4KTSA

Bovine trypsin in complex with microviridin j at ph 8.5
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Harnessing the evolvability of tricyclic microviridins to dissect protease-inhibitor interactions.
pubmed doi rcsb
source organism Microcystis aeruginosa mrc
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktsA02
1ANEA 4GAWA 2BDAA 3GY2A 1MU6B 4CH2B 3RU4D 1SQOA 2ZGBH 1O5CB 4QT8C 4WWYA 4A5TS 5E0JA 1IHTH 1NESE 4HZHA 5J4QA 5T3HA 4JYTA 1THSH 3BEUA 1QBNA 4K5ZA 5JPMH 2J38A 3ODFA 1DPOA 5FBIA 1TGTA 3QWCH 1YPHC 1BUIA 2BY5X 2QY0B 1TRYA 3T29A 1C5XB 1P12E 3PB1E 3LJJA 4Z6AH 1AMHA 4CHAC 4R8TB 3RXCA 2ANWA 4DGJA 2GTBA 4Y71A 2Z94A 1TRNA 3VFEA 1O34A 3MHWU 8GCHG 3V0XA 3U1JB 4Y6DA 2QYIA 3RXHA 1XUHA 4WJG2 1UVUH 1Y59T 5GCHF 4NWLA 1C9TA 1KXAA 5DP7A 1FN8A 1LQDB 1TAWA 5FAHA 1H4WA 3QGJA 1AE5A 3A7VA 4TPYA 4SGBE 1DY9A 1TGBA 3ZZCA 1ZZZA 3HGPA 1TMBH 2CV3A 3M61U 2ZA5A 1O2MA 2C8XB 1CA0B 4ISLA 2RA0A 1DX5M 1BRAA 1PPCE 2TGPZ 4Q7XA 1UHBB 1A3BH 2ASUB 5E0HA 3RXVA 4I8GA 3RXTA 2QN5T 1O2HA 3FP6E 1GGDC 2BD8A 1TRMA 2GX4A 3K6ZA 1HRTH 4DVAU 3QTOH 1S0QA 1KDQB 5LPEA 1GHBG 3SV6A 1P2NA 2BQ6B 4ZROA 4D76A 2BDCA 3M7TA 1CGHA 1TQ7B 3BN9A 3MOCA 1EPTA 2BY6X 4KP0A 1MTWA 1EKBB 1OPHB 3LPRA 1SGFA 2VWLA 4JMYA 1YCPM 1NFWA 3VB4A 2A4QA 3TK6A 1LPZB 1AFQC 2R3UA 1O2SA 4MPUA 1H9HE 2WV4A 1DWEH 1HAVA 2EA3A 1ZR0A 2XTTB 1EB2A 2HGTH 2FI5E 1JWTA 2BOHB 2XYAA 2BX3A 1SFQB 2FI3E 3SNDA 4DW2U 2O9QA 1GBEA 1FUJA 3DT0H 4JZIA 1C1WH 1OYTH 4XDEA 3RM2H 3RXJA 1DS2E 3PLBA 3MH5A 5I25A 4Q7YA 1P2MA 4Q7ZA 1RGQA 1RS0A 2CF9H 1GI1A 1O2LA 4FU7A 2G00A 4VGCB 1FAKH 2VVCA 4FXGH 4E7RG 3GCOA 3BTTE 1SGPE 1KXDA 1N8OB 1QCPA 1T8NA 1WOFA 2F9VA 1GJ7B 5F8XA 4OGXA 1ABJH 1V3XA 1OWHA 3GDVA 2FOAA 2FM2A 2ZF0H 1A5IA 1ETRH 4AX9H 2FOHA 1NT1A 4IMZA 4O9VA 5C1UA 4AGKA 2NU1E 1O3PB 1YLDA 2HALA 2H1UA 1VJAU 1GHAF 3ENSB 3LGUA 3H7TA 3PMJA 1SGTA 1ELFA 1RRKA 3BIUH 3A7WA 1W11U 2B7DH 1PQ5A 2C93B 2F9UA 1SGDE 2OLGA 1V2ST 5H4IB 5F8TA 2M5TA 3SU5A 3UPEA 5A0CA 1EZXC 3M7QA 1A5HA 2C3SA 1XUJA 1LHGH 5K7RA 4DCDA 2IOTA 4K1SA 1AWHB 1HDTH 3UQOA 2BB4A 2F9OA 3M5LA 1O3DA 3E1XB 1T8LA 1O5GH 3MU0A 3C1KA 4GUXA 3S7HB 1BITA 3QGNB 1AVGH 1MBMA 1HJAB 3EAJA 1YC0A 3ZZ7A 1GBHA 3SU2A 1MKWK 4IC6A 1TNIA 1OWJA 2FYQA 1CVWH 2BD5A 3F9FA 4CRGA 2Y5GA 2ODQA 3SU1A 2H5CA 1F5LA 1GMCG 5C1YA 1D4PB 4AFSA 2ZI2H 1DLEA 4J1YA 2ZCKP 1CT2E 2F83A 1NRNH 5TJXA 4ZKRU 1QNJA 1FJSA 4BXSA 4CRDA 1D3TB 4UEHH 4OGYA 3OX7U 5DP9A 3SV2H 3N7OA 1UO6A 3M7UA 2A4OA 2P59A 2GCTC 2B5TB 2QF0A 1CQQA 1L2EA 1LPKB 3QZQA 1OWKA 1SGRE 5EGMA 4H4FA 1V2PT 4NIVA 1VGCC 3P17H 3HKJB 3CS0A 5LPRA 1YPMH 3R3GB 1QJ1B 3P8FA 4JZFH 4MLFB 4WF8A 4I32A 4YO9A 1AD8H 2O8MA 3ZVDA 4AFUA 2QC2A 3SV9A 1FY4A 5FCKA 4O3UA 5CHAB 1QBVH 2BM2A 1CGJE 1XX9A 2ZHWH 3P70B 4UFDH 1HAYB 1LVYA 4D9RA 5GJ4B 3B8JA 2EI7A 3MH7A 1EB1H 3SNBA 3ZYEA 2ZC9H 1UVOA 1W3CA 2C90B 3JZ2B 3LU9B 3ZZ3A 1Z8RA 1Y5UT 5EQQA 4CH8B 1ABIH 3V12A 4YOJA 4X6OA 1O5BB 1V2RT 3S9CA 1XMNB 2FODA 1JIRA 1UTNA 1TMTH 5T6DA 1QRXA 1PPHE 3ZZ9A 1GG6B 4Y8ZA 2PKSC 5AHGH 2OC7A 3ODDA 4BAHB 1GMHF 5GCHG 4A1TA 1MTUA 1O2TA 1ZMNA 1KY9A 3A82A 4Y10E 9ESTA 3TJOA 3Q00A 5K0HA 1K1OA 1SHHB 2FIRH 2H6MA 4WMDA 1SR5C 4MG3A 4O97A 1V2KT 1A2CH 5JBTA 1GL0E 3OY5U 3GY6A 1BMMH 5AVDA 5FPTA 6CHAB 3QLPH 2SFAA 1K28D 1EUFA 1CHOF 1RXPA 3SQEE 1S6HA 1XKAC 3UR6A 3M36A 1SB1H 1KXCA 3A8CA 4X8SH 1H8DH 1HPGA 2ZIQH 3ESTA 1AZ8A 5AF9H 3GCHC 4Y76A 1MZDA 1O38A 1V2JT 3LH1A 2QXIA 1IQFA 1ZTJA 4GLYA 1BRBE 4INLA 1SLUB 4YLUA 5JBBS 4ZHMU 4ABFA 4B71A 1GCDA 3M3SA 1DLKB 2FOFA 3TPIZ 4BTIB 1P2IA 3LGYA 1M9UA 3GICB 3ZZBA 2Z7FE 2B8OH 4MVNA 3HK3B 3ZVCA 1Z8IB 2Q6FA 3GY4A 2FTMA 2GV6A 2BZ6H 1NPMA 1EASA 1Z8JB 3L3TA 1O2GH 3TGIE 3BV9B 4X1RU 2FESH 1TNKA 2PR3A 3KHVA 1VJ9U 1O3JA 3SUFA 1XKBC 3KQDA 2RCEA 2VH6A 4DG4A 1YCPH 1C2LA 3FFGA 2PWXA 1C5WB 1PFXC 3RXDA 2QV1A 4OS1A 4FUCA 4WXVA 1D6WA 1W14U 1X7AC 1NN6A 2FOCA 2O8UA 2ZCHP 4Q2KA 1F5RA 1A61H 1GI9B 1EZQA 2XBXA 2ZHDA 1LKBA 4U01A 2WUCA 1V2MT 1ZSKA 6ESTA 3RXIA 3TK5A 1ZMLA 2GVFA 3VB6A 3QUMP 3F9HA 3SU4A 4OS5A 1NFYA 5FX5A 4FUDA 1SGEE 3PWCA 1SC8U 1V2WT 3PTNA 3A89A 3SU6A 1C5LH 3FP7E 1UTJA 3PMAB 1UVTH 1IQIA 1V2QT 2XWBI 3E8LA 4TY6A 1IQGA 3RXFA 2ZPSA 1GHAG 1TOMH 1UHBA 2WINI 1ELCA 1RIWC 4X2WA 4YM9A 1O2RA 5C20A 5EPYA 1F0TA 2W7UA 2OC8A 1P03A 3ZV9A 2VWMA 1TPAE 5FX6A 2ZTZA 1KDQA 1S81A 2B0FA 2CXVA 1ELVA 4D7GA 3NPSA 1HLTH 3EYDA 5ABWA 3TH4H 1RJXB 1G36A 2GZ8A 1TX7A 3E0PB 1O2ZA 1P8VC 4IMQA 3I77A 1W10U 4AFQA 1LKAA 2AS9A 3P6ZB 3HPTB 1HXEH 1FNIA 1W13U 2A5KA 3RXLA 2ZTYA 4JK6A 2BDIA 1PPEE 1KTTB 2GP9B 4MTBA 1THRH 2ZQ2A 1FDPA 4NIWA 1J14A 5JDUB 5E2OA 2BVSH 1C1NA 3UFAA 5JB8S 1VITH 3URCA 2A7JA 1PQ8A 2SGAA 2HPPH 3QX5H 1V2NT 5FBEA 1SHYA 4I8LA 1UVSH 2JH6D 2R9PA 2ZCLP 3RP2A 3RXAA 1E35B 1ELTA 5JBAS 1DUEA 1ZPCA 3LKWA 2V3OH 4TY7A 4A92A 3O8CA 2Z3CA 3KN2A 2D8WA 1ZYOA 2ZDLA 1OWIA 1OXGA 2G52A 1MH0A 3R0FA 3SNEA 1IQEA 3U8OH 4AG1A 1B0EA 1GI4A 3NKKA 1KLTA 3MNCA 4ZKNU 2BVRH 1WTHD 2PTNA 3UOPA 3SJOA 2GCHF 2JETC 1T32A 3RXPA 3M3VA 4WH6A 3PYHA 2QXJA 1OSSA 1ZJDA 4I31A 1VR1H 3MNSA 4KTCA 3IITA 6LPRA 3TIUA 2WUBA 2WPIS 1G9IE 5FPYA 3SNAA 2W7SA 1A4WH 2GZ9A 1A0LA 1UK3A 4X2VA 4ISIH 1NY22 3MO6A 1IQJA 5FCRA 2XRCA 2ZFTA 2Z6BD 3H5CB 1LVOA 4ZXYH 2VIDA 4E06H 4O3TA 1GMDF 3SQHE 4CHAB 1KYNA 4I8HA 3U98H 1Y3XA 1FQ3A 2QXGA 1QRWA 1GMHG 1DUAA 1NRSH 1UK2A 3QDZB 4WMEA 1BQYA 4BAQB 1QA7A 1LHCH 1TB6H 3T62A 1NTPA 2ODYB 2G51A 1OP8A 3A85A 1TPOA 4B75A 4D7FA 1P05A 2ZO3H 5L6NH 3MTYA 1P2KA 4SGAE 1DY8A 1QBOA 2PSXA 3LGIA 1ESBA 1CHOG 4FUBA 2EI6A 3A88A 2Z3EA 4BANB 1K1IA 3A7XA 3ITIA 1SMFE 1Y8TA 4B73A 1YKTA 1XUIA 1FXYA 3QN7A 2RG3A 1TE0A 2VINA 1ZHRA 1EX3A 1C1VH 1G30B 1GGDB 4X8UH 2O8TA 1FZZA 1GHWH 1O3GA 1IQKA 1KXBA 2PUQH 3VB5A 1HXFH 5L2YH 1GHXH 4X1PU 3BTQE 2ALPA 3LT3A 3RU4E 2WPKS 3TGJE 3EA9A 3PLKA 2BXUH 4FU9A 4AN7A 2ANKH 1ZGVA 1FY8E 2A4RA 1MAYA 1W0ZU 2A7HA 1MQ6A 5EXLA 2VGCC 4CREA 2BOKA 1AFQB 1B0FA 2Y7ZA 4BTUB 1BMNH 5TCCA 3IG6B 3UY9A 2WYGA 2VB0A 3SV8A 3AW0A 2CF8H 2VNTA 1QY6A 3ZZ5A 4BAOB 4FUFA 2JH0D 1GBBA 1C5ZB 1C2FA 2AGIX 3M37A 1WAYB 2JH5D 1HCGA 1C9PA 1P2QA 1SLXB 1XUKA 2A4GA 1H9IE 3RC6A 5T6GA 2VIVA 2ULLA 1G3CA 3RXSA 2ZEBA 4YT6H 1E36B 5HM9A 1O3EA 2P3TB 3KF2A 2PGQB 1GI6A 4TYDA 2IPHA 1BTUA 1DSTA 3F9GA 3MFJA 1ZMJA 1L1JA 1WUNH 1ETTH 4FUEA 2I6SA 5EW1H 2Y7XA 1EZSC 3BF6H 1TLDA 1O30A 1NRRH 1W8BH 4I8JA 1JXPA 2AEIH 1O3LA 1NZQH 3F9EA 5AFYH 1DT2A 3JZ1B 1BTWA 2BQ7B 1UTMA 1O2KA 1Y3WA 1Z8GA 3HATH 2FLRH 4K1TA 1E38B 1LMWB 2YNAA 1O5AB 1QB9A 2BX4A 2CHAC 2P94A 1NFUA 2DUCA 2HVXA 1OYQA 1Z71A 1EP5A 1THPB 6GCHF 2UUYA 3AAUA 3Q3KA 3SJIA 1PYTD 2BDHA 3BTKE 1JIMA 1J9CH 2BY9X 1OP0A 4NIXA 2UWLA 4B76A 1O2QA 2OBQA 1O2JA 2UUKB 2QCYA 1BTZA 1MBQA 1SOTA 2H9TH 1CT0E 2FS9A 4CR5A 3KEEA 4IBLH 5LPFA 5E2PA 3DA9B 1MD8A 4U2WA 4R0IA 1JRSA 2BMGB 1BRUP 1N6YA 1AB9C 1P9UA 4X6PA 4CRAA 1HFDA 1O3MA 1MKWH 3SV7A 1L1GA 5EQSA 3ZVGA 4UFGH 4YTAA 3K6YA 1TMUH 1DFPA 2GMTC 2ZDMA 2LPRA 4FUGA 2ZGHA 1SGCA 1Y5AT 1QTFA 4MNWA 2V6NA 3VXFH 1LTOA 1GBAA 5GIBA 1TBQH 3SJ9A 3AW1A 1K1NA 3S9BA 5T6FA 2HWLB 1GJ8B 2G5NA 3RXBA 2GCTB 5B6OA 3AASA 1VZQH 1AU8A 2ZNKH 5HMAA 1VGCB 2BVXH 5HYOA 4GHTA 4Y7BA 5LGOA 1NRQH 3MO9A 4DY7B 1BOQA 1DWBH 4MNVA 2GCHG 3NXPA 2C4FH 1AHTH 1LVMA 4X2YA 3UWJH 1EAWA 3F68H 1D3PB 1S6FA 1DWCH 2FTLE 1IHSH 1V2TT 1UVPA 3EGKH 3LC3A 1Z6JH 3ZZAA 2ZFRH 1ZPZA 1BJVA 2CGAA 3UNRA 2FS8A 2Z9LA 2VWOA 1NU9A 1A5GH 1IOEA 3LDXH 2BDYA 5EU8A 2H9EH 3OTJE 1C4V2 1F92A 1FIWA 9LPRA 1GMDG 2OD3B 2WV5A 4GPGA 1WSSH 1W7GH 2AIPA 3URDA 2QGRA 1NROH 2C8ZB 4J2YB 2GV7A 2QIQA 3T2NA 1FY3A 2PKSB 3H7OA 2SNVA 1FLEE 4GHQA 2W26A 4AORA 2VU8E 1BBRE 1O36A 1OP2A 1ZHPA 1SLWB 2FDAA 1KTSB 3FP8E 2O8LA 4ISNA 1VITF 1WYKA 3M5MA 2ZWLH 3P8GA 2STBE 3SJKA 1A46H 3E6PH 2GDDA 4LOYH 2OQUA 1TWXB 3RLWH 4UFEH 2OBOA 3NK8A 1G2LA 1TNJA 5DKMA 2GKVE 3A87A 1D9IA 4ZKSU 1IAUA 1L4ZA 4LZ1H 5C1XA 3OY6U 3SO3A 3UOUA 3LJOA 2BD2A 1DOJA 1C5TA 2D26C 2XCNA 1ZHMA 1ZOMA 3GCHB 1NC6A 5BPEA 5EPNA 4NA8A 4MNXA 3SI3H 4ISHH 1FY5A 5DO4H 1W2KH 1J8AA 2AMDA 1ELAA 4NFFA 1EP6A 2ZFQH 5A09A 3ZZ4A 1LHFH 2WPJS 4ABAA 1FN6A 3A7YA 1AE8H 2XBYA 4XSKU 1MAXA 2Y80A 5L30H 2BD4A 5A8XA 2XW9A 3RXMA 5IYTA 3EE0B 3MU1A 1GVZA 3PO1C 3BG4B 4H6TA 3A7ZA 3VB7A 1SI5H 3UREA 4B2BA 1P2JA 3SW2B 1XUGA 2TRMA 2Y6TA 1CA8B 2LNCA 1P04A 1XXDA 1CSOE 1RTFB 1BRCE 4JCNA 3MYWA 1O3KA 1DITH 1MTNC 3GISB 4ASHA 3MU8A 3P8NA 3ZVAA 2Y82A 2SGEE 2XWAA 1EAIA 1GVLA 2TGDA 4NA7A 1GCTC 1GJDB 2AMPA 1BTYA 2JKHA 4CBNA 1O5FH 3A8BA 3FANA 4PROA 3A81A 1PQ7A 1MCVA 2P8OC 1TBZH 3EA8A 1TA6A 1DSUA 1C5QA 1O0DH 4INKA 3FAOA 3RMNH 2QA9E 1C2IA 1CBWC 1XVMA 3DD2H 3PM3A 3UNSA 3SGQE 1RIWB 5F8ZA 1A0HB 1FV9A 2GD4B 3T28A 1NRPH 1O39A 2HRVA 4O03A 4NIYA 4UD9H 1HAOH 3SNCA 4DT7B 1TX8A 1P3CA 1ELEE 3F6UH 4BOHA 3LONA 1O2XA 3VEQB 2K1QA 6GCHG 1TNLA 2BDGA 3PV4A 4Y11E 1C2HA 2EC9H 3ZVFA 4X2XA 4Y7AA 1KXEA 3GOVB 1BDAA 1P10A 5PTPA 4CBOA 3GY5A 1QHRB 1MKXH 1K2I1 4YOGA 4HTCH 3M5OA 2AMQA 3MMGA 1EXFA 7GCHF 2ZECA 2A1DB 2R3YA 1GDNA 4A7IB 1F0RA 4FUIA 2FMJA 1BTPA 2XC4A 3A8DA 4NZQA 4FUHA 2J2UA 1UTOA 4RKJB 5JYIA 2Z9GA 2A2XH 2CJIA 5ESBA 5DP5A 4ESTE 3UTUH 4TPIZ 4ABDA 4YZUA 5DJ7A 5C5NA 5FXLA 5E8EH 4KKDA 3RDZA 3CENA 1S83A 4UE7H 1UTLM 1YGCH 5J4SA 5G4BA 2A5AA 1IQMA 1ZTLA 2A7CA 3PLPA 1TALA 1Z7KA 4X1SU 1C4U2 4ZUHA 3K2UA 5JB9S 2ILNA 1RD3B 1BTXA 3KNXA 1FI8A 4XOJA 2AFQB 2VH0A 2F91A 1GI5A 1UCYE 3MWIU 1E0FD 2XNIA 4ZAEA 4GVUA 4X6MA 3TITA 2JETB 2Y5HA 3U8TH 3GY7A 5EODA 3LGVA 2FYRA 1QGFA 1WTGH 1QFKH 1IQNA 4ABJA 4MDSA 1HAPH 8KME2 2BY8X 1G3DA 4ISOA 1C2KA 3SN8A 1QA0A 1C5VA 3EQ0H 1NS3A 1BTHH 1JRTA 1P11E 4NA9H 4U30A 1VCWA 4ABHA 1P3EA 1Q2WA 2ZGXH 3A8AA 3RC4A 3E3TA 1EJNA 1OX1A 1HAIH 1MKXK 2UWOA 5EXMA 3T26A 4CRFA 2OCVB 2A0QB 1BBRK 1EATA 5SGAE 2P16A 3ATKA 1EPTC 2H2ZA 2A32A 2Z9IA 1KSNA 4K1EA 1XUFA 4IN1A 5DP4A 1VITG 1WV7H 1SSXA 2ESTE 4THNH 1K1MA 2AIQA 1E34B 2BLQA 3SORA 1TNGA 4BAKB 2AGEX 1GI2A 4M7GA 2OQ5A 3NCLA 3V7TA 2YNBA 2P93A 3STJA 4ZMAH 1GWAA 4LZ4B 1RTKA 1GDQA 1HAXB 1EQ9A 4DIHH 2J94A 2Z9KA 4LXBH 1B7XB 2NU4E 1GBMA 1TPPA 3K9XB 1W7XH 5DP3A 3I78A 1ANCA 1K9OE 3M5NA 3D62A 2XC5A 3TJNA 2RA3A 1AZZA 1GJ4H 2DE9A 4CRCA 1LCYA 1PJPA 2GZ7A 4FVDA 3TK9A 1O31A 2NU0E 2QXHA 4JYVH 4ABGA 2VGCB 5GXPA 1Y5BT 2PGBB 1L1NA 2XXLA 1TOCB 3ATMA 2FWWA 4TWYA 1O2UA 4UFFH 3ZV8A 5BRRE 1AUJA 2VJ1A 1TX6A 2GT8A 3RU4T 1N1LA 1INCA 3HGNA 1HV7A 4K60A 1W0YH 1V2LT 2ZU1A 1IQLA 1C1RA 4JK5A 5CMXH 3UR9A 4HGCA 4UONA 1HAZB 1QIXB 2ALVA 3SUGA 3WY8A 1Q3XA 1SPJA 5HGGA 1H9LB 3S0NA 1NM6A 3RC5A 1A0JA 2Z9JA 1Z1IA 1O2IA 1SGIB 3RXKA 2F9NA 2G4TA 2OXSA 3W94A 4AB9A 1XM1A 1QQUA 4JYUH 1WQSA 1LVBA 5A0AE 2XCFA 3SBKA 3W95A 4NCYA 1C2GA 1GL1A 4X8TH 4Z0KA 2BD7A 1K21H 1ZTKA 3UNQA 5EQRA 1HB0B 1UCYH 2BLVA 5E0GA 1FY1A 2FEQH 2HNTE 2W5EA 4RN6A 1O3HA 1GHVH 2ZHQH 1RFNA 3SU3A 1O37A 5JBCS 1YPEH 3GCTF 3BTGE 4IN2A 1OOKB 2HLCA 1P01A 1HBTH 1HJ9A 1KXFA 1GJCB 1KIGH 4DURA 1U6QA 1GBIA 2FP7B 2FI4E 1LO6A 3TGKE 3VGCC 4B2CA 1S85A 2P3FH 1EOLA 3RMLH 1O2OA 2ZHEH 1ELDE 1O3AA 2NU3E 4ZKOU 4JZ1A 3TH2H 1BZXE 2Q6DA 2XBVA 1XXFA 4BAMB 2BQWB 4XBDA 2KAIB 1C5UA 4KTUA 3SGBE 5CE1A 4YLQH 7GCHG 4K3JA 1DVAH 1AFEH 3SGAE 3SHCH 1ETSH 1SL3A 1T7CA 2OC0A 4Q80A 3ATIA 1AB9B 1T8MA 2OINA 1ZGIA 4NSVA 1O3IA 3SUEA 2FOBA 3FVFB 4DIIH 3LH3A 1A1RA 2ZZUH 3BTDE 2J4IA 2F9PA 1QL8A 1UTKA 2GMTB 3VXEH 4MPVA 4X8VH 4XBCA 5ETXA 3MU5A 1O3CA 1GDUA 1WQVH 2CN0H 3OU0A 1ELGA 4MPWA 5EXNA 3HK6B 2GGVB 1DXWA 3L33A 4NG9H 1QR3E 1WBGB 2ZU3A 2VIQA 4YESB 7ESTE 1DWDH 1UCYK 1K1PA 1FAXA 3QTVH 5HXFA 5FPSA 3MU4A 4BXWA 1AUTC 1DXPA 2Q6GA 2OUAA 4NSYA 2PTCE 4GCHF 3V13A 4JZDH 2SGQE 4KELA 1GBCA 4YT7H 2BD3A 3NZIA 3D49H 2VIWA 1A3EH 2XC0A 5C67A 2PV9B 1K1JA 1WU1A 1DM4B 2ZDAH 1C2MA 2PKAB 3Q76A 1JMOH 2GDEH 1XVOA 1EOJA 2STAE 4D8NA 1G3BA 4Y0YE 4AGJA 1A7SA 1P9SA 1ZPBA 2FPZA 3NUMA 1HAGE 1YYY1 3IWMA 1GBLA 1T8OA 2WPLS 1QL9A 1Q31A 3CP7A 2NWNA 2EEKA 1FPCH 1BMAA 3DFJA 3MO3A 5DGJA 1C1UH 3GDSA 2UUJB 3UQVA 2DE8A 1GHYH 3S9AA 3BG8A 2H5DA 3U69H 1C1MA 5TCAA 3A7TA 3RM0H 1UTQA 1NFXA 2UUFB 1BCUH 1BHXF 1C1PA 4NFEA 4X6NA 4X1NU 2BXTH 2IN2A 3RUOA 4AYVB 1D3DB 2H9HA 1MUEB 1LHEH 1C2EA 3E0NB 1F0SA 1OWEA 1GJ9B 2ZPQA 1O3NA 3E90B 2ZTXA 1NU7B 1VCPA 3PWBA 3UIRA 1AQ7A 4ZXXH 2ZQ1A 1TIOA 2PW8H 3FZZA 2ZDVH 3RMMH 1HAHH 1GPZA 1C5MD 1GJBB 5EW2H 2V0BA 4A6LA 3CS7A 8ESTE 2AH4X 4D9QA 1W12U 2PLXA 3A83A 3BEIB 2VVUA 4AZ2B 1BT7A 2V35A 3GCNA 1GBTA 4AB8A 5DP8A 4BNRA 2ZHFH 1CA0C 1HIAB 4FUJA 1O5DH 1HJ8A 3NWUA 3RXRA 2ANYA 1LPGB 1PPBH 2SGDE 3PO1B 4ZH8A 1ZJKA 2BY7X 3SI4H 2AYWA 4WVPE 4ABBA 3BSQA 3TH3H 1TGSZ 8LPRA 3GDUA 5A2MH 1F0UA 1DDJA 1C5YB 2J95A 4X1QU 1BB0B 2FX4A 1MTNB 1O2WA 1PQAA 2SGPE 1D6RA 2WYJA 3S69A 1ESAA 1JOUB 1ZSJA 2BDBA 1G2MA 2G5VA 3QO6A 3O8BA 1TBRH 1GCTB 5DPAA 5DP6A 3KGPA 2D2DA 2D1JA 4I7YH 4E7NA 1ANBA 2P8OB 4DOQA 1ZLRA 1TQ0B 1E37B 1YPLH 7LPRA 3GCTG 1GI8B 1LQEA 4XBBA 2OP9A 3BTEE 1CBWB 1C2DA 4IC5A 1V2VT 1AKSB 1V2UT 4H42U 2P95A 3TJVA 1ARBA 1GJ5H 1S84A 4VGCC 1TNHA 1CE5A 2BHGA 2PSYA 2G8TA 4XE4A 7KMEH 2R0KA 1SG8B 3GYLB 1Y3UA 2SNWA 5F6MA 1N8OC 4GSOA 4IS5A 3QZRA 2HNTC 2R0LA 1O33A 4KGAA 3MH4A 2VWNA 1C2JA 2G81E 1P0SH 4JZEH 3ZVBA 1G32B 1ZRKA 1P02A 1ESTA 3PTBA 5F03A 2IJOB 2VIPA 1AVXA 1Z6EA 1AIXH 3HKIB 5DK1A 2VIOA 2ZP0H 1EJMA 4CR9A 1KLJH 3SUDA 1TA2A 1AI8H 3DUXH 2TPIZ 1TFXA 2TGTA 1HNEE 4AG2A 1S5SA 1GJAB 1O2VA 1WCZA 4XFQA 2FOEA 1OS8A 4WMFA 1K1LA 4Y8XA 4ZHAA 1YPKH 2W3IA 2ANMH 1TGNA 5C3NA 2V3HH 1HYLA 2A5IA 1FONA 3RXUA 3TU7H 3M3TA 4Y0ZE 3KCGH 2ZGCA 2FOGA 3E91A 4ABEA 3ATWA 3U9AH 1ARCA 1MD7A 1D3QB 1QJ7B 3Q77A 1J15A 4FU8A 1SLVB 3A86A 3RXQA 1O2PA 1AWFH 2PUXB 1HJAC 4I33A 3T25A 3RXOA 2ZU5A 5A0BA 1TYNA 1GVKB 3TLOA 1SGFG 1BIOA 4GCHG 5C2ZA 3SZNA 1GI0A 4AYYB 3AVZA 1S82A 1ID5H 4ZHLU 1CGIE 1H1BA 1PPZA 4KTSA 3SOSA 3QK1A 1AO5A 3M35A 5GDSH 4INHA 1C4Y2 1CHGA 1ZRBA 2BD9A 3F1SB 1QB1A 1PPFE 1SQAA 2ZDKA 1CT4E 1NO9H 3LGWA 4RKOB 5A8ZA 2YOLA 1J17T 1O3FA 2C8WB 2KAIA 3RLYH 1P57B 1QURH 1BBRH 1B5GH 1YPHE 2A31A 1EPTB 4ABIA 2TIOA 1O3BA 1YP9A 1T4UH 4YOIA 4NWKA 2BZAA 2HOBA 4OS2A 2P3UB 3AAVA 4MQAA 4NZLA 1C5NH 3D23A 1YPJH 3PROA 1C1SA 2QAAA 5CHAC 3RXGA 3S7KB 3B9FH 1HAVB 1PYTC 3MNXA 1GI7B 4AOQA 4CRBA 1F5KU 1RTLA 1G3EA 3ZVEA 1Y3VA 1OKXA 1PPGE 3STIA 3C27B 3K65B 4HI3A 3BG4C 1P09A 1ELBA 1SBWA 4IGDA 1SOZA 1AN1E 1O3OA 1V6DA 3Q3XA 5IDKA 2VVVA 2PFEA 3SJ8A 3OYPA 5EOKA 5AFZH 4WH8A 2CMYA 1SQTA 1GG6C 2TGAA 2G55A 2PHBA 2J92A 3ZZ6A 4OS7A 8GCHF 1EZUC 1GBKA 3SU0A 1ANDA 4U32A 3ZZ8A 4A1XA 1P06A 3KQCA 3E16B 4B1TA 2A2QH 3BTME 2WPHS 1GJ6A 1YPGH 5FHTA 3VB3A 3LC5A 2ZPRA 4E05H 1BHXB 4K8BA 3ZZDA 5DG6A 3T5FH 2RDLA 1J16A 6CHAC 2R2WU 4MNYA 2GT7A 1C5OH 1S0RA 3PMHB 1ZSLA 4K69A 3BIVH 1OWDA 1YF4A 1YM0A 3TVJB 1QL7A 1IQHA 1FMGA 1MTSA 3TNTA 4OS4A 5HM2A 1L4DA 2ZDNA 4BTTB 2PKAA 5LH8A 5C5OA 1QB6A 1MMJN 2WPMS 1GBFA 1N6XA 3BTWE 1GHZA 1UJ1A 1BMLA 1MZAA 2ZFSA 3EA7A 1GHBF 2SGFE 3T27A 1AGJA 1JBUH 2ZG0H 1TABE 1YLCA 2ZFFH 1DICA 3MI4A 1C1TA 1QJ6B 2HNTF 1O35A 4UDWH 2ZKSA 1T4VH 3V3MA 4K8YA 2BLWA 2TBSA 3D65E 3GY8A 2I6QA 1C1OA 1O2YA 1HGTH 3LIWA 2UWPA 2B9LA 3RXEA 4MPXA 1H8IH 1C1QA 2ZGJA 3GY3A 4I8KA 3PMBB 3BTFE 1C5PA 1EAUA 2NU2E 1BJUA 1BA8B 3P95A 3KIDU 1YCPK 3LGTA 4DJZB 1KLIH 1LHDH 2FZZA 4Y8YA 4F4OC 2AGGX 1LDTT 2W3KA 2ZU2A 2Y5FA 3VPKA 2ZFPH 3ELAH 4OS6A 1SFIA 3KQBA 2HPQH 3BEFB 3MH6A 3Q3YA 3VGCB 1Y3YA 1FIZA 4X0WU 2FX6A 3KL6A 2J9NA 3TNSA 2FLBH 1HUTH 1F7ZA 4B2AA 3U1IB 1ACBE 2F9BH 1K22H 1YBWA 2Z3DA 2OTVA 3G01A 1SVPA 1MCTA 3P8OA 3FZDA 2OC1A 1VCQA 1HIAA 2Y81A 2A45B 3TJUA 3I29A 4RSPA 1O5EH 3A84A 2THFB 3UUZA 1C5SA 1EAXA 5I46H 2FXRA 1FPHH 1AY6H 1ORFA 2C8YB 3ZYDA 2FOMB 4LK4A 3L6PA 4A1VA 2F3CE 3EDXB 3O8DA 3SHAH 1T31A 3GYMA 2J34A 5GWZA 4B74A 3O8RA 1L0ZA 1C5RA 1P2OA 2BLOA 2XBWA 3KQEA 4WXIA 3UWIA 4Y79A 3LOXA 1UMAH 5L2ZH 1GI3A 3B23B 4K2YA 2O8WA 3A80A 5EG4A 3U8RH 2EI8A 3P92A 2BYAX 1MQ5A 3MNBA 3DFLA 3OSYA 1AVWA 1TGCA 2ODPA 4TWWA 1AKSA 1CU1A 1QRZA 1QQ4A 1V2OT 2ZU4A 1TONA 5ESTE 3BTHE 1Z1JA 1MU8B 1G37A 1O2NA 1GBJA 1O32A 1GMCF 4H6SB 3RMOH 1F2SE 3ATLA 4NGAH 3DHKH 5GPIB 4FVBA 2FO9A 2CHAB 2R2MB 2AERH 4F49A 4HFPB 4AFZA 1GBDA 1TPSA 1SGYE 1UTPA 2BTCE 2QF3A 1UK4A 1SGNE 4IW4E 1DANH 4WY3A 1CO7E 5A8YA 1EJAA 1DE7H 2G4UA 1SGQE 1MTVA 2Q1JA
chains in the Genus database with same CATH superfamily
1ANEA 4GAWA 2BDAA 3GY2A 1MU6B 3OEHD 4CH2B 3RU4D 1SQOA 2ZGBH 1O5CB 4QT8C 3KQ5A 2EY4C 4WWYA 4A5TS 5E0JA 1IHTH 1NESE 4HZHA 5J4QA 5T3HA 4JYTA 1THSH 2JJ2D 3BEUA 1QBNA 4K5ZA 5JPMH 2J38A 3ODFA 1DPOA 5FBIA 1TGTA 3QWCH 1YPHC 1BUIA 2BY5X 2QY0B 1TRYA 3T29A 1C5XB 1P12E 3PB1E 3LJJA 4Z6AH 1AMHA 4CHAC 4R8TB 3RXCA 2ANWA 4DGJA 2GTBA 4Y71A 2Z94A 1TRNA 3VFEA 1O34A 3MHWU 8GCHG 3V0XA 3U1JB 4Y6DA 2QYIA 3RXHA 1XUHA 4WJG2 1UVUH 1Y59T 5GCHF 4NWLA 1C9TA 1KXAA 5DP7A 1FN8A 1LQDB 1TAWA 5FAHA 1H4WA 3QGJA 1AE5A 3A7VA 4TPYA 4SGBE 1DY9A 1TGBA 3ZZCA 1ZZZA 3HGPA 1TMBH 2CV3A 3M61U 2ZA5A 1O2MA 2C8XB 1CA0B 4ISLA 2RA0A 1DX5M 1BRAA 1PPCE 2TGPZ 4Q7XA 1UHBB 1A3BH 2ASUB 5E0HA 3RXVA 3N99A 4I8GA 3RXTA 2QN5T 1O2HA 3FP6E 1GGDC 2BD8A 1TRMA 2GX4A 4OM9A 3K6ZA 1HRTH 4DVAU 3QTOH 1S0QA 1KDQB 5LPEA 1GHBG 3SV6A 1P2NA 2BQ6B 3W1EA 4ZROA 4D76A 5CDFE 2BDCA 3M7TA 1CGHA 1TQ7B 3BN9A 3MOCA 1EPTA 2BY6X 4KP0A 1MTWA 1EKBB 1OPHB 3LPRA 1SGFA 2VWLA 2W6ID 4JMYA 1YCPM 1NFWA 3VB4A 2A4QA 3TK6A 1LPZB 1AFQC 2R3UA 1O2SA 4MPUA 1H9HE 2WV4A 1DWEH 1HAVA 2EA3A 1ZR0A 2XTTB 4FETA 1EB2A 2HGTH 2FI5E 1JWTA 2BOHB 2XYAA 2BX3A 1SFQB 2FI3E 3SNDA 4DW2U 2O9QA 1GBEA 1FUJA 3DT0H 4JZIA 1C1WH 1OYTH 4XDEA 3RM2H 3RXJA 1DS2E 3PLBA 3MH5A 5I25A 4Q7YA 1P2MA 4Q7ZA 1RGQA 1RS0A 2CF9H 1GI1A 1O2LA 4FU7A 2G00A 4VGCB 1FAKH 2VVCA 4FXGH 4E7RG 3GCOA 3BTTE 1SGPE 1KXDA 1N8OB 4Z1MD 1QCPA 1T8NA 1WOFA 2F9VA 1GJ7B 5F8XA 4OGXA 1ABJH 1V3XA 1OWHA 3GDVA 2FOAA 5EJLA 2FM2A 2ZF0H 1A5IA 1ETRH 4AX9H 2FOHA 1NT1A 2K0QA 4IMZA 4O9VA 5C1UA 4AGKA 2NU1E 1O3PB 1YLDA 2HALA 2H1UA 4XRNA 1VJAU 1GHAF 3ENSB 3LGUA 3H7TA 3PMJA 1SGTA 1ELFA 1RRKA 3BIUH 3A7WA 1W11U 2B7DH 1PQ5A 2C93B 2F9UA 1SGDE 2OLGA 1V2ST 5H4IB 5F8TA 2M5TA 3SU5A 3UPEA 5A0CA 1EZXC 3M7QA 1A5HA 2C3SA 1XUJA 1LHGH 5K7RA 4DCDA 2IOTA 4K1SA 1AWHB 1HDTH 3UQOA 2BB4A 2F9OA 3M5LA 1O3DA 3E1XB 1T8LA 1O5GH 3MU0A 3C1KA 4GUXA 3S7HB 3U28C 1BITA 3QGNB 2WZQA 1AVGH 1MBMA 1HJAB 3EAJA 1YC0A 3ZZ7A 1GBHA 3SU2A 1MKWK 4IC6A 1TNIA 1OWJA 2FYQA 1CVWH 2BD5A 3F9FA 4CRGA 2Y5GA 2ODQA 3SU1A 2H5CA 1F5LA 1GMCG 5C1YA 1D4PB 4AFSA 2ZI2H 1DLEA 4J1YA 2ZCKP 1CT2E 2F83A 1NRNH 5TJXA 4ZKRU 1QNJA 1FJSA 4BXSA 4CRDA 1D3TB 4UEHH 4OGYA 3OX7U 5DP9A 3SV2H 3N7OA 1UO6A 3M7UA 2A4OA 2GCTC 2P59A 2B5TB 2QF0A 2YMSD 1CQQA 1L2EA 1LPKB 3QZQA 1OWKA 1SGRE 5EGMA 4H4FA 1V2PT 4NIVA 1VGCC 3P17H 3HKJB 3CS0A 3FKSD 5LPRA 1YPMH 3R3GB 1QJ1B 3P8FA 4JZFH 4MLFB 4WF8A 4I32A 4YO9A 1AD8H 2O8MA 3ZVDA 4AFUA 2QC2A 3SV9A 1FY4A 5FCKA 4O3UA 5CHAB 1QBVH 2J5UA 2BM2A 1CGJE 1XX9A 2ZHWH 3P70B 4UFDH 1HAYB 1LVYA 4D9RA 5GJ4B 3B8JA 2EI7A 3MH7A 1EB1H 3SNBA 3ZYEA 2ZC9H 1UVOA 1W3CA 2C90B 3JZ2B 2KR7A 3LU9B 3ZZ3A 1Z8RA 1Y5UT 5EQQA 4CH8B 1ABIH 3V12A 4YOJA 2HLDD 4X6OA 1O5BB 1V2RT 3S9CA 1XMNB 2FODA 1JIRA 1UTNA 1TMTH 5T6DA 1QRXA 1PPHE 3ZZ9A 3PV2A 1GG6B 4Y8ZA 2PKSC 4Q4LA 5AHGH 2OC7A 3ODDA 4BAHB 1GMHF 5GCHG 4A1TA 1MTUA 1O2TA 1ZMNA 1KY9A 3A82A 4Y10E 9ESTA 3TJOA 3Q00A 5K0HA 1K1OA 1SHHB 2FIRH 2H6MA 4WMDA 1SR5C 4MG3A 4O97A 4F55A 1V2KT 1A2CH 5JBTA 1GL0E 3OY5U 3GY6A 1BMMH 5AVDA 5FPTA 6CHAB 3QLPH 2V7QD 2SFAA 2KFWA 1K28D 1EUFA 1CHOF 3F2GA 4B6FA 1RXPA 3SQEE 1S6HA 1XKAC 3UR6A 3M36A 1SB1H 1KXCA 3A8CA 4X8SH 1H8DH 1HPGA 4ACAA 2ZIQH 3ESTA 1AZ8A 5CHBA 5AF9H 3GCHC 4Y76A 1MZDA 1O38A 1V2JT 3LH1A 2QXIA 1IQFA 1ZTJA 4GLYA 1BRBE 4INLA 1SLUB 4YLUA 5DSFA 5JBBS 4ZHMU 4B71A 1GCDA 3M3SA 1DLKB 2FOFA 3TPIZ 4BTIB 1P2IA 3LGYA 1M9UA 3GICB 3ZZBA 2Z7FE 2B8OH 4MVNA 3HK3B 3ZVCA 1Z8IB 2Q6FA 5T1VA 3GY4A 2FTMA 2GV6A 2BZ6H 1NPMA 1EFRD 1EASA 2K8IA 1Z8JB 3L3TA 1O2GH 3TGIE 3BV9B 4X1RU 2FESH 1TNKA 2PR3A 3KHVA 1VJ9U 1O3JA 3SUFA 1XKBC 3KQDA 2RCEA 2VH6A 4DG4A 1YCPH 1C2LA 3FFGA 2PWXA 1C5WB 1PFXC 3RXDA 2QV1A 4OS1A 4FUCA 2XOKD 4WXVA 3FO8D 1D6WA 1W14U 1X7AC 1NN6A 2FOCA 2O8UA 2ZCHP 4Q2KA 1F5RA 1A61H 1GI9B 1EZQA 2XBXA 2ZHDA 1LKBA 4U01A 2WUCA 1V2MT 3DSGA 1ZSKA 6ESTA 3RXIA 3TK5A 1ZMLA 2GVFA 3VB6A 3QUMP 3F9HA 3SU4A 4OS5A 1NFYA 5FX5A 4FUDA 3N7DA 1SGEE 3PWCA 1SC8U 1V2WT 3PTNA 3A89A 3SU6A 1C5LH 3FP7E 1UTJA 3PMAB 4ASUD 1UVTH 1IQIA 1V2QT 2XWBI 3E8LA 4TY6A 1IQGA 3RXFA 2ZPSA 1GHAG 1TOMH 1UHBA 2WINI 1ELCA 1RIWC 3OAAD 4X2WA 4YM9A 1O2RA 5C20A 5EPYA 1F0TA 2W7UA 2OC8A 1P03A 3ZV9A 2VWMA 1TPAE 5FX6A 2ZTZA 1KDQA 1S81A 2B0FA 2CXVA 1ELVA 4D7GA 3NPSA 1HLTH 3EYDA 5ABWA 3TH4H 1RJXB 1G36A 2GZ8A 1TX7A 3E0PB 1O2ZA 1P8VC 4IMQA 3I77A 1W10U 4AFQA 1LKAA 2AS9A 3P6ZB 3HPTB 1HXEH 1FNIA 1W13U 2A5KA 3RXLA 2ZTYA 4JK6A 2BDIA 1PPEE 1KTTB 3OTPA 2GP9B 4MTBA 1THRH 2ZQ2A 1FDPA 4NIWA 1J14A 5JDUB 5E2OA 2BVSH 1K0HA 1C1NA 3UFAA 5JB8S 1VITH 3URCA 2A7JA 1PQ8A 2SGAA 2HPPH 3QX5H 1V2NT 5FBEA 1SHYA 4I8LA 1UVSH 2JH6D 2R9PA 2ZCLP 3RP2A 3RXAA 1E35B 1ELTA 5JBAS 1DUEA 1ZPCA 3LKWA 2V3OH 4TY7A 4A92A 3O8CA 2Z3CA 5HKKD 3KN2A 2D8WA 1ZYOA 2ZDLA 1OWIA 1OXGA 2G52A 1MH0A 3R0FA 3SNEA 1IQEA 3U8OH 4AG1A 1B0EA 1GI4A 3NKKA 1KLTA 3MNCA 3KYFA 4ZKNU 2BVRH 1WTHD 2KCOA 2PTNA 3UOPA 3SJOA 2GCHF 2JETC 1T32A 3RXPA 3M3VA 4WH6A 3PYHA 2QXJA 1OSSA 1ZJDA 4I31A 1VR1H 3MNSA 4KTCA 3IITA 6LPRA 3TIUA 1BMFD 2WUBA 2WPIS 1G9IE 5FPYA 3SNAA 2W7SA 1A4WH 2GZ9A 1A0LA 1UK3A 4X2VA 4ISIH 1NY22 3MO6A 1IQJA 5FCRA 2XRCA 2ZFTA 2Z6BD 3H5CB 1LVOA 4ZXYH 2VIDA 4E06H 2KZ4A 4O3TA 1GMDF 3SQHE 2QF4A 4CHAB 1KYNA 4I8HA 3U98H 1Y3XA 1FQ3A 2QXGA 1QRWA 1GMHG 2OK5A 1DUAA 1NRSH 1UK2A 3QDZB 2IJD1 4WMEA 1BQYA 4BAQB 1QA7A 1LHCH 3F0OA 1TB6H 2PP6A 3T62A 1NTPA 2ODYB 2G51A 1OP8A 3A85A 1TPOA 4B75A 4D7FA 1P05A 2ZO3H 5L6NH 3MTYA 1P2KA 4SGAE 1DY8A 1QBOA 2PSXA 3LGIA 1ESBA 1CHOG 4FUBA 2EI6A 3A88A 2Z3EA 4BANB 1K1IA 3A7XA 3ITIA 1SMFE 1Y8TA 4B73A 1YKTA 1XUIA 3MQKC 1FXYA 3QN7A 2RG3A 1TE0A 2VINA 1ZHRA 1EX3A 1C1VH 1G30B 1GGDB 4X8UH 2O8TA 1FZZA 1GHWH 1O3GA 1IQKA 1KXBA 2KCYA 2PUQH 3VB5A 1HXFH 5L2YH 1GHXH 4X1PU 3BTQE 2ALPA 3LT3A 3RU4E 2WPKS 3TGJE 3EA9A 2QE7D 2BXUH 3PLKA 4FU9A 4AN7A 2J98B 2ANKH 3OFND 1ZGVA 1FY8E 2A4RA 1MAYA 1W0ZU 2A7HA 1MQ6A 5EXLA 2VGCC 4CREA 2BOKA 1AFQB 1B0FA 2Y7ZA 4BTUB 1BMNH 5TCCA 3IG6B 3UY9A 2WYGA 2VB0A 2M2AA 3SV8A 3AW0A 2CF8H 2VNTA 1QY6A 3ZZ5A 4BAOB 4FUFA 2JH0D 1GBBA 1C5ZB 1C2FA 2AGIX 3M37A 1WAYB 2JH5D 2XNDD 1HCGA 1C9PA 1P2QA 1SLXB 1XUKA 2A4GA 1H9IE 2KCAA 3RC6A 5T6GA 5EJ1A 2VIVA 2ULLA 1G3CA 3RXSA 2ZEBA 4YT6H 1E36B 5HM9A 1O3EA 2P3TB 3KF2A 2PGQB 1GI6A 4TYDA 2IPHA 1BTUA 1DSTA 3F9GA 3MFJA 1ZMJA 2V3MA 1L1JA 1WUNH 1ETTH 4FUEA 2I6SA 5EW1H 2Y7XA 1EZSC 3BF6H 1TLDA 1O30A 1NRRH 1W8BH 4I8JA 1JXPA 2AEIH 1O3LA 1NZQH 3F9EA 3DSOA 5AFYH 1DT2A 3JZ1B 1BTWA 3H09A 2BQ7B 1UTMA 1O2KA 1Y3WA 1Z8GA 3HATH 2FLRH 4K1TA 1E38B 1LMWB 2YNAA 1O5AB 1QB9A 2BX4A 2CHAC 2DUCA 1NFUA 2HVXA 2P94A 1OYQA 1Z71A 1EP5A 1THPB 6GCHF 2UUYA 3AAUA 3Q3KA 2L6OA 3SJIA 1PYTD 2BDHA 3BTKE 1JIMA 1J9CH 2BY9X 1OP0A 4NIXA 2UWLA 4B76A 1O2QA 2OBQA 1O2JA 2UUKB 2QCYA 1BTZA 1MBQA 2WV9A 1SOTA 2H9TH 1CT0E 2FS9A 4CR5A 3KEEA 4IBLH 5LPFA 5E2PA 3DA9B 1MD8A 4U2WA 4R0IA 1JRSA 2BMGB 1BRUP 1N6YA 3ZIAD 1AB9C 1P9UA 4X6PA 4CRAA 1HFDA 1O3MA 1MKWH 3SV7A 1L1GA 5EQSA 3ZVGA 4UFGH 4YTAA 3K6YA 1TMUH 1DFPA 2GMTC 2ZDMA 2LPRA 4FUGA 2ZGHA 1SGCA 1Y5AT 1QTFA 4MNWA 2V6NA 3VXFH 1LTOA 1GBAA 5GIBA 1TBQH 3SJ9A 3AW1A 1K1NA 3EE7A 3S9BA 1E79D 5T6FA 2HWLB 1GJ8B 2G5NA 3RXBA 2GCTB 5B6OA 3AASA 1VZQH 1AU8A 2ZNKH 5HMAA 1VGCB 2BVXH 5HYOA 4GHTA 4Y7BA 5LGOA 1NRQH 3MO9A 4DY7B 1BOQA 5KEDA 1DWBH 4MNVA 3FOAA 2GCHG 3NXPA 2C4FH 1AHTH 1LVMA 4X2YA 3UWJH 1EAWA 3F68H 1D3PB 1S6FA 1DWCH 2FTLE 1IHSH 1V2TT 1UVPA 3EGKH 3LC3A 1Z6JH 3ZZAA 2ZFRH 1ZPZA 1BJVA 2CGAA 3UNRA 2FS8A 2Z9LA 2VWOA 1NU9A 1A5GH 1IOEA 3LDXH 2BDYA 5EU8A 2H9EH 3OTJE 1C4V2 2KM0A 1F92A 1FIWA 9LPRA 1GMDG 2OD3B 2WV5A 4GPGA 1WSSH 1W7GH 2AIPA 3URDA 2QGRA 1NROH 2C8ZB 4J2YB 2GV7A 2QIQA 3T2NA 1FY3A 2PKSB 3H7OA 2SNVA 1FLEE 4GHQA 2W26A 4AORA 2VU8E 1BBRE 1O36A 1OP2A 1ZHPA 1SLWB 2FDAA 1KTSB 3FP8E 2F4LA 2O8LA 4ISNA 1VITF 1WYKA 3M5MA 2ZWLH 3P8GA 2STBE 3SJKA 1A46H 3E6PH 2GDDA 4ZCNA 4LOYH 2OQUA 1TWXB 3RLWH 4UFEH 5C0TA 2OBOA 3NK8A 1G2LA 1TNJA 5DKMA 2GKVE 4I86A 3A87A 1D9IA 4ZKSU 1IAUA 1L4ZA 4LZ1H 5C1XA 3OY6U 3SO3A 3UOUA 2JDID 3LJOA 2BD2A 1DOJA 2HVYB 3DSPA 1C5TA 2D26C 2XCNA 1ZHMA 1ZOMA 3GCHB 1NC6A 5BPEA 5EPNA 4NA8A 4MNXA 3SI3H 4ISHH 1FY5A 5DO4H 1W0JD 1W2KH 1J8AA 2AMDA 1ELAA 4NFFA 1EP6A 2ZFQH 5A09A 3ZZ4A 1LHFH 2WPJS 4ABAA 1FN6A 3A7YA 1AE8H 2XBYA 4XSKU 1MAXA 2Y80A 5GNDA 5L30H 2BD4A 5A8XA 2XW9A 3RXMA 1MABB 5IYTA 3EE0B 1SQRA 3MU1A 2JJ1D 3N7EA 1GVZA 3PO1C 3BG4B 4H6TA 3A7ZA 3VB7A 1SI5H 2VBCA 3UREA 4B2BA 1P2JA 3SW2B 1XUGA 2TRMA 2Y6TA 1CA8B 1FX0B 1P04A 2LNCA 1XXDA 1CSOE 4FOUC 1RTFB 1BRCE 4JCNA 3MYWA 1O3KA 1DITH 1MTNC 3GISB 4ASHA 3MU8A 3P8NA 3ZVAA 2Y82A 2SGEE 2XWAA 1EAIA 1GVLA 2TGDA 4NA7A 1GCTC 3CNRA 1GJDB 2AMPA 1BTYA 2JKHA 4CBNA 1O5FH 3A8BA 3FANA 4PROA 3A81A 1PQ7A 1MCVA 2P8OC 1TBZH 3EA8A 1TA6A 1DSUA 1C5QA 1O0DH 4INKA 1H8HD 3FAOA 3RMNH 2QA9E 1C2IA 1CBWC 1XVMA 3DD2H 3PM3A 3UNSA 3SGQE 1RIWB 5F8ZA 1A0HB 1FV9A 2GD4B 3T28A 1NRPH 1O39A 2HRVA 3F2FA 4O03A 4NIYA 4UD9H 1HAOH 3SNCA 4DT7B 1TX8A 1P3CA 1ELEE 3F2HA 3F6UH 4BOHA 3LONA 1O2XA 3VEQB 2K1QA 3WWFA 6GCHG 1TNLA 2BDGA 3PV4A 4Y11E 1C2HA 2EC9H 3ZVFA 4X2XA 4Y7AA 1KXEA 3GOVB 1BDAA 1P10A 5PTPA 4CBOA 2J98A 3GY5A 1QHRB 1MKXH 1K2I1 5KGOA 4YOGA 4HTCH 3M5OA 2QF5A 2AMQA 3MMGA 1EXFA 7GCHF 3KYGA 2ZECA 2A1DB 2R3YA 1GDNA 4A7IB 1F0RA 4FUIA 2FMJA 1BTPA 2XC4A 3A8DA 4NZQA 4FUHA 2J2UA 1UTOA 4RKJB 5JYIA 2Z9GA 2A2XH 2CJIA 5ESBA 5DP5A 4ESTE 3UTUH 4TPIZ 4ABDA 4YZUA 5DJ7A 5C5NA 5FXLA 5E8EH 4KKDA 3RDZA 3CENA 1S83A 4UE7H 1UTLM 1YGCH 5J4SA 1YWUA 5G4BA 2A5AA 1IQMA 1ZTLA 2A7CA 3PLPA 1TALA 1Z7KA 4X1SU 1C4U2 4ZUHA 3K2UA 5JB9S 2ILNA 1RD3B 1BTXA 3KNXA 1FI8A 4XOJA 2AFQB 2VH0A 2F91A 1GI5A 3UB0A 1UCYE 3MWIU 1E0FD 2JIZD 2XNIA 4ZAEA 4GVUA 4X6MA 3TITA 2JETB 2Y5HA 4Q63A 3U8TH 3GY7A 5EODA 3LGVA 2FYRA 3GS9A 1QGFA 1WTGH 1QFKH 1IQNA 2KX4A 4ABJA 4MDSA 1HAPH 8KME2 2BY8X 1G3DA 4ISOA 1UW7A 2WHXA 1C2KA 3SN8A 1QA0A 1C5VA 3EQ0H 1NS3A 1BTHH 1JRTA 1P11E 5KECA 4NA9H 4U30A 2CK3D 1VCWA 4ABHA 1P3EA 2AHME 1Q2WA 2ZGXH 3A8AA 3RC4A 3E3TA 1EJNA 1OX1A 1HAIH 1MKXK 2UWOA 5EXMA 3T26A 4CRFA 2OCVB 2A0QB 1BBRK 1EATA 5SGAE 2P16A 3ATKA 1EPTC 2H2ZA 4HG6A 2A32A 2Z9IA 1KSNA 4K1EA 1XUFA 4IN1A 5DP4A 1VITG 1WV7H 1SSXA 2ESTE 4THNH 1K1MA 2AIQA 1E34B 2BLQA 3F3BA 1TNGA 3SORA 4BAKB 2AGEX 1GI2A 4M7GA 2OQ5A 3NCLA 1NBMD 3V7TA 2YNBA 2P93A 3STJA 3PV5A 4ZMAH 1GWAA 4LZ4B 1RTKA 1GDQA 1HAXB 1EQ9A 4DIHH 2J94A 2Z9KA 4LXBH 1B7XB 2NU4E 3PRDA 1GBMA 1TPPA 3K9XB 2IPQX 1W7XH 5DP3A 3I78A 1ANCA 1K9OE 3M5NA 3D62A 2XC5A 3TJNA 2RA3A 1AZZA 1GJ4H 2DE9A 4CRCA 1LCYA 1YY3A 1PJPA 2GZ7A 4FVDA 3TK9A 1O31A 2NU0E 2QXHA 2YMSC 4JYVH 2VGCB 4ABGA 4DT4A 5GXPA 1Y5BT 2PGBB 1L1NA 2XXLA 1TOCB 3ATMA 2FWWA 4TWYA 1O2UA 4UFFH 3ZV8A 5BRRE 4P00A 1AUJA 2VJ1A 1TX6A 2GT8A 3RU4T 1N1LA 1INCA 3HGNA 1HV7A 4K60A 1W0YH 1V2LT 2ZU1A 1IQLA 1C1RA 4JK5A 3VG8A 5CMXH 3UR9A 4HGCA 4UONA 1HAZB 1QIXB 2ALVA 3SUGA 3WY8A 1Q3XA 1SPJA 5HGGA 1H9LB 3S0NA 1NM6A 3RC5A 1A0JA 2Z9JA 1Z1IA 1O2IA 1SGIB 3RXKA 2F9NA 2G4TA 2OXSA 3W94A 4AB9A 1XM1A 1QQUA 4JYUH 1WQSA 1LVBA 5A0AE 2XCFA 3SBKA 3W95A 4NCYA 1C2GA 1GL1A 4X8TH 4Z0KA 2BD7A 1K21H 1ZTKA 3UNQA 1QZ8A 5EQRA 1HB0B 1UCYH 2BLVA 5E0GA 1FY1A 2FEQH 2HNTE 4YXWD 2W5EA 4RN6A 1O3HA 1GHVH 2ZHQH 1RFNA 3SU3A 1O37A 5JBCS 1YPEH 3GCTF 3BTGE 4IN2A 1OOKB 2HLCA 1P01A 1HBTH 1HJ9A 1KXFA 1GJCB 1KIGH 4DURA 1U6QA 1GBIA 2FP7B 2FI4E 1LO6A 3TGKE 3VGCC 4B2CA 1S85A 2P3FH 1EOLA 3RMLH 1O2OA 2ZHEH 1ELDE 1O3AA 2NU3E 4ZKOU 4JZ1A 3TH2H 1BZXE 2Q6DA 2XBVA 1XXFA 4BAMB 2BQWB 4XBDA 2KAIB 1C5UA 4KTUA 5C94A 3SGBE 5CE1A 4YLQH 7GCHG 4K3JA 1DVAH 1AFEH 3SGAE 3SHCH 1ETSH 1SL3A 1T7CA 2OC0A 4Q80A 3ATIA 1AB9B 1T8MA 2OINA 1ZGIA 4NSVA 1O3IA 3SUEA 2EQNA 2FOBA 3FVFB 4DIIH 3LH3A 1A1RA 2ZZUH 3BTDE 2J4IA 4RT0A 2F9PA 1QL8A 1UTKA 2GMTB 3VXEH 4MPVA 4X8VH 4XBCA 5ETXA 3MU5A 1O3CA 1GDUA 1WQVH 2CN0H 3OU0A 1WXRA 1ELGA 4MPWA 5EXNA 3HK6B 2GGVB 1DXWA 3L33A 4NG9H 1QR3E 1WBGB 2ZU3A 2VIQA 4YESB 7ESTE 1DWDH 1UCYK 1K1PA 2RFKC 1FAXA 3QTVH 1H8ED 5HXFA 5FPSA 4AC9A 3MU4A 4BXWA 1AUTC 1DXPA 2Q6GA 1OHHD 2OUAA 4NSYA 2PTCE 4GCHF 3V13A 4JZDH 2SGQE 4KELA 1GBCA 4YT7H 2BD3A 3NZIA 3D49H 2VIWA 1A3EH 2XC0A 5C67A 2PV9B 1K1JA 1WU1A 1DM4B 2ZDAH 1C2MA 2PKAB 3Q76A 1JMOH 2GDEH 1XVOA 1EOJA 2STAE 4D8NA 1G3BA 4Y0YE 4AGJA 1A7SA 1P9SA 1ZPBA 2FPZA 3NUMA 1HAGE 1YYY1 3IWMA 1GBLA 1T8OA 2WPLS 1QL9A 4TT3D 1Q31A 3CP7A 2NWNA 2EEKA 4F48B 1FPCH 1BMAA 3DFJA 3MO3A 5DGJA 1C1UH 3GDSA 2UUJB 3UQVA 2DE8A 1GHYH 3S9AA 3BG8A 2H5DA 3U69H 1C1MA 5TCAA 3A7TA 3RM0H 1UTQA 1E1QD 1NFXA 1BCUH 1BHXF 2UUFB 1C1PA 4NFEA 4X6NA 4X1NU 2BXTH 2IN2A 3RUOA 4AYVB 1D3DB 2H9HA 1MUEB 1LHEH 1C2EA 3E0NB 1F0SA 1OWEA 1GJ9B 2ZPQA 1O3NA 2KCPA 3E90B 2ZTXA 1NU7B 1VCPA 3PWBA 3UIRA 1AQ7A 4ZXXH 2ZQ1A 1TIOA 2PW8H 3FZZA 2ZDVH 3RMMH 1HAHH 1GPZA 1C5MD 1GJBB 5EW2H 2V0BA 4A6LA 3NRLA 3CS7A 8ESTE 2AH4X 4D9QA 3F0PA 1W12U 2PLXA 3WWBA 3A83A 3BEIB 2VVUA 2W6JD 4AZ2B 1BT7A 2V35A 3GCNA 1GBTA 4AB8A 5DP8A 4BNRA 2ZHFH 2LELA 1CA0C 1HIAB 4FUJA 1O5DH 1HJ8A 3NWUA 3RXRA 2ANYA 4RI0A 1LPGB 1PPBH 2SGDE 3PO1B 3PRBA 4ZH8A 1ZJKA 2BY7X 3SI4H 2AYWA 4WVPE 4ABBA 1VKYA 2F43B 3BSQA 3TH3H 1TGSZ 8LPRA 3GDUA 5A2MH 1F0UA 1DDJA 2L74A 1C5YB 2J95A 4X1QU 1BB0B 2FX4A 1MTNB 1O2WA 1PQAA 2SGPE 1D6RA 2WYJA 3S69A 1ESAA 1JOUB 1ZSJA 2BDBA 1G2MA 2G5VA 3QO6A 3SYJA 3O8BA 1TBRH 1GCTB 5DPAA 5DP6A 3KGPA 3AK5A 2D2DA 2D1JA 4I7YH 4E7NA 5C17A 1ANBA 2P8OB 4DOQA 1ZLRA 1TQ0B 1E37B 1YPLH 7LPRA 3GCTG 1GI8B 1LQEA 4XBBA 2OP9A 3BTEE 5HIYA 1CBWB 1C2DA 4IC5A 1V2VT 1AKSB 1V2UT 4H42U 2P95A 2RDEA 3TJVA 1ARBA 1GJ5H 1S84A 4VGCC 1COWD 1TNHA 1CE5A 2BHGA 2PSYA 2G8TA 4XE4A 7KMEH 2R0KA 1SG8B 3GYLB 1Y3UA 2SNWA 5F6MA 1N8OC 4GSOA 4IS5A 3QZRA 2HNTC 2R0LA 1O33A 4KGAA 3MH4A 2VWNA 1C2JA 2G81E 1P0SH 4JZEH 3FN8A 3SZEA 3ZVBA 1G32B 1ZRKA 1P02A 1ESTA 3PTBA 5F03A 2IJOB 2VIPA 1AVXA 1Z6EA 1AIXH 3HKIB 5DK1A 2VIOA 2ZP0H 1EJMA 4CR9A 1KLJH 3SUDA 1TA2A 5DN6D 1AI8H 3DUXH 2TPIZ 3OEED 1TFXA 2TGTA 1HNEE 4AG2A 1S5SA 1GJAB 1O2VA 1WCZA 4XFQA 2FOEA 1OS8A 4WMFA 1K1LA 4Y8XA 4ZHAA 1YPKH 2W3IA 2ANMH 1TGNA 5FL7D 5C3NA 2V3HH 1HYLA 2A5IA 1FONA 3RXUA 3TU7H 3M3TA 4Y0ZE 3KCGH 2ZGCA 2FOGA 3E91A 4ABEA 3ATWA 3U9AH 1ARCA 1MD7A 1D3QB 1QJ7B 3Q77A 1J15A 4FU8A 1SLVB 3A86A 3RXQA 1O2PA 1AWFH 2PUXB 1HJAC 4I33A 3T25A 3RXOA 2ZU5A 5A0BA 1TYNA 1GVKB 3TLOA 1SGFG 1BIOA 4GCHG 5C2ZA 5C0UA 3SZNA 1GI0A 4AYYB 3AVZA 1S82A 1ID5H 4ZHLU 1CGIE 1H1BA 1PPZA 4KTSA 3SOSA 3QK1A 1AO5A 3M35A 5GDSH 4INHA 1C4Y2 1CHGA 1ZRBA 3OE7D 2BD9A 3F1SB 1QB1A 1PPFE 1SQAA 2ZDKA 1CT4E 1NO9H 3LGWA 4RKOB 5A8ZA 2YOLA 1J17T 1O3FA 2C8WB 5B6LA 2KAIA 3RLYH 1P57B 1QURH 1BBRH 1B5GH 1YPHE 2A31A 1EPTB 4ABIA 2TIOA 1O3BA 1YP9A 1T4UH 4YOIA 4NWKA 2BZAA 2HOBA 4OS2A 2P3UB 3AAVA 4MQAA 4NZLA 1C5NH 3D23A 1YPJH 1KMHB 3PROA 1C1SA 2LP6A 2QAAA 5CHAC 3RXGA 3S7KB 3B9FH 1HAVB 1PYTC 3MNXA 1GI7B 4AOQA 4CRBA 1F5KU 1RTLA 1G3EA 3ZVEA 1Y3VA 1OKXA 1PPGE 3STIA 3C27B 3K65B 4HI3A 3BG4C 1P09A 1ELBA 1SBWA 4IGDA 1SOZA 1AN1E 1O3OA 1V6DA 3Q3XA 5IDKA 2VVVA 2PFEA 3SJ8A 3OYPA 2WPDD 5AFZH 4WH8A 5EOKA 2CMYA 1SQTA 1GG6C 2TGAA 2G55A 2PHBA 2J92A 3ZZ6A 4OS7A 8GCHF 1EZUC 1GBKA 3SU0A 1ANDA 4U32A 3ZZ8A 3DCLA 4A1XA 1P06A 3KQCA 1W0KD 3E16B 2A2QH 4B1TA 3BTME 2WPHS 4TSFD 1GJ6A 1YPGH 5FHTA 3VB3A 3LC5A 2ZPRA 4E05H 1BHXB 4K8BA 3ZZDA 5DG6A 3T5FH 2RDLA 1J16A 2YMSB 2R2WU 4MNYA 6CHAC 2GT7A 1C5OH 1S0RA 3PMHB 1ZSLA 4K69A 3BIVH 1OWDA 1YF4A 1YM0A 3TVJB 1QL7A 1IQHA 1FMGA 1MTSA 3TNTA 4ACBA 4OS4A 5HM2A 1E1RD 1L4DA 2ZDNA 4BTTB 2PKAA 5LH8A 5C5OA 1QB6A 1MMJN 2WPMS 1GBFA 1N6XA 3BTWE 1GHZA 1UJ1A 1BMLA 5IK2D 1MZAA 2ZFSA 3EA7A 1GHBF 2SGFE 3T27A 1AGJA 1JBUH 2ZG0H 1TABE 1YLCA 2ZFFH 1DICA 3MI4A 1C1TA 1QJ6B 2HNTF 1O35A 1YLNA 4UDWH 2ZKSA 1T4VH 4B6EA 3V3MA 4K8YA 2BLWA 2TBSA 3D65E 3GY8A 2I6QA 2WSSD 1C1OA 1O2YA 1HGTH 5HIZA 3LIWA 4XD7D 3UAIC 1NBME 2UWPA 2B9LA 3RXEA 4MPXA 1H8IH 1C1QA 2ZGJA 3GY3A 4I8KA 3PMBB 3BTFE 1C5PA 1EAUA 2NU2E 1BJUA 1BA8B 3P95A 3KIDU 1YCPK 4RT1A 3LGTA 4DJZB 1KLIH 1LHDH 2FZZA 4Y8YA 4F4OC 2AGGX 1LDTT 2W3KA 2ZU2A 2Y5FA 3VPKA 2ZFPH 3ELAH 4OS6A 1SFIA 3KQBA 2HPQH 3BEFB 3MH6A 3Q3YA 3VGCB 1Y3YA 1FIZA 4X0WU 2FX6A 3KL6A 2J9NA 3TNSA 2FLBH 1HUTH 1F7ZA 4B2AA 3U1IB 1ACBE 2F9BH 1K22H 1YBWA 2Z3DA 2OTVA 3G01A 1SVPA 1MCTA 3P8OA 3FZDA 2OC1A 1VCQA 1HIAA 2Y81A 2A45B 3TJUA 1WDIA 3I29A 4P02A 4RSPA 1O5EH 3A84A 2THFB 4M9FA 3UUZA 1C5SA 1EAXA 5I46H 2FXRA 1FPHH 1AY6H 1ORFA 2C8YB 3ZYDA 2FOMB 5EJZA 4LK4A 3L6PA 3WW7A 4A1VA 2F3CE 3EDXB 3O8DA 3SHAH 1T31A 3GYMA 2J34A 5GWZA 4B74A 3O8RA 1L0ZA 1C5RA 1P2OA 2BLOA 2XBWA 3KQEA 4WXIA 3UWIA 4Y79A 3LOXA 1UMAH 5EIYA 1GI3A 5L2ZH 3B23B 4K2YA 1SKYE 2O8WA 3A80A 5EG4A 3U8RH 2EI8A 3P92A 2BYAX 1MQ5A 3MNBA 3DFLA 3OSYA 1AVWA 1TGCA 2ODPA 4TWWA 1AKSA 1CU1A 1QRZA 1QQ4A 1V2OT 2ZU4A 2J97A 1TONA 5ESTE 3BTHE 1Z1JA 1MU8B 1G37A 1O2NA 1GBJA 1O32A 1GMCF 4H6SB 3RMOH 1F2SE 3ATLA 4NGAH 3DHKH 5GPIB 4FVBA 2FO9A 4ABFA 2CHAB 2R2MB 2AERH 4F49A 4HFPB 4AFZA 1GBDA 1TPSA 1SGYE 1UTPA 2BTCE 2QF3A 1UK4A 5F53A 1SGNE 4IW4E 1DANH 1S6LA 4WY3A 1CO7E 5A8YA 1EJAA 1DE7H 2G4UA 1SGQE 2GJGA 1MTVA 2Q1JA
chains in the Genus database with same CATH topology
1ANEA 4GAWA 2BDAA 3GY2A 1MU6B 4CH2B 3RU4D 1SQOA 2ZGBH 1O5CB 4QT8C 4WWYA 4A5TS 5E0JA 1IHTH 1NESE 4HZHA 5J4QA 5T3HA 4JYTA 1THSH 3BEUA 1QBNA 4K5ZA 5JPMH 2J38A 3ODFA 1DPOA 5FBIA 1TGTA 3QWCH 1YPHC 1BUIA 2BY5X 2QY0B 1TRYA 3T29A 1C5XB 1P12E 3PB1E 3LJJA 4Z6AH 1AMHA 4CHAC 4R8TB 3RXCA 2ANWA 4DGJA 2GTBA 4Y71A 2Z94A 1TRNA 3VFEA 1O34A 3MHWU 8GCHG 3V0XA 3U1JB 4Y6DA 2QYIA 3RXHA 1XUHA 4WJG2 1UVUH 1Y59T 5GCHF 4NWLA 1C9TA 1KXAA 5DP7A 1FN8A 1LQDB 1TAWA 5FAHA 1H4WA 3QGJA 1AE5A 3A7VA 4TPYA 4SGBE 1DY9A 1TGBA 3ZZCA 1ZZZA 3HGPA 1TMBH 2CV3A 3M61U 2ZA5A 1O2MA 2C8XB 1CA0B 4ISLA 2RA0A 1DX5M 1BRAA 1PPCE 2TGPZ 4Q7XA 1UHBB 1A3BH 2ASUB 5E0HA 3RXVA 4I8GA 3RXTA 2QN5T 1O2HA 3FP6E 1GGDC 2BD8A 1TRMA 2GX4A 3K6ZA 1HRTH 4DVAU 3QTOH 1S0QA 1KDQB 5LPEA 1GHBG 3SV6A 1P2NA 2BQ6B 4ZROA 4D76A 2BDCA 3M7TA 1CGHA 1TQ7B 3BN9A 3MOCA 1EPTA 2BY6X 4KP0A 1MTWA 1EKBB 1OPHB 3LPRA 1SGFA 2VWLA 4JMYA 1YCPM 1NFWA 3VB4A 2A4QA 3TK6A 1LPZB 1AFQC 2R3UA 1O2SA 4MPUA 1H9HE 2WV4A 1DWEH 1HAVA 2EA3A 1ZR0A 2XTTB 1EB2A 2HGTH 2FI5E 1JWTA 2BOHB 2XYAA 2BX3A 1SFQB 2FI3E 3SNDA 4DW2U 2O9QA 1GBEA 1FUJA 3DT0H 4JZIA 1C1WH 1OYTH 4XDEA 3RM2H 3RXJA 1DS2E 3PLBA 3MH5A 5I25A 4Q7YA 1P2MA 4Q7ZA 1RGQA 1RS0A 2CF9H 1GI1A 1O2LA 4FU7A 2G00A 4VGCB 1FAKH 2VVCA 4FXGH 4E7RG 3GCOA 3BTTE 1SGPE 1KXDA 1N8OB 1QCPA 1T8NA 1WOFA 2F9VA 1GJ7B 5F8XA 4OGXA 1ABJH 1V3XA 1OWHA 3GDVA 2FOAA 2FM2A 2ZF0H 1A5IA 1ETRH 4AX9H 2FOHA 1NT1A 4IMZA 4O9VA 5C1UA 4AGKA 2NU1E 1O3PB 1YLDA 2HALA 2H1UA 1VJAU 1GHAF 3ENSB 3LGUA 3H7TA 3PMJA 1SGTA 1ELFA 1RRKA 3BIUH 3A7WA 1W11U 2B7DH 1PQ5A 2C93B 2F9UA 1SGDE 2OLGA 1V2ST 5H4IB 5F8TA 2M5TA 3SU5A 3UPEA 5A0CA 1EZXC 3M7QA 1A5HA 2C3SA 1XUJA 1LHGH 5K7RA 4DCDA 2IOTA 4K1SA 1AWHB 1HDTH 3UQOA 2BB4A 2F9OA 3M5LA 1O3DA 3E1XB 1T8LA 1O5GH 3MU0A 3C1KA 4GUXA 3S7HB 1BITA 3QGNB 1AVGH 1MBMA 1HJAB 3EAJA 1YC0A 3ZZ7A 1GBHA 3SU2A 1MKWK 4IC6A 1TNIA 1OWJA 2FYQA 1CVWH 2BD5A 3F9FA 4CRGA 2Y5GA 2ODQA 3SU1A 2H5CA 1F5LA 1GMCG 5C1YA 1D4PB 4AFSA 2ZI2H 1DLEA 4J1YA 2ZCKP 1CT2E 2F83A 1NRNH 5TJXA 4ZKRU 1QNJA 1FJSA 4BXSA 4CRDA 1D3TB 4UEHH 4OGYA 3OX7U 5DP9A 3SV2H 3N7OA 1UO6A 3M7UA 2A4OA 2P59A 2GCTC 2B5TB 2QF0A 1CQQA 1L2EA 1LPKB 3QZQA 1OWKA 1SGRE 5EGMA 4H4FA 1V2PT 4NIVA 1VGCC 3P17H 3HKJB 3CS0A 5LPRA 1YPMH 3R3GB 1QJ1B 3P8FA 4JZFH 4MLFB 4WF8A 4I32A 4YO9A 1AD8H 2O8MA 3ZVDA 4AFUA 2QC2A 3SV9A 1FY4A 5FCKA 4O3UA 5CHAB 1QBVH 2BM2A 1CGJE 1XX9A 2ZHWH 3P70B 4UFDH 1HAYB 1LVYA 4D9RA 5GJ4B 3B8JA 2EI7A 3MH7A 1EB1H 3SNBA 3ZYEA 2ZC9H 1UVOA 1W3CA 2C90B 3JZ2B 3LU9B 3ZZ3A 1Z8RA 1Y5UT 5EQQA 4CH8B 1ABIH 3V12A 4YOJA 4X6OA 1O5BB 1V2RT 3S9CA 1XMNB 2FODA 1JIRA 1UTNA 1TMTH 5T6DA 1QRXA 1PPHE 3ZZ9A 1GG6B 4Y8ZA 2PKSC 5AHGH 2OC7A 3ODDA 4BAHB 1GMHF 5GCHG 4A1TA 1MTUA 1O2TA 1ZMNA 1KY9A 3A82A 4Y10E 9ESTA 3TJOA 3Q00A 5K0HA 1K1OA 1SHHB 2FIRH 2H6MA 4WMDA 1SR5C 4MG3A 4O97A 1V2KT 1A2CH 5JBTA 1GL0E 3OY5U 3GY6A 1BMMH 5AVDA 5FPTA 6CHAB 3QLPH 2SFAA 1K28D 1EUFA 1CHOF 1RXPA 3SQEE 1S6HA 1XKAC 3UR6A 3M36A 1SB1H 1KXCA 3A8CA 4X8SH 1H8DH 1HPGA 2ZIQH 3ESTA 1AZ8A 5AF9H 3GCHC 4Y76A 1MZDA 1O38A 1V2JT 3LH1A 2QXIA 1IQFA 1ZTJA 4GLYA 1BRBE 4INLA 1SLUB 4YLUA 5JBBS 4ZHMU 4ABFA 4B71A 1GCDA 3M3SA 1DLKB 2FOFA 3TPIZ 4BTIB 1P2IA 3LGYA 1M9UA 3GICB 3ZZBA 2Z7FE 2B8OH 4MVNA 3HK3B 3ZVCA 1Z8IB 2Q6FA 3GY4A 2FTMA 2GV6A 2BZ6H 1NPMA 1EASA 1Z8JB 3L3TA 1O2GH 3TGIE 3BV9B 4X1RU 2FESH 1TNKA 2PR3A 3KHVA 1VJ9U 1O3JA 3SUFA 1XKBC 3KQDA 2RCEA 2VH6A 4DG4A 1YCPH 1C2LA 3FFGA 2PWXA 1C5WB 1PFXC 3RXDA 2QV1A 4OS1A 4FUCA 4WXVA 1D6WA 1W14U 1X7AC 1NN6A 2FOCA 2O8UA 2ZCHP 4Q2KA 1F5RA 1A61H 1GI9B 1EZQA 2XBXA 2ZHDA 1LKBA 4U01A 2WUCA 1V2MT 1ZSKA 6ESTA 3RXIA 3TK5A 1ZMLA 2GVFA 3VB6A 3QUMP 3F9HA 3SU4A 4OS5A 1NFYA 5FX5A 4FUDA 1SGEE 3PWCA 1SC8U 1V2WT 3PTNA 3A89A 3SU6A 1C5LH 3FP7E 1UTJA 3PMAB 1UVTH 1IQIA 1V2QT 2XWBI 3E8LA 4TY6A 1IQGA 3RXFA 2ZPSA 1GHAG 1TOMH 1UHBA 2WINI 1ELCA 1RIWC 4X2WA 4YM9A 1O2RA 5C20A 5EPYA 1F0TA 2W7UA 2OC8A 1P03A 3ZV9A 2VWMA 1TPAE 5FX6A 2ZTZA 1KDQA 1S81A 2B0FA 2CXVA 1ELVA 4D7GA 3NPSA 1HLTH 3EYDA 5ABWA 3TH4H 1RJXB 1G36A 2GZ8A 1TX7A 3E0PB 1O2ZA 1P8VC 4IMQA 3I77A 1W10U 4AFQA 1LKAA 2AS9A 3P6ZB 3HPTB 1HXEH 1FNIA 1W13U 2A5KA 3RXLA 2ZTYA 4JK6A 2BDIA 1PPEE 1KTTB 2GP9B 4MTBA 1THRH 2ZQ2A 1FDPA 4NIWA 1J14A 5JDUB 5E2OA 2BVSH 1C1NA 3UFAA 5JB8S 1VITH 3URCA 2A7JA 1PQ8A 2SGAA 2HPPH 3QX5H 1V2NT 5FBEA 1SHYA 4I8LA 1UVSH 2JH6D 2R9PA 2ZCLP 3RP2A 3RXAA 1E35B 1ELTA 5JBAS 1DUEA 1ZPCA 3LKWA 2V3OH 4TY7A 4A92A 3O8CA 2Z3CA 3KN2A 2D8WA 1ZYOA 2ZDLA 1OWIA 1OXGA 2G52A 1MH0A 3R0FA 3SNEA 1IQEA 3U8OH 4AG1A 1B0EA 1GI4A 3NKKA 1KLTA 3MNCA 4ZKNU 2BVRH 1WTHD 2PTNA 3UOPA 3SJOA 2GCHF 2JETC 1T32A 3RXPA 3M3VA 4WH6A 3PYHA 2QXJA 1OSSA 1ZJDA 4I31A 1VR1H 3MNSA 4KTCA 3IITA 6LPRA 3TIUA 2WUBA 2WPIS 1G9IE 5FPYA 3SNAA 2W7SA 1A4WH 2GZ9A 1A0LA 1UK3A 4X2VA 4ISIH 1NY22 3MO6A 1IQJA 5FCRA 2XRCA 2ZFTA 2Z6BD 3H5CB 1LVOA 4ZXYH 2VIDA 4E06H 4O3TA 1GMDF 3SQHE 4CHAB 1KYNA 4I8HA 3U98H 1Y3XA 1FQ3A 2QXGA 1QRWA 1GMHG 1DUAA 1NRSH 1UK2A 3QDZB 4WMEA 1BQYA 4BAQB 1QA7A 1LHCH 1TB6H 3T62A 1NTPA 2ODYB 2G51A 1OP8A 3A85A 1TPOA 4B75A 4D7FA 1P05A 2ZO3H 5L6NH 3MTYA 1P2KA 4SGAE 1DY8A 1QBOA 2PSXA 3LGIA 1ESBA 1CHOG 4FUBA 2EI6A 3A88A 2Z3EA 4BANB 1K1IA 3A7XA 3ITIA 1SMFE 1Y8TA 4B73A 1YKTA 1XUIA 1FXYA 3QN7A 2RG3A 1TE0A 2VINA 1ZHRA 1EX3A 1C1VH 1G30B 1GGDB 4X8UH 2O8TA 1FZZA 1GHWH 1O3GA 1IQKA 1KXBA 2PUQH 3VB5A 1HXFH 5L2YH 1GHXH 4X1PU 3BTQE 2ALPA 3LT3A 3RU4E 2WPKS 3TGJE 3EA9A 3PLKA 2BXUH 4FU9A 4AN7A 2ANKH 1ZGVA 1FY8E 2A4RA 1MAYA 1W0ZU 2A7HA 1MQ6A 5EXLA 2VGCC 4CREA 2BOKA 1AFQB 1B0FA 2Y7ZA 4BTUB 1BMNH 5TCCA 3IG6B 3UY9A 2WYGA 2VB0A 3SV8A 3AW0A 2CF8H 2VNTA 1QY6A 3ZZ5A 4BAOB 4FUFA 2JH0D 1GBBA 1C5ZB 1C2FA 2AGIX 3M37A 1WAYB 2JH5D 1HCGA 1C9PA 1P2QA 1SLXB 1XUKA 2A4GA 1H9IE 3RC6A 5T6GA 2VIVA 2ULLA 1G3CA 3RXSA 2ZEBA 4YT6H 1E36B 5HM9A 1O3EA 2P3TB 3KF2A 2PGQB 1GI6A 4TYDA 2IPHA 1BTUA 1DSTA 3F9GA 3MFJA 1ZMJA 1L1JA 1WUNH 1ETTH 4FUEA 2I6SA 5EW1H 2Y7XA 1EZSC 3BF6H 1TLDA 1O30A 1NRRH 1W8BH 4I8JA 1JXPA 2AEIH 1O3LA 1NZQH 3F9EA 5AFYH 1DT2A 3JZ1B 1BTWA 2BQ7B 1UTMA 1O2KA 1Y3WA 1Z8GA 3HATH 2FLRH 4K1TA 1E38B 1LMWB 2YNAA 1O5AB 1QB9A 2BX4A 2CHAC 2P94A 1NFUA 2DUCA 2HVXA 1OYQA 1Z71A 1EP5A 1THPB 6GCHF 2UUYA 3AAUA 3Q3KA 3SJIA 1PYTD 2BDHA 3BTKE 1JIMA 1J9CH 2BY9X 1OP0A 4NIXA 2UWLA 4B76A 1O2QA 2OBQA 1O2JA 2UUKB 2QCYA 1BTZA 1MBQA 1SOTA 2H9TH 1CT0E 2FS9A 4CR5A 3KEEA 4IBLH 5LPFA 5E2PA 3DA9B 1MD8A 4U2WA 4R0IA 1JRSA 2BMGB 1BRUP 1N6YA 1AB9C 1P9UA 4X6PA 4CRAA 1HFDA 1O3MA 1MKWH 3SV7A 1L1GA 5EQSA 3ZVGA 4UFGH 4YTAA 3K6YA 1TMUH 1DFPA 2GMTC 2ZDMA 2LPRA 4FUGA 2ZGHA 1SGCA 1Y5AT 1QTFA 4MNWA 2V6NA 3VXFH 1LTOA 1GBAA 5GIBA 1TBQH 3SJ9A 3AW1A 1K1NA 3S9BA 5T6FA 2HWLB 1GJ8B 2G5NA 3RXBA 2GCTB 5B6OA 3AASA 1VZQH 1AU8A 2ZNKH 5HMAA 1VGCB 2BVXH 5HYOA 4GHTA 4Y7BA 5LGOA 1NRQH 3MO9A 4DY7B 1BOQA 1DWBH 4MNVA 2GCHG 3NXPA 2C4FH 1AHTH 1LVMA 4X2YA 3UWJH 1EAWA 3F68H 1D3PB 1S6FA 1DWCH 2FTLE 1IHSH 1V2TT 1UVPA 3EGKH 3LC3A 1Z6JH 3ZZAA 2ZFRH 1ZPZA 1BJVA 2CGAA 3UNRA 2FS8A 2Z9LA 2VWOA 1NU9A 1A5GH 1IOEA 3LDXH 2BDYA 5EU8A 2H9EH 3OTJE 1C4V2 1F92A 1FIWA 9LPRA 1GMDG 2OD3B 2WV5A 4GPGA 1WSSH 1W7GH 2AIPA 3URDA 2QGRA 1NROH 2C8ZB 4J2YB 2GV7A 2QIQA 3T2NA 1FY3A 2PKSB 3H7OA 2SNVA 1FLEE 4GHQA 2W26A 4AORA 2VU8E 1BBRE 1O36A 1OP2A 1ZHPA 1SLWB 2FDAA 1KTSB 3FP8E 2O8LA 4ISNA 1VITF 1WYKA 3M5MA 2ZWLH 3P8GA 2STBE 3SJKA 1A46H 3E6PH 2GDDA 4LOYH 2OQUA 1TWXB 3RLWH 4UFEH 2OBOA 3NK8A 1G2LA 1TNJA 5DKMA 2GKVE 3A87A 1D9IA 4ZKSU 1IAUA 1L4ZA 4LZ1H 5C1XA 3OY6U 3SO3A 3UOUA 3LJOA 2BD2A 1DOJA 1C5TA 2D26C 2XCNA 1ZHMA 1ZOMA 3GCHB 1NC6A 5BPEA 5EPNA 4NA8A 4MNXA 3SI3H 4ISHH 1FY5A 5DO4H 1W2KH 1J8AA 2AMDA 1ELAA 4NFFA 1EP6A 2ZFQH 5A09A 3ZZ4A 1LHFH 2WPJS 4ABAA 1FN6A 3A7YA 1AE8H 2XBYA 4XSKU 1MAXA 2Y80A 5L30H 2BD4A 5A8XA 2XW9A 3RXMA 5IYTA 3EE0B 3MU1A 1GVZA 3PO1C 3BG4B 4H6TA 3A7ZA 3VB7A 1SI5H 3UREA 4B2BA 1P2JA 3SW2B 1XUGA 2TRMA 2Y6TA 1CA8B 2LNCA 1P04A 1XXDA 1CSOE 1RTFB 1BRCE 4JCNA 3MYWA 1O3KA 1DITH 1MTNC 3GISB 4ASHA 3MU8A 3P8NA 3ZVAA 2Y82A 2SGEE 2XWAA 1EAIA 1GVLA 2TGDA 4NA7A 1GCTC </