4ZUHA

Complex structure of pedv 3clpro mutant (c144a) with a peptide substrate.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
298
structure length
298
Chain Sequence
AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVLRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVVNTDCFSILAAKTGVDVQRLLASIQSLHKNFGGKQILGYTSLTDEFTTGEVIRQMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEDV 3C-Like protease
publication title Structural basis for the dimerization and substrate recognition specificity of porcine epidemic diarrhea virus 3C-like protease.
pubmed doi rcsb
source organism Porcine epidemic diarrhea virus
molecule tags Hydrolase/peptide
total genus 84
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4zuhA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zuhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zuhA01
3IG6B 4UONA 2FOGA 1Z7KA 2IN2A 5A8YA 5AVDA 1DXWA 4BNRA 2A4QA 1JBUH 1O2YA 4H4FA 1ANDA 3ZZ5A 2BDAA 1XKAC 2BM2A 1O34A 1PPHE 3U1JB 1AGJA 4D7GA 4KTSA 1V2RT 5JYIA 1DFPA 1Y5BT 1O36A 1YPGH 1FQ3A 5DP4A 4ABJA 8KME2 2XNIA 1QQ4A 1SB1H 1GBHA 3TH2H 1QTFA 1SHHB 1KIGH 4IMZA 1QGFA 1GJ4H 1C1TA 1GI6A 2R0LA 2GD4B 4MPVA 2ZCKP 3A7TA 5C20A 3M3SA 4DIIH 3MNSA 5A0AE 2HPQH 3M35A 3T29A 1OOKB 3V7TA 5A0CA 1AFEH 5EW2H 4E06H 2FESH 1QBOA 2A2XH 4JCNA 2FOMB 1P9UA 1GBMA 7GCHF 1ZRBA 4NFEA 2P3UB 3TLOA 1AZ8A 1O5GH 3SGQE 1Y5UT 3GCHC 3MYWA 1BT7A 3PLPA 1OS8A 1QY6A 1SLXB 2ALVA 1ARBA 3P92A 1C2HA 2PLXA 2J92A 1ZRKA 4U32A 1TX6A 1LO6A 1BUIA 2ODQA 2Z9IA 1IQHA 1QBNA 5BRRE 1PYTD 1J17T 1GJAB 5L2ZH 3KQDA 1OXGA 1GPZA 2GDEH 3SJ9A 3VB4A 2GT8A 1K1LA 2HOBA 3HATH 1GBDA 4K1EA 2ULLA 5JBTA 1V2LT 3TITA 1V2WT 5T6GA 3S9AA 5F6MA 4ZUHA 4GAWA 1HPGA 3RXTA 1JXPA 2WPLS 3ZVCA 1V2MT 3NK8A 3LONA 2ASUB 1WTGH 4UE7H 1SHYA 3SV7A 2OXSA 2C8XB 1ZJDA 1GDNA 1WBGB 2XCNA 1K2I1 1UCYE 3RXDA 2AH4X 1N8OB 1GVKB 2CHAC 2TBSA 4FUIA 1CBWC 2Y7ZA 1T7CA 1GMCF 1ZTKA 1BBRE 4MPUA 4ZH8A 1SI5H 1QR3E 4IC6A 4MNVA 1P04A 4NSYA 3ZZ3A 1NRSH 1S85A 2QXJA 1TGCA 5LGOA 5E0JA 4BXSA 4Q7ZA 3RXRA 2BZAA 3LC3A 4XOJA 2ANKH 1GG6B 2DUCA 1Q3XA 3HK6B 1NFWA 7ESTE 5GCHF 1J14A 1O3IA 2ZQ2A 2O8LA 4AB9A 8GCHG 1VJ9U 4DOQA 3SV6A 5AFYH 1LVYA 5I46H 2WPMS 2B0FA 1ZPZA 1ZHMA 1Z8JB 1UHBA 3ZZ6A 3ODDA 2XW9A 4JYVH 5F8TA 1TGNA 1ABIH 3MU5A 1TQ7B 4ABBA 4OGYA 3SV2H 4XBCA 2ZFQH 5E2OA 2I6SA 2AMQA 1HAHH 1PFXC 3QUMP 1BHXF 3P8NA 3T27A 1HYLA 1CVWH 5AHGH 4Q80A 1G36A 1UVOA 1GJ9B 2QC2A 1SLUB 2AGIX 2VH6A 2GZ8A 4INHA 5CHAB 1AKSA 1BTWA 2TGTA 1PPBH 1P10A 3ZZAA 5I25A 4MG3A 1AVWA 1O2SA 2BDYA 2LNCA 3ZZ9A 1RIWC 3RXAA 3ZZ7A 1P03A 2A7JA 3BTKE 4E7RG 5AFZH 5DPAA 5EOKA 4JZDH 1S0RA 2FWWA 3M3TA 3TGKE 4X1RU 3KQEA 2PSYA 1HGTH 1XXFA 2JH5D 3I77A 1P57B 1KXDA 5L30H 5C1YA 1Z8RA 2GMTC 2C4FH 1ANEA 1QL8A 2PKSC 3B9FH 3BSQA 1C1MA 3MH4A 4DIHH 1TOCB 4MPWA 3H7TA 1EAXA 3P8FA 3HGPA 3RC4A 1S82A 1S5SA 4X1QU 4B75A 2OQUA 7LPRA 1MD8A 5BPEA 4KP0A 1D6WA 3A87A 2ZWLH 5GIBA 1HIAA 4F49A 2WV5A 3KNXA 4AB8A 1P05A 2H6MA 2BQWB 5E2PA 1QNJA 3RXIA 1CT2E 3ATLA 3BTEE 1O32A 4Q2KA 4YTAA 1V2VT 1GJCB 4X1SU 2F9BH 4XE4A 1GI2A 4X1NU 5DP5A 1HXFH 1JOUB 4WF8A 5IYTA 2STBE 1Y5AT 2P3FH 1FMGA 2SGFE 4OS7A 4RN6A 1GBIA 1EJMA 2M5TA 3BTTE 3MU1A 5TCCA 2BD2A 2XCFA 3QN7A 1DS2E 3FP8E 1GVZA 1HJAC 4HFPB 2PHBA 2A45B 1S84A 1J16A 1E34B 1D4PB 1AD8H 1QHRB 1RGQA 1MTNC 1RRKA 1G30B 3JZ2B 5GPIB 1SGYE 1WQSA 2ODPA 1HFDA 2W5EA 8LPRA 4YOGA 1LMWB 4TYDA 1H1BA 1O2OA 1BITA 2R3UA 3S0NA 1ELCA 1N1LA 5FCKA 4KTUA 4ISHH 2CMYA 3KQCA 5EXMA 1GJ8B 2EI8A 1HJ9A 2FLBH 2J9NA 1VJAU 1Z6EA 1IQEA 1YPMH 2EA3A 3BTWE 1ZSKA 4FUJA 3G01A 1O5DH 1BOQA 3U8TH 1L0ZA 4WMEA 2TGPZ 3M5NA 2P8OC 1GHVH 2BD9A 2ZEBA 1C5UA 6CHAB 3V12A 1O39A 4NZLA 5K7RA 1SQTA 3V13A 1MH0A 2PSXA 1SGQE 1O2NA 3QZRA 5ESTE 4NWKA 2BOHB 2BQ7B 1K1MA 3SNCA 1SPJA 1DSTA 1ZMJA 1G3DA 4BTIB 1A5GH 2RG3A 4JZ1A 4YM9A 2FX4A 3SORA 1ZSLA 5LPRA 1MKXH 1E37B 2C3SA 1E36B 2AIQA 4ZKSU 1KSNA 1P0SH 2PW8H 3SU6A 1XUGA 4CRFA 2Y5GA 2ZO3H 4BANB 1CGJE 1AUTC 1NRQH 1EP6A 2A7CA 1UCYH 4JMYA 1KDQA 4OS1A 3E3TA 1DE7H 1RS0A 3LC5A 3ZVBA 1LPKB 1LPGB 2SGDE 3VGCC 3M7UA 1V6DA 3R3GB 1W10U 1GI9B 2XWBI 2ZGXH 1P8VC 1SSXA 3TGJE 1VITF 3UUZA 2XBVA 3BTME 3H7OA 4SGBE 4K8BA 1HRTH 2H5DA 1K9OE 2EEKA 1PQAA 2TIOA 2UUYA 3PM3A 3RU4D 1AWHB 4GUXA 3ELAH 4WJG2 2ZGCA 5F03A 1EOLA 3LIWA 4GVUA 4XDEA 1GDQA 4ZHMU 3RXLA 2XTTB 4MNYA 3U98H 5C67A 1P12E 3KF2A 3MO9A 1O3AA 1GHXH 2ZPSA 1G2LA 3SQEE 4ISLA 1ELGA 1K1PA 4ZXYH 1MTUA 1MKXK 3QX5H 1C1VH 2Y82A 2VU8E 3M37A 4K1SA 5A09A 3Q3KA 4BAKB 1O3BA 4Y0ZE 1H8DH 4NFFA 1DY9A 2Z3DA 3TK9A 2WYGA 1S6FA 5FX5A 1RTFB 1HAYB 1UCYK 2THFB 1TOMH 2ZU4A 4NA9H 1BA8B 3KHVA 3A8DA 1MQ6A 5DP3A 4Z6AH 1C2GA 2BY7X 1TPAE 4NG9H 1O2MA 1WCZA 1Y59T 1C1PA 5LPEA 3PO1B 1NRNH 1SOTA 4NWLA 5DP7A 2XC0A 1N6YA 3A89A 1EJNA 3GDVA 3S9CA 1CHOF 2XRCA 1P3CA 1C9TA 1FNIA 3RXOA 4WXIA 1V2OT 2GV6A 2P93A 2ZP0H 4X6OA 5HYOA 1C2LA 3QZQA 2FI5E 2G51A 4FUFA 2FO9A 2FZZA 4WH6A 4FUCA 1O3EA 3LGWA 2UWOA 1C5MD 3TIUA 2C93B 3RMLH 2O8TA 4Y8XA 1SMFE 4GLYA 4THNH 4FVBA 4KGAA 3UIRA 1HB0B 1QCPA 1YCPM 1UTQA 1SGTA 5T3HA 1ESTA 1IQGA 2LPRA 1T8LA 1UTPA 3PMJA 3TNTA 4VGCC 3SU1A 1GI7B 3GCHB 2F9PA 2V3OH 2AIPA 5T6FA 1JRTA 4WWYA 1VITH 3MFJA 3URDA 5JBAS 4LOYH 1SGPE 1V2NT 2JH0D 4FU8A 2BD8A 3OY5U 3W94A 1G9IE 1ELVA 5DO4H 1THPB 1YGCH 3PWBA 2ZQ1A 1QQUA 1YPKH 3NUMA 2QA9E 1OPHB 1UJ1A 1XKBC 1OYQA 1H8IH 2W3KA 3KN2A 3RLYH 4DG4A 5EODA 5HGGA 2C8YB 3P8OA 3B8JA 5FBIA 2FMJA 3UWIA 2DE8A 2VIOA 4HZHA 4X6MA 2ZTZA 4AG2A 2ZCLP 4Y7BA 3SNDA 1VZQH 1AB9C 1F0RA 1NY22 4UD9H 2ZU3A 5DP9A 1C2FA 4GSOA 1GHYH 4I8LA 1P2IA 4MLFB 1FN6A 1MAYA 1G3CA 3LGIA 1Z1JA 4TY7A 2CN0H 2GZ9A 1RJXB 3KIDU 1D3QB 2C90B 2BQ6B 1O2PA 1EX3A 1O33A 2H9HA 2BY5X 2BXUH 1AY6H 1UHBB 3LGTA 3S7KB 1XXDA 1ZHRA 1FPHH 3LKWA 3AW1A 1CA8B 1TPSA 3PTBA 3T62A 1QL9A 3GCTG 1CA0C 2FTMA 1SG8B 4HTCH 3Q00A 4XBBA 3U9AH 2Q1JA 2B5TB 4B1TA 1Y3WA 4WMDA 4GPGA 1HUTH 1GCTC 1GI4A 5C2ZA 4I31A 1IHTH 2TRMA 2FLRH 2P95A 2Q6DA 1AKSB 1F0SA 1L1JA 4BOHA 2BX4A 3CP7A 4M7GA 3EDXB 4Y76A 3GY5A 4UFEH 4MTBA 1WSSH 2CF9H 4QT8C 1HAIH 1F7ZA 1QA7A 2A5IA 6ESTA 4ZHAA 4ZMAH 1MZDA 2B7DH 1NTPA 5C3NA 1FY8E 2ANYA 1AVXA 1EP5A 3R0FA 4X1PU 1MTWA 2P16A 1YF4A 2QYIA 3E90B 1CQQA 1GHAG 5AF9H 1ELFA 2J2UA 3A8AA 4DURA 1PPFE 3LGUA 1XUIA 2P3TB 2PKAB 3BIVH 1EKBB 4Y6DA 5GJ4B 1EQ9A 1YM0A 1A1RA 1BMAA 1DVAH 1CSOE 2ZDKA 1UVSH 3DFLA 3GY6A 3W95A 1GJDB 4ZHLU 1XVOA 4I33A 3E6PH 4CR5A 2VIDA 2PTNA 4CH8B 2OC8A 3A7ZA 2PGQB 3MTYA 1EAIA 4NCYA 2SGAA 3F9HA 1A0HB 1GBLA 3UR6A 2VIVA 1W11U 1W0YH 3E8LA 1O5AB 1TA6A 4MNXA 3MH5A 2Y6TA 2J94A 1HIAB 3FAOA 2AGEX 4TWYA 1BJVA 1NZQH 1YLCA 1C5SA 1E35B 2BY8X 1FY3A 2BVSH 3CS0A 1TX8A 1DM4B 2F9VA 1C2DA 1IOEA 4MPXA 4CRAA 4D9RA 2K7XA 1ANCA 1TGTA 2VGCC 2JH6D 1GMDG 3EQ0H 1HAOH 1P2KA 1V2JT 4B76A 3SZNA 3QDZB 3BG4C 2GMTB 3BEIB 4TPYA 1UK2A 4NA7A 1K28D 1O3GA 2Y81A 4O97A 1VGCB 1AIXH 4AYVB 3I78A 1OWDA 4BAMB 3SU2A 1QRZA 3SNEA 1WTHD 2D8WA 5DGJA 2VJ1A 2ZG0H 1TMTH 1ANBA 1YCPH 4UEHH 2AMPA 3LH3A 3UOUA 1ETTH 1W7XH 1V2ST 5K0HA 1C1NA 2R0KA 4GCHG 1EPTC 1A7SA 4ZAEA 1JWTA 1O3CA 2VWMA 2FEQH 1A0LA 3EBNA 1O30A 1GVLA 2UUJB 2F9NA 1UVUH 2WUBA 3RMMH 1CE5A 1WOFA 1DWCH 1ZGVA 2GDDA 5JB8S 1TLDA 1NS3A 2QV1A 4LK4A 2EI6A 1FY4A 1O2VA 1NM6A 3SU4A 4YZUA 1SC8U 1MUEB 1OWEA 2FI3E 3QGJA 2UWLA 1ETRH 1P2QA 1C5ZB 5L2YH 2SGPE 2O8UA 2Q6FA 2BOKA 5FAHA 3SGAE 1BTUA 1H9IE 1YYY1 1L1GA 1KXCA 3EGKH 4X8TH 4Y8YA 5G4BA 1AE8H 1JRSA 1OSSA 2F91A 2WPKS 3SJKA 1A2CH 1O3PB 1T32A 5B6OA 1P11E 1OWKA 1EXFA 3F6UH 5HXFA 2RDLA 1GI5A 4A1TA 3ZZDA 1GHBG 1EATA 1H4WA 2ALPA 2A0QB 5EXNA 2ZPRA 3UWJH 4JZIA 3VB7A 5J4QA 1D3TB 1F5RA 1QJ7B 1KLTA 2GCTC 1ZMNA 1J15A 3GYLB 1C5RA 1KDQB 1LQDB 1Z71A 3SV9A 1UK4A 2B9LA 4XBDA 2XC4A 1P06A 3GY8A 3FZZA 1AFQC 2H9TH 1WYKA 3SHAH 3BTFE 3OSYA 4INLA 1UK3A 1BB0B 3RMNH 1C5XB 3MH7A 2QF0A 4X2XA 2BDBA 3TH4H 3WY8A 2GTBA 2G5NA 1KXBA 4MNWA 3E0NB 3T25A 1P3EA 3A7WA 1AHTH 2R9PA 2ZGJA 1D3DB 3BN9A 4YOIA 5EQRA 4I7YH 3ZVAA 4CBNA 2Z9GA 1F0TA 2UUFB 3TK6A 7GCHG 1FV9A 3SJOA 4I8JA 2ZF0H 1UTJA 4IS5A 1GBCA 1FXYA 1O2LA 1O2QA 3BV9B 2EI7A 1O3FA 4WVPE 4NIXA 1ELTA 5FCRA 1O35A 3MU4A 1EAWA 1HAVA 1PQ8A 2ZHEH 1GL0E 1OX1A 2VVUA 4CRGA 2P59A 1MQ5A 3KCGH 1QJ6B 1WUNH 1MU8B 1ELBA 5HMAA 3SU0A 1TMUH 1ZHPA 2FYRA 2A5AA 4IN2A 4TY6A 1NU9A 3BEUA 1V2KT 2TGAA 1X7AC 4K5ZA 2ZNKH 4Y11E 3FFGA 1QRWA 1LHDH 4Y8ZA 2WV4A 2A4RA 2AGGX 4INKA 2HNTE 2OUAA 4AOQA 1O5EH 4HGCA 1W14U 1K21H 2ZU5A 2Y5FA 3LOXA 3P6ZB 2V3HH 1YBWA 1O31A 5J4SA 3B23B 4BAOB 3LGYA 1THRH 2R2MB 3PV4A 3TPIZ 5EU8A 8ESTE 1XUHA 2VVCA 2FTLE 1GMCG 3RXVA 2Z3CA 3RXJA 4K3JA 3UNSA 1B0EA 1PPCE 1XUJA 4CHAB 3T2NA 3PMBB 3PLBA 5EPYA 4A7IB 5DKMA 3UQOA 5JPMH 1AWFH 2A32A 2JETB 1TE0A 4IN1A 4LXBH 3UNRA 4X8VH 1HDTH 2FX6A 2HWLB 2FODA 4TWWA 2J4IA 3VFEA 2ZFSA 3VXEH 2A31A 5GCHG 2W3IA 1N8OC 3RM0H 5GXPA 1G3BA 3F68H 2A5KA 1T4UH 3LJJA 2ZFTA 1FY1A 4NA8A 4FU7A 1L4DA 1ESAA 4X0WU 5A8XA 4NZQA 2AS9A 1BHXB 1XMNB 1C5TA 1O3OA 2BB4A 1GG6C 1MAXA 2AEIH 3UNQA 4AX9H 3A8CA 1T8NA 2FYQA 5EG4A 5F8ZA 4AG1A 3FZDA 3RXKA 2A4OA 1YKTA 1DX5M 3RC6A 1KLJH 2A4GA 1O5BB 1TFXA 2KAIA 2OBOA 1RD3B 4KKDA 1GGDB 1IQIA 2BD5A 4XSKU 1WAYB 3A85A 4Y79A 1GI3A 1LHCH 1C1UH 2SNWA 5ETXA 1O5FH 1SGCA 1GMHF 6GCHF 3SQHE 1P2OA 2O8WA 4B2BA 3GDUA 1UVPA 3RU4E 3NCLA 3T5FH 4BTTB 4WY3A 3GYMA 2Z6BD 4JK6A 4OS6A 3ZZCA 1FZZA 3PYHA 2BMGB 3MOCA 3NXPA 3A86A 3L33A 1UTLM 1NPMA 1EOJA 3MU8A 2ZGHA 5CHAC 1W8BH 1BBRH 2FP7B 1O2UA 1SFIA 4YT7H 2PTCE 4JYUH 4UDWH 3SV8A 4ABAA 3A7VA 2GCHF 1FI8A 2HPPH 1DUAA 2QXGA 1DDJA 2LIZA 1TX7A 3QTVH 3ZV9A 5A8ZA 3AAUA 1O3DA 2OC7A 4LZ1H 4YO9A 3ODFA 1YPHE 2SGEE 1C1RA 2BXTH 1EJAA 1O2KA 3FVFB 3K2UA 2G55A 2WPHS 2BTCE 4X8UH 3TJVA 1IAUA 2H2ZA 1LQEA 5L6NH 3E91A 4IMQA 1O2ZA 4PROA 1Q2WA 1FPCH 1SL3A 1W3CA 2G8TA 3LJOA 3A80A 1C5PA 2OLGA 2QGRA 1MBMA 1D9IA 2JKHA 3LDXH 5DK1A 1ZYOA 5E0HA 1MMJN 2VVVA 2NU2E 3RXCA 3T28A 1A4WH 1TWXB 1J9CH 3O8DA 3SGBE 1O2JA 1EZSC 1NO9H 1HAXB 3UPEA 2BY6X 3GY4A 1BBRK 3P17H 2J95A 1MCTA 1C1SA 2FS9A 3DFJA 1O0DH 3MWIU 1KLIH 4LZ4B 3V0XA 1TALA 2ZA5A 1KTTB 4DVAU 3MNXA 1A61H 3RLWH 4XFQA 3A8BA 1NN6A 1W13U 1B7XB 1FJSA 3SHCH 1INCA 4GHTA 2HGTH 1A0JA 4J2YB 3RU4T 4DY7B 1Y3VA 4ZKNU 1P2NA 1FONA 5TJXA 3SUDA 3P70B 5DP6A 1QB6A 4KTCA 1HV7A 4Y71A 1SQOA 3F9FA 1UMAH 4OS2A 1VCQA 1GL1A 3ZYDA 1TRYA 1BRUP 3TU7H 3ZYEA 1PPEE 1WQVH 4U30A 1P01A 3EA7A 1TGBA 1ZTLA 1SGFA 1ZPCA 3LH1A 1PYTC 2Z9JA 4CR9A 3H5CB 2FOBA 3FP7E 2BY9X 4AGJA 1SGIB 1KYNA 1ZPBA 1C2MA 2NU0E 2XYAA 3RXHA 3SNBA 2ZI2H 1LCYA 3KEEA 4B2CA 5HM9A 2FDAA 1U6QA 5A2MH 3A82A 2AFQB 1N6XA 3DA9B 1GDUA 2Z94A 5A0BA 2AMDA 3HK3B 1KXEA 1S83A 1SOZA 6CHAC 2A7HA 4B2AA 1NFXA 2ANWA 4R0IA 1O3NA 2V35A 4YT6H 5CE1A 3TVJB 1ID5H 1FIWA 1QRXA 1T8MA 3VPKA 1GBJA 1GI8B 3M3VA 2FIRH 3K9XB 4ESTE 4RKOB 1K1IA 2F83A 2C8WB 1VITG 2CHAB 1CBWB 1B0FA 2FOCA 3C27B 1DANH 3AASA 2NWNA 3ZVFA 3BTQE 4CRBA 1SGDE 2Y5HA 5EGMA 1NESE 2CV3A 1BMMH 3PROA 5FPYA 4NIVA 1K22H 3F9GA 1SBWA 2XXLA 2G52A 1IQNA 5TCAA 1LKBA 1CT0E 3Q3YA 1RFNA 4KELA 1ESBA 3DT0H 2ZHWH 1MU6B 2BLQA 1AQ7A 3SU5A 1ZTJA 5H4IB 3OYPA 3ATKA 1F92A 4OS5A 4Q7YA 2VWOA 1CO7E 4YOJA 2Z9KA 2G81E 2NU1E 2OC0A 2PR3A 1PPGE 2TGDA 1TAWA 1GJ6A 3RXBA 1O2RA 2HALA 3ZVEA 4WH8A 5C1UA 1SLWB 1F2SE 1C2JA 1O3HA 2PWXA 1DY8A 2D1JA 2P94A 3F1SB 1A3EH 3OX7U 3TJOA 4ABIA 1C4V2 1OYTH 2FS8A 4DGJA 2A2QH 3STIA 1AFQB 1HAVB 3GY7A 1CHOG 1BCUH 2YNBA 1P2JA 1F5LA 4FUEA 1K1OA 4WXVA 4HI3A 4JZFH 1DLEA 1UTKA 2XBWA 4IGDA 3SUFA 2STAE 1TBRH 3TGIE 2BD3A 1GJ7B 3PO1C 1C1OA 1C2KA 3O8CA 3VB6A 2ZHDA 3E1XB 3P95A 1RIWB 1O3LA 3P8GA 4R8TB 4AZ2B 1A46H 5ABWA 2J34A 2RA0A 1TNHA 2ZDAH 6LPRA 2CGAA 3VEQB 3MO6A 1B5GH 1O2WA 4IC5A 3ITIA 1LVBA 2VIQA 2VIPA 1C1WH 5FHTA 1VCWA 4JK5A 3AVZA 1GBFA 3ZVGA 2PKSB 3SUEA 3RXUA 3UY9A 2F3CE 3TH3H 4K1TA 2DE9A 1BRBE 3NWUA 3AAVA 3QO6A 1SR5C 3ATIA 4ABEA 2ZKSA 1KY9A 5T6DA 1GI1A 4CRDA 1LHGH 1HLTH 1EZQA 2Q6GA 3BEFB 2BLOA 2I6QA 2ZHQH 2ZECA 1YPEH 1RXPA 2CJIA 4AFUA 3URCA 3UQVA 4A1XA 2WUCA 5C5NA 4A6LA 4YESB 1QJ1B 4X8SH 1EZUC 1MD7A 4ASHA 1BTZA 2O9QA 5EW1H 4SGAE 2F9UA 3SI4H 3A7XA 3EA9A 1OWHA 5JDUB 1J8AA 2HLCA 1IQMA 3O8BA 1BTXA 3M7QA 1F5KU 4Y7AA 1BJUA 1QFKH 5EXLA 4UFGH 1C2EA 1GBEA 2Z3EA 1WV7H 4A92A 2HNTC 4B73A 2FOFA 2ZTXA 4I8GA 1BZXE 1P09A 1TNGA 1AI8H 1EUFA 1YC0A 5GDSH 1FIZA 2CF8H 4ISOA 1QB1A 5HM2A 1GBKA 3RUOA 1HJAB 1AO5A 1MCVA 1D3PB 1L4ZA 2KAIB 2R2WU 3TJUA 5FXLA 1DOJA 2V6NA 3U1IB 1EPTA 1MTNB 2Z7FE 1NC6A 2FM2A 3KL6A 1L1NA 5EQSA 1AMHA 3K6YA 1AU8A 1T31A 4RSPA 2OP9A 2SFAA 1YCPK 2SNVA 3ATWA 2BHGA 2QAAA 1G3EA 2AERH 3PLKA 4FUDA 9ESTA 1LVMA 1DT2A 3EE0B 1C5NH 3LT3A 3OU0A 3L6PA 3UREA 5FPTA 4FUGA 3SJ8A 2ZTYA 2NU4E 3U69H 4UFFH 1TNIA 3M5MA 2BD7A 3VB5A 1ETSH 4IBLH 1C5YB 4ZKOU 2P8OB 2OBQA 1CT4E 2BVXH 4ABFA 3FP6E 4AFZA 1TPPA 1O2XA 3CS7A 1T8OA 9LPRA 4K8YA 2QN5T 3LU9B 1BRCE 3MNBA 2VIWA 2ZGBH 2RA3A 3M7TA 3PB1E 1ACBE 3D62A 3TNSA 5PTPA 1H9HE 3S69A 4X6PA 1VR1H 1O3JA 3L3TA 2QY0B 1BRAA 3GICB 4ZKRU 3BTHE 4DCDA 1RTLA 3TK5A 1V2UT 3V3MA 1QL7A 4U01A 3MNCA 1DWDH 2G4TA 4FUBA 4OGXA 1NRRH 1Z8GA 1O37A 1O3KA 2FOEA 4O03A 4I8KA 4MVNA 3MMGA 4D9QA 2Y80A 1MZAA 2AYWA 5C5OA 3ZZ8A 3KQBA 3VGCB 4AN7A 4K69A 1Z1IA 1LHFH 1FAKH 2IJOB 3NPSA 3O8RA 4TPIZ 1NROH 2ZHFH 1C5OH 3MH6A 4NIWA 2UUKB 5GWZA 3UTUH 1TRMA 1FUJA 2BDHA 1BIOA 1BTPA 1GHZA 1XM1A 1ELAA 1TMBH 4WMFA 1C5QA 2ZDNA 1OWIA 1BDAA 1QIXB 2ZFFH 2H9EH 2FOAA 3A81A 1E0FD 1DLKB 3ZVDA 2PKAA 3SNAA 1TNKA 1FLEE 4NGAH 5F8XA 4Y0YE 1YPLH 3S9BA 2OCVB 4K2YA 4CRCA 2VINA 1EB1H 2R3YA 3RXPA 1TNJA 1C9PA 3GISB 1E38B 1GI0A 1VGCC 2BDCA 3BG8A 1ORFA 1DWBH 3SOSA 3Q77A 4B74A 4Y10E 4B71A 1HXEH 1P2MA 1YPHC 4O3TA 1OP8A 2D2DA 1O2IA 1ZLRA 5C1XA 2H5CA 1S6HA 5DG6A 1SVPA 2V0BA 5IDKA 3M61U 2G4UA 1O3MA 2YOLA 3A7YA 1ZZZA 5FX6A 4U2WA 3K6ZA 3OTJE 1JMOH 5EQQA 4X2VA 1AZZA 1L2EA 1FY5A 4I32A 2BX3A 4BXWA 1HAPH 2A1DB 2VWNA 1C5WB 1GBTA 2ZDVH 1TNLA 1NFUA 1SGFG 1XVMA 1NT1A 2B8OH 2SGQE 2UWPA 2FI4E 3I29A 4YLQH 2ZPQA 3E0PB 1TONA 1V2TT 4AFSA 2BZ6H 4DJZB 1CGHA 2J38A 2ZFRH 4JZEH 4E7NA 2OD3B 4ZXXH 1O2TA 2QIQA 1MTVA 4DT7B 2G00A 1BTYA 3IWMA 1F0UA 1GCDA 4VGCB 1SGNE 1TB6H 1H9LB 2ZFPH 4O3UA 3ZZBA 4CBOA 3AW0A 3A84A 3BF6H 3STJA 1MKWH 3RXQA 2FPZA 5E0GA 3JZ1B 1IQFA 2GGVB 3SJIA 5E8EH 1DITH 2W26A 2ZZUH 1P02A 1SGEE 2ESTE 2GVFA 1UO6A 4H6TA 1EZXC 1K1JA 3QLPH 4RKJB 1TQ0B 1TA2A 2FOHA 3DHKH 4NSVA 1QB9A 2RCEA 1EAUA 3VB3A 1ZOMA 1BMNH 1ZJKA 5CMXH 2ZU2A 1NRPH 4D76A 1GJ5H 2BVRH 1O2HA 1S0QA 1AB9B 3MO3A 2ZDMA 4UFDH 4X2WA 1GWAA 1TBZH 2VNTA 4GHQA 2PUQH 1QURH 3RXFA 1ZR0A 3DD2H 1LVOA 2C8ZB 4ABHA 2D26C 1C4U2 4YLUA 3NKKA 1OP0A 1HJ8A 3PTNA 1C2IA 1IHSH 4ABGA 1IQKA 1FDPA 4ABDA 1YLDA 3BTDE 1EB2A 4OS4A 1G32B 2ODYB 3N7OA 1DSUA 1ZGIA 1DPOA 1TRNA 1MKWK 1DWEH 1CA0B 1ELEE 1KTSB 1CHGA 4E05H 1G2MA 1BQYA 3C1KA 3RXGA 1C5VA 1EASA 1Y8TA 1HCGA 2BYAX 4AGKA 1M9UA 1UTNA 1KXAA 2HVXA 1V3XA 3SI3H 1TGSZ 3RDZA 1PQ5A 1GCTB 2HNTF 3S7HB 4JYTA 1Y3UA 2W7UA 2PGBB 3QTOH 2GX4A 2GT7A 1TBQH 4MQAA 3QK1A 4ISNA 1MBQA 2WINI 3FANA 3QGNB 4IW4E 2ANMH 5FBEA 3RXSA 4FUHA 1K1NA 1WU1A 3GCTF 4FXGH 2XWAA 3SUGA 2PFEA 3ENSB 4ISIH 1C4Y2 2GV7A 4X6NA 2ZC9H 3T26A 1PQ7A 1SQAA 1ZMLA 1OP2A 3MHWU 2OC1A 4O9VA 1UTOA 1LDTT 1TIOA 4BAHB 1W2KH 1JIRA 2XBYA 2GP9B 4MDSA 1JIMA 2BLWA 1QA0A 3ATMA 5ESBA 1C1QA 1DXPA 3RM2H 2FXRA 2HRVA 1W7GH 3GOVB 5DJ7A 3A83A 4AYYB 2H1UA 3QWCH 2F9OA 1DICA 3RP2A 3F9EA 4K60A 1V2QT 1LPZB 1LKAA 1DUEA 2QCYA 3SO3A 1IQJA 3D23A 2OINA 2WYJA 1O38A 1S81A 4Q7XA 1XUFA 2K1QA 3D65E 1GHAF 4CHAC 7KMEH 3KGPA 1CU1A 4A5TS 4CH2B 3UFAA 4CREA 2IOTA 4FVDA 1AVGH 1W12U 4FU9A 3EAJA 2JETC 1MTSA 1G37A 1A5IA 4NIYA 3RXMA 4AORA 5JB9S 2GZ7A 2VGCB 5SGAE 3M5OA 1KXFA 1OWJA 3BTGE 1Q31A 1A5HA 1W0ZU 5LH8A 3A88A 2XC5A 3BG4B 3BIUH 4DW2U 1Y3XA 3PMAB 5JBCS 5LPFA 2BDIA 2PV9B 3M36A 1ZSJA 2ZDLA 2W7SA 1UTMA 1OKXA 3K65B 3DUXH 2Y7XA 2QXIA 1GMHG 1BMLA 2ZU1A 6GCHG 2NU3E 3NZIA 1TABE 3EYDA 1P9SA 3RMOH 4H6SB 5EPNA 8GCHF 3HKJB 3UOPA 1C5LH 2QXHA 1RTKA 3PWCA 4BTUB 1HBTH 1GMDF 1UVTH 3D49H 2BLVA 1EPTB 3MI4A 3Q3XA 2XBXA 3HKIB 4D8NA 1XX9A 1GGDC 1LHEH 4Z0KA 3ZV8A 3OY6U 2IPHA 2ZCHP 1V2PT 2GKVE 1Z8IB 1SGRE 1ABJH 1THSH 4F4OC 4BAQB 1PJPA 2TPIZ 4I8HA 4A1VA 4D7FA 1A3BH 3ESTA 3SN8A 2GCHG 3GY2A 1O2GH 3TJNA 4ZROA 3HGNA 5DP8A 1FAXA 3SBKA 5JBBS 1YPJH 3Q76A 3GDSA 3LPRA 1IQLA 4GCHF 1SLVB 2EC9H 3M5LA 2BD4A 3VXFH 1D6RA 2ILNA 2PUXB 1PPZA 3RC5A 2G5VA 3HPTB 3GCOA 2WPIS 1SFQB 1GJBB 1TYNA 1GHWH 2OQ5A 1TPOA 3SU3A 3RXEA 1NFYA 1ARCA 3CENA 1BTHH 2O8MA 2Z9LA 3UR9A 1YP9A 1HAGE 1HNEE 1AN1E 1AE5A 2YNAA 1GBAA 3ZZ4A 3IITA 3LGVA 2VB0A 4X2YA 2CXVA 3U8OH 1T4VH 2ZIQH 1CGIE 1XUKA 5FPSA 1QBVH 1LTOA 2QF3A 3PMHB 2GCTB 1ELDE 2VH0A 1Y3YA 3SW2B 3GCNA 3E16B 4H42U 1FN8A 2OTVA 1Z6JH 1VCPA 3MU0A 3U8RH 4AFQA 1GBBA 1GHBF 1AUJA 1HAZB 3EA8A 2BDGA 1O5CB 1NU7B 2WPJS 3GY3A 4J1YA 2VWLA
chains in the Genus database with same CATH superfamily
3IG6B 4UONA 2FOGA 1Z7KA 2IN2A 5A8YA 5AVDA 1DXWA 4BNRA 2A4QA 1JBUH 1O2YA 4H4FA 3FOAA 1ANDA 3ZZ5A 2BDAA 1XKAC 2BM2A 1O34A 1PPHE 2WZQA 3U1JB 5EIYA 1AGJA 4D7GA 4KTSA 1V2RT 5JYIA 1DFPA 1Y5BT 1O36A 1YPGH 1FQ3A 5DP4A 4ABJA 8KME2 2XNIA 4M9FA 3PRDA 1QQ4A 1SB1H 1GBHA 3TH2H 1QTFA 1SHHB 1KIGH 4IMZA 1QGFA 1GJ4H 1C1TA 1GI6A 2R0LA 2GD4B 4MPVA 2ZCKP 3A7TA 5C20A 3M3SA 4DIIH 3MNSA 5A0AE 2HPQH 3M35A 3T29A 1OOKB 3V7TA 2GJGA 5A0CA 1NBME 1AFEH 5EW2H 4E06H 2FESH 1QBOA 2A2XH 4JCNA 2FOMB 1P9UA 1GBMA 7GCHF 1ZRBA 4NFEA 2P3UB 3TLOA 1AZ8A 1O5GH 3SGQE 1Y5UT 3GCHC 2F4LA 3MYWA 2W6JD 1BT7A 3PLPA 1OS8A 1QY6A 1SLXB 2ALVA 1ARBA 3P92A 1C2HA 2PLXA 2J92A 1ZRKA 4U32A 1TX6A 1LO6A 1BUIA 2ODQA 2Z9IA 1IQHA 1QBNA 5HIZA 5BRRE 1PYTD 1J17T 1GJAB 5L2ZH 3KQDA 1OXGA 1GPZA 2GDEH 3SJ9A 3VB4A 2GT8A 1K1LA 2HOBA 3HATH 1GBDA 4K1EA 2ULLA 5JBTA 1V2LT 3TITA 1V2WT 5T6GA 2QF4A 3S9AA 5F6MA 2WPDD 4ZUHA 4GAWA 1HPGA 3RXTA 1JXPA 2WPLS 3ZVCA 1V2MT 3NK8A 3LONA 2ASUB 1WTGH 4UE7H 1SHYA 3SV7A 1W0KD 2OXSA 2C8XB 1ZJDA 1GDNA 1WBGB 2XCNA 1K2I1 1UCYE 3RXDA 2AH4X 1N8OB 1GVKB 2CHAC 2TBSA 4FUIA 1CBWC 2Y7ZA 1T7CA 1GMCF 1ZTKA 1BBRE 4MPUA 4ZH8A 1SI5H 1QR3E 4IC6A 4MNVA 1P04A 4NSYA 3ZZ3A 1NRSH 2W6ID 1S85A 2QXJA 1TGCA 5LGOA 3DSPA 5E0JA 4BXSA 4Q7ZA 2KZ4A 5IK2D 3RXRA 2BZAA 3LC3A 4XOJA 2ANKH 1GG6B 2DUCA 1Q3XA 3HK6B 1NFWA 7ESTE 5GCHF 1J14A 1O3IA 2ZQ2A 2O8LA 2L74A 3F2HA 4AB9A 8GCHG 1VJ9U 2EY4C 4DOQA 3SV6A 5AFYH 1LVYA 5I46H 2WPMS 2B0FA 1ZPZA 1ZHMA 1Z8JB 1UHBA 3ZZ6A 2KX4A 3ODDA 2XW9A 4JYVH 1FX0B 5F8TA 1TGNA 1ABIH 3MU5A 1TQ7B 4ABBA 4OGYA 3SV2H 4XBCA 2ZFQH 5E2OA 2I6SA 3CNRA 2AMQA 1HAHH 1PFXC 3QUMP 1BHXF 3P8NA 3T27A 1HYLA 1CVWH 5AHGH 4Q80A 1G36A 2PP6A 2KCOA 1UVOA 1GJ9B 2QC2A 1SLUB 2AGIX 3WWBA 2VH6A 2GZ8A 4INHA 5CHAB 1AKSA 1BTWA 2TGTA 1PPBH 1P10A 3ZZAA 5I25A 4MG3A 1AVWA 1O2SA 2BDYA 2LNCA 4XRNA 3ZZ9A 1RIWC 4Z1MD 3RXAA 3ZZ7A 1P03A 2A7JA 3BTKE 4E7RG 5AFZH 5DPAA 5EOKA 4JZDH 1S0RA 2FWWA 3M3TA 3TGKE 4X1RU 3KQEA 2PSYA 1HGTH 1XXFA 2JH5D 3I77A 2WHXA 1P57B 1KXDA 5L30H 5C1YA 1Z8RA 2GMTC 2C4FH 1ANEA 1QL8A 2PKSC 3B9FH 3BSQA 1C1MA 1S6LA 3MH4A 4DIHH 1TOCB 4MPWA 3H7TA 1EAXA 3P8FA 3HGPA 3RC4A 1S82A 1S5SA 4X1QU 4B75A 2OQUA 7LPRA 1MD8A 5BPEA 4KP0A 1D6WA 3A87A 2ZWLH 5GIBA 1HIAA 4F49A 2WV5A 3KNXA 4AB8A 1P05A 2H6MA 2BQWB 5E2PA 1QNJA 3RXIA 1CT2E 3ATLA 3BTEE 2JDID 1O32A 4Q2KA 4YTAA 1V2VT 1GJCB 4X1SU 2F9BH 4XE4A 1GI2A 4X1NU 5DP5A 1HXFH 2QF5A 1JOUB 4WF8A 5IYTA 2STBE 1Y5AT 2P3FH 1FMGA 2SGFE 5C0UA 4OS7A 4RN6A 1GBIA 1EJMA 2M5TA 3BTTE 3MU1A 5TCCA 2BD2A 2XCFA 3QN7A 1DS2E 3FP8E 1GVZA 1HJAC 4HFPB 2PHBA 2A45B 1S84A 1J16A 1E34B 1D4PB 1AD8H 1QHRB 1RGQA 1MTNC 1RRKA 1G30B 3JZ2B 5GPIB 1SGYE 1WQSA 2ODPA 1HFDA 2W5EA 8LPRA 4YOGA 1LMWB 4TYDA 1H1BA 1O2OA 1BITA 2R3UA 3S0NA 1ELCA 1N1LA 5FCKA 4KTUA 4ISHH 2CMYA 3KQCA 5EXMA 1GJ8B 2EI8A 1HJ9A 2FLBH 2J9NA 1VJAU 1Z6EA 1IQEA 1YPMH 2EA3A 3BTWE 1ZSKA 4FUJA 3G01A 1O5DH 1BOQA 3U8TH 1L0ZA 4WMEA 2TGPZ 3M5NA 2P8OC 1GHVH 2BD9A 2ZEBA 1C5UA 6CHAB 4HG6A 3V12A 1O39A 4NZLA 5K7RA 1SQTA 3V13A 1MH0A 2PSXA 1SGQE 1O2NA 3FO8D 3QZRA 5ESTE 4NWKA 2BOHB 2BQ7B 1K1MA 3SNCA 1SPJA 1DSTA 1ZMJA 1G3DA 4BTIB 1A5GH 2RG3A 4JZ1A 2J5UA 4YM9A 2FX4A 3SORA 1ZSLA 5KECA 5LPRA 1MKXH 1E37B 2C3SA 1E36B 2AIQA 4ZKSU 1KSNA 1P0SH 2PW8H 3SU6A 1XUGA 4CRFA 2Y5GA 2ZO3H 4BANB 1CGJE 1AUTC 1NRQH 1EP6A 2A7CA 1UCYH 4JMYA 1KDQA 4OS1A 3E3TA 1DE7H 1RS0A 3LC5A 3ZVBA 1LPKB 1LPGB 2SGDE 3VGCC 3M7UA 1V6DA 3R3GB 5CDFE 1W10U 1GI9B 2XWBI 2ZGXH 1P8VC 1SSXA 3TGJE 1VITF 3UUZA 2XBVA 3BTME 3H7OA 4SGBE 4K8BA 1HRTH 2H5DA 1K9OE 2EEKA 1PQAA 2TIOA 2UUYA 3PM3A 3RU4D 1AWHB 4GUXA 3ELAH 4WJG2 2ZGCA 4B6FA 5F03A 1EOLA 3LIWA 4GVUA 4XDEA 1GDQA 4ZHMU 3RXLA 2XTTB 4MNYA 3U98H 5C67A 1P12E 3KF2A 3MO9A 1O3AA 1GHXH 2ZPSA 1G2LA 3SQEE 2JJ1D 4ISLA 1ELGA 1K1PA 4ZXYH 1MTUA 1MKXK 3QX5H 1C1VH 2Y82A 2VU8E 3M37A 2QE7D 4K1SA 5A09A 3Q3KA 4BAKB 1O3BA 4Y0ZE 1H8DH 4NFFA 1DY9A 2Z3DA 3TK9A 2WYGA 1S6FA 5FX5A 1RTFB 1HAYB 1UCYK 2THFB 1TOMH 2ZU4A 4NA9H 1BA8B 3KHVA 3A8DA 1MQ6A 5DP3A 4Z6AH 1C2GA 2BY7X 2IPQX 1TPAE 4NG9H 1O2MA 1WCZA 1Y59T 1C1PA 5LPEA 3PO1B 1NRNH 1SOTA 4Q4LA 4NWLA 5DP7A 2XC0A 1N6YA 3A89A 1EJNA 3GDVA 3S9CA 1CHOF 3OE7D 2XRCA 1P3CA 1C9TA 1FNIA 3RXOA 4WXIA 1V2OT 2GV6A 2P93A 2ZP0H 4X6OA 5HYOA 1C2LA 3QZQA 2FI5E 2G51A 5EJLA 4FUFA 2FO9A 2FZZA 4WH6A 4FUCA 1O3EA 3LGWA 2UWOA 1C5MD 3TIUA 2C93B 3RMLH 2O8TA 4Y8XA 1SMFE 4GLYA 4THNH 4FVBA 1SQRA 4KGAA 3UIRA 1HB0B 1QCPA 1YCPM 1UTQA 1SGTA 5T3HA 1ESTA 1IQGA 2LPRA 1T8LA 1UTPA 3PMJA 3TNTA 4VGCC 3SU1A 2J98A 1GI7B 3GCHB 2F9PA 2V3OH 2AIPA 5T6FA 1JRTA 4WWYA 1VITH 3MFJA 3URDA 5JBAS 4LOYH 1SGPE 1V2NT 2JH0D 4FU8A 2BD8A 3OY5U 3W94A 1G9IE 1ELVA 4F55A 5DO4H 1THPB 1YGCH 3PWBA 2ZQ1A 1QQUA 3N99A 1YPKH 3NUMA 2QA9E 2JIZD 1OPHB 1UJ1A 1XKBC 1OYQA 1H8IH 2W3KA 3KN2A 3RLYH 4DG4A 5EODA 5HGGA 2C8YB 2L6OA 3P8OA 3B8JA 5FBIA 2FMJA 3UWIA 2DE8A 2VIOA 4HZHA 4X6MA 3SZEA 2ZTZA 4AG2A 2ZCLP 4Y7BA 3SNDA 1VZQH 1AB9C 1F0RA 1NY22 4UD9H 2ZU3A 5DP9A 1C2FA 4GSOA 1GHYH 4I8LA 1P2IA 4MLFB 1FN6A 1MAYA 1G3CA 3LGIA 1Z1JA 4TY7A 2CN0H 2GZ9A 1RJXB 3KIDU 1D3QB 2C90B 2BQ6B 1O2PA 1EX3A 1O33A 2H9HA 2BY5X 2BXUH 1AY6H 1UHBB 3LGTA 3S7KB 1XXDA 1ZHRA 1FPHH 2V7QD 3LKWA 3AW1A 1CA8B 1TPSA 3PTBA 3T62A 1QL9A 3GCTG 1CA0C 2FTMA 1SG8B 4HTCH 3Q00A 4XBBA 1H8HD 3FN8A 5EJZA 3U9AH 2Q1JA 2B5TB 4B1TA 1Y3WA 4WMDA 4GPGA 1HUTH 1GCTC 1GI4A 5C2ZA 4I31A 1IHTH 2TRMA 2FLRH 2P95A 2Q6DA 1AKSB 1F0SA 1L1JA 4BOHA 2BX4A 3CP7A 4M7GA 3EDXB 4Y76A 3GY5A 4UFEH 4MTBA 1WSSH 2CF9H 4QT8C 1HAIH 1F7ZA 1QA7A 2A5IA 2AHME 6ESTA 4ZHAA 4ZMAH 1MZDA 2B7DH 1NTPA 5C3NA 1FY8E 2ANYA 1AVXA 1EP5A 3R0FA 4X1PU 1MTWA 2P16A 1YF4A 2QYIA 3E90B 1CQQA 1GHAG 5AF9H 1ELFA 2J2UA 3A8AA 4DURA 1PPFE 3LGUA 1XUIA 2P3TB 2PKAB 3BIVH 1EKBB 4Y6DA 4RT0A 5GJ4B 1EQ9A 1YM0A 3N7EA 1A1RA 1BMAA 1DVAH 1CSOE 2ZDKA 1UVSH 3DFLA 3GY6A 3W95A 1GJDB 4ZHLU 1XVOA 4I33A 3E6PH 4CR5A 3F2FA 2VIDA 2PTNA 3AK5A 2KM0A 2OC8A 4CH8B 3A7ZA 2PGQB 3MTYA 1EAIA 4NCYA 2SGAA 3F9HA 1A0HB 1GBLA 3UR6A 2VIVA 1W11U 1W0YH 4P02A 3E8LA 1O5AB 1TA6A 4MNXA 3MH5A 2Y6TA 2J94A 1HIAB 3FAOA 2AGEX 4TWYA 1BJVA 1NZQH 1YLCA 1C5SA 1E35B 2BY8X 1FY3A 2BVSH 3CS0A 1TX8A 1DM4B 2F9VA 1C2DA 1IOEA 4MPXA 5KGOA 4CRAA 2K7XA 1ANCA 1TGTA 2VGCC 2JH6D 1GMDG 3EQ0H 1HAOH 1P2KA 1V2JT 4B76A 3SZNA 3QDZB 3BG4C 4Q63A 2GMTB 4B6EA 3BEIB 4TPYA 1UK2A 2M2AA 4NA7A 1K28D 1O3GA 2Y81A 4O97A 1VGCB 1AIXH 4AYVB 3I78A 1OWDA 4BAMB 3SU2A 1QRZA 3SNEA 1WTHD 2D8WA 5DGJA 2VJ1A 2ZG0H 1TMTH 1ANBA 1YCPH 4UEHH 2AMPA 3LH3A 3UOUA 1ETTH 1W7XH 1V2ST 5K0HA 3VG8A 1C1NA 2R0KA 4GCHG 1EPTC 1A7SA 4ZAEA 1JWTA 1O3CA 2VWMA 2FEQH 1A0LA 3EBNA 1O30A 1GVLA 2UUJB 2F9NA 1UVUH 2WUBA 3RMMH 1CE5A 1WOFA 1DWCH 1ZGVA 2GDDA 5JB8S 1TLDA 1NS3A 2QV1A 4LK4A 2EI6A 1FY4A 1O2VA 1NM6A 3SU4A 4YZUA 3KQ5A 1SC8U 1MUEB 1OWEA 2FI3E 3QGJA 2UWLA 1ETRH 1P2QA 1C5ZB 5L2YH 2SGPE 2O8UA 2Q6FA 2BOKA 5FAHA 3SGAE 1BTUA 1H9IE 1YYY1 1L1GA 1KXCA 3EGKH 4X8TH 4Y8YA 5G4BA 1AE8H 1JRSA 1OSSA 2F91A 2WPKS 3SJKA 1A2CH 1O3PB 1T32A 5B6OA 1P11E 1OWKA 1EXFA 3F6UH 5HXFA 2RDLA 1GI5A 4A1TA 3ZZDA 1GHBG 3KYGA 1EATA 5C17A 3SYJA 1H4WA 2ALPA 2A0QB 5EXNA 2ZPRA 3UWJH 4JZIA 3VB7A 5J4QA 1D3TB 1F5RA 1QJ7B 1KLTA 2GCTC 1ZMNA 1J15A 3GYLB 1C5RA 1KDQB 1LQDB 1Z71A 3SV9A 1UK4A 5B6LA 2B9LA 4XBDA 2XC4A 1P06A 3GY8A 3FZZA 1AFQC 2H9TH 1WYKA 3SHAH 3BTFE 3OSYA 5C94A 4INLA 1UK3A 1BB0B 3RMNH 1C5XB 3MH7A 2QF0A 4X2XA 2BDBA 3TH4H 3WY8A 2GTBA 2G5NA 1KXBA 2K8IA 4MNWA 3E0NB 3T25A 1P3EA 3A7WA 1AHTH 2R9PA 2ZGJA 1D3DB 3BN9A 4YOIA 5EQRA 4DT4A 4I7YH 3ZVAA 2JJ2D 2Z9GA 4CBNA 1F0TA 2UUFB 3TK6A 7GCHG 1FV9A 2LP6A 3SJOA 4I8JA 3W1EA 2ZF0H 1UTJA 4IS5A 1GBCA 1FXYA 1O2LA 1O2QA 3BV9B 2EI7A 1O3FA 4WVPE 4NIXA 1ELTA 3OFND 5FCRA 1O35A 3MU4A 1EAWA 1HAVA 1PQ8A 2ZHEH 1GL0E 4FETA 3PRBA 1OX1A 2LELA 2VVUA 4CRGA 2P59A 1MQ5A 3KCGH 1QJ6B 1WUNH 1MU8B 1MABB 1ELBA 5CHBA 5HMAA 3SU0A 1TMUH 1ZHPA 2FYRA 2A5AA 4IN2A 4TY6A 1NU9A 3BEUA 1V2KT 2TGAA 4ACBA 1X7AC 4K5ZA 2ZNKH 4Y11E 1BMFD 3FFGA 5KEDA 1QRWA 1LHDH 4Y8ZA 2WV4A 2A4RA 2AGGX 4INKA 2HNTE 2OUAA 4AOQA 1O5EH 4HGCA 1W14U 1K21H 2ZU5A 2Y5FA 3LOXA 3P6ZB 2V3HH 1YBWA 1O31A 5J4SA 3B23B 4BAOB 3LGYA 1THRH 2R2MB 3PV4A 3TPIZ 5EU8A 2YMSC 8ESTE 1OHHD 1XUHA 2VVCA 2FTLE 1GMCG 3RXVA 2Z3CA 3RXJA 4K3JA 3UNSA 2J98B 1EFRD 2IJD1 1B0EA 1PPCE 1XUJA 4CHAB 3T2NA 3PMBB 3PLBA 5EPYA 4A7IB 5DKMA 3UQOA 5JPMH 1AWFH 2A32A 2JETB 1TE0A 4IN1A 4LXBH 3UNRA 4X8VH 1HDTH 2FX6A 2HWLB 2FODA 4TWWA 2J4IA 3VFEA 2ZFSA 3VXEH 2A31A 1YY3A 5GCHG 2W3IA 1N8OC 3RM0H 5GXPA 1G3BA 3F68H 2A5KA 1T4UH 3LJJA 2ZFTA 1FY1A 4NA8A 4FU7A 1L4DA 1ESAA 4X0WU 5A8XA 4NZQA 2AS9A 1BHXB 1XMNB 1E1QD 1C5TA 1O3OA 2BB4A 1GG6C 1MAXA 2AEIH 3UNQA 4AX9H 3A8CA 1T8NA 2FYQA 5EG4A 5F8ZA 4AG1A 3FZDA 3RXKA 2A4OA 1YKTA 1DX5M 3RC6A 1WXRA 1KLJH 2A4GA 1O5BB 1TFXA 2KAIA 4TSFD 2OBOA 1RD3B 4KKDA 1GGDB 1IQIA 2BD5A 2CK3D 4XSKU 1WAYB 3A85A 4Y79A 1GI3A 1LHCH 1C1UH 2SNWA 5ETXA 1O5FH 1SGCA 1GMHF 6GCHF 3SQHE 1P2OA 2O8WA 4B2BA 3GDUA 1UVPA 3RU4E 3NCLA 3T5FH 4BTTB 4WY3A 3GYMA 2Z6BD 4JK6A 4OS6A 3ZZCA 1FZZA 3PYHA 2BMGB 3MOCA 3NXPA 3A86A 3L33A 1UTLM 1NPMA 1EOJA 3MU8A 3PV2A 3GS9A 2ZGHA 5CHAC 1W8BH 1BBRH 2FP7B 1O2UA 1SFIA 4YT7H 2PTCE 4JYUH 4UDWH 3SV8A 4ABAA 3A7VA 2GCHF 1FI8A 2HPPH 1DUAA 2QXGA 3F0PA 1DDJA 2LIZA 1TX7A 3QTVH 3ZV9A 5A8ZA 3AAUA 1O3DA 2OC7A 4LZ1H 2HVYB 4YO9A 3ODFA 1YPHE 2SGEE 1C1RA 2BXTH 1EJAA 2WV9A 1O2KA 3FVFB 3K2UA 2G55A 2WPHS 2BTCE 4X8UH 3TJVA 1IAUA 2H2ZA 1LQEA 5L6NH 2KCYA 3E91A 4IMQA 1O2ZA 4PROA 1Q2WA 1FPCH 1SL3A 1W3CA 2G8TA 3LJOA 3A80A 1C5PA 2OLGA 2QGRA 1MBMA 1D9IA 2JKHA 3LDXH 5DK1A 1ZYOA 5E0HA 1MMJN 2VVVA 2NU2E 3RXCA 3T28A 1A4WH 1TWXB 1J9CH 3O8DA 3SGBE 1O2JA 2RDEA 1EZSC 1NO9H 1HAXB 3UPEA 2BY6X 3GY4A 1BBRK 3P17H 2J95A 1MCTA 1C1SA 2FS9A 3DFJA 1O0DH 3MWIU 1KLIH 4LZ4B 5HIYA 3V0XA 1TALA 2ZA5A 1KTTB 4DVAU 1VKYA 3MNXA 1A61H 3RLWH 4XFQA 3A8BA 1NN6A 5T1VA 1W13U 1B7XB 1FJSA 2YMSD 1INCA 4GHTA 2HGTH 3SHCH 1A0JA 4J2YB 3RU4T 4DY7B 1Y3VA 4ZKNU 1P2NA 1FONA 5TJXA 3SUDA 4AC9A 3P70B 5DP6A 1QB6A 4KTCA 1HV7A 4Y71A 1SQOA 3F9FA 1UMAH 4OS2A 1VCQA 1GL1A 3ZYDA 1TRYA 5F53A 1BRUP 3TU7H 3ZYEA 4P00A 1PPEE 2VBCA 1WQVH 4U30A 1P01A 3EA7A 1TGBA 1ZTLA 1SGFA 1ZPCA 3LH1A 1PYTC 2Z9JA 4CR9A 3H5CB 2FOBA 3FP7E 2BY9X 4AGJA 1SGIB 1KYNA 4RI0A 1ZPBA 1C2MA 2NU0E 2XYAA 3RXHA 3SNBA 2ZI2H 1YLNA 1LCYA 3KEEA 4B2CA 5HM9A 2FDAA 2KFWA 3KYFA 1U6QA 5A2MH 3A82A 2AFQB 4I86A 1N6XA 3DA9B 1GDUA 1SKYE 2Z94A 5A0BA 2AMDA 3HK3B 1KXEA 1S83A 1SOZA 6CHAC 2A7HA 4B2AA 1NFXA 2ANWA 4R0IA 1O3NA 2V35A 4YT6H 5CE1A 3TVJB 1ID5H 1FIWA 1QRXA 1T8MA 3VPKA 1GBJA 1GI8B 3M3VA 2FIRH 3K9XB 4ESTE 4RKOB 1K1IA 3DSGA 2F83A 2C8WB 1VITG 2CHAB 1CBWB 1B0FA 2FOCA 3C27B 1DANH 3AASA 2NWNA 3ZVFA 3BTQE 4CRBA 1SGDE 2Y5HA 5EGMA 1NESE 2CV3A 1BMMH 3PROA 5FPYA 4NIVA 1K22H 3F9GA 1SBWA 2XXLA 2G52A 1IQNA 5TCAA 1LKBA 1CT0E 3Q3YA 1RFNA 4KELA 2J97A 1ESBA 3DT0H 2ZHWH 1MU6B 2BLQA 1AQ7A 3SU5A 1ZTJA 5H4IB 3OYPA 3ATKA 1F92A 4OS5A 4Q7YA 2VWOA 1CO7E 4ACAA 4YOJA 2Z9KA 5HKKD 2G81E 2NU1E 2OC0A 2PR3A 1PPGE 2TGDA 1TAWA 1GJ6A 3RXBA 1O2RA 2HALA 3ZVEA 4WH8A 5C1UA 1SLWB 1F2SE 3F2GA 1C2JA 1O3HA 2PWXA 1DY8A 2D1JA 2P94A 3F1SB 1A3EH 3OX7U 3TJOA 4ABIA 1C4V2 1OYTH 2FS8A 4DGJA 2A2QH 3STIA 1AFQB 1HAVB 3GY7A 1CHOG 1BCUH 2YNBA 1P2JA 2XNDD 1F5LA 4FUEA 1K1OA 4WXVA 4HI3A 4JZFH 1UW7A 1DLEA 1UTKA 2XBWA 4IGDA 3SUFA 2STAE 1TBRH 3TGIE 2BD3A 1GJ7B 3PO1C 1C1OA 1C2KA 3O8CA 3VB6A 2ZHDA 3E1XB 3P95A 1RIWB 1O3LA 3P8GA 4R8TB 4AZ2B 1A46H 5ABWA 2J34A 2RA0A 1TNHA 2ZDAH 1E1RD 6LPRA 2CGAA 3VEQB 3MO6A 1B5GH 1O2WA 4IC5A 3ITIA 1LVBA 2VIQA 2VIPA 1C1WH 5FHTA 1VCWA 4JK5A 3AVZA 1GBFA 1KMHB 3ZVGA 2PKSB 3SUEA 3RXUA 3UY9A 2F3CE 3TH3H 4K1TA 2KCPA 2DE9A 1BRBE 3NWUA 3AAVA 3QO6A 1SR5C 3ATIA 4ABEA 2ZKSA 1KY9A 5T6DA 1GI1A 4CRDA 1LHGH 1HLTH 1EZQA 2Q6GA 3BEFB 2BLOA 2I6QA 2ZHQH 2ZECA 4YXWD 1YPEH 1RXPA 2CJIA 4AFUA 3URCA 3UQVA 4A1XA 2WUCA 5C5NA 4A6LA 4YESB 1QJ1B 4X8SH 1EZUC 1MD7A 4ASHA 1BTZA 2YMSB 2O9QA 5GNDA 4SGAE 1NBMD 5EW1H 2F9UA 3SI4H 3A7XA 3EA9A 1OWHA 5JDUB 1J8AA 2HLCA 1IQMA 3O8BA 1BTXA 3M7QA 1F5KU 4Y7AA 1BJUA 1QFKH 5EXLA 4UFGH 1C2EA 1GBEA 2Z3EA 1WV7H 3F0OA 4A92A 2HNTC 4B73A 2FOFA 2ZTXA 4I8GA 1BZXE 1P09A 1TNGA 1AI8H 1EUFA 1YC0A 5GDSH 1FIZA 2CF8H 4ISOA 1QB1A 5HM2A 1GBKA 3RUOA 1HJAB 1AO5A 1MCVA 1D3PB 1L4ZA 2KAIB 2R2WU 3TJUA 5FXLA 1DOJA 2V6NA 3U1IB 1EPTA 1MTNB 2Z7FE 1NC6A 2FM2A 3KL6A 4ZCNA 1L1NA 5EQSA 1AMHA 3K6YA 1AU8A 1T31A 4RSPA 2OP9A 2SFAA 1YCPK 2SNVA 3ATWA 2BHGA 2QAAA 1G3EA 2AERH 3PLKA 4FUDA 9ESTA 1LVMA 1DT2A 3EE0B 1C5NH 3LT3A 3OU0A 3L6PA 1H8ED 3UREA 5FPTA 4FUGA 3SJ8A 2ZTYA 2NU4E 3U69H 4UFFH 1TNIA 3M5MA 2BD7A 1E79D 3VB5A 1ETSH 2OK5A 4IBLH 1C5YB 4ZKOU 2P8OB 2OBQA 1CT4E 2BVXH 4ABFA 3FP6E 4AFZA 5EJ1A 1TPPA 1O2XA 3CS7A 1T8OA 9LPRA 4K8YA 2QN5T 3LU9B 1BRCE 3MNBA 2VIWA 2ZGBH 2RA3A 3M7TA 3PB1E 1ACBE 3D62A 3TNSA 3OEHD 1H9HE 5PTPA 3S69A 4X6PA 1VR1H 1O3JA 3L3TA 3WW7A 2QY0B 1BRAA 3GICB 4ZKRU 3BTHE 4DCDA 1RTLA 3TK5A 1V2UT 3V3MA 1QL7A 4U01A 3MNCA 1DWDH 2G4TA 4FUBA 4OGXA 4D9RA 1NRRH 1Z8GA 1O37A 1O3KA 2FOEA 4O03A 4I8KA 4MVNA 3MMGA 4D9QA 2Y80A 1MZAA 2AYWA 5C5OA 3ZZ8A 3KQBA 3VGCB 4AN7A 4K69A 1Z1IA 1LHFH 1FAKH 2IJOB 3NPSA 3UB0A 3O8RA 4TPIZ 1NROH 2ZHFH 4OM9A 1C5OH 3MH6A 4NIWA 2UUKB 5GWZA 3DSOA 1TRMA 3UTUH 1FUJA 2BDHA 1BIOA 1BTPA 1GHZA 1XM1A 1ELAA 1TMBH 4WMFA 1C5QA 2ZDNA 1OWIA 1BDAA 1QIXB 2ZFFH 2H9EH 2FOAA 3A81A 1E0FD 1DLKB 3ZVDA 2PKAA 3SNAA 1TNKA 1FLEE 4NGAH 5F8XA 4Y0YE 1COWD 1YPLH 3S9BA 3UAIC 2OCVB 4K2YA 4CRCA 2VINA 1EB1H 2R3YA 3RXPA 1TNJA 1C9PA 3GISB 1E38B 1GI0A 1VGCC 2BDCA 3BG8A 1ORFA 1DWBH 3SOSA 3Q77A 4B74A 3OAAD 4Y10E 4B71A 1HXEH 1P2MA 1YPHC 4O3TA 1OP8A 2D2DA 1O2IA 1ZLRA 5C1XA 2H5CA 4ASUD 1S6HA 5DG6A 1SVPA 2V0BA 5IDKA 3M61U 2G4UA 1O3MA 2YOLA 3A7YA 1ZZZA 5FX6A 4U2WA 3K6ZA 3OTJE 4XD7D 1JMOH 5EQQA 4X2VA 1AZZA 1L2EA 3MQKC 1FY5A 4I32A 2BX3A 4BXWA 1HAPH 2A1DB 2VWNA 1C5WB 1GBTA 2ZDVH 1TNLA 1NFUA 1SGFG 1XVMA 1NT1A 2B8OH 2SGQE 2UWPA 2FI4E 3I29A 4YLQH 2ZPQA 2F43B 1TONA 1V2TT 3E0PB 2BZ6H 4AFSA 4DJZB 1CGHA 2J38A 2ZFRH 4JZEH 4E7NA 2OD3B 4ZXXH 1O2TA 2QIQA 1MTVA 4DT7B 2G00A 2KCAA 1BTYA 3IWMA 1F0UA 1GCDA 4VGCB 1SGNE 1TB6H 1H9LB 2ZFPH 4O3UA 3ZZBA 4CBOA 3AW0A 3A84A 3BF6H 3STJA 1MKWH 3RXQA 2FPZA 5E0GA 3JZ1B 1IQFA 2GGVB 3SJIA 5E8EH 1DITH 1YWUA 2W26A 2ZZUH 1P02A 1SGEE 2ESTE 2GVFA 1UO6A 4H6TA 1EZXC 1K1JA 3QLPH 3U28C 4RKJB 1TQ0B 1TA2A 2FOHA 3DHKH 4NSVA 1QB9A 2RCEA 1EAUA 3VB3A 1ZOMA 1BMNH 1ZJKA 5CMXH 2ZU2A 1NRPH 4D76A 1GJ5H 2BVRH 1O2HA 1S0QA 1AB9B 3MO3A 2ZDMA 4UFDH 4X2WA 1GWAA 1TBZH 2VNTA 4GHQA 2PUQH 1QURH 3RXFA 1ZR0A 3DD2H 1LVOA 2KR7A 2C8ZB 4ABHA 2D26C 1C4U2 4YLUA 3NKKA 1OP0A 1HJ8A 3PTNA 1C2IA 1IHSH 4ABGA 1IQKA 1FDPA 4ABDA 1YLDA 2EQNA 1EB2A 3BTDE 4OS4A 1G32B 2ODYB 3N7OA 1DSUA 1ZGIA 1DPOA 3EE7A 1TRNA 1MKWK 1DWEH 1W0JD 1CA0B 1ELEE 1KTSB 1CHGA 4E05H 1G2MA 1BQYA 3C1KA 3RXGA 1C5VA 1EASA 1Y8TA 1HCGA 2BYAX 4AGKA 1M9UA 1UTNA 1KXAA 2HVXA 1V3XA 3SI3H 1TGSZ 3RDZA 3PV5A 1PQ5A 1GCTB 2HNTF 3S7HB 4JYTA 1Y3UA 2W7UA 2PGBB 3QTOH 2GX4A 2GT7A 1TBQH 4MQAA 3QK1A 4ISNA 1MBQA 2WINI 3FANA 3QGNB 4IW4E 2ANMH 5FBEA 3RXSA 4FUHA 1K1NA 1WU1A 3GCTF 4FXGH 2XWAA 3SUGA 2PFEA 3ENSB 4ISIH 1C4Y2 5FL7D 2GV7A 4X6NA 2ZC9H 3T26A 1PQ7A 1QZ8A 1SQAA 1OP2A 1ZMLA 3MHWU 2OC1A 4O9VA 1UTOA 1LDTT 1TIOA 4BAHB 1W2KH 1JIRA 2XBYA 2GP9B 4MDSA 1JIMA 2BLWA 1QA0A 3ATMA 5ESBA 1C1QA 1DXPA 3RM2H 2FXRA 2HRVA 1W7GH 3GOVB 5DJ7A 3A83A 4AYYB 2H1UA 3QWCH 2F9OA 1DICA 3RP2A 3F9EA 4K60A 1V2QT 1LPZB 1LKAA 1DUEA 2QCYA 3SO3A 1IQJA 3D23A 2OINA 2WYJA 1O38A 1S81A 4Q7XA 1XUFA 2K1QA 3D65E 1GHAF 4CHAC 7KMEH 3KGPA 1CU1A 4A5TS 4CH2B 3UFAA 4CREA 3H09A 2IOTA 4FVDA 1AVGH 1W12U 4FU9A 3EAJA 2JETC 1MTSA 1G37A 1A5IA 4NIYA 3RXMA 4AORA 5JB9S 1WDIA 4TT3D 2GZ7A 2VGCB 5SGAE 3M5OA 1KXFA 1OWJA 3BTGE 1Q31A 1A5HA 1W0ZU 5LH8A 3A88A 2XC5A 3BG4B 3BIUH 4DW2U 1Y3XA 3PMAB 5JBCS 5LPFA 2BDIA 2PV9B 3M36A 1ZSJA 2ZDLA 2W7SA 1UTMA 3WWFA 3OEED 1OKXA 3K65B 3DUXH 2Y7XA 2QXIA 1GMHG 1BMLA 2ZU1A 6GCHG 2NU3E 3NZIA 1TABE 3EYDA 1P9SA 3RMOH 4H6SB 5EPNA 8GCHF 3HKJB 3UOPA 1C5LH 2V3MA 2QXHA 2WSSD 1RTKA 3PWCA 3FKSD 4BTUB 2HLDD 1HBTH 1GMDF 1UVTH 1K0HA 3D49H 2BLVA 1EPTB 3MI4A 3Q3XA 2XBXA 3HKIB 4D8NA 1XX9A 1GGDC 1LHEH 3ZIAD 4Z0KA 3ZV8A 3OY6U 2IPHA 3DCLA 2ZCHP 1V2PT 2GKVE 1Z8IB 1SGRE 3OTPA 1ABJH 1THSH 4F4OC 4BAQB 1PJPA 2TPIZ 4I8HA 4A1VA 4FOUC 1A3BH 3ESTA 4D7FA 3SN8A 2GCHG 3GY2A 5DSFA 1O2GH 3TJNA 4ZROA 3HGNA 3NRLA 5DP8A 1FAXA 3SBKA 5JBBS 1YPJH 3Q76A 3GDSA 3LPRA 1IQLA 4GCHF 1SLVB 4RT1A 2EC9H 3M5LA 2BD4A 3VXFH 1D6RA 2ILNA 2PUXB 1PPZA 3RC5A 2G5VA 5DN6D 3HPTB 3GCOA 2WPIS 1SFQB 5C0TA 1GJBB 1TYNA 1GHWH 2OQ5A 1TPOA 3SU3A 3RXEA 2K0QA 1NFYA 1ARCA 3CENA 1BTHH 2O8MA 2Z9LA 3UR9A 1YP9A 1HAGE 1HNEE 1AN1E 1AE5A 2YNAA 1GBAA 3ZZ4A 3IITA 3LGVA 2VB0A 4X2YA 2CXVA 3U8OH 1T4VH 2ZIQH 1CGIE 1XUKA 2XOKD 5FPSA 3F3BA 2RFKC 1QBVH 1LTOA 2QF3A 3PMHB 3N7DA 2GCTB 1ELDE 2VH0A 1Y3YA 3SW2B 3GCNA 3E16B 4H42U 1FN8A 2OTVA 1Z6JH 1VCPA 3MU0A 3U8RH 4AFQA 1GBBA 1GHBF 4F48B 1AUJA 1HAZB 3EA8A 2BDGA 1O5CB 1NU7B 2WPJS 3GY3A 4J1YA 2VWLA
chains in the Genus database with same CATH topology
3IG6B 4UONA 2FOGA 1Z7KA 2IN2A 5A8YA 5AVDA 1DXWA 4BNRA 2A4QA 1JBUH 1O2YA 4H4FA 1ANDA 3ZZ5A 2BDAA 1XKAC 2BM2A 1O34A 1PPHE 3U1JB 1AGJA 4D7GA 4KTSA 1V2RT 5JYIA 1DFPA 1Y5BT 1O36A 1YPGH 1FQ3A 5DP4A 4ABJA 8KME2 2XNIA 1QQ4A 1SB1H 1GBHA 3TH2H 1QTFA 1SHHB 1KIGH 4IMZA 1QGFA 1GJ4H 1C1TA 1GI6A 2R0LA 2GD4B 4MPVA 2ZCKP 3A7TA 5C20A 3M3SA 4DIIH 3MNSA 5A0AE 2HPQH 3M35A 3T29A 1OOKB 3V7TA 5A0CA 1AFEH 5EW2H 4E06H 2FESH 1QBOA 2A2XH 4JCNA 2FOMB 1P9UA 1GBMA 7GCHF 1ZRBA 4NFEA 2P3UB 3TLOA 1AZ8A 1O5GH 3SGQE 1Y5UT 3GCHC 3MYWA 1BT7A 3PLPA 1OS8A 1QY6A 1SLXB 2ALVA 1ARBA 3P92A 1C2HA 2PLXA 2J92A 1ZRKA 4U32A 1TX6A 1LO6A 1BUIA 2ODQA 2Z9IA 1IQHA 1QBNA 5BRRE 1PYTD 1J17T 1GJAB 5L2ZH 3KQDA 1OXGA 1GPZA 2GDEH 3SJ9A 3VB4A 2GT8A 1K1LA 2HOBA 3HATH 1GBDA 4K1EA 2ULLA 5JBTA 1V2LT 3TITA 1V2WT 5T6GA 3S9AA 5F6MA 4ZUHA 4GAWA 1HPGA 3RXTA 1JXPA 2WPLS 3ZVCA 1V2MT 3NK8A 3LONA 2ASUB 1WTGH 4UE7H 1SHYA 3SV7A 2OXSA 2C8XB 1ZJDA 1GDNA 1WBGB 2XCNA 1K2I1 1UCYE 3RXDA 2AH4X 1N8OB 1GVKB 2CHAC 2TBSA 4FUIA 1CBWC 2Y7ZA 1T7CA 1GMCF 1ZTKA 1BBRE 4MPUA 4ZH8A 1SI5H 1QR3E 4IC6A 4MNVA 1P04A 4NSYA 3ZZ3A 1NRSH 1S85A 2QXJA 1TGCA 5LGOA 5E0JA 4BXSA 4Q7ZA 3RXRA 2BZAA 3LC3A 4XOJA 2ANKH 1GG6B 2DUCA 1Q3XA 3HK6B 1NFWA 7ESTE 5GCHF 1J14A 1O3IA 2ZQ2A 2O8LA 4AB9A 8GCHG 1VJ9U 4DOQA 3SV6A 5AFYH 1LVYA 5I46H 2WPMS 2B0FA 1ZPZA 1ZHMA 1Z8JB 1UHBA 3ZZ6A 3ODDA 2XW9A 4JYVH 5F8TA 1TGNA 1ABIH 3MU5A 1TQ7B 4ABBA 4OGYA 3SV2H 4XBCA 2ZFQH 5E2OA 2I6SA 2AMQA 1HAHH 1PFXC 3QUMP 1BHXF 3P8NA 3T27A 1HYLA 1CVWH 5AHGH 4Q80A 1G36A 1UVOA 1GJ9B 2QC2A 1SLUB 2AGIX 2VH6A 2GZ8A 4INHA 5CHAB 1AKSA 1BTWA 2TGTA 1PPBH 1P10A 3ZZAA 5I25A 4MG3A 1AVWA 1O2SA 2BDYA 2LNCA 3ZZ9A 1RIWC 3RXAA 3ZZ7A 1P03A 2A7JA 3BTKE 4E7RG 5AFZH 5DPAA 5EOKA 4JZDH 1S0RA 2FWWA 3M3TA 3TGKE 4X1RU 3KQEA 2PSYA 1HGTH 1XXFA 2JH5D 3I77A 1P57B 1KXDA 5L30H 5C1YA 1Z8RA 2GMTC 2C4FH 1ANEA 1QL8A 2PKSC 3B9FH 3BSQA 1C1MA 3MH4A 4DIHH 1TOCB 4MPWA 3H7TA 1EAXA 3P8FA 3HGPA 3RC4A 1S82A 1S5SA 4X1QU 4B75A 2OQUA 7LPRA 1MD8A 5BPEA 4KP0A 1D6WA 3A87A 2ZWLH 5GIBA 1HIAA 4F49A 2WV5A 3KNXA 4AB8A 1P05A 2H6MA 2BQWB 5E2PA 1QNJA 3RXIA 1CT2E 3ATLA 3BTEE 1O32A 4Q2KA 4YTAA 1V2VT 1GJCB 4X1SU 2F9BH 4XE4A 1GI2A 4X1NU 5DP5A 1HXFH 1JOUB 4WF8A 5IYTA 2STBE 1Y5AT 2P3FH 1FMGA 2SGFE 4OS7A 4RN6A 1GBIA 1EJMA 2M5TA 3BTTE 3MU1A 5TCCA 2BD2A 2XCFA 3QN7A 1DS2E 3FP8E 1GVZA 1HJAC 4HFPB 2PHBA 2A45B 1S84A 1J16A 1E34B 1D4PB 1AD8H 1QHRB 1RGQA 1MTNC 1RRKA 1G30B 3JZ2B 5GPIB 1SGYE 1WQSA 2ODPA 1HFDA 2W5EA 8LPRA 4YOGA 1LMWB 4TYDA 1H1BA 1O2OA 1BITA 2R3UA 3S0NA 1ELCA 1N1LA 5FCKA 4KTUA 4ISHH 2CMYA 3KQCA 5EXMA 1GJ8B 2EI8A 1HJ9A 2FLBH 2J9NA 1VJAU 1Z6EA 1IQEA 1YPMH 2EA3A 3BTWE 1ZSKA 4FUJA 3G01A 1O5DH 1BOQA 3U8TH 1L0ZA 4WMEA 2TGPZ 3M5NA 2P8OC 1GHVH 2BD9A 2ZEBA 1C5UA 6CHAB 3V12A 1O39A 4NZLA 5K7RA 1SQTA 3V13A 1MH0A 2PSXA 1SGQE 1O2NA 3QZRA 5ESTE 4NWKA 2BOHB 2BQ7B 1K1MA 3SNCA 1SPJA 1DSTA 1ZMJA 1G3DA 4BTIB 1A5GH 2RG3A 4JZ1A 4YM9A 2FX4A 3SORA 1ZSLA 5LPRA 1MKXH 1E37B 2C3SA 1E36B 2AIQA 4ZKSU 1KSNA 1P0SH 2PW8H 3SU6A 1XUGA 4CRFA 2Y5GA 2ZO3H 4BANB 1CGJE 1AUTC 1NRQH 1EP6A 2A7CA 1UCYH 4JMYA 1KDQA 4OS1A 3E3TA 1DE7H 1RS0A 3LC5A 3ZVBA 1LPKB 1LPGB 2SGDE 3VGCC 3M7UA 1V6DA 3R3GB 1W10U 1GI9B 2XWBI 2ZGXH 1P8VC 1SSXA 3TGJE 1VITF 3UUZA 2XBVA 3BTME 3H7OA 4SGBE 4K8BA 1HRTH 2H5DA 1K9OE 2EEKA 1PQAA 2TIOA 2UUYA 3PM3A 3RU4D 1AWHB 4GUXA 3ELAH 4WJG2 2ZGCA 5F03A 1EOLA 3LIWA 4GVUA 4XDEA 1GDQA 4ZHMU 3RXLA 2XTTB 4MNYA 3U98H 5C67A 1P12E 3KF2A 3MO9A 1O3AA 1GHXH 2ZPSA 1G2LA 3SQEE 4ISLA 1ELGA 1K1PA 4ZXYH 1MTUA 1MKXK 3QX5H 1C1VH 2Y82A 2VU8E 3M37A 4K1SA 5A09A 3Q3KA 4BAKB 1O3BA 4Y0ZE 1H8DH 4NFFA 1DY9A 2Z3DA 3TK9A 2WYGA 1S6FA 5FX5A 1RTFB 1HAYB 1UCYK 2THFB 1TOMH 2ZU4A 4NA9H 1BA8B 3KHVA 3A8DA 1MQ6A 5DP3A 4Z6AH 1C2GA 2BY7X 1TPAE 4NG9H 1O2MA 1WCZA 1Y59T 1C1PA 5LPEA 3PO1B 1NRNH 1SOTA 4NWLA 5DP7A 2XC0A 1N6YA 3A89A 1EJNA 3GDVA 3S9CA 1CHOF 2XRCA 1P3CA 1C9TA 1FNIA 3RXOA 4WXIA 1V2OT 2GV6A 2P93A 2ZP0H 4X6OA 5HYOA 1C2LA 3QZQA 2FI5E 2G51A 4FUFA 2FO9A 2FZZA 4WH6A 4FUCA 1O3EA 3LGWA 2UWOA 1C5MD 3TIUA 2C93B 3RMLH 2O8TA 4Y8XA 1SMFE 4GLYA 4THNH 4FVBA 4KGAA 3UIRA 1HB0B 1QCPA 1YCPM 1UTQA 1SGTA 5T3HA 1ESTA 1IQGA 2LPRA 1T8LA 1UTPA 3PMJA 3TNTA 4VGCC 3SU1A 1GI7B 3GCHB 2F9PA 2V3OH 2AIPA 5T6FA 1JRTA 4WWYA 1VITH 3MFJA 3URDA 5JBAS 4LOYH 1SGPE 1V2NT 2JH0D 4FU8A 2BD8A 3OY5U 3W94A 1G9IE 1ELVA 5DO4H 1THPB 1YGCH 3PWBA 2ZQ1A 1QQUA 1YPKH 3NUMA 2QA9E 1OPHB 1UJ1A 1XKBC 1OYQA 1H8IH 2W3KA 3KN2A 3RLYH 4DG4A 5EODA 5HGGA 2C8YB 3P8OA 3B8JA 5FBIA 2FMJA 3UWIA 2DE8A 2VIOA 4HZHA 4X6MA 2ZTZA 4AG2A 2ZCLP 4Y7BA 3SNDA 1VZQH 1AB9C 1F0RA 1NY22 4UD9H 2ZU3A 5DP9A 1C2FA 4GSOA 1GHYH 4I8LA 1P2IA 4MLFB 1FN6A 1MAYA 1G3CA 3LGIA 1Z1JA 4TY7A 2CN0H 2GZ9A 1RJXB 3KIDU 1D3QB 2C90B 2BQ6B 1O2PA 1EX3A 1O33A 2H9HA 2BY5X 2BXUH 1AY6H 1UHBB 3LGTA 3S7KB 1XXDA 1ZHRA 1FPHH 3LKWA 3AW1A 1CA8B 1TPSA 3PTBA 3T62A 1QL9A 3GCTG 1CA0C 2FTMA 1SG8B 4HTCH 3Q00A 4XBBA 3U9AH 2Q1JA 2B5TB 4B1TA 1Y3WA 4WMDA 4GPGA 1HUTH 1GCTC 1GI4A 5C2ZA 4I31A 1IHTH 2TRMA 2FLRH 2P95A 2Q6DA 1AKSB 1F0SA 1L1JA 4BOHA 2BX4A 3CP7A 4M7GA 3EDXB 4Y76A 3GY5A 4UFEH 4MTBA 1WSSH 2CF9H 4QT8C 1HAIH 1F7ZA 1QA7A 2A5IA 6ESTA 4ZHAA 4ZMAH 1MZDA 2B7DH 1NTPA 5C3NA 1FY8E 2ANYA 1AVXA 1EP5A 3R0FA 4X1PU 1MTWA 2P16A 1YF4A 2QYIA 3E90B 1CQQA 1GHAG 5AF9H 1ELFA 2J2UA 3A8AA 4DURA 1PPFE 3LGUA 1XUIA 2P3TB 2PKAB 3BIVH 1EKBB 4Y6DA 5GJ4B 1EQ9A 1YM0A 1A1RA 1BMAA 1DVAH 1CSOE 2ZDKA 1UVSH 3DFLA 3GY6A 3W95A 1GJDB 4ZHLU 1XVOA 4I33A 3E6PH 4CR5A 2VIDA 2PTNA 4CH8B 2OC8A 3A7ZA 2PGQB 3MTYA 1EAIA 4NCYA 2SGAA 3F9HA 1A0HB 1GBLA 3UR6A 2VIVA 1W11U 1W0YH 3E8LA 1O5AB 1TA6A 4MNXA 3MH5A 2Y6TA 2J94A 1HIAB 3FAOA 2AGEX 4TWYA 1BJVA 1NZQH 1YLCA 1C5SA 1E35B 2BY8X 1FY3A 2BVSH 3CS0A 1TX8A 1DM4B 2F9VA 1C2DA 1IOEA 4MPXA 4CRAA 4D9RA 2K7XA 1ANCA 1TGTA 2VGCC 2JH6D 1GMDG 3EQ0H 1HAOH 1P2KA 1V2JT 4B76A 3SZNA 3QDZB 3BG4C 2GMTB 3BEIB 4TPYA 1UK2A 4NA7A 1K28D 1O3GA 2Y81A 4O97A 1VGCB 1AIXH 4AYVB 3I78A 1OWDA 4BAMB 3SU2A 1QRZA 3SNEA 1WTHD 2D8WA 5DGJA 2VJ1A 2ZG0H 1TMTH 1ANBA 1YCPH 4UEHH 2AMPA 3LH3A 3UOUA 1ETTH 1W7XH 1V2ST 5K0HA 1C1NA 2R0KA 4GCHG 1EPTC 1A7SA 4ZAEA 1JWTA 1O3CA 2VWMA 2FEQH 1A0LA 3EBNA 1O30A 1GVLA 2UUJB 2F9NA 1UVUH 2WUBA 3RMMH 1CE5A 1WOFA 1DWCH 1ZGVA 2GDDA 5JB8S 1TLDA 1NS3A 2QV1A 4LK4A 2EI6A 1FY4A 1O2VA 1NM6A 3SU4A 4YZUA 1SC8U 1MUEB 1OWEA 2FI3E 3QGJA 2UWLA 1ETRH 1P2QA 1C5ZB 5L2YH 2SGPE 2O8UA 2Q6FA 2BOKA 5FAHA 3SGAE 1BTUA 1H9IE 1YYY1 1L1GA 1KXCA 3EGKH 4X8TH 4Y8YA 5G4BA 1AE8H 1JRSA 1OSSA 2F91A 2WPKS 3SJKA 1A2CH 1O3PB 1T32A 5B6OA 1P11E 1OWKA 1EXFA 3F6UH 5HXFA 2RDLA 1GI5A 4A1TA 3ZZDA 1GHBG 1EATA 1H4WA 2ALPA 2A0QB 5EXNA 2ZPRA 3UWJH 4JZIA 3VB7A 5J4QA 1D3TB 1F5RA 1QJ7B 1KLTA 2GCTC 1ZMNA 1J15A 3GYLB 1C5RA 1KDQB 1LQDB 1Z71A 3SV9A 1UK4A 2B9LA 4XBDA 2XC4A 1P06A 3GY8A 3FZZA 1AFQC 2H9TH 1WYKA 3SHAH 3BTFE 3OSYA 4INLA 1UK3A 1BB0B 3RMNH 1C5XB 3MH7A 2QF0A 4X2XA 2BDBA 3TH4H 3WY8A 2GTBA 2G5NA 1KXBA 4MNWA 3E0NB 3T25A 1P3EA 3A7WA 1AHTH 2R9PA 2ZGJA 1D3DB 3BN9A 4YOIA 5EQRA 4I7YH 3ZVAA 4CBNA 2Z9GA 1F0TA 2UUFB 3TK6A 7GCHG 1FV9A 3SJOA 4I8JA 2ZF0H 1UTJA 4IS5A 1GBCA 1FXYA 1O2LA 1O2QA 3BV9B 2EI7A 1O3FA 4WVPE 4NIXA 1ELTA 5FCRA 1O35A 3MU4A 1EAWA 1HAVA 1PQ8A 2ZHEH 1GL0E 1OX1A 2VVUA 4CRGA 2P59A 1MQ5A 3KCGH 1QJ6B 1WUNH 1MU8B 1ELBA 5HMAA 3SU0A 1TMUH 1ZHPA 2FYRA 2A5AA 4IN2A 4TY6A 1NU9A 3BEUA 1V2KT 2TGAA 1X7AC 4K5ZA 2ZNKH 4Y11E 3FFGA 1QRWA 1LHDH 4Y8ZA 2WV4A 2A4RA 2AGGX 4INKA 2HNTE 2OUAA 4AOQA 1O5EH 4HGCA 1W14U 1K21H 2ZU5A 2Y5FA 3LOXA 3P6ZB 2V3HH 1YBWA 1O31A 5J4SA 3B23B 4BAOB 3LGYA 1THRH 2R2MB 3PV4A 3TPIZ 5EU8A 8ESTE 1XUHA 2VVCA 2FTLE 1GMCG 3RXVA 2Z3CA 3RXJA 4K3JA 3UNSA 1B0EA 1PPCE 1XUJA 4CHAB 3T2NA 3PMBB 3PLBA 5EPYA 4A7IB 5DKMA 3UQOA 5JPMH 1AWFH 2A32A 2JETB 1TE0A 4IN1A 4LXBH 3UNRA 4X8VH 1HDTH 2FX6A 2HWLB 2FODA 4TWWA 2J4IA 3VFEA 2ZFSA 3VXEH 2A31A 5GCHG 2W3IA 1N8OC 3RM0H 5GXPA 1G3BA 3F68H 2A5KA 1T4UH 3LJJA 2ZFTA 1FY1A 4NA8A 4FU7A 1L4DA 1ESAA 4X0WU 5A8XA 4NZQA 2AS9A 1BHXB 1XMNB 1C5TA 1O3OA 2BB4A