4ZUHA

Complex structure of pedv 3clpro mutant (c144a) with a peptide substrate.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
298
structure length
298
Chain Sequence
AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVLRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVVNTDCFSILAAKTGVDVQRLLASIQSLHKNFGGKQILGYTSLTDEFTTGEVIRQMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/peptide
molecule keywords PEDV 3C-Like protease
publication title Structural basis for the dimerization and substrate recognition specificity of porcine epidemic diarrhea virus 3C-like protease.
pubmed doi rcsb
source organism Porcine epidemic diarrhea virus
total genus 84
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4zuhA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zuhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zuhA01
1PPFE 2C8XB 4YESB 1S0QA 2A7JA 1ELAA 2J95A 1RIWC 1W12U 4NFEA 4AYVB 3V13A 1SGRE 3K2UA 1D4PB 1NPMA 3BTDE 1CBWC 2XBWA 2WYJA 1T4UH 2ANYA 1YF4A 1LPZB 1C2HA 3LT3A 1TNKA 1E38B 3OY5U 1C2GA 3LC3A 1C5PA 1DWBH 4Q7XA 1OWKA 3KQBA 2Z94A 2GCTB 2VIPA 4WMFA 5EU8A 1PYTC 3F9HA 1UTMA 5FCRA 1HAVA 2VVVA 1FY8E 1DX5M 2XCNA 1KIGH 1DICA 2GX4A 1C5SA 3V12A 2ALPA 1AKSB 2BHGA 4MG3A 7LPRA 3E0NB 1Q3XA 1G37A 2UUJB 2HRVA 4FU9A 2Z9GA 2FI3E 1TWXB 2FEQH 1YPKH 1B5GH 1O2RA 5DP3A 1BTXA 5FX6A 2FTLE 2HNTC 4DY7B 1BRCE 1TPAE 1AVWA 3RLWH 4KTUA 1G3CA 4ZMAH 2NWNA 2AFQB 3UREA 1TNJA 4Y6DA 2DE9A 3UWIA 2FOFA 3MWIU 1RRKA 5B6OA 2J9NA 1BMNH 4A6LA 5TCCA 1WTHD 2HGTH 2QF0A 1XXFA 2UUKB 2WPKS 1O5AB 1NC6A 1T7CA 1GDUA 1ZRBA 2I6SA 2J2UA 3ATLA 1GMDF 1BMLA 1FAXA 3C27B 4IMZA 1O30A 3QN7A 3EAJA 3RXCA 4X2VA 1GBJA 2PSYA 1NFXA 2QA9E 4CH2B 3GY4A 3L33A 4E06H 3ZV8A 1GHYH 1ORFA 2CV3A 4DGJA 1OWIA 1XM1A 2ZGJA 1UCYE 2Z6BD 1XVOA 4E05H 2ZDKA 1O2NA 4CH8B 2O9QA 1C5ZB 2QXHA 5DPAA 4JMYA 4GCHF 1HB0B 2TGAA 1UMAH 1EP6A 3HK3B 5GCHG 3HGNA 2ANKH 2ZKSA 2G52A 3SJ9A 3AAUA 3A7TA 1OP8A 1J16A 1OS8A 1V2PT 2A31A 3SJ8A 1THPB 1J8AA 3RM2H 1G2LA 2C93B 2ZCHP 4NZQA 1S5SA 3RM0H 3L6PA 3KEEA 3S9AA 3TJOA 1DFPA 1TPOA 1IQJA 2HLCA 2ZPSA 1QB9A 3PYHA 3K6YA 1L2EA 2PGBB 2A7HA 3G01A 3A7YA 1UK4A 1GCDA 4GCHG 1TPSA 1W0ZU 2ZGCA 2A5AA 2OINA 1Z6JH 1GVLA 2R0KA 5LPFA 2JKHA 3SJOA 1P2QA 3ZZCA 1NFUA 4ISOA 3EA8A 1TX7A 3FP7E 2V35A 1A4WH 1QBOA 2VH0A 3FAOA 4B73A 1FIWA 1TOMH 1XUIA 5G4BA 3TK5A 2VWLA 1HIAA 4X1NU 5T6DA 1ZJDA 1DLEA 3BEIB 5DP5A 5AFYH 2IOTA 1LKBA 3SNCA 4NIYA 4AB8A 1ZZZA 1BTUA 1NU9A 1QRWA 3Q77A 1DY8A 3TVJB 4SGBE 4DW2U 1IOEA 3RC5A 2XXLA 4Y7AA 5EXMA 1WBGB 3A7XA 4FUDA 1NTPA 1O37A 6CHAB 4XBDA 3H7TA 3QTOH 1V2NT 4OS2A 3UNQA 4NIVA 3MNBA 3M37A 1JXPA 1TALA 3SW2B 1QA0A 3EA7A 3TK9A 3M3VA 1O35A 2XBYA 1JBUH 3GCOA 3I77A 1P2JA 3SN8A 4ZXYH 3F9GA 1DLKB 1AN1E 1EPTC 1NS3A 3B9FH 3ATWA 1QJ6B 2QYIA 2ZHWH 3WY8A 2F9NA 2BOHB 4BAQB 4K8YA 2I6QA 2PLXA 1IAUA 2WPLS 1MCVA 1T8NA 1PPEE 4D7GA 4YLUA 3E90B 1YM0A 4K3JA 5EXNA 1QRXA 2RDLA 3V0XA 4BTTB 5C1YA 1SLUB 1BIOA 2OTVA 1LHCH 1LTOA 2AH4X 2A4RA 4JCNA 4O97A 2D1JA 1RXPA 2XWBI 1ANDA 8KME2 4FXGH 3MNXA 1ZGIA 3LH1A 4ZHLU 1HJAB 3SO3A 2GZ7A 5A8YA 2KAIA 2BY7X 5A8XA 3PWCA 3BTFE 3KF2A 1G3EA 4ISLA 1WQVH 4JZEH 2FS8A 1P11E 3HKIB 1Y5AT 1S0RA 4I8KA 1QL9A 1BCUH 1TMUH 1GI2A 3M7TA 1K9OE 4D9RA 2GZ8A 2ZNKH 3RXGA 1GL0E 1DVAH 1SB1H 1J14A 2ZU5A 4JK6A 2F83A 1FPHH 1TPPA 1S6FA 2Y7XA 2GT8A 4DG4A 1FAKH 1MU6B 1YPJH 3PV4A 3LKWA 1DOJA 1GPZA 1WTGH 1S84A 2ZHEH 1NRRH 1SGQE 5HMAA 3RMMH 2IJOB 4AYYB 2PW8H 1KXDA 1WUNH 1SLXB 4KTCA 3KQEA 1CVWH 2GT7A 2FIRH 4Y0YE 3RC6A 1EJAA 1LHGH 1TAWA 2ZHFH 3SOSA 1TABE 2H5CA 2AIQA 1T8LA 2ZO3H 1GBEA 5ABWA 1AHTH 1KDQA 4Y8XA 4X1PU 1PPGE 2Z9IA 5C1XA 1VGCC 1BHXF 4JYUH 3E16B 1PPZA 2J34A 3K6ZA 4E7NA 2TGDA 1L1NA 2VGCC 4DCDA 2WYGA 2G4UA 1N8OC 4Q7ZA 1BTYA 5PTPA 2SGFE 1FXYA 1ELFA 1VZQH 2IPHA 3DHKH 3ATIA 5EGMA 2H5DA 3NK8A 2ZHQH 1LPKB 2YNAA 2UUYA 1HJAC 1Z8GA 2BQWB 4HFPB 1C5WB 2AEIH 2OC7A 1OX1A 3SGAE 1QRZA 4YT6H 3EBNA 3E91A 3M36A 3SGQE 1TQ7B 1VITF 3BTWE 3KQCA 3ZVFA 5ESTE 1F92A 2DUCA 2C8ZB 2GGVB 1QTFA 1L1GA 3SHCH 1FY1A 3NXPA 3SU4A 3TH3H 5JBAS 1HAZB 4F4OC 1BJUA 1F0TA 2BD9A 1JMOH 2PKSC 2ZU4A 2TIOA 1BRAA 2H6MA 4NWLA 1K22H 1NRPH 1AO5A 2FZZA 5FPYA 1GI5A 2Z3DA 5BPEA 1G3BA 1CO7E 1TMTH 1E36B 1GMCG 2ZECA 1T4VH 3RXRA 3F68H 4MNXA 1C2FA 1RTFB 1G30B 2XBXA 1ZSJA 2PUXB 2ZPQA 1LMWB 1HAOH 5K7RA 4AFQA 3NZIA 1Y3XA 4A92A 1LVYA 1PQ5A 1GJ5H 2K7XA 2A2QH 2RCEA 2WPMS 4NZLA 2BDAA 4E7RG 1A5GH 2B7DH 1IQGA 1TGBA 2A2XH 3K9XB 4MTBA 2VNTA 1TQ0B 1P12E 1GDQA 1QQUA 1F5LA 2XWAA 2Y5FA 4I8LA 1UHBB 2XNIA 1F0SA 1ELEE 4FUJA 5E2OA 1Z8JB 4Q7YA 3MU0A 1VCQA 3QWCH 2BLOA 4WWYA 1EOJA 1BB0B 1BQYA 1FN6A 4X1RU 1YYY1 4Y10E 5CE1A 3MTYA 3ODDA 7ESTE 1UVTH 3PTNA 1Y59T 1GJ8B 1GI6A 5DKMA 5FBEA 4MNVA 5C67A 3UQOA 4BAHB 4JZDH 1MMJN 1OSSA 2QXJA 1EOLA 1O3HA 5C5OA 5DG6A 1TMBH 3VFEA 2C3SA 1Z1IA 2O8LA 4FU7A 1DWEH 1VJ9U 1C1RA 1QA7A 1O2HA 1O2GH 1Y5UT 1TGNA 1RD3B 3I78A 1OPHB 1MU8B 2BDGA 4FU8A 2G00A 2NU2E 2AERH 2W3IA 1NM6A 1QBNA 2BXUH 2V0BA 5SGAE 4YOJA 2R2MB 2W3KA 4B71A 2ZIQH 2OLGA 3TIUA 4DT7B 2GVFA 4K1SA 1DPOA 1H9LB 1UVUH 4MPWA 4CR9A 4OS6A 4KGAA 3RXBA 1LCYA 3RMLH 2UWLA 2Y5GA 3SU5A 1QBVH 1O3JA 1NROH 2EC9H 3S0NA 4ABIA 1DY9A 1DM4B 1ZHPA 2FPZA 1ZMLA 1GG6B 4I8GA 1PPHE 1TNHA 2WUCA 3MH7A 4JZ1A 1K1JA 4CRCA 1IQIA 1VITH 1H4WA 3ZVCA 5LPEA 3U8TH 1PQAA 2BDBA 4GUXA 1C4U2 2Y82A 4I32A 4X1QU 5HGGA 3MMGA 2FESH 5A0CA 1AU8A 2OP9A 1SGEE 3QTVH 4B2CA 1KLIH 1YLCA 3SJIA 1C5LH 2HWLB 3TJVA 4BAOB 1DANH 1O3FA 3A7VA 2VB0A 1EUFA 2YNBA 2PTCE 2QV1A 4DVAU 2ZP0H 4BTIB 1C5QA 3QGNB 5LPRA 1OOKB 1AFQB 4LOYH 1C5YB 3W95A 4MLFB 4X8SH 3EA9A 3BV9B 2AMDA 1ANBA 2H2ZA 4XDEA 1D6WA 2GCHF 5BRRE 4LXBH 2B9LA 3EQ0H 1O3LA 2O8MA 3PO1C 1EKBB 1ZOMA 1XXDA 1TX8A 4LZ4B 1TONA 2PR3A 2A4GA 4Y0ZE 3URCA 2PWXA 3VB3A 2SGPE 4RKOB 4BAMB 3ZYDA 1SI5H 5EQSA 4Z0KA 2A7CA 4AGJA 3O8RA 2ASUB 5F8TA 1L4DA 3U8RH 1KXFA 5DGJA 1O2UA 2FO9A 3ZZ7A 2Z9LA 1RTKA 4KP0A 1QJ7B 2BDIA 1TBQH 1KXBA 1MTUA 2VINA 4B2BA 1O33A 3BN9A 3GYMA 4YLQH 1SC8U 2CHAC 4U2WA 1WOFA 1HAVB 5JYIA 1GG6C 1TYNA 2ZCKP 2CF8H 3SJKA 4CHAB 3AW0A 1CA8B 4NFFA 2ZC9H 3ZVEA 4TPYA 1UK2A 3JZ2B 4XE4A 1AZZA 4ZKRU 1MKWK 3NPSA 1CSOE 1SQTA 1J17T 4B74A 4YOIA 3CP7A 1V2ST 2EI8A 4ABBA 3KHVA 1DSUA 3FANA 1XUHA 2F91A 4IC5A 5E0HA 1BBRE 3MH5A 1KXAA 3QUMP 1EJNA 4CR5A 3E0PB 4XBBA 1O0DH 4WXIA 1O39A 1DDJA 1GVKB 1O5DH 1B0EA 3M5MA 1H1BA 4XSKU 3ENSB 1EP5A 1IHTH 2G55A 2ZDNA 2UWPA 3ZVGA 1K1OA 6ESTA 2BQ6B 4XFQA 1B7XB 2ZFSA 1TRYA 1V2QT 2VU8E 1HXFH 1NRSH 1GI4A 5J4SA 1WQSA 5A09A 1JRSA 3UY9A 3SU1A 1YGCH 5TJXA 4RKJB 1P09A 1O2MA 2A5IA 1TBZH 1GBKA 2Q6DA 2FX6A 5DP9A 4CRFA 1MD7A 2G81E 3BIVH 3LGVA 3RXTA 3A81A 3DD2H 3U1JB 4ABDA 1V6DA 3MU1A 1H9HE 3V3MA 3LIWA 1NZQH 4ABAA 3GDSA 2ZDLA 3T28A 3UUZA 1BOQA 2BM2A 7KMEH 1FQ3A 1UTLM 4INKA 2V3HH 1B0FA 5JBTA 3RXVA 1Q31A 1K1NA 4IGDA 4INHA 3A7WA 2A1DB 3PM3A 1LDTT 1FY4A 1P01A 2BOKA 1GJAB 3A8BA 1PPCE 1GGDB 2FOGA 3SU6A 1GBIA 1T31A 4GVUA 2AGGX 2QAAA 1AI8H 2VIDA 2BD8A 1BA8B 5E0JA 2Q6FA 1GJDB 3A82A 3Q00A 1YLDA 3PTBA 3T2NA 1JRTA 3SQEE 1O36A 3RP2A 3T25A 1C5XB 1HAIH 2OC0A 1Q2WA 3W94A 1BRUP 1GMDG 3GCHB 2GCTC 1HIAB 3TNSA 3PWBA 2FODA 4HGCA 4ZKNU 1MTNB 1C1VH 2XC5A 3SBKA 1GBDA 5H4IB 2ZZUH 2LIZA 1HPGA 1G2MA 4K5ZA 2VWMA 4UEHH 2DE8A 3QLPH 8GCHF 1MZDA 1C1NA 3SU3A 2XW9A 1MKWH 5DP8A 2LNCA 4YTAA 1EZQA 1GHZA 3S69A 5F6MA 2UWOA 1A5HA 3STIA 1EX3A 3KCGH 3PB1E 3A86A 2CGAA 2RG3A 4UD9H 1P9SA 1A0LA 2R0LA 1ZYOA 3R3GB 1AQ7A 1C9PA 3LGTA 2C8YB 1CHOF 4AZ2B 2Z3CA 3U8OH 5A2MH 1H9IE 1Y3YA 2A4OA 1UCYK 3MNCA 1GMHF 3TGKE 1PPBH 3VGCB 1FJSA 3GDVA 5DK1A 1ELCA 2BDCA 2O8TA 1D3PB 3M3SA 3RXEA 1HYLA 1V2TT 1HUTH 1KLJH 2F9PA 1BTHH 3MH4A 1EPTA 3UIRA 1SOTA 2BXTH 3BIUH 2M5TA 4D7FA 1S85A 1WSSH 1YC0A 2XC0A 3M7UA 1A0HB 1TNGA 3M35A 4FUGA 4RSPA 3U1IB 2SGAA 1A3BH 4BXWA 3PMAB 3EGKH 2JH5D 2STBE 2PHBA 2P59A 1BT7A 1FIZA 1SLWB 1GMHG 1TNLA 1F5KU 2KAIB 1C1UH 2SNVA 3GICB 2G51A 1UJ1A 4X0WU 4O9VA 3RC4A 1C1MA 1IQLA 3NCLA 3P95A 1BUIA 1GBBA 3VB4A 1ZTJA 2GMTB 3MO3A 1TRMA 5EQRA 3Q3KA 1W11U 3BEFB 1ESTA 1UTKA 7GCHF 1P2NA 2SNWA 1V2LT 1FDPA 3SUFA 3VXFH 1EAUA 4ZHMU 4WXVA 1W10U 1P3CA 1YCPM 5EPYA 3VPKA 4BANB 2R9PA 1O2QA 5EG4A 3MOCA 1CT4E 1C1WH 4H6TA 2FI4E 3ZVAA 2GDEH 2Y80A 3RXLA 1FLEE 2F9VA 1FI8A 4NSYA 1D3TB 1OKXA 2PFEA 1AE8H 4YO9A 2FYRA 2FMJA 2BYAX 2HPPH 4K8BA 3LONA 6GCHF 2ZI2H 1DUEA 1DXPA 1ZLRA 2BTCE 1GHAF 3SHAH 2PKAA 2NU3E 3HK6B 3CS7A 1SHYA 1D6RA 2OQUA 5L6NH 2QXIA 2ZU1A 2C4FH 2SGDE 3KQDA 1P2KA 1V2KT 5FHTA 4I33A 4RN6A 3VGCC 7GCHG 1YBWA 1C2LA 1KDQB 4CRAA 2AGIX 5J4QA 4X8VH 1LVMA 2D2DA 2OC1A 1AFEH 4ZKSU 1KTTB 4AOQA 2QF3A 2OCVB 2ILNA 1ARCA 3SU0A 1L0ZA 6CHAC 4I31A 6GCHG 2WV4A 2BLQA 3GY7A 1GHAG 1ABJH 3RXAA 4Q2KA 5EXLA 3A7ZA 1OWDA 4IMQA 1THSH 1C2MA 4FVBA 4JYTA 1O3AA 4DJZB 2ESTE 1UCYH 4X8UH 5AF9H 2ZU2A 4MVNA 1MBMA 4OS7A 3EDXB 4MQAA 4HTCH 1ETTH 1HAYB 3BF6H 4CRBA 4Y11E 5A8ZA 1RGQA 3BSQA 1KY9A 2NU1E 1MTWA 2YOLA 1AWHB 2VIWA 1N1LA 1ZPCA 3PMBB 3RUOA 1O2IA 4TPIZ 1X7AC 1GCTB 1QURH 4IW4E 5EW2H 2QXGA 1M9UA 1SHHB 1QY6A 4VGCB 3TGJE 3AVZA 2ODQA 1C4V2 5ETXA 4WMEA 4ZUHA 5C20A 5LGOA 1O2KA 4NGAH 2P3UB 4B2AA 4GHTA 2Y5HA 4ABHA 3E8LA 2BLWA 4F49A 3MU8A 1UK3A 1CGIE 5GWZA 5C5NA 2VVCA 2EEKA 1LHFH 1ZMJA 4B76A 3DUXH 4M7GA 1O3CA 1ZRKA 5E8EH 1HXEH 1H8IH 1KTSB 3RXHA 3T62A 1G36A 1EAIA 3MHWU 4OS5A 1SOZA 1TA6A 4D8NA 1TB6H 3KN2A 1UTQA 5JPMH 1HAPH 1KXCA 1N6YA 1J9CH 1BMMH 1QIXB 2QN5T 1OWEA 2GKVE 2Z7FE 5I25A 2RA0A 1WU1A 1E37B 2BD5A 5HM2A 3M5LA 4GSOA 3GDUA 3D62A 3FZDA 8LPRA 4A1XA 2GV6A 1FONA 5L30H 1EZXC 1L4ZA 2WUBA 2BMGB 1VITG 4ESTE 1LQDB 5CHAB 1V3XA 1Y3UA 3S7KB 5EQQA 4K69A 1LKAA 3NKKA 3LH3A 1C5OH 2EI6A 2AMPA 1DWDH 3SZNA 1AB9B 1V2RT 1CA0B 3MU5A 4ZH8A 1THRH 4Y8ZA 3ZVDA 3BTGE 1NFYA 1A5IA 5JBCS 3FVFB 2FXRA 3M5OA 2CF9H 4NA9H 4IS5A 3MNSA 4ISNA 2ZDAH 3ESTA 3P6ZB 3E3TA 3GCTF 1CU1A 3GISB 1GBLA 3RXJA 3STJA 1LHDH 2ZFQH 2Y6TA 4X6PA 1O38A 5CMXH 4ABEA 1YPHC 3RU4T 1ZTKA 2QGRA 1ACBE 2A45B 1HGTH 4AFZA 2J38A 1V2UT 1FN8A 1O2XA 2ZTZA 1AZ8A 1O2TA 5FX5A 1LVBA 1O3OA 1PJPA 5GIBA 3ZZ9A 2CMYA 1FV9A 1LO6A 2JH0D 3D49H 3GCTG 5DO4H 2Z9KA 1GHBF 1GBAA 1TGTA 1P2OA 1YPLH 3NWUA 3OYPA 5LH8A 1UO6A 1SGCA 2BX3A 1G9IE 3GY5A 4A7IB 2FTMA 5FXLA 2BVXH 1YP9A 5FAHA 3GOVB 1VR1H 3SGBE 3TK6A 1P03A 2XC4A 1Z7KA 1SGFG 3FP8E 2HPQH 1Y3VA 5DJ7A 1C5TA 1XVMA 1YPMH 4X6NA 5FPSA 1EJMA 2VJ1A 1RS0A 2ZDMA 2OC8A 3MYWA 9LPRA 3RXMA 2HNTE 1GHBG 3RXFA 4BAKB 2BY9X 1GI0A 3RU4D 1P2IA 1S81A 1HLTH 1PQ8A 3S7HB 4AN7A 1P8VC 1SQOA 2P93A 1YPGH 2ZEBA 2VH6A 2F3CE 4NG9H 4AGKA 2ZDVH 3UOUA 1GL1A 2FOEA 4ZKOU 1NESE 1J15A 2XTTB 2NU4E 2F9BH 1DXWA 5FCKA 1UTJA 1EAXA 2BX4A 2WINI 1RIWB 1SLVB 2OUAA 1P57B 2EA3A 3A8DA 4K2YA 4TY6A 4X8TH 3P8GA 1O2YA 2P95A 1O3PB 2ZGHA 1Z6EA 3P70B 5EOKA 2BD2A 1CBWB 4UE7H 4ZAEA 2TBSA 3LJOA 4Y8YA 1LPGB 2PUQH 3VB5A 4D76A 2GD4B 3BEUA 1BDAA 5JB9S 1C2IA 2ZU3A 5F8XA 1ZSKA 4WMDA 1YPEH 3MO9A 1IQKA 1LVOA 1MZAA 3OU0A 3ZZAA 4UONA 1EAWA 1VCWA 1HAHH 1AD8H 2P3TB 3GYLB 2ZFTA 4ZROA 3SV7A 1SGTA 2ODPA 2G8TA 2HALA 1CT2E 3D23A 1O2LA 4UDWH 3ZZDA 1BRBE 5AFZH 1T32A 2GCHG 4LZ1H 4UFFH 1CE5A 4I7YH 4BNRA 2QC2A 3RXPA 2Z3EA 3QZQA 2VVUA 4MPUA 3LGUA 1CQQA 1XMNB 1ZTLA 3TJNA 1F2SE 1MH0A 1QL8A 4J2YB 8ESTE 5GXPA 1A7SA 3IG6B 1OP2A 1AVXA 1O31A 1QJ1B 1HAXB 4UFDH 4FUEA 4NCYA 3S9CA 1EZSC 1ESAA 1O5GH 5E2PA 3LOXA 4YZUA 1UTNA 2FOBA 1ELDE 2P8OB 3O8DA 3LGIA 1SGPE 3DT0H 4ASHA 1Z8IB 1T8MA 1XUFA 5F03A 3ZYEA 3TPIZ 1NRNH 5I46H 4PROA 2K1QA 1VJAU 4K1EA 1A46H 2ZTXA 5K0HA 4X2YA 4JZIA 1E0FD 2ZGXH 4Y79A 1IQEA 3IWMA 1Y5BT 1O3MA 3ZZ5A 2W26A 1Z8RA 1AFQC 1QB6A 1C5MD 1SGIB 2R3YA 1UVSH 1BMAA 3GY3A 1F7ZA 3NUMA 3UTUH 1SBWA 4JYVH 1W14U 1LHEH 3D65E 1EATA 1OYTH 2FWWA 4FUHA 2ZPRA 1MAXA 4I8JA 4IN2A 1O3BA 3SNDA 1KLTA 1C1QA 3TGIE 1K28D 4KELA 1O3NA 1NY22 1UVPA 1GI9B 1O3DA 4K1TA 3RXQA 5IYTA 3RXDA 1ZPBA 3JZ1B 1CHGA 3B8JA 2FDAA 3RXIA 2QCYA 1QNJA 1S83A 1EB2A 3SUDA 2Y81A 1DE7H 3GY6A 1QHRB 1GJBB 1Z1JA 2FOMB 3SU2A 3MI4A 3A8AA 4FUFA 3SV6A 1BJVA 3A89A 1ZSLA 3QK1A 1XX9A 4Y76A 1BITA 1AVGH 4NIWA 1ETRH 1K21H 3T26A 3SQHE 2ZA5A 1BBRK 2OQ5A 3P17H 5HM9A 1FUJA 2V3OH 4ZXXH 1O5BB 1QFKH 5T6FA 4BTUB 3SV2H 3C1KA 4CHAC 3FZZA 1O5EH 5DP4A 3A83A 4THNH 4B1TA 3TH2H 2XBVA 1P02A 5GCHF 4NIXA 1TGSZ 1SFIA 3Q76A 4MPVA 3IITA 3UOPA 2P8OC 1EASA 4WJG2 4OGYA 3UR6A 4A1VA 2BD4A 1AKSA 1ESBA 2FP7B 3M61U 2ANWA 3F9EA 1G3DA 3GCNA 5JBBS 1P9UA 3T27A 3E6PH 2A32A 2XCFA 2BQ7B 1O32A 3ZZ6A 3RXOA 3A85A 1K1PA 3M5NA 3TH4H 3QX5H 1RTLA 2OBOA 3LPRA 4I8HA 4YOGA 1DWCH 4AFSA 2BD3A 2BY8X 2BLVA 2W7SA 1MQ5A 1MUEB 2ZQ1A 3RXSA 1ABIH 1EPTB 1DT2A 3EE0B 2Q1JA 2VIOA 1K1IA 2CXVA 1XUGA 2B8OH 2PSXA 2XYAA 1JIRA 3ATKA 3UNSA 1PYTD 1Y3WA 1RFNA 1ANEA 1BTPA 1O2ZA 2G5NA 1F0UA 1JOUB 4UFEH 1W7XH 3M7QA 4ABJA 1U6QA 4FUBA 1IHSH 1JWTA 4NSVA 3P8OA 2A4QA 1TLDA 4AX9H 1SFQB 3SV8A 2ZQ2A 2FOAA 9ESTA 2OD3B 4YT7H 4TWYA 1BTWA 1ELVA 8GCHG 1C5NH 1KSNA 3F9FA 4IN1A 3PROA 5HXFA 4CREA 1HV7A 4YM9A 2VWOA 3UPEA 2R3UA 1AUJA 2R2WU 1GVZA 3SI3H 1P10A 1GI3A 3PLBA 1AGJA 5C2ZA 3BG4B 4A5TS 2SFAA 1CHOG 1C1SA 1GGDC 3U69H 1C1TA 3LGWA 3AASA 4OS4A 1IQFA 2TGTA 3VB6A 1W7GH 1XUJA 4GPGA 3KL6A 1MBQA 1GJCB 2WPJS 2PKAB 3RXKA 1QR3E 1EXFA 3AAVA 5AHGH 2H1UA 4X1SU 2WPHS 3GCHC 4U30A 3HKJB 1PQ7A 2D8WA 1BBRH 1CT0E 2F9OA 1HNEE 1QQ4A 5C1UA 2OXSA 4U32A 1SVPA 2AYWA 2J94A 2ZFPH 1A0JA 1ZPZA 4BXSA 4GHQA 1GBFA 1MTNC 1ZMNA 1GJ4H 3RU4E 3ODFA 1ANCA 2ODYB 4O3TA 2BVSH 2OBQA 1ETSH 3A80A 5HYOA 3Q3XA 1VGCB 4Q80A 4ABFA 4OGXA 2Z9JA 1SG8B 1P2MA 3DFLA 3TU7H 4ABGA 2EI7A 1O3GA 4AG2A 4TYDA 1FPCH 2VGCB 4ISHH 3OX7U 1EZUC 1DITH 1N8OB 1DUAA 2C8WB 1HBTH 4J1YA 2A0QB 3LJJA 1KYNA 1RJXB 5FBIA 2P3FH 1O2JA 4H4FA 4X6MA 1FY3A 1O5CB 4JZFH 4O03A 5C3NA 3VEQB 2BDHA 1P04A 3MFJA 1QGFA 3KNXA 5AVDA 1DS2E 2VIVA 1W0YH 1KXEA 1NU7B 2AGEX 1YPHE 6LPRA 1GBTA 1W8BH 3DFJA 4MNWA 1HDTH 1FMGA 1OWHA 4R8TB 4A1TA 1D9IA 3I29A 1F5RA 3O8BA 1QL7A 1TX6A 1CGJE 2BY6X 1NO9H 1GHWH 5A0AE 4WF8A 5EW1H 1BZXE 1V2JT 2HVXA 5ESBA 1ZR0A 3BG4C 2VWNA 1SL3A 2PKSB 5JB8S 1WV7H 4H6SB 4X2XA 3RXUA 5JDUB 4LK4A 3SNEA 1SQAA 3OY6U 4WY3A 3P8FA 3KGPA 1L1JA 1IQHA 2TGPZ 1WAYB 1HJ8A 1ZJKA 1IQNA 1T8OA 2W5EA 2ZFRH 1JIMA 1V2OT 1FZZA 1O5FH 2NU0E 1K2I1 2ZCLP 1O2OA 1SR5C 5E0GA 3A8CA 1GHXH 1SGDE 3P8NA 4HZHA 3CS0A 2BZ6H 3BTQE 4R0IA 3LC5A 5T6GA 4K60A 3HATH 5FPTA 1AMHA 3UR9A 4AG1A 1S6HA 2GMTC 1FY5A 2ZG0H 1YCPK 1ZHMA 3ZZ4A 1HJ9A 4FUIA 3N7OA 1C2KA 2ULLA 1AWFH 3RMNH 2Y7ZA 2Q6GA 2A5KA 1TNIA 2P16A 3MU4A 3UNRA 2JETB 1HAGE 3OSYA 3UFAA 2BB4A 1TIOA 4GAWA 2B0FA 1NT1A 2TPIZ 3K65B 1K1LA 2CN0H 1BHXB 1F0RA 2W7UA 1MTSA 3A87A 3UQVA 1P3EA 1SSXA 2PGQB 1W2KH 2ZWLH 3ZVBA 2HOBA 1GMCF 1A2CH 1SMFE 2BZAA 1OYQA 5GDSH 2FLBH 4NA8A 3TJUA 4ZHAA 2FYQA 1OP0A 3T29A 2JH6D 4FVDA 1MTVA 3ZZBA 4D9QA 4O3UA 1PFXC 4AORA 1Z71A 2FI5E 4DOQA 2PV9B 3Q3YA 1GJ9B 1O34A 4ISIH 1GBHA 3OTJE 5A0BA 1TGCA 2G4TA 3RLYH 3F1SB 1INCA 1O2VA 1FNIA 1XKBC 4XOJA 3MO6A 1NRQH 3H7OA 3PMHB 4TY7A 2ZTYA 5GJ4B 1S82A 4SGAE 4UFGH 1P05A 3RMOH 1BTZA 1V2MT 4Y7BA 1O2SA 1TE0A 4TWWA 1N6XA 3GY8A 3MH6A 3ZZ3A 4DIHH 3ZV9A 3SORA 4MPXA 1D3DB 2CJIA 4QT8C 3O8CA 3PLPA 1HFDA 3LDXH 2ZGBH 5F8ZA 2H9TH 2P94A 3BTME 2J4IA 1MKXK 1AE5A 1C5UA 1C1PA 1WYKA 3TLOA 1ELTA 1ZHRA 2GDDA 4KKDA 4JK5A 1QCPA 1P0SH 4KTSA 4MNYA 4GLYA 1O2PA 1GCTC 3CENA 3TNTA 4BOHA 4VGCC 1A3EH 1P06A 4X2WA 4Y71A 1C5RA 3F6UH 3SI4H 1GBCA 1GJ6A 2GV7A 2JETC 3ITIA 4FUCA 4WH6A 2ZHDA 1V2WT 3P92A 4CRDA 3AW1A 1GI8B 4HI3A 1AY6H 5TCAA 1C2DA 3A84A 3PO1B 3M3TA 1TBRH 2BY5X 2SGEE 3R0FA 2ANMH 2GZ9A 1MAYA 3BTEE 4Z6AH 1C5VA 3DA9B 2XRCA 5L2ZH 1O3EA 1YCPH 4XBCA 2J92A 3HPTB 1UHBA 2AS9A 2C90B 4WH8A 1NFWA 1GI1A 1A1RA 1EB1H 2FM2A 1TRNA 2BDYA 1XUKA 3QGJA 4H42U 5DP7A 3SUGA 4DURA 1ELBA 1GWAA 1C9TA 1TA2A 2RA3A 2GTBA 2ZFFH 1MQ6A 3ELAH 3U9AH 2FS9A 3GY2A 3HGPA 4B75A 3BTTE 2D26C 5CHAC 1E34B 1VCPA 1TFXA 1UVOA 1MD8A 3V7TA 1GJ7B 4NA7A 2IN2A 1GI7B 1SGNE 2UUFB 1AB9C 1CA0C 3E1XB 2THFB 1UTPA 2CHAB 2WPIS 1TOCB 1QB1A 2V6NA 2QIQA 4INLA 1OXGA 3URDA 1AIXH 3EYDA 4CBOA 3RDZA 1CGHA 1D3QB 1ARBA 2BD7A 1NN6A 1OWJA 1WCZA 3TITA 1ID5H 2FOHA 1W13U 1SGFA 3ZZ8A 3A88A 1AUTC 1ELGA 2FOCA 2VIQA 1Y8TA 1A61H 3FP6E 4CBNA 3PLKA 4AB9A 1HRTH 3H5CB 3T5FH 1K1MA 3LU9B 2GP9B 1GHVH 1H8DH 2ZF0H 3B23B 2WV5A 4MDSA 2AIPA 1DSTA 1YKTA 2QY0B 4DIIH 1O3KA 5EODA 4AFUA 1GDNA 1LQEA 2O8UA 3SNBA 1O2WA 3LGYA 4OS1A 1SPJA 2F9UA 1XKAC 2LPRA 2G5VA 3U98H 3BG8A 2HNTF 2O8WA 3ATMA 1MKXH 2ALVA 1C4Y2 2BVRH 3QDZB 3BTHE 2AMQA 1C2EA 3PMJA 3SV9A 3FFGA 3SNAA 1ZGVA 4IBLH 2FLRH 3SUEA 2H9EH 4IC6A 3UWJH 3VXEH 3QO6A 1HCGA 3QZRA 2SGQE 1W3CA 1C1OA 2FX4A 4CRGA 5T3HA 2H9HA 5EPNA 2STAE 5IDKA 1G32B 3S9BA 3VB7A 1E35B 1UTOA 2TRMA 2PTNA 2B5TB 3BTKE 4X6OA 5DP6A 1MCTA 3KIDU 4WVPE 1O3IA 1C2JA 4NWKA 5GPIB 5L2YH 1SGYE 4U01A 1IQMA 1GBMA 3L3TA 1EQ9A 1V2VT
chains in the Genus database with same CATH superfamily
1PPFE 2C8XB 4YESB 1S0QA 2A7JA 1ELAA 2J95A 1RIWC 1W12U 4NFEA 4AYVB 2JJ2D 3V13A 1SGRE 3K2UA 1D4PB 1NPMA 3BTDE 1CBWC 2XBWA 2WYJA 1T4UH 2ANYA 1YF4A 1LPZB 1C2HA 3LT3A 1TNKA 1E38B 3OY5U 1C2GA 3LC3A 1C5PA 1DWBH 4Q7XA 1OWKA 3KQBA 2Z94A 2GCTB 2VIPA 4WMFA 5EU8A 1PYTC 3F9HA 1UTMA 5FCRA 1HAVA 2VVVA 1FY8E 1DX5M 2XCNA 1KIGH 1DICA 2GX4A 1C5SA 3V12A 2ALPA 1AKSB 2BHGA 4MG3A 7LPRA 3E0NB 1Q3XA 1G37A 2UUJB 2HRVA 4FU9A 2Z9GA 2FI3E 1TWXB 2FEQH 1YPKH 1B5GH 1O2RA 5DP3A 1BTXA 5FX6A 2FTLE 2HNTC 3F2HA 4DY7B 1BRCE 1TPAE 1AVWA 3RLWH 4KTUA 1G3CA 4ZMAH 2NWNA 2AFQB 3UREA 1TNJA 4Y6DA 2DE9A 3UWIA 2FOFA 3MWIU 1RRKA 5B6OA 4I86A 4ACBA 2J9NA 1BMNH 4A6LA 5TCCA 1WTHD 2HGTH 2QF0A 1XXFA 2UUKB 2WPKS 1O5AB 1NC6A 1T7CA 1GDUA 1ZRBA 2I6SA 2J2UA 3ATLA 1GMDF 1BMLA 1FAXA 3C27B 4IMZA 1O30A 3QN7A 3EAJA 3RXCA 4X2VA 1GBJA 3F3BA 2PSYA 2KCYA 1NFXA 2QA9E 4CH2B 3GY4A 3L33A 4E06H 3ZV8A 1GHYH 1ORFA 2CV3A 4DGJA 1OWIA 1XM1A 2ZGJA 1UCYE 2Z6BD 1XVOA 4E05H 2ZDKA 1O2NA 2WZQA 4CH8B 2O9QA 1C5ZB 2QXHA 5DPAA 4JMYA 4GCHF 1HB0B 2TGAA 1UMAH 1EP6A 3HK3B 5GCHG 3HGNA 2ANKH 2ZKSA 2G52A 3SJ9A 3NRLA 3AAUA 3A7TA 1OP8A 1J16A 1OS8A 1V2PT 2A31A 3SJ8A 1THPB 1J8AA 3RM2H 1G2LA 2C93B 2ZCHP 4NZQA 1S5SA 3RM0H 3L6PA 3KEEA 3S9AA 3TJOA 1DFPA 1TPOA 1IQJA 2HLCA 2ZPSA 1QB9A 3PYHA 3K6YA 1L2EA 5B6LA 2PGBB 2A7HA 3G01A 3A7YA 1UK4A 1GCDA 4GCHG 1TPSA 4P02A 1W0ZU 2ZGCA 2A5AA 2OINA 1Z6JH 1GVLA 2R0KA 5LPFA 2JKHA 3SJOA 1P2QA 3ZZCA 1NFUA 4ISOA 3EA8A 1TX7A 3FP7E 2VBCA 2V35A 1A4WH 1QBOA 2VH0A 2YMSB 3FAOA 4B73A 1FIWA 1TOMH 1XUIA 5G4BA 3TK5A 2VWLA 1HIAA 4X1NU 5T6DA 3W1EA 1ZJDA 1DLEA 3BEIB 5DP5A 5AFYH 2IOTA 1LKBA 3SNCA 4NIYA 4AB8A 1ZZZA 1BTUA 1NU9A 1QRWA 2JIZD 3Q77A 3FO8D 1DY8A 3TVJB 4SGBE 4DW2U 1IOEA 3RC5A 2XXLA 4Y7AA 5EXMA 1WBGB 3A7XA 4FUDA 1NTPA 1O37A 6CHAB 4XBDA 3H7TA 3QTOH 1V2NT 4OS2A 3UNQA 4NIVA 2JJ1D 3MNBA 3M37A 1JXPA 1TALA 3PV5A 3SW2B 1QA0A 3EA7A 3TK9A 3M3VA 1O35A 2XBYA 1JBUH 3GCOA 3I77A 1P2JA 3SN8A 1W0KD 4ZXYH 3F9GA 1DLKB 5EIYA 1AN1E 1EPTC 1NS3A 3B9FH 3ATWA 1QJ6B 2QYIA 2ZHWH 3WY8A 2F9NA 2BOHB 4BAQB 4K8YA 2I6QA 2PLXA 1IAUA 2WPLS 1MCVA 1T8NA 1PPEE 4D7GA 4YLUA 3E90B 1YM0A 4K3JA 5EXNA 1QRXA 4Q63A 2RDLA 3V0XA 4BTTB 5C1YA 1SLUB 1BIOA 2OTVA 1LHCH 1LTOA 2AH4X 2A4RA 4JCNA 4O97A 2D1JA 1RXPA 2XWBI 1ANDA 8KME2 4FXGH 3MNXA 1ZGIA 3LH1A 4ZHLU 3AK5A 1HJAB 3SO3A 2GZ7A 5A8YA 2KAIA 2BY7X 3OTPA 3PWCA 5A8XA 3BTFE 3KF2A 1G3EA 4ISLA 1WQVH 4JZEH 2FS8A 1P11E 3HKIB 1Y5AT 1S0RA 4I8KA 1QL9A 1BCUH 1TMUH 1GI2A 3M7TA 1K9OE 4D9RA 2GZ8A 2ZNKH 3OEED 3RXGA 1GL0E 1DVAH 1SB1H 1J14A 2ZU5A 4JK6A 2F83A 1FPHH 1TPPA 1S6FA 2Y7XA 2GT8A 4DG4A 1FAKH 1MU6B 1YPJH 3PV4A 3LKWA 1DOJA 1GPZA 1WTGH 1S84A 2ZHEH 1NRRH 1SGQE 5HMAA 3RMMH 2IJOB 4AYYB 2PW8H 1KXDA 1WUNH 1SLXB 4KTCA 3KQEA 1CVWH 2GT7A 2FIRH 4Y0YE 3RC6A 1EJAA 1E79D 1LHGH 1TAWA 2ZHFH 3F0PA 3SOSA 1TABE 2H5CA 2AIQA 1T8LA 2ZO3H 5GNDA 1GBEA 5ABWA 1AHTH 1KDQA 4Y8XA 4X1PU 1PPGE 2Z9IA 5C1XA 1VGCC 1BHXF 4JYUH 3E16B 1PPZA 2J34A 3K6ZA 4E7NA 2TGDA 1L1NA 2VGCC 4DCDA 2WYGA 2G4UA 1N8OC 4Q7ZA 1BTYA 5PTPA 2SGFE 1FXYA 1ELFA 1VZQH 2IPHA 3DHKH 3ATIA 5EGMA 2H5DA 3NK8A 2ZHQH 1LPKB 2YNAA 2UUYA 1HJAC 1Z8GA 2BQWB 4HFPB 1C5WB 2AEIH 2OC7A 1OX1A 3SGAE 1QRZA 4YT6H 5C0TA 3EBNA 3E91A 3M36A 3SGQE 1TQ7B 1VITF 3BTWE 3KQCA 3ZVFA 5ESTE 3PRBA 1F92A 2DUCA 2C8ZB 2GGVB 1QTFA 1L1GA 3F2FA 3SHCH 1FY1A 3NXPA 3SU4A 3TH3H 5JBAS 3F0OA 1HAZB 1UW7A 4F4OC 1BJUA 1F0TA 2BD9A 1JMOH 2PKSC 3VG8A 2ZU4A 2TIOA 1BRAA 2H6MA 4NWLA 1K22H 1NRPH 1AO5A 2FZZA 5FPYA 1GI5A 2CK3D 2Z3DA 5BPEA 1G3BA 1CO7E 1TMTH 1E36B 1GMCG 2ZECA 5T1VA 1T4VH 3RXRA 3F68H 4MNXA 1C2FA 1RTFB 1G30B 3CNRA 2XBXA 1ZSJA 2PUXB 2ZPQA 1LMWB 1HAOH 5K7RA 4AFQA 3NZIA 1Y3XA 4A92A 1LVYA 1PQ5A 1GJ5H 2K7XA 2A2QH 2RCEA 2WPMS 4NZLA 2BDAA 4E7RG 1A5GH 2B7DH 1IQGA 1TGBA 2A2XH 3K9XB 4MTBA 2VNTA 1TQ0B 1P12E 1GDQA 1QQUA 1F5LA 2XWAA 2Y5FA 4I8LA 1QZ8A 5KECA 1UHBB 2XNIA 1F0SA 1ELEE 2XOKD 4FUJA 5E2OA 1Z8JB 4Q7YA 3MU0A 1VCQA 3QWCH 2BLOA 4WWYA 1EOJA 1BB0B 1BQYA 1FN6A 4X1RU 1YYY1 4Y10E 5CE1A 3N7EA 3MTYA 3ODDA 7ESTE 1UVTH 3PTNA 1Y59T 1GJ8B 1GI6A 5DKMA 5FBEA 4MNVA 5C67A 3UQOA 4BAHB 4JZDH 1MMJN 1OSSA 2QXJA 1EOLA 1O3HA 5C5OA 5DG6A 1TMBH 3VFEA 2C3SA 1Z1IA 2O8LA 4FU7A 1DWEH 1VJ9U 1C1RA 1QA7A 1O2HA 1O2GH 1Y5UT 2F4LA 3N99A 1TGNA 1RD3B 3I78A 1OPHB 2WPDD 1MU8B 2BDGA 4FU8A 2G00A 2NU2E 2AERH 2W3IA 1NM6A 1QBNA 2BXUH 2V0BA 5SGAE 4YOJA 2R2MB 2W3KA 4B71A 2ZIQH 2OLGA 3TIUA 4DT7B 2GVFA 4K1SA 1DPOA 1H9LB 1UVUH 4MPWA 4CR9A 4OS6A 4KGAA 3RXBA 1LCYA 3RMLH 2UWLA 2Y5GA 3SU5A 1QBVH 4RI0A 1O3JA 1NROH 2EC9H 3S0NA 4ABIA 1DY9A 1DM4B 1ZHPA 2FPZA 1ZMLA 1GG6B 4I8GA 1PPHE 1TNHA 2WUCA 3MH7A 4JZ1A 1K1JA 4CRCA 1IQIA 1VITH 1H4WA 3ZVCA 5LPEA 1H8ED 3U8TH 1PQAA 2BDBA 4GUXA 1C4U2 2Y82A 4I32A 4X1QU 5HGGA 3MMGA 2FESH 5A0CA 1AU8A 2OP9A 1SGEE 3QTVH 4B2CA 1KLIH 1YLCA 3SJIA 1C5LH 2HWLB 3TJVA 4BAOB 1DANH 1O3FA 3A7VA 2VB0A 1EUFA 2YNBA 2PTCE 2QV1A 4DVAU 2ZP0H 4BTIB 1C5QA 3FKSD 3QGNB 5LPRA 1OOKB 1AFQB 4LOYH 1C5YB 3W95A 4MLFB 4X8SH 3EA9A 3BV9B 2AMDA 1ANBA 2H2ZA 4XDEA 1D6WA 2GCHF 5BRRE 4LXBH 2B9LA 3EQ0H 1O3LA 2O8MA 3PO1C 1EKBB 1ZOMA 1XXDA 1TX8A 4LZ4B 1TONA 2PR3A 2A4GA 4Y0ZE 5HKKD 3URCA 2PWXA 3VB3A 2SGPE 4RKOB 4BAMB 3ZYDA 1SI5H 5EQSA 4Z0KA 2A7CA 4AGJA 3O8RA 2ASUB 5F8TA 1L4DA 3U8RH 1KXFA 5EJLA 5DGJA 1O2UA 2FO9A 3ZZ7A 2Z9LA 1RTKA 4KP0A 3KQ5A 1QJ7B 2BDIA 1TBQH 1KXBA 1MTUA 2VINA 4B2BA 1O33A 3BN9A 3GYMA 4YLQH 1SC8U 3OEHD 2CHAC 4U2WA 1WOFA 1HAVB 5JYIA 1GG6C 1TYNA 2ZCKP 2CF8H 3SJKA 4CHAB 3AW0A 1CA8B 4NFFA 2ZC9H 3ZVEA 4TPYA 1UK2A 3JZ2B 4XE4A 1AZZA 4ZKRU 1MKWK 3NPSA 1CSOE 1SQTA 1J17T 4B74A 4YOIA 3CP7A 1V2ST 2EI8A 4ABBA 3KHVA 1DSUA 3FANA 1XUHA 2F91A 4IC5A 5E0HA 1BBRE 3MH5A 1KXAA 3QUMP 1EJNA 4CR5A 3E0PB 3N7DA 4XBBA 1O0DH 3FN8A 4WXIA 1O39A 1DDJA 1GVKB 1O5DH 1B0EA 3M5MA 1H1BA 4XSKU 3ENSB 1EP5A 1IHTH 2G55A 2ZDNA 2UWPA 3ZVGA 1K1OA 6ESTA 2BQ6B 4XFQA 1B7XB 2ZFSA 1TRYA 1V2QT 2VU8E 1HXFH 1NRSH 1GI4A 5J4SA 1WQSA 5A09A 1JRSA 1EFRD 3UY9A 3SU1A 1YGCH 5TJXA 4RKJB 1P09A 1O2MA 2A5IA 1TBZH 4F48B 1GBKA 2Q6DA 2FX6A 5DP9A 4CRFA 1MD7A 2G81E 2V3MA 3BIVH 3LGVA 3RXTA 3A81A 5EJZA 3DD2H 3U1JB 4ABDA 1V6DA 3MU1A 1H9HE 3V3MA 3LIWA 1NZQH 4ABAA 3GDSA 2ZDLA 3T28A 3UUZA 1BOQA 2BM2A 7KMEH 1FQ3A 1UTLM 4INKA 2V3HH 1B0FA 5JBTA 3RXVA 1Q31A 1K1NA 4IGDA 4INHA 3A7WA 2A1DB 3PM3A 1LDTT 1FY4A 1P01A 2BOKA 1GJAB 3A8BA 1PPCE 1GGDB 1E1RD 2FOGA 3SU6A 1GBIA 1T31A 4GVUA 2AGGX 2QAAA 1AI8H 2VIDA 2BD8A 1BA8B 5E0JA 2Q6FA 2IPQX 1GJDB 3A82A 3Q00A 3PRDA 1YLDA 3PTBA 5FL7D 3T2NA 1JRTA 3SQEE 1O36A 3RP2A 3T25A 1C5XB 1HAIH 2OC0A 1Q2WA 3W94A 1BRUP 1GMDG 3GCHB 2GCTC 1HIAB 3TNSA 3PWBA 2FODA 4HGCA 4ZKNU 1MTNB 1C1VH 2XC5A 3SBKA 1GBDA 5H4IB 2ZZUH 3F2GA 2LIZA 1HPGA 1G2MA 4K5ZA 2VWMA 4UEHH 2DE8A 3QLPH 8GCHF 1MZDA 1C1NA 3SU3A 2XW9A 1MKWH 5DP8A 2LNCA 4YTAA 1EZQA 1GHZA 3S69A 5F6MA 2UWOA 1A5HA 3STIA 1EX3A 3KCGH 3PB1E 3A86A 2CGAA 2RG3A 4UD9H 1P9SA 4B6EA 1A0LA 2R0LA 1ZYOA 3R3GB 1AQ7A 1C9PA 3LGTA 2C8YB 1CHOF 4AZ2B 2Z3CA 3U8OH 5A2MH 1H9IE 1Y3YA 1YWUA 2A4OA 2J98A 1UCYK 3MNCA 1GMHF 3TGKE 1PPBH 3VGCB 1FJSA 3GDVA 2L74A 5DK1A 1ELCA 2BDCA 2O8TA 1D3PB 3M3SA 3RXEA 1HYLA 1KMHB 1V2TT 1HUTH 1KLJH 2F9PA 2QE7D 1BTHH 3MH4A 4RT1A 1EPTA 3UIRA 4AC9A 1SOTA 2BXTH 3BIUH 2M5TA 4D7FA 1S85A 1WSSH 1YC0A 2XC0A 3EE7A 3M7UA 1A0HB 1NBMD 1TNGA 3M35A 4FUGA 4RSPA 3U1IB 2SGAA 1A3BH 4BXWA 3PMAB 3EGKH 2JH5D 2STBE 2PHBA 2P59A 1BT7A 1FIZA 1SLWB 1GMHG 1TNLA 1F5KU 2KAIB 1C1UH 2L6OA 2SNVA 3GICB 2G51A 1UJ1A 4X0WU 4O9VA 3RC4A 1C1MA 1IQLA 3NCLA 3P95A 1BUIA 1GBBA 3VB4A 1ZTJA 2GMTB 3MO3A 1TRMA 5EQRA 3Q3KA 1W11U 5HIYA 3BEFB 1ESTA 1UTKA 3GS9A 1P2NA 7GCHF 2SNWA 1V2LT 1FDPA 3SUFA 3VXFH 1EAUA 4ZHMU 4WXVA 1W10U 1P3CA 1YCPM 5EPYA 3VPKA 4BANB 2R9PA 1O2QA 5EG4A 3MOCA 1CT4E 1C1WH 4H6TA 2FI4E 3ZVAA 2GDEH 2Y80A 3RXLA 1FLEE 2F9VA 1FI8A 4NSYA 1D3TB 1OKXA 2PFEA 1AE8H 4YO9A 2FYRA 2FMJA 2BYAX 2HPPH 4K8BA 3LONA 3U28C 6GCHF 2ZI2H 1DUEA 1DXPA 1ZLRA 2BTCE 1GHAF 3SHAH 2PKAA 2NU3E 3HK6B 3CS7A 1SHYA 1D6RA 2OQUA 5L6NH 2QXIA 2YMSC 2ZU1A 2C4FH 4YXWD 2SGDE 3KQDA 1P2KA 1V2KT 5FHTA 4I33A 4RN6A 3VGCC 7GCHG 1YBWA 1C2LA 1KDQB 4CRAA 2AGIX 5J4QA 4X8VH 1LVMA 2D2DA 2OC1A 1AFEH 4ZKSU 1KTTB 4AOQA 2QF3A 2OCVB 2ILNA 1ARCA 3SU0A 1L0ZA 6CHAC 4I31A 6GCHG 2WV4A 2BLQA 3GY7A 1GHAG 1ABJH 3RXAA 4Q2KA 5EXLA 5EJ1A 3A7ZA 1OWDA 4IMQA 1THSH 1C2MA 4FVBA 4JYTA 1O3AA 4DJZB 3DCLA 2ESTE 1UCYH 4X8UH 5AF9H 2ZU2A 2XNDD 1MBMA 4MVNA 4OS7A 3EDXB 4MQAA 4HTCH 1ETTH 1HAYB 3BF6H 4CRBA 4Y11E 5A8ZA 1RGQA 3BSQA 1KY9A 2NU1E 1MTWA 2YOLA 2RFKC 1AWHB 2VIWA 1N1LA 1ZPCA 3PMBB 3RUOA 1O2IA 4TPIZ 1X7AC 1GCTB 1QURH 4IW4E 5EW2H 2QXGA 1M9UA 1SHHB 1QY6A 4VGCB 3TGJE 3AVZA 2ODQA 1C4V2 5ETXA 4WMEA 4ZUHA 5C20A 5LGOA 1O2KA 4NGAH 2P3UB 1WDIA 2RDEA 4B2AA 4GHTA 1OHHD 2Y5HA 4ABHA 3E8LA 2BLWA 4F49A 3MU8A 1UK3A 1CGIE 5GWZA 5C5NA 2VVCA 2EEKA 1LHFH 1ZMJA 4B76A 3DUXH 2YMSD 4M7GA 1O3CA 1ZRKA 5E8EH 1HXEH 1H8IH 1KTSB 3RXHA 3T62A 1G36A 3PV2A 1EAIA 3MHWU 4OS5A 1SOZA 1TA6A 4D8NA 1TB6H 3KN2A 1UTQA 5JPMH 1HAPH 1KXCA 1N6YA 1J9CH 1BMMH 1QIXB 2QN5T 1OWEA 2GKVE 2Z7FE 5I25A 2RA0A 1WU1A 1E37B 2BD5A 5HM2A 3M5LA 4GSOA 3GDUA 3D62A 3FZDA 8LPRA 4A1XA 2GV6A 1FONA 5L30H 1EZXC 1L4ZA 2WUBA 2BMGB 1VITG 4ESTE 1LQDB 5CHAB 1V3XA 1Y3UA 3S7KB 5EQQA 2KCOA 4K69A 1LKAA 3NKKA 3LH3A 1C5OH 2EI6A 2AMPA 1DWDH 3SZNA 1AB9B 1V2RT 1CA0B 2OK5A 3MU5A 4ZH8A 1THRH 4Y8ZA 3ZVDA 3BTGE 1NFYA 1A5IA 5JBCS 3FVFB 2FXRA 3M5OA 2CF9H 4NA9H 4IS5A 3MNSA 4ISNA 2ZDAH 3ESTA 3P6ZB 4TT3D 3E3TA 3GCTF 1CU1A 3GISB 1GBLA 3RXJA 4HG6A 3STJA 1LHDH 2KZ4A 2ZFQH 2Y6TA 4X6PA 1O38A 5CMXH 4ABEA 1YPHC 3RU4T 1ZTKA 3UB0A 2QGRA 1ACBE 2A45B 1HGTH 5C94A 4AFZA 2J38A 1V2UT 1FN8A 1O2XA 2ZTZA 1AZ8A 1O2TA 5FX5A 1LVBA 1O3OA 1PJPA 5GIBA 3ZZ9A 2CMYA 1FV9A 1LO6A 2JH0D 3D49H 3GCTG 5DO4H 2Z9KA 1GHBF 1FX0B 1GBAA 1TGTA 1P2OA 1YPLH 3NWUA 3OYPA 5LH8A 1UO6A 1SGCA 2BX3A 1G9IE 3GY5A 4A7IB 2FTMA 5FXLA 2BVXH 1YP9A 5FAHA 3GOVB 1VR1H 3SGBE 3TK6A 1P03A 2XC4A 1Z7KA 1SGFG 3FP8E 2HPQH 1Y3VA 5DJ7A 1C5TA 2KFWA 1XVMA 1YPMH 4X6NA 5FPSA 1EJMA 2VJ1A 1RS0A 2ZDMA 2OC8A 3MYWA 9LPRA 3RXMA 2HNTE 1GHBG 3RXFA 4BAKB 2BY9X 1GI0A 3RU4D 1P2IA 1S81A 1HLTH 1PQ8A 3S7HB 4AN7A 1P8VC 1SQOA 2P93A 1YPGH 2ZEBA 2VH6A 2F3CE 4NG9H 4AGKA 2ZDVH 3UOUA 1GL1A 2FOEA 4ZKOU 1NESE 2K0QA 1J15A 2XTTB 2NU4E 2F9BH 2QF5A 1DXWA 5FCKA 1UTJA 1EAXA 2BX4A 3FOAA 2WINI 1RIWB 1SLVB 2OUAA 1P57B 2EA3A 3A8DA 4K2YA 4TY6A 4X8TH 3P8GA 1O2YA 2KX4A 1O3PB 2P95A 1Z6EA 2ZGHA 3P70B 5EOKA 2BD2A 1CBWB 4UE7H 4ZAEA 2TBSA 3LJOA 4Y8YA 1LPGB 2PUQH 3VB5A 1SKYE 4D76A 2GD4B 2WHXA 3BEUA 1BDAA 5JB9S 1C2IA 2ZU3A 3DSOA 5F8XA 1ZSKA 4WMDA 2J5UA 1YPEH 3MO9A 1IQKA 2AHME 1LVOA 1MZAA 3OU0A 3ZZAA 4UONA 1EAWA 1VCWA 2PP6A 1HAHH 1AD8H 2P3TB 3GYLB 2EY4C 4M9FA 2ZFTA 4ZROA 5DSFA 4RT0A 3SV7A 1SGTA 2ODPA 2G8TA 2HALA 1CT2E 3D23A 1O2LA 4UDWH 4P00A 3ZZDA 1BRBE 5AFZH 1T32A 4DT4A 2GCHG 5C17A 4LZ1H 4UFFH 1CE5A 4I7YH 4BNRA 2QC2A 3RXPA 2Z3EA 3QZQA 2VVUA 4MPUA 3LGUA 1CQQA 1XMNB 1ZTLA 3TJNA 1F2SE 1MH0A 1QL8A 4J2YB 8ESTE 5GXPA 1A7SA 3IG6B 1OP2A 1AVXA 1O31A 1QJ1B 1HAXB 4UFDH 4FUEA 4NCYA 3S9CA 1EZSC 1ESAA 1O5GH 5E2PA 3LOXA 4YZUA 1UTNA 2FOBA 1ELDE 2P8OB 3O8DA 3MQKC 3LGIA 1SGPE 3DT0H 4ASHA 1Z8IB 1T8MA 1XUFA 5F03A 3ZYEA 3TPIZ 1NRNH 5I46H 4PROA 2K1QA 1VJAU 4K1EA 1A46H 2GJGA 2ZTXA 5K0HA 4X2YA 4JZIA 1E0FD 2ZGXH 4Y79A 1IQEA 3IWMA 1Y5BT 1O3MA 3ZZ5A 2W26A 1Z8RA 1AFQC 1QB6A 1C5MD 1SGIB 2R3YA 1UVSH 1BMAA 3GY3A 1F7ZA 3NUMA 3UTUH 1SBWA 4JYVH 5F53A 1W14U 1LHEH 3D65E 1EATA 1OYTH 2FWWA 4FUHA 2ZPRA 1MAXA 4I8JA 4IN2A 1O3BA 3SNDA 1KLTA 1C1QA 3TGIE 1K28D 4KELA 1O3NA 4ASUD 1NY22 1UVPA 1GI9B 1O3DA 4K1TA 3RXQA 5IYTA 3RXDA 1ZPBA 3JZ1B 1CHGA 3B8JA 4FOUC 2F43B 2FDAA 3RXIA 2QCYA 1QNJA 1S83A 1EB2A 5DN6D 3SUDA 2Y81A 1DE7H 3GY6A 1QHRB 1GJBB 1Z1JA 2FOMB 3SU2A 3MI4A 3A8AA 4FUFA 3SV6A 1BJVA 3A89A 1ZSLA 3SZEA 3QK1A 1XX9A 4Y76A 1BITA 1AVGH 4NIWA 1ETRH 1K21H 3T26A 3SQHE 2ZA5A 1BBRK 2OQ5A 3P17H 5HM9A 1FUJA 2V3OH 4ZXXH 1O5BB 1QFKH 5T6FA 4BTUB 3SV2H 3C1KA 4CHAC 3FZZA 1COWD 1O5EH 5DP4A 3A83A 4THNH 4B1TA 3TH2H 2XBVA 1P02A 5GCHF 4NIXA 1TGSZ 1SFIA 3Q76A 4MPVA 3IITA 3UOPA 2P8OC 1EASA 4WJG2 4OGYA 3UR6A 4A1VA 2BD4A 1AKSA 1ESBA 2FP7B 3M61U 2ANWA 3F9EA 1G3DA 2V7QD 3GCNA 5JBBS 1P9UA 3T27A 3E6PH 2A32A 2XCFA 2BQ7B 1O32A 3ZZ6A 3RXOA 3A85A 1K1PA 1VKYA 2J98B 3M5NA 3TH4H 3QX5H 1RTLA 2OBOA 3LPRA 4I8HA 5CHBA 4YOGA 1DWCH 2M2AA 4AFSA 2BD3A 2BY8X 2BLVA 2W7SA 1MQ5A 1MUEB 2ZQ1A 3RXSA 1K0HA 1ABIH 1WXRA 1EPTB 1DT2A 3EE0B 2Q1JA 2VIOA 1YLNA 1K1IA 2CXVA 1XUGA 2B8OH 2PSXA 2XYAA 2KCAA 1JIRA 3ATKA 3UNSA 1PYTD 1Y3WA 1RFNA 1ANEA 1BTPA 1O2ZA 2G5NA 1F0UA 1JOUB 4UFEH 1W7XH 2LP6A 3M7QA 4ABJA 1U6QA 4FUBA 1IHSH 4TSFD 1JWTA 4NSVA 3P8OA 5KGOA 2A4QA 1TLDA 4AX9H 3DSGA 1SFQB 3SV8A 2ZQ2A 2W6JD 3WWFA 2FOAA 3OAAD 9ESTA 2OD3B 4YT7H 4TWYA 1BTWA 1ELVA 8GCHG 1C5NH 1KSNA 3F9FA 4IN1A 3PROA 5HXFA 4CREA 1HV7A 4YM9A 2VWOA 3UPEA 2R3UA 1AUJA 2R2WU 1GVZA 3SI3H 1P10A 1GI3A 3PLBA 1AGJA 5C2ZA 3BG4B 4A5TS 2SFAA 1CHOG 1C1SA 1GGDC 3SYJA 3U69H 1C1TA 3LGWA 3AASA 4OS4A 1IQFA 2TGTA 3VB6A 1W7GH 1XUJA 4GPGA 3KL6A 1MBQA 1GJCB 2WPJS 2PKAB 3RXKA 1QR3E 1EXFA 3AAVA 5AHGH 3UAIC 2H1UA 4X1SU 2WPHS 3GCHC 4U30A 3HKJB 1PQ7A 2D8WA 1BBRH 1CT0E 2F9OA 1HNEE 1QQ4A 5C1UA 2OXSA 4U32A 5HIZA 1SVPA 2AYWA 2J94A 2ZFPH 1A0JA 1ZPZA 4BXSA 4GHQA 1GBFA 1MTNC 1ZMNA 1GJ4H 3RU4E 3DSPA 3ODFA 1ANCA 2ODYB 4O3TA 2BVSH 2OBQA 1ETSH 3A80A 5HYOA 3Q3XA 1VGCB 5KEDA 2J97A 4Q80A 4ABFA 4OGXA 2Z9JA 1SG8B 1P2MA 3DFLA 3TU7H 4ABGA 2EI7A 1O3GA 4AG2A 4TYDA 1FPCH 2VGCB 4ISHH 3OX7U 1EZUC 1DITH 1N8OB 1DUAA 2JDID 2C8WB 1HBTH 1MABB 4J1YA 2A0QB 3LJJA 1KYNA 1RJXB 2KCPA 2P3FH 5FBIA 1O2JA 4H4FA 4X6MA 1FY3A 1O5CB 4JZFH 4O03A 5C3NA 3VEQB 2BDHA 1P04A 3MFJA 1QGFA 3KNXA 5AVDA 1DS2E 2VIVA 1BMFD 1KXEA 1NU7B 1W0YH 2AGEX 1YPHE 6LPRA 1GBTA 1W8BH 3DFJA 4MNWA 1HDTH 1FMGA 1OWHA 4R8TB 4A1TA 1D9IA 3I29A 1F5RA 3KYGA 3O8BA 1QL7A 1TX6A 1CGJE 2BY6X 1NO9H 1GHWH 5A0AE 4WF8A 5EW1H 1BZXE 2IJD1 1V2JT 2HVXA 5ESBA 1ZR0A 3BG4C 2VWNA 1SL3A 2PKSB 5JB8S 1WV7H 4H6SB 4X2XA 3RXUA 5JDUB 4LK4A 3SNEA 1SQAA 3OY6U 3ZIAD 4WY3A 3P8FA 3KGPA 1L1JA 4XRNA 1IQHA 2TGPZ 1WAYB 1HJ8A 1ZJKA 1IQNA 1T8OA 2W5EA 2ZFRH 1JIMA 1V2OT 1FZZA 1O5FH 2NU0E 1K2I1 2ZCLP 1O2OA 1SR5C 5E0GA 3A8CA 1GHXH 1YY3A 1SGDE 3P8NA 4HZHA 3CS0A 2BZ6H 3BTQE 4R0IA 3LC5A 5T6GA 4K60A 3HATH 5FPTA 1AMHA 1W0JD 3UR9A 4AG1A 1S6HA 2GMTC 1FY5A 2ZG0H 1YCPK 1ZHMA 3ZZ4A 1HJ9A 4FUIA 3N7OA 1C2KA 2ULLA 1AWFH 2EQNA 3RMNH 2Y7ZA 2Q6GA 2A5KA 1TNIA 2P16A 3MU4A 2HVYB 3UNRA 2JETB 1HAGE 3OSYA 3UFAA 2BB4A 1TIOA 4GAWA 2B0FA 1NT1A 2TPIZ 3K65B 1K1LA 2CN0H 1BHXB 1F0RA 2W7UA 1MTSA 3A87A 3UQVA 1P3EA 1SSXA 2PGQB 1W2KH 2ZWLH 3ZVBA 2HOBA 1GMCF 1A2CH 1SMFE 2BZAA 1OYQA 5GDSH 2FLBH 4NA8A 3TJUA 4ZHAA 2FYQA 1OP0A 3T29A 2JH6D 4FVDA 1MTVA 3ZZBA 4D9QA 4O3UA 1PFXC 4AORA 1Z71A 2FI5E 4DOQA 2PV9B 3Q3YA 1GJ9B 2K8IA 1O34A 4ISIH 3WWBA 1GBHA 3OTJE 5A0BA 1TGCA 2G4TA 3RLYH 3F1SB 1INCA 1O2VA 1FNIA 1XKBC 4OM9A 4XOJA 2QF4A 3MO6A 1NRQH 3H7OA 3PMHB 4TY7A 2ZTYA 3OE7D 5GJ4B 1S82A 4SGAE 4UFGH 1P05A 3RMOH 1BTZA 1V2MT 4Y7BA 1O2SA 1TE0A 4TWWA 1N6XA 3GY8A 3MH6A 3ZZ3A 4DIHH 4ZCNA 3ZV9A 3SORA 4MPXA 1D3DB 2CJIA 4QT8C 3O8CA 3PLPA 1HFDA 3LDXH 2ZGBH 5F8ZA 2H9TH 4XD7D 2P94A 2LELA 3BTME 2J4IA 4ACAA 1MKXK 1AE5A 1C5UA 1C1PA 1WYKA 3TLOA 1SQRA 1ELTA 1ZHRA 2GDDA 4KKDA 4JK5A 1QCPA 1P0SH 4KTSA 4MNYA 4GLYA 1O2PA 1GCTC 3CENA 3TNTA 4BOHA 4VGCC 1A3EH 1P06A 4X2WA 4Y71A 1C5RA 3F6UH 3SI4H 1GBCA 1GJ6A 2GV7A 2JETC 3ITIA 4FUCA 4WH6A 2W6ID 2ZHDA 1V2WT 3P92A 2KR7A 4CRDA 3AW1A 1GI8B 4HI3A 1AY6H 5TCAA 1C2DA 3A84A 3PO1B 4FETA 3M3TA 1TBRH 2BY5X 2SGEE 3R0FA 2ANMH 2GZ9A 1MAYA 3BTEE 4Z6AH 1C5VA 3DA9B 2XRCA 5CDFE 5L2ZH 1O3EA 2WSSD 5C0UA 1YCPH 4XBCA 2J92A 3HPTB 1UHBA 2AS9A 2C90B 4WH8A 1NFWA 1GI1A 1A1RA 1EB1H 2FM2A 1TRNA 2BDYA 1XUKA 3QGJA 4H42U 5DP7A 3SUGA 4DURA 1ELBA 1GWAA 1C9TA 1TA2A 2RA3A 2GTBA 2ZFFH 1MQ6A 3ELAH 3U9AH 2FS9A 3GY2A 3HGPA 4B75A 3BTTE 2D26C 5CHAC 1E34B 1VCPA 1TFXA 1UVOA 1MD8A 3V7TA 1GJ7B 4NA7A 2IN2A 1GI7B 1SGNE 2HLDD 2UUFB 1AB9C 1CA0C 3E1XB 2THFB 1UTPA 2CHAB 2WPIS 1TOCB 1QB1A 2V6NA 2QIQA 4INLA 1OXGA 3URDA 1AIXH 3EYDA 3KYFA 4CBOA 3RDZA 1CGHA 1D3QB 1ARBA 2BD7A 4Q4LA 1NN6A 1OWJA 1WCZA 3TITA 1ID5H 2FOHA 1W13U 1SGFA 3ZZ8A 3A88A 1AUTC 1ELGA 2FOCA 2VIQA 1NBME 1Y8TA 1A61H 3FP6E 4CBNA 3PLKA 4AB9A 1E1QD 1HRTH 3H5CB 3T5FH 1K1MA 3LU9B 2GP9B 1GHVH 1H8DH 2ZF0H 3B23B 2WV5A 2AIPA 4MDSA 1DSTA 2WV9A 1YKTA 2QY0B 4DIIH 1O3KA 3H09A 5EODA 4AFUA 1GDNA 1LQEA 2O8UA 3SNBA 1O2WA 3LGYA 4OS1A 1H8HD 1SPJA 2F9UA 1XKAC 2LPRA 2G5VA 3U98H 3BG8A 2HNTF 2O8WA 3ATMA 1MKXH 2ALVA 1C4Y2 2BVRH 3QDZB 3BTHE 2AMQA 1C2EA 3PMJA 3SV9A 4F55A 3FFGA 5IK2D 3SNAA 1ZGVA 4IBLH 2FLRH 4Z1MD 3SUEA 2H9EH 4IC6A 3UWJH 3VXEH 3QO6A 1HCGA 3QZRA 2SGQE 1W3CA 1C1OA 2FX4A 4B6FA 4CRGA 5T3HA 2H9HA 5EPNA 2STAE 5IDKA 1G32B 2KM0A 3S9BA 3VB7A 1E35B 1UTOA 2TRMA 2PTNA 2B5TB 3BTKE 3WW7A 3OFND 4X6OA 5DP6A 1MCTA 1S6LA 3KIDU 4WVPE 1O3IA 1C2JA 4NWKA 5GPIB 5L2YH 1SGYE 4U01A 1IQMA 1GBMA 3L3TA 1EQ9A 1V2VT
chains in the Genus database with same CATH topology
1PPFE 2C8XB 4YESB 1S0QA 2A7JA 1ELAA 2J95A 1RIWC 1W12U 4NFEA 4AYVB 3V13A 1SGRE 3K2UA 1D4PB 1NPMA 3BTDE 1CBWC 2XBWA 2WYJA 1T4UH 2ANYA 1YF4A 1LPZB 1C2HA 3LT3A 1TNKA 1E38B 3OY5U 1C2GA 3LC3A 1C5PA 1DWBH 4Q7XA 1OWKA 3KQBA 2Z94A 2GCTB 2VIPA 4WMFA 5EU8A 1PYTC 3F9HA 1UTMA 5FCRA 1HAVA 2VVVA 1FY8E 1DX5M 2XCNA 1KIGH 1DICA 2GX4A 1C5SA 3V12A 2ALPA 1AKSB 2BHGA 4MG3A 7LPRA 3E0NB 1Q3XA 1G37A 2UUJB 2HRVA 4FU9A 2Z9GA 2FI3E 1TWXB 2FEQH 1YPKH 1B5GH 1O2RA 5DP3A 1BTXA 5FX6A 2FTLE 2HNTC 4DY7B 1BRCE 1TPAE 1AVWA 3RLWH 4KTUA 1G3CA 4ZMAH 2NWNA 2AFQB 3UREA 1TNJA 4Y6DA 2DE9A 3UWIA 2FOFA 3MWIU 1RRKA 5B6OA 2J9NA 1BMNH 4A6LA 5TCCA 1WTHD 2HGTH 2QF0A 1XXFA 2UUKB 2WPKS 1O5AB 1NC6A 1T7CA 1GDUA 1ZRBA 2I6SA 2J2UA 3ATLA 1GMDF 1BMLA 1FAXA 3C27B 4IMZA 1O30A 3QN7A 3EAJA 3RXCA 4X2VA 1GBJA 2PSYA 1NFXA 2QA9E 4CH2B 3GY4A 3L33A 4E06H 3ZV8A 1GHYH 1ORFA 2CV3A 4DGJA 1OWIA 1XM1A 2ZGJA 1UCYE 2Z6BD 1XVOA 4E05H 2ZDKA 1O2NA 4CH8B 2O9QA 1C5ZB 2QXHA 5DPAA 4JMYA 4GCHF 1HB0B 2TGAA 1UMAH 1EP6A 3HK3B 5GCHG 3HGNA 2ANKH 2ZKSA 2G52A 3SJ9A 3AAUA 3A7TA 1OP8A 1J16A 1OS8A 1V2PT 2A31A 3SJ8A 1THPB 1J8AA 3RM2H 1G2LA 2C93B 2ZCHP 4NZQA 1S5SA 3RM0H 3L6PA 3KEEA 3S9AA 3TJOA 1DFPA 1TPOA 1IQJA 2HLCA 2ZPSA 1QB9A 3PYHA 3K6YA 1L2EA 2PGBB 2A7HA 3G01A 3A7YA 1UK4A 1GCDA 4GCHG 1TPSA 1W0ZU 2ZGCA 2A5AA 2OINA 1Z6JH 1GVLA 2R0KA 5LPFA 2JKHA 3SJOA 1P2QA 3ZZCA 1NFUA 4ISOA 3EA8A 1TX7A 3FP7E 2V35A 1A4WH 1QBOA 2VH0A 3FAOA 4B73A 1FIWA 1TOMH 1XUIA 5G4BA 3TK5A 2VWLA 1HIAA 4X1NU 5T6DA 1ZJDA 1DLEA 3BEIB 5DP5A 5AFYH 2IOTA 1LKBA 3SNCA 4NIYA 4AB8A 1ZZZA 1BTUA 1NU9A 1QRWA 3Q77A 1DY8A 3TVJB 4SGBE 4DW2U 1IOEA 3RC5A 2XXLA 4Y7AA 5EXMA 1WBGB 3A7XA 4FUDA 1NTPA 1O37A 6CHAB 4XBDA 3H7TA 3QTOH 1V2NT 4OS2A 3UNQA 4NIVA 3MNBA 3M37A 1JXPA 1TALA 3SW2B 1QA0A 3EA7A 3TK9A 3M3VA 1O35A 2XBYA 1JBUH 3GCOA 3I77A 1P2JA 3SN8A 4ZXYH 3F9GA 1DLKB 1AN1E 1EPTC 1NS3A 3B9FH 3ATWA 1QJ6B 2QYIA 2ZHWH 3WY8A 2F9NA 2BOHB 4BAQB 4K8YA 2I6QA 2PLXA 1IAUA 2WPLS 1MCVA 1T8NA 1PPEE 4D7GA 4YLUA 3E90B 1YM0A 4K3JA 5EXNA 1QRXA 2RDLA 3V0XA 4BTTB 5C1YA 1SLUB 1BIOA 2OTVA 1LHCH 1LTOA 2AH4X 2A4RA 4JCNA 4O97A 2D1JA 1RXPA 2XWBI 1ANDA 8KME2 4FXGH 3MNXA 1ZGIA 3LH1A 4ZHLU 1HJAB 3SO3A 2GZ7A 5A8YA 2KAIA 2BY7X 5A8XA 3PWCA 3BTFE 3KF2A 1G3EA 4ISLA 1WQVH 4JZEH 2FS8A 1P11E 3HKIB 1Y5AT 1S0RA 4I8KA 1QL9A 1BCUH 1TMUH 1GI2A 3M7TA 1K9OE 4D9RA 2GZ8A 2ZNKH 3RXGA 1GL0E 1DVAH 1SB1H 1J14A 2ZU5A 4JK6A 2F83A 1FPHH 1TPPA 1S6FA 2Y7XA 2GT8A 4DG4A 1FAKH 1MU6B 1YPJH 3PV4A 3LKWA 1DOJA 1GPZA 1WTGH 1S84A 2ZHEH 1NRRH 1SGQE 5HMAA 3RMMH 2IJOB 4AYYB 2PW8H 1KXDA 1WUNH 1SLXB 4KTCA 3KQEA 1CVWH 2GT7A 2FIRH 4Y0YE 3RC6A 1EJAA 1LHGH 1TAWA 2ZHFH 3SOSA 1TABE 2H5CA 2AIQA 1T8LA 2ZO3H 1GBEA 5ABWA 1AHTH 1KDQA 4Y8XA 4X1PU 1PPGE 2Z9IA 5C1XA 1VGCC 1BHXF 4JYUH 3E16B 1PPZA 2J34A 3K6ZA 4E7NA 2TGDA 1L1NA 2VGCC 4DCDA 2WYGA 2G4UA 1N8OC 4Q7ZA 1BTYA 5PTPA 2SGFE 1FXYA 1ELFA 1VZQH 2IPHA 3DHKH 3ATIA 5EGMA 2H5DA 3NK8A 2ZHQH 1LPKB 2YNAA 2UUYA 1HJAC 1Z8GA 2BQWB 4HFPB 1C5WB 2AEIH 2OC7A 1OX1A 3SGAE 1QRZA 4YT6H 3EBNA 3E91A 3M36A 3SGQE 1TQ7B 1VITF 3BTWE 3KQCA 3ZVFA 5ESTE 1F92A 2DUCA 2C8ZB 2GGVB 1QTFA 1L1GA 3SHCH 1FY1A 3NXPA 3SU4A 3TH3H 5JBAS 1HAZB 4F4OC 1BJUA 1F0TA 2BD9A 1JMOH 2PKSC 2ZU4A 2TIOA 1BRAA 2H6MA 4NWLA 1K22H 1NRPH 1AO5A 2FZZA 5FPYA 1GI5A 2Z3DA 5BPEA 1G3BA 1CO7E 1TMTH 1E36B 1GMCG 2ZECA 1T4VH 3RXRA 3F68H 4MNXA 1C2FA 1RTFB 1G30B 2XBXA 1ZSJA 2PUXB 2ZPQA 1LMWB 1HAOH 5K7RA 4AFQA 3NZIA 1Y3XA 4A92A 1LVYA 1PQ5A 1GJ5H 2K7XA 2A2QH 2RCEA 2WPMS 4NZLA 2BDAA 4E7RG 1A5GH 2B7DH 1IQGA 1TGBA 2A2XH 3K9XB 4MTBA 2VNTA 1TQ0B 1P12E 1GDQA 1QQUA 1F5LA 2XWAA 2Y5FA 4I8LA 1UHBB 2XNIA 1F0SA 1ELEE 4FUJA 5E2OA 1Z8JB 4Q7YA 3MU0A 1VCQA 3QWCH 2BLOA 4WWYA 1EOJA 1BB0B 1BQYA 1FN6A 4X1RU 1YYY1 4Y10E 5CE1A 3MTYA 3ODDA 7ESTE 1UVTH 3PTNA 1Y59T 1GJ8B 1GI6A 5DKMA 5FBEA 4MNVA 5C67A 3UQOA 4BAHB 4JZDH 1MMJN 1OSSA 2QXJA 1EOLA 1O3HA 5C5OA 5DG6A 1TMBH 3VFEA 2C3SA 1Z1IA 2O8LA 4FU7A 1DWEH 1VJ9U 1C1RA 1QA7A 1O2HA 1O2GH 1Y5UT 1TGNA 1RD3B 3I78A 1OPHB 1MU8B 2BDGA 4FU8A 2G00A 2NU2E 2AERH 2W3IA 1NM6A 1QBNA 2BXUH 2V0BA 5SGAE 4YOJA 2R2MB 2W3KA 4B71A 2ZIQH 2OLGA 3TIUA 4DT7B 2GVFA 4K1SA 1DPOA 1H9LB 1UVUH 4MPWA 4CR9A 4OS6A 4KGAA 3RXBA 1LCYA 3RMLH 2UWLA 2Y5GA 3SU5A 1QBVH 1O3JA 1NROH 2EC9H 3S0NA 4ABIA 1DY9A 1DM4B 1ZHPA 2FPZA 1ZMLA 1GG6B 4I8GA 1PPHE 1TNHA 2WUCA 3MH7A 4JZ1A 1K1JA 4CRCA 1IQIA 1VITH 1H4WA 3ZVCA 5LPEA 3U8TH 1PQAA 2BDBA 4GUXA 1C4U2 2Y82A 4I32A 4X1QU 5HGGA 3MMGA 2FESH 5A0CA 1AU8A 2OP9A 1SGEE 3QTVH 4B2CA 1KLIH 1YLCA 3SJIA 1C5LH 2HWLB 3TJVA 4BAOB 1DANH 1O3FA 3A7VA 2VB0A 1EUFA 2YNBA 2PTCE 2QV1A 4DVAU 2ZP0H 4BTIB 1C5QA 3QGNB 5LPRA 1OOKB 1AFQB 4LOYH 1C5YB 3W95A 4MLFB 4X8SH 3EA9A 3BV9B 2AMDA 1ANBA 2H2ZA 4XDEA 1D6WA 2GCHF 5BRRE 4LXBH 2B9LA 3EQ0H 1O3LA 2O8MA 3PO1C 1EKBB 1ZOMA 1XXDA 1TX8A 4LZ4B 1TONA 2PR3A 2A4GA 4Y0ZE 3URCA 2PWXA 3VB3A 2SGPE 4RKOB 4BAMB 3ZYDA 1SI5H 5EQSA 4Z0KA 2A7CA 4AGJA 3O8RA 2ASUB 5F8TA 1L4DA 3U8RH 1KXFA 5DGJA 1O2UA 2FO9A 3ZZ7A 2Z9LA 1RTKA 4KP0A 1QJ7B 2BDIA 1TBQH 1KXBA 1MTUA 2VINA 4B2BA 1O33A 3BN9A 3GYMA 4YLQH 1SC8U 2CHAC 4U2WA 1WOFA 1HAVB 5JYIA 1GG6C 1TYNA 2ZCKP 2CF8H 3SJKA 4CHAB 3AW0A 1CA8B 4NFFA 2ZC9H 3ZVEA 4TPYA 1UK2A 3JZ2B 4XE4A 1AZZA 4ZKRU 1MKWK 3NPSA 1CSOE 1SQTA 1J17T 4B74A 4YOIA 3CP7A 1V2ST 2EI8A 4ABBA 3KHVA 1DSUA 3FANA 1XUHA 2F91A 4IC5A 5E0HA 1BBRE 3MH5A 1KXAA 3QUMP 1EJNA 4CR5A 3E0PB 4XBBA 1O0DH 4WXIA 1O39A 1DDJA 1GVKB 1O5DH 1B0EA 3M5MA 1H1BA 4XSKU 3ENSB 1EP5A 1IHTH 2G55A 2ZDNA 2UWPA 3ZVGA 1K1OA 6ESTA 2BQ6B 4XFQA 1B7XB 2ZFSA 1TRYA 1V2QT 2VU8E 1HXFH 1NRSH 1GI4A 5J4SA 1WQSA 5A09A 1JRSA 3UY9A 3SU1A 1YGCH 5TJXA 4RKJB 1P09A 1O2MA 2A5IA 1TBZH 1GBKA 2Q6DA 2FX6A 5DP9A 4CRFA 1MD7A 2G81E 3BIVH 3LGVA 3RXTA 3A81A 3DD2H 3U1JB 4ABDA 1V6DA 3MU1A 1H9HE 3V3MA 3LIWA 1NZQH 4ABAA 3GDSA 2ZDLA 3T28A 3UUZA 1BOQA 2BM2A 7KMEH 1FQ3A 1UTLM 4INKA 2V3HH 1B0FA 5JBTA 3RXVA 1Q31A 1K1NA 4IGDA 4INHA 3A7WA 2A1DB 3PM3A 1LDTT 1FY4A 1P01A 2BOKA 1GJAB 3A8BA 1PPCE 1GGDB 2FOGA 3SU6A 1GBIA 1T31A 4GVUA 2AGGX 2QAAA 1AI8H 2VIDA 2BD8A 1BA8B 5E0JA 2Q6FA 1GJDB 3A82A 3Q00A 1YLDA 3PTBA 3T2NA 1JRTA 3SQEE 1O36A 3RP2A 3T25A 1C5XB 1HAIH 2OC0A 1Q2WA 3W94A 1BRUP 1GMDG 3GCHB 2GCTC 1HIAB 3TNSA 3PWBA 2FODA 4HGCA 4ZKNU 1MTNB 1C1VH 2XC5A 3SBKA 1GBDA 5H4IB 2ZZUH 2LIZA 1HPGA 1G2MA 4K5ZA 2VWMA 4UEHH 2DE8A 3QLPH 8GCHF 1MZDA 1C1NA 3SU3A 2XW9A 1MKWH 5DP8A 2LNCA 4YTAA 1EZQA 1GHZA 3S69A 5F6MA 2UWOA 1A5HA 3STIA 1EX3A 3KCGH 3PB1E 3A86A 2CGAA 2RG3A 4UD9H 1P9SA 1A0LA 2R0LA 1ZYOA 3R3GB 1AQ7A 1C9PA 3LGTA 2C8YB 1CHOF 4AZ2B 2Z3CA 3U8OH 5A2MH 1H9IE 1Y3YA 2A4OA 1UCYK 3MNCA 1GMHF 3TGKE 1PPBH 3VGCB 1FJSA 3GDVA 5DK1A 1ELCA 2BDCA 2O8TA 1D3PB 3M3SA 3RXEA 1HYLA 1V2TT 1HUTH 1KLJH 2F9PA 1BTHH 3MH4A 1EPTA 3UIRA 1SOTA 2BXTH 3BIUH 2M5TA 4D7FA 1S85A 1WSSH 1YC0A 2XC0A 3M7UA 1A0HB 1TNGA 3M35A 4FUGA 4RSPA 3U1IB 2SGAA 1A3BH 4BXWA 3PMAB 3EGKH 2JH5D 2STBE 2PHBA 2P59A 1BT7A 1FIZA 1SLWB 1GMHG 1TNLA 1F5KU 2KAIB 1C1UH 2SNVA 3GICB 2G51A 1UJ1A 4X0WU 4O9VA 3RC4A 1C1MA 1IQLA 3NCLA 3P95A 1BUIA 1GBBA 3VB4A 1ZTJA 2GMTB 3MO3A 1TRMA 5EQRA 3Q3KA 1W11U 3BEFB 1ESTA 1UTKA 7GCHF 1P2NA 2SNWA 1V2LT 1FDPA 3SUFA 3VXFH 1EAUA 4ZHMU 4WXVA 1W10U 1P3CA 1YCPM 5EPYA 3VPKA 4BANB 2R9PA 1O2QA 5EG4A 3MOCA 1CT4E 1C1WH 4H6TA 2FI4E 3ZVAA 2GDEH 2Y80A 3RXLA 1FLEE 2F9VA 1FI8A 4NSYA 1D3TB 1OKXA 2PFEA 1AE8H 4YO9A 2FYRA 2FMJA 2BYAX 2HPPH 4K8BA 3LONA 6GCHF 2ZI2H 1DUEA 1DXPA 1ZLRA 2BTCE 1GHAF 3SHAH 2PKAA 2NU3E 3HK6B 3CS7A 1SHYA 1D6RA 2OQUA 5L6NH 2QXIA 2ZU1A 2C4FH 2SGDE 3KQDA 1P2KA 1V2KT 5FHTA 4I33A 4RN6A 3VGCC 7GCHG 1YBWA 1C2LA 1KDQB 4CRAA 2AGIX 5J4QA 4X8VH 1LVMA 2D2DA 2OC1A 1AFEH 4ZKSU 1KTTB 4AOQA 2QF3A 2OCVB 2ILNA 1ARCA 3SU0A 1L0ZA 6CHAC 4I31A 6GCHG 2WV4A 2BLQA 3GY7A 1GHAG 1ABJH 3RXAA 4Q2KA 5EXLA 3A7ZA 1OWDA 4IMQA 1THSH 1C2MA 4FVBA 4JYTA 1O3AA 4DJZB 2ESTE 1UCYH 4X8UH 5AF9H 2ZU2A 4MVNA 1MBMA 4OS7A 3EDXB 4MQAA 4HTCH 1ETTH 1HAYB 3BF6H 4CRBA 4Y11E 5A8ZA 1RGQA 3BSQA 1KY9A 2NU1E 1MTWA 2YOLA 1AWHB 2VIWA