4KTSA

Bovine trypsin in complex with microviridin j at ph 8.5
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Harnessing the evolvability of tricyclic microviridins to dissect protease-inhibitor interactions.
pubmed doi rcsb
source organism Microcystis aeruginosa mrc
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktsA02
1ZMJA 3SI3H 1O31A 1E37B 5EGMA 1O33A 4NSVA 1HGTH 3ZYEA 3A8DA 5E2OA 3AASA 1O0DH 3GCHC 1GGDC 2BXTH 2OTVA 4TPIZ 1QB1A 5JBAS 1HPGA 3ZZCA 3TGKE 1D6RA 2QGRA 1O5BB 3PWCA 1F5RA 4FUEA 1QCPA 1SGCA 1UTQA 2ZFPH 1AO5A 1GMHG 1BRBE 5JDUB 4Y7AA 2FEQH 1GBTA 1P57B 2BDGA 3TNTA 1QBNA 3A82A 3O8DA 2ZFQH 3BTTE 1YCPK 1GBFA 5C20A 4DY7B 1AWHB 3F9EA 1V2WT 4XBDA 1T7CA 2C8YB 1GI2A 1VITF 1L1NA 4IMQA 2NWNA 2FOCA 4H6TA 4GPGA 2BDBA 3UNRA 1PPZA 1KYNA 2ZPSA 3MU4A 1O3LA 1V2LT 1VZQH 2BLVA 3EYDA 4TYDA 8KME2 1MBMA 3MU5A 3D62A 3MO9A 1O2KA 4RN6A 2ANWA 2Q6GA 2M5TA 5L2YH 1Y8TA 3GDSA 4ZKNU 3KEEA 1O2MA 1WQVH 4CHAB 4Y76A 1O38A 2ZFRH 2BY5X 1TFXA 5C5OA 1C5VA 4MQAA 3SUGA 1KXEA 3F6UH 5FPYA 4A5TS 2CJIA 1ETSH 5EW2H 3ZZBA 5FAHA 5HM2A 1P06A 2ANYA 4I8GA 1OWIA 1FNIA 1TRMA 3MYWA 2QXHA 5F03A 4X6OA 1ELAA 5ESBA 2LNCA 1WSSH 3P6ZB 2BX3A 1NO9H 3SU1A 3OSYA 1NRSH 3KN2A 3UOPA 4JYTA 2A31A 1YPGH 2AMQA 4X2YA 1QR3E 2GV6A 2OUAA 3M36A 1UK3A 2XRCA 2G81E 2PTNA 3V7TA 4MG3A 2SGPE 2AH4X 2QF0A 3ENSB 4U32A 1YPHE 4ZXXH 4NGAH 1IQFA 5LPEA 4BANB 3H7OA 4ZH8A 4KTSA 1DVAH 1AQ7A 3MH6A 1O3NA 3R3GB 1IQEA 5C67A 4A6LA 2HNTF 2A4RA 4MPUA 5F8ZA 1TPOA 1KDQA 4GHTA 1UVOA 3NKKA 1BMNH 1DT2A 1BTXA 5HGGA 1H9HE 3TJUA 1UTKA 2HPPH 1TX6A 1AFQB 1DY8A 3IG6B 4YO9A 2D26C 2ZHQH 1J16A 1BTPA 5GIBA 1LHDH 1HAYB 3H5CB 1LVBA 3S7KB 3LH1A 1GI1A 1MU6B 3UOUA 1C2HA 3BIUH 3M7TA 2FX4A 1GJ8B 2FX6A 2BD5A 1C1PA 1OWDA 2HPQH 1DWDH 2ZGJA 3M5NA 1N8OC 1LTOA 1BIOA 1C1WH 1SGFG 4WH6A 4CRDA 3Q76A 3OX7U 1LDTT 1TPSA 4QT8C 1T8NA 4Z0KA 1FMGA 5IYTA 1HXFH 2A2XH 2UUKB 4CH2B 2AYWA 1KSNA 2QXJA 1ZMLA 1E38B 2ZQ2A 1NM6A 2VVVA 1KLTA 1HXEH 1QRWA 4J2YB 1Q3XA 4DIHH 5C1YA 4I31A 5CMXH 1P04A 2SGQE 1A0HB 2QAAA 3SHCH 1C5NH 1QA7A 3RXCA 1KXBA 1KDQB 1EZUC 2G51A 3JZ2B 3NCLA 2XCFA 1SI5H 2Y5GA 1AY6H 3MI4A 3A7TA 3B8JA 3TH2H 1Y3XA 2FODA 3ZZ3A 1YM0A 2WINI 1H9IE 2SGFE 1FAKH 4NFEA 4AB9A 2QYIA 3OTJE 2PKSC 2BOHB 2OBOA 4IW4E 1TPAE 4DCDA 1EOLA 1EJAA 1QY6A 4UD9H 1O3JA 2W3KA 1V2ST 4FUCA 3GCOA 3T26A 1J17T 1GHAG 2CV3A 1HUTH 4Y0ZE 3MWIU 5A8YA 2CXVA 4XBBA 2WV5A 1RS0A 1XUHA 5DK1A 4M7GA 1BJUA 1SGIB 3E91A 2STBE 1AUTC 4CR9A 1DITH 1YP9A 2F9PA 5H4IB 3TK5A 1EASA 1P2NA 4LZ4B 4NWKA 3ESTA 1D3PB 4IS5A 3UR9A 1TLDA 3TJNA 3FP6E 3RMLH 2ZTYA 2A5KA 2H9HA 5DPAA 4ZKRU 1ZHPA 3KCGH 4ABJA 1ZRBA 1GG6C 2VU8E 2W5EA 3E16B 3RXJA 2FP7B 5B6OA 3KIDU 4BNRA 5DP5A 3A83A 2BD7A 3SJ8A 1BBRE 3O8BA 1YBWA 1AMHA 4YT7H 2G5NA 1DUEA 4BAOB 4DGJA 2DUCA 1MKXH 1D3QB 3U9AH 4B2AA 2FO9A 1QFKH 2FOEA 1BDAA 3BN9A 5GPIB 1E0FD 1O2UA 3LJJA 4GLYA 2BDYA 2QCYA 3N7OA 1NN6A 1O3KA 2QIQA 2G52A 3TIUA 5L6NH 3TLOA 1VJAU 1C5OH 3SBKA 4Q7XA 3I77A 3SV7A 5F6MA 4X1RU 1BQYA 1AVGH 3NUMA 2ZCHP 1A0JA 2GMTB 1BTUA 2NU3E 4A92A 1HJAC 1D9IA 1UVUH 4GCHF 1D4PB 4IN2A 3F9HA 3EA8A 2EEKA 1MTNC 3TPIZ 1GBAA 1TBQH 2BD8A 2GCTB 4F49A 1ZR0A 1CBWC 4FUFA 4O03A 1T8OA 1GHXH 3A85A 3UTUH 2RA3A 1ANEA 1V2KT 2F91A 1B7XB 1EZSC 2R0LA 1UCYH 4X8TH 5DG6A 4BOHA 5C1XA 1SPJA 3VGCC 1SGFA 3BG8A 1O3MA 3ZZ7A 1A2CH 5GXPA 4KGAA 3AVZA 3IWMA 3SNEA 2A7CA 4KP0A 1W14U 1AVWA 1NPMA 1TAWA 4AG1A 4YT6H 1BTZA 1T8LA 1VJ9U 1QBVH 1C2JA 2D1JA 2HGTH 2OQ5A 1V2RT 2AEIH 4GHQA 3UNQA 4AZ2B 1QRXA 3BIVH 2XCNA 5DP8A 2FYQA 3K6YA 4H6SB 2Z3CA 1FPCH 3GCTG 5L2ZH 5DJ7A 3HGNA 5PTPA 3ZVBA 4NIVA 2ZTZA 2WPHS 3A88A 1W7GH 2J9NA 2A0QB 8ESTE 4BAQB 1TWXB 2R0KA 5JB8S 1P05A 2Y5FA 2C8WB 3BTWE 1W12U 3EQ0H 1P8VC 1GGDB 3SU6A 1F0UA 2FLBH 1AE8H 1YC0A 1ZJKA 1IQJA 4JZEH 1C1TA 2R3YA 4CRGA 2ZEBA 1DUAA 1U6QA 3AAVA 3CENA 5EU8A 1AI8H 2BZ6H 1NFUA 4MLFB 3LIWA 4LXBH 2F83A 1K28D 2XC0A 3PMBB 1DWBH 1G9IE 2BD2A 2PGQB 1ELVA 1PPEE 2BXUH 5DGJA 2FMJA 3BG4B 4ABHA 1CHOG 5K0HA 2OC7A 2H5CA 3EGKH 2OCVB 1BMLA 2AGGX 4LOYH 1FY3A 1O3GA 4JZFH 2CHAB 1ZSKA 1O2OA 2OP9A 1UTJA 1O37A 3W95A 1Z1IA 2B0FA 4Y8XA 1FIZA 3RXBA 3LT3A 2ZECA 1BITA 4WF8A 3FZDA 5F8TA 2D8WA 5EW1H 1H4WA 3HK3B 5FXLA 4AFZA 1AE5A 1WQSA 4INKA 5FBIA 2HALA 3SV2H 3PYHA 5LH8A 2VGCC 4RKJB 2GDEH 3SNAA 2QF3A 4YTAA 2Y6TA 3KGPA 2XXLA 2IN2A 3KL6A 1HFDA 2V3HH 4NFFA 4UFGH 1HAVA 4ZHLU 5EOKA 1JIMA 1Z8RA 3KF2A 3DHKH 2OD3B 3STIA 2ZDVH 1O2QA 5DP7A 2R2MB 4UFEH 2ESTE 1AWFH 3SNBA 1GMCG 1AFEH 1GMDG 3PB1E 4ABBA 4D76A 2TGTA 4AB8A 5ETXA 1O32A 1S82A 3V12A 1SQOA 1ESTA 3K9XB 1O2ZA 1ANBA 1GCDA 5EQRA 3U69H 7GCHG 1SC8U 1QB6A 3UWIA 3ZZ5A 1O3FA 3FP7E 3PO1B 4NG9H 3K65B 3QTVH 3LGIA 1CT4E 3GDVA 4FU9A 1MCTA 2NU1E 1GBLA 2ALPA 3UY9A 1ORFA 3MNCA 2P95A 3SV6A 1PPCE 1YCPM 4X6MA 3VEQB 2SFAA 1HIAA 5FX5A 1LHEH 1YPLH 3KQBA 1GHWH 2J34A 1G30B 3F9GA 1TOCB 1C1UH 2QN5T 3UQVA 7ESTE 1UHBA 2WPLS 4JZ1A 1OP8A 4WVPE 2VWOA 4WXIA 4Q2KA 3RLYH 1TPPA 2BLOA 4ISNA 1KTSB 3HK6B 1CU1A 3NK8A 4ABDA 2XWBI 1ABIH 3NZIA 1FAXA 2QXIA 1ID5H 1RGQA 4H4FA 4A1XA 3SGQE 3BTGE 1MZAA 2PSXA 1G3DA 1BA8B 3P8NA 2EI6A 3SJKA 1DFPA 5DP6A 2WUCA 2VIDA 1LQEA 1G3BA 1B0EA 1SHYA 3QK1A 1P12E 1DS2E 1LCYA 2UWPA 1TRNA 1BHXB 3H7TA 1LHGH 3SU4A 1FY1A 1K2I1 3MH4A 1O5AB 3RUOA 1K1MA 3L6PA 1EB1H 3M7QA 1HIAB 2JETC 4X8VH 2G00A 4K1SA 3RXIA 2VB0A 1C5PA 2WUBA 2C8XB 1KXAA 1RIWB 3SU3A 5EODA 4J1YA 2PKSB 4Y8ZA 2C90B 1VITG 3AAUA 2ZC9H 4BTIB 1UCYK 1BRCE 1XUFA 1UHBB 2OC8A 1Q2WA 1XUIA 2ZGHA 1AZ8A 6ESTA 1SBWA 2ZWLH 1WUNH 4I8JA 2VWLA 3T5FH 2ZA5A 2ZNKH 2Z7FE 4X2XA 1ZHRA 3AW0A 1V3XA 3P17H 1P9UA 3GYMA 2P93A 4WMEA 1VGCB 1NTPA 1DOJA 1C5RA 1SG8B 2SGEE 3SO3A 5TJXA 1P2MA 3ODFA 3UR6A 2Y82A 1WTGH 2OLGA 1BTWA 1GBIA 2TRMA 4E06H 2W7SA 2AGEX 1BT7A 4ESTE 5F8XA 1UVPA 2BHGA 1A5IA 4FUIA 3UREA 1S83A 1L0ZA 3M7UA 1TOMH 3SUEA 5C3NA 4X2WA 3W94A 1IQHA 1O5DH 1NRNH 5FBEA 1FN6A 2ZP0H 1ZPZA 3VB3A 1K1IA 1OWKA 1XMNB 1OSSA 7LPRA 6LPRA 3WY8A 1DLEA 5HXFA 1ZLRA 1SFQB 5BRRE 1JRSA 4X1SU 2ZG0H 3RXKA 4VGCC 3BSQA 1C1QA 1MU8B 1SGYE 3BEIB 1CHGA 1ZOMA 1Z6EA 3A89A 1PPHE 3BTKE 1ELFA 3MTYA 1DSTA 2A4GA 1LPKB 2ZHFH 3F68H 1GI0A 2ZF0H 1JOUB 4D8NA 3FAOA 1SGEE 1EP6A 4D9RA 4X0WU 1DANH 2OINA 2IPHA 3TNSA 1GBBA 3K6ZA 2ZDLA 4GSOA 1CSOE 4NIYA 4BAKB 7KMEH 1CBWB 1C4Y2 1TMTH 4TY7A 4K2YA 1LKBA 1IQGA 3ZZDA 3QUMP 1SGQE 2BVSH 3RMNH 1BZXE 5T6DA 4UFDH 2ZU5A 3P8OA 4X6PA 1BRUP 1XX9A 2QC2A 2YOLA 1VCQA 1EOJA 2BY8X 2TPIZ 1MAYA 1T4UH 1GVLA 1CA0C 9ESTA 4KKDA 1DX5M 1W3CA 5AFZH 1EJMA 3TVJB 1C5LH 4DURA 2ZHDA 1C1OA 1CO7E 1MD8A 2A32A 8GCHF 1ZTJA 5E0GA 2BDIA 3M3VA 3GY5A 1GBDA 3VXEH 2PGBB 2HRVA 1BB0B 4FUDA 5LGOA 1GBHA 3ZYDA 2ZU1A 5LPFA 5EXMA 4X1PU 6CHAC 2QA9E 1RFNA 3SQEE 3A7YA 3VB5A 4JZIA 3GISB 1QTFA 2ZIQH 3QX5H 3ATLA 1O2JA 2ANMH 1P0SH 1XKBC 5GCHF 1YPHC 3SNDA 2I6SA 2UUYA 1Y5BT 5C2ZA 2PKAA 3ZZAA 4ZHMU 3MHWU 4OS1A 1DWCH 3TU7H 3UWJH 3PLBA 2ZU3A 1IQIA 2G5VA 2H9TH 1P02A 1NU7B 2BOKA 2TIOA 1TNKA 3CS0A 1QQUA 2XTTB 3KQCA 1THRH 4AN7A 5T3HA 3NXPA 2G8TA 1QBOA 1A5HA 3RXOA 3S9CA 5TCAA 2Z6BD 4AGKA 1ELCA 1SLXB 1THSH 1VITH 2SNVA 1X7AC 4Y71A 1GCTC 1ELGA 4YZUA 1ELTA 1QL7A 1C4V2 5ABWA 1HAPH 2YNBA 2ZPRA 2G4UA 1EPTA 3OU0A 1GWAA 4ISOA 1RTLA 1SB1H 3ZVEA 2BDAA 2J95A 1Z7KA 1UVTH 2ZHWH 4JK6A 2W7UA 3DT0H 4TPYA 1KXFA 1WBGB 1HAIH 3E0NB 3Q77A 2H5DA 5DO4H 3ATIA 3U8OH 1FXYA 1HJ8A 2VIQA 3P95A 3SV9A 1V2TT 1ZSJA 3D23A 2O8UA 1ZJDA 3ZZ4A 3I29A 2QY0B 1F7ZA 3EAJA 2F9VA 2PKAB 1O2RA 2A45B 1O36A 4IBLH 1TQ7B 3U8RH 1E34B 1DPOA 1JWTA 2F9UA 1PQ8A 3SU2A 2JKHA 3F9FA 2GD4B 2QXGA 1A3EH 2R3UA 1G3EA 3PMJA 4FXGH 1E35B 2P16A 2P94A 4I8HA 2BVRH 4ZHAA 1UK2A 2IJOB 3V0XA 1LPZB 3PM3A 1DM4B 1DWEH 1YF4A 2R2WU 3C1KA 3SQHE 1K22H 1C9TA 3CP7A 3LGVA 5FCKA 4GCHG 1SGDE 1XXFA 1KLJH 3PWBA 1TRYA 5E2PA 3LONA 1AB9B 4I8LA 3RC5A 3MNXA 3URCA 3JZ1B 1EPTB 1MMJN 1UTOA 1O5GH 1RRKA 1Y5AT 2PW8H 1UVSH 1XKAC 4WY3A 2AS9A 3M5OA 4Y8YA 2DE8A 1YPEH 2B9LA 2Z3DA 2ZHEH 3A7VA 1AN1E 4AYYB 2JH6D 1O2YA 1OYTH 1A1RA 4WJG2 4X1QU 1T31A 1NRQH 1ZTLA 2QV1A 1P9SA 1GHZA 1MTSA 2ODQA 3ELAH 1GHBF 2VNTA 1LO6A 1IAUA 1FDPA 3P8GA 1SFIA 1FI8A 3LGWA 1V6DA 4MDSA 1IQKA 1RD3B 4IGDA 4CREA 1EKBB 5JBCS 5CHAB 1G37A 1O5FH 3RXMA 4MPWA 2Z3EA 5T6GA 2FDAA 2B5TB 3TJOA 3RXLA 4X6NA 1GBMA 5DP4A 1SGPE 4HI3A 1QHRB 5FHTA 2ZGCA 3C27B 4CHAC 1LMWB 2Y80A 1O39A 2TBSA 1N1LA 1C1NA 1V2VT 1SQTA 2Y7ZA 1IHSH 1THPB 1CE5A 2CMYA 1HAZB 3A80A 3RU4T 1QJ6B 1FQ3A 2V35A 1QIXB 3P8FA 4K69A 3A81A 3PTBA 2ALVA 1TX7A 3A7WA 1F0TA 1WTHD 5A2MH 1ELBA 1F0RA 1EQ9A 2FI4E 1HB0B 4AOQA 2GTBA 2CF8H 4INHA 1FY5A 1N6XA 2ZZUH 4XDEA 1ETTH 1ACBE 4K1EA 1O2LA 1RXPA 2BY6X 1QJ1B 1S81A 1C2MA 3EE0B 4SGBE 3T27A 3T25A 1DSUA 1EXFA 1PPGE 2PUQH 1QNJA 5T6FA 1ZYOA 1C2DA 3VB4A 2EI7A 1OXGA 1Q31A 4AORA 2BDHA 3A8BA 5EG4A 2OC1A 3ZVFA 5K7RA 2GCHG 3FZZA 1LQDB 5J4SA 3ZZ8A 3A8CA 1ZPBA 3GCHB 5EPNA 1QL8A 1WCZA 3U98H 1LKAA 1P2IA 4O9VA 3BTDE 1GI7B 3MH5A 3E0PB 3MO6A 1TGNA 1LVOA 4YM9A 2Z9LA 2A5IA 4AYVB 2GKVE 2ZI2H 3ITIA 2A7JA 4Q80A 3SU0A 1SHHB 4HFPB 5GWZA 3DFJA 2ZFTA 3GY3A 3QGJA 3V13A 4AGJA 6GCHG 1SGNE 4THNH 1P01A 3A86A 3LC3A 4BXSA 5E0HA 1P3EA 1W13U 1GPZA 3PLKA 1OWJA 2ZDNA 1IHTH 1O2WA 2ZGXH 1G32B 1MZDA 4NZLA 2O8LA 2WPKS 4E05H 1Y5UT 1V2PT 4ISLA 1GBCA 2DE9A 3RXQA 1MQ6A 1WYKA 4B2BA 3PV4A 3OY6U 2OQUA 1O3PB 1E36B 1V2QT 4OS5A 5EQSA 2OC0A 5DP9A 1SVPA 3GY6A 2Q1JA 1EJNA 1O3HA 3MU8A 1OP2A 3B23B 2BB4A 3GCTF 3M3SA 2HWLB 1LHCH 2XNIA 4I8KA 1DXWA 1G2MA 3M5MA 3LOXA 1QA0A 4YOGA 3BEUA 1Z8JB 2CF9H 2ZPQA 4FVBA 5JB9S 1FPHH 1NRRH 2GZ8A 4LK4A 4DT7B 4SGAE 1S84A 1GI6A 1T32A 2Q6DA 2RCEA 2ZU4A 4ZKOU 3Q3XA 4D7GA 1PJPA 2V6NA 1ZZZA 1W10U 2UWLA 1BTYA 1O2NA 1VCPA 1O3IA 1NZQH 4NA9H 1C4U2 4Q7ZA 1CGHA 2VIWA 1TGCA 1YPJH 2ZQ1A 1QJ7B 5IDKA 4NSYA 1TIOA 3P92A 3M61U 3HKJB 1CA0B 1TGBA 2FPZA 2F9NA 2EA3A 2YNAA 2CN0H 1BOQA 2XW9A 3GYLB 4YOIA 4K60A 2BQ7B 1TONA 4MNYA 3PMHB 3MOCA 2XBWA 1EZQA 1EZXC 4HZHA 2RG3A 2THFB 3D65E 3RMMH 1DXPA 3LPRA 2XBXA 1GBKA 6CHAB 4OS7A 1G2LA 3HKIB 1MTWA 1KTTB 2PV9B 1LPGB 2SGAA 1TBRH 1D3DB 2HNTE 1KXDA 2GP9B 2H9EH 1K1NA 4JK5A 1ZMNA 4AX9H 1N8OB 1Y3YA 2V0BA 1O2HA 3QWCH 3VB6A 5SGAE 5G4BA 1MKXK 3FVFB 1T8MA 2ASUB 2PFEA 3SN8A 4UFFH 1BTHH 4DOQA 1HLTH 5CE1A 4B1TA 2GMTC 4K3JA 4CRAA 1FY4A 2A5AA 2A4OA 2Q6FA 4ISIH 4ISHH 1TGSZ 1GMDF 1DDJA 4BTUB 1QB9A 4IC6A 4Y0YE 1G3CA 1WOFA 3GY8A 4XOJA 3RLWH 2SNWA 5J4QA 1TA6A 2TGDA 1JXPA 2G55A 2GCTC 3RXAA 3MU0A 1QGFA 1IQMA 7GCHF 1HNEE 1RTFB 3ATMA 5A0AE 5GDSH 1V2UT 3U1IB 1HAHH 3KQDA 1RJXB 1ESAA 5A0CA 3RM2H 2WYGA 1HAOH 4E7RG 4FUGA 3ATKA 3BTFE 4OS4A 3U1JB 2FI3E 1F5LA 1UCYE 2B7DH 4F4OC 1BCUH 2RA0A 1C2IA 1O2XA 1MTVA 5A8ZA 1ANCA 3RC4A 3ZVDA 1GI5A 4A1TA 4BTTB 1GVKB 1WU1A 3A7XA 4RKOB 1UJ1A 3SUFA 2P3FH 1TNLA 3LDXH 1CQQA 5AFYH 2WPIS 2H6MA 4AFUA 4CRBA 3GY7A 4A7IB 3F1SB 4X2VA 1HRTH 3MFJA 4H42U 3RXPA 2B8OH 1L4DA 1TA2A 1MH0A 1Z71A 2VH6A 3QN7A 3URDA 2STAE 1GI3A 1YYY1 2BQ6B 1O2PA 2FXRA 5EQQA 2HOBA 4ASHA 1QURH 4LZ1H 1AD8H 1GG6B 1BBRH 2WYJA 2FTLE 5HM9A 2TGPZ 2AIPA 1HAXB 1ESBA 1WAYB 1W0ZU 5A0BA 4Z6AH 2XC4A 1SR5C 5LPRA 1K1PA 2FWWA 5FPTA 2NU2E 2WPMS 1TB6H 2P8OC 4Q7YA 1GDNA 3TK9A 1GVZA 1HYLA 2ZTXA 4JZDH 3BG4C 3RXHA 2BD3A 3A84A 1HAGE 1UTNA 1AHTH 1OP0A 4XBCA 2Z9JA 1AZZA 1S6FA 3ZV8A 2CHAC 4BAHB 1O2VA 2EI8A 8GCHG 1NROH 2BDCA 1S0QA 4KTCA 1UO6A 1S85A 3AW1A 1HJAB 3T29A 1INCA 4ABFA 3ZVAA 2FIRH 1C1SA 3QTOH 4K8BA 3VXFH 3LC5A 5I46H 2AIQA 4XE4A 4B73A 1MTNB 1TQ0B 3RXEA 1XVMA 1C1VH 4INLA 3TGJE 1GJ5H 1A3BH 4JYUH 1A4WH 1V2NT 2BVXH 5GCHG 3GCNA 3M35A 1GDQA 1RTKA 1GMHF 1SQAA 4MNVA 3TK6A 1GHYH 1GJ9B 1NY22 2ZU2A 4K1TA 2R9PA 3L33A 1P11E 1NU9A 2PWXA 1TNGA 4OS2A 3VGCB 1C2GA 1GHVH 1Y3WA 3D49H 1S6HA 2P3TB 2Y81A 1FV9A 1H1BA 3T28A 5JBBS 1UTMA 1O3AA 2GT7A 1LVYA 2BLWA 3MMGA 1ARCA 1TX8A 4NIWA 1O34A 3RP2A 4YLUA 3B9FH 2A1DB 1C5SA 3PO1C 2GT8A 1C5YB 3ZV9A 1GI4A 2ZDAH 2PUXB 2VWMA 5DP3A 1MAXA 4NA7A 3RXDA 1NFXA 3EDXB 2O8MA 4B75A 1GBEA 2A4QA 4UONA 3STJA 3VB7A 4CRCA 2IOTA 4WWYA 2VH0A 3VPKA 4B71A 3RXRA 3HATH 4FVDA 2JH5D 4BAMB 1PYTD 1W7XH 1TYNA 1C2FA 1O2IA 1C2KA 1P2KA 3SORA 1O3OA 1XXDA 1MD7A 3RXTA 2H2ZA 1VR1H 5C5NA 5EXLA 1SOZA 1JBUH 3QGNB 1Y3VA 2H1UA 2ZGBH 5AVDA 4ZXYH 1K21H 1TMBH 2J2UA 1GL0E 2LPRA 4E7NA 3S69A 1SGRE 1YPKH 1YKTA 2PR3A 3HGPA 5BPEA 3ATWA 2AERH 1YGCH 2PSYA 3DFLA 1BRAA 1TABE 2BD4A 1TNJA 4XSKU 1AIXH 4JCNA 4ZAEA 1EAUA 2Y5HA 4TWWA 3A7ZA 3NPSA 5A8XA 1KY9A 1AUJA 4NZQA 3BTQE 1SMFE 1CT2E 2AFQB 1YLDA 1NT1A 2VJ1A 2J94A 4DVAU 2ZFFH 4ABIA 1N6YA 2O9QA 1GJAB 4ZKSU 2VGCB 4U01A 4AG2A 3O8RA 1JIRA 1G36A 1OOKB 1OWHA 1XUJA 5TCCA 4TWYA 4OGXA 3LKWA 1RIWC 3PLPA 1GHBG 4CRFA 3TH3H 3KHVA 4GVUA 2VIPA 2HVXA 1L1JA 1PYTC 1BMAA 1XM1A 1V2JT 3MNSA 3SGBE 1A0LA 1C5XB 1V2OT 4TY6A 3MNBA 2AMPA 1Z6JH 3DUXH 4HGCA 3E1XB 2BY9X 4CH8B 1PFXC 4Y6DA 1P3CA 5AF9H 4GAWA 2FM2A 1VGCC 4ZUHA 1CA8B 3OYPA 1GDUA 2FOAA 2FI5E 4A1VA 5E0JA 4KELA 1ZHMA 1GL1A 3SNCA 2HLCA 1ZGIA 1GI8B 3P70B 1GJDB 1MKWH 1XUGA 1SLWB 3SUDA 1NESE 1V2MT 3IITA 4KTUA 4D9QA 1O3EA 3MO3A 3GDUA 4I32A 2BX4A 4D7FA 2FOMB 4YOJA 1FIWA 1NFWA 2G4TA 2K1QA 1O35A 1BMMH 2FTMA 1Z1JA 3PROA 4K5ZA 1MCVA 1OPHB 4DJZB 4IMZA 2WPJS 2BYAX 3FFGA 1A61H 1IQLA 2ZCKP 1DICA 1FUJA 4WMFA 3RC6A 3SZNA 2Z9GA 2BMGB 3UFAA 2P59A 1BBRK 3DA9B 5EXNA 3BTHE 1F92A 1GHAF 1CVWH 1EB2A 4MPVA 1C1RA 1P03A 3QZQA 4XFQA 1EX3A 3SW2B 3M5LA 3U8TH 2FLRH 1F2SE 4ABEA 1HV7A 1TBZH 4JYVH 2Z9KA 3GY2A 4NWLA 1NRPH 3E6PH 1S0RA 3LGUA 5I25A 1D3TB 1TMUH 1QQ4A 3SJOA 1AU8A 1UK4A 5HYOA 1P10A 1B0FA 3A87A 1UTPA 2OXSA 3SI4H 5FPSA 2J92A 2Z9IA 3UQOA 1SGTA 1DE7H 1EP5A 2BQWB 3ZVGA 2BTCE 1GJ4H 5A09A 4MTBA 5FCRA 3RXFA 3RXGA 1TGTA 2A7HA 1QL9A 1JMOH 1EUFA 3S7HB 1A46H 1MQ5A 4R8TB 1L2EA 1O3DA 3SGAE 4R0IA 1B5GH 3UIRA 2O8WA 2XWAA 5DKMA 1P09A 1ABJH 2F3CE 3SJIA 2ODYB 3MU1A 2BM2A 3FANA 4U30A 4WMDA 3Q00A 3ODDA 2JETB 2FZZA 2NU0E 3TGIE 1J15A 2EC9H 3KQEA 2C3SA 1FJSA 4X1NU 3SJ9A 1BJVA 1ETRH 1P2QA 1SLVB 3PMAB 3LJOA 4OGYA 1DLKB 1EATA 1TNIA 1ZRKA 3T62A 3I78A 1O5EH 4FUJA 4O3TA 1K1OA 1FONA 4BXWA 1PQ5A 3UPEA 1AFQC 1CGIE 1QRZA 4MNXA 1K9OE 1KIGH 2UWOA 3EA7A 4WH8A 3EA9A 2A2QH 5EPYA 1C5QA 2F9OA 4FUHA 3V3MA 3E90B 3BTEE 4X8UH 3TH4H 5AHGH 1YCPH 3S0NA 2VIOA 3QDZB 2FS8A 5GJ4B 2V3OH 1WV7H 3UUZA 1OX1A 1OYQA 1BHXF 1HDTH 5JYIA 1M9UA 2D2DA 2ZO3H 1HBTH 4I7YH 1K1JA 1SSXA 4ABAA 2XBYA 3BTME 4MPXA 2BLQA 2C93B 1UMAH 3QLPH 2XYAA 1O2SA 4FU7A 1IQNA 4GUXA 8LPRA 4CBNA 2PTCE 2GDDA 1MTUA 4JMYA 3G01A 2J38A 1W8BH 2GV7A 3LGTA 3SU5A 1JRTA 1UTLM 4NA8A 4Y7BA 1YLCA 2ILNA 2P8OB 1GJ6A 1W0YH 4B2CA 2TGAA 3O8CA 3DD2H 1Z8IB 2ANKH 1H8IH 2C4FH 1O5CB 1ZTKA 4VGCB 2ZKSA 2FOHA 1GJCB 3PTNA 1EAXA 3TITA 1TE0A 5E8EH 4UE7H 2GVFA 1PQAA 4Y11E 3Q3YA 1H9LB 2GGVB 4PROA 4CBOA 2NU4E 2Z94A 1MUEB 3E8LA 2XBVA 2VIVA 4B76A 1H8DH 2GCHF 3NWUA 1AKSA 4I33A 5C1UA 1ZPCA 5FX6A 1J8AA 3BEFB 1FN8A 4ABGA 1EAIA 1MBQA 2FOBA 3RDZA 3HPTB 1A7SA 1O30A 1C5UA 1PQ7A 1W11U 3GY4A 1P2OA 4MVNA 3A8AA 3RXUA 3OY5U 1C9PA 1VCWA 2O8TA 3LH3A 1O2TA 1OKXA 2ODPA 1A5GH 4IC5A 1C5WB 3GICB 1FZZA 1OS8A 6GCHF 1GI9B 1YPMH 1CHOF 4Y79A 3ZZ9A 2VWNA 3CS7A 3GOVB 2PHBA 1GJBB 4AFSA 4ZROA 4UDWH 2GX4A 3K2UA 9LPRA 2FOGA 1Z8GA 2KAIA 1AVXA 2VVUA 2AMDA 1AB9C 1L1GA 1TNHA 1EPTC 3BF6H 2WV4A 3TJVA 1PPFE 4B74A 3M3TA 4ZMAH 2BZAA 3VFEA 4UEHH 1D6WA 2FS9A 4OS6A 3QO6A 3S9BA 1KXCA 2J4IA 2ULLA 4K8YA 2UUJB 1C2EA 1AKSB 3M37A 1S5SA 3S9AA 1IOEA 2SGDE 1C2LA 1MKWK 1J9CH 3SV8A 1C1MA 1TALA 1O3BA 1OWEA 2FYRA 4FU8A 4NCYA 4RSPA 1BUIA 2ZDKA 2F9BH 2OBQA 5CHAC 1HAVB 1HCGA 1ZSLA 2FESH 2FOFA 1LVMA 5L30H 1GMCF 1NFYA 2XC5A 4MNWA 4NIXA 4YESB 5JBTA 1DY9A 4O3UA 4YLQH 3LGYA 1ELEE 1ARBA 3RXVA 4Y10E 1O2GH 1EAWA 1F0SA 2VVCA 3RU4D 1PPBH 1NC6A 2I6QA 3LU9B 2HNTC 2JH0D 4CR5A 4O97A 1GCTB 2CGAA 2P3UB 2KAIB 2W3IA 1ELDE 2BY7X 1FY8E 1ZGVA 1FLEE 4WXVA 5JPMH 3ZZ6A 4DW2U 4IN1A 1K1LA 1SOTA 3E3TA 2C8ZB 3QZRA 4FUBA 1LHFH 1CGJE 3BV9B 1Y3UA 2UUFB 2AGIX 2Y7XA 1GJ7B 3RM0H 2ZCLP 1J14A 1C5MD 1ANDA 1AGJA 3RU4E 2ZFSA 5HMAA 3ZVCA 1SLUB 3L3TA 1C5TA 1L4ZA 1SL3A 3MH7A 1XUKA 4X8SH 3SHAH 1T4VH 2PLXA 2ZDMA 3Q3KA 1HJ9A 3R0FA 2GZ9A 2GZ7A 1CT0E 3T2NA 4U2WA 3KNXA 3FP8E 2BD9A 1NS3A 2RDLA 1XVOA 4AFQA 4DIIH 1P2JA 3RMOH 3SOSA 1KLIH 4HTCH 4DG4A 2W26A 2VINA 5ESTE 1F5KU 1C5ZB 3UNSA 3RXSA 1O3CA 1W2KH 1Y59T 1GBJA
chains in the Genus database with same CATH superfamily
1ZMJA 3SI3H 1O31A 1E37B 5EGMA 1O33A 4NSVA 1HGTH 2CK3D 3ZYEA 1VKYA 3A8DA 5E2OA 3AASA 1O0DH 3GCHC 1GGDC 2BXTH 2OTVA 4TPIZ 1QB1A 5JBAS 1HPGA 3ZZCA 3TGKE 1D6RA 2QGRA 1O5BB 3PWCA 1F5RA 4FUEA 1QCPA 1SGCA 1UTQA 2ZFPH 1AO5A 1GMHG 1BRBE 5JDUB 4Y7AA 2RFKC 2FEQH 1GBTA 1P57B 2BDGA 3TNTA 3F3BA 1QBNA 3A82A 3O8DA 2ZFQH 3BTTE 1YCPK 1GBFA 5DSFA 4DY7B 5C20A 1AWHB 3F9EA 1V2WT 4XBDA 1T7CA 2C8YB 1GI2A 1VITF 1L1NA 4IMQA 2NWNA 4AC9A 2FOCA 4Q4LA 4H6TA 4GPGA 2BDBA 3UNRA 1YWUA 1PPZA 1KYNA 2ZPSA 3MU4A 1O3LA 1V2LT 1VZQH 2BLVA 3EYDA 4TYDA 8KME2 3F0OA 1MBMA 3MU5A 3D62A 3MO9A 1O2KA 4RN6A 2ANWA 2Q6GA 3UAIC 2M5TA 5L2YH 1Y8TA 3GDSA 3F2GA 4ZKNU 3KEEA 1O2MA 1WQVH 4CHAB 4Y76A 1O38A 2ZFRH 2BY5X 1TFXA 2V3MA 5C5OA 1C5VA 4MQAA 3SUGA 1KXEA 3F6UH 5FPYA 4A5TS 2CJIA 3U28C 1ETSH 5EW2H 3ZZBA 5FAHA 5HM2A 1P06A 2ANYA 4I8GA 1OWIA 1FNIA 1TRMA 3MYWA 2QXHA 5F03A 4X6OA 1ELAA 5ESBA 2LNCA 1WSSH 3P6ZB 4ZCNA 2BX3A 1NO9H 3SU1A 3OSYA 1NRSH 3KN2A 2WPDD 3UOPA 4JYTA 2A31A 1YPGH 2AMQA 4X2YA 1QR3E 2GV6A 2OUAA 3M36A 1UK3A 2XRCA 2G81E 2PTNA 3V7TA 4ACAA 4MG3A 2SGPE 2AH4X 2QF0A 3ENSB 4U32A 1YPHE 4ZXXH 4NGAH 1IQFA 5LPEA 4BANB 3FO8D 3H7OA 4ZH8A 4KTSA 1DVAH 1AQ7A 3MH6A 1O3NA 3R3GB 1IQEA 2QE7D 5C67A 4A6LA 2HNTF 2A4RA 4MPUA 5F8ZA 1TPOA 1KDQA 4GHTA 1UVOA 3NKKA 1BMNH 1DT2A 1BTXA 5HGGA 1H9HE 3TJUA 1UTKA 2HPPH 1TX6A 3N99A 1AFQB 1DY8A 3IG6B 4YO9A 2D26C 2ZHQH 1J16A 1BTPA 5GIBA 1LHDH 1HAYB 3AK5A 3H5CB 1LVBA 3S7KB 3LH1A 1GI1A 1MU6B 3UOUA 1C2HA 3BIUH 3M7TA 2FX4A 1GJ8B 2FX6A 2BD5A 1C1PA 1OWDA 2HPQH 1DWDH 1WXRA 2ZGJA 3M5NA 1N8OC 1LTOA 1BIOA 1C1WH 1SGFG 4WH6A 4CRDA 3Q76A 3OX7U 1LDTT 1TPSA 4QT8C 1T8NA 4Z0KA 4ACBA 1FMGA 5IYTA 1HXFH 2A2XH 2UUKB 4CH2B 4DT4A 3FKSD 2AYWA 1KSNA 2QXJA 1ZMLA 1E38B 2ZQ2A 1NM6A 2VVVA 1KLTA 1HXEH 2WV9A 1QRWA 4J2YB 1Q3XA 4DIHH 5C1YA 4FOUC 4I31A 1P04A 2SGQE 5CMXH 1A0HB 2QAAA 3SHCH 1C5NH 1QA7A 3RXCA 1KXBA 1KDQB 1EZUC 2G51A 3JZ2B 3NCLA 1SQRA 2IJD1 1SI5H 2XCFA 2Y5GA 1AY6H 3MI4A 3A7TA 3B8JA 3TH2H 1Y3XA 2FODA 3ZZ3A 1YM0A 2WINI 1H9IE 2SGFE 5EJZA 1FAKH 4NFEA 4AB9A 2QYIA 3OTJE 2PKSC 2BOHB 2OBOA 4IW4E 1TPAE 4DCDA 1EOLA 1EJAA 1QY6A 4UD9H 1O3JA 2W3KA 1V2ST 4FUCA 3GCOA 3T26A 1J17T 1GHAG 2CV3A 5F53A 1HUTH 2LELA 4Y0ZE 3MWIU 5A8YA 2CXVA 3N7DA 4XBBA 2WV5A 1RS0A 1XUHA 5DK1A 4M7GA 1BJUA 1SGIB 3E91A 2L74A 2STBE 1AUTC 4CR9A 1DITH 1YP9A 2F9PA 5H4IB 5EJ1A 3TK5A 1EASA 1P2NA 4LZ4B 4NWKA 2RDEA 3ESTA 1D3PB 4IS5A 3UR9A 1TLDA 3TJNA 3FP6E 3RMLH 2ZTYA 2A5KA 2H9HA 5DPAA 4ZKRU 1ZHPA 3KCGH 4ABJA 1ZRBA 1GG6C 2VU8E 2W5EA 3E16B 3RXJA 2FP7B 5B6OA 3KIDU 4BNRA 3FOAA 5DP5A 3A83A 2BD7A 3SJ8A 1BBRE 3O8BA 1YBWA 1AMHA 2KM0A 4YT7H 2G5NA 1DUEA 4BAOB 4DGJA 2DUCA 1MKXH 1D3QB 3U9AH 4B2AA 2FO9A 1QFKH 2FOEA 1BDAA 3BN9A 5GPIB 1E0FD 1O2UA 3LJJA 4GLYA 2BDYA 2QCYA 3N7OA 1NN6A 1O3KA 2QIQA 2G52A 3TIUA 5L6NH 3TLOA 1VJAU 1C5OH 3SBKA 4Q7XA 3I77A 3SV7A 5F6MA 4X1RU 3W1EA 1BQYA 1AVGH 3NUMA 2ZCHP 1A0JA 2GMTB 5IK2D 1BTUA 2NU3E 4A92A 1HJAC 1D9IA 1UVUH 4GCHF 1D4PB 2WHXA 4IN2A 3F9HA 3EA8A 2EEKA 1MTNC 3TPIZ 1GBAA 1TBQH 2BD8A 2GCTB 4F49A 1ZR0A 2YMSB 1CBWC 4FUFA 4O03A 1T8OA 1GHXH 3A85A 3UTUH 2RA3A 1ANEA 1V2KT 3F2FA 2F91A 1W0KD 1B7XB 5DN6D 1EZSC 2R0LA 1UCYH 4X8TH 5DG6A 4BOHA 5C1XA 1SPJA 3VGCC 1SGFA 3BG8A 1O3MA 3ZZ7A 1A2CH 5GXPA 4KGAA 3AVZA 3IWMA 3SNEA 2A7CA 4KP0A 1W14U 1AVWA 1NPMA 1TAWA 4AG1A 4F55A 4YT6H 1BTZA 1T8LA 1VJ9U 1QBVH 1C2JA 2D1JA 2HGTH 2OQ5A 1V2RT 2AEIH 4GHQA 3UNQA 4AZ2B 1QRXA 3BIVH 2XCNA 5DP8A 2FYQA 3K6YA 4H6SB 2Z3CA 1FPCH 3GCTG 5L2ZH 5DJ7A 3HGNA 5PTPA 3ZVBA 4NIVA 2ZTZA 2WPHS 3A88A 1W7GH 2J9NA 2A0QB 8ESTE 4BAQB 1TWXB 2R0KA 5JB8S 1P05A 2Y5FA 2C8WB 3BTWE 1W12U 3EQ0H 1P8VC 1GGDB 3SU6A 1F0UA 2FLBH 1AE8H 1YC0A 1ZJKA 1IQJA 4JZEH 2XOKD 1C1TA 2R3YA 4CRGA 2ZEBA 1DUAA 1U6QA 3AAVA 3CENA 5EU8A 1AI8H 2BZ6H 2KX4A 4HG6A 1SKYE 1NFUA 4MLFB 3LIWA 4LXBH 2F83A 1K28D 2XC0A 3PMBB 1DWBH 1G9IE 2BD2A 2PGQB 1NBMD 1ELVA 1PPEE 2BXUH 5DGJA 2FMJA 3BG4B 4ABHA 1CHOG 5K0HA 2OC7A 3PRDA 2H5CA 3EGKH 2OCVB 1BMLA 2AGGX 4LOYH 1FY3A 1O3GA 4JZFH 2CHAB 1ZSKA 1O2OA 2OP9A 1UTJA 1O37A 3W95A 1Z1IA 2B0FA 4Y8XA 1FIZA 3RXBA 3LT3A 3H09A 2ZECA 4YXWD 1BITA 4WF8A 3FZDA 5F8TA 2D8WA 5EW1H 1MABB 1H4WA 1NBME 2V7QD 3HK3B 5FXLA 4AFZA 1AE5A 1WQSA 4INKA 5FBIA 2HALA 3SV2H 3PYHA 5LH8A 3OEHD 2VGCC 4RKJB 2GDEH 3SNAA 2QF3A 4YTAA 2Y6TA 3KGPA 2XXLA 2IN2A 3KL6A 1HFDA 2V3HH 4NFFA 4UFGH 1HAVA 4ZHLU 5EOKA 1JIMA 1Z8RA 3KF2A 3DHKH 2OD3B 3STIA 2ZDVH 1O2QA 5DP7A 2R2MB 4UFEH 2ESTE 1AWFH 3SNBA 1GMCG 1AFEH 1GMDG 3PB1E 4ABBA 4D76A 2TGTA 4AB8A 5ETXA 1O32A 1S82A 3V12A 1SQOA 1ESTA 3K9XB 1O2ZA 1ANBA 1GCDA 5EQRA 3U69H 7GCHG 1SC8U 1QB6A 3UWIA 3ZZ5A 1O3FA 3FP7E 2KCYA 3PO1B 2W6JD 4NG9H 3K65B 3QTVH 3LGIA 1CT4E 3GDVA 4FU9A 1MCTA 2NU1E 4B6FA 1GBLA 2ALPA 3UY9A 1ORFA 3MNCA 2P95A 3SV6A 1H8HD 1PPCE 1YCPM 4X6MA 3VEQB 4ASUD 2SFAA 1HIAA 5FX5A 1LHEH 1YPLH 3KQBA 1GHWH 2J34A 1G30B 3F9GA 1TOCB 1C1UH 2QN5T 3UQVA 7ESTE 1UHBA 2WPLS 4JZ1A 1OP8A 4WVPE 2VWOA 4WXIA 4Q2KA 3RLYH 1TPPA 2BLOA 4ISNA 1KTSB 3HK6B 1CU1A 3NK8A 4ABDA 2XWBI 1ABIH 3NZIA 1OHHD 1FAXA 2QXIA 1ID5H 1RGQA 4H4FA 4A1XA 3SGQE 3BTGE 1MZAA 2PSXA 1G3DA 4I86A 1BA8B 3P8NA 2EI6A 3SJKA 1DFPA 5DP6A 2WUCA 2VIDA 3F0PA 1LQEA 1G3BA 1B0EA 1SHYA 3QK1A 1P12E 1DS2E 1LCYA 2UWPA 1TRNA 1BHXB 2LP6A 3H7TA 2EY4C 1LHGH 3SU4A 1FY1A 1K2I1 3MH4A 1O5AB 3RUOA 1KMHB 1K1MA 3L6PA 3DSGA 1EB1H 3M7QA 1HIAB 2JETC 4X8VH 2G00A 4K1SA 3RXIA 2VB0A 1C5PA 2WUBA 2C8XB 1KXAA 1RIWB 3SU3A 5EODA 4J1YA 2PKSB 4Y8ZA 2C90B 1VITG 3AAUA 2ZC9H 4BTIB 1UCYK 1BRCE 1XUFA 1UHBB 2OC8A 1Q2WA 1XUIA 2ZGHA 1K0HA 1AZ8A 6ESTA 1SBWA 2ZWLH 1WUNH 4I8JA 2VWLA 3T5FH 2ZA5A 2ZNKH 2Z7FE 4X2XA 1ZHRA 3AW0A 1V3XA 3P17H 1P9UA 3GYMA 2J5UA 2P93A 4WMEA 1VGCB 1NTPA 1DOJA 1C5RA 1SG8B 2SGEE 3SO3A 5TJXA 1P2MA 1E79D 3ODFA 2Y82A 3UR6A 1WTGH 2OLGA 1BTWA 1GBIA 2TRMA 4E06H 2W7SA 2AGEX 1BT7A 4ESTE 5F8XA 1UVPA 2BHGA 1A5IA 4FUIA 3UREA 1S83A 1L0ZA 3M7UA 1TOMH 3SUEA 5C3NA 5HIZA 4X2WA 3W94A 1IQHA 1O5DH 1NRNH 5FBEA 1FN6A 2ZP0H 1ZPZA 3VB3A 1K1IA 1OWKA 1XMNB 1OSSA 7LPRA 6LPRA 3WY8A 5FL7D 1DLEA 5HXFA 1ZLRA 1SFQB 5BRRE 1JRSA 4X1SU 2ZG0H 3SZEA 3RXKA 4VGCC 3BSQA 1C1QA 1MU8B 1SGYE 3BEIB 2EQNA 1CHGA 1ZOMA 1Z6EA 3A89A 1PPHE 3BTKE 1ELFA 3MTYA 1DSTA 2A4GA 1LPKB 2ZHFH 2KFWA 3F68H 1GI0A 2ZF0H 1JOUB 4D8NA 3FAOA 1SGEE 2K0QA 1EP6A 4D9RA 4X0WU 1DANH 2OINA 2IPHA 3TNSA 1GBBA 3K6ZA 2HLDD 2ZDLA 4GSOA 1BMFD 1CSOE 4NIYA 4BAKB 2JIZD 7KMEH 1CBWB 1C4Y2 1TMTH 4TY7A 4K2YA 1LKBA 1IQGA 3ZZDA 3QUMP 1SGQE 2BVSH 3RMNH 1BZXE 5T6DA 4UFDH 2ZU5A 3P8OA 4X6PA 1BRUP 1XX9A 2J98B 2QC2A 2YOLA 1VCQA 1EOJA 2BY8X 2TPIZ 1MAYA 1T4UH 1GVLA 1CA0C 3F2HA 9ESTA 4KKDA 1DX5M 1W3CA 5AFZH 1EJMA 3TVJB 1C5LH 4DURA 2ZHDA 1C1OA 1CO7E 1MD8A 2A32A 8GCHF 1ZTJA 5E0GA 2BDIA 3M3VA 1UW7A 3GY5A 1GBDA 3VXEH 2PGBB 2HRVA 1BB0B 4FUDA 5LGOA 1GBHA 3ZYDA 2ZU1A 5LPFA 5EXMA 4X1PU 6CHAC 2QA9E 1RFNA 3SQEE 3A7YA 3VB5A 1YLNA 4JZIA 4B6EA 3GISB 1QTFA 2ZIQH 3QX5H 3ATLA 1O2JA 2ANMH 1P0SH 1XKBC 3KYFA 5GCHF 1YPHC 3SNDA 2I6SA 2UUYA 1Y5BT 5C2ZA 2PKAA 3ZZAA 4ZHMU 3MHWU 4OS1A 1DWCH 3TU7H 2QF5A 3UWJH 3PLBA 2ZU3A 1IQIA 2G5VA 2H9TH 1P02A 1NU7B 2BOKA 2TIOA 1TNKA 3CS0A 1QQUA 2XTTB 3KQCA 1THRH 4AN7A 5T3HA 3NXPA 2G8TA 1QBOA 1A5HA 3RXOA 3S9CA 5TCAA 5HIYA 2Z6BD 4AGKA 1ELCA 1SLXB 1THSH 1VITH 2SNVA 1X7AC 4Y71A 1GCTC 1ELGA 4YZUA 1ELTA 1QL7A 1C4V2 5ABWA 1HAPH 2YNBA 2ZPRA 2G4UA 1EPTA 3OU0A 1GWAA 4ISOA 1RTLA 1SB1H 2K8IA 3ZVEA 2BDAA 2J95A 1Z7KA 1UVTH 3WWBA 2ZHWH 4JK6A 2W7UA 3DT0H 4TPYA 1KXFA 1WBGB 1HAIH 3E0NB 3Q77A 2H5DA 3OTPA 3ATIA 3U8OH 5DO4H 1FXYA 1HJ8A 2VIQA 3P95A 3SV9A 1V2TT 1ZSJA 3D23A 2O8UA 1ZJDA 3ZZ4A 3I29A 2QY0B 1F7ZA 3EAJA 2F9VA 1O2RA 2A45B 2PKAB 1O36A 4IBLH 1TQ7B 3U8RH 1E34B 1DPOA 1JWTA 2F9UA 1PQ8A 3SU2A 2JKHA 3F9FA 2GD4B 2QXGA 1A3EH 2R3UA 3ZIAD 1G3EA 3PMJA 4FXGH 1E35B 2P16A 2P94A 4I8HA 2BVRH 4ZHAA 1UK2A 2IJOB 3V0XA 1LPZB 3PM3A 1DM4B 1DWEH 1YF4A 2R2WU 3C1KA 3SQHE 1K22H 1C9TA 3CP7A 3LGVA 4Z1MD 5FCKA 3OFND 4GCHG 1SGDE 1XXFA 1KLJH 2GJGA 3PWBA 1TRYA 5E2PA 3LONA 1AB9B 4I8LA 3RC5A 3MNXA 3URCA 3JZ1B 1EPTB 1MMJN 1UTOA 1O5GH 1RRKA 1Y5AT 2PW8H 1UVSH 1XKAC 4WY3A 2AS9A 3M5OA 4Y8YA 2DE8A 1YPEH 2B9LA 2Z3DA 2ZHEH 3A7VA 1AN1E 2KR7A 4AYYB 2JH6D 1O2YA 1OYTH 1A1RA 4WJG2 4X1QU 1T31A 1NRQH 1ZTLA 2QV1A 1P9SA 1GHZA 1MTSA 2ODQA 3ELAH 1GHBF 2VNTA 1LO6A 1IAUA 1FDPA 5EIYA 3P8GA 1SFIA 1FI8A 3LGWA 1V6DA 4MDSA 1IQKA 1RD3B 4IGDA 4CREA 1EKBB 5JBCS 5CHAB 1G37A 1O5FH 3RXMA 4MPWA 2Z3EA 5T6GA 2FDAA 2B5TB 3TJOA 3RXLA 4X6NA 1GBMA 5DP4A 1SGPE 4HI3A 1QHRB 5FHTA 2ZGCA 3C27B 4CHAC 3UB0A 2J97A 1LMWB 2Y80A 1O39A 2TBSA 1N1LA 1C1NA 1V2VT 1SQTA 2Y7ZA 1IHSH 1THPB 1CE5A 2CMYA 1HAZB 3A80A 3RU4T 1QJ6B 2JDID 1FQ3A 2V35A 1QIXB 3P8FA 4K69A 3A81A 3PTBA 2ALVA 1TX7A 3A7WA 1F0TA 1WTHD 5A2MH 1ELBA 1F0RA 1EQ9A 2FI4E 1HB0B 4AOQA 2GTBA 2CF8H 2KCOA 4INHA 1FY5A 5CDFE 1N6XA 2ZZUH 4XDEA 1ETTH 2WSSD 1ACBE 5KEDA 4K1EA 1O2LA 1RXPA 2BY6X 1QJ1B 1S81A 1C2MA 3EE0B 4SGBE 3T27A 3T25A 1DSUA 1EXFA 1PPGE 2PUQH 1QNJA 5T6FA 1ZYOA 1C2DA 3VB4A 2EI7A 1OXGA 1Q31A 4AORA 2BDHA 3A8BA 5EG4A 2OC1A 3ZVFA 5K7RA 2GCHG 3FZZA 1LQDB 5J4SA 3ZZ8A 3A8CA 1ZPBA 3GCHB 5EPNA 1QL8A 1WCZA 3U98H 1LKAA 1P2IA 4O9VA 3BTDE 5C94A 1GI7B 3MH5A 3E0PB 3MO6A 2AHME 2KCAA 1TGNA 1LVOA 4YM9A 3OAAD 2Z9LA 2A5IA 4AYVB 2GKVE 2ZI2H 3ITIA 2A7JA 4Q80A 3SU0A 1SHHB 4HFPB 5GWZA 3DFJA 2ZFTA 3GY3A 3QGJA 3V13A 4AGJA 6GCHG 1SGNE 4THNH 1P01A 3A86A 3LC3A 4BXSA 5E0HA 1EFRD 1P3EA 1W13U 1GPZA 3PLKA 1OWJA 2ZDNA 1IHTH 1O2WA 2ZGXH 1G32B 1MZDA 4NZLA 2KCPA 2O8LA 2WPKS 4E05H 1Y5UT 1V2PT 4ISLA 1GBCA 2DE9A 3RXQA 1MQ6A 1WYKA 4B2BA 3PV4A 3OY6U 2OQUA 1O3PB 1E36B 1V2QT 4OS5A 5EQSA 2OC0A 5DP9A 1SVPA 3GY6A 2Q1JA 1EJNA 1O3HA 3MU8A 1OP2A 3B23B 2BB4A 3GCTF 3M3SA 5C0TA 2HWLB 1LHCH 2WZQA 2XNIA 4I8KA 1DXWA 1G2MA 3M5MA 3LOXA 1QA0A 4YOGA 3BEUA 4F48B 1Z8JB 2CF9H 2ZPQA 4FVBA 5JB9S 1FPHH 1NRRH 2GZ8A 4LK4A 4DT7B 4SGAE 1S84A 1GI6A 1T32A 2Q6DA 2RCEA 2ZU4A 4ZKOU 3Q3XA 4D7GA 4XRNA 1PJPA 2V6NA 1ZZZA 1W10U 2UWLA 3N7EA 4FETA 1BTYA 1O2NA 1VCPA 1O3IA 1NZQH 4NA9H 1C4U2 4Q7ZA 1CGHA 2VIWA 1TGCA 1YPJH 2ZQ1A 2JJ1D 1QJ7B 5IDKA 4NSYA 2YMSD 1TIOA 3P92A 5KECA 3M61U 3HKJB 1CA0B 1TGBA 2FPZA 2F9NA 2EA3A 2YNAA 2CN0H 1BOQA 2XW9A 3GYLB 4YOIA 4K60A 2BQ7B 1TONA 4MNYA 3PMHB 3MOCA 2XBWA 1EZQA 1EZXC 4HZHA 2RG3A 2THFB 4RI0A 3D65E 3RMMH 1DXPA 2W6ID 3LPRA 2XBXA 1GBKA 6CHAB 4OS7A 1G2LA 3HKIB 1MTWA 1KTTB 3VG8A 2PV9B 1LPGB 2SGAA 1TBRH 1D3DB 2HNTE 1KXDA 2GP9B 2H9EH 1K1NA 4JK5A 1ZMNA 4AX9H 1N8OB 1Y3YA 2V0BA 1O2HA 3CNRA 3QWCH 3VB6A 5G4BA 5SGAE 2F43B 1MKXK 3FVFB 1T8MA 2ASUB 2PFEA 3SN8A 4UFFH 1BTHH 4DOQA 1HLTH 5CE1A 4B1TA 2GMTC 4K3JA 4CRAA 1FY4A 2A5AA 2A4OA 2Q6FA 4ISIH 4ISHH 1TGSZ 1GMDF 1DDJA 4BTUB 1QB9A 4IC6A 4Y0YE 1G3CA 1WOFA 3GY8A 4XOJA 3RLWH 2SNWA 5J4QA 1TA6A 2TGDA 1JXPA 2G55A 2GCTC 2YMSC 3RXAA 3MU0A 3KYGA 1QGFA 1IQMA 7GCHF 1HNEE 4TSFD 1RTFB 3ATMA 5A0AE 5GDSH 3MQKC 1V2UT 3GS9A 1HAHH 3U1IB 3KQDA 1RJXB 1ESAA 5A0CA 3RM2H 2WYGA 1HAOH 4E7RG 4FUGA 3ATKA 3BTFE 4OS4A 3U1JB 2FI3E 1F5LA 1UCYE 2B7DH 4F4OC 1BCUH 2RA0A 1C2IA 1O2XA 1MTVA 5A8ZA 1ANCA 3RC4A 3ZVDA 1GI5A 4A1TA 4BTTB 1GVKB 1WU1A 3A7XA 4RKOB 1UJ1A 3SUFA 2P3FH 1TNLA 2L6OA 3LDXH 1CQQA 5AFYH 2WPIS 2H6MA 4AFUA 1E1RD 4CRBA 3GY7A 4A7IB 3F1SB 4X2VA 1HRTH 3MFJA 4H42U 5T1VA 2B8OH 3RXPA 1L4DA 1TA2A 1MH0A 1Z71A 2VH6A 3QN7A 5KGOA 3URDA 2STAE 1GI3A 1YYY1 2BQ6B 1O2PA 2FXRA 5EQQA 2HOBA 4ASHA 1QURH 4LZ1H 1AD8H 1GG6B 1BBRH 2WYJA 2FTLE 5HM9A 2TGPZ 2AIPA 1HAXB 1ESBA 1WAYB 1W0ZU 2J98A 5A0BA 4Z6AH 2XC4A 1SR5C 5LPRA 1K1PA 2FWWA 5FPTA 2NU2E 2WPMS 1TB6H 2P8OC 4Q7YA 1GDNA 3TK9A 1GVZA 1HYLA 2ZTXA 4JZDH 3BG4C 3RXHA 2BD3A 3A84A 1HAGE 1UTNA 1AHTH 1OP0A 4XBCA 2Z9JA 1AZZA 1S6FA 3KQ5A 3ZV8A 2CHAC 4BAHB 1O2VA 2EI8A 8GCHG 1NROH 2BDCA 1S0QA 4KTCA 1UO6A 1S85A 3AW1A 1HJAB 3T29A 1INCA 4ABFA 3ZVAA 2FIRH 1C1SA 3QTOH 4K8BA 3VXFH 3LC5A 5I46H 2AIQA 4XE4A 4B73A 1MTNB 1TQ0B 3RXEA 1XVMA 1C1VH 4INLA 3TGJE 1GJ5H 3WWFA 3WW7A 1A3BH 4JYUH 1A4WH 1V2NT 2BVXH 5GCHG 3GCNA 3M35A 1GDQA 1RTKA 1GMHF 1SQAA 5GNDA 4MNVA 3TK6A 1GHYH 1GJ9B 1NY22 2ZU2A 4K1TA 2R9PA 3L33A 1P11E 1NU9A 1YY3A 2PWXA 1TNGA 4OS2A 3VGCB 1C2GA 1GHVH 1Y3WA 3D49H 1S6HA 2P3TB 2Y81A 1FV9A 1H1BA 3T28A 5JBBS 1UTMA 1O3AA 3FN8A 2GT7A 1LVYA 2BLWA 3MMGA 1ARCA 1TX8A 4NIWA 1O34A 3RP2A 4YLUA 3B9FH 2A1DB 1C5SA 3PO1C 2GT8A 1C5YB 3ZV9A 1GI4A 2ZDAH 2PUXB 2VWMA 5DP3A 1MAXA 4NA7A 1WDIA 3RXDA 1NFXA 3EDXB 2O8MA 4B75A 1GBEA 2A4QA 4UONA 2PP6A 3STJA 3VB7A 4CRCA 2IOTA 4WWYA 2VH0A 3VPKA 4B71A 3RXRA 3HATH 4FVDA 2JH5D 4BAMB 1PYTD 1W7XH 1TYNA 1C2FA 1O2IA 1C2KA 1P2KA 3SORA 1O3OA 1XXDA 1MD7A 3RXTA 2H2ZA 1VR1H 5C5NA 5EXLA 1SOZA 1JBUH 3QGNB 1Y3VA 2H1UA 2ZGBH 5AVDA 4ZXYH 1K21H 1TMBH 2J2UA 1GL0E 2LPRA 4E7NA 3S69A 1SGRE 1YPKH 1YKTA 2PR3A 3HGPA 5BPEA 3ATWA 2AERH 1YGCH 2PSYA 3DFLA 1BRAA 1TABE 2BD4A 1TNJA 4XSKU 1AIXH 4JCNA 4ZAEA 1EAUA 2Y5HA 4TWWA 3A7ZA 3NPSA 5A8XA 5HKKD 3PV2A 1KY9A 1AUJA 4NZQA 3BTQE 3PRBA 1SMFE 1CT2E 3OEED 3PV5A 2AFQB 1YLDA 1NT1A 2VJ1A 2J94A 4DVAU 2ZFFH 4ABIA 1N6YA 2O9QA 1GJAB 4ZKSU 2VGCB 4U01A 4AG2A 3O8RA 1JIRA 1G36A 1OOKB 1OWHA 1XUJA 5TCCA 4TWYA 4OGXA 3LKWA 1RIWC 3PLPA 1GHBG 4CRFA 3TH3H 3KHVA 4GVUA 2VIPA 2HVXA 1L1JA 1PYTC 1BMAA 1XM1A 1V2JT 3MNSA 3SGBE 1A0LA 1C5XB 1V2OT 4TY6A 3MNBA 2AMPA 1Z6JH 3DUXH 4HGCA 3E1XB 2BY9X 4CH8B 2JJ2D 1PFXC 2QF4A 4Y6DA 1P3CA 5AF9H 4GAWA 2FM2A 3DCLA 1VGCC 4ZUHA 1CA8B 3OYPA 1GDUA 2FOAA 2FI5E 4A1VA 5E0JA 4KELA 1ZHMA 1GL1A 3SNCA 2HLCA 1ZGIA 1GI8B 3P70B 1GJDB 1MKWH 1XUGA 1SLWB 3SUDA 1NESE 1V2MT 3IITA 4KTUA 4D9QA 1O3EA 3MO3A 3GDUA 4I32A 2BX4A 4D7FA 2FOMB 4YOJA 1FIWA 1NFWA 2G4TA 2K1QA 1O35A 1BMMH 2FTMA 1Z1JA 3PROA 4K5ZA 1MCVA 1OPHB 4DJZB 4IMZA 2WPJS 3EE7A 2BYAX 3OE7D 3FFGA 1A61H 1IQLA 2ZCKP 2OK5A 1DICA 1FUJA 4WMFA 3RC6A 3SZNA 2Z9GA 5B6LA 1FX0B 2BMGB 3UFAA 5C0UA 2P59A 1BBRK 3DA9B 5EXNA 3BTHE 1F92A 1GHAF 1CVWH 1EB2A 4MPVA 1C1RA 1P03A 3QZQA 4XFQA 1EX3A 3SW2B 3M5LA 3U8TH 2FLRH 1F2SE 4ABEA 1HV7A 1TBZH 4JYVH 2Z9KA 3GY2A 4NWLA 2KZ4A 1NRPH 3E6PH 1S0RA 3LGUA 5I25A 1D3TB 1TMUH 1QQ4A 3DSOA 3SJOA 1AU8A 1UK4A 5HYOA 1P10A 1B0FA 3A87A 1UTPA 2OXSA 3SI4H 5FPSA 2J92A 2Z9IA 3UQOA 1SGTA 4OM9A 1DE7H 1EP5A 2BQWB 3ZVGA 2BTCE 1GJ4H 5A09A 4MTBA 5C17A 5FCRA 3RXFA 4XD7D 3RXGA 1TGTA 2A7HA 1QL9A 1JMOH 1EUFA 3S7HB 1A46H 1MQ5A 4R8TB 1L2EA 1O3DA 3SGAE 4R0IA 1B5GH 3UIRA 2O8WA 2XWAA 5DKMA 1P09A 1ABJH 1QZ8A 2F3CE 3SJIA 2ODYB 3MU1A 4Q63A 2BM2A 3FANA 4U30A 4WMDA 3Q00A 3ODDA 2JETB 2FZZA 2NU0E 3TGIE 1J15A 2EC9H 3KQEA 2C3SA 1FJSA 4X1NU 3SJ9A 1BJVA 1ETRH 1P2QA 1SLVB 3PMAB 3LJOA 4OGYA 1DLKB 1EATA 1TNIA 1ZRKA 3T62A 1COWD 3I78A 1O5EH 4FUJA 4O3TA 1K1OA 1FONA 4P02A 4BXWA 1PQ5A 3UPEA 1AFQC 1CGIE 1QRZA 4MNXA 1K9OE 1KIGH 2UWOA 3EA7A 4WH8A 3EA9A 2A2QH 5EPYA 1C5QA 2F9OA 4FUHA 3V3MA 3E90B 3BTEE 4X8UH 3TH4H 5AHGH 1YCPH 3S0NA 2VIOA 3QDZB 2FS8A 5GJ4B 3SYJA 2V3OH 1WV7H 3UUZA 1OX1A 1OYQA 1BHXF 1HDTH 5JYIA 1M9UA 2D2DA 2ZO3H 1HBTH 4I7YH 1K1JA 1SSXA 4ABAA 2XBYA 3BTME 4MPXA 2BLQA 2C93B 1UMAH 3QLPH 2XYAA 1O2SA 4FU7A 1IQNA 4GUXA 8LPRA 4CBNA 2PTCE 2GDDA 1MTUA 4JMYA 3G01A 2J38A 4RT1A 1W8BH 2GV7A 3LGTA 3SU5A 1JRTA 1UTLM 4NA8A 4Y7BA 1YLCA 2ILNA 2P8OB 1GJ6A 1W0YH 4B2CA 2TGAA 3O8CA 2IPQX 3DD2H 1Z8IB 4RT0A 2ANKH 5EJLA 1H8IH 2C4FH 1O5CB 1ZTKA 2HVYB 4VGCB 2M2AA 2ZKSA 2FOHA 1GJCB 3PTNA 1EAXA 3TITA 1TE0A 5E8EH 4UE7H 2GVFA 4TT3D 1PQAA 4Y11E 3Q3YA 3NRLA 1H9LB 2GGVB 4PROA 4CBOA 2NU4E 2VBCA 2Z94A 1MUEB 3E8LA 2XBVA 2VIVA 4B76A 1H8DH 2GCHF 3NWUA 1AKSA 4I33A 5C1UA 1ZPCA 5FX6A 1J8AA 3BEFB 1FN8A 4ABGA 1EAIA 1MBQA 2FOBA 3RDZA 3HPTB 1A7SA 1O30A 1C5UA 1PQ7A 1W11U 3GY4A 1P2OA 4MVNA 3A8AA 3RXUA 3OY5U 1C9PA 1VCWA 2O8TA 3LH3A 1O2TA 1OKXA 2ODPA 1A5GH 4IC5A 1C5WB 3GICB 1FZZA 1OS8A 6GCHF 1GI9B 1YPMH 1CHOF 4Y79A 3ZZ9A 2VWNA 3CS7A 3GOVB 2F4LA 2PHBA 1GJBB 4AFSA 4ZROA 4UDWH 2GX4A 3K2UA 3DSPA 9LPRA 2FOGA 1Z8GA 2KAIA 1AVXA 2VVUA 2AMDA 1AB9C 1L1GA 5CHBA 1W0JD 1TNHA 1EPTC 3BF6H 2WV4A 3TJVA 1PPFE 4B74A 3M3TA 4ZMAH 2BZAA 3VFEA 4UEHH 1D6WA 2FS9A 4OS6A 3QO6A 3S9BA 1KXCA 2J4IA 2ULLA 4K8YA 2UUJB 1C2EA 1AKSB 3M37A 1S5SA 3S9AA 1IOEA 2SGDE 1C2LA 1MKWK 1J9CH 3SV8A 1C1MA 1TALA 1H8ED 1O3BA 1OWEA 2FYRA 4FU8A 4NCYA 4RSPA 1BUIA 2ZDKA 2F9BH 2OBQA 5CHAC 4M9FA 2XNDD 1HAVB 1HCGA 1ZSLA 2FESH 2FOFA 1LVMA 5L30H 1GMCF 1NFYA 2XC5A 4MNWA 4NIXA 4YESB 5JBTA 1DY9A 4O3UA 4YLQH 3LGYA 1ELEE 1ARBA 3RXVA 4Y10E 4P00A 1O2GH 1EAWA 1F0SA 2VVCA 3RU4D 1PPBH 1NC6A 2I6QA 3LU9B 2HNTC 2JH0D 4CR5A 4O97A 1GCTB 2CGAA 2P3UB 2KAIB 2W3IA 1ELDE 2BY7X 1FY8E 1ZGVA 1FLEE 4WXVA 5JPMH 3ZZ6A 4DW2U 4IN1A 1K1LA 1SOTA 3E3TA 2C8ZB 3QZRA 4FUBA 1LHFH 1CGJE 3BV9B 1Y3UA 2UUFB 2AGIX 2Y7XA 1GJ7B 1E1QD 3RM0H 2ZCLP 1J14A 1C5MD 1ANDA 1AGJA 3RU4E 2ZFSA 5HMAA 3ZVCA 1SLUB 3L3TA 1C5TA 1L4ZA 1SL3A 3MH7A 1XUKA 4X8SH 3SHAH 1T4VH 2PLXA 2ZDMA 3Q3KA 1HJ9A 3R0FA 2GZ9A 2GZ7A 1CT0E 3T2NA 4U2WA 3KNXA 3FP8E 2BD9A 1NS3A 2RDLA 1XVOA 4AFQA 1S6LA 4DIIH 1P2JA 3RMOH 3SOSA 1KLIH 4HTCH 4DG4A 2W26A 2VINA 5ESTE 1F5KU 1C5ZB 3UNSA 3RXSA 1O3CA 1W2KH 1Y59T 1GBJA
chains in the Genus database with same CATH topology
1ZMJA 3SI3H 1O31A 1E37B 5EGMA 1O33A 4NSVA 1HGTH 3ZYEA 3A8DA 5E2OA 3AASA 1O0DH 3GCHC 1GGDC 2BXTH 2OTVA 4TPIZ 1QB1A 5JBAS 1HPGA 3ZZCA 3TGKE 1D6RA 2QGRA 1O5BB 3PWCA 1F5RA 4FUEA 1QCPA 1SGCA 1UTQA 2ZFPH 1AO5A 1GMHG 1BRBE 5JDUB 4Y7AA 2FEQH 1GBTA 1P57B 2BDGA 3TNTA 1QBNA 3A82A 3O8DA 2ZFQH 3BTTE 1YCPK 1GBFA 5C20A 4DY7B 1AWHB 3F9EA 1V2WT 4XBDA 1T7CA 2C8YB 1GI2A 1VITF 1L1NA 4IMQA 2NWNA 2FOCA 4H6TA 4GPGA 2BDBA 3UNRA 1PPZA 1KYNA 2ZPSA 3MU4A 1O3LA 1V2LT 1VZQH 2BLVA 3EYDA 4TYDA 8KME2 1MBMA 3MU5A 3D62A 3MO9A 1O2KA 4RN6A 2ANWA 2Q6GA 2M5TA 5L2YH 1Y8TA 3GDSA 4ZKNU 3KEEA 1O2MA 1WQVH 4CHAB 4Y76A 1O38A 2ZFRH 2BY5X 1TFXA 5C5OA 1C5VA 4MQAA 3SUGA 1KXEA 3F6UH 5FPYA 4A5TS 2CJIA 1ETSH 5EW2H 3ZZBA 5FAHA 5HM2A 1P06A 2ANYA 4I8GA 1OWIA 1FNIA 1TRMA 3MYWA 2QXHA 5F03A 4X6OA 1ELAA 5ESBA 2LNCA 1WSSH 3P6ZB 2BX3A 1NO9H 3SU1A 3OSYA 1NRSH 3KN2A 3UOPA 4JYTA 2A31A 1YPGH 2AMQA 4X2YA 1QR3E 2GV6A 2OUAA 3M36A 1UK3A 2XRCA 2G81E 2PTNA 3V7TA 4MG3A 2SGPE 2AH4X 2QF0A 3ENSB 4U32A 1YPHE 4ZXXH 4NGAH 1IQFA 5LPEA 4BANB 3H7OA 4ZH8A 4KTSA 1DVAH 1AQ7A 3MH6A 1O3NA 3R3GB 1IQEA 5C67A 4A6LA 2HNTF 2A4RA 4MPUA 5F8ZA 1TPOA 1KDQA 4GHTA 1UVOA 3NKKA 1BMNH 1DT2A 1BTXA 5HGGA 1H9HE 3TJUA 1UTKA 2HPPH 1TX6A 1AFQB 1DY8A 3IG6B 4YO9A 2D26C 2ZHQH 1J16A 1BTPA 5GIBA 1LHDH 1HAYB 3H5CB 1LVBA 3S7KB 3LH1A 1GI1A 1MU6B 3UOUA 1C2HA 3BIUH 3M7TA 2FX4A 1GJ8B 2FX6A 2BD5A 1C1PA 1OWDA 2HPQH 1DWDH 2ZGJA 3M5NA 1N8OC 1LTOA 1BIOA 1C1WH 1SGFG 4WH6A 4CRDA 3Q76A 3OX7U 1LDTT 1TPSA 4QT8C 1T8NA 4Z0KA 1FMGA 5IYTA 1HXFH 2A2XH 2UUKB 4CH2B 2AYWA 1KSNA 2QXJA 1ZMLA 1E38B 2ZQ2A 1NM6A 2VVVA 1KLTA 1HXEH 1QRWA 4J2YB 1Q3XA 4DIHH 5C1YA 4I31A 5CMXH 1P04A 2SGQE 1A0HB 2QAAA 3SHCH 1C5NH 1QA7A 3RXCA 1KXBA 1KDQB 1EZUC 2G51A 3JZ2B 3NCLA 2XCFA 1SI5H 2Y5GA 1AY6H 3MI4A 3A7TA 3B8JA 3TH2H 1Y3XA 2FODA 3ZZ3A 1YM0A 2WINI 1H9IE 2SGFE 1FAKH 4NFEA 4AB9A 2QYIA 3OTJE 2PKSC 2BOHB 2OBOA 4IW4E 1TPAE 4DCDA 1EOLA 1EJAA 1QY6A 4UD9H 1O3JA 2W3KA 1V2ST 4FUCA 3GCOA 3T26A 1J17T 1GHAG 2CV3A 1HUTH 4Y0ZE 3MWIU 5A8YA 2CXVA 4XBBA 2WV5A 1RS0A 1XUHA 5DK1A 4M7GA 1BJUA 1SGIB 3E91A 2STBE 1AUTC 4CR9A 1DITH 1YP9A 2F9PA 5H4IB 3TK5A 1EASA 1P2NA 4LZ4B 4NWKA 3ESTA 1D3PB 4IS5A 3UR9A 1TLDA 3TJNA 3FP6E 3RMLH 2ZTYA 2A5KA 2H9HA 5DPAA 4ZKRU 1ZHPA 3KCGH 4ABJA 1ZRBA 1GG6C 2VU8E 2W5EA 3E16B 3RXJA 2FP7B 5B6OA 3KIDU 4BNRA 5DP5A 3A83A 2BD7A 3SJ8A 1BBRE 3O8BA 1YBWA 1AMHA 4YT7H 2G5NA 1DUEA 4BAOB 4DGJA 2DUCA 1MKXH 1D3QB 3U9AH 4B2AA 2FO9A 1QFKH 2FOEA 1BDAA 3BN9A 5GPIB 1E0FD 1O2UA 3LJJA 4GLYA 2BDYA 2QCYA 3N7OA 1NN6A 1O3KA 2QIQA 2G52A 3TIUA 5L6NH 3TLOA 1VJAU 1C5OH 3SBKA 4Q7XA 3I77A 3SV7A 5F6MA 4X1RU 1BQYA 1AVGH 3NUMA 2ZCHP 1A0JA 2GMTB 1BTUA 2NU3E 4A92A 1HJAC 1D9IA 1UVUH 4GCHF 1D4PB 4IN2A 3F9HA 3EA8A 2EEKA 1MTNC 3TPIZ 1GBAA 1TBQH 2BD8A 2GCTB 4F49A 1ZR0A 1CBWC 4FUFA 4O03A 1T8OA 1GHXH 3A85A 3UTUH 2RA3A 1ANEA 1V2KT 2F91A 1B7XB 1EZSC 2R0LA 1UCYH 4X8TH 5DG6A 4BOHA 5C1XA 1SPJA 3VGCC 1SGFA 3BG8A 1O3MA 3ZZ7A 1A2CH 5GXPA 4KGAA 3AVZA 3IWMA 3SNEA 2A7CA 4KP0A 1W14U 1AVWA 1NPMA 1TAWA 4AG1A 4YT6H 1BTZA 1T8LA 1VJ9U 1QBVH 1C2JA 2D1JA 2HGTH 2OQ5A 1V2RT 2AEIH 4GHQA 3UNQA 4AZ2B 1QRXA 3BIVH 2XCNA 5DP8A 2FYQA 3K6YA 4H6SB 2Z3CA 1FPCH 3GCTG 5L2ZH 5DJ7A 3HGNA 5PTPA 3ZVBA 4NIVA 2ZTZA 2WPHS 3A88A 1W7GH 2J9NA 2A0QB 8ESTE 4BAQB 1TWXB 2R0KA 5JB8S 1P05A 2Y5FA 2C8WB 3BTWE 1W12U 3EQ0H 1P8VC 1GGDB 3SU6A 1F0UA 2FLBH 1AE8H 1YC0A 1ZJKA 1IQJA 4JZEH 1C1TA 2R3YA 4CRGA 2ZEBA 1DUAA 1U6QA 3AAVA 3CENA 5EU8A 1AI8H 2BZ6H 1NFUA 4MLFB 3LIWA 4LXBH 2F83A 1K28D 2XC0A 3PMBB 1DWBH 1G9IE 2BD2A 2PGQB 1ELVA 1PPEE 2BXUH 5DGJA 2FMJA 3BG4B 4ABHA 1CHOG 5K0HA 2OC7A 2H5CA 3EGKH 2OCVB 1BMLA 2AGGX 4LOYH 1FY3A 1O3GA 4JZFH 2CHAB 1ZSKA 1O2OA 2OP9A 1UTJA 1O37A 3W95A 1Z1IA 2B0FA 4Y8XA 1FIZA 3RXBA 3LT3A 2ZECA 1BITA 4WF8A 3FZDA 5F8TA 2D8WA 5EW1H 1H4WA 3HK3B 5FXLA 4AFZA 1AE5A 1WQSA 4INKA 5FBIA 2HALA 3SV2H 3PYHA 5LH8A 2VGCC 4RKJB 2GDEH 3SNAA 2QF3A 4YTAA 2Y6TA 3KGPA 2XXLA 2IN2A 3KL6A 1HFDA 2V3HH 4NFFA 4UFGH 1HAVA 4ZHLU 5EOKA 1JIMA 1Z8RA 3KF2A 3DHKH 2OD3B 3STIA 2ZDVH 1O2QA 5DP7A 2R2MB 4UFEH 2ESTE 1AWFH 3SNBA 1GMCG 1AFEH 1GMDG 3PB1E 4ABBA 4D76A 2TGTA 4AB8A 5ETXA 1O32A 1S82A 3V12A 1SQOA 1ESTA 3K9XB 1O2ZA 1ANBA 1GCDA 5EQRA 3U69H 7GCHG 1SC8U 1QB6A 3UWIA 3ZZ5A 1O3FA 3FP7E 3PO1B 4NG9H 3K65B 3QTVH 3LGIA 1CT4E 3GDVA 4FU9A 1MCTA 2NU1E 1GBLA 2ALPA 3UY9A 1ORFA 3MNCA 2P95A 3SV6A 1PPCE 1YCPM 4X6MA 3VEQB 2SFAA 1HIAA 5FX5A 1LHEH 1YPLH 3KQBA 1GHWH 2J34A 1G30B 3F9GA 1TOCB 1C1UH 2QN5T 3UQVA 7ESTE 1UHBA 2WPLS 4JZ1A 1OP8A 4WVPE 2VWOA 4WXIA 4Q2KA 3RLYH 1TPPA 2BLOA 4ISNA 1KTSB 3HK6B 1CU1A 3NK8A 4ABDA 2XWBI 1ABIH 3NZIA 1FAXA 2QXIA 1ID5H 1RGQA 4H4FA 4A1XA 3SGQE 3BTGE 1MZAA 2PSXA 1G3DA 1BA8B 3P8NA 2EI6A 3SJKA 1DFPA 5DP6A 2WUCA 2VIDA 1LQEA 1G3BA 1B0EA 1SHYA 3QK1A 1P12E 1DS2E 1LCYA 2UWPA 1TRNA 1BHXB 3H7TA 1LHGH 3SU4A 1FY1A 1K2I1 3MH4A 1O5AB 3RUOA 1K1MA 3L6PA 1EB1H 3M7QA 1HIAB 2JETC 4X8VH 2G00A 4K1SA 3RXIA 2VB0A 1C5PA 2WUBA 2C8XB 1KXAA 1RIWB 3SU3A 5EODA 4J1YA 2PKSB 4Y8ZA 2C90B 1VITG 3AAUA 2ZC9H 4BTIB 1UCYK 1BRCE 1XUFA 1UHBB 2OC8A 1Q2WA 1XUIA 2ZGHA 1AZ8A 6ESTA 1SBWA 2ZWLH 1WUNH 4I8JA 2VWLA 3T5FH 2ZA5A 2ZNKH 2Z7FE 4X2XA 1ZHRA 3AW0A 1V3XA 3P17H 1P9UA 3GYMA 2P93A 4WMEA 1VGCB 1NTPA 1DOJA 1C5RA 1SG8B 2SGEE 3SO3A 5TJXA 1P2MA 3ODFA 3UR6A 2Y82A 1WTGH 2OLGA 1BTWA 1GBIA 2TRMA 4E06H 2W7SA 2AGEX 1BT7A 4ESTE 5F8XA 1UVPA 2BHGA 1A5IA 4FUIA 3UREA 1S83A 1L0ZA 3M7UA 1TOMH 3SUEA 5C3NA 4X2WA 3W94A 1IQHA 1O5DH 1NRNH 5FBEA 1FN6A 2ZP0H 1ZPZA 3VB3A 1K1IA 1OWKA 1XMNB 1OSSA 7LPRA 6LPRA 3WY8A 1DLEA 5HXFA 1ZLRA 1SFQB 5BRRE 1JRSA 4X1SU 2ZG0H 3RXKA 4VGCC 3BSQA 1C1QA 1MU8B 1SGYE 3BEIB 1CHGA 1ZOMA 1Z6EA 3A89A 1PPHE 3BTKE 1ELFA 3MTYA 1DSTA 2A4GA 1LPKB 2ZHFH 3F68H 1GI0A 2ZF0H 1JOUB 4D8NA 3FAOA 1SGEE 1EP6A 4D9RA 4X0WU 1DANH 2OINA 2IPHA 3TNSA 1GBBA 3K6ZA 2ZDLA 4GSOA 1CSOE 4NIYA 4BAKB 7KMEH 1CBWB 1C4Y2 1TMTH 4TY7A 4K2YA 1LKBA 1IQGA 3ZZDA 3QUMP 1SGQE 2BVSH 3RMNH 1BZXE 5T6DA 4UFDH 2ZU5A 3P8OA 4X6PA 1BRUP 1XX9A 2QC2A 2YOLA 1VCQA 1EOJA 2BY8X 2TPIZ 1MAYA 1T4UH 1GVLA 1CA0C 9ESTA 4KKDA 1DX5M 1W3CA 5AFZH 1EJMA 3TVJB 1C5LH 4DURA 2ZHDA 1C1OA 1CO7E 1MD8A 2A32A 8GCHF 1ZTJA 5E0GA 2BDIA 3M3VA 3GY5A 1GBDA 3VXEH 2PGBB 2HRVA 1BB0B 4FUDA 5LGOA 1GBHA 3ZYDA 2ZU1A 5LPFA 5EXMA 4X1PU 6CHAC 2QA9E 1RFNA 3SQEE 3A7YA 3VB5A 4JZIA 3GISB 1QTFA 2ZIQH 3QX5H 3ATLA 1O2JA 2ANMH 1P0SH 1XKBC 5GCHF 1YPHC 3SNDA 2I6SA 2UUYA 1Y5BT 5C2ZA 2PKAA 3ZZAA 4ZHMU 3MHWU 4OS1A 1DWCH 3TU7H 3UWJH 3PLBA 2ZU3A 1IQIA 2G5VA 2H9TH 1P02A 1NU7B 2BOKA 2TIOA 1TNKA 3CS0A 1QQUA 2XTTB 3KQCA 1THRH 4AN7A 5T3HA 3NXPA 2G8TA 1QBOA 1A5HA 3RXOA 3S9CA 5TCAA 2Z6BD 4AGKA 1ELCA 1SLXB 1THSH 1VITH 2SNVA 1X7AC 4Y71A 1GCTC 1ELGA 4YZUA 1ELTA 1QL7A 1C4V2 5ABWA 1HAPH 2YNBA 2ZPRA 2G4UA 1EPTA 3OU0A 1GWAA 4ISOA 1RTLA 1SB1H 3ZVEA 2BDAA 2J95A 1Z7KA 1UVTH 2ZHWH 4JK6A 2W7UA 3DT0H 4TPYA 1KXFA 1WBGB 1HAIH 3E0NB 3Q77A 2H5DA 5DO4H 3ATIA 3U8OH 1FXYA 1HJ8A 2VIQA 3P95A 3SV9A 1V2TT 1ZSJA 3D23A 2O8UA 1ZJDA 3ZZ4A 3I29A 2QY0B 1F7ZA 3EAJA 2F9VA 2PKAB 1O2RA 2A45B 1O36A 4IBLH 1TQ7B 3U8RH 1E34B 1DPOA 1JWTA 2F9UA 1PQ8A 3SU2A 2JKHA 3F9FA 2GD4B 2QXGA 1A3EH 2R3UA 1G3EA 3PMJA 4FXGH 1E35B 2P16A 2P94A 4I8HA 2BVRH 4ZHAA 1UK2A 2IJOB 3V0XA 1LPZB 3PM3A 1DM4B 1DWEH 1YF4A 2R2WU 3C1KA 3SQHE 1K22H 1C9TA 3CP7A 3LGVA 5FCKA 4GCHG 1SGDE 1XXFA 1KLJH 3PWBA 1TRYA 5E2PA 3LONA 1AB9B 4I8LA 3RC5A 3MNXA 3URCA 3JZ1B 1EPTB 1MMJN 1UTOA 1O5GH 1RRKA 1Y5AT 2PW8H 1UVSH 1XKAC 4WY3A 2AS9A 3M5OA 4Y8YA 2DE8A 1YPEH 2B9LA 2Z3DA 2ZHEH 3A7VA 1AN1E 4AYYB 2JH6D 1O2YA 1OYTH 1A1RA 4WJG2 4X1QU 1T31A 1NRQH 1ZTLA 2QV1A 1P9SA 1GHZA 1MTSA 2ODQA 3ELAH 1GHBF 2VNTA 1LO6A 1IAUA 1FDPA 3P8GA 1SFIA 1FI8A 3LGWA 1V6DA 4MDSA 1IQKA 1RD3B 4IGDA 4CREA 1EKBB 5JBCS 5CHAB 1G37A 1O5FH 3RXMA 4MPWA 2Z3EA 5T6GA 2FDAA 2B5TB 3TJOA 3RXLA 4X6NA 1GBMA 5DP4A 1SGPE 4HI3A 1QHRB 5FHTA 2ZGCA 3C27B 4CHAC 1LMWB 2Y80A 1O39A 2TBSA 1N1LA 1C1NA 1V2VT 1SQTA 2Y7ZA 1IHSH 1THPB 1CE5A 2CMYA 1HAZB 3A80A 3RU4T 1QJ6B 1FQ3A 2V35A 1QIXB 3P8FA 4K69A 3A81A 3PTBA