA 3AW1A 1FNIA 4TWWA 4ABIA 4AGJA 4Y0ZE 1YPGH 4I31A 4MNYA 1BTWA 3NXPA 1SI5H 4TPYA 3H7OA 2H9EH 2Z7FE 2XC0A 1QQ4A 1S5SA 2XWAA 1S83A 4NCYA 2ANWA 1BTXA 2BVSH 2Z94A 1DUAA 1ZPCA 1KLIH 3MTYA 2FTMA 1SGNE 1NZQH 1AUJA 2AH4X 1O5DH 3GCHB 1BIOA 1X7AC 2QGRA 3QGJA 1E37B 2EEKA 4MNWA 3LDXH 3QUMP 1P04A 3SJIA 3V3MA 1MBQA 3FP8E 5DPAA 2TPIZ 4HI3A 1S6FA 1TGTA 2BD3A 2VVVA 2GZ8A 1DE7H 3P8OA 2V3OH 1WV7H 7KMEH 2ZGCA 2P59A 1P12E 3D49H 1O5AB 4Y79A 4AZ2B 1YYY1 2QAAA 4BAMB 3JZ2B 5H4IB 4CH2B 2G4TA 5CE1A 1S85A 1A4WH 1P8VC 3OYPA 2ZTXA 3PWBA 3SZNA 1GWAA 3A86A 1OYTH 2CF9H 1VJAU 1BQYA 3PB1E 3MHWU 1O2QA 4YLQH 1MBMA 5EQQA 2G5VA 1IQEA 4DT7B 1Z8GA 1V2VT 1ESBA 5HM2A 2ZF0H 3ZV8A 3TVJB 1O5CB 1O3PB 5E8EH 3ZV9A 1DT2A 2J38A 4TWYA 2QXHA 3BTGE 2HALA 2SGFE 1KXCA 1Y3XA 1CA8B 3LONA 2Y81A 1KXFA 1V2UT 2VIWA 1C2KA 1N6YA 4QT8C 1MTUA 2ZHWH 1LPKB 1XUIA 4FUIA 1YPKH 2FESH 4AG2A 4ZH8A 1GJ7B 1QRXA 3GY2A 2J92A 4CRGA 1BTPA 2UUFB 1XVOA 5L30H 4CREA 3FVFB 2EI6A 1TE0A 1QJ1B 1GVZA 3OY5U 2F9OA 2C3SA 1BTZA 1V2WT 1ZR0A 3TK5A 1PPGE 2ZDKA 3LGVA 2ODQA 3T25A 1KSNA 2EI7A 4ABFA 4O9VA 3HKIB 1PPEE 3RXUA 1KTSB 1P2JA 1O0DH 1HBTH 1FPCH 4JZFH 3ZVAA 1YP9A 4RN6A 1GHBG 2ZQ2A 1NY22 3P8NA 2K1QA 2ZFQH 5EPNA 3SHCH 2A7JA 1OPHB 1RXPA 4OS6A 5J4QA 3E91A 1O3OA 1G36A 4K1EA 3Q77A 1JRTA 5HXFA 1F5LA 3ESTA 1C1UH 3KIDU 5TCCA 1QB1A 3F1SB 2BOHB 3U69H 1P9SA 4BXSA 1CA0B 1UTLM 1JXPA 3M37A 1HAGE 5DO4H 1MMJN 1M9UA 2ODYB 3QLPH 1XUJA 2F83A 3TLOA 1O36A 1ID5H 2G5NA 4ABEA 3A80A 3FZDA 3TJVA 2FIRH 3TNSA 1OYQA 2ZZUH 3EGKH 1SLUB 1F0UA 1W3CA 1T4UH 1EQ9A 1HIAA 2VIQA 2FODA 2PHBA 1DITH 1ANEA 1GI5A 2A1DB 1A0HB 2Q6FA 3SU3A 1JOUB 1TX8A 3RXDA 2J94A 4DG4A 2WV4A 1V2JT 2W3IA 1TOMH 1BB0B 5FX5A 5JBAS 2BZAA 3BF6H 3TJNA 1XMNB 2ZDMA 6CHAB 3ZYDA 5E2PA 3GCOA 1LMWB 2EA3A 4JK6A 1C1QA 1C4V2 8GCHF 1YM0A 4NZLA 1WTGH 2Y5HA 4XDEA 1P3CA 4WMDA 2TIOA 3RXBA 4IGDA 1K1PA 1Y5AT 1GHZA 2XBXA 1DWEH 3BG8A 2F9NA 2GKVE 3B8JA 3KNXA 2F3CE 1A2CH 4Y8ZA 2VVCA 2RA3A 1GBAA 4LZ4B 3OSYA 1WU1A 3KGPA 1KYNA 2QF0A 2NU0E 1BMLA 3I77A 1MZAA 3UOUA 4ABJA 1TFXA 1FN6A 4OGYA 2VGCC 5A0AE 3OY6U 3UWJH 4BAOB 3WY8A 2CGAA 4TPIZ 2CHAC 4ZKNU 5TCAA 1LHGH 2BLVA 4Z6AH 1G3CA 2SGQE 1ETRH 6GCHF 1G37A 2A4OA 3KQBA 3ZZDA 2QC2A 2ZDAH 4WH6A 2G81E 1O5EH 3E1XB 5F03A 1W10U 3VXEH 1E38B 2A5AA 1GBFA 4FUFA 3KEEA 3ATIA 2XC5A 4I8LA 2RDLA 1O3EA 3W94A 3UNQA 4FU7A 5A2MH 4DW2U 1JBUH 1A0LA 3A7WA 6LPRA 5FAHA 4ISLA 1VCQA 4NIVA 1O2JA 2FEQH 3ATLA 5FCRA 3QN7A 3GOVB 1IQFA 1GBEA 1GI1A 4IN2A 2ZKSA 4BXWA 1DSTA 3DHKH 3MU8A 3S9AA 3UR6A 1O3BA 2BB4A 2FOHA 2PGQB 2GCHG 1C2LA 3E8LA 1Z8JB 5CHAC 1DSUA 1O3NA 4ZHMU 1HFDA 1V2PT 3ZVBA 3VGCC 2BZ6H 4X1RU 1EAIA 4AFSA 2PKAA 1MZDA 2TBSA 1NTPA 1W14U 1ZRKA 5GJ4B 2PV9B 1ELTA 4HZHA 2PTCE 2ZGJA 2BVRH 2AMQA 3ENSB 3PO1B 1C1NA 1EZSC 2O9QA 1YPMH 3TGKE 1CGHA 1N1LA 1QB9A 1ETTH 1D3TB 1GI4A 1KLTA 1THSH 2FS9A 3HKJB 1O38A 2ZPQA 3RDZA 3S7HB 1CVWH 3CS0A 1IQKA 3BTKE 1FIZA 3MYWA 1YLCA 1G2MA 2OBOA 4ESTE 1DM4B 2PSYA 3OU0A 1DPOA 3Q3YA 1UVUH 3UOPA 5F6MA 1O31A 1LKAA 3D23A 2WPJS 1QJ7B 4ZKOU 1PPHE 3U98H 3SJOA 1WQSA 1ZGIA 3ZVFA 3MMGA 3ZZ9A 3SU5A 1LPGB 2PGBB 4OS5A 1ESTA 2Q6DA 1THPB 3K65B 3RXIA 1V2KT 1LPZB 1LTOA 2KAIA 1V2OT 1GDNA 3A7XA 3AW0A 4MPUA 3O8DA 1G32B 1KXAA 4XBCA 3O8CA 1QRWA 1BDAA 2Q1JA 4H42U 1FAKH 3FP6E 2VWMA 2PUXB 1K1LA 3SU2A 2OQ5A 1B7XB 1L0ZA 3PMBB 3M36A 5C1XA 1QBOA 4YO9A 1CHOF 1EJMA 2QIQA 4UD9H 1TA2A 3PMJA 5EXLA 1Y3VA 1K1JA 3SNDA 3BIUH 1HLTH 1HXFH 2AFQB 1EP5A 4X2YA 1H4WA 4GUXA 2R0LA 3UIRA 1UTOA 1O3CA 2F9PA 1RFNA 1SGDE 3LIWA 4Y7BA 3UUZA 1TQ7B 4WMEA 5DK1A 1PFXC 1TIOA 1ZJKA 3L6PA 3M5NA 1S0RA 5GXPA 1YPJH 1NFYA 1C1WH 2WYJA 4XBBA 1FLEE 2UWOA 2HNTC 3F68H 5FXLA 5GDSH 4X2WA 1ELAA 2PFEA 4DCDA 5JPMH 2B7DH 2VWOA 5GCHG 2Z9LA 3IG6B 3L33A 1MTSA 1GG6C 1SGRE 4WY3A 4CRCA 1UJ1A 1J17T 3LGWA 1TNKA 2G55A 2XBVA 3A8BA 1FAXA 2CXVA 5JBBS 4Z0KA 1GMHG 1H8DH 1PQ7A 2G52A 5C67A 3RXGA 5C5OA 3MNSA 1ZTLA 1DWDH 1SGTA 2LPRA 1DICA 4MDSA 4I8JA 1Q31A 1SSXA 3GY4A 1H8IH 2ZGBH 4E06H 1K28D 1KIGH 1KXBA 1J9CH 1ZYOA 2I6QA 1ABIH 4ZROA 1GBTA 1ARCA 3P6ZB 4JYUH 1BMNH 1C5NH 1SGIB 5EW1H 2O8WA 3V7TA 1B0EA 1DXPA 4WMFA 1OWIA 2GT8A 4CBNA 2VH6A 1UTPA 3T62A 1SC8U 4MPWA 1C1OA 2NU2E 3NZIA 1HAOH 1BMAA 2FI3E 2CV3A 4K8YA 1YPHC 1GMDF 4CRDA 4YOGA 1JIRA 2BLOA 1K21H 4GCHG 3RXQA 1N8OC 1O3KA 3MH6A 3SU4A 1O2WA 1SHHB 1DX5M 1CGJE 3IITA 5AFYH 5EQSA 4DY7B 2BDBA 3RU4E 1H9LB 1V2LT 5BPEA 2D2DA 2STBE 3EAJA 1HRTH 4AB9A 2ALVA 1QBNA 5IYTA 3STIA 2ZC9H 3VB7A 2FYRA 7GCHF 1ZHPA 5DP6A 1XKBC 3A82A 4Q7XA 1TPSA 2XC4A 1C5ZB 3ZYEA 1N6XA 1MAYA 1D4PB 1MTWA 1SPJA 3W95A 1UTJA 2IOTA 1C1PA 4K1TA 1J16A 1TQ0B 1SGFA 1PQAA 2B8OH 1SGQE 3I29A 1W2KH 4BNRA 5DP8A 1TGBA 2FOFA 2ZU4A 2Z9JA 4UFFH 3P17H 2HPQH 1ACBE 3ZVEA 1E34B 1OKXA 1ZZZA 2C90B 1TWXB 3S9BA 3FZZA 4F4OC 3D62A 1WOFA 3TJUA 4H6TA 3VB3A 2GD4B 3VXFH 2XRCA 1EXFA 3RXTA 4NFFA 2Z9IA 3M61U 5GPIB 1TPOA 1EASA 1W13U 4I32A 2XWBI 1ANCA 3A7VA 4UFGH 1C5QA 1UTQA 3RXPA 1C5MD 3Q76A 3R0FA 1GBDA 1GJ9B 2AGGX 3SV2H 2FP7B 1NFXA 3BSQA 2FI5E 3VPKA 1TYNA 3MH4A 1CE5A 3E3TA 3P70B 3TH4H 1FIWA 1WQVH 1SOTA 1EPTB 3FAOA 3RXJA 3QDZB 3JZ1B 1MTNB 1NC6A 2YNAA 4ZHLU 1AIXH 1H9IE 1QQUA 1RTKA 4AFUA 3M5MA 4B76A 1T32A 4WF8A 4X2XA 4FU8A 3KL6A 3RXCA 4RSPA 3GDUA 3SN8A 2VWLA 4ZXYH 1XXFA 1YPLH 1OSSA 2C8XB 1V3XA 3EYDA 3TK6A 4H6SB 2ZG0H 3O8RA 3MI4A 1GMCF 4Q80A 8LPRA 2JETC 1OP0A 4NGAH 1MQ5A 1C5TA 4D7FA 1L1GA 2BQ7B 4XE4A 2H6MA 2YNBA 4Y0YE 1ELVA 1BRAA 1GHWH 5BRRE 4AG1A 8ESTE 1DLKB 1QL9A 1W8BH 1LDTT 3P8GA 3R3GB 1GBLA 3RXAA 1HAZB 4WVPE 4B71A 1O34A 3T2NA 3QGNB 3F9GA 2OINA 1SLVB 1EPTC 5A0BA 1QNJA 1UCYH 4YT6H 5A8ZA 1P2OA 1MTNC 3V12A 4B1TA 1MD7A 1HAVB 1GI8B 3SHAH 2EC9H 3SNBA 1O3DA 2HVXA 1TABE 1Z8IB 3LGIA 3F9EA 1A5IA 1C2DA 1NESE 2VIPA 1GCDA 1T31A 1P3EA 1Q2WA 2OCVB 2G8TA 4R0IA 2JH6D 1SR5C 1BTUA 8KME2 4VGCC 4UONA 2BD9A 5C2ZA 2FOGA 2BX3A 1BUIA 1GCTB 3TIUA 1QBVH 1A5GH 1UHBA 2BHGA 4U30A 1DXWA 2HNTF 3ZVCA 2ZPRA 2JH0D 3DA9B 5FBEA 3ZVDA 2ODPA 2SGAA 2H9HA 1ESAA 4MNVA 5E0GA 3LT3A 4DVAU 1FI8A 4YESB 2YOLA 1HAPH 4JZDH 2NWNA 1P11E 1O2SA 2FS8A 2ZHEH 2M5TA 1O3IA 4CHAC 2PR3A 4GSOA 4K60A 2ZECA 3UY9A 3MO9A 3SGQE 1C5YB 1P2NA 4AFQA 4IC5A 1K1NA 2ZFPH 4B2BA 5LPEA 1VITG 2ALPA 5B6OA 1TNIA 4J1YA 1GBHA 1MH0A 2J34A 1CBWC 3QK1A 1PPZA 1K1MA 3LH3A 1TX7A 2BDAA 1ETSH 4GLYA 4A6LA 4NFEA 1HJAC 2OC8A 2UUYA 4R8TB 1GCTC 2NU4E 1SB1H 3F6UH 1IOEA 1TNGA 5FPYA 4FVDA 1ELDE 1EJAA 3TNTA 1DY8A 1GI2A 1GI7B 4XOJA 2JH5D 1OP8A 2VVUA 1NRPH 3HGPA 2FX4A 2XNIA 2ZA5A 3RXHA 1JRSA 4AYYB 2W5EA 2QCYA 1AFEH 5F8XA 3LKWA 1L1JA 1T4VH 3PM3A 2D1JA 2H2ZA 2SNWA 2BD5A 1AFQC 1GHBF 4X8VH 1TGSZ 2ANYA 4X1PU 3G01A 1C1VH 1O3HA 9ESTA 2V3HH 2WPHS 1ELGA 1YPEH 4NZQA 1GPZA 1YCPH 5EG4A 3RU4D 1HNEE 5C1YA 2DE8A 1TALA 4MPXA 2FTLE 3BTEE 1FY8E 2P95A 5L6NH 2ZFRH 3SI4H 5AHGH 1XVMA 1EATA 2FZZA 4U32A 3ZZ8A 3DT0H 4K2YA 1O3AA 3SNEA 7LPRA 1GI0A 1JIMA 2P93A 2STAE 3BG4C 1SGEE 4MTBA 1UMAH 1NT1A 2Q6GA 2R3YA 1QA0A 2VGCB 2GV7A 2ZCKP 1S84A 3KHVA 3S0NA 1SBWA 2Y82A 1Z7KA 5F8ZA 4A1VA 1PYTC 1C4Y2 2R3UA 1TRMA 2CHAB 3NKKA 1UVSH 5DP9A 2GMTC 2EI8A 2Y5GA 1TNHA 2AMDA 4D7GA 2V6NA 1D6WA 1VCWA 3TJOA 1MCVA 2OTVA 4NIYA 1OS8A 1CGIE 1S0QA 1QGFA 1ZSJA 4MPVA 1HAIH 2D8WA 3RLWH 1AZZA 3BEUA 5EODA 3SU0A 1A0JA 1GBMA 3U1IB 1BCUH 4SGAE 3SORA 1P2QA 1UTNA 1FY3A 3EQ0H 2ZU3A 4FVBA 1PQ8A 5T6GA 5C3NA 1RS0A 1VR1H 2FLBH 4GVUA 3E90B 1AMHA 3U8RH 1LVOA 3NUMA 3SGAE 2R2MB 2FWWA 5CHAB 3GYLB 1ZSKA 1ZTKA 3LJOA 2IN2A 3VGCB 1W11U 4UFDH 1UCYE 5GWZA 3ZZAA 2AGIX 2P16A 3GDSA 2F9UA 5ESBA 1HV7A 4BTIB 3BEFB 1IQHA 1AVXA 3BTWE 4I33A 1NO9H 3P92A 1NRRH 2QN5T 1AD8H 3ZZ5A 1C1MA 3PMAB 1C5LH 3SV9A 1GJ6A 4LXBH 5LGOA 4Y71A 3AVZA 3SNCA 2FO9A 3U9AH 1C2FA 1Y59T 1ZMNA 4MLFB 1JMOH 4INKA 2WUBA 1HCGA 2C8WB 4X6OA 4DIIH 1XUHA 1SL3A 4H4FA 1EAWA 4RKOB 1QFKH 3PTBA 1HAXB 4CH8B 3T5FH 4X6MA 2D26C 1W0ZU 3GISB 3SOSA 3KQEA 2FOCA 1YCPM 1H9HE 5DP7A 4K1SA 3OTJE 2BLWA 2ZU5A 1O2YA 2ZI2H 2OQUA 2BY7X 2GCHF 2FMJA 1TPPA 2VWNA 3A85A 3GY5A 1A1RA 1C5RA 1EJNA 1IHSH 2J95A 2OBQA 2V0BA 2A31A 3CP7A 2VNTA 2HPPH 3MNBA 1P0SH 1XM1A 1TMTH 5DP5A 3SV8A 3FFGA 5IDKA 1TLDA 4XSKU 1A3EH 3DD2H 2A2QH 2P8OC 1GBJA 1QTFA 2C8ZB 2ZGHA 5HMAA 2WPKS 7ESTE 3BN9A 3QO6A 2PW8H 5JBCS 4FUGA 2ZWLH 1EUFA 1AKSB 1TONA 3U8OH 4CRAA 1NM6A 1GDQA 1SGFG 4DURA 5F8TA 2ZU2A 4WJG2 4FUBA 3A7YA 3UFAA 1FMGA 1C9PA 4IBLH 5ESTE 1BA8B 3E0NB 3A7TA 4YOIA 4ZMAH 1A46H 1BHXB 1TRYA 1EAXA 1RTLA 1BT7A 4D9RA 1P03A 2CJIA 1GG6B 3NCLA 4UDWH 1QJ6B 1B5GH 4BTUB 3TU7H 1A5HA 1YF4A 1P9UA 1FQ3A 1JWTA 2FLRH 1O37A 3PMHB 1TOCB 2B9LA 3RLYH 4AGKA 1CHGA 2GT7A 2OC1A 3BTTE 1HGTH 1GBKA 5A8YA 3RMOH 2HGTH 2VIVA 4GAWA 1Y5UT 3GICB 2ZNKH 3RU4T 1XUFA 3RC6A 1EOLA 1OWEA 2QXJA 4X1QU 2BDHA 5GIBA 1ELFA 3A87A 3PV4A 1DS2E 5EU8A 1LQEA 1TGCA 3SU1A 1TMUH 1NRSH 1GGDC 1SFIA 2ZHDA 4Y7AA 3ZZCA 1V2QT 1GVLA 5A0CA 2FX6A 4LK4A 1TPAE 3GY3A 4ISOA 4DIHH 4ZUHA 5L2ZH 2RCEA 2PLXA 2OUAA 1E36B 3Q00A 3PROA 2H1UA 5FHTA 1V2MT 5FPSA 3RUOA 3QZQA 3UQVA 2AYWA 1VGCC 1K22H 3BTFE 3LGTA 3KQDA 1Z71A 2A7HA 1GHAG 4YM9A 4GHQA 3S7KB 5EQRA 1HAYB 3PWCA 4YLUA 1OXGA 1NN6A 2Z9GA 1O33A 4Y76A 1DOJA 3MFJA 2BXTH 1N8OB 3SQEE 1VZQH 5GCHF 1DFPA 1IQNA 4UEHH 1MKXH 4B2CA 1BMMH 1K9OE 1SQTA 2HNTE 4OS7A 1Z1IA 1LVYA 2F9VA 2FI4E 3ODFA 5I46H 1NRNH 1XUGA 2BLQA 3PYHA 4UE7H 4Y10E 5T6FA 3M5OA 5CMXH 1GJ5H 1SOZA 2ZP0H 4X6PA 1QB6A 4WXVA 4Y6DA 1C1SA 2AMPA 1T8NA 3E6PH 4HGCA 3M35A 4A5TS 1UTMA 5C20A 1W12U 1XUKA 4E7NA 4CBOA 1RRKA 3P95A 3VEQB 2AIQA 1CT0E 2R2WU 2WYGA 4FUCA 3IWMA 4K3JA 3BTME 3A84A 1XXDA 2BDYA 1D3DB 1AY6H 1C2IA 1HXEH 4UFEH 4Y8YA 1ORFA 3U8TH 2QV1A 4MG3A 2PKSC 4LOYH 2ZEBA 2UUKB 4Q7YA 2GCTB 3K2UA 1IQMA 2FOBA 1E35B 1HUTH 2CN0H 2IJOB 4IC6A 1KLJH 4O03A 1D3QB 1QRZA 2GVFA 1O2ZA 1V6DA 3MH7A 1WYKA 7GCHG 1GJBB 1XX9A 1AQ7A 4FU9A 2QF3A 1SHYA 4ABHA 4D8NA 1YPHE 1GBCA 2BDIA 1C2GA 4JCNA 3AAVA 3RC4A 2ZU1A 1TRNA 2A2XH 2BY9X 1EAUA 1FZZA 1RIWC 4AX9H 1GI9B 2J9NA 1LCYA 2WUCA 2SFAA 3MU1A 1AB9C 4F49A 4B2AA 3ZZBA 1CT4E 1C5VA 2A5IA 4A92A 1J14A 2Y7XA 1GHYH 2XW9A 1BRBE 1VCPA 1QA7A 4KGAA 1LVMA 4FXGH 1E0FD 3TPIZ 1SFQB 1OP2A 1S82A 1Z6EA 2BD4A 4XFQA 5AF9H 1O2GH 1MKWH 1O2UA 3M7TA 5LPRA 1AU8A 2JETB 1QURH 2GCTC 4TY6A 1O2KA 3UNSA 4AYVB 2XXLA 3GDVA 3H5CB 2VB0A 3VFEA 1CO7E 1P06A 2C93B 4OGXA 4D9QA 1A3BH 1D6RA 4X8SH 2J2UA 1ZJDA 1P57B 1XKAC 3SQHE 3MU5A 1SMFE 1GVKB 1ABJH 3B23B 2HRVA 4GPGA 4CRFA 3GCNA 1IHTH 1YKTA 1KDQB 1FY5A 1HB0B 2XBYA 4DJZB 3MWIU 1F5RA 3GCTF 1O5FH 3EA9A 2WV5A 2ZQ1A 1P02A 2P3TB 2Z6BD 1U6QA 2BVXH 2XTTB 1H1BA 1UK2A 4K5ZA 3ATWA 1GBIA 1UVOA 4TYDA 1QY6A 2ZPSA 2GP9B 1UCYK 1LHCH 3RMNH 1F5KU 3LC5A 3TITA 2P3FH 3P8FA 1Y5BT 1Q3XA 2Z3CA 4VGCB 1NRQH 3TGIE 2GGVB 4Y8XA 4Q2KA 1G2LA 4JMYA 4FUEA 5LH8A 4NA7A 3RC5A 1BBRH 3KQCA 2W7SA 1DWBH 2BM2A 3QX5H 4JZIA 3URCA 1TB6H 1SGYE 4XBDA 3MNCA 1SLWB 4FUJA 5A8XA 1AVGH 4CHAB 1HAHH 3LOXA 1YGCH 3C1KA 3GYMA 1C2HA 4X1SU 2BD7A 4KP0A 1V2TT 2BQWB 1NS3A 1RGQA 3EDXB 4A7IB 5HGGA 1HDTH 1RD3B 1ZHMA 3PLBA 4ISIH 2ULLA 3LPRA 2ZTZA 4KELA 1CBWB 1GL0E 1DWCH 4E7RG 5HYOA 1MU8B 2ZIQH 1AN1E 1IQJA 1ZMLA 4BAQB 3LGYA 1BRUP 1LQDB 1QHRB 1HJAB 1O2PA 1BZXE 1AI8H 1F0SA 1EZXC 1FY1A 3EA7A 4BAHB 2A5KA 1VJ9U 1FV9A 1LKBA 3BIVH 1ZPZA 3URDA 1BHXF 3A8AA 2XCFA 3SW2B 1EKBB 3RXEA 3M3SA 3DFJA 2BY8X 1O2TA 1V2ST 3A7ZA 4DGJA 2GTBA 3RXOA 3ZVGA 2ZHFH 3A8CA 2Y80A 2F91A 2GZ7A 3GCHC 1MCTA 5DG6A 1BITA 1P2IA 4B74A 4YZUA 2JKHA 2OC0A 4B75A 3A89A 1AFQB 4NG9H 2SGDE 3KF2A 3LH1A 3RXLA 3B9FH 4K8BA 3ZZ7A 1O5GH 1C9TA 1NPMA 3O8BA 3UTUH 1LHDH 4IMZA 5FBIA 1SLXB 9LPRA 2GZ9A 3K6ZA 5ETXA 3F9HA 1NU7B 2FXRA 4KTUA 2H5DA 1VITF 1O5BB 3SU6A 3RXRA 4KTCA 2FM2A 3A8DA 3BG4B 1EZUC 1FN8A 1YCPK 2THFB 3K9XB 3LC3A 2O8TA 2OXSA 1IQIA 3FANA 1BJUA 1NROH 1ZMJA 3M3VA 5DGJA 1HJ9A 4PROA 2XYAA 5C1UA 1DUEA 1O3GA 1O3LA 5EXMA 3SUFA 3UQOA 2GMTB 4NA9H 1S81A 5G4BA 4NSYA 1P10A 1C1TA 2Y6TA 1SQOA 3RXVA 5C5NA 3RM0H 1WCZA 2O8UA 5EOKA 1S6HA 3RXMA 1A61H 2H9TH 4ABAA 1B0FA 1UK3A 1GHXH 2FOEA 5JB9S 2G51A 2CF8H 1THRH 3T28A 1UO6A 1LHEH 2BTCE 3PLKA 1EZQA 2O8LA 1ARBA 4O3UA 4WH8A 1WAYB 2TRMA 1ANBA 1K1IA 4NIXA 1YC0A 4INLA 2BQ6B 1FONA 1ZHRA 4AOQA 4OS1A 4DOQA 1HYLA 3RP2A 2G4UA 1KTTB 4OS4A 1GHVH 2VIOA 4NWKA 1F0TA 8GCHG 2C4FH 2BXUH 2PTNA 1BJVA 3M7UA 1AE5A 3SV6A 3OX7U 4FUHA 2NU1E 1EP6A 3BTHE 1V2RT 2ZCHP 1T8LA 1PPFE 4BOHA 2FOMB 2GDEH 1UHBB 2ZO3H 3FP7E 2TGDA 1RJXB 4I8GA 4ASHA 3M7QA 4JZEH 5DKMA 2UWPA 1CA0C 1Y3YA 1AKSA 1TGNA 4K69A 3S9CA 3SUGA 2NU3E 2Y5FA 4ZKRU 5A09A 3EA8A 3MH5A 1AWFH 1D3PB 4KKDA 2BMGB 1BBRE 2ZFFH 1AHTH 4RKJB 2P3UB 4U2WA 4CRBA 1ELEE 1BOQA 1RTFB 2LNCA 1WSSH 1CSOE 2TGTA 3H7TA 4BAKB 3MU0A 5AFZH 5SGAE 3L3TA 2BD2A 1Y8TA 2IPHA 5L2YH 1C5WB 3MO6A 6GCHG 1O2XA 1BTYA 3A81A 3K6YA 4I7YH 1BTHH 1ZSLA 1F92A 2ZHQH 1EX3A 1O2RA 3D65E 1MQ6A 3UPEA 1FUJA 5EXNA 1MU6B 3ATKA 3LGUA 1CT2E 1GL1A 1DANH 6CHAC 2J4IA 1MAXA 4Q7ZA 3GY6A 2BDCA 3BTDE 2FOAA 3KN2A 2V35A 3RMLH 1IQGA 2HOBA 1HJ8A 1C5XB 2I6SA 1HPGA 2P8OB 1F0RA 2TGAA 3VB5A 2BOKA 2C8YB 2ASUB 1TA6A 1P09A 1Z8RA 4IS5A 1P2KA 1TMBH 4BANB 1G3DA 1MTVA 1VITH 1LO6A 1FDPA 2Z3DA 1K1OA 1GDUA 5DP4A 3TH2H 3ZZ4A 2A45B 1L1NA 1T8MA 5K7RA 1SVPA 2ZGXH 4X8UH 3SV7A 1GI6A 4ISHH 4X1NU 5JB8S 3AASA 4THNH 3VB4A 5ABWA 1WUNH 1G30B 2ESTE 3UNRA
chains in the Genus database with same CATH superfamily
4A1TA 2BX4A 1GI3A 4AN7A 2WPLS 2VINA 4O3TA 3U1JB 5E0HA 1EOJA 1HIAB 1CQQA 2W6JD 2WPMS 4OM9A 1O3MA 1QL7A 3ODDA 4IN1A 2AS9A 1WBGB 3RM2H 1L2EA 2RA0A 3NWUA 4INHA 2O8MA 4CR5A 1T8OA 4JYVH 1DDJA 4ZHAA 3QZRA 2PWXA 3Q3XA 4WWYA 3TGJE 1EB2A 1MD8A 4ISNA 2SGPE 4M7GA 3UREA 5PTPA 1AO5A 4ZAEA 2ZDLA 1DY9A 4HFPB 4ABBA 1O3JA 1GJDB 1SGCA 4JZ1A 2AGEX 2BD8A 2K8IA 1GGDB 3MU4A 1J15A 2WPIS 2ANMH 3RXKA 2BY6X 4WXIA 1Y3UA 1KY9A 2BYAX 1C1RA 3HK6B 1YBWA 1QL8A 1UVPA 3VG8A 2PP6A 4U01A 3T26A 2OP9A 3SBKA 1INCA 1KXDA 1C4U2 1L4DA 3TK9A 2UWLA 4A1XA 2FYQA 3RXSA 1VGCB 2P94A 1OWDA 1CHOG 1KXEA 1AWHB 2ZFSA 2B0FA 3VB6A 2KM0A 1K2I1 2J97A 2F9BH 2A7CA 5JDUB 1ELCA 1F7ZA 4YTAA 1G9IE 2SGEE 1O2NA 1OWJA 1D9IA 5KGOA 1TBZH 3BEIB 5T6DA 3SGBE 3T29A 4BTTB 1P01A 1ZRBA 3PO1C 5FL7D 3NPSA 3UR9A 2FPZA 3DSPA 1GBBA 3LJJA 1QCPA 2GX4A 4I8KA 1O2HA 1GJCB 2VU8E 2R9PA 1FPHH 1ZLRA 2QXIA 3N7OA 5K0HA 2TGPZ 3PTNA 1YLNA 3BV9B 5FX6A 2OLGA 5DP3A 3AAUA 3ZZ6A 2UUJB 1Z1JA 1EB1H 3V13A 1W7XH 1O39A 3NK8A 4OS2A 2AERH 3QTVH 3UWIA 1MKXK 4ABDA 2AIPA 4FETA 2RG3A 3SJKA 4HTCH 1P05A 1L4ZA 2WHXA 2XBWA 1SG8B 1SQAA 2Z9KA 4AORA 3M5LA 2A32A 2GDDA 4DT4A 1C5SA 2ZDVH 1W0YH 4TSFD 2DE9A 5EPYA 5C94A 3SO3A 3ITIA 5EGMA 2ZDNA 2BY5X 2HLCA 1LVBA 2W7UA 1AE8H 3A88A 3EE0B 3STJA 2A4RA 3W1EA 3SJ9A 2PKAB 2PKSB 2ANKH 3E0PB 3BTQE 3RXFA 1GHAF 1QIXB 1EPTA 4X6NA 5B6LA 4KTSA 1KDQA 2VH0A 3CS7A 4B73A 1J8AA 1TBRH 2KCPA 1ELBA 3V0XA 1F2SE 1GMHF 3HK3B 3HPTB 1GJ4H 1ZGVA 4LZ1H 3M3TA 1OWHA 3QTOH 4ZXXH 2W3KA 4JK5A 4AB8A 1T7CA 3HATH 6ESTA 1TNLA 4E05H 1RIWB 3KYFA 2QY0B 2A0QB 1OOKB 2QYIA 1C2MA 3MNXA 1AB9B 3GY7A 1P2MA 2VJ1A 2H5CA 3LU9B 3SUEA 1GMDG 1C5OH 1O2VA 2EY4C 1Z6JH 1PYTD 4MQAA 1DVAH 4YOJA 4IMQA 4MNXA 2A4QA 5FCKA 1OWKA 5JYIA 2B5TB 1V2NT 3SI3H 4NIWA 1YLDA 3SNAA 2PSXA 4TY7A 1MUEB 2ILNA 1OX1A 1ZOMA 4Z1MD 5I25A 4IW4E 5T1VA 2Y7ZA 3TH3H 2ZTYA 1HAVA 1IQLA 2KAIB 1Y3WA 1UK4A 4GCHF 1G3BA 4X0WU 4YT7H 2HWLB 5JBTA 3MO3A 2GV6A 3KQ5A 4F48B 1G3EA 1AUTC 1O2OA 1MKWK 1CU1A 4SGBE 1AVWA 1O32A 1FY4A 1W7GH 1TBQH 3OEED 5LPFA 3ATMA 3GY8A 5HM9A 5J4SA 2Z3EA 1NFWA 1KMHB 3RMMH 1UVTH 3F9FA 4I8HA 4AFZA 2ZCLP 5DJ7A 4Y11E 1O35A 1GJAB 4ZKSU 3MQKC 1ZPBA 1FJSA 5E2OA 1O2LA 1AZ8A 2KX4A 1UTKA 1O2MA 3FN8A 1ZTJA 4NSVA 3DFLA 4NA8A 1FXYA 5T3HA 1AGJA 4D76A 1WTHD 5TJXA 4CR9A 1O30A 2ZFTA 3A83A 1O2IA 5AVDA 3QWCH 1C2JA 3SJ8A 1A7SA 1NU9A 1PPBH 1QR3E 2BDGA 4FUDA 1IAUA 2AEIH 2W26A 2G00A 3DUXH 3KCGH 2M2AA 1BRCE 3E16B 3KYGA 2WINI 1O3FA 1PPCE 1TAWA 3Q3KA 1TX6A 4J2YB 5E0JA 2SNVA 2VIDA 2FDAA 1PQ5A 3T27A 4ABGA 4MVNA 3MOCA 4JYTA 1LHFH 4NWLA 5FPTA 2QA9E 1SGPE 4X2VA 1C5PA 3GCTG 1C5UA 2A4GA 1C2EA 1DLEA 3C27B 4O97A 4X8TH 2XCNA 1TNJA 3SUDA 3PLPA 2DUCA 5EW2H 2PUQH 1PJPA 5KECA 1BBRK 2QXGA 1GJ8B 2V3MA 2CMYA 3CENA 2OC7A 3HGNA 3ELAH 3S69A 1ANDA 1NFUA 2OD3B 2R0KA 4XRNA 3I78A 1GMCG 3ZZ3A 4GHTA 3AW1A 1FNIA 4TWWA 4ABIA 4AGJA 4Y0ZE 1YPGH 4I31A 4MNYA 1BTWA 3NXPA 1SI5H 4TPYA 3H7OA 2H9EH 2Z7FE 2XC0A 1QQ4A 3WW7A 1S5SA 2XWAA 1S83A 4NCYA 2ANWA 1BTXA 2BVSH 2Z94A 1DUAA 1ZPCA 1KLIH 3MTYA 2FTMA 1SGNE 1NZQH 1AUJA 2AH4X 1O5DH 3GCHB 1BIOA 1X7AC 2QGRA 3QGJA 1E37B 2EEKA 4MNWA 3LDXH 3QUMP 1P04A 3SJIA 3V3MA 1MBQA 3FP8E 5DPAA 2TPIZ 4HI3A 1S6FA 1TGTA 2BD3A 2VVVA 2GZ8A 1DE7H 3P8OA 2V3OH 1WV7H 7KMEH 2ZGCA 2P59A 1P12E 3D49H 1O5AB 4Y79A 4AZ2B 1YYY1 2QAAA 4BAMB 3JZ2B 5H4IB 4CH2B 2G4TA 5CE1A 1S85A 3N99A 1A4WH 1P8VC 3OYPA 2ZTXA 3PWBA 3SZNA 1GWAA 3A86A 1OYTH 2CF9H 1VJAU 3F0OA 1BQYA 3PB1E 3MHWU 1QZ8A 1O2QA 4YLQH 1MBMA 5EQQA 2G5VA 1IQEA 4DT7B 1Z8GA 1V2VT 1ESBA 5HM2A 2ZF0H 3EE7A 3TVJB 3ZV8A 1O5CB 1O3PB 5E8EH 3ZV9A 2J38A 1DT2A 4TWYA 2QXHA 3BTGE 2HALA 2SGFE 1KXCA 1Y3XA 1CA8B 3LONA 2Y81A 1KXFA 1V2UT 2VIWA 1C2KA 1N6YA 4QT8C 1MTUA 2ZHWH 1LPKB 1XUIA 4FUIA 1YPKH 2FESH 4AG2A 4ZH8A 1GJ7B 1QRXA 3GY2A 2YMSD 2J92A 4CRGA 1BTPA 2UUFB 3H09A 5C0TA 1XVOA 5L30H 4CREA 3FVFB 2EI6A 1TE0A 1QJ1B 1GVZA 3OY5U 2F9OA 2C3SA 1BTZA 1V2WT 1ZR0A 3TK5A 4ACAA 1PPGE 5DSFA 2ZDKA 3LGVA 2ODQA 3T25A 1KSNA 2EI7A 4ABFA 4O9VA 3HKIB 1PPEE 3RXUA 1KTSB 1P2JA 1O0DH 1HBTH 1FPCH 4JZFH 3ZVAA 1YP9A 4RN6A 5F53A 1GHBG 2ZQ2A 1NY22 3P8NA 2K1QA 2ZFQH 5EPNA 3SHCH 2A7JA 1OPHB 1RXPA 4OS6A 5J4QA 3E91A 1O3OA 1G36A 4K1EA 3Q77A 1JRTA 5HXFA 1F5LA 3ESTA 1C1UH 3KIDU 5TCCA 1QB1A 3F1SB 1NBME 2BOHB 3U69H 1P9SA 4BXSA 1CA0B 1UTLM 1JXPA 3M37A 1HAGE 5DO4H 3WWBA 1MMJN 1M9UA 2ODYB 3QLPH 1XUJA 2F83A 3TLOA 1O36A 1ID5H 2G5NA 2IJD1 4ABEA 3A80A 3FZDA 3TJVA 2FIRH 3TNSA 1OYQA 2ZZUH 3EGKH 1SLUB 1F0UA 1W3CA 1T4UH 1EQ9A 1HIAA 2VIQA 2FODA 2PHBA 4Q63A 1DITH 1ANEA 1GI5A 2A1DB 1A0HB 2Q6FA 3SU3A 1JOUB 1TX8A 3RXDA 2J94A 4DG4A 2WV4A 1V2JT 2KZ4A 2W3IA 1TOMH 1BB0B 5FX5A 5JBAS 2BZAA 3BF6H 3TJNA 1XMNB 2ZDMA 6CHAB 3ZYDA 5E2PA 3GCOA 1LMWB 2EA3A 4JK6A 1C1QA 1C4V2 8GCHF 1YM0A 4NZLA 1WTGH 2Y5HA 4XDEA 1P3CA 4WMDA 2TIOA 3RXBA 4IGDA 1K1PA 1Y5AT 1GHZA 2XBXA 1DWEH 3BG8A 2F9NA 2GKVE 3B8JA 3KNXA 2F3CE 1A2CH 3SYJA 4Y8ZA 2VVCA 2RA3A 1GBAA 4LZ4B 3OSYA 1WU1A 3KGPA 1KYNA 2QF0A 2NU0E 1BMLA 3I77A 1MZAA 3ZIAD 3UOUA 4ABJA 1TFXA 1FN6A 4OGYA 2VGCC 2JJ1D 5A0AE 3OY6U 3UWJH 4BAOB 3WY8A 2CGAA 4TPIZ 2CHAC 4ZKNU 5TCAA 1LHGH 2BLVA 4Z6AH 1G3CA 2SGQE 1ETRH 6GCHF 1G37A 2A4OA 3KQBA 3ZZDA 2QC2A 2ZDAH 4WH6A 2G81E 1O5EH 3E1XB 5F03A 1W10U 3VXEH 2J98A 1E38B 2A5AA 1GBFA 4FUFA 3KEEA 3ATIA 2XC5A 4I8LA 2RDLA 1O3EA 3W94A 3UNQA 4FU7A 5A2MH 4ACBA 4DW2U 1JBUH 1A0LA 3A7WA 6LPRA 5FAHA 4ISLA 1VCQA 4NIVA 1O2JA 2FEQH 3ATLA 5FCRA 2F43B 3QN7A 3GOVB 1IQFA 1GBEA 1GI1A 4IN2A 2ZKSA 4BXWA 1DSTA 3DHKH 3MU8A 3S9AA 3UR6A 1O3BA 2BB4A 2FOHA 2PGQB 2GCHG 1C2LA 3E8LA 1Z8JB 5CHAC 1DSUA 1O3NA 4ZHMU 1HFDA 1V2PT 3ZVBA 3VGCC 2BZ6H 4X1RU 1EAIA 4AFSA 2PKAA 1MZDA 2TBSA 1NTPA 1W0KD 1W14U 1ZRKA 5GJ4B 2PV9B 1ELTA 4HZHA 2PTCE 2ZGJA 2BVRH 2AMQA 3ENSB 3PO1B 1C1NA 1EZSC 2O9QA 1YPMH 2KCYA 3TGKE 1CGHA 1N1LA 1QB9A 1ETTH 1SKYE 1D3TB 1GI4A 1KLTA 1THSH 2FS9A 1YWUA 1O38A 2ZPQA 3HKJB 3RDZA 3S7HB 1CVWH 3CS0A 1IQKA 2W6ID 3BTKE 1FIZA 3MYWA 1YLCA 1G2MA 2OBOA 4ESTE 1DM4B 2PSYA 5EIYA 3OU0A 2L6OA 1DPOA 3Q3YA 1UVUH 3UOPA 5F6MA 3OE7D 1O31A 1LKAA 3D23A 2WPJS 1QJ7B 4ZKOU 1PPHE 3U98H 3SJOA 1WQSA 1ZGIA 3ZVFA 3MMGA 2XNDD 3ZZ9A 3SU5A 1LPGB 2PGBB 4OS5A 1ESTA 2Q6DA 1THPB 3K65B 3RXIA 1V2KT 1LPZB 1LTOA 2KAIA 1V2OT 1GDNA 3A7XA 3AW0A 4MPUA 3O8DA 1G32B 1KXAA 4XBCA 3O8CA 1QRWA 1BDAA 2Q1JA 4H42U 1FAKH 3FP6E 2VWMA 2PUXB 1K1LA 3SU2A 2OQ5A 1B7XB 1L0ZA 3PMBB 1EFRD 3M36A 5C1XA 1QBOA 4YO9A 1CHOF 1EJMA 2QIQA 4UD9H 1TA2A 3PMJA 5EXLA 1Y3VA 1K1JA 3SNDA 3BIUH 1HLTH 1HXFH 2AFQB 1EP5A 4X2YA 1H4WA 4GUXA 2R0LA 3UIRA 1UTOA 1O3CA 2F9PA 1RFNA 1SGDE 3LIWA 4Y7BA 1VKYA 3UUZA 1TQ7B 4WMEA 5DK1A 1PFXC 1TIOA 1ZJKA 3L6PA 3M5NA 1S0RA 1NBMD 3OEHD 5GXPA 2LP6A 5HKKD 2QE7D 1YPJH 1NFYA 1C1WH 2WYJA 4XBBA 1FLEE 2UWOA 2HNTC 3F68H 5FXLA 5GDSH 4X2WA 1ELAA 2PFEA 2WSSD 3N7EA 4DCDA 2B7DH 2VWOA 5GCHG 5JPMH 2Z9LA 3IG6B 3L33A 1MTSA 1GG6C 1SGRE 4WY3A 4CRCA 3F0PA 1UJ1A 4I86A 1J17T 3LGWA 1TNKA 2G55A 2XBVA 3A8BA 1FAXA 2CXVA 5JBBS 4Z0KA 1GMHG 1H8DH 1PQ7A 2G52A 5C67A 3RXGA 5C5OA 3MNSA 1BMFD 1ZTLA 1DWDH 1S6LA 1SGTA 2LPRA 1DICA 4MDSA 4I8JA 1Q31A 1SSXA 3GY4A 1H8IH 2ZGBH 4E06H 1K28D 1KIGH 1KXBA 1J9CH 1ZYOA 2I6QA 1ABIH 4ZROA 1GBTA 1ARCA 3P6ZB 4JYUH 1BMNH 1C5NH 1SGIB 5EW1H 3F2HA 2O8WA 3V7TA 2HVYB 1B0EA 1DXPA 4WMFA 1OWIA 2GT8A 4CBNA 2VH6A 1UTPA 3T62A 1SC8U 4MPWA 1C1OA 2NU2E 3NZIA 1HAOH 1BMAA 2FI3E 2CV3A 4K8YA 1YPHC 1GMDF 4CRDA 4YOGA 5HIZA 1JIRA 2BLOA 1K21H 4GCHG 3RXQA 1N8OC 1O3KA 3MH6A 3SU4A 1O2WA 1SHHB 1DX5M 1CGJE 3IITA 5AFYH 5EQSA 4DY7B 2BDBA 3RU4E 1H9LB 1V2LT 4TT3D 5BPEA 2D2DA 2STBE 4ASUD 3EAJA 1HRTH 4AB9A 2ALVA 1QBNA 5IYTA 3STIA 2ZC9H 3VB7A 2FYRA 7GCHF 1ZHPA 3FO8D 5DP6A 1XKBC 3A82A 4Q7XA 1TPSA 2XC4A 1C5ZB 3ZYEA 1N6XA 1MAYA 1D4PB 1MTWA 1SPJA 3W95A 3DSGA 1UTJA 2IOTA 1C1PA 4K1TA 1J16A 1TQ0B 1SGFA 1PQAA 2B8OH 1SGQE 3I29A 1W2KH 4BNRA 5DP8A 1TGBA 2FOFA 2ZU4A 2Z9JA 4UFFH 2OK5A 3P17H 2HPQH 1ACBE 3ZVEA 1E34B 1OKXA 1ZZZA 2C90B 1TWXB 3S9BA 3FZZA 4F4OC 3D62A 1WOFA 3TJUA 4H6TA 3VB3A 2GD4B 3VXFH 2XRCA 1EXFA 3RXTA 4NFFA 2Z9IA 3M61U 5GPIB 4AC9A 1TPOA 1MABB 1EASA 1W13U 2AHME 2KCAA 2XWBI 4I32A 1ANCA 3A7VA 4UFGH 1C5QA 1UTQA 3RXPA 1C5MD 3Q76A 2V7QD 3R0FA 1GBDA 1GJ9B 2AGGX 3SV2H 2FP7B 1NFXA 3BSQA 5CHBA 2FI5E 3VPKA 1TYNA 3MH4A 1CE5A 3E3TA 3P70B 3TH4H 1FIWA 1WQVH 1SOTA 1EPTB 3FAOA 3RXJA 3PRDA 3QDZB 3JZ1B 2QF4A 1MTNB 1NC6A 2YNAA 4ZHLU 1AIXH 1H9IE 1QQUA 1RTKA 4AFUA 3M5MA 4B76A 1T32A 4WF8A 4X2XA 4FU8A 3KL6A 3RXCA 4RSPA 3GDUA 3SN8A 2VWLA 4ZXYH 1XXFA 1YPLH 2EQNA 1OSSA 4XD7D 2C8XB 4RI0A 1V3XA 3EYDA 3TK6A 4H6SB 2ZG0H 3O8RA 3MI4A 1GMCF 4Q80A 8LPRA 2JETC 1OP0A 4NGAH 2KCOA 1MQ5A 1C5TA 4D7FA 1L1GA 2BQ7B 4XE4A 2H6MA 2YNBA 4Y0YE 1ELVA 1BRAA 1GHWH 5BRRE 4AG1A 8ESTE 1DLKB 1QL9A 1W8BH 1LDTT 3P8GA 2JDID 1GBLA 3R3GB 3RXAA 1HAZB 4WVPE 4B71A 1O34A 3T2NA 3QGNB 3F9GA 2OINA 1SLVB 1EPTC 5A0BA 1QNJA 1UCYH 4YT6H 5A8ZA 1P2OA 1MTNC 3NRLA 3V12A 1MD7A 4B1TA 1HAVB 1GI8B 3SHAH 2EC9H 3SNBA 1O3DA 2HVXA 3CNRA 1TABE 1Z8IB 3LGIA 3F9EA 1A5IA 1C2DA 2J5UA 1NESE 2VIPA 1GCDA 1T31A 1P3EA 1Q2WA 2OCVB 2G8TA 4R0IA 2JH6D 1SR5C 1BTUA 8KME2 4VGCC 4UONA 2BD9A 5C2ZA 2FOGA 2BX3A 1BUIA 1GCTB 3TIUA 1QBVH 1A5GH 1UHBA 2BHGA 4U30A 1DXWA 2HNTF 3ZVCA 2ZPRA 2JH0D 3DA9B 5FBEA 3ZVDA 2ODPA 2SGAA 2H9HA 1ESAA 4MNVA 5E0GA 3LT3A 4DVAU 1FI8A 1WDIA 2YOLA 4YESB 4JZDH 1HAPH 2NWNA 1P11E 1O2SA 2FS8A 2ZHEH 2M5TA 1O3IA 4CHAC 2PR3A 4GSOA 4K60A 2ZECA 3UY9A 3MO9A 5KEDA 3SGQE 1C5YB 1P2NA 4AFQA 4IC5A 1K1NA 2ZFPH 4B2BA 5LPEA 1H8HD 1VITG 2ALPA 5B6OA 1TNIA 4J1YA 1GBHA 1MH0A 2J34A 1CBWC 3QK1A 1PPZA 1K1MA 3LH3A 3U28C 1TX7A 2BDAA 1YY3A 1ETSH 4GLYA 4A6LA 4NFEA 1HJAC 2OC8A 2UUYA 3UAIC 4R8TB 1GCTC 2NU4E 1SB1H 3F6UH 1IOEA 1TNGA 5FPYA 4FVDA 3F2FA 1ELDE 1EJAA 3TNTA 1DY8A 1GI2A 1GI7B 4XOJA 2JH5D 1OP8A 2VVUA 4HG6A 1NRPH 3HGPA 2FX4A 2XNIA 2ZA5A 3RXHA 1JRSA 2QF5A 4AYYB 2W5EA 2QCYA 1AFEH 5F8XA 3LKWA 1L1JA 1T4VH 5EJ1A 3PM3A 2D1JA 2H2ZA 2SNWA 2BD5A 1AFQC 1GHBF 4X8VH 1TGSZ 2ANYA 4X1PU 3G01A 1C1VH 1O3HA 9ESTA 1E1RD 2V3HH 2WPHS 1ELGA 1YPEH 4NZQA 1GPZA 5IK2D 1YCPH 5EG4A 3RU4D 1HNEE 5C1YA 3F3BA 2DE8A 1TALA 4MPXA 2FTLE 3BTEE 1FY8E 2P95A 5L6NH 2LELA 2ZFRH 3SI4H 5AHGH 1XVMA 1EATA 2FZZA 4U32A 3ZZ8A 3DCLA 3DT0H 4K2YA 1O3AA 3SNEA 7LPRA 1GI0A 1JIMA 2P93A 2STAE 3BG4C 1SGEE 4MTBA 1UMAH 1NT1A 2Q6GA 2R3YA 1QA0A 2VGCB 2GV7A 2ZCKP 1FX0B 1S84A 3KHVA 1SBWA 2Y82A 3S0NA 1Z7KA 5F8ZA 4A1VA 1PYTC 1C4Y2 2R3UA 1TRMA 2CHAB 3NKKA 1UVSH 5DP9A 2GMTC 2EI8A 2Y5GA 1TNHA 2AMDA 4D7GA 2V6NA 1D6WA 2RFKC 1VCWA 3TJOA 1MCVA 2OTVA 4NIYA 1OS8A 1CGIE 1S0QA 1QGFA 1ZSJA 4MPVA 1HAIH 2D8WA 3RLWH 1AZZA 3BEUA 5EODA 3SU0A 1A0JA 1GBMA 3U1IB 1BCUH 4SGAE 3SORA 1P2QA 1UTNA 1FY3A 2XOKD 2ZU3A 3EQ0H 4FVBA 1PQ8A 5T6GA 5C3NA 1RS0A 1VR1H 2FLBH 4GVUA 3E90B 1AMHA 3U8RH 1LVOA 3NUMA 3SGAE 2R2MB 2FWWA 5CHAB 3GYLB 1SQRA 1ZSKA 1ZTKA 3LJOA 2IN2A 3VGCB 1W11U 4UFDH 1UCYE 5GWZA 3ZZAA 2AGIX 2P16A 3GDSA 2F9UA 5ESBA 1HV7A 4BTIB 3BEFB 1IQHA 1AVXA 3BTWE 4I33A 1NO9H 3P92A 1NRRH 2QN5T 1AD8H 3ZZ5A 1C1MA 3PMAB 1C5LH 3SV9A 1GJ6A 4LXBH 5LGOA 4Y71A 3AVZA 3SNCA 2FO9A 3U9AH 1C2FA 1Y59T 1ZMNA 4MLFB 1JMOH 4INKA 2WUBA 1HCGA 2C8WB 4X6OA 4DIIH 1XUHA 1SL3A 4H4FA 1EAWA 4RKOB 1QFKH 3PTBA 1HAXB 4CH8B 3T5FH 4X6MA 2D26C 1W0ZU 3GISB 3SOSA 3KQEA 2FOCA 1YCPM 1H9HE 5DP7A 4K1SA 3OTJE 2BLWA 2ZU5A 1O2YA 2ZI2H 2OQUA 2BY7X 2GCHF 2FMJA 1TPPA 2VWNA 3A85A 3GY5A 1A1RA 1C5RA 1EJNA 1IHSH 2J95A 2OBQA 2V0BA 2A31A 3CP7A 2VNTA 2HPPH 3MNBA 1P0SH 1XM1A 1TMTH 5DP5A 3SV8A 3FFGA 5IDKA 1TLDA 4XSKU 1A3EH 3GS9A 3DD2H 2HLDD 2F4LA 2A2QH 2P8OC 1GBJA 1QTFA 2C8ZB 2ZGHA 5HMAA 2WPKS 7ESTE 3BN9A 3QO6A 2PW8H 5JBCS 4FUGA 2ZWLH 5DN6D 1EUFA 1AKSB 1TONA 3U8OH 4CRAA 1NM6A 1GDQA 1SGFG 4DURA 5F8TA 2ZU2A 4WJG2 4FUBA 3A7YA 3UFAA 1FMGA 1C9PA 4IBLH 5ESTE 2YMSB 1BA8B 3E0NB 3A7TA 4YOIA 4ZMAH 1A46H 1BHXB 1TRYA 1EAXA 1RTLA 1BT7A 4D9RA 1P03A 2CJIA 1GG6B 3NCLA 4UDWH 1QJ6B 1B5GH 4BTUB 3TU7H 1A5HA 1YF4A 1P9UA 1FQ3A 1JWTA 2FLRH 1O37A 3PMHB 1TOCB 2B9LA 3RLYH 4AGKA 1CHGA 2GT7A 2OC1A 3BTTE 1HGTH 1GBKA 5A8YA 3RMOH 2HGTH 2VIVA 4GAWA 1Y5UT 3GICB 2WPDD 2ZNKH 3RU4T 1XUFA 3RC6A 1UW7A 1EOLA 1OWEA 2QXJA 4X1QU 3AK5A 2BDHA 5GIBA 1ELFA 3A87A 3PV4A 1DS2E 5EU8A 1LQEA 1TGCA 3SU1A 1TMUH 1NRSH 2IPQX 1GGDC 5HIYA 1SFIA 2ZHDA 4Y7AA 3ZZCA 1V2QT 1GVLA 2J98B 4ZCNA 5A0CA 2FX6A 4LK4A 1TPAE 3GY3A 4ISOA 4DIHH 2YMSC 4ZUHA 5L2ZH 2RCEA 2PLXA 2OUAA 1E36B 3Q00A 3PROA 2H1UA 3OFND 5FHTA 1V2MT 5FPSA 3RUOA 3QZQA 3UQVA 2AYWA 1VGCC 1K22H 3BTFE 3LGTA 3KQDA 1Z71A 2A7HA 1GHAG 4YM9A 4GHQA 3S7KB 5EQRA 1HAYB 3PWCA 4YLUA 1OXGA 1NN6A 4YXWD 2KFWA 4RT1A 2Z9GA 1O33A 4Y76A 1DOJA 3MFJA 2BXTH 1N8OB 3SQEE 1VZQH 5GCHF 1DFPA 3FKSD 1IQNA 4UEHH 1MKXH 3N7DA 4B2CA 1BMMH 1K9OE 1SQTA 2HNTE 4OS7A 5CDFE 1Z1IA 1LVYA 2F9VA 2FI4E 3ODFA 2VBCA 5I46H 1NRNH 1XUGA 2BLQA 3PYHA 4UE7H 4Y10E 5T6FA 3M5OA 5CMXH 1GJ5H 1SOZA 2ZP0H 4X6PA 1QB6A 4WXVA 4Y6DA 5C0UA 1C1SA 2AMPA 1E79D 1T8NA 3E6PH 4HGCA 3M35A 4A5TS 1K0HA 1UTMA 5C20A 1W12U 1XUKA 4E7NA 4CBOA 1RRKA 3P95A 3VEQB 2AIQA 1CT0E 2R2WU 2WYGA 4FUCA 3IWMA 3PRBA 3BTME 4K3JA 4P00A 3A84A 1XXDA 2BDYA 1D3DB 1AY6H 1C2IA 1HXEH 4UFEH 4Y8YA 1ORFA 3U8TH 2QV1A 4MG3A 2PKSC 4LOYH 2ZEBA 2UUKB 4Q7YA 2GCTB 3K2UA 1IQMA 2FOBA 1E35B 1HUTH 2CN0H 2IJOB 4IC6A 1KLJH 4O03A 1D3QB 1QRZA 2GVFA 1O2ZA 1V6DA 3MH7A 1WYKA 7GCHG 1GJBB 1XX9A 1AQ7A 4FU9A 2QF3A 1SHYA 4ABHA 4D8NA 1YPHE 1GBCA 2BDIA 1C2GA 4JCNA 3AAVA 3RC4A 2ZU1A 1TRNA 2A2XH 2BY9X 1EAUA 1FZZA 1RIWC 4AX9H 1GI9B 2J9NA 1LCYA 2WUCA 4F55A 2SFAA 3MU1A 1AB9C 4F49A 4B2AA 3ZZBA 1CT4E 1C5VA 2A5IA 4A92A 1J14A 2JJ2D 2Y7XA 1GHYH 2XW9A 1BRBE 1VCPA 1QA7A 3OAAD 4KGAA 1LVMA 4FXGH 1E0FD 3TPIZ 1COWD 1SFQB 1OP2A 1S82A 1Z6EA 2BD4A 4XFQA 5AF9H 1O2GH 1MKWH 1O2UA 3M7TA 5LPRA 1AU8A 2JETB 1QURH 2GCTC 4TY6A 1O2KA 3UNSA 4AYVB 2XXLA 3GDVA 3H5CB 2VB0A 3VFEA 1CO7E 1P06A 2C93B 4OGXA 4D9QA 1A3BH 1D6RA 4X8SH 2J2UA 1ZJDA 1P57B 1XKAC 3SQHE 4P02A 3MU5A 5EJLA 1SMFE 1GVKB 1ABJH 3B23B 2HRVA 4GPGA 4CRFA 3GCNA 1IHTH 1YKTA 1KDQB 1FY5A 1HB0B 2XBYA 4DJZB 3MWIU 1F5RA 3GCTF 1O5FH 3EA9A 2WV5A 2ZQ1A 1P02A 2P3TB 2Z6BD 3PV2A 3SZEA 1U6QA 2BVXH 2XTTB 1H1BA 1UK2A 4K5ZA 3ATWA 1GBIA 1UVOA 4TYDA 1QY6A 2ZPSA 2GP9B 1UCYK 1LHCH 3RMNH 1F5KU 3LC5A 3TITA 2P3FH 3P8FA 1Y5BT 1Q3XA 2Z3CA 4VGCB 1NRQH 3TGIE 2GGVB 2WZQA 4Y8XA 4Q2KA 1G2LA 4JMYA 3DSOA 4FUEA 5LH8A 4NA7A 3RC5A 1BBRH 3KQCA 2W7SA 1DWBH 2BM2A 3QX5H 4JZIA 3URCA 1TB6H 1SGYE 4XBDA 3MNCA 1SLWB 4FUJA 2L74A 1AVGH 5A8XA 4CHAB 1HAHH 3LOXA 1YGCH 3C1KA 3GYMA 1C2HA 4X1SU 2BD7A 4KP0A 1V2TT 2BQWB 2WV9A 1NS3A 1RGQA 3EDXB 4A7IB 5HGGA 1HDTH 1RD3B 1ZHMA 3PLBA 2KR7A 4ISIH 2ULLA 3LPRA 2ZTZA 4KELA 2JIZD 1CBWB 1GL0E 1DWCH 4E7RG 5HYOA 1MU8B 2ZIQH 1AN1E 1IQJA 1ZMLA 4Q4LA 4BAQB 3LGYA 1BRUP 1LQDB 1QHRB 1HJAB 1O2PA 1BZXE 1AI8H 1F0SA 1EZXC 1FY1A 3EA7A 4BAHB 2A5KA 1VJ9U 1FV9A 1LKBA 3BIVH 1ZPZA 3URDA 1BHXF 3A8AA 2XCFA 3SW2B 1EKBB 3RXEA 3PV5A 3M3SA 3DFJA 2BY8X 1O2TA 1V2ST 3A7ZA 4DGJA 2GTBA 3RXOA 3ZVGA 2ZHFH 5GNDA 3A8CA 2Y80A 2F91A 3FOAA 2GZ7A 3GCHC 1MCTA 5DG6A 1BITA 1P2IA 4B74A 4YZUA 2JKHA 2OC0A 4B75A 3A89A 3WWFA 1AFQB 4NG9H 2SGDE 3KF2A 3LH1A 3RXLA 5C17A 3B9FH 4K8BA 3ZZ7A 1O5GH 1C9TA 1NPMA 3O8BA 3UTUH 1LHDH 4IMZA 5FBIA 1SLXB 2CK3D 9LPRA 2GZ9A 3K6ZA 5ETXA 3F9HA 1NU7B 2FXRA 4KTUA 2H5DA 1VITF 1O5BB 3SU6A 3RXRA 4KTCA 2FM2A 3A8DA 3BG4B 1EZUC 1FN8A 1YCPK 2THFB 3K9XB 3LC3A 2O8TA 2OXSA 1IQIA 3FANA 1BJUA 1NROH 1ZMJA 3M3VA 5DGJA 1HJ9A 4PROA 2XYAA 5C1UA 1DUEA 1O3GA 1O3LA 5EXMA 3SUFA 3UQOA 2GMTB 4NA9H 1S81A 5G4BA 4NSYA 1P10A 1C1TA 2Y6TA 1SQOA 3RXVA 5C5NA 3RM0H 1WCZA 2O8UA 5EOKA 1S6HA 3RXMA 1A61H 2H9TH 4ABAA 1B0FA 1UK3A 1GHXH 2FOEA 5JB9S 2G51A 2CF8H 1THRH 3T28A 1UO6A 1LHEH 2BTCE 3PLKA 1EZQA 2O8LA 1ARBA 4O3UA 4WH8A 1WAYB 2TRMA 3F2GA 1ANBA 1K1IA 4NIXA 1YC0A 4INLA 2BQ6B 1FONA 1ZHRA 4AOQA 4OS1A 4DOQA 1HYLA 3RP2A 2G4UA 1KTTB 4OS4A 1GHVH 2VIOA 4NWKA 1F0TA 1H8ED 1W0JD 8GCHG 2RDEA 2C4FH 2BXUH 2PTNA 1BJVA 1OHHD 3M7UA 1AE5A 3SV6A 3OX7U 4FUHA 2NU1E 1EP6A 3BTHE 1V2RT 2ZCHP 1T8LA 1PPFE 4BOHA 2FOMB 2GDEH 1UHBB 2ZO3H 3FP7E 2TGDA 1RJXB 4I8GA 4ASHA 1E1QD 3M7QA 4JZEH 5DKMA 2UWPA 1CA0C 2K0QA 1Y3YA 1AKSA 1TGNA 4K69A 3S9CA 3SUGA 2NU3E 2Y5FA 4ZKRU 5A09A 3EA8A 3MH5A 1AWFH 1D3PB 4KKDA 2BMGB 1BBRE 2ZFFH 1AHTH 4RKJB 2P3UB 4U2WA 4CRBA 1ELEE 1BOQA 1RTFB 1WSSH 2LNCA 1CSOE 4FOUC 2TGTA 5EJZA 3H7TA 4BAKB 3MU0A 5AFZH 5SGAE 3L3TA 2BD2A 1Y8TA 2IPHA 5L2YH 1C5WB 3MO6A 6GCHG 1O2XA 4B6EA 4B6FA 1BTYA 3A81A 3K6YA 4I7YH 1BTHH 1ZSLA 1F92A 2ZHQH 1EX3A 1O2RA 3D65E 1MQ6A 3UPEA 1FUJA 5EXNA 1MU6B 3ATKA 3LGUA 3OTPA 1CT2E 1GL1A 1DANH 6CHAC 2J4IA 1MAXA 4Q7ZA 2GJGA 3GY6A 2BDCA 3BTDE 2FOAA 3KN2A 2V35A 3RMLH 1IQGA 2HOBA 1HJ8A 4M9FA 1C5XB 2I6SA 1HPGA 4RT0A 1WXRA 2P8OB 1F0RA 2TGAA 3VB5A 2BOKA 2C8YB 2ASUB 1TA6A 1P09A 1Z8RA 4IS5A 1P2KA 1TMBH 4BANB 1G3DA 1MTVA 1VITH 1LO6A 1FDPA 2Z3DA 1K1OA 1GDUA 5DP4A 3TH2H 3ZZ4A 2A45B 1L1NA 1T8MA 5K7RA 1SVPA 2ZGXH 4X8UH 3SV7A 1GI6A 4ISHH 4X1NU 5JB8S 3AASA 4THNH 3VB4A 5ABWA 1WUNH 1G30B 3UB0A 2ESTE 3UNRA
chains in the Genus database with same CATH topology
4A1TA 2BX4A 1GI3A 4AN7A 2WPLS 2VINA 4O3TA 3U1JB 5E0HA 1EOJA 1HIAB 1CQQA 2WPMS 1O3MA 1QL7A 3ODDA 4IN1A 2AS9A 1WBGB 3RM2H 1L2EA 2RA0A 3NWUA 4INHA 2O8MA 4CR5A 1T8OA 4JYVH 1DDJA 4ZHAA 3QZRA 2PWXA 3Q3XA 4WWYA 3TGJE 1EB2A 1MD8A 4ISNA 2SGPE 4M7GA 3UREA 5PTPA 1AO5A 4ZAEA 2ZDLA 1DY9A 4HFPB 4ABBA 1O3JA 1GJDB 1SGCA 4JZ1A 2AGEX 2BD8A 1GGDB 3MU4A 1J15A 2WPIS 2ANMH 3RXKA 2BY6X 4WXIA 1Y3UA 1KY9A 2BYAX 1C1RA 3HK6B 1YBWA 1QL8A 1UVPA 4U01A 3T26A 2OP9A 3SBKA 1INCA 1KXDA 1C4U2 1L4DA 3TK9A 2UWLA 4A1XA 2FYQA 3RXSA 1VGCB 2P94A 1OWDA 1CHOG 1KXEA 1AWHB 2ZFSA 2B0FA 3VB6A 1K2I1 2F9BH 2A7CA 5JDUB 1ELCA 1F7ZA 4YTAA 1G9IE 2SGEE 1O2NA 1OWJA 1D9IA 3SGBE 1TBZH 3BEIB 5T6DA 3T29A 4BTTB 1P01A 1ZRBA 3PO1C 3NPSA 3UR9A 2FPZA 1GBBA 3LJJA 1QCPA 2GX4A 4I8KA 1O2HA 1GJCB 2VU8E 2R9PA 1FPHH 1ZLRA 2QXIA 3N7OA 5K0HA 2TGPZ 3PTNA 3BV9B 5FX6A 2OLGA 5DP3A 3AAUA 3ZZ6A 2UUJB 1Z1JA 1EB1H 3V13A 1W7XH 1O39A 3NK8A 4OS2A 2AERH 3QTVH 3UWIA 1MKXK 4ABDA 2AIPA 2RG3A 3SJKA 4HTCH 1P05A 1L4ZA 2XBWA 1SG8B 1SQAA 2Z9KA 4AORA 3M5LA 2A32A 2GDDA 1C5SA 2ZDVH 1W0YH 2DE9A 5EPYA 3SO3A 3ITIA 5EGMA 2ZDNA 2BY5X 2HLCA 1LVBA 2W7UA 1AE8H 3A88A 3EE0B 3STJA 2A4RA 3SJ9A 2PKAB 2PKSB 2ANKH 3E0PB 3BTQE 3RXFA 1GHAF 1QIXB 1EPTA 4X6NA 4KTSA 1KDQA 2VH0A 3CS7A 4B73A 1J8AA 1TBRH 1ELBA 3V0XA 1F2SE 1GMHF 3HK3B 3HPTB 1GJ4H 1ZGVA 4LZ1H 3M3TA 1OWHA 3QTOH 4ZXXH 2W3KA 4JK5A 4AB8A 1T7CA 3HATH 6ESTA 1TNLA 4E05H 1RIWB 2QY0B 2A0QB 1OOKB 2QYIA 1C2MA 3MNXA 1AB9B 3GY7A 1P2MA 2VJ1A 2H5CA 3LU9B 3SUEA 1GMDG 1C5OH 1O2VA 1Z6JH 1PYTD 4MQAA 1DVAH 4YOJA 4IMQA 4MNXA 2A4QA 5FCKA 1OWKA 5JYIA 2B5TB 1V2NT 3SI3H 4NIWA 1YLDA 3SNAA 2PSXA 4TY7A 1MUEB 2ILNA 1OX1A 1ZOMA 5I25A 4IW4E 2Y7ZA 3TH3H 2ZTYA 1HAVA 1IQLA 2KAIB 1Y3WA 1UK4A 4GCHF 1G3BA 4X0WU 4YT7H 2HWLB 5JBTA 3MO3A 2GV6A 1G3EA 1AUTC 1O2OA 1MKWK 1CU1A 4SGBE 1AVWA 1O32A 1FY4A 1W7GH 1TBQH 5LPFA 3ATMA 3GY8A 5HM9A 5J4SA 2Z3EA 1NFWA 3RMMH 1UVTH 3F9FA 4I8HA 4AFZA 2ZCLP 5DJ7A 4Y11E 1O35A 1GJAB 4ZKSU 1ZPBA 1FJSA 5E2OA 1O2LA 1AZ8A 1UTKA 1O2MA 1ZTJA 4NSVA 3DFLA 4NA8A 1FXYA 5T3HA 1AGJA 4D76A 1WTHD 5TJXA 4CR9A 1O30A 2ZFTA 3A83A 1O2IA 5AVDA 3QWCH 1C2JA 3SJ8A 1A7SA 1NU9A 1PPBH 1QR3E 2BDGA 4FUDA 1IAUA 2AEIH 2W26A 2G00A 3DUXH 3KCGH 1BRCE 3E16B 2WINI 1O3FA 1PPCE 1TAWA 3Q3KA 1TX6A 4J2YB 5E0JA 2SNVA 2VIDA 2FDAA 1PQ5A 3T27A 4ABGA 4MVNA 3MOCA 4JYTA 1LHFH 4NWLA 5FPTA 2QA9E 1SGPE 4X2VA 1C5PA 3GCTG 1C5UA 2A4GA 1C2EA 1DLEA 3C27B 4O97A 4X8TH 2XCNA 1TNJA 3SUDA 3PLPA 2DUCA 5EW2H 2PUQH 1PJPA 1BBRK 2QXGA 1GJ8B 2CMYA 3CENA 2OC7A 3HGNA 3ELAH 3S69A 1ANDA 1NFUA 2OD3B 2R0KA 3I78A 1GMCG 3ZZ3A 4GHTA 3AW1A 1FNIA 4TWWA 4ABIA 4AGJA 4Y0ZE 1YPGH 4I31A 4MNYA 1BTWA 3NXPA 1SI5H 4TPYA 3H7OA 2H9EH 2Z7FE 2XC0A 1QQ4A 1S5SA 2XWAA 1S83A 4NCYA 2ANWA 1BTXA 2BVSH 2Z94A 1DUAA 1ZPCA 1KLIH 3MTYA 2FTMA 1SGNE 1NZQH 1AUJA 2AH4X 1O5DH 3GCHB 1BIOA 1X7AC 2QGRA 3QGJA 1E37B 2EEKA 4MNWA 3LDXH 3QUMP 1P04A 3SJIA 3V3MA 1MBQA 3FP8E 5DPAA 2TPIZ 4HI3A 1S6FA 1TGTA 2BD3A 2VVVA 2GZ8A 1DE7H 3P8OA 2V3OH 1WV7H 7KMEH 2ZGCA 2P59A 1P12E 3D49H 1O5AB 4Y79A 4AZ2B 1YYY1 2QAAA 4BAMB 3JZ2B 5H4IB 4CH2B 2G4TA 5CE1A 1S85A 1A4WH 1P8VC 3OYPA 2ZTXA 3PWBA 3SZNA 1GWAA 3A86A 1OYTH 2CF9H 1VJAU 1BQYA 3PB1E 3MHWU 1O2QA 4YLQH 1MBMA 5EQQA 2G5VA 1IQEA 4DT7B 1Z8GA 1V2VT 1ESBA 5HM2A 2ZF0H 3ZV8A 3TVJB 1O5CB 1O3PB 5E8EH 3ZV9A 1DT2A 2J38A 4TWYA 2QXHA 3BTGE 2HALA 2SGFE 1KXCA 1Y3XA 1CA8B 3LONA 2Y81A 1KXFA 1V2UT 2VIWA 1C2KA 1N6YA 4QT8C 1MTUA 2ZHWH 1LPKB 1XUIA 4FUIA 1YPKH 2FESH 4AG2A 4ZH8A 1GJ7B 1QRXA 3GY2A 2J92A 4CRGA 1BTPA 2UUFB 1XVOA 5L30H 4CREA 3FVFB 2EI6A 1TE0A 1QJ1B 1GVZA 3OY5U 2F9OA 2C3SA 1BTZA 1V2WT 1ZR0A 3TK5A 1PPGE 2ZDKA 3LGVA 2ODQA 3T25A 1KSNA 2EI7A 4ABFA 4O9VA 3HKIB 1PPEE 3RXUA 1KTSB 1P2JA 1O0DH 1HBTH 1FPCH 4JZFH 3ZVAA 1YP9A 4RN6A 1GHBG 2ZQ2A 1NY22 3P8NA 2K1QA 2ZFQH 5EPNA 3SHCH 2A7JA 1OPHB 1RXPA 4OS6A 5J4QA 3E91A 1O3OA 1G36A 4K1EA 3Q77A 1JRTA 5HXFA 1F5LA 3ESTA 1C1UH 3KIDU 5TCCA 1QB1A 3F1SB 2BOHB 3U69H 1P9SA 4BXSA 1CA0B 1UTLM 1JXPA 3M37A 1HAGE 5DO4H 1MMJN 1M9UA 2ODYB 3QLPH 1XUJA 2F83A 3TLOA 1O36A 1ID5H 2G5NA 4ABEA 3A80A 3FZDA 3TJVA 2FIRH 3TNSA 1OYQA 2ZZUH 3EGKH 1SLUB 1F0UA 1W3CA 1T4UH 1EQ9A 1HIAA 2VIQA 2FODA 2PHBA 1DITH 1ANEA 1GI5A 2A1DB 1A0HB 2Q6FA 3SU3A 1JOUB 1TX8A 3RXDA 2J94A 4DG4A 2WV4A 1V2JT 2W3IA 1TOMH 1BB0B 5FX5A 5JBAS 2BZAA 3BF6H 3TJNA 1XMNB 2ZDMA 6CHAB 3ZYDA 5E2PA 3GCOA 1LMWB 2EA3A 4JK6A 1C1QA 1C4V2 8GCHF 1YM0A 4NZLA 1WTGH 2Y5HA 4XDEA 1P3CA 4WMDA 2TIOA 3RXBA 4IGDA 1K1PA 1Y5AT 1GHZA 2XBXA 1DWEH 3BG8A 2F9NA 2GKVE 3B8JA 3KNXA 2F3CE 1A2CH 4Y8ZA 2VVCA 2RA3A 1GBAA 4LZ4B 3OSYA 1WU1A 3KGPA 1KYNA 2QF0A 2NU0E 1BMLA 3I77A 1MZAA 3UOUA 4ABJA 1TFXA 1FN6A 4OGYA 2VGCC 5A0AE 3OY6U 3UWJH 4BAOB 3WY8A 2CGAA 4TPIZ 2CHAC 4ZKNU 5TCAA 1LHGH 2BLVA 4Z6AH 1G3CA 2SGQE 1ETRH 6GCHF 1G37A 2A4OA 3KQBA 3ZZDA 2QC2A 2ZDAH 4WH6A 2G81E 1O5EH 3E1XB 5F03A 1W10U 3VXEH 1E38B 2A5AA 1GBFA 4FUFA 3KEEA 3ATIA 2XC5A 4I8LA 2RDLA 1O3EA 3W94A 3UNQA 4FU7A 5A2MH 4DW2U 1JBUH 1A0LA 3A7WA 6LPRA 5FAHA 4ISLA 1VCQA 4NIVA 1O2JA 2FEQH 3ATLA 5FCRA 3QN7A 3GOVB 1IQFA 1GBEA 1GI1A 4IN2A 2ZKSA 4BXWA 1DSTA 3DHKH 3MU8A 3S9AA 3UR6A 1O3BA 2BB4A 2FOHA 2PGQB 2GCHG 1C2LA 3E8LA 1Z8JB 5CHAC 1DSUA 1O3NA 4ZHMU 1HFDA 1V2PT 3ZVBA 3VGCC 2BZ6H 4X1RU 1EAIA 4AFSA 2PKAA 1MZDA 2TBSA 1NTPA 1W14U 1ZRKA 5GJ4B 2PV9B 1ELTA 4HZHA 2PTCE 2ZGJA 2BVRH 2AMQA 3ENSB 3PO1B 1C1NA 1EZSC 2O9QA 1YPMH 3TGKE 1CGHA 1N1LA 1QB9A 1ETTH 1D3TB 1GI4A 1KLTA 1THSH 2FS9A 3HKJB 1O38A 2ZPQA 3RDZA 3S7HB 1CVWH 3CS0A 1IQKA 3BTKE 1FIZA 3MYWA 1YLCA 1G2MA 2OBOA 4ESTE 1DM4B 2PSYA 3OU0A 1DPOA 3Q3YA 1UVUH 3UOPA 5F6MA 1O31A 1LKAA 3D23A 2WPJS 1QJ7B 4ZKOU 1PPHE 3U98H 3SJOA 1WQSA 1ZGIA 3ZVFA 3MMGA 3ZZ9A 3SU5A 1LPGB 2PGBB 4OS5A 1ESTA 2Q6DA 1THPB 3K65B 3RXIA 1V2KT 1LPZB 1LTOA 2KAIA 1V2OT 1GDNA 3A7XA 3AW0A 4MPUA 3O8DA 1G32B 1KXAA 4XBCA 3O8CA 1QRWA 1BDAA 2Q1JA 4H42U 1FAKH 3FP6E 2VWMA 2PUXB 1K1LA 3SU2A 2OQ5A 1B7XB 1L0ZA 3PMBB 3M36A 5C1XA 1QBOA 4YO9A 1CHOF 1EJMA 2QIQA 4UD9H 1TA2A 3PMJA 5EXLA 1Y3VA 1K1JA 3SNDA 3BIUH 1HLTH 1HXFH 2AFQB 1EP5A 4X2YA 1H4WA 4GUXA 2R0LA 3UIRA 1UTOA 1O3CA 2F9PA 1RFNA 1SGDE 3LIWA 4Y7BA 3UUZA 1TQ7B 4WMEA 5DK1A 1PFXC 1TIOA 1ZJKA 3L6PA 3M5NA 1S0RA 5GXPA 1YPJH 1NFYA 1C1WH 2WYJA 4XBBA 1FLEE 2UWOA 2HNTC 3F68H 5FXLA 5GDSH 4X2WA 1ELAA 2PFEA 4DCDA 5JPMH 2B7DH 2VWOA 5GCHG 2Z9LA 3IG6B 3L33A 1MTSA 1GG6C 1SGRE 4WY3A 4CRCA 1UJ1A 1J17T 3LGWA 1TNKA 2G55A 2XBVA 3A8BA 1FAXA 2CXVA 5JBBS 4Z0KA 1GMHG 1H8DH 1PQ7A 2G52A 5C67A 3RXGA 5C5OA 3MNSA 1ZTLA 1DWDH 1SGTA 2LPRA 1DICA 4MDSA 4I8JA 1Q31A 1SSXA 3GY4A 1H8IH 2ZGBH 4E06H 1K28D 1KIGH 1KXBA 1J9CH 1ZYOA 2I6QA 1ABIH 4ZROA 1GBTA 1ARCA 3P6ZB 4JYUH 1BMNH 1C5NH 1SGIB 5EW1H 2O8WA 3V7TA 1B0EA 1DXPA 4WMFA 1OWIA 2GT8A 4CBNA 2VH6A 1UTPA 3T62A 1SC8U 4MPWA 1C1OA 2NU2E 3NZIA 1HAOH 1BMAA 2FI3E 2CV3A 4K8YA 1YPHC 1GMDF 4CRDA 4YOGA 1JIRA 2BLOA 1K21H 4GCHG 3RXQA 1N8OC 1O3KA 3MH6A 3SU4A 1O2WA 1SHHB 1DX5M 1CGJE 3IITA 5AFYH 5EQSA 4DY7B 2BDBA 3RU4E 1H9LB 1V2LT 5BPEA 2D2DA 2STBE 3EAJA 1HRTH 4AB9A 2ALVA 1QBNA 5IYTA 3STIA 2ZC9H 3VB7A 2FYRA 7GCHF 1ZHPA 5DP6A 1XKBC 3A82A 4Q7XA 1TPSA 2XC4A 1C5ZB 3ZYEA 1N6XA 1MAYA 1D4PB 1MTWA 1SPJA 3W95A 1UTJA 2IOTA 1C1PA 4K1TA 1J16A 1TQ0B 1SGFA 1PQAA 2B8OH 1SGQE 3I29A 1W2KH 4BNRA 5DP8A 1TGBA 2FOFA 2ZU4A 2Z9JA 4UFFH 3P17H 2HPQH 1ACBE 3ZVEA 1E34B 1OKXA 1ZZZA 2C90B 1TWXB 3S9BA 3FZZA 4F4OC 3D62A 1WOFA 3TJUA 4H6TA 3VB3A 2GD4B 3VXFH 2XRCA 1EXFA 3RXTA 4NFFA 2Z9IA 3M61U 5GPIB 1TPOA 1EASA 1W13U 4I32A 2XWBI 1ANCA 3A7VA 4UFGH 1C5QA 1UTQA 3RXPA 1C5MD 3Q76A 3R0FA 1GBDA 1GJ9B 2AGGX 3SV2H 2FP7B 1NFXA 3BSQA 2FI5E 3VPKA 1TYNA 3MH4A 1CE5A 3E3TA 3P70B 3TH4H 1FIWA 1WQVH 1SOTA 1EPTB 3FAOA 3RXJA 3QDZB 3JZ1B 1MTNB 1NC6A 2YNAA 4ZHLU 1AIXH 1H9IE 1QQUA 1RTKA 4AFUA 3M5MA 4B76A 1T32A 4WF8A 4X2XA 4FU8A 3KL6A 3RXCA 4RSPA 3GDUA 3SN8A 2VWLA 4ZXYH 1XXFA 1YPLH 1OSSA 2C8XB 1V3XA 3EYDA 3TK6A 4H6SB 2ZG0H 3O8RA 3MI4A 1GMCF 4Q80A 8LPRA 2JETC 1OP0A 4NGAH 1MQ5A 1C5TA 4D7FA 1L1GA 2BQ7B 4XE4A 2H6MA 2YNBA 4Y0YE 1ELVA 1BRAA 1GHWH 5BRRE 4AG1A 8ESTE 1DLKB 1QL9A 1W8BH 1LDTT 3P8GA 3R3GB 1GBLA 3RXAA 1HAZB 4WVPE