1ANEA

Anionic trypsin wild type
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords ANIONIC TRYPSIN
publication title Structure of an engineered, metal-actuated switch in trypsin.
pubmed doi rcsb
source organism Rattus rattus
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aneA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aneA02
1DWDH 1NS3A 2YNBA 1AVXA 1Z6JH 3Q3YA 3GY7A 1ZPZA 1DSTA 3P6ZB 2Y5FA 1S6FA 4UD9H 1QB1A 1A3EH 2FPZA 1EATA 1ZZZA 1GHZA 2H9TH 3E16B 3A8BA 4X2YA 1ZRBA 1O5EH 1VJ9U 1C9PA 1ETSH 3S9BA 1C2DA 1P3CA 3QLPH 3S7HB 1SGCA 8GCHG 4Y8YA 6LPRA 3OTJE 4DG4A 1YLCA 3R3GB 2ZCHP 3BTTE 1QHRB 3M5NA 4BXSA 1RTLA 3ZYDA 1SQTA 1C2IA 3Q00A 1GJBB 1LKBA 5EQRA 1WOFA 2F3CE 5FX6A 3PTBA 2ZFRH 1K1OA 1LCYA 4F4OC 5EGMA 1DUAA 4U01A 1QQ4A 2FWWA 3UOUA 3GDVA 1GJCB 1O2GH 1ARCA 2A5KA 3FP6E 3GCTF 2NWNA 1P03A 1PYTD 3SJOA 1ELAA 4D7FA 4K5ZA 1FI8A 2FOAA 3P8OA 1J8AA 1C2HA 1YLDA 2GZ7A 4IBLH 1F0TA 1S0RA 2ZTZA 3V12A 1NU9A 2HRVA 1TGTA 2Y7XA 3ODFA 2PKSB 1W10U 4K2YA 1F5LA 1ELDE 5DKMA 1GCTC 1EKBB 4I8HA 2HNTF 1GI0A 1AHTH 1ANCA 2R0LA 1C5SA 5HYOA 3ZZAA 5EXLA 2G55A 1UJ1A 4ABAA 1FONA 1A0LA 4MPXA 2F83A 1LHGH 3ATKA 4X1SU 1W8BH 3RU4T 3TK5A 5ESTE 3GCOA 3LONA 1GJ4H 1O3BA 2Z3CA 4VGCC 2A5IA 4JZFH 3SJ9A 4X1QU 2XYAA 3KL6A 1EJAA 1K1LA 1PQ8A 1C2GA 4NA9H 1UTLM 1O3DA 1SGDE 6ESTA 3LGVA 5DP9A 1EZQA 1A7SA 1ABIH 1SSXA 1CHOG 1GMCG 4Q7XA 3QK1A 1J15A 3GYLB 1KIGH 1KDQB 4AFSA 1CT2E 2F9OA 4B76A 3EQ0H 4Z0KA 1DWBH 1Z7KA 1FPCH 1Z8RA 2C8XB 3GY8A 2ZF0H 4MNVA 4XBBA 4B1TA 2AMQA 1W2KH 1TGNA 1Y5UT 2WPIS 1ID5H 1O32A 2ZQ2A 1E38B 2GZ9A 2ZGBH 2PSXA 4WJG2 1YC0A 1AN1E 1C1OA 1K1PA 3H7TA 3L6PA 4DY7B 2QXIA 3LGWA 2J9NA 1A5HA 1TOMH 1EASA 1MZDA 3QZRA 4ISOA 4X6OA 3VB7A 2WPLS 3SORA 1C1SA 1ARBA 3AAVA 1DDJA 1GBEA 2BX3A 3M5LA 1AVWA 4OS7A 1E37B 1T8OA 3CS7A 3PLPA 5DK1A 1S84A 1GBKA 4NWKA 3F9EA 3A8DA 2AGEX 1C9TA 4OS6A 4GHTA 2AMDA 4FUBA 3O8RA 4IS5A 1EPTC 1KXCA 2DE8A 2G4UA 1EOLA 1AKSA 2EI6A 1EAIA 2H9HA 1MD7A 1TX8A 1QTFA 5E0JA 3SV8A 3BTDE 4X0WU 1XUFA 4E05H 3FZDA 2SGPE 1ZGVA 1YF4A 5A8YA 3KN2A 2AYWA 1G37A 1O5AB 2P8OC 5JDUB 1MKWH 1HJ8A 3TITA 1P06A 1O39A 2Z3EA 2SGQE 1SOZA 4ASHA 4BTTB 1GGDC 2G8TA 4WMFA 1QB9A 5FPSA 2FMJA 3SN8A 2ALPA 4ZKNU 2FX6A 3V13A 4AGKA 2LPRA 4ZAEA 3ZYEA 2F9PA 5EODA 3EA8A 2DUCA 1XUKA 1E35B 1K2I1 1O2XA 1O0DH 3PMHB 5GCHG 1T4UH 4X2XA 1MBQA 3BTQE 1V6DA 3QGJA 4JK5A 3ZZ3A 1UCYE 1O35A 1V2VT 2BY8X 2TGPZ 3V3MA 1SLWB 1GMHF 2ZKSA 4XOJA 1MD8A 5JBAS 3KF2A 1O5CB 3RXUA 3A82A 3D62A 5C2ZA 1SQOA 3E6PH 3RXLA 3UQOA 4BAOB 2C4FH 1THPB 3ATMA 1F5RA 3L3TA 2W7UA 4DIIH 3CP7A 5I25A 2ZU3A 2TGDA 1L4ZA 1ZSJA 1HAXB 1AWHB 1QL7A 1TQ7B 1QRXA 4NA7A 2UUFB 2OUAA 2W3IA 1SI5H 2PR3A 3U9AH 3KQBA 3VFEA 4LZ1H 4X6MA 1C4V2 3KNXA 4NFFA 1O33A 1FJSA 3S9AA 4AB8A 1NU7B 4AORA 2AGIX 2GT8A 3SV2H 3RXGA 2QXGA 2W7SA 3BTHE 1ZGIA 1C1WH 4R8TB 2K1QA 4ISNA 1HCGA 3A80A 1KTSB 4NIYA 1MU8B 2V6NA 3O8CA 3F6UH 4BAQB 4B71A 4Y7AA 1E0FD 1MTSA 5T6GA 1TGBA 1UVUH 3ZZDA 3RXMA 3OY6U 2UUKB 1YPHC 1QA7A 2OLGA 3PTNA 4JMYA 2NU4E 1GL1A 1C5PA 4IC5A 3ZVEA 2FS9A 1CSOE 3UR9A 2ZCLP 3AAUA 4J1YA 1OX1A 1ACBE 1UHBB 1GI7B 3W95A 1XUIA 1Y5BT 1BMMH 2GP9B 3U1JB 1GJ7B 1GI2A 1TGSZ 1N6YA 4JK6A 1NFXA 1MUEB 1XXDA 1CBWB 1D3DB 1GBCA 1JRSA 1EZUC 4INLA 1JWTA 5DP3A 3T29A 2I6QA 3GCHC 1O3IA 1V2OT 1OSSA 3K9XB 1JMOH 4AG1A 1WYKA 2HPQH 1UMAH 1SLUB 1TRNA 4FUEA 3PMBB 2QF0A 2QCYA 3RXFA 2SGFE 3SGQE 5FXLA 1THSH 2PGBB 3SUDA 1V2PT 1QJ1B 3AW0A 4XBCA 1O2TA 5T6FA 2SFAA 1GJ8B 2VB0A 3LGIA 3T27A 1DM4B 2XRCA 3A7VA 5E2OA 3SU4A 1JOUB 1MH0A 1S5SA 2WPJS 4GSOA 1PPBH 4ZHAA 2ZGJA 3MI4A 5C1UA 3TGKE 1C5LH 2FX4A 5JBBS 2ZHWH 4X2WA 4YT7H 1W7GH 3RXPA 1V2LT 3M5MA 3P8NA 3SQEE 3OSYA 3GISB 4WXIA 3MNSA 1ZMJA 1MU6B 2UWPA 4Q7ZA 2OCVB 3RC5A 5LPRA 1J14A 5DJ7A 4Y6DA 1EAUA 1O2RA 2ZCKP 1C5NH 4ABFA 2J34A 1UVTH 3VGCC 1Z8IB 1SGRE 4M7GA 2ULLA 4Y10E 2BD4A 4I7YH 1O2NA 4O97A 4KTUA 3A7ZA 3Q77A 4JZ1A 2OBOA 2HVXA 4I8GA 2ESTE 1BBRE 3BG8A 2C8WB 2CF8H 1SL3A 1ELCA 1TNHA 5DP5A 3G01A 4BANB 4AG2A 1ZOMA 5ABWA 1SC8U 2VNTA 4WY3A 1O2LA 2W5EA 3A85A 1BA8B 3Q3KA 2A4QA 4NGAH 1G32B 1P57B 2KAIB 1ESTA 2FOCA 5HMAA 1QURH 1OP0A 1ZHPA 2BZAA 2PSYA 1GBFA 1V3XA 1YCPM 1BJUA 4UONA 1O2VA 1Q3XA 3GY2A 1SBWA 5EG4A 4DOQA 1VZQH 1GL0E 1W3CA 5CMXH 1FAKH 1FPHH 2AIPA 4AGJA 4KTCA 1HAPH 3QTVH 1DFPA 4TY7A 4JZIA 4XDEA 5PTPA 1O3JA 2ZHEH 3HGPA 3UTUH 1OWDA 3E1XB 3M5OA 2WPHS 1TIOA 2CN0H 4YOJA 2OC8A 3A7TA 1ZTKA 3BTGE 1P3EA 2BY5X 1HAGE 5GWZA 2FTLE 1GBMA 5A0BA 3ATWA 5E0GA 3K65B 3BTFE 9LPRA 1UK4A 3TPIZ 4CHAC 1CVWH 1O2KA 3UFAA 2BY7X 3UNSA 3GY4A 1GG6C 5AFZH 3LGYA 5DG6A 1AWFH 1NM6A 2C93B 3PWBA 4ABIA 2VJ1A 1SR5C 1LPZB 2GX4A 5K0HA 2J92A 2BX4A 1TGCA 1GI5A 1LQDB 2C8YB 3MMGA 4I8LA 2P3TB 4X8TH 2SGAA 1WBGB 1SHHB 1G3CA 1O3MA 1YGCH 4CBNA 1PPFE 3TJOA 2YOLA 4B2CA 1E36B 4DURA 4YZUA 1L2EA 3SI4H 1VITF 3DA9B 2F9UA 4XFQA 1O30A 2JETB 1CT4E 5A8ZA 1NZQH 7KMEH 1KLJH 1TWXB 2HOBA 2ODPA 1G30B 3ZZ4A 1A0JA 3O8DA 3GYMA 2FS8A 4YOIA 1IHSH 1VGCC 2F9BH 3STIA 1CGJE 1NFWA 1YPJH 1KXDA 4X1NU 4ZROA 4AYYB 1YCPH 2ZTXA 1PPCE 1BQYA 2G4TA 2ZGCA 4DGJA 4NZQA 3T28A 3SGAE 1O3NA 1MZAA 3PV4A 3RXHA 3PO1B 3TK6A 1GJ9B 2ZU5A 3GICB 5LGOA 1CGHA 1LO6A 3MFJA 3PROA 1GBJA 3SU6A 3A89A 3B23B 2ZDVH 1QIXB 1HLTH 3RDZA 1O2WA 1S0QA 3UR6A 1QGFA 3A87A 1NRPH 1XXFA 3B8JA 1BB0B 2Z9GA 1O2HA 3MU1A 4YO9A 3S9CA 1HIAA 2ZI2H 1P05A 1LDTT 2HALA 4IN1A 1VJAU 3U8OH 1EJNA 2RDLA 2R3YA 3M7QA 2FOBA 2P3UB 2FEQH 1C1UH 3P8GA 1N1LA 2R3UA 2CMYA 2CHAB 1C5XB 1RTKA 1C2KA 2GCTB 1GI1A 2SNVA 1WQSA 2BB4A 5H4IB 2QY0B 4ABHA 4OGXA 1CQQA 4DCDA 2PWXA 1GHBF 2ZO3H 4TY6A 4SGAE 1DWEH 3AASA 4X8SH 3VXFH 1ZPBA 3EA9A 2Z9JA 6GCHF 3KHVA 2PFEA 4Y79A 3FP8E 2OINA 1RJXB 4UDWH 4JZDH 4U2WA 4ESTE 1L1NA 2LNCA 1LQEA 4TWYA 1V2KT 3STJA 1QR3E 4K1EA 1O37A 2Y82A 3FVFB 3PWCA 1QNJA 1K9OE 3EGKH 3QDZB 3LH3A 1A61H 2WUBA 4AFQA 1C4U2 1AO5A 3U69H 3UREA 7GCHF 1BTHH 1XVOA 1ZR0A 4UFFH 1HAOH 3PMJA 4E7NA 1J16A 1ZMNA 5AFYH 4BXWA 1OP2A 1JBUH 1GMDF 1P2KA 3E90B 1SGEE 2A5AA 1BTPA 2XC4A 2G52A 3T25A 4I8KA 1AE8H 1CO7E 1PPZA 1YPEH 1O2PA 1O2JA 1H8IH 1KYNA 1GI8B 1XX9A 2BDYA 2W26A 1A2CH 1NN6A 5DGJA 2WYJA 5G4BA 1TPSA 1O2YA 1P8VC 4HZHA 1WUNH 2AIQA 1AI8H 3JZ1B 5FHTA 5ETXA 2VIQA 1M9UA 1T31A 2F91A 5IYTA 3QZQA 2V3OH 2Q6FA 4UE7H 2ANKH 1LTOA 4GHQA 1IQFA 3SNBA 1OXGA 2FOHA 3MOCA 4KELA 4UEHH 5FX5A 3RXDA 5F8TA 3URDA 1P2NA 3V0XA 1FN6A 2BD8A 3M61U 2FDAA 3MO9A 3MH7A 1K1IA 1W13U 4K69A 2H1UA 3MH6A 4NSYA 5DP6A 3SQHE 2AH4X 4NWLA 4A6LA 1Q31A 1GJ6A 1RXPA 1D6WA 3UUZA 1ABJH 5HM9A 1YM0A 5T3HA 2QA9E 2KAIA 2OP9A 3FP7E 1RS0A 4BTUB 1FV9A 1K1NA 4K8YA 5EPYA 1LVMA 3T2NA 3RXIA 1QJ6B 5CHAC 2RG3A 2ANMH 2P59A 4NIXA 1MAYA 1QFKH 2ZC9H 1ELTA 4ABJA 2VH6A 1AFQC 2H9EH 4X2VA 5EXNA 1WTGH 1YCPK 4B73A 1WTHD 3U1IB 2GTBA 2WPKS 1IQMA 3PYHA 1P09A 3SJKA 4AX9H 4A1VA 4NA8A 4NZLA 1ESAA 1BZXE 1O5BB 1OWEA 1V2NT 2A7HA 2FO9A 2GCHG 5JBCS 1PPEE 2D2DA 2FIRH 2GDEH 5TCCA 1T8MA 3UQVA 2ASUB 1FY4A 4DIHH 1OP8A 5AHGH 3SJ8A 5SGAE 1IQGA 4CBOA 1OYTH 3N7OA 3DHKH 1P12E 1UO6A 4MG3A 4OS1A 2V3HH 4ABEA 3IWMA 2BHGA 1EB1H 2STAE 1C5OH 1JIMA 5FPTA 1SGFA 2A0QB 1CA8B 2PW8H 2ZFFH 1FAXA 1DITH 5HM2A 1SMFE 4AYVB 4AN7A 5LPEA 1A3BH 1J17T 5EXMA 2PTNA 5EOKA 1GCTB 2D8WA 5GDSH 3RXKA 4WF8A 2BTCE 3TNTA 4X8VH 5FPYA 1L1GA 1QL9A 3SHAH 2G00A 3SNEA 5FAHA 5CE1A 1QY6A 2EEKA 2RA3A 2YNAA 1S85A 3NZIA 1HAVB 3P92A 4D76A 1EJMA 8GCHF 3SV6A 3RXAA 2WPMS 4VGCB 4MQAA 3SJIA 1HAHH 1HAIH 4ABBA 1V2TT 1TNJA 2FI5E 1FY8E 1N8OC 1G2LA 2H2ZA 3LOXA 2BMGB 1BRUP 3LU9B 1F0RA 2NU1E 3M37A 2BXUH 3SGBE 3GDUA 2Z9IA 2Q6GA 2AGGX 2O8LA 2BY9X 5DP4A 1GBBA 1HJAB 3MO6A 2HPPH 5LPFA 1CA0C 1EX3A 5AVDA 4BNRA 3PLBA 6CHAC 2PV9B 5E2PA 3Q76A 1F0SA 2TPIZ 3LJJA 3MU0A 1C1RA 1XM1A 1HPGA 5EW2H 2ZGXH 1O38A 1YBWA 1BITA 1BTYA 2ANWA 1QB6A 1EAWA 3ZVFA 3SHCH 1GI4A 2THFB 2A7JA 1ANBA 3GY3A 2XCNA 4A5TS 1NROH 1Z8GA 2A45B 1UCYK 2D26C 1LVOA 1FIZA 1UVOA 3TJUA 3ELAH 1P2JA 4FUDA 3MNXA 3U98H 2XCFA 1AB9C 1C4Y2 4B75A 2O8WA 1D9IA 1OWJA 2G5VA 4GVUA 1WQVH 1CHOF 4AFZA 1GMCF 1IQLA 1GHAG 2QN5T 1ELGA 5E0HA 3ODDA 3TLOA 5HXFA 2GMTC 2CV3A 3TJVA 1TX7A 2BLOA 4DT7B 4WMDA 2HNTE 1EPTB 1NRQH 1QJ7B 2VIWA 1ORFA 3S7KB 1XUJA 4D7GA 3M3VA 3SW2B 1XVMA 3HK6B 2BM2A 2P16A 3UY9A 2CXVA 1ZHMA 4GAWA 4O03A 3A7YA 2Q1JA 1O5GH 3BG4C 1DICA 1BTWA 4OGYA 1C5VA 5TCAA 1AVGH 1BJVA 1MTWA 1LHDH 5EQQA 2P8OB 3ZZ8A 1BRBE 1T4VH 3A83A 4K60A 2QXHA 5C1XA 2EI7A 1GVLA 1GGDB 1S6HA 1UTKA 3NKKA 4WWYA 2OC1A 4HGCA 4DW2U 4KKDA 2C90B 1G3BA 1V2MT 3EDXB 5IDKA 2QIQA 2BQWB 1K21H 3I77A 2F9VA 1A4WH 1HDTH 4Q7YA 2QXJA 3I78A 3SU1A 3KIDU 1Z1JA 5DP8A 1A46H 2ALVA 1UTJA 1PYTC 5J4SA 1TBZH 1C1TA 1QCPA 1HNEE 2J4IA 8KME2 5L2ZH 5FCRA 1K1JA 2VVCA 2BDCA 2UUYA 2FOGA 3BTKE 2STBE 5EW1H 1PQ7A 3A84A 2XXLA 1UTNA 2NU2E 3P8FA 4ABGA 3KQDA 1L4DA 1TA2A 3FAOA 3CENA 4Y7BA 3PLKA 1GHVH 1XMNB 4GLYA 3TH2H 1OOKB 5A2MH 1D6RA 1UK2A 1Z71A 4ISHH 2R0KA 1V2RT 2J94A 2F9NA 1SGPE 1P11E 1IHTH 1O5FH 3A8AA 2JH5D 1ZTJA 2FYQA 1ANEA 1QA0A 1SB1H 3S69A 3LC3A 4YLQH 4FUHA 1IQJA 3ZZ5A 4FU7A 2VGCC 2ZU1A 1DPOA 2IOTA 3SBKA 3FFGA 3QTOH 4GCHG 1V2JT 1TONA 3F1SB 1KDQA 1H8DH 4RSPA 1RIWC 5GCHF 1NESE 1O34A 1FQ3A 4K1SA 1C2MA 4E06H 5DO4H 3ZZBA 2FI3E 1KLIH 1UTMA 1A5IA 4ZKRU 4JYTA 2ZIQH 3ITIA 2G51A 2V35A 1C1VH 1MKXK 1MMJN 4JYUH 1WCZA 1TRMA 1SQAA 1YKTA 2ZPRA 1PJPA 4CRBA 1A1RA 1GBTA 3RXBA 2R9PA 3UNQA 1O2UA 4Z6AH 2TGTA 2Y6TA 2BDIA 2ZDKA 1BBRK 5HGGA 1O3CA 3BN9A 3LKWA 1EOJA 2WV5A 3GCNA 2WV4A 4FUJA 3E0PB 1BTUA 5K7RA 3T5FH 1AMHA 4X6NA 3UOPA 2EA3A 1MBMA 1QBOA 1O3PB 2GV7A 3ZVAA 4OS2A 3O8BA 1C5QA 4O9VA 2ZFQH 1AD8H 3GCHB 1O3AA 3LH1A 2OC7A 3ZV8A 1O3HA 2A4RA 2O9QA 2ZNKH 1RGQA 1QRWA 1K22H 2ZEBA 4D9RA 3KCGH 2GZ8A 1MTNC 1G2MA 1CHGA 1O31A 1MCVA 7LPRA 1XUGA 1SGNE 1ELFA 3RXTA 1C5UA 1FZZA 1HB0B 1YPGH 2Y5HA 4UFGH 1D3PB 1SLXB 3SNCA 4LZ4B 4Y71A 2PTCE 1DE7H 1G36A 4NG9H 1AUJA 1SOTA 1CT0E 3RC4A 1GVKB 4CH2B 3K6YA 3NWUA 1OWKA 1SGTA 1S81A 3BEIB 3RXEA 5E8EH 1LHCH 2A1DB 1NRNH 2BOKA 3HATH 2A7CA 1GJDB 2ZZUH 5LH8A 1EZSC 4PROA 1IQNA 4AFUA 3BTME 4YLUA 3MTYA 3BIVH 3MH4A 3BTWE 2ZA5A 3VGCB 1C1NA 3F9HA 1P01A 2OQUA 4KTSA 4NSVA 4NCYA 1TPPA 3GCTG 3VB3A 3ZVGA 2WINI 3OX7U 1TMTH 1FY5A 3GY6A 1AKSB 2PUQH 1H4WA 3C1KA 2BLVA 4RKOB 2FI4E 2WYGA 1KTTB 3ZZ9A 4Y8ZA 1VITH 1INCA 1N6XA 1BRAA 2ZP0H 1SGIB 5JB8S 2Z9KA 5JB9S 9ESTA 4X1PU 3VEQB 1B5GH 3MYWA 3OYPA 1HAZB 2JKHA 1AQ7A 4ZKSU 1O3FA 3DUXH 4JYVH 2XWBI 1Y59T 4X1RU 3TH4H 1MTVA 3L33A 3EE0B 1W0ZU 5F03A 1YPMH 2XC0A 3M3TA 2XNIA 4ZHLU 1C5ZB 5J4QA 1VCPA 3M36A 1O3EA 1GHWH 1Y5AT 1THRH 4TPYA 3RXVA 3TJNA 4THNH 1BMAA 2VVUA 3A86A 4ZKOU 1NPMA 4O3UA 3A81A 3D23A 4CREA 5C5OA 1P9SA 1ZPCA 3TK9A 2I6SA 4CHAB 1GBAA 1GWAA 5B6OA 2D1JA 3QGNB 5FCKA 1PFXC 1RRKA 1GG6B 2QF3A 3S0NA 1H9IE 2PKSC 2GT7A 4WH8A 4Y76A 1FY3A 1OWIA 1PQAA 1SG8B 1Z1IA 2G81E 1EAXA 1JXPA 3MNCA 3A7XA 3RXRA 3TVJB 2AS9A 5I46H 2XBXA 4IMQA 1DX5M 1UHBA 5C67A 2FZZA 3NPSA 2A2XH 1ZJKA 2FOFA 1TMBH 2Y5GA 3DT0H 1NFUA 3MHWU 3BEFB 3CS0A 2BVSH 3NK8A 4AB9A 1OWHA 4H42U 2C3SA 3PB1E 2QAAA 2HGTH 1SFQB 2BQ6B 1V2UT 1YPLH 2BDAA 2BQ7B 1BTZA 1MAXA 3GY5A 3QO6A 4MPWA 3LC5A 1NFYA 2XWAA 5ESBA 1VGCB 1HGTH 3RLYH 5EQSA 1BHXF 3SV9A 3MNBA 3RXSA 3LT3A 4IGDA 2FXRA 5JBTA 2ZHQH 3SUFA 1BIOA 1GJ5H 1KY9A 4OS4A 5DPAA 3TNSA 2C8ZB 4WH6A 3TIUA 2ZHFH 3UWJH 1LHFH 4CR9A 1FUJA 1UCYH 5C3NA 1TB6H 3VB6A 2SGEE 2BD5A 2TGAA 3D65E 1KSNA 2VWMA 4ABDA 1C1PA 3RM0H 4TPIZ 2ZFSA 1B0FA 1P2QA 2VIDA 5L2YH 4LOYH 2BD3A 3RMNH 2OBQA 1RD3B 3HK3B 2J2UA 3WY8A 3H5CB 4CRGA 1MCTA 2VWOA 4MNYA 4YM9A 3U8TH 3F9FA 1GBLA 3BF6H 3SOSA 1A5GH 1BDAA 1TYNA 3M3SA 3RM2H 2H5DA 1LPGB 1EXFA 3UIRA 1GHYH 3F9GA 1EB2A 2ZG0H 1U6QA 3D49H 1B0EA 5GPIB 2JH0D 1H9LB 1GMHG 3MH5A 5DP7A 1VCWA 2GGVB 2ZDLA 3LJOA 1JIRA 1FNIA 4CRFA 2SGDE 2Y80A 1FLEE 3KGPA 4KP0A 1TNGA 4MPUA 4BAHB 1T7CA 1AZ8A 1VR1H 1EQ9A 3OU0A 4FVBA 2RCEA 3A8CA 4A1TA 2FP7B 1GDQA 3LGTA 4U32A 3UNRA 2B7DH 2BOHB 3ATIA 2BY6X 3BEUA 1BCUH 2GDDA 1ESBA 2Z3DA 1DUEA 3ZVBA 1AFEH 1O36A 2BD2A 3SO3A 1T8NA 2RA0A 2PKAB 4CRCA 4R0IA 3HKJB 2CJIA 3MU4A 5JPMH 2FODA 1MTUA 1HJAC 1SPJA 3P17H 4WVPE 3PMAB 1Q2WA 3E8LA 3Q3XA 2EC9H 1O3OA 1TE0A 2EI8A 1DSUA 4MNXA 4QT8C 2XC5A 2ZWLH 4E7RG 1P10A 4MDSA 1W12U 3I29A 1ZLRA 2VIOA 3RXCA 1FDPA 1QBVH 1LVYA 4FUGA 2NU0E 1BMLA 2FM2A 1O2ZA 2HNTC 2B8OH 3ENSB 1HXFH 1SGFG 4FUIA 2A4GA 1ELBA 2UUJB 3T26A 2P3FH 5BRRE 1EP5A 4H6TA 2ZDAH 1IOEA 4GUXA 1D3TB 4FXGH 3E91A 2Q6DA 2VVVA 2P95A 1XUHA 2G5NA 3MU5A 1IAUA 4NIWA 1BRCE 3VB4A 1DXPA 2B9LA 2GV6A 3P70B 4BAKB 2ZDMA 1HYLA 3LDXH 3GOVB 3HGNA 1D3QB 1Z6EA 2CGAA 2V0BA 1G3DA 4TWWA 1C5YB 2IJOB 2QC2A 5GJ4B 4IN2A 1YPKH 2ZPQA 1TNIA 1Y3XA 1BHXB 2FLBH 3SI3H 1YYY1 4WMEA 1Y3VA 1MKXH 3UPEA 2BDBA 3RMOH 1TNKA 1ANDA 1TLDA 1HBTH 3RUOA 1IQHA 1Y3UA 2VU8E 3RC6A 2BVXH 1W14U 4OS5A 3PM3A 1K28D 1TQ0B 2Y81A 1ETRH 1BBRH 2Y7ZA 1DS2E 1TMUH 5CHAB 3AVZA 1Z8JB 5A0AE 2FTMA 3T62A 1GJAB 1P2OA 1BTXA 3ZV9A 1TFXA 1AFQB 3URCA 3MU8A 5FBIA 1AU8A 4XBDA 1DLEA 4TYDA 4YT6H 4MTBA 1HAYB 5A8XA 2XBVA 2PLXA 1IQIA 4HFPB 1CBWC 4DVAU 2ZU4A 1UTPA 2ZFTA 4Y0ZE 1O2OA 1QL8A 3BSQA 1W11U 2BD9A 1KXAA 1GDNA 2Z94A 2BLWA 4A7IB 3QWCH 4BAMB 1HFDA 2ODQA 1IQKA 1DXWA 1DY8A 2FOEA 2FYRA 4O3TA 1TOCB 3SU0A 3GDSA 4KGAA 3U8RH 2OQ5A 3A7WA 1NO9H 1P0SH 1GBIA 5FBEA 3NXPA 3QUMP 1FMGA 3B9FH 3SUEA 2UWOA 3FANA 1EZXC 1V2QT 4INHA 3M7TA 3E0NB 2FESH 3MO3A 1F5KU 1RFNA 1HV7A 2GKVE 2TBSA 1QRZA 1CGIE 3ZVCA 4ZXYH 1Y3YA 2ZGHA 3RMMH 1ZYOA 2XBWA 4FVDA 3ESTA 2VH0A 1XKAC 1SGQE 4BTIB 2W3KA 3UWIA 4D8NA 1XKBC 2H6MA 1UTOA 1HXEH 1X7AC 3M7UA 1JRTA 1O3GA 2TRMA 3HPTB 1SGYE 4F49A 1HJ9A 4I31A 2BXTH 2GCHF 2QV1A 4X6PA 3NCLA 5L6NH 3LPRA 1HIAB 1ZHRA 1C5TA 4B74A 1L1JA 4MLFB 2ZHDA 4B2BA 1FXYA 1K1MA 1N8OB 1TALA 1P02A 1O5DH 4Q2KA 3LGUA 1UK3A 1BMNH 4ZH8A 2A31A 5JYIA 3KQCA 2QGRA 1S82A 1CA0B 4JCNA 6CHAB 2GVFA 1GBDA 1CU1A 1PQ5A 2ZTYA 2A32A 1CE5A 4ZUHA 1GBHA 4RN6A 4AOQA 1P9UA 2H5CA 4Q80A 5BPEA 4YESB 3TH3H 3E3TA 1EP6A 3RU4E 2PGQB 2VIPA 3ZZ6A 1P2MA 2WUCA 3ZZ7A 1W0YH 2XTTB 5GXPA 3A88A 4LK4A 1HRTH 4MNWA 1O2IA 1VITG 3K6ZA 3W94A 2FOMB 4K1TA 1W7XH 4J2YB 1MQ6A 2O8UA 1Y8TA 1ZSLA 3BTEE 4XE4A 1F0UA 1ZSKA 4I32A 5C1YA 1ZRKA 2ZDNA 3MWIU 3C27B 1DT2A 1AB9B 4SGBE 1H1BA 5F8ZA 1P04A 4ISIH 1LPKB 2ZU2A 1WV7H 2VWLA 1O2SA 4X8UH 1BOQA 2GMTB 2FLRH 3QN7A 5EU8A 4MPVA 1UTQA 1C1QA 2BVRH 4K8BA 2VIVA 1RTFB 2A2QH 1OS8A 2Z9LA 1ELVA 3SU5A 1S83A 1TAWA 1ZTLA 3F68H 4IC6A 1TABE 2QYIA 1KXBA 2ANYA 1GI6A 2JH6D 5T6DA 1GI9B 4XSKU 2PKAA 3BG4B 4ISLA 4D9QA 2BDHA 1LMWB 1O3KA 1SLVB 1NRRH 2JETC 2AERH 3EYDA 3TGIE 3IITA 1LVBA 3EA7A 2P93A 1MKWK 2PHBA 1F2SE 2OC0A 2AEIH 1TRYA 1F7ZA 1TNLA 5A0CA 4AZ2B 3RXOA 4Y8XA 5GIBA 4INKA 4FUFA 4K3JA 4CH8B 2BDGA 3TU7H 2Z7FE 1KXFA 1GHAF 1GVZA 2PUXB 1AGJA 4FUCA 1YPHE 1AY6H 1GDUA 3PO1C 4MVNA 5L30H 1NTPA 2AMPA 1C5RA 1V2ST 1GHBG 2CF9H 3LIWA 3SU2A 1DANH 2DE9A 1ZMLA 2ODYB 4I8JA 4JZEH 3HKIB 2HLCA 5EPNA 1O3LA 6GCHG 4IMZA 2ZECA 1LHEH 7ESTE 1C2FA 1C5MD 1GPZA 1FIWA 2IN2A 2ZFPH 3SUGA 4CRAA 2OXSA 1UVPA 1L0ZA 3OY5U 1HAVA 2M5TA 2TIOA 2P94A 1PPGE 3R0FA 3ATLA 1TA6A 3VXEH 1YP9A 8ESTE 1WSSH 1T32A 3RXJA 1OKXA 4UFDH 3RXQA 1MQ5A 4A92A 1KLTA 1F92A 2VGCB 1BUIA 5TJXA 2IPHA 3EAJA 7GCHG 1GHXH 1GMDG 4YTAA 2ILNA 2CHAC 2OD3B 2R2WU 2XW9A 1RIWB 4HTCH 2GCTC 3V7TA 1J9CH 3VPKA 1OPHB 1HUTH 3RP2A 1O2QA 1G3EA 4A1XA 1TPOA 4ZXXH 2ZPSA 1DWCH 1T8LA 3BV9B 3TGJE 4ZMAH 1C2JA 1OYQA 4CRDA 2O8MA 3DD2H 1ETTH 1TBRH 4FU8A 4BOHA 5A09A 1E34B 2GD4B 3KQEA 2BZ6H 4CR5A 2J38A 2SNWA 3M35A 4WXVA 1Y3WA 4U30A 2NU3E 3DFLA 1FY1A 1G9IE 1LKAA 3RU4D 4FU9A 1QQUA 2VWNA 1DLKB 3VB5A 1AUTC 3SV7A 2VINA 3P95A 4YOGA 4I33A 1DVAH 1C5WB 1TX6A 2B5TB 3SU3A 3K2UA 1O2MA 1IQEA 1V2WT 5AF9H 4NFEA 4GPGA 4NIVA 1D4PB 1VCQA 3KEEA 4Y11E 1GCDA 4GCHF 5F8XA 3DFJA 1ZJDA 1SHYA 3IG6B 4H4FA 4B2AA 2BD7A 2O8TA 3ZVDA 1EPTA 3AW1A 1MTNB 4IW4E 1SFIA 1FN8A 1GI3A 1H9HE 1NC6A 3RLWH 1NT1A 3BIUH 1BT7A 1C1MA 1UVSH 5F6MA 1P2IA 2J95A 1SVPA 1ELEE 1QBNA 1AIXH 1TPAE 2B0FA 1EUFA 2OTVA 3SNAA 1WU1A 2XBYA 1C2EA 1DOJA 2HWLB 3H7OA 4H6SB 4HI3A 1C2LA 4UFEH 1NY22 1B7XB 3QX5H 4RKJB 1DY9A 1NRSH 3FZZA 3RMLH 4DJZB 4Y0YE 2R2MB 3JZ2B 3ZZCA 2ZQ1A 2BYAX 1WAYB 2BLQA 1TBQH 2UWLA 3SNDA 4ZHMU 3SZNA 1AZZA 1PPHE 3NUMA 8LPRA 2Z6BD 4LXBH 1AE5A 1KXEA 5C5NA 5C20A 2A4OA 2AFQB 1A0HB
chains in the Genus database with same CATH superfamily
1DWDH 2KCYA 1NS3A 2YNBA 1AVXA 1NBMD 1Z6JH 3Q3YA 3GY7A 1ZPZA 1DSTA 3P6ZB 2Y5FA 1S6FA 4UD9H 1QB1A 1A3EH 2FPZA 1EATA 1ZZZA 1GHZA 2H9TH 3E16B 3A8BA 3PRBA 4X2YA 1ZRBA 1O5EH 1VJ9U 1C9PA 1ETSH 3S9BA 1C2DA 1P3CA 3QLPH 3S7HB 1SGCA 8GCHG 4Y8YA 6LPRA 3OTJE 4DG4A 1YLCA 3R3GB 2ZCHP 2J98A 3BTTE 3N7EA 1QHRB 3M5NA 4BXSA 1RTLA 3ZYDA 1SQTA 1C2IA 3Q00A 3FO8D 1GJBB 1LKBA 5EQRA 1WOFA 2F3CE 5FX6A 3PTBA 2ZFRH 1K1OA 1LCYA 4F4OC 5EGMA 1DUAA 4U01A 1QQ4A 2FWWA 3UOUA 3GDVA 1GJCB 1O2GH 2KM0A 1ARCA 2A5KA 3FP6E 3GCTF 2NWNA 1P03A 1PYTD 3SJOA 1ELAA 4D7FA 4K5ZA 1FI8A 2FOAA 3OE7D 3P8OA 1J8AA 3WWBA 1C2HA 1YLDA 2GZ7A 3OEED 4IBLH 1F0TA 1S0RA 2ZTZA 3V12A 1NU9A 2HRVA 1TGTA 2Y7XA 3ODFA 2PKSB 3KQ5A 1W10U 4K2YA 1F5LA 1ELDE 5DKMA 1GCTC 1EKBB 4I8HA 2HNTF 1GI0A 1AHTH 1ANCA 2R0LA 3KYGA 1C5SA 5HYOA 3ZZAA 5EXLA 2G55A 1UJ1A 4ABAA 1FONA 1A0LA 4MPXA 2F83A 1LHGH 2QF5A 3ATKA 1W8BH 4X1SU 3RU4T 3TK5A 5ESTE 3GCOA 3LONA 1GJ4H 1O3BA 2Z3CA 4VGCC 2A5IA 4JZFH 3SJ9A 4X1QU 2XYAA 3KL6A 1EJAA 1K1LA 1PQ8A 1C2GA 4NA9H 2K8IA 1UTLM 1O3DA 1SGDE 6ESTA 3LGVA 2JJ1D 1EZQA 5DP9A 1A7SA 1ABIH 1SSXA 1CHOG 2HLDD 1GMCG 4Q7XA 3QK1A 1J15A 3GYLB 1KIGH 1KDQB 4AFSA 1CT2E 2F9OA 4B76A 3EQ0H 4Z0KA 1DWBH 1Z7KA 1FPCH 1Z8RA 2C8XB 3GY8A 3OTPA 2ZF0H 4MNVA 4XBBA 4B1TA 2AMQA 1W2KH 1TGNA 1Y5UT 2WPIS 2CK3D 1ID5H 1O32A 2ZQ2A 1E38B 2GZ9A 2ZGBH 2PSXA 4WJG2 1YC0A 2V3MA 1AN1E 1C1OA 1K1PA 3H7TA 3L6PA 4DY7B 2QXIA 3LGWA 2J9NA 1A5HA 1TOMH 1EASA 1MZDA 3QZRA 4ISOA 4X6OA 3VB7A 4F55A 2WPLS 3SORA 1C1SA 1ARBA 3AAVA 1DDJA 2QE7D 2KFWA 1GBEA 3F2FA 2BX3A 3M5LA 1AVWA 4OS7A 1E37B 1T8OA 3CS7A 3PLPA 5DK1A 1S84A 1GBKA 4NWKA 3F9EA 3A8DA 2AGEX 1C9TA 4OS6A 4GHTA 2AMDA 4FUBA 3O8RA 4IS5A 1EPTC 1KXCA 2DE8A 1YWUA 2G4UA 1EOLA 1AKSA 2EI6A 1EAIA 2H9HA 1MD7A 1TX8A 1QTFA 5E0JA 3SV8A 3BTDE 4X0WU 1XUFA 4E05H 3FZDA 2SGPE 1ZGVA 1YF4A 5A8YA 3KN2A 2AYWA 1G37A 1O5AB 2P8OC 5JDUB 1MKWH 1HJ8A 3TITA 1P06A 1O39A 2Z3EA 2SGQE 1SOZA 4ASHA 4BTTB 1GGDC 2G8TA 4WMFA 1QB9A 5FPSA 2FMJA 3SN8A 2ALPA 4ZKNU 2FX6A 3V13A 4AGKA 2LPRA 4ZAEA 3ZYEA 2F9PA 5EODA 3EA8A 2DUCA 1XUKA 1E35B 1K2I1 1O2XA 1O0DH 3PMHB 5GCHG 1T4UH 4X2XA 1MBQA 3BTQE 1V6DA 3QGJA 4JK5A 3ZZ3A 1UCYE 1O35A 1V2VT 2BY8X 4Z1MD 2TGPZ 3V3MA 1SLWB 1GMHF 2ZKSA 4XOJA 1MD8A 5JBAS 3KF2A 1O5CB 3RXUA 3A82A 3D62A 5C2ZA 2WV9A 1SQOA 3E6PH 2KX4A 3RXLA 3UQOA 2C4FH 4BAOB 1THPB 3ATMA 1F5RA 3L3TA 2W7UA 4DIIH 3CP7A 5I25A 2ZU3A 2TGDA 1L4ZA 1ZSJA 1HAXB 1AWHB 1QL7A 1TQ7B 1QRXA 4NA7A 2UUFB 2OUAA 2W3IA 1SI5H 2PR3A 3U9AH 3KQBA 3VFEA 4LZ1H 4X6MA 1C4V2 3KNXA 4NFFA 1O33A 1FJSA 3S9AA 4AB8A 1NU7B 4AORA 2AGIX 2GT8A 3SV2H 2K0QA 3RXGA 2QXGA 2W7SA 3BTHE 1ZGIA 1C1WH 4R8TB 2K1QA 4ISNA 1HCGA 3A80A 1KTSB 4NIYA 1MU8B 2V6NA 3O8CA 3F6UH 4BAQB 4B71A 4Y7AA 1E0FD 1MTSA 5T6GA 1TGBA 1UVUH 3ZZDA 3RXMA 3OY6U 2UUKB 1YPHC 1QA7A 2OLGA 3PTNA 4JMYA 2NU4E 1GL1A 1C5PA 4IC5A 3ZVEA 2FS9A 1CSOE 3UR9A 2ZCLP 3AAUA 4J1YA 1OX1A 1ACBE 1UHBB 1GI7B 3W95A 3N7DA 1XUIA 1Y5BT 1BMMH 2GP9B 3U1JB 1GJ7B 1GI2A 1TGSZ 1N6YA 4JK6A 1NFXA 1MUEB 1XXDA 1CBWB 1D3DB 1GBCA 1JRSA 1EZUC 4INLA 1JWTA 5DP3A 3T29A 2I6QA 3GCHC 1O3IA 1V2OT 1OSSA 3K9XB 5HIYA 1JMOH 4AG1A 1WYKA 2HPQH 1UMAH 1SLUB 1TRNA 4FUEA 3PMBB 2QF0A 2QCYA 3RXFA 2SGFE 3SGQE 5FXLA 1THSH 2PGBB 3SUDA 1V2PT 1QJ1B 3AW0A 4XBCA 1O2TA 5T6FA 2SFAA 1GJ8B 2VB0A 3LGIA 3T27A 1DM4B 2XRCA 3A7VA 5E2OA 3SU4A 1JOUB 1MH0A 1S5SA 2WPJS 4GSOA 1PPBH 4ZHAA 2ZGJA 3MI4A 5C1UA 3TGKE 1C5LH 2FX4A 5JBBS 2ZHWH 4X2WA 4YT7H 1W7GH 3RXPA 1V2LT 3M5MA 3P8NA 3SQEE 3OSYA 3GISB 4WXIA 3MNSA 1ZMJA 1MU6B 2M2AA 1E1RD 2UWPA 2RFKC 4Q7ZA 2OCVB 3RC5A 5LPRA 1J14A 5DJ7A 4Y6DA 1EAUA 1O2RA 2ZCKP 1C5NH 4ABFA 2J34A 1UVTH 3VGCC 1Z8IB 1SGRE 4M7GA 2ULLA 4Y10E 2BD4A 4I7YH 1O2NA 4O97A 4KTUA 3A7ZA 3Q77A 4JZ1A 2OBOA 2HVXA 4I8GA 2ESTE 1BBRE 4AC9A 3BG8A 1BMFD 2C8WB 2CF8H 1SL3A 1ELCA 1TNHA 5DP5A 3G01A 4BANB 4Q4LA 4AG2A 1ZOMA 5ABWA 1SC8U 2VNTA 4WY3A 1O2LA 2W5EA 3A85A 1BA8B 3Q3KA 2A4QA 4NGAH 1G32B 1P57B 2KAIB 1ESTA 2FOCA 3ZIAD 5HMAA 1QURH 4DT4A 1OP0A 1ZHPA 2BZAA 2PSYA 1GBFA 1V3XA 1YCPM 1BJUA 4UONA 1O2VA 1Q3XA 3GY2A 4HG6A 1SBWA 5EG4A 4DOQA 1VZQH 1GL0E 1W3CA 5CMXH 1FAKH 1FPHH 2AIPA 4AGJA 4KTCA 1HAPH 3QTVH 1DFPA 4TY7A 4JZIA 4XDEA 5PTPA 1O3JA 2ZHEH 3HGPA 3UTUH 1OWDA 3E1XB 3M5OA 2WPHS 1TIOA 2CN0H 4M9FA 4YOJA 2OC8A 3A7TA 1ZTKA 3BTGE 1P3EA 3DSPA 2BY5X 1HAGE 5GWZA 2FTLE 1GBMA 1E1QD 5A0BA 3ATWA 5E0GA 3K65B 3BTFE 9LPRA 1UK4A 3TPIZ 4CHAC 1CVWH 1O2KA 3UFAA 2BY7X 3FKSD 3UNSA 3GY4A 1GG6C 3OFND 4Q63A 5AFZH 3LGYA 5DG6A 1AWFH 1NM6A 2C93B 3PWBA 4ABIA 2VJ1A 5HKKD 1SR5C 1LPZB 2GX4A 5K0HA 2J92A 2BX4A 1TGCA 1GI5A 1LQDB 2C8YB 3MMGA 4I8LA 2P3TB 4X8TH 2SGAA 1WBGB 1SHHB 1G3CA 1O3MA 1YGCH 4CBNA 1PPFE 3TJOA 2YOLA 4B2CA 1E36B 4DURA 3F0PA 4YZUA 1L2EA 3SI4H 1VITF 3DA9B 2F9UA 4XFQA 1O30A 2JETB 1CT4E 5A8ZA 1NZQH 7KMEH 1KLJH 1TWXB 2HOBA 2ODPA 1G30B 3ZZ4A 1A0JA 3O8DA 3GYMA 2FS8A 4YOIA 1IHSH 1VGCC 2F9BH 3STIA 1CGJE 2L74A 1NFWA 1YPJH 1KXDA 4X1NU 4ZROA 4AYYB 1YCPH 2ZTXA 1PPCE 1BQYA 2G4TA 2ZGCA 4DGJA 4NZQA 3T28A 3SGAE 1O3NA 1MZAA 3PV4A 3RXHA 3PO1B 3TK6A 1GJ9B 2ZU5A 3GICB 5LGOA 1CGHA 1LO6A 3MFJA 3PROA 1GBJA 3SU6A 3A89A 3B23B 2ZDVH 1QIXB 1HLTH 3RDZA 1O2WA 1S0QA 3UR6A 3DSGA 1QGFA 3A87A 1NRPH 1XXFA 3B8JA 1BB0B 2Z9GA 1O2HA 3MU1A 4YO9A 3S9CA 1HIAA 2ZI2H 1P05A 1LDTT 2HALA 4IN1A 1VJAU 3U8OH 1EJNA 2RDLA 2R3YA 3M7QA 2FOBA 2P3UB 2FEQH 1C1UH 3P8GA 1N1LA 2R3UA 2CMYA 2CHAB 1C5XB 4ZCNA 1RTKA 1C2KA 2GCTB 1GI1A 2SNVA 1WQSA 2BB4A 5H4IB 2QY0B 4ABHA 4OGXA 1CQQA 4DCDA 5IK2D 2PWXA 1GHBF 2ZO3H 4TY6A 4SGAE 1DWEH 3AASA 4X8SH 3VXFH 1ZPBA 2J97A 3EA9A 2Z9JA 6GCHF 3KHVA 2PFEA 4Y79A 3FP8E 2OINA 1RJXB 4UDWH 4JZDH 4U2WA 4ESTE 1L1NA 2LNCA 1LQEA 4TWYA 1V2KT 3STJA 1QR3E 4K1EA 1O37A 2Y82A 3FVFB 3PWCA 1QNJA 1K9OE 3EGKH 3QDZB 2KCPA 3LH3A 1A61H 2WUBA 4AFQA 1C4U2 1AO5A 3U69H 3UREA 7GCHF 1BTHH 1XVOA 1ZR0A 4UFFH 1HAOH 3PMJA 4E7NA 1J16A 1ZMNA 5AFYH 4BXWA 1OP2A 1JBUH 1GMDF 1P2KA 3E90B 1SGEE 5CDFE 2A5AA 1BTPA 2XC4A 2G52A 2JDID 3T25A 4I8KA 1AE8H 1CO7E 1PPZA 1YPEH 1O2PA 1O2JA 1H8IH 1KYNA 1GI8B 1XX9A 2BDYA 2W26A 1A2CH 1NN6A 5DGJA 2WYJA 5G4BA 1TPSA 1O2YA 1P8VC 4HZHA 1WUNH 2AIQA 1AI8H 3JZ1B 5FHTA 5ETXA 2VIQA 1M9UA 1T31A 2F91A 5IYTA 3QZQA 2V3OH 2Q6FA 4UE7H 2ANKH 1LTOA 4GHQA 1IQFA 3SNBA 1OXGA 2FOHA 3MOCA 4KELA 4UEHH 5FX5A 3RXDA 5F8TA 3URDA 5GNDA 1P2NA 3V0XA 1FN6A 2BD8A 3M61U 2FDAA 3MO9A 3MH7A 1K1IA 1W13U 4K69A 2H1UA 3MH6A 4NSYA 5DP6A 3SQHE 2YMSB 2AH4X 4NWLA 4A6LA 1Q31A 1GJ6A 3KYFA 1RXPA 1D6WA 3UUZA 1ABJH 5HM9A 1YM0A 5T3HA 2QA9E 2KAIA 2OP9A 3FP7E 1RS0A 4BTUB 1FV9A 1K1NA 4K8YA 5EPYA 1LVMA 3T2NA 3RXIA 1QJ6B 5CHAC 2RG3A 2ANMH 2P59A 4NIXA 1MAYA 1QFKH 2ZC9H 1ELTA 4ABJA 2VH6A 1AFQC 2H9EH 4X2VA 5EXNA 1WTGH 5EJLA 1YCPK 4B73A 1WTHD 3U1IB 2GTBA 2WPKS 1IQMA 3PYHA 1P09A 3SJKA 2W6ID 4AX9H 4A1VA 4NA8A 4NZLA 1ESAA 1BZXE 1O5BB 1OWEA 1V2NT 2A7HA 2FO9A 2GCHG 5JBCS 1PPEE 2D2DA 2FIRH 2GDEH 5TCCA 1T8MA 3UQVA 2ASUB 1FY4A 4DIHH 1OP8A 5AHGH 3SJ8A 5SGAE 1IQGA 4CBOA 1OYTH 3N7OA 1E79D 3DHKH 1P12E 1UO6A 1H8ED 4MG3A 2V3HH 4OS1A 4ABEA 3IWMA 2RDEA 2BHGA 1EB1H 2STAE 1C5OH 1JIMA 5FPTA 5C94A 1SGFA 1KMHB 2A0QB 1CA8B 2PW8H 2ZFFH 1FAXA 1DITH 5HM2A 1SMFE 4I86A 4AYVB 4AN7A 5LPEA 1A3BH 1J17T 5EXMA 2PTNA 5EOKA 1GCTB 2D8WA 5GDSH 3RXKA 4WF8A 2BTCE 3TNTA 4X8VH 5FPYA 1L1GA 1QL9A 3SHAH 2G00A 3SNEA 5FAHA 5CE1A 1QY6A 2EEKA 2RA3A 2YNAA 1S85A 3NZIA 1WXRA 1HAVB 3P92A 4D76A 1EJMA 8GCHF 3SV6A 3RXAA 2WPMS 4VGCB 4MQAA 3SJIA 1HAHH 1HAIH 4ABBA 4ACAA 1V2TT 3EE7A 1TNJA 2FI5E 1FY8E 1N8OC 1G2LA 2H2ZA 3LOXA 2BMGB 1BRUP 3LU9B 1F0RA 2NU1E 3M37A 2BXUH 3SGBE 3GDUA 2Z9IA 2Q6GA 2AGGX 2O8LA 2BY9X 5DP4A 1GBBA 1HJAB 3MO6A 2HPPH 5LPFA 1CA0C 1EX3A 5AVDA 4BNRA 3PLBA 6CHAC 1QZ8A 2PV9B 5E2PA 3Q76A 1F0SA 2TPIZ 3H09A 3LJJA 3MU0A 1C1RA 1XM1A 1HPGA 5EW2H 2ZGXH 1O38A 1YBWA 1BITA 1BTYA 2ANWA 1QB6A 1EAWA 3ZVFA 3SHCH 1GI4A 2THFB 2A7JA 1ANBA 3GY3A 2XCNA 4A5TS 1NROH 1Z8GA 2A45B 1UCYK 3W1EA 2D26C 1LVOA 1FIZA 1UVOA 3TJUA 3ELAH 1P2JA 4FUDA 3MNXA 3U98H 3F2HA 2XCFA 1W0JD 1AB9C 1C4Y2 4B75A 2O8WA 1D9IA 1OWJA 2G5VA 4GVUA 1WQVH 1CHOF 4AFZA 1GMCF 1IQLA 1GHAG 2QN5T 1ELGA 5E0HA 3ODDA 3TLOA 5HXFA 2GMTC 5DSFA 2CV3A 3TJVA 1TX7A 2BLOA 4DT7B 4WMDA 2HNTE 1EPTB 1NRQH 3OEHD 1QJ7B 3U28C 2VIWA 1ORFA 3S7KB 1XUJA 4D7GA 3M3VA 3SW2B 1XVMA 3HK6B 2BM2A 2P16A 3UY9A 2CXVA 1ZHMA 4GAWA 4O03A 3A7YA 2Q1JA 1O5GH 3BG4C 1DICA 1BTWA 4OGYA 1C5VA 5TCAA 1AVGH 1BJVA 1MTWA 1LHDH 5EQQA 2P8OB 3ZZ8A 1BRBE 1T4VH 3A83A 2J5UA 4K60A 2QXHA 5C1XA 2EI7A 1GVLA 1GGDB 1S6HA 1UTKA 3NKKA 4WWYA 2OC1A 4HGCA 4DW2U 4KKDA 2C90B 1G3BA 1V2MT 2F43B 1SQRA 3EDXB 5IDKA 4YXWD 2QIQA 2BQWB 1K21H 3I77A 2F9VA 1A4WH 1HDTH 4Q7YA 2QXJA 3I78A 3SU1A 3KIDU 1Z1JA 5DP8A 1A46H 2ALVA 1UTJA 2XNDD 1PYTC 5J4SA 1TBZH 1C1TA 1QCPA 1HNEE 2J4IA 8KME2 5L2ZH 5FCRA 1K1JA 2VVCA 2BDCA 2UUYA 2FOGA 3BTKE 5EJZA 2LELA 2STBE 5EW1H 1PQ7A 3A84A 2XXLA 1UTNA 2NU2E 3P8FA 4ABGA 3KQDA 1L4DA 1TA2A 3FAOA 3CENA 4Y7BA 3PLKA 1GHVH 1XMNB 4GLYA 3TH2H 1OOKB 5A2MH 1D6RA 1UK2A 1Z71A 4ISHH 2R0KA 1V2RT 2J94A 2F9NA 1SGPE 1P11E 2J98B 1IHTH 1O5FH 3A8AA 2JH5D 1ZTJA 2FYQA 1ANEA 1QA0A 1SB1H 3S69A 3LC3A 4YLQH 4FUHA 1IQJA 3ZZ5A 1FX0B 4FU7A 2GJGA 2VGCC 2ZU1A 1DPOA 2IOTA 3SBKA 3FFGA 3QTOH 4GCHG 1V2JT 1TONA 3F1SB 1KDQA 1H8DH 4RSPA 1RIWC 5GCHF 1NESE 1O34A 1FQ3A 2OK5A 4K1SA 1C2MA 4E06H 5DO4H 3ZZBA 2IJD1 2FI3E 1KLIH 1UTMA 3FOAA 1A5IA 4ZKRU 4JYTA 2ZIQH 3ITIA 2G51A 2V35A 1C1VH 1MKXK 1MMJN 4JYUH 1WCZA 1TRMA 1SQAA 1YKTA 2ZPRA 1PJPA 4CRBA 1A1RA 1GBTA 3RXBA 2R9PA 3UNQA 1O2UA 4Z6AH 2TGTA 2Y6TA 2BDIA 2ZDKA 2WPDD 1BBRK 5HGGA 1O3CA 3BN9A 3LKWA 1EOJA 2WV5A 3GCNA 2WV4A 4FUJA 3E0PB 1BTUA 5K7RA 3T5FH 1AMHA 4X6NA 3UOPA 2EA3A 1MBMA 1QBOA 1O3PB 2GV7A 3ZVAA 4OS2A 3O8BA 1C5QA 4O9VA 2ZFQH 1AD8H 3GCHB 1O3AA 3LH1A 2OC7A 3ZV8A 1O3HA 2A4RA 2O9QA 2ZNKH 1RGQA 1QRWA 1K22H 2ZEBA 4D9RA 3KCGH 2GZ8A 1MTNC 1G2MA 1CHGA 1O31A 1MCVA 7LPRA 1XUGA 1SGNE 1ELFA 3RXTA 2EY4C 1C5UA 1FZZA 1HB0B 1YPGH 2Y5HA 4UFGH 1D3PB 1SLXB 3SNCA 4LZ4B 4Y71A 2PTCE 1DE7H 1G36A 4NG9H 1AUJA 1SOTA 1CT0E 3RC4A 1GVKB 4CH2B 3K6YA 3NWUA 1OWKA 1SGTA 1S81A 3BEIB 3RXEA 5E8EH 1LHCH 2A1DB 1NRNH 2BOKA 5CHBA 3HATH 2A7CA 1GJDB 2ZZUH 5LH8A 1EZSC 4PROA 1IQNA 4AFUA 3BTME 4YLUA 3MTYA 3BIVH 3MH4A 3BTWE 2ZA5A 3VGCB 1C1NA 3F9HA 1P01A 2OQUA 4KTSA 4NSVA 4NCYA 1TPPA 3GCTG 1COWD 3VB3A 3ZVGA 2WINI 5T1VA 3OX7U 1TMTH 1FY5A 3GY6A 1AKSB 2PUQH 1H4WA 3C1KA 2BLVA 4RKOB 2FI4E 2WYGA 1KTTB 3ZZ9A 4Y8ZA 1VITH 1INCA 1N6XA 1BRAA 2ZP0H 1SGIB 5JB8S 2Z9KA 4P02A 9ESTA 4X1PU 3VEQB 5JB9S 1B5GH 3MYWA 3OYPA 1HAZB 2JKHA 1AQ7A 4ZKSU 1O3FA 3DUXH 4JYVH 2XWBI 1Y59T 4X1RU 3TH4H 1MTVA 1W0KD 3L33A 3EE0B 1W0ZU 5F03A 1YPMH 2XC0A 3M3TA 2XNIA 4ZHLU 1C5ZB 5J4QA 1VCPA 3M36A 1O3EA 1GHWH 1Y5AT 1THRH 4TPYA 3RXVA 3TJNA 4THNH 1BMAA 2VVUA 3A86A 4ZKOU 1NPMA 4O3UA 3A81A 3D23A 4CREA 5C5OA 1P9SA 1ZPCA 3TK9A 2I6SA 5KGOA 4CHAB 1GBAA 1GWAA 5B6OA 2D1JA 3QGNB 5FCKA 3F0OA 1PFXC 1RRKA 1GG6B 2QF3A 3S0NA 1H9IE 2PKSC 2GT7A 4WH8A 4Y76A 1FY3A 1OWIA 1PQAA 1SG8B 1Z1IA 2G81E 1EAXA 1JXPA 1YY3A 3MNCA 3A7XA 3RXRA 2WZQA 3TVJB 2AS9A 5I46H 2XBXA 4IMQA 1DX5M 1UHBA 5C67A 2FZZA 3NPSA 2A2XH 1ZJKA 2FOFA 1TMBH 2Y5GA 3DT0H 1NFUA 3MHWU 3BEFB 3F2GA 3CS0A 2V7QD 2BVSH 3NK8A 4AB9A 1OWHA 4H42U 2C3SA 3PB1E 2QAAA 2HGTH 1SFQB 2BQ6B 1V2UT 1YPLH 2BDAA 2BQ7B 1BTZA 1MAXA 3GY5A 3QO6A 4MPWA 3LC5A 1NFYA 2XWAA 5ESBA 1VGCB 1HGTH 3RLYH 5EQSA 1BHXF 3SV9A 3MNBA 3RXSA 2WSSD 3LT3A 4IGDA 2FXRA 5C0TA 5JBTA 2ZHQH 3SUFA 1BIOA 1GJ5H 1KY9A 4OS4A 5DPAA 3TNSA 2C8ZB 2HVYB 4WH6A 3TIUA 2ZHFH 3UWJH 1LHFH 4CR9A 1FUJA 1UCYH 5C3NA 1TB6H 3VB6A 2SGEE 2BD5A 2TGAA 3D65E 1KSNA 2VWMA 4ABDA 1C1PA 3RM0H 4TPIZ 2ZFSA 1B0FA 1P2QA 2VIDA 5L2YH 4LOYH 2BD3A 3RMNH 2OBQA 1RD3B 3HK3B 2J2UA 3WY8A 3H5CB 3SYJA 4CRGA 1MCTA 2VWOA 4MNYA 4YM9A 3U8TH 3F9FA 1GBLA 3BF6H 3SOSA 1A5GH 1BDAA 1TYNA 3M3SA 3RM2H 2H5DA 1LPGB 1EXFA 3UIRA 1GHYH 3F9GA 1EB2A 2ZG0H 1U6QA 3D49H 1B0EA 5GPIB 2JH0D 3SZEA 1H9LB 1GMHG 3MH5A 5DP7A 1VCWA 2GGVB 5C0UA 2ZDLA 3LJOA 4XRNA 4XD7D 1JIRA 1FNIA 4CRFA 2SGDE 2Y80A 1FLEE 3KGPA 4KP0A 1TNGA 4MPUA 4BAHB 1T7CA 1AZ8A 1VR1H 1EQ9A 3OU0A 4FVBA 2RCEA 3A8CA 4A1TA 3AK5A 2FP7B 1GDQA 3LGTA 4U32A 3UNRA 2B7DH 2BOHB 5F53A 3ATIA 2BY6X 3BEUA 1BCUH 2GDDA 5EIYA 1ESBA 2Z3DA 1DUEA 3ZVBA 1AFEH 1O36A 2BD2A 3SO3A 1T8NA 2RA0A 2PKAB 2F4LA 2KCAA 4CRCA 4R0IA 3HKJB 2CJIA 3MU4A 5JPMH 2FODA 1MTUA 1HJAC 1SPJA 3P17H 4WVPE 3PMAB 1Q2WA 3E8LA 3Q3XA 2EC9H 1O3OA 1TE0A 2EI8A 1DSUA 4MNXA 4QT8C 2XC5A 2ZWLH 4E7RG 2XOKD 1P10A 4MDSA 1W12U 3I29A 1ZLRA 2VIOA 3RXCA 1FDPA 1QBVH 1LVYA 4FUGA 2NU0E 4ACBA 1BMLA 2FM2A 1O2ZA 2HNTC 2B8OH 3ENSB 1HXFH 1SGFG 4FUIA 2A4GA 1ELBA 2UUJB 3T26A 2P3FH 5BRRE 1EP5A 4H6TA 2ZDAH 1IOEA 4GUXA 1D3TB 4FXGH 3E91A 2Q6DA 2JIZD 2VVVA 2P95A 1XUHA 2G5NA 3MU5A 1IAUA 4NIWA 1BRCE 3VB4A 1DXPA 2B9LA 2GV6A 3P70B 4BAKB 2ZDMA 1HYLA 3LDXH 3GOVB 3HGNA 4ASUD 1D3QB 1Z6EA 3PRDA 2CGAA 2V0BA 1G3DA 4TWWA 1C5YB 3PV5A 2IJOB 2QC2A 2JJ2D 5GJ4B 5KECA 4IN2A 1YPKH 2ZPQA 1TNIA 1Y3XA 1BHXB 2FLBH 3SI3H 1YYY1 4WMEA 1Y3VA 1MKXH 1S6LA 2BDBA 4OM9A 3RMOH 3UPEA 1TNKA 3OAAD 4P00A 1ANDA 1TLDA 3FN8A 1EFRD 1HBTH 3RUOA 1IQHA 1Y3UA 2VU8E 3RC6A 2BVXH 1W14U 4OS5A 3PM3A 1K28D 1TQ0B 2Y81A 1ETRH 1BBRH 2Y7ZA 1DS2E 1TMUH 5CHAB 3AVZA 1Z8JB 5A0AE 2FTMA 3T62A 1GJAB 1P2OA 1BTXA 3ZV9A 1TFXA 1AFQB 3URCA 3MU8A 5FBIA 1AU8A 4XBDA 1DLEA 4TYDA 3PV2A 4YT6H 4MTBA 1HAYB 5A8XA 2XBVA 2PLXA 1IQIA 4HFPB 1CBWC 3WWFA 4DVAU 2ZU4A 1UTPA 2ZFTA 4Y0ZE 1O2OA 1QL8A 3BSQA 1W11U 2BD9A 1KXAA 1GDNA 2Z94A 2BLWA 4A7IB 3QWCH 4BAMB 3VG8A 1HFDA 2ODQA 1IQKA 1DXWA 1DY8A 2FOEA 2FYRA 4O3TA 1TOCB 3SU0A 3GDSA 4KGAA 3U8RH 2OQ5A 3A7WA 1NO9H 4FOUC 1P0SH 1GBIA 5FBEA 3NXPA 3QUMP 1FMGA 3B9FH 3SUEA 2UWOA 4B6EA 3FANA 1EZXC 1V2QT 4INHA 3M7TA 3E0NB 2FESH 3MO3A 1F5KU 1RFNA 1HV7A 2GKVE 2TBSA 1QRZA 1CGIE 3ZVCA 4ZXYH 1Y3YA 2ZGHA 3RMMH 3UB0A 1ZYOA 2XBWA 4FVDA 3ESTA 2VH0A 1XKAC 1SGQE 4BTIB 2W3KA 3UWIA 4D8NA 1XKBC 2H6MA 1UTOA 1HXEH 1X7AC 2PP6A 3M7UA 1JRTA 1O3GA 2TRMA 2VBCA 3HPTB 1UW7A 1SGYE 4F49A 1HJ9A 4I31A 2BXTH 3MQKC 2GCHF 2QV1A 4X6PA 3NCLA 5L6NH 3LPRA 1HIAB 1ZHRA 1C5TA 4B74A 1L1JA 4MLFB 2ZHDA 4B2BA 1FXYA 1K1MA 1N8OB 1TALA 1P02A 1O5DH 4Q2KA 2QF4A 3LGUA 2YMSD 1UK3A 1BMNH 4ZH8A 2A31A 5JYIA 3KQCA 2QGRA 1S82A 1CA0B 4JCNA 6CHAB 2GVFA 1GBDA 1CU1A 1PQ5A 2ZTYA 2A32A 1CE5A 4ZUHA 1GBHA 4RN6A 4AOQA 1P9UA 2H5CA 4Q80A 5BPEA 4YESB 3TH3H 3E3TA 1EP6A 3RU4E 2PGQB 2VIPA 3ZZ6A 1P2MA 2WUCA 3ZZ7A 1W0YH 2XTTB 5GXPA 3A88A 4LK4A 1HRTH 2IPQX 4MNWA 1O2IA 1VITG 3K6ZA 3W94A 2W6JD 2FOMB 4K1TA 1W7XH 1SKYE 4J2YB 1MQ6A 2O8UA 1Y8TA 1ZSLA 3BTEE 4XE4A 1F0UA 1ZSKA 4I32A 5C1YA 1ZRKA 2ZDNA 3MWIU 3C27B 1DT2A 1AB9B 4SGBE 1H1BA 5F8ZA 1P04A 4ISIH 1LPKB 2ZU2A 1WV7H 2VWLA 1O2SA 4X8UH 1BOQA 2GMTB 2FLRH 4F48B 2L6OA 3QN7A 5EU8A 4MPVA 1UTQA 1C1QA 2BVRH 4K8BA 3DSOA 2VIVA 1RTFB 2A2QH 1OS8A 2Z9LA 1ELVA 3SU5A 1S83A 1TAWA 1ZTLA 3F68H 1K0HA 4IC6A 1TABE 2QYIA 1KXBA 2ANYA 1GI6A 2JH6D 5T6DA 1GI9B 4XSKU 2PKAA 3BG4B 4ISLA 4D9QA 5KEDA 2BDHA 1LMWB 1O3KA 1SLVB 1NRRH 2JETC 2AERH 3EYDA 3TGIE 3IITA 1LVBA 3GS9A 3EA7A 2P93A 1MKWK 2PHBA 1F2SE 1OHHD 2OC0A 2AEIH 3F3BA 1TRYA 1F7ZA 1TNLA 5A0CA 4AZ2B 2KCOA 4RT1A 3RXOA 4Y8XA 5GIBA 4B6FA 4INKA 1NBME 4FUFA 4K3JA 4CH8B 2BDGA 3TU7H 2Z7FE 1KXFA 1GHAF 1GVZA 5EJ1A 2PUXB 1MABB 1AGJA 4FUCA 1YPHE 1AY6H 1GDUA 3PO1C 4MVNA 2LP6A 5L30H 1NTPA 2AMPA 4RI0A 1C5RA 1V2ST 1GHBG 2CF9H 3LIWA 3SU2A 1DANH 2DE9A 1ZMLA 2ODYB 4I8JA 4JZEH 4TT3D 3HKIB 2HLCA 5EPNA 1O3LA 6GCHG 4IMZA 2ZECA 1LHEH 7ESTE 1C2FA 1C5MD 1GPZA 1FIWA 2IN2A 2ZFPH 3SUGA 4CRAA 2OXSA 1UVPA 3CNRA 1L0ZA 3OY5U 1HAVA 2M5TA 2TIOA 2P94A 1PPGE 3R0FA 3ATLA 1TA6A 5C17A 3VXEH 1YP9A 3WW7A 8ESTE 1WSSH 1T32A 4TSFD 4FETA 3RXJA 1OKXA 4UFDH 3RXQA 1MQ5A 4A92A 1KLTA 1F92A 2VGCB 1BUIA 5TJXA 2IPHA 3EAJA 7GCHG 1GHXH 1GMDG 4YTAA 2ILNA 2CHAC 2OD3B 3UAIC 2R2WU 2XW9A 1RIWB 5HIZA 4HTCH 2GCTC 3V7TA 1J9CH 3VPKA 1OPHB 1HUTH 3RP2A 1O2QA 1G3EA 2KZ4A 4A1XA 2EQNA 1TPOA 4RT0A 4ZXXH 2ZPSA 1DWCH 1T8LA 3BV9B 3TGJE 4ZMAH 1C2JA 1OYQA 4CRDA 2O8MA 3DD2H 1ETTH 1TBRH 4FU8A 4BOHA 5A09A 1E34B 2GD4B 3KQEA 2BZ6H 4CR5A 2J38A 2SNWA 3M35A 4WXVA 5DN6D 1Y3WA 4U30A 2NU3E 3DFLA 1FY1A 1G9IE 1LKAA 3RU4D 4FU9A 1QQUA 2VWNA 1DLKB 3VB5A 1AUTC 3SV7A 2VINA 3P95A 4YOGA 4I33A 1DVAH 1C5WB 1TX6A 2B5TB 3SU3A 3K2UA 1O2MA 1IQEA 1H8HD 1V2WT 2KR7A 5AF9H 4NFEA 1YLNA 4GPGA 4NIVA 1D4PB 1VCQA 3KEEA 4Y11E 1GCDA 4GCHF 5F8XA 3DFJA 1ZJDA 1SHYA 3IG6B 4H4FA 4B2AA 2BD7A 2O8TA 3NRLA 3ZVDA 1EPTA 3AW1A 1MTNB 4IW4E 1SFIA 5B6LA 1FN8A 1GI3A 1H9HE 1NC6A 3RLWH 1NT1A 1WDIA 3BIUH 1BT7A 1C1MA 1UVSH 5F6MA 1P2IA 2J95A 1SVPA 1ELEE 1QBNA 3DCLA 5FL7D 1AIXH 2WHXA 1TPAE 2B0FA 1EUFA 2OTVA 3SNAA 1WU1A 2XBYA 1C2EA 1DOJA 2HWLB 3H7OA 4H6SB 4HI3A 1C2LA 4UFEH 1VKYA 1NY22 1B7XB 2AHME 3QX5H 1DY9A 1NRSH 4RKJB 3FZZA 3RMLH 4DJZB 4Y0YE 2R2MB 3JZ2B 3N99A 3ZZCA 2ZQ1A 2YMSC 2BYAX 1WAYB 2BLQA 1TBQH 2UWLA 3SNDA 4ZHMU 3SZNA 1AZZA 1PPHE 3NUMA 8LPRA 2Z6BD 4LXBH 1AE5A 1KXEA 5C5NA 5C20A 2A4OA 2AFQB 1A0HB
chains in the Genus database with same CATH topology
1DWDH 1NS3A 2YNBA 1AVXA 1Z6JH 3Q3YA 3GY7A 1ZPZA 1DSTA 3P6ZB 2Y5FA 1S6FA 4UD9H 1QB1A 1A3EH 2FPZA 1EATA 1ZZZA 1GHZA 2H9TH 3E16B 3A8BA 4X2YA 1ZRBA 1O5EH 1VJ9U 1C9PA 1ETSH 3S9BA 1C2DA 1P3CA 3QLPH 3S7HB 1SGCA 8GCHG 4Y8YA 6LPRA 3OTJE 4DG4A 1YLCA 3R3GB 2ZCHP 3BTTE 1QHRB 3M5NA 4BXSA 1RTLA 3ZYDA 1SQTA 1C2IA 3Q00A 1GJBB 1LKBA 5EQRA 1WOFA 2F3CE 5FX6A 3PTBA 2ZFRH 1K1OA 1LCYA 4F4OC 5EGMA 1DUAA 4U01A 1QQ4A 2FWWA 3UOUA 3GDVA 1GJCB 1O2GH 1ARCA 2A5KA 3FP6E 3GCTF 2NWNA 1P03A 1PYTD 3SJOA 1ELAA 4D7FA 4K5ZA 1FI8A 2FOAA 3P8OA 1J8AA 1C2HA 1YLDA 2GZ7A 4IBLH 1F0TA 1S0RA 2ZTZA 3V12A 1NU9A 2HRVA 1TGTA 2Y7XA 3ODFA 2PKSB 1W10U 4K2YA 1F5LA 1ELDE 5DKMA 1GCTC 1EKBB 4I8HA 2HNTF 1GI0A 1AHTH 1ANCA 2R0LA 1C5SA 5HYOA 3ZZAA 5EXLA 2G55A 1UJ1A 4ABAA 1FONA 1A0LA 4MPXA 2F83A 1LHGH 3ATKA 4X1SU 1W8BH 3RU4T 3TK5A 5ESTE 3GCOA 3LONA 1GJ4H 1O3BA 2Z3CA 4VGCC 2A5IA 4JZFH 3SJ9A 4X1QU 2XYAA 3KL6A 1EJAA 1K1LA 1PQ8A 1C2GA 4NA9H 1UTLM 1O3DA 1SGDE 6ESTA 3LGVA 5DP9A 1EZQA 1A7SA 1ABIH 1SSXA 1CHOG 1GMCG 4Q7XA 3QK1A 1J15A 3GYLB 1KIGH 1KDQB 4AFSA 1CT2E 2F9OA 4B76A 3EQ0H 4Z0KA 1DWBH 1Z7KA 1FPCH 1Z8RA 2C8XB 3GY8A 2ZF0H 4MNVA 4XBBA 4B1TA 2AMQA 1W2KH 1TGNA 1Y5UT 2WPIS 1ID5H 1O32A 2ZQ2A 1E38B 2GZ9A 2ZGBH 2PSXA 4WJG2 1YC0A 1AN1E 1C1OA 1K1PA 3H7TA 3L6PA 4DY7B 2QXIA 3LGWA 2J9NA 1A5HA 1TOMH 1EASA 1MZDA 3QZRA 4ISOA 4X6OA 3VB7A 2WPLS 3SORA 1C1SA 1ARBA 3AAVA 1DDJA 1GBEA 2BX3A 3M5LA 1AVWA 4OS7A 1E37B 1T8OA 3CS7A 3PLPA 5DK1A 1S84A 1GBKA 4NWKA 3F9EA 3A8DA 2AGEX 1C9TA 4OS6A 4GHTA 2AMDA 4FUBA 3O8RA 4IS5A 1EPTC 1KXCA 2DE8A 2G4UA 1EOLA 1AKSA 2EI6A 1EAIA 2H9HA 1MD7A 1TX8A 1QTFA 5E0JA 3SV8A 3BTDE 4X0WU 1XUFA 4E05H 3FZDA 2SGPE 1ZGVA 1YF4A 5A8YA 3KN2A 2AYWA 1G37A 1O5AB 2P8OC 5JDUB 1MKWH 1HJ8A 3TITA 1P06A 1O39A 2Z3EA 2SGQE 1SOZA 4ASHA 4BTTB 1GGDC 2G8TA 4WMFA 1QB9A 5FPSA 2FMJA 3SN8A 2ALPA 4ZKNU 2FX6A 3V13A 4AGKA 2LPRA 4ZAEA 3ZYEA 2F9PA 5EODA 3EA8A 2DUCA 1XUKA 1E35B 1K2I1 1O2XA 1O0DH 3PMHB 5GCHG 1T4UH 4X2XA 1MBQA 3BTQE 1V6DA 3QGJA 4JK5A 3ZZ3A 1UCYE 1O35A 1V2VT 2BY8X 2TGPZ 3V3MA 1SLWB 1GMHF 2ZKSA 4XOJA 1MD8A 5JBAS 3KF2A 1O5CB 3RXUA 3A82A 3D62A 5C2ZA 1SQOA 3E6PH 3RXLA 3UQOA 4BAOB 2C4FH 1THPB 3ATMA 1F5RA 3L3TA 2W7UA 4DIIH 3CP7A 5I25A 2ZU3A 2TGDA 1L4ZA 1ZSJA 1HAXB 1AWHB 1QL7A 1TQ7B 1QRXA 4NA7A 2UUFB 2OUAA 2W3IA 1SI5H 2PR3A 3U9AH 3KQBA 3VFEA 4LZ1H 4X6MA 1C4V2 3KNXA 4NFFA 1O33A 1FJSA 3S9AA 4AB8A 1NU7B 4AORA 2AGIX 2GT8A 3SV2H 3RXGA 2QXGA 2W7SA 3BTHE 1ZGIA 1C1WH 4R8TB 2K1QA 4ISNA 1HCGA 3A80A 1KTSB 4NIYA 1MU8B 2V6NA 3O8CA 3F6UH 4BAQB 4B71A 4Y7AA 1E0FD 1MTSA 5T6GA 1TGBA 1UVUH 3ZZDA 3RXMA 3OY6U 2UUKB 1YPHC 1QA7A 2OLGA 3PTNA 4JMYA 2NU4E 1GL1A 1C5PA 4IC5A 3ZVEA 2FS9A 1CSOE 3UR9A 2ZCLP 3AAUA 4J1YA 1OX1A 1ACBE 1UHBB 1GI7B 3W95A 1XUIA 1Y5BT 1BMMH 2GP9B 3U1JB 1GJ7B 1GI2A 1TGSZ 1N6YA 4JK6A 1NFXA 1MUEB 1XXDA 1CBWB 1D3DB 1GBCA 1JRSA 1EZUC 4INLA 1JWTA 5DP3A 3T29A 2I6QA 3GCHC 1O3IA 1V2OT 1OSSA 3K9XB 1JMOH 4AG1A 1WYKA 2HPQH 1UMAH 1SLUB 1TRNA 4FUEA 3PMBB 2QF0A 2QCYA 3RXFA 2SGFE 3SGQE 5FXLA 1THSH 2PGBB 3SUDA 1V2PT 1QJ1B 3AW0A 4XBCA 1O2TA 5T6FA 2SFAA 1GJ8B 2VB0A 3LGIA 3T27A 1DM4B 2XRCA 3A7VA 5E2OA 3SU4A 1JOUB 1MH0A 1S5SA 2WPJS 4GSOA 1PPBH 4ZHAA 2ZGJA 3MI4A 5C1UA 3TGKE 1C5LH 2FX4A 5JBBS 2ZHWH 4X2WA 4YT7H 1W7GH 3RXPA 1V2LT 3M5MA 3P8NA 3SQEE 3OSYA 3GISB 4WXIA 3MNSA 1ZMJA 1MU6B 2UWPA 4Q7ZA 2OCVB 3RC5A 5LPRA 1J14A 5DJ7A 4Y6DA 1EAUA 1O2RA 2ZCKP 1C5NH 4ABFA 2J34A 1UVTH 3VGCC 1Z8IB 1SGRE 4M7GA 2ULLA 4Y10E 2BD4A 4I7YH 1O2NA 4O97A 4KTUA 3A7ZA 3Q77A 4JZ1A 2OBOA 2HVXA 4I8GA 2ESTE 1BBRE 3BG8A 2C8WB 2CF8H 1SL3A 1ELCA 1TNHA 5DP5A 3G01A 4BANB 4AG2A 1ZOMA 5ABWA 1SC8U 2VNTA 4WY3A 1O2LA 2W5EA 3A85A 1BA8B 3Q3KA 2A4QA 4NGAH 1G32B 1P57B 2KAIB 1ESTA 2FOCA 5HMAA 1QURH 1OP0A 1ZHPA 2BZAA 2PSYA 1GBFA 1V3XA 1YCPM 1BJUA 4UONA 1O2VA 1Q3XA 3GY2A 1SBWA 5EG4A 4DOQA 1VZQH 1GL0E 1W3CA 5CMXH 1FAKH 1FPHH 2AIPA 4AGJA 4KTCA 1HAPH 3QTVH 1DFPA 4TY7A 4JZIA 4XDEA 5PTPA 1O3JA 2ZHEH 3HGPA 3UTUH 1OWDA 3E1XB 3M5OA 2WPHS 1TIOA 2CN0H 4YOJA 2OC8A 3A7TA 1ZTKA 3BTGE 1P3EA 2BY5X 1HAGE 5GWZA 2FTLE 1GBMA 5A0BA 3ATWA 5E0GA 3K65B 3BTFE 9LPRA 1UK4A 3TPIZ 4CHAC 1CVWH 1O2KA 3UFAA 2BY7X 3UNSA 3GY4A 1GG6C 5AFZH 3LGYA 5DG6A 1AWFH 1NM6A 2C93B 3PWBA 4ABIA 2VJ1A 1SR5C 1LPZB 2GX4A 5K0HA 2J92A 2BX4A 1TGCA 1GI5A 1LQDB 2C8YB 3MMGA 4I8LA 2P3TB 4X8TH 2SGAA 1WBGB 1SHHB 1G3CA 1O3MA 1YGCH 4CBNA 1PPFE 3TJOA 2YOLA 4B2CA 1E36B 4DURA 4YZUA 1L2EA 3SI4H 1VITF 3DA9B 2F9UA 4XFQA 1O30A 2JETB 1CT4E 5A8ZA 1NZQH 7KMEH 1KLJH 1TWXB 2HOBA 2ODPA 1G30B 3ZZ4A 1A0JA 3O8DA 3GYMA 2FS8A 4YOIA 1IHSH 1VGCC 2F9BH 3STIA 1CGJE 1NFWA 1YPJH 1KXDA 4X1NU 4ZROA 4AYYB 1YCPH 2ZTXA 1PPCE 1BQYA 2G4TA 2ZGCA 4DGJA 4NZQA 3T28A 3SGAE 1O3NA 1MZAA 3PV4A 3RXHA 3PO1B 3TK6A 1GJ9B 2ZU5A 3GICB 5LGOA 1CGHA 1LO6A 3MFJA 3PROA 1GBJA 3SU6A 3A89A 3B23B 2ZDVH 1QIXB 1HLTH 3RDZA 1O2WA 1S0QA 3UR6A 1QGFA 3A87A 1NRPH 1XXFA 3B8JA 1BB0B 2Z9GA 1O2HA 3MU1A 4YO9A 3S9CA 1HIAA 2ZI2H 1P05A 1LDTT 2HALA 4IN1A 1VJAU 3U8OH 1EJNA 2RDLA 2R3YA 3M7QA 2FOBA 2P3UB 2FEQH 1C1UH 3P8GA 1N1LA 2R3UA 2CMYA 2CHAB 1C5XB 1RTKA 1C2KA 2GCTB 1GI1A 2SNVA 1WQSA 2BB4A 5H4IB 2QY0B 4ABHA 4OGXA 1CQQA 4DCDA 2PWXA 1GHBF 2ZO3H 4TY6A 4SGAE 1DWEH 3AASA 4X8SH 3VXFH 1ZPBA 3EA9A 2Z9JA 6GCHF 3KHVA 2PFEA 4Y79A 3FP8E 2OINA 1RJXB 4UDWH 4JZDH 4U2WA 4ESTE 1L1NA 2LNCA 1LQEA 4TWYA 1V2KT 3STJA 1QR3E 4K1EA 1O37A 2Y82A 3FVFB 3PWCA 1QNJA 1K9OE 3EGKH 3QDZB 3LH3A 1A61H 2WUBA 4AFQA 1C4U2 1AO5A 3U69H 3UREA 7GCHF 1BTHH 1XVOA 1ZR0A 4UFFH 1HAOH 3PMJA 4E7NA 1J16A 1ZMNA 5AFYH 4BXWA 1OP2A 1JBUH 1GMDF 1P2KA 3E90B 1SGEE 2A5AA 1BTPA 2XC4A 2G52A 3T25A 4I8KA 1AE8H 1CO7E 1PPZA 1YPEH 1O2PA 1O2JA 1H8IH 1KYNA 1GI8B 1XX9A 2BDYA 2W26A 1A2CH 1NN6A 5DGJA 2WYJA 5G4BA 1TPSA 1O2YA 1P8VC 4HZHA 1WUNH 2AIQA 1AI8H 3JZ1B 5FHTA 5ETXA 2VIQA 1M9UA 1T31A 2F91A 5IYTA 3QZQA 2V3OH 2Q6FA 4UE7H 2ANKH 1LTOA 4GHQA 1IQFA 3SNBA 1OXGA 2FOHA 3MOCA 4KELA 4UEHH 5FX5A 3RXDA 5F8TA 3URDA 1P2NA 3V0XA 1FN6A 2BD8A 3M61U 2FDAA 3MO9A 3MH7A 1K1IA 1W13U 4K69A 2H1UA 3MH6A 4NSYA 5DP6A 3SQHE 2AH4X 4NWLA 4A6LA 1Q31A 1GJ6A 1RXPA 1D6WA 3UUZA 1ABJH 5HM9A 1YM0A 5T3HA 2QA9E 2KAIA 2OP9A 3FP7E 1RS0A 4BTUB 1FV9A 1K1NA 4K8YA 5EPYA 1LVMA 3T2NA 3RXIA 1QJ6B 5CHAC 2RG3A 2ANMH 2P59A 4NIXA 1MAYA 1QFKH 2ZC9H 1ELTA 4ABJA 2VH6A 1AFQC 2H9EH 4X2VA 5EXNA 1WTGH 1YCPK 4B73A 1WTHD 3U1IB 2GTBA 2WPKS 1IQMA 3PYHA 1P09A 3SJKA 4AX9H 4A1VA 4NA8A 4NZLA 1ESAA 1BZXE 1O5BB 1OWEA 1V2NT 2A7HA 2FO9A 2GCHG 5JBCS 1PPEE 2D2DA 2FIRH 2GDEH 5TCCA 1T8MA 3UQVA 2ASUB 1FY4A 4DIHH 1OP8A 5AHGH 3SJ8A 5SGAE 1IQGA 4CBOA 1OYTH 3N7OA 3DHKH 1P12E 1UO6A 4MG3A 4OS1A 2V3HH 4ABEA 3IWMA 2BHGA 1EB1H 2STAE 1C5OH 1JIMA 5FPTA 1SGFA 2A0QB 1CA8B 2PW8H 2ZFFH 1FAXA 1DITH 5HM2A 1SMFE 4AYVB 4AN7A 5LPEA 1A3BH 1J17T 5EXMA 2PTNA 5EOKA 1GCTB 2D8WA 5GDSH 3RXKA 4WF8A 2BTCE 3TNTA 4X8VH 5FPYA 1L1GA 1QL9A 3SHAH 2G00A 3SNEA 5FAHA 5CE1A 1QY6A 2EEKA 2RA3A 2YNAA 1S85A 3NZIA 1HAVB 3P92A 4D76A 1EJMA 8GCHF 3SV6A 3RXAA 2WPMS 4VGCB 4MQAA 3SJIA 1HAHH 1HAIH 4ABBA 1V2TT 1TNJA 2FI5E 1FY8E 1N8OC 1G2LA 2H2ZA 3LOXA 2BMGB 1BRUP 3LU9B 1F0RA 2NU1E 3M37A 2BXUH 3SGBE 3GDUA 2Z9IA 2Q6GA 2AGGX 2O8LA 2BY9X 5DP4A 1GBBA 1HJAB 3MO6A 2HPPH 5LPFA 1CA0C 1EX3A 5AVDA 4BNRA 3PLBA 6CHAC 2PV9B 5E2PA 3Q76A 1F0SA 2TPIZ 3LJJA 3MU0A 1C1RA 1XM1A 1HPGA 5EW2H 2ZGXH 1O38A 1YBWA 1BITA 1BTYA 2ANWA 1QB6A 1EAWA 3ZVFA 3SHCH 1GI4A 2THFB 2A7JA 1ANBA 3GY3A 2XCNA 4A5TS 1NROH 1Z8GA 2A45B 1UCYK 2D26C 1LVOA 1FIZA 1UVOA 3TJUA 3ELAH 1P2JA 4FUDA 3MNXA 3U98H 2XCFA 1AB9C 1C4Y2 4B75A 2O8WA 1D9IA 1OWJA 2G5VA 4GVUA 1WQVH 1CHOF 4AFZA 1GMCF 1IQLA 1GHAG 2QN5T 1ELGA 5E0HA 3ODDA 3TLOA 5HXFA 2GMTC 2CV3A 3TJVA 1TX7A 2BLOA 4DT7B 4WMDA 2HNTE 1EPTB 1NRQH 1QJ7B 2VIWA 1ORFA 3S7KB 1XUJA 4D7GA 3M3VA 3SW2B 1XVMA 3HK6B 2BM2A 2P16A 3UY9A 2CXVA 1ZHMA 4GAWA 4O03A 3A7YA 2Q1JA 1O5GH 3BG4C 1DICA 1BTWA 4OGYA 1C5VA 5TCAA 1AVGH 1BJVA 1MTWA 1LHDH 5EQQA 2P8OB 3ZZ8A 1BRBE 1T4VH 3A83A 4K60A 2QXHA 5C1XA 2EI7A 1GVLA 1GGDB 1S6HA 1UTKA 3NKKA 4WWYA 2OC1A 4HGCA 4DW2U 4KKDA 2C90B 1G3BA