4KTSA

Bovine trypsin in complex with microviridin j at ph 8.5
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Harnessing the evolvability of tricyclic microviridins to dissect protease-inhibitor interactions.
pubmed doi rcsb
source organism Microcystis aeruginosa mrc
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktsA02
3OTJE 5IYTA 1AVXA 2PKSB 4YOJA 1EAUA 1A5HA 3Q3XA 5A2MH 4ISNA 3U69H 2XW9A 1TX6A 1EZSC 2OP9A 5EU8A 1YCPK 1C5NH 2OC7A 1NFUA 1BMMH 1GBAA 1AB9C 1GHZA 1XUHA 5C67A 4AGJA 5BPEA 2CV3A 1GJ9B 2ZGCA 4TY6A 1PQ8A 1JOUB 2FESH 4FUBA 1W3CA 5CHAC 1O35A 2ZFSA 4HGCA 3T27A 2R2MB 4B71A 2RG3A 4B2AA 2CN0H 5DGJA 4NWKA 3QTVH 4IS5A 4LK4A 3U98H 5GCHF 3BTHE 1LHDH 2JETB 2OTVA 1ELFA 3DUXH 1SFQB 2Z9GA 3GY8A 4UFFH 3P17H 1IQEA 2AGIX 1QJ7B 5DP4A 5L2ZH 3RMMH 2WYGA 1HXFH 3MHWU 2VGCC 7LPRA 1SOTA 2ZU2A 2VIWA 1LQDB 1AFEH 3PYHA 4I32A 3PV4A 8ESTE 3B8JA 2LNCA 2EI6A 4LZ1H 1OWKA 3D23A 3AW0A 1ANEA 1QRWA 1L2EA 2OXSA 5EXLA 3IG6B 3SGBE 2FM2A 1NU7B 1DPOA 3ZVGA 4DCDA 3CS0A 3UPEA 3LOXA 1QFKH 3P8NA 5FX5A 7KMEH 1GI0A 3RXHA 1TGSZ 1YLCA 1L4ZA 5E8EH 1EOLA 1TPSA 1SMFE 1O5CB 3CP7A 2O8UA 5T3HA 2ANWA 3RXKA 5ETXA 4HZHA 2Y80A 3D65E 2PKSC 2Y6TA 2FP7B 3ZZDA 5DP5A 5FX6A 3BIUH 1C4Y2 3Q3KA 2YNAA 1QL7A 1ESAA 1ANDA 1W11U 2AFQB 3MU1A 4Z6AH 3O8RA 3UWIA 1TGCA 2A7JA 4D8NA 1DE7H 4BOHA 1EAWA 4IW4E 1CU1A 1ZOMA 3RXJA 3UNRA 1SGTA 5HXFA 1GHBF 1HB0B 1BHXF 1BOQA 1EB2A 3EDXB 4AB8A 3A81A 1OWDA 3LC5A 2ZTZA 2JETC 2ZQ1A 1FJSA 1TRNA 1YPKH 5AFYH 3GCTG 3ZZAA 3LGTA 1PPEE 3C27B 4ZXYH 3SUGA 1C1RA 3P92A 2G52A 1BTHH 1NC6A 2TBSA 1H9IE 1T31A 3PTNA 1MMJN 1P2NA 1HAGE 1OOKB 1K22H 5FPYA 5DJ7A 3ATKA 3RMLH 1P2JA 2ZNKH 1Z1JA 1MKXH 1O2GH 5DO4H 1WQVH 1W7GH 1W8BH 3EA7A 3SJ9A 1A4WH 3RXBA 1FMGA 4ISIH 3RU4E 1XXDA 2SGAA 1S5SA 1D3DB 1BIOA 1SGPE 4O3UA 1Y5BT 1K1OA 1TFXA 3KCGH 3NWUA 1YCPH 1SQAA 1V2MT 1O2UA 2TRMA 3TJVA 3SNEA 1TOCB 3BV9B 2ZFTA 2FO9A 4O9VA 1C4U2 1EZUC 2NU3E 3EA8A 1LMWB 1MTVA 9ESTA 2B0FA 1P10A 4Y0ZE 1Y5AT 1GMCG 4JK6A 2M5TA 2HRVA 4JZ1A 3RXLA 2BDIA 4YOGA 1JIRA 1TONA 2B9LA 3RXEA 1MTSA 1DSUA 1FY5A 1TPAE 1BQYA 1C5WB 3AAVA 1DDJA 1BTUA 2VINA 4TPYA 1BDAA 5A0AE 2NWNA 2VIDA 3SORA 1SGDE 4PROA 2RA3A 1ETTH 2ZIQH 3P6ZB 2PGBB 1NY22 2BY5X 1NU9A 4TY7A 1W0ZU 2VWLA 2XCFA 1YPHC 1ZZZA 1LVMA 1PYTC 1KY9A 1C5PA 2Y5HA 3DD2H 2ESTE 1O5AB 4FUJA 2Z9LA 3RXTA 1C2KA 1F7ZA 2JKHA 1YPEH 1Y3YA 5JBTA 1S81A 5FPTA 5GCHG 1DFPA 1TPPA 1GI6A 2PUQH 1QQUA 1HIAA 2K1QA 3LKWA 4FU8A 1O3IA 4GCHF 1GHWH 3TH2H 4MPWA 4QT8C 1N6XA 3TIUA 1H9LB 1KXFA 3MI4A 1ZHRA 1O5GH 3RXQA 3RUOA 4NA8A 1FV9A 4CHAB 1EZXC 4Y8YA 3HKIB 1SOZA 4OGYA 1KYNA 3UQVA 1GBCA 1GHXH 5AFZH 1QQ4A 1QCPA 1DY8A 1HAZB 2PWXA 3QX5H 2C3SA 3A82A 2ZWLH 1SGEE 1TNIA 2RA0A 1D3TB 1U6QA 2VVUA 2FLBH 4RKOB 4FU9A 3RXUA 3S69A 4CBOA 1G3CA 3F6UH 2VWOA 1AN1E 1GPZA 1ELEE 1XUGA 2GZ7A 5AVDA 1F5KU 1V2KT 3K6YA 1WQSA 2JH6D 1G2MA 1GBFA 1V2TT 1P02A 4WMFA 1IQMA 1O2WA 3LT3A 1FUJA 2A5KA 4I8JA 1GJ6A 3M61U 3SV2H 1XKBC 1MBMA 1QJ1B 4B2CA 1Q31A 1NPMA 2W3KA 1WYKA 4XFQA 2P8OB 1C5UA 2EC9H 1C1VH 4X2VA 1NRRH 1YLDA 1T8MA 1BTXA 4X1SU 3SNCA 1BRUP 2A4QA 1CT2E 1YP9A 1BRAA 1RTFB 4DG4A 4GHTA 3V3MA 1V2LT 1ZJKA 3OY5U 1CT4E 2ZTXA 3SU4A 3GDVA 1ELCA 2FOAA 4LOYH 2STAE 2G8TA 3BTME 2GCTB 2H1UA 5FXLA 2VIQA 2O8WA 2VH0A 1MH0A 4BAMB 1WU1A 1ZPZA 2CF9H 2WPJS 2H5CA 1GHBG 1O3JA 5LH8A 3KQDA 1O3LA 3GYLB 1KXBA 3K2UA 4BTIB 4WVPE 1AWHB 2XBYA 4U30A 2QGRA 1K2I1 1FONA 3ODFA 1FY8E 1INCA 3LU9B 4CRCA 5C1UA 3R0FA 3BTDE 1BITA 1GJDB 1GMHF 2ZU3A 4K2YA 4WMEA 2XBWA 1V6DA 2NU1E 2ZU1A 2BD9A 1GBMA 5FCRA 1OSSA 1K1IA 2F3CE 1G36A 3SV8A 4YT6H 1ZJDA 1RJXB 2RCEA 2A2XH 2F9VA 2AGEX 1AE8H 3MU5A 1H9HE 1W12U 1SGIB 4JZDH 6GCHF 1GCDA 2J9NA 3MNCA 2PW8H 2FOFA 1UK3A 3A8AA 1SG8B 1RIWB 4XSKU 4ABHA 2GT8A 4R0IA 4ZHAA 2A0QB 1SQOA 4WMDA 4X6NA 2HPQH 1S0QA 2VJ1A 5EGMA 1TMBH 4YLQH 5LPFA 1HJ8A 1KXDA 3VXFH 3TK5A 1Z8RA 3UQOA 5EW1H 1IHTH 2J34A 1P06A 2NU4E 3SNBA 2OBQA 5EQRA 2P8OC 3C1KA 4IMZA 3RM2H 1YPHE 1OKXA 1GL1A 1AZZA 1QRXA 2FZZA 1C1WH 2G81E 3V0XA 1QURH 4XBBA 3JZ1B 3SGAE 3MNSA 1ESTA 4X8UH 3RXMA 3SUEA 2GCTC 2FI5E 4ABFA 1O5FH 2BY8X 4ABEA 4RKJB 2ZFQH 1RRKA 2R0LA 1HAVA 4O03A 2ZC9H 2OQUA 1DLKB 5FBEA 3SJ8A 3GCOA 4AG1A 3QLPH 1A5IA 1GHVH 2ODYB 1NESE 2GMTB 4GCHG 4YM9A 1NRSH 1P8VC 3GY2A 3M36A 1PJPA 2F9BH 2ZDVH 1GJCB 4Y79A 1W13U 1P04A 2AMQA 2R0KA 3MOCA 4AYYB 1UTLM 3A7TA 3LGYA 2VIOA 1XX9A 2ZU5A 3RXAA 4ISHH 4FUGA 1IQKA 4F4OC 1XMNB 5FBIA 1YYY1 2XYAA 3F68H 1LKBA 3RXGA 1NRQH 1DT2A 3LDXH 1CA0C 3FANA 1C5SA 1AQ7A 1P2MA 3JZ2B 4D9QA 1HV7A 1K28D 1G32B 3NK8A 5HM9A 1WBGB 1C2MA 4INHA 3RXIA 1C2HA 1YC0A 1GJ8B 3PROA 3P70B 3KL6A 1DANH 3A7ZA 5F8XA 1NS3A 1C1NA 3A8BA 1TA2A 2BQ6B 1L0ZA 1UCYK 4WH6A 1JRSA 4GUXA 2V0BA 3SI4H 4OS7A 1YPLH 1VJ9U 2P93A 2FOEA 2AH4X 3ZVCA 4MPVA 1C5MD 3UWJH 2C93B 1P12E 1V2WT 3Q76A 2WPMS 2J4IA 5BRRE 4AN7A 1HIAB 1LO6A 1S85A 1EZQA 4FVBA 3E8LA 2AIQA 1AB9B 1Z8IB 2QXGA 1L4DA 1LVYA 4VGCB 1ZRKA 1VCWA 1HGTH 3RC6A 3VB4A 2Z6BD 1EASA 3BN9A 2ZHWH 2TIOA 1TYNA 5GXPA 1EX3A 1RS0A 3TH4H 2OBOA 2W26A 4GSOA 1EQ9A 2SGPE 1F0SA 3PM3A 2ALVA 4B75A 2FX6A 2GGVB 3UNSA 2FI4E 2R3UA 1GBJA 4K69A 3U9AH 3FFGA 1H8DH 1O0DH 1V3XA 3TVJB 2IPHA 1ZGIA 5L2YH 3MNBA 4A1VA 3WY8A 2BD5A 1EJMA 1B0EA 4Q7YA 3HKJB 1DWCH 3W95A 1UCYE 2VGCB 2ZDNA 1TX8A 4IGDA 2G55A 4AB9A 1WSSH 1OPHB 2AMDA 1SGQE 3UNQA 3V13A 1DITH 1UVTH 2HVXA 1ZSKA 1SFIA 2WINI 1SC8U 3FZZA 2FDAA 1XVOA 2H2ZA 1ZYOA 3A87A 3ATWA 6GCHG 1YPMH 3IWMA 4BTTB 2VWNA 1EUFA 2DE8A 1PFXC 2O9QA 2VVVA 3STJA 1S83A 4OS4A 5C5NA 1Z8GA 2CJIA 3U1IB 1E34B 3KF2A 4F49A 1DXPA 1F5LA 4NZLA 3ESTA 4YOIA 1C2FA 1FIWA 3TH3H 4A6LA 2H5DA 2F9NA 1E0FD 1HNEE 1MQ5A 3V12A 3NZIA 4LXBH 3CENA 1MTWA 3TJUA 3QUMP 3ZZ9A 1CA8B 1OP2A 1YKTA 3P8OA 1C5TA 1H4WA 1K1JA 2W3IA 3M37A 3SHCH 4VGCC 1FY1A 1O31A 4OS6A 1UJ1A 3LGWA 1UVSH 1SGCA 1ZPCA 2GX4A 2GDEH 4E7NA 2AEIH 4B76A 1OWIA 3TJOA 3M35A 4I8GA 1THRH 2V6NA 1AU8A 2BXUH 2QYIA 2B7DH 4MNVA 2BD7A 4X2YA 1PPGE 3VGCC 2QIQA 1A3BH 2Y5FA 2STBE 5F8TA 5EXNA 3A7YA 2QC2A 3NXPA 1HJ9A 2BY6X 4Y7AA 2HLCA 5JBBS 9LPRA 3GY5A 3NPSA 2ZHQH 4YLUA 2WYJA 1M9UA 1UCYH 3A83A 3MWIU 1DSTA 1BHXB 2ZI2H 1LVBA 1JRTA 2AIPA 1QBOA 2ZZUH 3GCHB 3KQBA 3PMAB 5A8XA 2C4FH 3Q77A 1NFXA 2ANMH 1MCVA 2A1DB 3LJJA 3KIDU 4GHQA 4NA7A 1E37B 3ZV8A 2Z3CA 3T5FH 3MMGA 2PUXB 2FPZA 1ELDE 2ZGXH 1GMDF 1BUIA 4J2YB 4OS2A 1AE5A 1D3PB 4X8SH 1AVGH 3E0NB 4X2WA 3H7TA 1FIZA 2Z9KA 1AUTC 3M7UA 2Z9IA 4BXSA 3I78A 1GJ7B 3PMBB 4X1RU 4ZKNU 2BQ7B 1A0JA 1A61H 1VZQH 1V2OT 2J94A 1D6RA 2BVRH 2QY0B 3VFEA 1TWXB 5PTPA 3ZV9A 1CT0E 4IC5A 1AGJA 3BTKE 2WPHS 3A8CA 1O2ZA 3UR6A 2WPLS 1J17T 1NO9H 4Q7XA 2FOBA 1ZRBA 2FODA 5JPMH 5LPEA 1F0TA 4KTUA 1IQLA 2ODQA 4CR9A 4R8TB 3RXVA 1GBIA 3DA9B 2BLQA 1PQAA 2ZU4A 3RLYH 3FAOA 2BZAA 1DOJA 2BOKA 1GG6C 2ZFRH 1PQ5A 4X6MA 1OS8A 1MZAA 2PTCE 2ALPA 2VWMA 3RXSA 2Z94A 3EA9A 2GDDA 2CMYA 4UFDH 4NIYA 5J4SA 2JH5D 4K8YA 3ITIA 1A0HB 1HRTH 1J9CH 2DUCA 2Y82A 2A2QH 3GCHC 1KXCA 5DP9A 4FUIA 2CXVA 2O8TA 3FP6E 3SOSA 4U32A 1GBKA 1HAXB 1AWFH 1EAXA 3LH3A 1HPGA 1C5VA 4KKDA 1AO5A 1BTYA 4NA9H 3ZZ7A 2ZFFH 2EI7A 2WUBA 2P95A 1D3QB 4XBCA 4DIIH 1W10U 2A4GA 4MG3A 1AKSA 1XVMA 4BNRA 5EPNA 1XXFA 1JIMA 1GBEA 1UK2A 1SHHB 4D7GA 3GY6A 4KTSA 1DWEH 2C8WB 3HGPA 2SGDE 1CO7E 3ZZ5A 1NTPA 1NN6A 1N8OB 1EPTA 4A1TA 1BTZA 1O3NA 1S0RA 3AAUA 1TQ0B 1O3DA 2VVCA 1C1MA 1JBUH 3MNXA 5A8ZA 3A7XA 4JYUH 1TBZH 3E1XB 2WV4A 4HTCH 4B1TA 3MU8A 3MH7A 3H7OA 1MTNC 2TPIZ 1L1JA 1C2GA 3ZYDA 1JMOH 1PPZA 2HOBA 1V2ST 5E0JA 2IOTA 2H9EH 1UVUH 1ZSLA 1GJAB 1QIXB 5AHGH 1C2JA 2KAIB 1NT1A 5ESTE 1QTFA 3GYMA 1KSNA 3VB3A 3D62A 2D2DA 3RXPA 5GWZA 3HK6B 5DG6A 4MNWA 3AVZA 4DW2U 1CSOE 1ZMLA 1XM1A 2ZFPH 2AGGX 2O8MA 2ZCLP 3FP8E 2PV9B 4YTAA 2F9OA 1GVZA 1S6FA 4XE4A 3QGJA 3TU7H 1O34A 3A7VA 4Y0YE 1EJNA 1GWAA 3A8DA 1BA8B 4YO9A 4JZEH 3LONA 1BJUA 1BMAA 3LGUA 2SGFE 1MD8A 3EYDA 3U1JB 3M5OA 2QV1A 2ZHEH 3K65B 5EQQA 4O3TA 2C8XB 1A46H 3OU0A 1IQGA 3VXEH 3PMJA 1LKAA 2GD4B 4K8BA 1GMDG 1YPJH 3S9AA 4A5TS 1LCYA 3QDZB 3M3SA 4NCYA 3T25A 3LGVA 3SJOA 1LHCH 4DT7B 1SHYA 3MFJA 2GP9B 2BD4A 2UWLA 2ZTYA 4AX9H 1N8OC 4Y10E 4IN2A 3SN8A 4ABDA 1VCPA 1GI5A 2TGPZ 1SGNE 2A5IA 1DICA 1QBVH 2W7SA 4E7RG 3TGKE 1LVOA 1VJAU 2R2WU 4H42U 3P8GA 4ZAEA 1FY4A 2P94A 1O3MA 4MPUA 2FMJA 3U8RH 1FXYA 3M3VA 4DGJA 5I46H 2YOLA 1BBRK 4E06H 1O3FA 3EAJA 1FNIA 1ID5H 1ACBE 1UTMA 4U2WA 1TIOA 2J92A 4X6PA 1ELAA 4FUDA 1XUIA 1CHGA 3ENSB 1ZTJA 2XWBI 1O3HA 3F9GA 3I29A 2C90B 2CF8H 4H6SB 4UE7H 1BCUH 1QB6A 4X6OA 3GCNA 3UY9A 1DWBH 2D1JA 3ZZ6A 3TITA 4CRFA 4X1NU 4ISOA 3W94A 1TX7A 3MH6A 2AYWA 1MU6B 1Z8JB 2SGQE 1V2UT 1Q3XA 1WTGH 1C2LA 3UOPA 3LH1A 2HGTH 3SU6A 1MU8B 3EQ0H 4E05H 2ANYA 2OC8A 4KTCA 3M5LA 1QL8A 2UUYA 3A80A 1CA0B 4ABBA 2Y81A 4AFQA 1UK4A 1A7SA 1GJ5H 2EA3A 3M7TA 4NIXA 4ZHMU 2BVXH 3RDZA 3TNTA 2UUJB 2UUFB 2H6MA 3DFLA 4K1SA 3SV9A 4UONA 1O2QA 1UHBA 1N1LA 4ZUHA 1EAIA 1HAHH 3SJKA 1Y3XA 1P9SA 4Y71A 1GI3A 2GT7A 1WUNH 1BBRE 1T4UH 4NSVA 4TWWA 4J1YA 2I6QA 3TK6A 4AFZA 3D49H 2VU8E 2FWWA 4B74A 2IJOB 1TBRH 2O8LA 5C5OA 1O2HA 1OP0A 1V2PT 3LC3A 4I33A 4TPIZ 2SFAA 1G3DA 2JH0D 2BZ6H 2BY9X 2LPRA 1G37A 1LPZB 3ZZBA 2XNIA 1QY6A 1CHOG 2TGAA 3E3TA 2WPKS 1MD7A 1F2SE 1FN6A 1DUAA 1GBHA 5DP6A 3L3TA 1LTOA 1FAKH 2BLWA 3O8DA 4SGBE 4SGAE 2ZO3H 4I8HA 3ODDA 4CRBA 5H4IB 2J95A 1TGNA 2FTLE 4XBDA 2VB0A 1O2NA 1MKWK 3BEFB 1TABE 4CRGA 3RXCA 1IQIA 3QN7A 1FPHH 2A31A 4DIHH 1YPGH 1EKBB 4UDWH 1SQTA 1O2PA 1Z7KA 1HFDA 1P05A 2DE9A 2QXJA 1MTUA 1QL9A 2ZDKA 2HALA 3KHVA 2HNTF 5EPYA 3QZQA 2ZHDA 1UTQA 2BDHA 3EGKH 3SW2B 2BDYA 1O3EA 4X2XA 1AKSB 5K7RA 4X8TH 2QF3A 1CGJE 1VR1H 4I31A 5FAHA 4JZIA 1G3EA 1OWJA 1VITG 3G01A 1O2SA 4WXVA 6CHAB 2XRCA 3M5MA 4D7FA 3O8CA 1NRPH 1GDQA 1EPTB 4K1EA 1UMAH 2XBXA 4A7IB 3PLKA 1IQFA 4UFGH 2HNTC 1NROH 3T26A 1NFWA 5EQSA 1W7XH 3VB6A 2Z3EA 1TRYA 3BG4C 3ZZ4A 2BXTH 1HAIH 1NFYA 2BVSH 2GV7A 1O2OA 3T28A 4BAKB 3RC5A 1IAUA 1ZHPA 1DM4B 2BTCE 3PTBA 3RM0H 4AOQA 1O38A 4AGKA 3GY4A 1BBRH 2XCNA 4IN1A 1SL3A 2GZ8A 2ZGHA 5DP3A 1P2IA 1T32A 1SPJA 2BM2A 3I77A 4AFUA 4WJG2 2ODPA 3P8FA 2BHGA 5F6MA 1O2VA 2PLXA 2OD3B 2ILNA 3R3GB 5LGOA 1GDUA 3RXRA 4MNYA 2UUKB 2P3TB 1KDQA 1QB1A 1ZPBA 3A7WA 3SBKA 4ABGA 4JMYA 4NWLA 3MO6A 3UREA 3GOVB 4XDEA 3SO3A 1BMNH 3ATMA 5GJ4B 3MH5A 1A3EH 3SU3A 4BAQB 1O3OA 2W5EA 3MO9A 1HUTH 1O2JA 3K6ZA 3PWCA 1C1QA 1C1UH 3ZZ8A 5T6GA 5DP8A 3MU4A 4CH8B 3VGCB 2P3UB 1ZTLA 1D9IA 5JYIA 3LPRA 1XUJA 3MO3A 1W0YH 4DURA 2PKAA 1Y8TA 1GGDB 3SGQE 3NUMA 1QA7A 2GV6A 1V2NT 3L6PA 4ABJA 3URCA 3ATLA 6CHAC 2OCVB 1X7AC 2OC0A 1O3PB 4WY3A 2BX3A 3BTFE 1OYQA 5EW2H 1EPTC 5DPAA 1G9IE 3BTEE 1FI8A 5ESBA 5A0BA 1TNHA 1ZR0A 1JXPA 2P16A 3E90B 1AVWA 1IQNA 4AG2A 2I6SA 4X8VH 5DKMA 3QO6A 1C5ZB 1Z1IA 5C20A 2CHAB 4WWYA 3SJIA 2C8ZB 2A45B 1C4V2 1JWTA 4I8LA 3VB7A 5TCAA 3GICB 1GI1A 5T6FA 1C2EA 3BTWE 3A86A 4UEHH 2BDAA 1CBWC 3F9EA 1TRMA 1V2JT 1MKWH 3HGNA 2FYRA 4K5ZA 4X1QU 4FUHA 4Q80A 1TAWA 1OX1A 1UTPA 3DHKH 3ZVBA 2ZQ2A 5C1YA 1TOMH 3SI3H 5A09A 3M7QA 1K1MA 3RU4T 1FN8A 2QN5T 1YF4A 3KNXA 1GBTA 3SU0A 2J2UA 5AF9H 4U01A 1HCGA 3A89A 2FOHA 4MDSA 1GDNA 3L33A 1KLTA 2G00A 3RC4A 3N7OA 1TA6A 1B5GH 1GBLA 1EOJA 3LGIA 4JZFH 4O97A 4FUFA 4Y6DA 1GG6B 2P59A 2XC4A 5CMXH 1C2IA 1GI9B 1TPOA 1J15A 2ZCKP 5E0GA 1GI8B 2W7UA 2SGEE 1UHBB 4FVDA 1BTPA 5GIBA 2QF0A 5C3NA 1GGDC 1S84A 3AASA 2ZG0H 1PPCE 4RSPA 1QBNA 3S0NA 1W2KH 1K1PA 2VH6A 1IQHA 2HNTE 3KN2A 1QB9A 3B23B 1FDPA 5HMAA 4CBNA 2BX4A 1XUKA 4JCNA 1KXAA 1T4VH 4BANB 1J14A 1UVOA 1PYTD 3URDA 4AZ2B 1DLEA 1QRZA 1TGTA 5JDUB 8GCHG 2ZDAH 1E38B 1SR5C 1GI7B 1P3CA 5JBCS 1TNLA 2QCYA 1P09A 3BTTE 4K3JA 4M7GA 1O5DH 1O2KA 2CHAC 1K1NA 1TMUH 2GCHG 2OC1A 5DK1A 1TALA 3ATIA 1KTTB 1HXEH 1OWEA 1V2VT 3HATH 4MTBA 1O2MA 2BB4A 1Y3UA 2GVFA 2ZEBA 2PFEA 2FS8A 4NIVA 1HAVB 3MU0A 3OY6U 2BLVA 3LIWA 4HFPB 1QGFA 2FS9A 1DUEA 3ZVFA 2FOCA 2BOHB 3KQEA 2ZPQA 2ZGJA 1ETRH 2Y5GA 1C5RA 1WV7H 2A32A 2C8YB 4Y76A 1P3EA 1TQ7B 4BXWA 3GY7A 1GBDA 1ELTA 1O5EH 4THNH 4ZHLU 2PTNA 3BEUA 3B9FH 1O3GA 1ABJH 2G51A 1Y59T 4OS1A 1K1LA 1RFNA 5GPIB 4BTUB 3QK1A 1AFQB 2YNBA 1FAXA 1NRNH 1ORFA 4YESB 2D26C 4Y8ZA 3S9CA 1MTNB 3RMOH 1AMHA 2B5TB 1S82A 5F03A 2F91A 1RTKA 1KIGH 5E2PA 4GAWA 2P3FH 4WXIA 3BEIB 3UR9A 2SNVA 3RXOA 3TJNA 1BZXE 6LPRA 4KP0A 2Q6GA 1K9OE 4K1TA 4FXGH 1LHEH 4GLYA 3GY3A 1O33A 1PPBH 3HK3B 4CRDA 2NU2E 1IHSH 4XOJA 1HAPH 2WUCA 4BAOB 4ZROA 3TPIZ 2G5NA 1O2LA 1ZMJA 3BG8A 4ZMAH 1O3BA 3QZRA 3PMHB 3BSQA 3VPKA 2V3HH 2Q1JA 2OINA 1SGFG 1C5OH 1AUJA 2XBVA 3SQEE 1EP6A 4TYDA 2FI3E 3ZVEA 4DY7B 1KDQB 2D8WA 1F0RA 1P9UA 1O32A 3QGNB 3OSYA 1O3KA 2PGQB 4B73A 5A0CA 4FU7A 2HPPH 2R3YA 4H6TA 1H1BA 3M5NA 1ESBA 7GCHF 4B2BA 2XC5A 2UWOA 3SZNA 2G4TA 3SUFA 1GVKB 1BB0B 3F9HA 4WF8A 2B8OH 2FEQH 1ANCA 1GJ4H 2RDLA 3UOUA 5C1XA 1P2QA 1O2RA 2H9TH 2QA9E 1CHOF 2PKAB 2EEKA 4CREA 3SU2A 1Y5UT 1YGCH 1EB1H 1O37A 1TNGA 1V2RT 1RXPA 3ZVDA 2AMPA 3KGPA 3TGIE 1RGQA 3QWCH 1AFQC 1B7XB 4AFSA 3RMNH 1Y3WA 1LPKB 3RXFA 3GDUA 3PLPA 1F5RA 1P11E 2ZGBH 1SGFA 3DFJA 1FPCH 3MTYA 3DT0H 3A84A 2FIRH 1ELBA 1LDTT 5TCCA 1HDTH 1BTWA 2ASUB 4NSYA 4NGAH 1SLXB 2Z9JA 2J38A 2ULLA 1VITF 1WOFA 3T62A 3KQCA 5E0HA 5DP7A 4CH2B 3PO1B 1O2XA 2XXLA 1QHRB 1HLTH 1DWDH 2GTBA 4JYVH 1ABIH 1QR3E 8LPRA 1GI4A 2FXRA 3U8OH 1CGIE 2FX4A 3T29A 2ZPRA 1HAYB 1LPGB 3ZVAA 4D76A 3BTQE 2QAAA 1C5XB 4Y7BA 4MQAA 2CGAA 1ZGVA 1CGHA 1C1OA 4MNXA 4NG9H 1BT7A 4JYTA 1G30B 6ESTA 1CQQA 1ZTKA 3EE0B 2BY7X 3UTUH 3A88A 1S6HA 4ZKRU 1BRCE 4RN6A 2BQWB 1G3BA 3ELAH 2BDGA 1VGCB 3TNSA 1T8OA 2BDCA 1L1GA 1D6WA 1MZDA 1AD8H 1C1PA 2OQ5A 1GI2A 1HJAB 1P0SH 2AERH 5FPSA 5SGAE 1YCPM 4GPGA 2NU0E 1SSXA 3PLBA 4ISLA 4AYVB 1GBBA 5ABWA 4A1XA 4FUCA 1MBQA 2XTTB 1W14U 1IOEA 1GL0E 5EOKA 2ZKSA 4MLFB 3T2NA 2GKVE 4KELA 4KGAA 2FOMB 4I7YH 5HGGA 1GCTB 5EXMA 4H4FA 1UVPA 2ZDLA 1T7CA 2BD3A 4CRAA 1K21H 2BLOA 1SBWA 4LZ4B 2H9HA 4K60A 1FZZA 2G4UA 1LQEA 1C5YB 3MYWA 3Q00A 1GHAF 2F9UA 2SNWA 2F9PA 1IQJA 1WAYB 1A5GH 4YZUA 3ZZCA 2V3OH 4NFEA 2BD8A 1HYLA 3SV7A 2VIVA 1F92A 3PO1C 3SU1A 1O3CA 2BYAX 5A8YA 4D9RA 1P01A 1HBTH 3QTOH 1ARBA 3A85A 2HWLB 4NIWA 5IDKA 4JK5A 2ANKH 3E16B 1DY9A 2PSXA 2Z3DA 1C1SA 4CHAC 1FY3A 2GZ9A 1Z6JH 3Q3YA 4ASHA 2XWAA 1D4PB 3NCLA 1AY6H 3F1SB 1O5BB 4X1PU 1ETSH 3SUDA 1OXGA 3BG4B 1SGRE 2THFB 4I8KA 1UO6A 4AORA 2WPIS 1NM6A 3U8TH 1V2QT 1ELVA 1O36A 3S7KB 5F8ZA 4CR5A 1PPFE 5T6DA 7ESTE 1O39A 7GCHG 1KTSB 2BDBA 1MAXA 1VGCC 5I25A 1Y3VA 3STIA 2A5AA 4IBLH 1HJAC 1CVWH 1ZLRA 1BMLA 1TNJA 3TGJE 3FVFB 1O3AA 1PPHE 1A2CH 1SB1H 4ZKSU 1SLUB 4GVUA 1MUEB 2PSYA 2Y7XA 1CE5A 3CS7A 2TGDA 3RU4D 1G2LA 5L30H 2OLGA 3P95A 1E35B 4A92A 1GCTC 2A4OA 1XKAC 3SQHE 1TB6H 3GISB 1Q2WA 3KEEA 4NFFA 4YT7H 2VIPA 3MH4A 3UFAA 3VB5A 2BMGB 1SVPA 1A0LA 1TMTH 1YBWA 1SLVB 2FYQA 2Y7ZA 3BTGE 1FQ3A 1GVLA 5B6OA 2QXHA 4UD9H 1ZHMA 1C5QA 1EJAA 4MPXA 1BJVA 1YM0A 1TGBA 4IMQA 2XC0A 1HAOH 1QNJA 3SHAH 1J16A 1THPB 8GCHF 1F0UA 3RLWH 1LHGH 5TJXA 1AZ8A 1C2DA 2R9PA 3E0PB 1KXEA 4INLA 4X0WU 1DVAH 1L1NA 2Z7FE 4WH8A 3S9BA 3TLOA 1P03A 1O2IA 4OS5A 5EG4A 2GCHF 3E6PH 3ZZ3A 1A1RA 4IC6A 3E91A 1GHYH 1TBQH 2Q6DA 5G4BA 1Z6EA 5C2ZA 5JBAS 4UFEH 4DJZB 3ZYEA 3RXDA 1AHTH 1UTJA 4INKA 5CE1A 1CBWB 3UIRA 2WV5A 1O2TA 3PB1E 1SI5H 2ZCHP 4MVNA 2ZHFH 3OX7U 1OYTH 5JB8S 3BIVH 3H5CB 1T8NA 1RIWC 3AW1A 3K9XB 3SNAA 3PWBA 1C5LH 1TE0A 3SV6A 4ABIA 2PR3A 1PQ7A 5K0HA 3SNDA 2IN2A 2F83A 5E2OA 2FTMA 1XUFA 2BD2A 3FP7E 1TNKA 2A7HA 1ELGA 4ZH8A 2PHBA 1ANBA 2A7CA 1DS2E 4ESTE 1FLEE 2G5VA 5HM2A 1RTLA 1J8AA 4BAHB 5J4QA 1C9TA 1P2KA 4ABAA 1NZQH 2ZA5A 1Z71A 3NKKA 3SU5A 1WCZA 1T8LA 1P2OA 5LPRA 2FLRH 1B0FA 4ZKOU 2ZECA 1AI8H 1DXWA 1C1TA 1C9PA 4Z0KA 5CHAB 4Y8XA 3RP2A 1KLJH 1GHAG 4OGXA 4TWYA 5FHTA 1ARCA 2A4RA 1AIXH 1UTOA 1ZMNA 2Q6FA 3GCTF 1P57B 1DX5M 1N6YA 1RD3B 4DOQA 2GMTC 4ZXXH 1EATA 2AS9A 3TK9A 1UTNA 1WTHD 1VITH 2ZP0H 4FUEA 1H8IH 1VCQA 1GJBB 3OYPA 1MAYA 2TGTA 1SLWB 1E36B 3F9FA 1GMHG 1KLIH 3M3TA 1SGYE 3FZDA 3GDSA 4DVAU 2QXIA 2ZF0H 2OUAA 5EODA 5JB9S 3IITA 4HI3A 2FOGA 1MCTA 1O30A 3LJOA 5L6NH 1THSH 1OP8A 1QA0A 4Y11E 2EI8A 2UWPA 1ZSJA 4Q2KA 3BF6H 1TLDA 3UUZA 4Q7ZA 1UTKA 2ZPSA 3S7HB 1OWHA 3V7TA 1MQ6A 2KAIA 5GDSH 5HYOA 4NZQA 1O2YA 5FCKA 3VEQB 1BRBE 1EXFA 1LHFH 1EP5A 1QJ6B 3O8BA 1GMCF 2VNTA 2V35A 1MKXK 2ZDMA 8KME2 3HPTB
chains in the Genus database with same CATH superfamily
3OTJE 5IYTA 1AVXA 2PKSB 4YOJA 1EAUA 1A5HA 3Q3XA 5A2MH 4ISNA 3U69H 2XW9A 1TX6A 1EZSC 2OP9A 5EU8A 1YCPK 1C5NH 2OC7A 1NFUA 1BMMH 1GBAA 1AB9C 1GHZA 1XUHA 5C67A 4AGJA 5BPEA 2CV3A 1GJ9B 2ZGCA 4TY6A 1PQ8A 1JOUB 2FESH 4FUBA 1W3CA 5CHAC 1O35A 2ZFSA 4HGCA 3T27A 2R2MB 3OAAD 4B71A 1EFRD 2RG3A 4B2AA 2CN0H 5DGJA 4NWKA 3QTVH 4IS5A 4LK4A 3U98H 5GCHF 1BMFD 3BTHE 1LHDH 2JETB 2OTVA 1ELFA 3DUXH 1SFQB 2Z9GA 3GY8A 4UFFH 3P17H 1IQEA 2AGIX 1QJ7B 5DP4A 5L2ZH 3RMMH 2WYGA 1HXFH 2WV9A 2VGCC 3MHWU 1SOTA 2ZU2A 7LPRA 2VIWA 1LQDB 1AFEH 3PYHA 4I32A 2KCPA 3PV4A 3B8JA 8ESTE 2LNCA 2EI6A 2XNDD 1OWKA 3D23A 4LZ1H 3AW0A 3KYGA 1ANEA 1QRWA 1L2EA 2OXSA 5EXLA 3IG6B 2WPDD 3OTPA 3SGBE 2FM2A 1NU7B 1DPOA 3ZVGA 4DCDA 4RI0A 3CS0A 3UPEA 3LOXA 1QFKH 3P8NA 5FX5A 7KMEH 1GI0A 3RXHA 1TGSZ 1YLCA 1L4ZA 2IJD1 5E8EH 1EOLA 1TPSA 5DN6D 1SMFE 1O5CB 1H8ED 3CP7A 2O8UA 5T3HA 2ANWA 3PRDA 3RXKA 5ETXA 4HZHA 2Y80A 3D65E 2PKSC 2Y6TA 2FP7B 3OEED 3ZZDA 5DP5A 5FX6A 3BIUH 1C4Y2 3Q3KA 2YNAA 1QL7A 1ESAA 1ANDA 1W11U 2AFQB 3MU1A 4Z6AH 3O8RA 3UWIA 1TGCA 5B6LA 2A7JA 4D8NA 1E1QD 1DE7H 4BOHA 1EAWA 4IW4E 1CU1A 1ZOMA 3RXJA 3UNRA 1SGTA 5EIYA 5HXFA 1GHBF 1HB0B 1BHXF 4M9FA 1BOQA 1EB2A 3EDXB 4AB8A 3A81A 1OWDA 3LC5A 2ZTZA 2LP6A 2JETC 2ZQ1A 1FJSA 1TRNA 1YPKH 5AFYH 3GCTG 3ZZAA 3LGTA 1PPEE 3C27B 4ZXYH 2KCOA 3SUGA 1C1RA 3P92A 2G52A 1BTHH 1NC6A 2TBSA 1H9IE 1T31A 3PTNA 1MMJN 5F53A 1P2NA 1HAGE 1OOKB 2V7QD 1K22H 5FPYA 5DJ7A 3ATKA 3RMLH 1P2JA 2ZNKH 1Z1JA 1MKXH 1O2GH 2EQNA 5DO4H 1WQVH 1W7GH 2GJGA 1W8BH 3EA7A 3SJ9A 1A4WH 3RXBA 1FMGA 4ISIH 3RU4E 1XXDA 2SGAA 1S5SA 1D3DB 1BIOA 1SGPE 4O3UA 1Y5BT 1K1OA 1TFXA 3KCGH 3NWUA 1YCPH 1SQAA 1V2MT 1O2UA 2TRMA 3TJVA 3SNEA 1TOCB 3BV9B 2ZFTA 2FO9A 4O9VA 1C4U2 2KX4A 1EZUC 2NU3E 3EA8A 1LMWB 5IK2D 1MTVA 9ESTA 2B0FA 1P10A 4Y0ZE 3MQKC 1Y5AT 1GMCG 4JK6A 2M5TA 2HRVA 4JZ1A 3RXLA 2BDIA 4YOGA 1JIRA 1TONA 2B9LA 3RXEA 1MTSA 1DSUA 1FY5A 1TPAE 1BQYA 1C5WB 3AAVA 1DDJA 1BTUA 2VINA 4TPYA 1BDAA 5A0AE 2NWNA 2VIDA 3SORA 1SGDE 4PROA 2RA3A 1ETTH 2ZIQH 3P6ZB 2PGBB 1NY22 2BY5X 1NU9A 4TY7A 1W0ZU 2VWLA 2XCFA 1YPHC 1COWD 1ZZZA 1LVMA 1PYTC 1KY9A 1C5PA 2Y5HA 3DD2H 1H8HD 2ESTE 1O5AB 4FUJA 2Z9LA 3RXTA 1C2KA 1F7ZA 2JKHA 1YPEH 5HIZA 1Y3YA 5JBTA 1S81A 5FPTA 5GCHG 1DFPA 1TPPA 1GI6A 2PUQH 1QQUA 1HIAA 2K1QA 3LKWA 4FU8A 1O3IA 4GCHF 1GHWH 3TH2H 4MPWA 4QT8C 1N6XA 3TIUA 1H9LB 1KXFA 3MI4A 1ZHRA 1O5GH 3RXQA 3RUOA 4NA8A 1FV9A 4CHAB 1EZXC 4Y8YA 3HKIB 1SOZA 4OGYA 1KYNA 3UQVA 1GBCA 1GHXH 5AFZH 1KMHB 1QQ4A 1QCPA 1DY8A 1HAZB 2PWXA 3QX5H 2C3SA 3A82A 2ZWLH 1SGEE 1TNIA 2RA0A 2K0QA 1D3TB 1U6QA 2VVUA 2FLBH 4RKOB 4FU9A 3RXUA 3S69A 4CBOA 1G3CA 5C0UA 3F6UH 2VWOA 1AN1E 1GPZA 1ELEE 1XUGA 2GZ7A 3ZIAD 5AVDA 1F5KU 1V2KT 3K6YA 5HIYA 1WQSA 2JH6D 1UW7A 1G2MA 1GBFA 1V2TT 1P02A 4WMFA 1IQMA 1O2WA 3LT3A 1FUJA 2A5KA 4I8JA 1GJ6A 3M61U 3SV2H 1XKBC 5CHBA 1MBMA 1QJ1B 4B2CA 1Q31A 1NPMA 2W3KA 1WYKA 4XFQA 1C5UA 2EC9H 2P8OB 1C1VH 4X2VA 1NRRH 1K0HA 1YLDA 1T8MA 1BTXA 4X1SU 3SNCA 1BRUP 2A4QA 1CT2E 1YP9A 1BRAA 1RTFB 4DG4A 4GHTA 3V3MA 1V2LT 1ZJKA 3OY5U 1CT4E 1MABB 2ZTXA 3SU4A 3GDVA 1ELCA 2FOAA 4LOYH 2STAE 2G8TA 3BTME 2GCTB 2H1UA 5FXLA 2VIQA 2O8WA 2VH0A 1MH0A 4BAMB 1WU1A 1ZPZA 2CF9H 2WPJS 2H5CA 1GHBG 1O3JA 5LH8A 3KQDA 1O3LA 3GYLB 1KXBA 3K2UA 4BTIB 4WVPE 1AWHB 2XBYA 4U30A 5EJ1A 2QGRA 1K2I1 1FONA 3ODFA 1FY8E 1INCA 3LU9B 4CRCA 4HG6A 5C1UA 3R0FA 3BTDE 1BITA 1GJDB 1GMHF 2ZU3A 4K2YA 4WMEA 2XBWA 1V6DA 2NU1E 2ZU1A 2BD9A 1GBMA 5FCRA 1OSSA 1K1IA 2F3CE 1G36A 3SV8A 4YT6H 1ZJDA 1RJXB 2RCEA 2A2XH 2F9VA 2AGEX 2KZ4A 1AE8H 3F0PA 3MU5A 1H9HE 1W12U 1SGIB 4JZDH 6GCHF 1GCDA 2J9NA 3MNCA 2PW8H 2FOFA 1UK3A 3A8AA 1SG8B 2QF4A 1RIWB 4XSKU 2JDID 4ABHA 2GT8A 4R0IA 5T1VA 4ZHAA 2A0QB 1SQOA 4WMDA 4X6NA 2HPQH 1S0QA 2VJ1A 5EGMA 1TMBH 4YLQH 5LPFA 2EY4C 1HJ8A 1KXDA 3VXFH 3TK5A 1Z8RA 3UQOA 5EW1H 1IHTH 2J34A 1P06A 2NU4E 3SNBA 2OBQA 5EQRA 2P8OC 3C1KA 4IMZA 3RM2H 1YPHE 1OKXA 1GL1A 1AZZA 1QRXA 2FZZA 1C1WH 2G81E 3V0XA 1QURH 4XBBA 3JZ1B 3SGAE 3MNSA 1ESTA 4X8UH 3RXMA 3SUEA 2GCTC 2FI5E 1W0KD 4ABFA 3AK5A 1O5FH 2BY8X 4ABEA 4RKJB 2ZFQH 1RRKA 2R0LA 1HAVA 4O03A 2ZC9H 2OQUA 1DLKB 5FBEA 3SJ8A 3GCOA 4AG1A 3QLPH 1A5IA 1GHVH 2ODYB 1NESE 2GMTB 4GCHG 4YM9A 1NRSH 1P8VC 3GY2A 3M36A 1PJPA 2F9BH 2ZDVH 1GJCB 4Y79A 1W13U 1P04A 2AMQA 2R0KA 3MOCA 4AYYB 1UTLM 3A7TA 3LGYA 2VIOA 1XX9A 2ZU5A 3RXAA 4ISHH 4FUGA 1IQKA 4F4OC 3UAIC 1XMNB 5FBIA 1YYY1 2XYAA 3F68H 1LKBA 3RXGA 1NRQH 1DT2A 3LDXH 1CA0C 5HKKD 3FANA 1C5SA 1AQ7A 1P2MA 3JZ2B 4D9QA 4XRNA 1HV7A 1K28D 1G32B 3NK8A 4I86A 5HM9A 1WBGB 1C2MA 4INHA 3RXIA 1C2HA 1YC0A 1GJ8B 3PROA 3P70B 3KL6A 1DANH 3A7ZA 3F2FA 5F8XA 1NS3A 1C1NA 3A8BA 1TA2A 2V3MA 2BQ6B 1L0ZA 1UCYK 4WH6A 1JRSA 4GUXA 2V0BA 3SI4H 4OS7A 1YPLH 1VJ9U 2P93A 2FOEA 2AH4X 3ZVCA 4MPVA 4OM9A 1C5MD 3UWJH 2C93B 1P12E 1V2WT 3Q76A 2WPMS 2J4IA 5BRRE 4AN7A 4FOUC 1HIAB 1LO6A 1S85A 1EZQA 4FVBA 3E8LA 2AIQA 1AB9B 1Z8IB 2QXGA 1L4DA 1LVYA 4VGCB 1ZRKA 1VCWA 1HGTH 3RC6A 3VB4A 2Z6BD 1EASA 3BN9A 2ZHWH 5C94A 2TIOA 2YMSD 1TYNA 5GXPA 1EX3A 1RS0A 3TH4H 2OBOA 4F48B 2W26A 4GSOA 1EQ9A 2SGPE 1F0SA 3SYJA 3PM3A 2ALVA 4B75A 2FX6A 2GGVB 3UNSA 2FI4E 2R3UA 1GBJA 4K69A 3U9AH 4F55A 3FFGA 1H8DH 1O0DH 1V3XA 3TVJB 2IPHA 1ZGIA 5L2YH 2KR7A 3MNBA 4A1VA 3WY8A 3U28C 2BD5A 1EJMA 1B0EA 4Q7YA 3N7DA 3HKJB 1DWCH 3W95A 1UCYE 2VGCB 2KCYA 2ZDNA 1TX8A 4IGDA 2G55A 4AB9A 1WSSH 1OPHB 2AMDA 1SGQE 3UNQA 3V13A 1DITH 1UVTH 2HVXA 1ZSKA 1SFIA 2WINI 1SC8U 3FZZA 2FDAA 1XVOA 3WW7A 2H2ZA 1ZYOA 3A87A 3ATWA 6GCHG 1YPMH 3IWMA 4BTTB 4P02A 2VWNA 1EUFA 2DE8A 1PFXC 2O9QA 3DCLA 2VVVA 3STJA 1S83A 4OS4A 5C5NA 1WDIA 1Z8GA 2CJIA 3U1IB 1E34B 3KF2A 4F49A 1DXPA 1F5LA 4NZLA 3ESTA 3FN8A 4YOIA 1C2FA 1FIWA 3TH3H 4A6LA 2H5DA 2F9NA 1E0FD 1HNEE 1MQ5A 3V12A 3NZIA 4LXBH 3CENA 1MTWA 3TJUA 3QUMP 1YY3A 3ZZ9A 1CA8B 1OP2A 1YKTA 3P8OA 1C5TA 1H4WA 1K1JA 2PP6A 2W3IA 3M37A 3OFND 1FY1A 4VGCC 1O31A 3SHCH 4OS6A 1UJ1A 3LGWA 1UVSH 1SGCA 1ZPCA 2GX4A 2GDEH 4E7NA 2AEIH 4B76A 1OWIA 3TJOA 3M35A 4I8GA 1THRH 2V6NA 1AU8A 2BXUH 2QYIA 2B7DH 4MNVA 2BD7A 4X2YA 1PPGE 3F2HA 3VGCC 2QIQA 1A3BH 2Y5FA 2STBE 5F8TA 5EXNA 3A7YA 2QC2A 3NXPA 1HJ9A 2BY6X 4Y7AA 2HLCA 5JBBS 9LPRA 3GY5A 3NPSA 2ZHQH 4YLUA 2WYJA 1M9UA 1UCYH 3A83A 3MWIU 1DSTA 1BHXB 2ZI2H 1LVBA 1JRTA 2AIPA 1QBOA 2ZZUH 3GCHB 3KQBA 3PMAB 5A8XA 2C4FH 3Q77A 1NFXA 2ANMH 1MCVA 2A1DB 3LJJA 3KIDU 4GHQA 4NA7A 1E37B 3ZV8A 2Z3CA 3T5FH 3MMGA 2PUXB 2FPZA 1ELDE 2ZGXH 1GMDF 1BUIA 4J2YB 4OS2A 1AE5A 1D3PB 4X8SH 1AVGH 3E0NB 4X2WA 3H7TA 1FIZA 2Z9KA 1AUTC 3M7UA 2Z9IA 4BXSA 3I78A 1GJ7B 3PMBB 4X1RU 4ZKNU 2BQ7B 1A0JA 1A61H 1VZQH 1V2OT 2J94A 1D6RA 2BVRH 2QY0B 3VFEA 1TWXB 1QZ8A 5PTPA 3WWFA 3ZV9A 1CT0E 4IC5A 1AGJA 3BTKE 2WPHS 3A8CA 1O2ZA 3UR6A 2WPLS 1J17T 1NO9H 4Q7XA 2FOBA 1ZRBA 2FODA 5JPMH 5LPEA 1F0TA 4KTUA 1IQLA 2ODQA 4CR9A 4R8TB 3RXVA 1GBIA 3DA9B 2BLQA 1PQAA 2ZU4A 3RLYH 3FAOA 2BZAA 2J98A 1DOJA 2BOKA 1GG6C 2ZFRH 1PQ5A 4X6MA 1OS8A 1MZAA 2PTCE 2ALPA 2VWMA 3RXSA 2Z94A 3EA9A 2GDDA 2CMYA 4UFDH 4NIYA 5J4SA 2JH5D 4K8YA 3ITIA 1A0HB 4B6EA 1HRTH 2F43B 1J9CH 1SQRA 2DUCA 2Y82A 2A2QH 3GCHC 1KXCA 2L6OA 5DP9A 4FUIA 2CXVA 2O8TA 3FP6E 3SOSA 4U32A 1GBKA 1HAXB 1AWFH 1EAXA 3LH3A 5C0TA 1HPGA 1C5VA 4KKDA 1AO5A 1BTYA 4NA9H 3ZZ7A 2ZFFH 2EI7A 2WUBA 2P95A 1D3QB 4XBCA 4DIIH 1W10U 2A4GA 4MG3A 1E1RD 1AKSA 1XVMA 4BNRA 5EPNA 1XXFA 1JIMA 1GBEA 1UK2A 1SHHB 4D7GA 3GY6A 4KTSA 1DWEH 2C8WB 3HGPA 2SGDE 1CO7E 3ZZ5A 1NTPA 1NN6A 1N8OB 1EPTA 4A1TA 1BTZA 1O3NA 1S0RA 3AAUA 1TQ0B 1O3DA 2VVCA 1C1MA 1JBUH 3MNXA 5A8ZA 3A7XA 4JYUH 1TBZH 3E1XB 2WV4A 4HTCH 4B1TA 3MU8A 3MH7A 3H7OA 1MTNC 2TPIZ 1L1JA 1C2GA 3ZYDA 1JMOH 1PPZA 2HOBA 1V2ST 5E0JA 2IOTA 2H9EH 1UVUH 1ZSLA 1GJAB 1QIXB 5AHGH 1VKYA 1C2JA 2KAIB 3PRBA 1NT1A 5ESTE 1QTFA 3GYMA 1KSNA 3VB3A 3D62A 2D2DA 3RXPA 5GWZA 3HK6B 5DG6A 4MNWA 3AVZA 4DW2U 1CSOE 1ZMLA 1XM1A 2ZFPH 2AGGX 4P00A 2O8MA 2ZCLP 3FP8E 2PV9B 4YTAA 2F9OA 1GVZA 1S6FA 4XE4A 3QGJA 3TU7H 1O34A 3A7VA 4Y0YE 1EJNA 1GWAA 3A8DA 1BA8B 4YO9A 4JZEH 3LONA 1BJUA 1BMAA 3CNRA 3LGUA 2SGFE 1MD8A 3EYDA 3U1JB 3M5OA 2QV1A 2ZHEH 3K65B 5EQQA 4O3TA 2C8XB 1A46H 3OU0A 1IQGA 3VXEH 3PMJA 3SZEA 1LKAA 2GD4B 4K8BA 1GMDG 1YPJH 3S9AA 4A5TS 1LCYA 3QDZB 3M3SA 4NCYA 3T25A 3LGVA 3SJOA 5CDFE 1LHCH 4DT7B 1SHYA 3MFJA 2GP9B 4YXWD 2BD4A 2UWLA 2ZTYA 2HLDD 4AC9A 4AX9H 1N8OC 4Y10E 4IN2A 3SN8A 4ABDA 1VCPA 1GI5A 2TGPZ 4ACAA 1SGNE 2A5IA 1DICA 1QBVH 2W7SA 4E7RG 3TGKE 1LVOA 1VJAU 2R2WU 4H42U 3P8GA 4ZAEA 1FY4A 2P94A 1O3MA 4MPUA 2FMJA 3U8RH 1FXYA 3M3VA 1YLNA 4DGJA 5I46H 2YOLA 1BBRK 4E06H 1O3FA 3EAJA 1FNIA 1ID5H 1ACBE 1UTMA 4U2WA 1TIOA 2J92A 4X6PA 1ELAA 4FUDA 1XUIA 1CHGA 3ENSB 5KGOA 1ZTJA 2XWBI 1O3HA 3F9GA 3I29A 2C90B 2CF8H 4H6SB 4UE7H 1BCUH 1QB6A 4X6OA 3GCNA 3UY9A 1DWBH 2D1JA 3ZZ6A 3TITA 4CRFA 4X1NU 4ISOA 3W94A 1TX7A 3MH6A 2AYWA 1MU6B 1Z8JB 2SGQE 1V2UT 1Q3XA 1WTGH 1C2LA 3UOPA 1W0JD 3F2GA 3LH1A 2HGTH 3SU6A 1MU8B 3EQ0H 4E05H 2ANYA 2OC8A 4KTCA 3M5LA 1QL8A 2UUYA 3A80A 1CA0B 4ABBA 2Y81A 4AFQA 1UK4A 1A7SA 1GJ5H 2EA3A 3M7TA 4NIXA 4ZHMU 2BVXH 3RDZA 3TNTA 2UUJB 2UUFB 2H6MA 3DFLA 4K1SA 3SV9A 4UONA 1O2QA 1UHBA 1N1LA 4ZUHA 1EAIA 1HAHH 3SJKA 1Y3XA 1P9SA 4Y71A 1GI3A 2GT7A 1WUNH 1BBRE 1T4UH 4NSVA 4TWWA 4J1YA 2I6QA 3TK6A 4AFZA 3D49H 2VU8E 2FWWA 4B74A 2XOKD 2J98B 2IJOB 4ACBA 1TBRH 2O8LA 5C5OA 1O2HA 2JJ1D 1OP0A 1V2PT 3LC3A 4I33A 4TPIZ 2SFAA 1G3DA 2JH0D 2BZ6H 2BY9X 2LPRA 1G37A 1LPZB 3ZZBA 2XNIA 1QY6A 4FETA 1CHOG 2TGAA 3E3TA 2WPKS 1MD7A 1F2SE 1FN6A 1DUAA 1GBHA 3KYFA 5DP6A 3L3TA 1LTOA 1FAKH 2BLWA 3O8DA 4SGBE 4SGAE 2ZO3H 4I8HA 3ODDA 4CRBA 5H4IB 2J95A 1TGNA 2CK3D 2FTLE 4XBDA 2VB0A 1O2NA 1MKWK 3BEFB 1TABE 4CRGA 3RXCA 1IQIA 3QN7A 1FPHH 2A31A 4DIHH 1YPGH 1EKBB 4UDWH 1SQTA 1O2PA 4DT4A 1Z7KA 1HFDA 1P05A 2DE9A 2QXJA 1MTUA 1QL9A 2ZDKA 2HALA 3OEHD 3KHVA 2HNTF 5EPYA 3QZQA 2ZHDA 1UTQA 2BDHA 3EGKH 3SW2B 2BDYA 1O3EA 4X2XA 1AKSB 5K7RA 4X8TH 2QF3A 1CGJE 1VR1H 4I31A 5FAHA 4JZIA 1G3EA 1OWJA 1VITG 3G01A 1O2SA 4WXVA 6CHAB 2XRCA 3M5MA 4D7FA 3O8CA 1NRPH 1GDQA 2JIZD 1EPTB 4K1EA 1UMAH 2XBXA 4A7IB 3PLKA 1IQFA 5GNDA 4UFGH 2HNTC 1NROH 3T26A 1NFWA 5EQSA 1W7XH 3VB6A 2Z3EA 1TRYA 3BG4C 3ZZ4A 2BXTH 1HAIH 1NBMD 1NFYA 2BVSH 2GV7A 1O2OA 3T28A 4BAKB 3RC5A 1IAUA 1ZHPA 1DM4B 2BTCE 3PTBA 3RM0H 4AOQA 1O38A 4AGKA 3GY4A 1BBRH 2XCNA 4IN1A 1SL3A 2GZ8A 2ZGHA 5DP3A 1P2IA 1T32A 1SPJA 2BM2A 3I77A 4TSFD 4AFUA 4WJG2 2ODPA 3P8FA 2BHGA 5F6MA 1O2VA 2PLXA 2OD3B 3GS9A 3FOAA 2ILNA 3R3GB 5LGOA 1GDUA 3RXRA 4MNYA 2UUKB 2P3TB 1KDQA 2IPQX 1QB1A 1ZPBA 3A7WA 3SBKA 4ABGA 4JMYA 4NWLA 3MO6A 3UREA 3GOVB 4XDEA 3SO3A 1BMNH 3ATMA 5GJ4B 3MH5A 1A3EH 3SU3A 4BAQB 5KEDA 1O3OA 2W5EA 3MO9A 1HUTH 1O2JA 3K6ZA 3PWCA 1C1QA 1C1UH 3ZZ8A 5T6GA 5DP8A 3MU4A 4CH8B 3VGCB 2P3UB 1ZTLA 1D9IA 5JYIA 3LPRA 1XUJA 3MO3A 1W0YH 4DURA 2PKAA 1Y8TA 1GGDB 3SGQE 3NUMA 1QA7A 2GV6A 1V2NT 3L6PA 4ABJA 3URCA 3NRLA 3ATLA 6CHAC 2OCVB 1X7AC 2OC0A 1O3PB 4WY3A 2BX3A 3BTFE 1OYQA 5EW2H 1EPTC 5DPAA 1G9IE 3BTEE 1FI8A 3VG8A 5ESBA 5A0BA 1TNHA 1ZR0A 1JXPA 2P16A 3E90B 1AVWA 1IQNA 4AG2A 2I6SA 4X8VH 5DKMA 3QO6A 1C5ZB 1Z1IA 5C20A 2CHAB 4WWYA 3SJIA 2C8ZB 2A45B 1C4V2 1JWTA 4I8LA 3VB7A 5TCAA 3GICB 1GI1A 5T6FA 1C2EA 3BTWE 3A86A 4UEHH 2BDAA 1CBWC 3F9EA 1TRMA 1V2JT 4RT0A 2KM0A 1MKWH 3HGNA 2FYRA 4K5ZA 2YMSB 4X1QU 4FUHA 4Q80A 1TAWA 1OX1A 1UTPA 3DHKH 3ZVBA 2ZQ2A 5C1YA 1TOMH 3SI3H 5A09A 3M7QA 1K1MA 3RU4T 1FN8A 2QN5T 1YF4A 3KNXA 1GBTA 3SU0A 2J2UA 5AF9H 4U01A 1HCGA 3A89A 2FOHA 4MDSA 1GDNA 3L33A 1KLTA 2G00A 3RC4A 3N7OA 4Z1MD 1TA6A 1B5GH 1GBLA 1EOJA 3LGIA 4JZFH 4O97A 4FUFA 4Y6DA 1GG6B 2P59A 2XC4A 5CMXH 1C2IA 1GI9B 1TPOA 1J15A 1FX0B 2ZCKP 5E0GA 1GI8B 2WHXA 2W7UA 2SGEE 1UHBB 4FVDA 1BTPA 5GIBA 2QF0A 5C3NA 1GGDC 1S84A 3AASA 2ZG0H 1PPCE 4RSPA 1QBNA 3S0NA 1W2KH 1K1PA 2VH6A 1IQHA 3WWBA 2HNTE 3KN2A 1QB9A 3B23B 5FL7D 1FDPA 5HMAA 4CBNA 2BX4A 1XUKA 4JCNA 1KXAA 1T4VH 4BANB 1J14A 1UVOA 1PYTD 3URDA 4AZ2B 1DLEA 1QRZA 1TGTA 5JDUB 8GCHG 2ZDAH 1E38B 1SR5C 1GI7B 1P3CA 5JBCS 1TNLA 2QCYA 1P09A 3BTTE 4K3JA 4M7GA 1O5DH 1O2KA 2CHAC 1K1NA 1TMUH 2QE7D 2GCHG 2OC1A 5DK1A 1TALA 3ATIA 1KTTB 1HXEH 1OWEA 1V2VT 3HATH 4MTBA 1O2MA 2BB4A 1Y3UA 5EJLA 2GVFA 2ZEBA 2PFEA 2FS8A 4NIVA 1HAVB 3MU0A 3OY6U 2BLVA 3LIWA 4HFPB 1QGFA 2FS9A 1DUEA 3ZVFA 2YMSC 2FOCA 2BOHB 3KQEA 2ZPQA 2ZGJA 1ETRH 2Y5GA 1S6LA 1C5RA 1WV7H 2A32A 2C8YB 4Y76A 1P3EA 1TQ7B 4BXWA 3GY7A 1GBDA 1ELTA 1O5EH 4THNH 4ZHLU 2L74A 2PTNA 3BEUA 3B9FH 1O3GA 1ABJH 2G51A 1Y59T 4OS1A 1K1LA 1RFNA 5GPIB 4BTUB 3QK1A 1AFQB 2YNBA 1FAXA 1NRNH 1ORFA 4YESB 2D26C 4Y8ZA 2JJ2D 3S9CA 1MTNB 3RMOH 1AMHA 2B5TB 1S82A 5DSFA 5F03A 2F91A 1RTKA 1KIGH 5E2PA 2LELA 4GAWA 2P3FH 4WXIA 3H09A 3BEIB 3UR9A 2SNVA 3RXOA 3TJNA 1BZXE 6LPRA 4KP0A 2Q6GA 1K9OE 4K1TA 4FXGH 1LHEH 4GLYA 3GY3A 3W1EA 1O33A 1PPBH 3HK3B 4CRDA 2NU2E 1IHSH 4XOJA 1HAPH 2WUCA 4BAOB 4ZROA 3TPIZ 2G5NA 1O2LA 1ZMJA 3BG8A 4ZMAH 1O3BA 3QZRA 3PMHB 3BSQA 3VPKA 2V3HH 2Q1JA 2OINA 1SGFG 1C5OH 1AUJA 2XBVA 3SQEE 1EP6A 4TYDA 5KECA 2FI3E 3ZVEA 4DY7B 1KDQB 2D8WA 1F0RA 1P9UA 1O32A 3QGNB 3OSYA 1O3KA 2PGQB 4B73A 5A0CA 4FU7A 2HPPH 2R3YA 4H6TA 1H1BA 3M5NA 1ESBA 7GCHF 3PV2A 4B2BA 2XC5A 2UWOA 3SZNA 2G4TA 3SUFA 1GVKB 1BB0B 3F9HA 4WF8A 2B8OH 2FEQH 1ANCA 1GJ4H 2RDLA 3UOUA 5C1XA 1P2QA 1O2RA 2W6JD 2H9TH 2QA9E 1CHOF 2PKAB 2EEKA 4CREA 3SU2A 1Y5UT 1YGCH 1EB1H 1O37A 1TNGA 1V2RT 1RXPA 3ZVDA 2AMPA 3KGPA 3TGIE 1RGQA 3QWCH 1AFQC 1B7XB 4AFSA 3RMNH 1Y3WA 1LPKB 3RXFA 3GDUA 3PLPA 1F5RA 1P11E 2ZGBH 1SGFA 3DFJA 1FPCH 3MTYA 3DT0H 3A84A 2FIRH 1ELBA 1LDTT 5TCCA 1HDTH 1BTWA 2ASUB 1NBME 1WXRA 4NSYA 4NGAH 1SLXB 2Z9JA 2J38A 2ULLA 1VITF 1WOFA 3T62A 3KQCA 5E0HA 5DP7A 4CH2B 3PO1B 1O2XA 2XXLA 1QHRB 1HLTH 1DWDH 2GTBA 4JYVH 4RT1A 1ABIH 1QR3E 8LPRA 1GI4A 2FXRA 3U8OH 1CGIE 2FX4A 2WSSD 2ZPRA 3T29A 1HAYB 1LPGB 2RDEA 3ZVAA 4D76A 3BTQE 2QAAA 1C5XB 4Y7BA 4MQAA 2CGAA 1ZGVA 1CGHA 1C1OA 4MNXA 4NG9H 1BT7A 4JYTA 1G30B 6ESTA 1CQQA 1ZTKA 3EE0B 2BY7X 2HVYB 3UTUH 3A88A 1S6HA 4ZKRU 1BRCE 4RN6A 2BQWB 1G3BA 3ELAH 2BDGA 1VGCB 3TNSA 1T8OA 3DSGA 2BDCA 1L1GA 1D6WA 1MZDA 1AD8H 1C1PA 2OQ5A 1GI2A 1HJAB 1P0SH 2AERH 5FPSA 5SGAE 1YCPM 4GPGA 2NU0E 1SSXA 3PLBA 4ISLA 4AYVB 1GBBA 3F3BA 5ABWA 4A1XA 4FUCA 1MBQA 2XTTB 1W14U 1IOEA 1GL0E 5EOKA 2ZKSA 4MLFB 3T2NA 2GKVE 4KELA 4KGAA 2FOMB 4I7YH 5HGGA 1GCTB 5EXMA 4H4FA 1UVPA 2ZDLA 1T7CA 1YWUA 2BD3A 4CRAA 1K21H 2BLOA 4Q4LA 2KFWA 1SBWA 2K8IA 4LZ4B 2H9HA 4K60A 1FZZA 3DSOA 2G4UA 1LQEA 2WZQA 1C5YB 3MYWA 3Q00A 1GHAF 2F9UA 2SNWA 2F9PA 1IQJA 1WAYB 1A5GH 4YZUA 3ZZCA 2V3OH 4NFEA 2BD8A 1HYLA 3SV7A 2VIVA 1F92A 3PO1C 3SU1A 1O3CA 2BYAX 5A8YA 4D9RA 1P01A 1HBTH 3QTOH 1ARBA 3A85A 2HWLB 4NIWA 5IDKA 4JK5A 2ANKH 3E16B 3FKSD 1DY9A 2PSXA 2Z3DA 1C1SA 4CHAC 1FY3A 2GZ9A 1Z6JH 2J5UA 3Q3YA 2XWAA 1D4PB 3NCLA 4ASHA 1AY6H 3F1SB 1O5BB 4X1PU 1ETSH 3SUDA 1OXGA 3BG4B 1SGRE 2THFB 4I8KA 1UO6A 4AORA 2WPIS 1NM6A 3U8TH 1V2QT 1ELVA 1O36A 2OK5A 1OHHD 3S7KB 5F8ZA 1E79D 1PPFE 4CR5A 5T6DA 7ESTE 1O39A 7GCHG 1KTSB 2BDBA 1MAXA 1VGCC 5I25A 1Y3VA 3STIA 2A5AA 4IBLH 2J97A 1HJAC 1CVWH 1ZLRA 1BMLA 1TNJA 3TGJE 3FVFB 1O3AA 1PPHE 1A2CH 1SB1H 3DSPA 4Q63A 4ZKSU 1SLUB 4GVUA 1MUEB 2PSYA 2Y7XA 1CE5A 3CS7A 2TGDA 3RU4D 4ASUD 1G2LA 5L30H 2OLGA 3P95A 1E35B 4A92A 1GCTC 2A4OA 1XKAC 3SQHE 1TB6H 3KQ5A 3GISB 1Q2WA 3KEEA 4NFFA 4YT7H 2VIPA 3MH4A 3FO8D 3UFAA 3VB5A 2BMGB 1SVPA 1A0LA 1TMTH 1YBWA 1SLVB 2FYQA 2Y7ZA 3BTGE 1FQ3A 1GVLA 5B6OA 2QXHA 4B6FA 4UD9H 1ZHMA 1C5QA 1EJAA 4MPXA 1BJVA 1YM0A 1TGBA 4IMQA 2XC0A 1HAOH 1QNJA 3SHAH 1J16A 1THPB 3UB0A 8GCHF 1F0UA 3RLWH 1LHGH 5TJXA 3N99A 1AZ8A 1C2DA 2R9PA 3E0PB 1KXEA 4INLA 4X0WU 1DVAH 1L1NA 2Z7FE 4WH8A 3S9BA 3TLOA 1P03A 1O2IA 4OS5A 5EG4A 2GCHF 3E6PH 3ZZ3A 1A1RA 4IC6A 3E91A 1GHYH 1TBQH 2Q6DA 5G4BA 1Z6EA 5C2ZA 5JBAS 4UFEH 4DJZB 3ZYEA 3RXDA 1AHTH 1UTJA 4INKA 4ZCNA 5CE1A 1CBWB 3UIRA 2WV5A 1O2TA 3PB1E 1SI5H 2ZCHP 4MVNA 2ZHFH 3OX7U 1OYTH 5JB8S 3BIVH 3H5CB 1T8NA 1RIWC 3AW1A 3K9XB 3SNAA 3PWBA 1C5LH 1TE0A 3SV6A 4ABIA 2PR3A 1PQ7A 5K0HA 3SNDA 2IN2A 2F83A 5E2OA 3N7EA 2FTMA 1XUFA 2BD2A 3FP7E 1TNKA 2A7HA 1ELGA 4XD7D 4ZH8A 2PHBA 1ANBA 2A7CA 1DS2E 4ESTE 1FLEE 2G5VA 5HM2A 1RTLA 1J8AA 4BAHB 5J4QA 1C9TA 1P2KA 4ABAA 1NZQH 2ZA5A 1Z71A 3NKKA 3SU5A 1WCZA 1T8LA 1P2OA 5LPRA 2FLRH 1B0FA 4ZKOU 2ZECA 3PV5A 1AI8H 1DXWA 1C1TA 1C9PA 2AHME 4Z0KA 5CHAB 4Y8XA 3RP2A 1KLJH 1GHAG 3F0OA 4OGXA 4TT3D 2KCAA 5EJZA 4TWYA 5FHTA 2W6ID 1ARCA 2A4RA 1AIXH 1UTOA 1ZMNA 2Q6FA 3GCTF 2F4LA 1P57B 1DX5M 1N6YA 1RD3B 4DOQA 2GMTC 4ZXXH 1EATA 3EE7A 2AS9A 3TK9A 1UTNA 1WTHD 1VITH 2ZP0H 4FUEA 1H8IH 1VCQA 1GJBB 3OYPA 1MAYA 2TGTA 1SLWB 1E36B 3F9FA 1GMHG 1KLIH 3M3TA 1SGYE 3FZDA 3GDSA 4DVAU 2QXIA 2ZF0H 2OUAA 5EODA 5JB9S 2QF5A 3IITA 4HI3A 2FOGA 1MCTA 1O30A 3LJOA 5L6NH 1THSH 1OP8A 1QA0A 4Y11E 2EI8A 2UWPA 1ZSJA 4Q2KA 3BF6H 1TLDA 3UUZA 2RFKC 4Q7ZA 1UTKA 2ZPSA 3S7HB 1OWHA 3V7TA 1MQ6A 2KAIA 3OE7D 5GDSH 5HYOA 4NZQA 1O2YA 2M2AA 5FCKA 3VEQB 1BRBE 1EXFA 1LHFH 1EP5A 1QJ6B 3O8BA 1GMCF 2VNTA 2V35A 5C17A 1SKYE 1MKXK 2VBCA 2ZDMA 8KME2 3HPTB
chains in the Genus database with same CATH topology
3OTJE 5IYTA 1AVXA 2PKSB 4YOJA 1EAUA 1A5HA 3Q3XA 5A2MH 4ISNA 3U69H 2XW9A 1TX6A 1EZSC 2OP9A 5EU8A 1YCPK 1C5NH 2OC7A 1NFUA 1BMMH 1GBAA 1AB9C 1GHZA 1XUHA 5C67A 4AGJA 5BPEA 2CV3A 1GJ9B 2ZGCA 4TY6A 1PQ8A 1JOUB 2FESH 4FUBA 1W3CA 5CHAC 1O35A 2ZFSA 4HGCA 3T27A 2R2MB 4B71A 2RG3A 4B2AA 2CN0H 5DGJA 4NWKA 3QTVH 4IS5A 4LK4A 3U98H 5GCHF 3BTHE 1LHDH 2JETB 2OTVA 1ELFA 3DUXH 1SFQB 2Z9GA 3GY8A 4UFFH 3P17H 1IQEA 2AGIX 1QJ7B 5DP4A 5L2ZH 3RMMH 2WYGA 1HXFH 3MHWU 2VGCC 7LPRA 1SOTA 2ZU2A 2VIWA 1LQDB 1AFEH 3PYHA 4I32A 3PV4A 8ESTE 3B8JA 2LNCA 2EI6A 4LZ1H 1OWKA 3D23A 3AW0A 1ANEA 1QRWA 1L2EA 2OXSA 5EXLA 3IG6B 3SGBE 2FM2A 1NU7B 1DPOA 3ZVGA 4DCDA 3CS0A 3UPEA 3LOXA 1QFKH 3P8NA 5FX5A 7KMEH 1GI0A 3RXHA 1TGSZ 1YLCA 1L4ZA 5E8EH 1EOLA 1TPSA 1SMFE 1O5CB 3CP7A 2O8UA 5T3HA 2ANWA 3RXKA 5ETXA 4HZHA 2Y80A 3D65E 2PKSC 2Y6TA 2FP7B 3ZZDA 5DP5A 5FX6A 3BIUH 1C4Y2 3Q3KA 2YNAA 1QL7A 1ESAA 1ANDA 1W11U 2AFQB 3MU1A 4Z6AH 3O8RA 3UWIA 1TGCA 2A7JA 4D8NA 1DE7H 4BOHA 1EAWA 4IW4E 1CU1A 1ZOMA 3RXJA 3UNRA 1SGTA 5HXFA 1GHBF 1HB0B 1BHXF 1BOQA 1EB2A 3EDXB 4AB8A 3A81A 1OWDA 3LC5A 2ZTZA 2JETC 2ZQ1A 1FJSA 1TRNA 1YPKH 5AFYH 3GCTG 3ZZAA 3LGTA 1PPEE 3C27B 4ZXYH 3SUGA 1C1RA 3P92A 2G52A 1BTHH 1NC6A 2TBSA 1H9IE 1T31A 3PTNA 1MMJN 1P2NA 1HAGE 1OOKB 1K22H 5FPYA 5DJ7A 3ATKA 3RMLH 1P2JA 2ZNKH 1Z1JA 1MKXH 1O2GH 5DO4H 1WQVH 1W7GH 1W8BH 3EA7A 3SJ9A 1A4WH 3RXBA 1FMGA 4ISIH 3RU4E 1XXDA 2SGAA 1S5SA 1D3DB 1BIOA 1SGPE 4O3UA 1Y5BT 1K1OA 1TFXA 3KCGH 3NWUA 1YCPH 1SQAA 1V2MT 1O2UA 2TRMA 3TJVA 3SNEA 1TOCB 3BV9B 2ZFTA 2FO9A 4O9VA 1C4U2 1EZUC 2NU3E 3EA8A 1LMWB 1MTVA 9ESTA 2B0FA 1P10A 4Y0ZE 1Y5AT 1GMCG 4JK6A 2M5TA 2HRVA 4JZ1A 3RXLA 2BDIA 4YOGA 1JIRA 1TONA 2B9LA 3RXEA 1MTSA 1DSUA 1FY5A 1TPAE 1BQYA 1C5WB 3AAVA 1DDJA 1BTUA 2VINA 4TPYA 1BDAA 5A0AE 2NWNA 2VIDA 3SORA 1SGDE 4PROA 2RA3A 1ETTH 2ZIQH 3P6ZB 2PGBB 1NY22 2BY5X 1NU9A 4TY7A 1W0ZU 2VWLA 2XCFA 1YPHC 1ZZZA 1LVMA 1PYTC 1KY9A 1C5PA 2Y5HA 3DD2H 2ESTE 1O5AB 4FUJA 2Z9LA 3RXTA 1C2KA 1F7ZA 2JKHA 1YPEH 1Y3YA 5JBTA 1S81A 5FPTA 5GCHG 1DFPA 1TPPA 1GI6A 2PUQH 1QQUA 1HIAA 2K1QA 3LKWA 4FU8A 1O3IA 4GCHF 1GHWH 3TH2H 4MPWA 4QT8C 1N6XA 3TIUA 1H9LB 1KXFA 3MI4A 1ZHRA 1O5GH 3RXQA 3RUOA 4NA8A 1FV9A 4CHAB 1EZXC 4Y8YA 3HKIB 1SOZA 4OGYA 1KYNA 3UQVA 1GBCA 1GHXH 5AFZH 1QQ4A 1QCPA 1DY8A 1HAZB 2PWXA 3QX5H 2C3SA 3A82A 2ZWLH 1SGEE 1TNIA 2RA0A 1D3TB 1U6QA 2VVUA 2FLBH 4RKOB 4FU9A 3RXUA 3S69A 4CBOA 1G3CA 3F6UH 2VWOA 1AN1E 1GPZA 1ELEE 1XUGA 2GZ7A 5AVDA 1F5KU 1V2KT 3K6YA 1WQSA 2JH6D 1G2MA 1GBFA 1V2TT 1P02A 4WMFA 1IQMA 1O2WA 3LT3A 1FUJA 2A5KA 4I8JA 1GJ6A 3M61U 3SV2H 1XKBC 1MBMA 1QJ1B 4B2CA 1Q31A 1NPMA 2W3KA 1WYKA 4XFQA 2P8OB 1C5UA 2EC9H 1C1VH 4X2VA 1NRRH 1YLDA 1T8MA 1BTXA 4X1SU 3SNCA 1BRUP 2A4QA 1CT2E 1YP9A 1BRAA 1RTFB 4DG4A 4GHTA 3V3MA 1V2LT 1ZJKA 3OY5U 1CT4E 2ZTXA 3SU4A 3GDVA 1ELCA 2FOAA 4LOYH 2STAE 2G8TA 3BTME 2GCTB 2H1UA 5FXLA 2VIQA 2O8WA 2VH0A 1MH0A 4BAMB 1WU1A 1ZPZA 2CF9H 2WPJS 2H5CA 1GHBG 1O3JA 5LH8A 3KQDA 1O3LA 3GYLB 1KXBA 3K2UA 4BTIB 4WVPE 1AWHB 2XBYA 4U30A 2QGRA 1K2I1 1FONA 3ODFA 1FY8E 1INCA 3LU9B 4CRCA 5C1UA 3R0FA 3BTDE 1BITA 1GJDB 1GMHF 2ZU3A 4K2YA 4WMEA 2XBWA 1V6DA 2NU1E 2ZU1A 2BD9A 1GBMA 5FCRA 1OSSA 1K1IA 2F3CE 1G36A 3SV8A 4YT6H 1ZJDA 1RJXB 2RCEA 2A2XH 2F9VA 2AGEX 1AE8H 3MU5A 1H9HE 1W12U 1SGIB 4JZDH 6GCHF 1GCDA 2J9NA 3MNCA 2PW8H 2FOFA 1UK3A 3A8AA 1SG8B 1RIWB 4XSKU 4ABHA 2GT8A 4R0IA 4ZHAA 2A0QB 1SQOA 4WMDA 4X6NA 2HPQH 1S0QA 2VJ1A 5EGMA 1TMBH 4YLQH 5LPFA 1HJ8A 1KXDA 3VXFH 3TK5A 1Z8RA 3UQOA 5EW1H 1IHTH 2J34A 1P06A 2NU4E 3SNBA 2OBQA 5EQRA 2P8OC 3C1KA 4IMZA 3RM2H 1YPHE 1OKXA 1GL1A 1AZZA 1QRXA 2FZZA 1C1WH 2G81E 3V0XA 1QURH 4XBBA 3JZ1B 3SGAE 3MNSA 1ESTA 4X8UH 3RXMA 3SUEA 2GCTC 2FI5E 4ABFA 1O5FH 2BY8X 4ABEA 4RKJB 2ZFQH 1RRKA 2R0LA 1HAVA 4O03A 2ZC9H 2OQUA 1DLKB 5FBEA 3SJ8A 3GCOA 4AG1A 3QLPH 1A5IA 1GHVH 2ODYB 1NESE 2GMTB 4GCHG 4YM9A 1NRSH 1P8VC 3GY2A 3M36A 1PJPA 2F9BH 2ZDVH 1GJCB 4Y79A 1W13U 1P04A 2AMQA 2R0KA 3MOCA 4AYYB 1UTLM 3A7TA 3LGYA 2VIOA 1XX9A 2ZU5A 3RXAA 4ISHH 4FUGA 1IQKA 4F4OC 1XMNB 5FBIA 1YYY1 2XYAA 3F68H 1LKBA 3RXGA 1NRQH 1DT2A 3LDXH 1CA0C 3FANA 1C5SA 1AQ7A 1P2MA 3JZ2B 4D9QA 1HV7A 1K28D 1G32B 3NK8A 5HM9A 1WBGB 1C2MA 4INHA 3RXIA 1C2HA 1YC0A 1GJ8B 3PROA 3P70B 3KL6A 1DANH 3A7ZA 5F8XA 1NS3A 1C1NA 3A8BA 1TA2A 2BQ6B 1L0ZA 1UCYK 4WH6A 1JRSA 4GUXA 2V0BA 3SI4H 4OS7A 1YPLH 1VJ9U 2P93A 2FOEA 2AH4X 3ZVCA 4MPVA 1C5MD 3UWJH 2C93B 1P12E 1V2WT 3Q76A 2WPMS 2J4IA 5BRRE 4AN7A 1HIAB 1LO6A 1S85A 1EZQA 4FVBA 3E8LA 2AIQA 1AB9B 1Z8IB 2QXGA 1L4DA 1LVYA 4VGCB 1ZRKA 1VCWA 1HGTH 3RC6A 3VB4A 2Z6BD 1EASA 3BN9A 2ZHWH 2TIOA 1TYNA 5GXPA 1EX3A 1RS0A 3TH4H 2OBOA 2W26A 4GSOA 1EQ9A 2SGPE 1F0SA 3PM3A 2ALVA 4B75A 2FX6A 2GGVB 3UNSA 2FI4E 2R3UA 1GBJA 4K69A 3U9AH 3FFGA 1H8DH 1O0DH 1V3XA 3TVJB 2IPHA 1ZGIA 5L2YH 3MNBA 4A1VA 3WY8A 2BD5A 1EJMA 1B0EA 4Q7YA 3HKJB 1DWCH 3W95A 1UCYE 2VGCB 2ZDNA 1TX8A 4IGDA 2G55A 4AB9A 1WSSH 1OPHB 2AMDA 1SGQE 3UNQA 3V13A 1DITH 1UVTH 2HVXA 1ZSKA 1SFIA 2WINI 1SC8U 3FZZA 2FDAA 1XVOA 2H2ZA 1ZYOA 3A87A 3ATWA 6GCHG 1YPMH 3IWMA 4BTTB 2VWNA 1EUFA 2DE8A 1PFXC 2O9QA 2VVVA 3STJA 1S83A 4OS4A 5C5NA 1Z8GA 2CJIA 3U1IB 1E34B 3KF2A 4F49A 1DXPA 1F5LA 4NZLA 3ESTA 4YOIA 1C2FA 1FIWA 3TH3H 4A6LA 2H5DA 2F9NA 1E0FD 1HNEE 1MQ5A 3V12A 3NZIA 4LXBH 3CENA 1MTWA 3TJUA 3QUMP 3ZZ9A 1CA8B 1OP2A 1YKTA 3P8OA 1C5TA 1H4WA 1K1JA 2W3IA 3M37A 3SHCH 4VGCC 1FY1A 1O31A 4OS6A 1UJ1A 3LGWA 1UVSH 1SGCA 1ZPCA 2GX4A 2GDEH 4E7NA 2AEIH 4B76A 1OWIA 3TJOA 3M35A 4I8GA 1THRH 2V6NA 1AU8A 2BXUH 2QYIA 2B7DH 4MNVA 2BD7A 4X2YA 1PPGE 3VGCC 2QIQA 1A3BH 2Y5FA 2STBE 5F8TA 5EXNA 3A7YA 2QC2A 3NXPA 1HJ9A 2BY6X 4Y7AA 2HLCA 5JBBS 9LPRA 3GY5A 3NPSA 2ZHQH 4YLUA 2WYJA 1M9UA 1UCYH 3A83A 3MWIU 1DSTA 1BHXB 2ZI2H 1LVBA 1JRTA 2AIPA 1QBOA 2ZZUH 3GCHB 3KQBA 3PMAB 5A8XA 2C4FH 3Q77A 1NFXA 2ANMH 1MCVA 2A1DB 3LJJA 3KIDU 4GHQA 4NA7A 1E37B 3ZV8A 2Z3CA 3T5FH 3MMGA 2PUXB 2FPZA 1ELDE 2ZGXH 1GMDF 1BUIA 4J2YB 4OS2A 1AE5A 1D3PB 4X8SH 1AVGH 3E0NB 4X2WA 3H7TA 1FIZA 2Z9KA 1AUTC 3M7UA 2Z9IA 4BXSA 3I78A 1GJ7B 3PMBB 4X1RU 4ZKNU 2BQ7B 1A0JA 1A61H 1VZQH 1V2OT 2J94A 1D6RA 2BVRH 2QY0B 3VFEA 1TWXB 5PTPA 3ZV9A 1CT0E 4IC5A 1AGJA 3BTKE 2WPHS 3A8CA 1O2ZA 3UR6A 2WPLS 1J17T 1NO9H 4Q7XA 2FOBA 1ZRBA 2FODA 5JPMH 5LPEA 1F0TA 4KTUA 1IQLA 2ODQA 4CR9A 4R8TB 3RXVA 1GBIA 3DA9B 2BLQA 1PQAA 2ZU4A 3RLYH 3FAOA 2BZAA 1DOJA 2BOKA 1GG6C 2ZFRH 1PQ5A 4X6MA 1OS8A 1MZAA 2PTCE 2ALPA 2VWMA 3RXSA 2Z94A 3EA9A 2GDDA 2CMYA 4UFDH 4NIYA 5J4SA 2JH5D 4K8YA 3ITIA 1A0HB 1HRTH 1J9CH 2DUCA 2Y82A 2A2QH 3GCHC 1KXCA 5DP9A 4FUIA 2CXVA 2O8TA 3FP6E 3SOSA 4U32A 1GBKA 1HAXB 1AWFH 1EAXA 3LH3A 1HPGA 1C5VA 4KKDA 1AO5A 1BTYA 4NA9H 3ZZ7A 2ZFFH 2EI7A 2WUBA 2P95A 1D3QB 4XBCA 4DIIH 1W10U 2A4GA 4MG3A 1AKSA 1XVMA 4BNRA 5EPNA 1XXFA 1JIMA 1GBEA 1UK2A 1SHHB 4D7GA 3GY6A 4KTSA 1DWEH 2C8WB 3HGPA 2SGDE 1CO7E 3ZZ5A 1NTPA 1NN6A 1N8OB 1EPTA 4A1TA 1BTZA 1O3NA 1S0RA 3AAUA 1TQ0B 1O3DA 2VVCA 1C1MA 1JBUH 3MNXA 5A8ZA 3A7XA 4JYUH 1TBZH 3E1XB 2WV4A 4HTCH 4B1TA 3MU8A 3MH7A 3H7OA 1MTNC 2TPIZ 1L1JA 1C2GA 3ZYDA 1JMOH 1PPZA 2HOBA 1V2ST 5E0JA 2IOTA 2H9EH 1UVUH 1ZSLA 1GJAB 1QIXB 5AHGH 1C2JA 2KAIB 1NT1A 5ESTE 1QTFA 3GYMA 1KSNA 3VB3A 3D62A 2D2DA 3RXPA 5GWZA 3HK6B 5DG6A 4MNWA 3AVZA 4DW2U 1CSOE 1ZMLA 1XM1A 2ZFPH 2AGGX 2O8MA 2ZCLP 3FP8E 2PV9B 4YTAA 2F9OA 1GVZA 1S6FA 4XE4A 3QGJA 3TU7H 1O34A 3A7VA 4Y0YE 1EJNA 1GWAA 3A8DA 1BA8B 4YO9A 4JZEH 3LONA 1BJUA 1BMAA 3LGUA 2SGFE 1MD8A 3EYDA 3U1JB 3M5OA 2QV1A 2ZHEH 3K65B 5EQQA 4O3TA 2C8XB 1A46H 3OU0A 1IQGA 3VXEH 3PMJA 1LKAA 2GD4B 4K8BA 1GMDG 1YPJH 3S9AA 4A5TS 1LCYA 3QDZB 3M3SA 4NCYA 3T25A 3LGVA 3SJOA 1LHCH 4DT7B 1SHYA 3MFJA 2GP9B 2BD4A 2UWLA 2ZTYA 4AX9H 1N8OC 4Y10E 4IN2A 3SN8A 4ABDA 1VCPA 1GI5A 2TGPZ 1SGNE 2A5IA 1DICA 1QBVH 2W7SA 4E7RG 3TGKE 1LVOA 1VJAU 2R2WU 4H42U 3P8GA 4ZAEA 1FY4A 2P94A 1O3MA 4MPUA 2FMJA 3U8RH 1FXYA 3M3VA 4DGJA 5I46H 2YOLA 1BBRK 4E06H 1O3FA 3EAJA 1FNIA 1ID5H 1ACBE 1UTMA 4U2WA 1TIOA 2J92A 4X6PA 1ELAA 4FUDA 1XUIA 1CHGA 3ENSB 1ZTJA 2XWBI 1O3HA 3F9GA 3I29A 2C90B