4INHA

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
178
structure length
172
Chain Sequence
DDDKAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 172
sequence length 178
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4inhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4inhA01
1RGQA 3NPSA 4ABHA 2GCHF 1V2VT 2HOBA 1A0HB 4VGCB 1DOJA 1TGSZ 1SPJA 1GBEA 3Q3KA 1QRZA 2F3CE 1MZDA 1Y3UA 2A31A 3AAUA 1T4VH 4JZDH 1C5MD 4MLFB 1PQ5A 1VJAU 1G3BA 3SHAH 1F5LA 3ZYDA 1BTWA 1P57B 4LXBH 2BYAX 1DE7H 2GMTB 1UTJA 2SNVA 1DT2A 3OU0A 1C1NA 4UONA 2PSXA 1O2GH 4FUGA 3M3TA 1EKBB 1ZTJA 3K2UA 1ZHMA 4K5ZA 1TE0A 3MYWA 1ZJKA 3MH4A 4F4OC 2VB0A 1WYKA 3QK1A 1DY9A 2J4IA 2ZFRH 1ESBA 3LGYA 3RU4T 1RJXB 3DFJA 1PPBH 2WPKS 4KTCA 3GCHB 1YPEH 3MWIU 5DP3A 3EYDA 2HPQH 1S6HA 3NXPA 5DKMA 4B1TA 4E7NA 4R8TB 1QB6A 1Y5AT 1TGBA 2G55A 1K1NA 1K2I1 2EI6A 1XKAC 2HNTF 1AU8A 1FXYA 4Y71A 1DWEH 3BG4C 1C5QA 1O5AB 3IWMA 4XBDA 2AYWA 4E05H 1KSNA 1O3FA 4CRFA 3FAOA 1V2UT 2R2MB 3V3MA 2AGEX 4XE4A 1HXEH 1LHCH 1KXCA 4E7RG 1F2SE 4MVNA 2UUKB 1CHOG 1IHTH 3ZZAA 1HBTH 1SQOA 2C3SA 1KLJH 2ZDVH 4NGAH 3JZ1B 1C5WB 1GBAA 4X1PU 2GCTB 2AMDA 4ABGA 2NU2E 1CE5A 1MU8B 2QGRA 5J4QA 2CHAC 4WH8A 1MKWK 2B0FA 1CT4E 1EAIA 3M3SA 3CP7A 1A3EH 1P01A 2HVXA 1NY22 1S85A 2AMQA 4MNYA 2XNIA 3JZ2B 1CU1A 3ENSB 3T27A 1AVGH 3MH6A 1A4WH 1N8OC 2J94A 3LDXH 1W14U 3TH2H 1GI3A 1GJ9B 1WQSA 2W26A 3PMJA 3PROA 4ABEA 1O2LA 2BVRH 1DWDH 3FZZA 2VU8E 2ZU2A 4MNWA 4Z0KA 2GDEH 1ELEE 4WMDA 5F8TA 4ABFA 2CJIA 3SV2H 3SZNA 2BY5X 1ID5H 1D6WA 1GGDC 3VB7A 4LOYH 1EJAA 1GI2A 4GCHF 5GXPA 3SORA 2BDAA 7GCHG 1THPB 1V2PT 1GBFA 2JKHA 4OGYA 1SC8U 3VXFH 4CREA 1TNIA 1TPAE 5EQSA 1EASA 4U32A 3SNEA 2GX4A 3O8RA 1C5NH 5IYTA 1Y3YA 3M35A 1NRPH 2GT8A 3PMHB 3P6ZB 2ZHQH 2ZU5A 4X8SH 2FOGA 5AF9H 4DT7B 5A0AE 2B9LA 3SI3H 2A1DB 4X8TH 5EXLA 1Y5UT 2R0LA 3UPEA 1VCQA 3UNSA 1D9IA 3QWCH 1IQGA 3KGPA 4BNRA 4Z6AH 1P05A 4OS2A 1YLCA 1HJAB 5L6NH 4H42U 1GHWH 1F5KU 1OWIA 5FPSA 3ZZ6A 3RU4D 4X6PA 1EPTB 2BQ7B 3ZZCA 1MBMA 1DWCH 1ZSLA 4A6LA 1O3IA 3U9AH 2PFEA 2ZGBH 2PKAB 1DUEA 4U01A 2PSYA 2GCHG 2FYRA 4FUIA 1JIMA 2C8XB 2R3UA 4NIXA 5FHTA 1W7XH 3MNBA 2ZHWH 1EOLA 2ODYB 4AZ2B 5A8ZA 4K60A 2PKSC 1A46H 3EQ0H 1O3DA 1YM0A 4Y8XA 2EA3A 3SV6A 1O2XA 2ZCHP 4Y11E 4A1VA 4MTBA 4Q80A 1NPMA 1D3TB 1EJMA 1O2HA 3NK8A 1O30A 1HDTH 2ZHDA 5FBEA 1GCDA 1N6XA 3RM0H 1F7ZA 4JK6A 2OD3B 1SGFA 3V12A 2ZG0H 2F91A 4X6OA 4D8NA 1V2ST 1IQLA 3A88A 4OS4A 1EB1H 4I8GA 1KXEA 1BDAA 1L0ZA 3SJKA 4DY7B 1MTNB 4JCNA 3QLPH 1ETTH 4IN1A 4MPUA 2AGGX 1XVOA 1K1PA 2O8TA 2GMTC 1SSXA 2BLVA 2SGFE 2H1UA 1QURH 2AEIH 5AHGH 1AVWA 1LQEA 3MMGA 4DGJA 4Y6DA 2OINA 2QXHA 2OTVA 1Z7KA 1UCYE 1A61H 1V2KT 2FOAA 2FS8A 2ZTZA 1N1LA 2J2UA 4NIWA 3RXAA 2ZDAH 1U6QA 3PWBA 3SBKA 2IPHA 1C5VA 2A32A 4U2WA 2C8WB 1MU6B 4WXIA 1HRTH 3B8JA 3A87A 3ZZ7A 1ZJDA 2FOFA 2BOHB 2ZQ1A 2VWLA 3GCHC 4BAHB 1TRNA 1P10A 2OQUA 5E2PA 2HNTE 1IQMA 5EQRA 1ELBA 3UIRA 1V2JT 3A7VA 4FVBA 1HFDA 2OBOA 1O38A 1C1TA 2XRCA 1Q3XA 2A4QA 1GI6A 1AVXA 2BX3A 3IG6B 2FEQH 1PFXC 3NKKA 1K9OE 1W0YH 2RA0A 4MPXA 1W11U 1SGQE 1NC6A 4IC5A 4CR5A 2FXRA 3O8DA 1C1MA 2A45B 1XXFA 1AIXH 2BXUH 3GYMA 1GI0A 3GICB 4ZXYH 3UNQA 3UUZA 2XYAA 4ZKRU 1G3EA 1RFNA 1EB2A 3K9XB 3UOPA 4FUCA 4IN2A 1TBQH 2BX4A 4JZEH 1DFPA 2BDIA 3HATH 1TPPA 1TIOA 1HAXB 1L1GA 2Z3DA 1VCWA 4H6SB 1BTUA 3S9CA 4JYUH 1QFKH 4AYYB 2Z9GA 1C5OH 1GDUA 2BTCE 4A92A 2C90B 1C1RA 1GBMA 4JZ1A 1T4UH 2GD4B 4U30A 3QUMP 4ISHH 3MO6A 4Y79A 5SGAE 2H9TH 4GCHG 4Q2KA 3OSYA 1ETSH 3BEIB 1FQ3A 1AFQB 1OWKA 3GY4A 3ZVFA 2OXSA 2VGCB 1UTPA 4ISIH 1TOCB 3ZZ3A 1B7XB 3RXRA 1C1SA 4YTAA 1EUFA 1NTPA 1YPJH 4AFSA 2ZFTA 4MG3A 1TWXB 2GV6A 1C5ZB 1W13U 4YLUA 1P02A 1GMCF 1UTNA 1BZXE 5EPNA 2P8OB 2VH6A 5GJ4B 4R0IA 3BIVH 3VB4A 3LGTA 3O8BA 3ATLA 3F6UH 1EPTA 3ZVCA 4NIVA 1KYNA 1N6YA 2TIOA 3TJOA 1A7SA 1Y5BT 3SGAE 3IITA 1V2NT 3MU1A 3BTHE 2PKAA 1D3PB 2OBQA 2BLWA 1AKSB 1UHBB 2HNTC 3A8BA 1HYLA 2NWNA 1ZZZA 7ESTE 1QJ6B 1UTKA 1Z71A 2A2XH 1GJAB 2OUAA 1LMWB 3K6ZA 3UY9A 4UEHH 3SNAA 2OQ5A 3PV4A 1ARCA 2GZ9A 5JB8S 2ZCKP 2Y82A 4TY7A 8GCHF 3TLOA 1BMMH 1PYTD 1ZHRA 1ESTA 4THNH 3GY3A 3VB5A 2VWMA 1EZUC 2AIQA 3RXMA 1ZPCA 3DT0H 1HJAC 1ZRKA 3BTDE 4WF8A 1QBNA 1GJCB 5EG4A 1GJ5H 2WV5A 3GDVA 5E8EH 3BIUH 2DUCA 1ABIH 4K8BA 1C2GA 2FZZA 2SGDE 5TCAA 3DHKH 2HWLB 4CRGA 1TQ7B 1C4U2 3TJNA 1BRCE 5EGMA 2ZDNA 2D8WA 4IW4E 2WYJA 1P2MA 1SBWA 1GDQA 3CS0A 2FX4A 3GCNA 1ELVA 3TJVA 5IDKA 3E3TA 1YCPH 3LC5A 1NO9H 1O5FH 1TPSA 2FODA 1D3QB 3M7QA 4IS5A 4AORA 4X1NU 2VIPA 2Z9IA 1SOTA 2ZQ2A 1GL1A 3A8CA 1TNLA 3GYLB 3M7TA 5DGJA 1VCPA 1O5GH 1KXDA 2BVSH 5GIBA 1FY8E 2CXVA 1LDTT 8ESTE 1FI8A 1HGTH 1THSH 1GBIA 4IBLH 4MDSA 1FUJA 1C9TA 1XKBC 2BDYA 1QB9A 2CHAB 1WCZA 1PPGE 1NFXA 3AAVA 3Q77A 2Y5GA 1CA8B 3TGKE 4BTTB 1UVPA 1QIXB 1HCGA 3LGUA 2H9EH 2BD8A 1FJSA 3NWUA 4O3TA 4BANB 1L1JA 1YPGH 3A80A 2UWPA 3UR6A 1JWTA 4BAQB 1DANH 3HKIB 1C5SA 3ZZ8A 1GMHF 3MFJA 1BMLA 4I8JA 3SGQE 1FAKH 1C2KA 2FOCA 4ZROA 3ZZ5A 1QCPA 3SU0A 5EU8A 1O3OA 2Y80A 3GDUA 4TYDA 3SNBA 2J38A 5E0GA 1DLKB 4ISOA 5BPEA 1OWJA 3DFLA 2BMGB 1HAPH 4MPWA 1BIOA 4NFFA 1HAGE 2P93A 4AFQA 3I78A 1SG8B 1BBRE 4FVDA 6CHAB 1GBTA 2Y81A 3H5CB 1ZYOA 4KELA 5T6FA 1TMTH 1RS0A 2PGBB 3OTJE 1OSSA 1QGFA 3M37A 2H6MA 4XBBA 2TPIZ 2H2ZA 4FU9A 3RUOA 4DJZB 1JRSA 2QXGA 1GBJA 1DS2E 1NN6A 2QC2A 1HB0B 1T8MA 1E37B 2XC5A 2ZGHA 1Z1IA 1O2MA 2GP9B 2G4TA 1RXPA 1CGJE 1SMFE 4D7GA 1FPCH 3F9GA 2JETC 4ESTE 3GDSA 3A83A 3RMOH 4K1SA 2P95A 1BTYA 1TQ0B 3EA8A 2CV3A 2TGAA 3TJUA 1GI7B 5EOKA 4TPYA 1H8DH 4XOJA 1C2LA 2J92A 3S9AA 1TRYA 1Z8IB 1OKXA 4Y8ZA 1GMCG 2FI5E 2QY0B 1MQ5A 1AKSA 1UHBA 3SQHE 1C1OA 2G51A 1SGNE 1Y3VA 3KQEA 3PMAB 1C2IA 2PKSB 1LKAA 1PPFE 3ATMA 3PYHA 1O2TA 4A7IB 4ISLA 1DUAA 2AH4X 3GY2A 1QB1A 1DSUA 1O3JA 1O5EH 2GT7A 3RXIA 2IJOB 3KN2A 3M7UA 1UVTH 2QN5T 1ZGVA 1ELAA 3ZVDA 3LONA 2EC9H 3E16B 2ZFFH 2VVVA 2ZNKH 2P8OC 3Q3YA 1Y59T 3AW0A 1VITF 1TX6A 2BDBA 2BQWB 1Q31A 1FN8A 2BLOA 1MMJN 2ZGCA 1SGDE 2GGVB 2HGTH 2ESTE 3PO1C 4XFQA 3L33A 8GCHG 4X8VH 3TGIE 1GDNA 1J15A 2C4FH 4FU7A 3DUXH 1EQ9A 1UCYH 2A4OA 1PQAA 1O2JA 3E0PB 1KXBA 5FPYA 3PM3A 4CR9A 1OYQA 3STIA 2G5VA 2ZWLH 1CBWB 4D76A 3T29A 2JH5D 1V2RT 1ZRBA 1O2VA 3T28A 3C27B 1IQIA 2BD5A 1O3CA 3P8GA 1AWHB 4AX9H 1ZPBA 2ZU1A 3VB3A 4LZ4B 2ZF0H 1YCPK 4XSKU 2VIQA 5JDUB 1DSTA 1HAIH 2XCNA 1IAUA 1P8VC 1K1LA 2VWOA 3MI4A 1AD8H 3U98H 5C2ZA 1P3EA 5DP7A 4CHAB 1NFYA 4X0WU 3SUDA 5E0HA 2GTBA 3ODDA 1O2SA 3VEQB 3GY7A 1A2CH 1T32A 2A5KA 1QHRB 2XTTB 5T6GA 1L4DA 3RXDA 4ZHLU 5J4SA 2G8TA 1NRQH 1FY4A 3RXBA 1J14A 2W3KA 1FPHH 2YNBA 1S82A 2STBE 4NSVA 2Q6FA 1GVKB 1MQ6A 1OS8A 5BRRE 2ZU3A 1P03A 3L6PA 5ABWA 1XX9A 3UTUH 2BD2A 2AIPA 2D2DA 5DPAA 1K22H 3RLWH 4ZXXH 2BOKA 2Q6DA 1B0EA 1LQDB 4I8KA 1NU9A 3PMBB 1GG6C 1SI5H 1GMHG 2XWBI 3MU8A 1T31A 2SGPE 2WPJS 2Y5FA 3BTGE 1L2EA 1AQ7A 2G4UA 1LHFH 3SJOA 4M7GA 2LPRA 2CF9H 1YPLH 4UFGH 1FZZA 1SFIA 1V3XA 2ASUB 1CO7E 3D65E 3EDXB 2W3IA 2VIOA 2ANMH 2OP9A 1C2JA 1O37A 2CN0H 3KF2A 1HV7A 1C5XB 4ZKNU 2J34A 2ANWA 3TK5A 2V6NA 1BRBE 2B7DH 1ZPZA 1ANDA 3P17H 2J9NA 2FS9A 1GI8B 1E34B 1OX1A 2PUQH 3E0NB 1P2NA 3FZDA 4ASHA 1G32B 2AGIX 2STAE 1FLEE 3URCA 3ATKA 6CHAC 2W7SA 2ALPA 3SN8A 4FXGH 1GI4A 3RXPA 1P11E 1FY3A 3TK6A 1GVLA 2SNWA 4FU8A 1TAWA 4ABAA 2VIVA 2P16A 1BHXF 4Y8YA 4UFFH 2EI7A 4ZHAA 4BTUB 1C4V2 1GL0E 2OC1A 1LKBA 4O3UA 1XVMA 1NT1A 1IQKA 3G01A 1C5YB 3UQOA 3H7TA 5DP4A 1ELTA 4X1QU 2BVXH 1P04A 3SJ9A 1Y8TA 3A7ZA 3SUEA 1XMNB 3EGKH 3MNXA 3E91A 2BD7A 2P59A 3LGIA 1HPGA 2HRVA 3UWJH 1O3LA 1O3AA 3RXKA 2ZU4A 1F0SA 2QCYA 2PTCE 1LPKB 4GPGA 3A89A 4QT8C 3VB6A 1KTTB 1BT7A 4I31A 1EZXC 4K1EA 1P9SA 3MHWU 3VXEH 4YOJA 2B8OH 3BTFE 2BD9A 5JBBS 1GJBB 1WU1A 3MH5A 1Q2WA 4YZUA 1VITG 4HTCH 2ULLA 3KEEA 1UCYK 4RN6A 4O03A 1THRH 4NA9H 1BJVA 3RXTA 1NROH 1ZR0A 4CRDA 2HPPH 5LPRA 1NU7B 2AS9A 1TALA 2ZGJA 1MTUA 2XC0A 5DG6A 3BTME 2W5EA 4GAWA 1HNEE 1TNHA 2WPLS 1Z8RA 1IOEA 1W12U 4INLA 5PTPA 4KTUA 4SGBE 3SV9A 3OYPA 1SLXB 3M36A 3A84A 1V2MT 2P3TB 1A0JA 4FUBA 1AUTC 1NFUA 3GY6A 3UR9A 2A4GA 5EODA 4ZKOU 2FOEA 2ZFQH 1UTMA 1RTLA 1XUKA 1BHXB 1RTKA 2FOHA 3FP6E 4K2YA 5A0CA 1W0ZU 4I8HA 1CBWC 3SU1A 1ZSJA 3LH3A 4BAKB 3M5MA 3P8OA 2SGEE 1E38B 2A5AA 4Q7YA 5A8XA 1J16A 4I8LA 1BBRH 2BLQA 2G00A 4YESB 2FOMB 3MO3A 2BY7X 2BXTH 4BXSA 5C3NA 1ZMJA 3A7YA 3T2NA 1QL9A 1C1UH 4YLQH 3UOUA 1YCPM 2FESH 1S84A 2ZDLA 4CHAC 3LU9B 1T8LA 2XBVA 3SQEE 2FYQA 4TWWA 2VJ1A 1O3HA 4BAMB 1VR1H 1JOUB 4ZAEA 3ZV8A 3SU4A 4DURA 1P2OA 4TY6A 2B5TB 5LH8A 2ZPRA 3PWCA 1SVPA 4UFDH 5ESBA 1HJ8A 1O39A 4AB9A 2PHBA 1TMUH 1CT2E 1O2PA 2ZDKA 5CHAC 5L2YH 4RKJB 3U69H 1ZSKA 1P12E 1QBVH 3ITIA 1CVWH 2A0QB 2OCVB 5DP9A 1GWAA 2ZFPH 1HAVB 2Y7ZA 2JETB 3S9BA 3TH3H 4BOHA 1Y3WA 2BQ6B 1GBHA 3RXVA 3QZRA 3T5FH 3MNCA 2IOTA 2VIDA 4RKOB 2Z3CA 1LHEH 2GKVE 3PLPA 5FCRA 3RMMH 1ETRH 1GHAF 1GBBA 1TABE 2GZ8A 3SU6A 1O3GA 1KTSB 1GJDB 1B0FA 1YGCH 1AE5A 2ZHFH 1D3DB 5L2ZH 3P70B 2FI4E 1SFQB 3TITA 3K65B 1LVMA 2F9PA 1UVUH 3LJOA 4X2VA 2ZTXA 3S7HB 2UWOA 1JBUH 3A7XA 1NFWA 2F9BH 3UWIA 2ZGXH 3RXUA 4IGDA 1P0SH 1HIAB 1TYNA 3A86A 3RXGA 3PO1B 4FUEA 1A5GH 4AFUA 3GOVB 4B76A 1QRWA 1QA7A 5FCKA 1J8AA 1DDJA 5EW1H 3GISB 4BAOB 1BTHH 1MD8A 1V2TT 1MTWA 4XDEA 5GWZA 4NFEA 1IQNA 5I46H 2Z3EA 5F6MA 5F8XA 5JYIA 1GHBF 3MU4A 1WSSH 1GJ4H 3SI4H 4J1YA 3CS7A 1WOFA 4NSYA 1SLWB 4KKDA 5JBAS 1F0TA 2PWXA 1DM4B 4Y7BA 1QL7A 1E35B 1TGTA 1PQ7A 5FXLA 1C5LH 1G2MA 1VGCB 1O33A 2NU4E 2TBSA 5JBTA 4LZ1H 2GZ7A 2UWLA 1UVOA 1TA2A 2H9HA 1MD7A 1NESE 1WQVH 4O9VA 1KY9A 1YYY1 2BDCA 1UJ1A 1EXFA 2CF8H 3FVFB 1AZZA 3SV8A 1AB9B 4BXWA 1MZAA 5EW2H 1MH0A 2NU0E 4GHQA 1O2NA 3ZZ9A 1C2EA 1ZHPA 1QR3E 3QX5H 1C1VH 1MAYA 1ACBE 4NWLA 5HM2A 1BCUH 3ODFA 1BOQA 4Y76A 3V0XA 4ABDA 2RG3A 1SHYA 1LO6A 1J9CH 1A0LA 2Z6BD 1O5BB 3RMNH 1JRTA 1H9LB 1UO6A 1HXFH 3A8AA 1L4ZA 1H9HE 1YPKH 1QBOA 2QF0A 2BY6X 1BBRK 2G52A 1GG6B 5A0BA 2WUCA 3UFAA 1ELFA 1GBKA 3D62A 1W10U 1OPHB 1K1IA 2OLGA 3AVZA 3DA9B 3LGWA 4IMZA 3I77A 1CSOE 4WWYA 3OY5U 1EP5A 1HLTH 1EZQA 3SV7A 3GCTF 1F0RA 2QF3A 1F5RA 4ZKSU 4GSOA 4X2WA 1T8OA 2V0BA 3HK6B 3Q3XA 4AYVB 9LPRA 3T25A 1BUIA 4FUDA 5GPIB 1J17T 4DOQA 2FMJA 6ESTA 6GCHF 2FLBH 5AVDA 3RP2A 2O9QA 1UVSH 3QZQA 1B5GH 3PTNA 1DICA 1Z8GA 1AHTH 2BB4A 2XBYA 1HAVA 1GPZA 1S0RA 3A7TA 2GVFA 2Z7FE 1ZMLA 2ZI2H 1O5CB 1P2JA 3SHCH 1A5IA 2EI8A 1QY6A 1O5DH 1C5PA 1SGYE 1EAUA 1F92A 4MPVA 3SNDA 4JZIA 3ELAH 1WBGB 4CBNA 2SFAA 1GCTC 3ZVEA 3A7WA 3A81A 2XWAA 3A85A 1BTPA 1UK4A 2H5CA 1CHGA 2Y7XA 2QA9E 3RC4A 3BTEE 1FAXA 1RRKA 5C1UA 1YBWA 2Z9JA 5DP8A 3GY5A 1HAZB 1P09A 3NCLA 1A5HA 2LNCA 3BG8A 1GHAG 3UQVA 3BF6H 1BRAA 3O8CA 2VINA 2F9NA 2PUXB 2QIQA 3QTOH 4OGXA 1LVBA 1DLEA 3D49H 3OX7U 4K1TA 1G3DA 1HIAA 1AWFH 1GHYH 1XUGA 2ZPQA 2O8UA 3RXFA 1O2OA 2ZDMA 3LH1A 1KLIH 1FY1A 2ZZUH 2OC7A 3F1SB 2THFB 2PLXA 2QAAA 1FV9A 3M5OA 4HZHA 4JMYA 1V2QT 4D9QA 1AZ8A 3TGJE 2QXJA 1TGNA 2Z9LA 5LPEA 2ODQA 1TNJA 1GI9B 2ODPA 3R3GB 2R9PA 1TNGA 1PYTC 3P92A 1DY8A 1TFXA 4INHA 1KXFA 2ZC9H 1SGPE 1OP2A 1GHBG 2VWNA 5GDSH 2P94A 2FLRH 4F49A 2FDAA 1TBZH 1O2WA 3EE0B 3A82A 1G30B 2F83A 2M5TA 3SJIA 1PPCE 1O32A 3SUFA 3BEUA 1Z6JH 1MCVA 4Y10E 4J2YB 5LGOA 4SGAE 2F9VA 1C1QA 1ZLRA 4AGJA 4A1XA 3RXJA 3EA9A 2FOBA 1FN6A 1WV7H 1CQQA 3C1KA 3RXCA 1LHGH 4ZHMU 2FIRH 3HGPA 1IQJA 1VGCC 2RA3A 4B71A 5H4IB 1GHVH 4OS7A 4ISNA 1W2KH 1O2RA 2ZIQH 3BSQA 1BA8B 1AFEH 3HKJB 3RXLA 1SGTA 5C67A 3BTWE 2WINI 3KQCA 3ATWA 2BD3A 1W3CA 4LK4A 2ZHEH 2JH0D 3BTKE 1AB9C 3MU0A 1WUNH 1GJ7B 1QRXA 2PV9B 1EOJA 3BTQE 1CA0B 4X6NA 5TCCA 1O3MA 2Y5HA 1VJ9U 4NZLA 1S6FA 5CHAB 1PQ8A 1ARBA 4ABIA 1OP8A 1MKXH 3GCTG 2FPZA 1MAXA 1GJ6A 2A2QH 1K28D 3MOCA 3FFGA 4Y0YE 1TBRH 3RXHA 3KCGH 4RSPA 3ZZ4A 6GCHG 1VZQH 1C2DA 1IQEA 1XUFA 2Z9KA 4OS6A 4X1RU 5DK1A 1FMGA 1INCA 2TGDA 1O2YA 2A7JA 1ORFA 3U8RH 1TX7A 3F9EA 3TH4H 1ELDE 5ETXA 3DD2H 1JIRA 3R0FA 4NA8A 3M3VA 3I29A 4YM9A 1LHDH 3QDZB 3LJJA 1G2LA 3RDZA 2W7UA 3D23A 1QQ4A 1W7GH 1O2QA 4DIHH 5DP6A 4UE7H 1TNKA 7KMEH 2G5NA 4AN7A 3SO3A 4BTIB 1NZQH 3LT3A 1XUHA 1P2KA 1Y3XA 3SU3A 4NIYA 4X6MA 4AFZA 1DPOA 2C8ZB 4TPIZ 1LTOA 1P2IA 2V3OH 3URDA 1S0QA 3A8DA 5FPTA 3NUMA 3E1XB 4K69A 4CRAA 1SR5C 4I32A 3H7OA 3HPTB 4HGCA 4JYTA 1E36B 4WH6A 5HYOA 1QJ7B 2OC8A 1O3KA 4OS1A 2FI3E 4X2XA 2UUFB 3U8OH 2ZEBA 1KDQB 5C5NA 1ZTKA 1H1BA 4H4FA 4JZFH 2BHGA 4NA7A 4MNVA 2WUBA 1SLVB 3Q00A 1H9IE 4K3JA 1C2FA 1LPZB 2TGTA 3PLBA 5JB9S 2BD4A 2FX6A 1UMAH 1SGFG 1ANBA 3UNRA 1QA0A 1O2UA 4ABBA 4X8UH 1O34A 5K0HA 2H5DA 2VH0A 4NWKA 4X1SU 1C9PA 2FM2A 3B9FH 2WV4A 1T7CA 3F68H 3UREA 3VFEA 2VIWA 1MTSA 3TK9A 4B74A 8KME2 5EQQA 3P8FA 4UDWH 5TJXA 1ANEA 1XXDA 4HI3A 1C4Y2 2P3UB 5GCHF 3LC3A 2QYIA 1RIWB 2BY9X 3MTYA 2O8LA 3KQBA 5G4BA 1HAYB 1GHZA 4CBOA 3SW2B 3E90B 1ZMNA 1ZTLA 1TOMH 3BTTE 7LPRA 1LPGB 1EAXA 3SGBE 2ILNA 1K1OA 3V13A 1SB1H 1OP0A 1SL3A 3ZVAA 1G9IE 4D9RA 3AASA 2G81E 5FX5A 2ZFSA 5HMAA 5JBCS 1UTQA 3VGCC 2NU3E 1H8IH 1M9UA 2XC4A 1S81A 4CH8B 1TX8A 1DX5M 4GLYA 5I25A 1K1JA 2QXIA 3F9FA 4VGCC 5T6DA 1RD3B 2SGQE 1O31A 1FDPA 4H6TA 1P06A 5AFYH 3TNTA 1C5TA 5T3HA 4Q7ZA 4KTSA 5DJ7A 1SOZA 1BMNH 1ZGIA 1C2HA 2Q1JA 3S69A 5F03A 2XBXA 4A5TS 1P3CA 2CGAA 3RU4E 4WJG2 4K8YA 2O8MA 1FONA 1NS3A 3MNSA 1EX3A 1JXPA 1ABJH 3AW1A 3MO9A 4B75A 4WVPE 1MKXK 3K6YA 2P3FH 1AN1E 2RDLA 2BDHA 1GCTB 1GBCA 4AOQA 4NCYA 3WY8A 1GVZA 1E0FD 3HK3B 4A1TA 3SU2A 1V2OT 3Q76A 4CH2B 1OYTH 1SLUB 1O2IA 1SGCA 2ZECA 2JH6D 4GVUA 3ZVGA 4YT7H 2PR3A 1EAWA 1CA0C 3GCOA 3M5LA 3ZYEA 5LPFA 1HUTH 3P8NA 1BTXA 3TNSA 1BRUP 2PTNA 4ZUHA 3P95A 1WTGH 2EEKA 1CT0E 2YNAA 1RTFB 1GI5A 4UD9H 4E06H 1KLTA 4JYVH 9ESTA 2ZP0H 4B2BA 4KGAA 1AY6H 4XBCA 1GBDA 3ESTA 1W8BH 5HM9A 5ESTE 4GUXA 2AMPA 4ZH8A 2VVCA 1HJ9A 5CE1A 5C1XA 2R3YA 1V2WT 4GHTA 1GMDF 1GHXH 3NZIA 4YOGA 3SJ8A 1ESAA 1QQUA 4FUJA 4KP0A 4IC6A 1QJ1B 3KQDA 2DE8A 3ZZBA 2GV7A 5DO4H 3T62A 3ZV9A 1FY5A 4HFPB 3F9HA 1O0DH 4JK5A 2GCTC 4AG1A 2ZTYA 2OC0A 3RXOA 1EJNA 2PGQB 3RXEA 1O2KA 2NU1E 1FIWA 4DCDA 1YLDA 2WYGA 1KDQA 1BB0B 2XCFA 3PLKA 2J95A 1IQFA 1G37A 3VPKA 1X7AC 5EXNA 1PPEE 2RCEA 3ATIA 2BDGA 2KAIB 3S7KB 3HGNA 3TPIZ 4OS5A 5A8YA 1DXWA 1MUEB 3B23B 1S5SA 5B6OA 3M61U 1P2QA 1BMAA 1V2LT 2FO9A 4X2YA 3L3TA 4CRBA 3TU7H 3S0NA 1D4PB 1YPHE 5C5OA 2O8WA 1FNIA 2XW9A 1O35A 2Y6TA 4B2CA 4AB8A 1G3CA 1G36A 1T8NA 1EZSC 1Z6EA 3SNCA 1C1WH 3RXSA 3SUGA 1TMBH 5FBIA 2WPHS 3N7OA 5GCHG 3V7TA 1AGJA 1AUJA 4DIIH 8LPRA 3FP7E 1BITA 1GBLA 1TA6A 1PJPA 1YKTA 2FTLE 4FUFA 1EP6A 1OWDA 1BQYA 3LOXA 3RC6A 2UUJB 1QL8A 3SU5A 1O3NA 5JPMH 3GY8A 4MNXA 3FP8E 1D6RA 1ELCA 4WMEA 1FIZA 1YC0A 1EPTC 1OOKB 2BM2A 4AGKA 1A1RA 4B2AA 1RIWC 1Z1JA 4UFEH 3STJA 2FP7B 4O97A 1UK2A 1BJUA 5FAHA 1Z8JB 5A2MH 1P9UA 5K7RA 2Q6GA 2C93B 1SGEE 2XXLA 2ZPSA 4WMFA 1UTOA 1K21H 1ZOMA 3TVJB 3ZVBA 5DP5A 1LVYA 3SOSA 1L1NA 2IN2A 3BG4B 1MBQA 3KIDU 1O36A 1S83A 5HXFA 1DWBH 2V35A 2QV1A 2R0KA 4D7FA 1QTFA 1PPHE 4FUHA 4YT6H 3PTBA 1C5RA 4PROA 3EAJA 3RXQA 1GJ8B 3E8LA 3PB1E 3KHVA 3W94A 1LCYA 3OY6U 1C5UA 3LKWA 1CGIE 1UTLM 1ANCA 4B73A 3QGNB 1EATA 1YF4A 2I6QA 2A7CA 3QGJA 1A3BH 4ABJA 1TPOA 3FANA 1K1MA 1OWEA 2ALVA 1IHSH 1GI1A 1MTNC 4WY3A 5A09A 2YOLA 4I33A 1V6DA 1YPHC 2WPMS 1YP9A 1PPZA 1DXPA 1CHOF 3MU5A 4NZQA 1TONA 4MQAA 3T26A 1H4WA 1N8OB 3M5NA 4IMQA 2UUYA 4WXVA 5F8ZA 5C20A 2K1QA 2ANKH 1OWHA 6LPRA 2BZ6H 3KNXA 3U8TH 2ZA5A 1DVAH 1KXAA 1O3PB 2WPIS 4TWYA 1XUJA 1GGDB 2AERH 2ZCLP 1XUIA 2TGPZ 5CMXH 1MKWH 1MCTA 4Y7AA 4I7YH 5FX6A 1YPMH 1AE8H 1SHHB 2ANYA 1GMDG 2FWWA 1OXGA 2A5IA 2Z94A 3TIUA 3W95A 4INKA 2DE9A 1NRNH 5C1YA 2BY8X 2R2WU 5E2OA 3LGVA 3RLYH 5E0JA 2I6SA 1NM6A 2A4RA 1JMOH 2ZO3H 2XBWA 2C8YB 1O2ZA 3U1IB 2ZKSA 3EA7A 1SGIB 2KAIA 2TRMA 3E6PH 2A7HA 3LPRA 1UK3A 1BTZA 7GCHF 3BEFB 1NRSH 1XM1A 1WTHD 1C1PA 1SQTA 2F9UA 4Y0ZE 3RMLH 1HAOH 2AFQB 1AMHA 4AG2A 1VITH 2D1JA 4YO9A 2HLCA 3QO6A 2VNTA 1F0UA 1TRMA 3QTVH 5AFZH 2V3HH 2HALA 4DG4A 1ELGA 1QNJA 1TGCA 1MTVA 3U1JB 1SQAA 2GDDA 3RC5A 3CENA 5EXMA 1IQHA 1AI8H 4YOIA 4ZMAH 5EPYA 1HAHH 1O3BA 1TLDA 4NG9H 4CRCA 1SGRE 2CMYA 3KL6A 1NRRH 3RM2H 4DW2U 2BZAA 3ZZDA 1WAYB 1TB6H 3QN7A 5HGGA 3LIWA 1KIGH 1O3EA 1CGHA 1AFQC 2PW8H 3BN9A 3BV9B 2VVUA 1LVOA 2VGCC 4Q7XA 1C2MA 1DITH 2FTMA 1AO5A 2F9OA 4DVAU 2SGAA 5L30H 3MH7A 3VGCB 2D26C
chains in the Genus database with same CATH superfamily
1RGQA 3NPSA 3OEED 4ABHA 2GCHF 1V2VT 2HOBA 1A0HB 4VGCB 2YMSB 1DOJA 1TGSZ 1SPJA 1GBEA 3Q3KA 1QRZA 2F3CE 1MZDA 1Y3UA 2A31A 3AAUA 1T4VH 4JZDH 1C5MD 4MLFB 1PQ5A 1VJAU 1G3BA 3SHAH 1F5LA 3ZYDA 1BTWA 1P57B 4LXBH 2BYAX 2V7QD 1DE7H 2GMTB 1UTJA 4YXWD 2SNVA 5KECA 1DT2A 3OU0A 1C1NA 4UONA 2PSXA 1MABB 1O2GH 4FUGA 3M3TA 1EKBB 1ZTJA 3K2UA 1ZHMA 1H8ED 4K5ZA 1TE0A 3KYFA 3MYWA 1ZJKA 3MH4A 4F4OC 2VB0A 1WYKA 3QK1A 1DY9A 2J4IA 2ZFRH 1ESBA 3LGYA 3RU4T 2W6ID 1RJXB 3DFJA 1PPBH 2WPKS 4KTCA 3GCHB 1YPEH 3MWIU 5DP3A 3EYDA 2HPQH 1S6HA 3NXPA 5DKMA 5KGOA 4B1TA 4E7NA 4R8TB 1QB6A 1Y5AT 1TGBA 2G55A 1K1NA 1K2I1 2EI6A 1XKAC 2HNTF 2KCYA 1AU8A 1FXYA 4Y71A 3DSOA 1DWEH 3NRLA 3BG4C 1C5QA 1O5AB 3IWMA 4XBDA 2AYWA 4E05H 1KSNA 1O3FA 4CRFA 3FAOA 1V2UT 2R2MB 3V3MA 2AGEX 4XE4A 1HXEH 1LHCH 1KXCA 4E7RG 1F2SE 2HVYB 4MVNA 2UUKB 1CHOG 1IHTH 3ZZAA 1HBTH 1SQOA 2C3SA 1KLJH 2ZDVH 4NGAH 3JZ1B 1C5WB 1GBAA 4X1PU 2GCTB 2AMDA 4ABGA 2NU2E 1CE5A 1MU8B 2QGRA 5J4QA 2CHAC 4WH8A 1MKWK 2B0FA 1CT4E 1EAIA 3M3SA 3CP7A 1A3EH 1P01A 2HVXA 1NY22 1S85A 2AMQA 4MNYA 2XNIA 3JZ2B 1CU1A 3ENSB 3T27A 1AVGH 3MH6A 1A4WH 4HG6A 1N8OC 2J94A 3LDXH 5IK2D 1W14U 3TH2H 1GI3A 1GJ9B 1WQSA 2W26A 3PMJA 3PROA 4ABEA 1O2LA 2BVRH 1DWDH 3FZZA 2VU8E 2ZU2A 4MNWA 4Z0KA 2GDEH 1ELEE 4WMDA 5F8TA 4ABFA 2CJIA 3SV2H 3SZNA 2BY5X 1ID5H 1D6WA 5EJ1A 1GGDC 3VB7A 4LOYH 1EJAA 1GI2A 4GCHF 5GXPA 3SORA 2BDAA 2CK3D 7GCHG 1THPB 1V2PT 1GBFA 2JKHA 4OGYA 1SC8U 3VXFH 4CREA 1TNIA 1TPAE 5EQSA 1EASA 4U32A 3SNEA 2GX4A 3O8RA 1C5NH 5IYTA 1Y3YA 3M35A 2RDEA 1NRPH 2GT8A 3PMHB 3P6ZB 2K8IA 2ZHQH 2ZU5A 4X8SH 2FOGA 5AF9H 4DT7B 5A0AE 2B9LA 3SI3H 2A1DB 4X8TH 5EXLA 1Y5UT 2R0LA 2QF5A 3UPEA 1VCQA 1YLNA 4I86A 3UNSA 1D9IA 3QWCH 1IQGA 3KGPA 4BNRA 4Z6AH 1P05A 2KCOA 4OS2A 1YLCA 1HJAB 5L6NH 4H42U 1GHWH 1F5KU 1OWIA 5FPSA 3ZZ6A 3RU4D 4X6PA 1EPTB 2BQ7B 3ZZCA 1MBMA 1DWCH 1ZSLA 4A6LA 1O3IA 3U9AH 2PFEA 2ZGBH 2K0QA 1DUEA 2PKAB 4U01A 2PSYA 2GCHG 2FYRA 4FUIA 1JIMA 2C8XB 3DSPA 2R3UA 4NIXA 5FHTA 1W7XH 4B6FA 3MNBA 2ZHWH 1EOLA 2ODYB 4AZ2B 1E79D 5A8ZA 4K60A 2PKSC 1A46H 1K0HA 3EQ0H 1O3DA 1YM0A 4Y8XA 2EA3A 3SV6A 1O2XA 2EY4C 2ZCHP 4Y11E 4A1VA 4MTBA 4Q80A 1NPMA 1D3TB 1EJMA 1O2HA 3NK8A 1O30A 1HDTH 2ZHDA 5FBEA 1GCDA 1N6XA 1SQRA 3RM0H 1F7ZA 4JK6A 3F0OA 2OD3B 5CDFE 1SGFA 2YMSC 2ZG0H 3V12A 2F91A 2WV9A 4X6OA 4D8NA 1V2ST 1IQLA 3A88A 4OS4A 1EB1H 4I8GA 1KXEA 1BDAA 1L0ZA 3SJKA 4DY7B 1MTNB 4JCNA 3QLPH 1ETTH 4IN1A 4MPUA 2AGGX 1XVOA 1K1PA 2O8TA 2GMTC 1SSXA 2BLVA 2SGFE 2H1UA 1QURH 2AEIH 5AHGH 1AVWA 1LQEA 3MMGA 4DGJA 5C0UA 4Y6DA 2OINA 2QXHA 4FETA 2OTVA 5CHBA 1Z7KA 1UCYE 1A61H 1V2KT 2FOAA 2FS8A 2ZTZA 1N1LA 2J2UA 4NIWA 3RXAA 2ZDAH 1U6QA 3PWBA 2QE7D 3SBKA 2IPHA 1C5VA 2A32A 4U2WA 2C8WB 1MU6B 1S6LA 5EIYA 4WXIA 1HRTH 3B8JA 3A87A 3ZZ7A 1ZJDA 2FOFA 2BOHB 2ZQ1A 2VWLA 3GCHC 4BAHB 1TRNA 1P10A 2OQUA 5E2PA 2HNTE 1IQMA 5EQRA 1ELBA 3UIRA 1V2JT 3A7VA 4FVBA 1HFDA 2OBOA 1O38A 1C1TA 2XRCA 1Q3XA 2A4QA 1GI6A 1AVXA 2BX3A 3IG6B 2FEQH 1PFXC 3NKKA 1K9OE 1W0YH 2RA0A 4MPXA 1W11U 1SGQE 1NC6A 4IC5A 4CR5A 2FXRA 3O8DA 1C1MA 2WPDD 2A45B 1XXFA 1AIXH 2BXUH 3GYMA 1GI0A 3GICB 4ZXYH 3UNQA 3UUZA 2XYAA 4ZKRU 1G3EA 1RFNA 1EB2A 3K9XB 3UOPA 4FUCA 4IN2A 1TBQH 2BX4A 4JZEH 1DFPA 2BDIA 2PP6A 3HATH 1TPPA 1TIOA 1HAXB 1L1GA 2Z3DA 1VCWA 4H6SB 1BTUA 3S9CA 4JYUH 1QFKH 4AYYB 5KEDA 2Z9GA 1C5OH 1GDUA 2BTCE 4A92A 2C90B 1C1RA 1GBMA 4JZ1A 1T4UH 2GD4B 4U30A 3QUMP 4ISHH 3MO6A 4Y79A 5SGAE 2H9TH 4GCHG 4Q2KA 3OSYA 1ETSH 3BEIB 1FQ3A 1AFQB 1OWKA 3GY4A 3ZVFA 2OXSA 2VGCB 1UTPA 4ISIH 1TOCB 3ZZ3A 1B7XB 3RXRA 1C1SA 4YTAA 1EUFA 1NTPA 1YPJH 4AFSA 2ZFTA 4MG3A 1TWXB 2GV6A 4ZCNA 1C5ZB 1W13U 4YLUA 1P02A 1GMCF 1UTNA 1BZXE 5EPNA 2P8OB 2VH6A 5GJ4B 4R0IA 3BIVH 3VB4A 3LGTA 3O8BA 3ATLA 3F6UH 1EPTA 3ZVCA 4NIVA 1KYNA 1N6YA 2TIOA 3TJOA 1A7SA 1Y5BT 3SGAE 3IITA 1V2NT 3MU1A 3BTHE 2PKAA 2J5UA 1D3PB 2OBQA 2BLWA 1AKSB 1UHBB 2HNTC 3A8BA 1HYLA 2NWNA 1ZZZA 7ESTE 1QJ6B 1UTKA 1Z71A 2A2XH 1GJAB 2OUAA 1LMWB 3K6ZA 3N7EA 3UY9A 4UEHH 3SNAA 2OQ5A 3PV4A 1ARCA 2GZ9A 5JB8S 2ZCKP 2Y82A 4TY7A 8GCHF 3F2HA 3TLOA 1BMMH 1PYTD 1ZHRA 1ESTA 2V3MA 4THNH 3GY3A 3VB5A 2VWMA 1EZUC 2AIQA 3RXMA 1ZPCA 3DT0H 1HJAC 1ZRKA 3BTDE 4WF8A 1QBNA 1GJCB 5EG4A 1GJ5H 2WV5A 3GDVA 5E8EH 3BIUH 2DUCA 1ABIH 4K8BA 1C2GA 2FZZA 2SGDE 5TCAA 3DHKH 2HWLB 4CRGA 1TQ7B 1C4U2 3TJNA 1BRCE 5EGMA 2ZDNA 2D8WA 4IW4E 2WYJA 1P2MA 1SBWA 1GDQA 3CS0A 2FX4A 3GCNA 1ELVA 3TJVA 5IDKA 3E3TA 5HIZA 1YCPH 3LC5A 1NO9H 1O5FH 1TPSA 2FODA 1D3QB 3M7QA 4XRNA 4IS5A 4AORA 4X1NU 2VIPA 2Z9IA 1SOTA 2ZQ2A 1GL1A 3N7DA 3A8CA 1TNLA 5FL7D 3GYLB 3M7TA 5DGJA 1VCPA 1O5GH 1KXDA 2BVSH 5GIBA 1FY8E 2CXVA 2XOKD 1LDTT 8ESTE 1FI8A 1HGTH 1THSH 1GBIA 4IBLH 1QZ8A 4MDSA 1FUJA 1C9TA 1XKBC 2BDYA 1QB9A 2CHAB 3ZIAD 1WCZA 1PPGE 1NFXA 3AAVA 3Q77A 2Y5GA 1CA8B 3TGKE 4BTTB 1UVPA 1QIXB 1HCGA 3LGUA 2H9EH 2BD8A 1FJSA 3NWUA 4O3TA 4BANB 1L1JA 1YPGH 3A80A 2UWPA 3UR6A 1JWTA 4BAQB 1DANH 3HKIB 1C5SA 3ZZ8A 1GMHF 3MFJA 1BMLA 4I8JA 3SGQE 1FAKH 1C2KA 2FOCA 4ZROA 3ZZ5A 1QCPA 2W6JD 3SU0A 5EU8A 1O3OA 2Y80A 3GDUA 4TYDA 3SNBA 2J38A 5E0GA 1DLKB 4ISOA 5BPEA 1OWJA 3DFLA 2BMGB 1HAPH 4MPWA 1BIOA 4NFFA 1HAGE 2P93A 4AFQA 3I78A 1SG8B 1BBRE 4FVDA 6CHAB 1GBTA 2Y81A 3H5CB 1ZYOA 1EFRD 2JJ1D 4KELA 5T6FA 1TMTH 1RS0A 2PGBB 3OTJE 1OSSA 1QGFA 2JDID 3M37A 2H6MA 5C94A 3VG8A 4XBBA 2TPIZ 2H2ZA 4FU9A 3RUOA 4DJZB 1JRSA 2QXGA 1GBJA 1DS2E 1NN6A 2QC2A 1HB0B 1T8MA 1E37B 2XC5A 2ZGHA 1Z1IA 3DCLA 1O2MA 2GP9B 2G4TA 1RXPA 1CGJE 1SMFE 4D7GA 1FPCH 3F9GA 2JETC 4ESTE 3GDSA 3A83A 3RMOH 4K1SA 2P95A 1BTYA 1TQ0B 3EA8A 2CV3A 2TGAA 3TJUA 1GI7B 5EOKA 4TPYA 1H8DH 4XOJA 4B6EA 1C2LA 2J92A 3S9AA 1FX0B 1TRYA 1Z8IB 1OKXA 2J97A 4Y8ZA 1GMCG 2FI5E 2QY0B 1MQ5A 1AKSA 1UHBA 2KCPA 3SQHE 1C1OA 2G51A 1SGNE 1Y3VA 3KQEA 3PMAB 5HIYA 1C2IA 2PKSB 1LKAA 1PPFE 3ATMA 3PYHA 1O2TA 4A7IB 5B6LA 4ISLA 1DUAA 2AH4X 3GY2A 1QB1A 1DSUA 1O3JA 3GS9A 1O5EH 2M2AA 2GT7A 3RXIA 2IJOB 3KN2A 3M7UA 1UVTH 2QN5T 1ZGVA 1ELAA 3ZVDA 3LONA 2EC9H 3E16B 2ZFFH 2VVVA 2ZNKH 2P8OC 3Q3YA 1Y59T 3AW0A 1VITF 1TX6A 2BDBA 2BQWB 1Q31A 1FN8A 2BLOA 1MMJN 2ZGCA 1SGDE 2GGVB 2HGTH 2ESTE 3PO1C 4XFQA 3L33A 8GCHG 4X8VH 3TGIE 1GDNA 1J15A 2C4FH 4FU7A 3DUXH 1EQ9A 1UCYH 2A4OA 1PQAA 1O2JA 3E0PB 1KXBA 5FPYA 3PM3A 4CR9A 1OYQA 3STIA 2G5VA 2ZWLH 1CBWB 4D76A 3T29A 2JH5D 1V2RT 1ZRBA 1O2VA 3T28A 3C27B 1IQIA 2BD5A 1O3CA 3P8GA 1AWHB 4AX9H 1ZPBA 2ZU1A 3VB3A 4LZ4B 2ZF0H 1YCPK 4XSKU 4Q4LA 2VIQA 5JDUB 1DSTA 1HAIH 2XCNA 1IAUA 1P8VC 1K1LA 2VWOA 3MI4A 1AD8H 3U98H 4ACBA 5C2ZA 1P3EA 5DP7A 4CHAB 1NFYA 4X0WU 3SUDA 5E0HA 2GTBA 3ODDA 1O2SA 3VEQB 3GY7A 1A2CH 1T32A 2A5KA 1QHRB 2XTTB 5T6GA 1L4DA 3RXDA 4ZHLU 5J4SA 2G8TA 2IJD1 1NRQH 1FY4A 3RXBA 1J14A 2W3KA 1FPHH 2YNBA 1E1QD 1S82A 2STBE 3FKSD 2Q6FA 4NSVA 1GVKB 1MQ6A 1OS8A 5BRRE 2ZU3A 1P03A 3L6PA 5ABWA 1XX9A 3UTUH 2BD2A 2AIPA 2D2DA 5DPAA 1K22H 3RLWH 4ZXXH 2BOKA 2Q6DA 1B0EA 1LQDB 4I8KA 1NU9A 4AC9A 3PMBB 1GG6C 1SI5H 1GMHG 2XWBI 3MU8A 1T31A 2SGPE 2WPJS 2Y5FA 3BTGE 1L2EA 1KMHB 5T1VA 1AQ7A 2G4UA 1LHFH 3SJOA 4M7GA 2LPRA 2CF9H 1YPLH 4Z1MD 3PV2A 4UFGH 1FZZA 1SFIA 1V3XA 2ASUB 1CO7E 3D65E 3EDXB 2W3IA 2VIOA 2ANMH 2OP9A 1C2JA 1O37A 2CN0H 2KZ4A 3KF2A 1HV7A 1C5XB 4ZKNU 2J34A 2ANWA 3TK5A 2V6NA 1BRBE 2B7DH 1ZPZA 1ANDA 1NBMD 3P17H 2J9NA 2FS9A 1GI8B 1E34B 1OX1A 2PUQH 3E0NB 1P2NA 3FZDA 4ASHA 1G32B 2AGIX 2STAE 1FLEE 3URCA 3ATKA 6CHAC 2W7SA 2ALPA 3SN8A 4FXGH 1GI4A 3RXPA 1P11E 1FY3A 3TK6A 1GVLA 2SNWA 4FU8A 1TAWA 4ABAA 2VIVA 2P16A 1BHXF 4Y8YA 4UFFH 2EI7A 1W0JD 4ZHAA 4BTUB 1C4V2 1GL0E 2KX4A 2OC1A 1WDIA 1LKBA 4O3UA 1XVMA 1NT1A 1IQKA 3G01A 1C5YB 3UQOA 3H7TA 5DP4A 1ELTA 3OAAD 4X1QU 2BVXH 1P04A 3SJ9A 1Y8TA 3A7ZA 3SUEA 1XMNB 3EGKH 3MNXA 3E91A 2BD7A 2P59A 2WHXA 3LGIA 1HPGA 2HRVA 3UWJH 1O3LA 1O3AA 3RXKA 2ZU4A 1F0SA 2QCYA 2PTCE 1LPKB 4GPGA 3A89A 4QT8C 3VB6A 1KTTB 1BT7A 4I31A 1EZXC 4K1EA 1P9SA 3MHWU 3VXEH 4YOJA 2B8OH 3BTFE 3UAIC 2BD9A 5JBBS 1GJBB 1WU1A 3MH5A 3F2FA 1Q2WA 4YZUA 1VITG 4HTCH 2ULLA 3KEEA 1UCYK 4RN6A 3N99A 4O03A 1THRH 4NA9H 1BJVA 3RXTA 1NROH 1ZR0A 4CRDA 2HPPH 5LPRA 1NU7B 2AS9A 1TALA 2ZGJA 1MTUA 2XC0A 5DG6A 3BTME 2W5EA 4GAWA 1HNEE 1TNHA 2WPLS 1Z8RA 1IOEA 1W12U 4INLA 5PTPA 4KTUA 4SGBE 3SV9A 3OYPA 1SLXB 1W0KD 3M36A 3A84A 3PRDA 1V2MT 2P3TB 1A0JA 4FUBA 1AUTC 1NFUA 3GY6A 3UR9A 2A4GA 5EODA 4ZKOU 2FOEA 3DSGA 2ZFQH 1UTMA 1RTLA 1XUKA 1BHXB 1RTKA 2FOHA 3FP6E 4K2YA 5A0CA 1W0ZU 4I8HA 1CBWC 3SU1A 1ZSJA 3LH3A 4BAKB 3M5MA 3P8OA 2SGEE 1E38B 2A5AA 4Q7YA 5A8XA 1J16A 4I8LA 1BBRH 2BLQA 2G00A 4YESB 2FOMB 3MO3A 2BY7X 2BXTH 4BXSA 5C3NA 1ZMJA 3A7YA 2QF4A 3T2NA 1QL9A 1C1UH 4YLQH 3UOUA 1YCPM 2FESH 1S84A 2ZDLA 4CHAC 4DT4A 3LU9B 1T8LA 2XBVA 3SQEE 2FYQA 4TWWA 2VJ1A 1O3HA 4BAMB 1VR1H 1JOUB 4ZAEA 3ZV8A 3SU4A 4DURA 1P2OA 4TY6A 2B5TB 5LH8A 2ZPRA 3PWCA 1SVPA 4UFDH 5ESBA 1HJ8A 1O39A 4TT3D 4AB9A 2PHBA 1TMUH 1CT2E 1O2PA 2ZDKA 5CHAC 5L2YH 4RKJB 3U69H 1ZSKA 1P12E 1QBVH 3ITIA 1CVWH 2A0QB 2OCVB 5DP9A 1GWAA 2ZFPH 1HAVB 2Y7ZA 2JETB 3S9BA 3TH3H 4BOHA 1Y3WA 2BQ6B 1GBHA 3RXVA 3QZRA 3T5FH 3MNCA 2IOTA 2VIDA 4RKOB 2Z3CA 2EQNA 1LHEH 2GKVE 3PLPA 5FCRA 3RMMH 1ETRH 1GHAF 1GBBA 1TABE 2GZ8A 3SU6A 1O3GA 1KTSB 1GJDB 3F2GA 1B0FA 1YGCH 1AE5A 2ZHFH 1D3DB 5L2ZH 3P70B 2FI4E 1SFQB 3TITA 3K65B 1LVMA 2F9PA 1UVUH 3LJOA 4X2VA 2ZTXA 3S7HB 2UWOA 1JBUH 3A7XA 4F48B 1NFWA 2F9BH 3UWIA 2ZGXH 3RXUA 4IGDA 3SZEA 1P0SH 1HIAB 1TYNA 3A86A 3RXGA 3PO1B 4FUEA 1A5GH 4AFUA 3GOVB 4B76A 1QRWA 4RT0A 1QA7A 5FCKA 1J8AA 1DDJA 5EW1H 3GISB 4BAOB 2GJGA 1BTHH 2AHME 1MD8A 1V2TT 1MTWA 4XDEA 5GWZA 4NFEA 1IQNA 5I46H 2Z3EA 5F6MA 5F8XA 5JYIA 1GHBF 3OFND 3MU4A 1WSSH 1GJ4H 3SI4H 4J1YA 3CS7A 1WOFA 4NSYA 1SLWB 4KKDA 5JBAS 1F0TA 2PWXA 1DM4B 4Y7BA 1QL7A 1E35B 1TGTA 1PQ7A 5FXLA 3OTPA 1C5LH 1G2MA 1VGCB 1O33A 2NU4E 2TBSA 5JBTA 4LZ1H 2GZ7A 2UWLA 1UVOA 1TA2A 2H9HA 1MD7A 4FOUC 1NESE 1WQVH 4O9VA 1KY9A 1YYY1 2BDCA 1UJ1A 1EXFA 2CF8H 3FVFB 2XNDD 1AZZA 3SV8A 1AB9B 4BXWA 1MZAA 5EW2H 1MH0A 2NU0E 4GHQA 1O2NA 3ZZ9A 1C2EA 1ZHPA 1QR3E 3QX5H 1C1VH 1MAYA 1ACBE 4NWLA 2KM0A 5HM2A 1BCUH 3ODFA 2JJ2D 1BOQA 4Y76A 3V0XA 4ABDA 2RG3A 1SHYA 1LO6A 1J9CH 1A0LA 2Z6BD 1O5BB 3WWFA 3RMNH 1JRTA 1H9LB 1UO6A 1HXFH 3A8AA 1L4ZA 1H9HE 1YPKH 1QBOA 2QF0A 2BY6X 1BBRK 2G52A 1GG6B 5EJLA 5A0BA 2WUCA 3UFAA 1ELFA 1GBKA 3D62A 1W10U 1OPHB 1K1IA 2OLGA 3AVZA 3DA9B 3LGWA 4IMZA 3I77A 1CSOE 4WWYA 3OY5U 1EP5A 1HLTH 1EZQA 3SV7A 3FO8D 3GCTF 1F0RA 2QF3A 1F5RA 4ZKSU 4GSOA 4X2WA 1T8OA 2V0BA 2L74A 3HK6B 3Q3XA 4AYVB 9LPRA 3T25A 1SKYE 1BUIA 4FUDA 5GPIB 1J17T 4DOQA 2FMJA 6ESTA 6GCHF 2FLBH 5AVDA 3RP2A 2O9QA 3FN8A 1UVSH 3QZQA 1B5GH 3PTNA 1DICA 1Z8GA 1AHTH 2BB4A 2XBYA 1HAVA 1GPZA 1S0RA 3A7TA 2GVFA 2Z7FE 1ZMLA 2ZI2H 1O5CB 1P2JA 3SHCH 1A5IA 2EI8A 1QY6A 2IPQX 1O5DH 1C5PA 1SGYE 1EAUA 1F92A 4MPVA 3SNDA 4JZIA 3ELAH 1WBGB 4CBNA 2SFAA 1GCTC 3ZVEA 3A7WA 3A81A 2XWAA 3A85A 1BTPA 1UK4A 5DN6D 2H5CA 1CHGA 2Y7XA 2QA9E 3RC4A 3BTEE 1FAXA 1RRKA 5C1UA 1YBWA 2Z9JA 5DP8A 3GY5A 1HAZB 3OE7D 1P09A 3NCLA 1A5HA 2LNCA 3BG8A 1GHAG 3UQVA 3BF6H 1BRAA 3O8CA 2VINA 1COWD 2RFKC 2F9NA 2PUXB 2QIQA 3H09A 3QTOH 4OGXA 1LVBA 4RT1A 1DLEA 3D49H 2OK5A 3OX7U 4K1TA 1G3DA 1HIAA 4P02A 2LELA 1AWFH 1GHYH 1XUGA 2ZPQA 2O8UA 3RXFA 1O2OA 2ZDMA 3LH1A 1KLIH 1FY1A 2F4LA 2ZZUH 2OC7A 3F1SB 2THFB 3WW7A 2PLXA 2QAAA 1FV9A 3M5OA 4HZHA 4JMYA 1V2QT 3OEHD 1AZ8A 4D9QA 2QXJA 3TGJE 1TGNA 2Z9LA 5LPEA 2ODQA 1TNJA 1GI9B 2ODPA 3R3GB 2R9PA 1TNGA 1PYTC 3P92A 1DY8A 1TFXA 4INHA 1KXFA 2ZC9H 1SGPE 1OP2A 1GHBG 2VWNA 5GDSH 2P94A 2FLRH 4F49A 2FDAA 1TBZH 1O2WA 3EE0B 3A82A 1G30B 2F83A 2M5TA 2KCAA 2L6OA 3SJIA 1PPCE 1O32A 3SUFA 3BEUA 1Z6JH 1MCVA 4Y10E 4J2YB 5LGOA 4SGAE 2F9VA 1C1QA 1ZLRA 4RI0A 4AGJA 4A1XA 3RXJA 3EA9A 2FOBA 1FN6A 1WV7H 1CQQA 3C1KA 3RXCA 1LHGH 2F43B 4ZHMU 2FIRH 3HGPA 1IQJA 1VGCC 2RA3A 4B71A 5H4IB 1GHVH 4OS7A 4XD7D 4ISNA 1W2KH 1O2RA 2ZIQH 3BSQA 3PRBA 1BA8B 2KFWA 1AFEH 3HKJB 3RXLA 1SGTA 5C67A 3BTWE 2WINI 3KQCA 3ATWA 2BD3A 1W3CA 4LK4A 2ZHEH 2JH0D 3BTKE 1AB9C 3MU0A 1WUNH 1GJ7B 1QRXA 2PV9B 1EOJA 3BTQE 1CA0B 4X6NA 5TCCA 2YMSD 1O3MA 2Y5HA 1VJ9U 4NZLA 1S6FA 5CHAB 1PQ8A 1ARBA 4ABIA 1OP8A 1MKXH 3GCTG 2FPZA 3AK5A 1MAXA 1GJ6A 2A2QH 1K28D 3MOCA 3FFGA 4Y0YE 1TBRH 3RXHA 3KCGH 4RSPA 3ZZ4A 4Q63A 6GCHG 1VZQH 1C2DA 1IQEA 1XUFA 2Z9KA 4OS6A 4X1RU 5DK1A 1FMGA 1INCA 3SYJA 2TGDA 1O2YA 2A7JA 1ORFA 3U8RH 1TX7A 3F9EA 3TH4H 1ELDE 5ETXA 3UB0A 3DD2H 1JIRA 3R0FA 4NA8A 3M3VA 3I29A 4YM9A 1LHDH 3QDZB 3LJJA 1G2LA 3RDZA 1UW7A 2W7UA 3D23A 1QQ4A 1W7GH 1O2QA 4DIHH 5DP6A 4UE7H 1TNKA 7KMEH 2G5NA 4AN7A 3SO3A 4BTIB 1NZQH 3LT3A 1XUHA 1P2KA 1Y3XA 3SU3A 4NIYA 4X6MA 4AFZA 1DPOA 2C8ZB 4TPIZ 2WZQA 1LTOA 1P2IA 2V3OH 3URDA 1S0QA 3A8DA 5FPTA 3MQKC 3NUMA 3E1XB 1E1RD 4K69A 4CRAA 1SR5C 4I32A 3H7OA 3HPTB 1OHHD 4HGCA 4JYTA 1E36B 4WH6A 5HYOA 1QJ7B 2OC8A 1O3KA 4OS1A 2FI3E 4X2XA 2UUFB 3U8OH 2ZEBA 1KDQB 5C5NA 1ZTKA 1H1BA 4H4FA 4JZFH 2BHGA 4NA7A 4MNVA 2WUBA 1SLVB 3Q00A 1H9IE 4K3JA 1C2FA 1LPZB 2TGTA 3PLBA 5JB9S 2BD4A 2FX6A 1UMAH 1SGFG 1ANBA 3UNRA 1QA0A 1O2UA 4ABBA 4X8UH 1O34A 5K0HA 2H5DA 2VH0A 4NWKA 4X1SU 1C9PA 2FM2A 3B9FH 2WV4A 1T7CA 3F68H 3UREA 3VFEA 2VIWA 1MTSA 3TK9A 4B74A 8KME2 5EQQA 3P8FA 4UDWH 5TJXA 1NBME 1ANEA 1XXDA 4HI3A 1C4Y2 2P3UB 5GCHF 3LC3A 3F3BA 2QYIA 1RIWB 2BY9X 3MTYA 2O8LA 2HLDD 3KQBA 5G4BA 1HAYB 1GHZA 4CBOA 3SW2B 3E90B 1ZMNA 1ZTLA 1TOMH 3BTTE 7LPRA 1LPGB 1EAXA 2WSSD 3SGBE 2ILNA 1K1OA 3V13A 1SB1H 1OP0A 1SL3A 3ZVAA 1G9IE 4D9RA 4OM9A 3AASA 2G81E 5FX5A 2ZFSA 5HMAA 5JBCS 1UTQA 3VGCC 2NU3E 1H8IH 1M9UA 2XC4A 1S81A 4CH8B 1TX8A 1DX5M 4GLYA 5I25A 1K1JA 2QXIA 3F9FA 4VGCC 5T6DA 1RD3B 2SGQE 1O31A 1FDPA 4H6TA 1P06A 5AFYH 3TNTA 1C5TA 5T3HA 4Q7ZA 4KTSA 5DJ7A 1SOZA 1BMNH 1ZGIA 1C2HA 2Q1JA 3S69A 5F03A 2XBXA 4A5TS 1P3CA 3W1EA 2CGAA 3RU4E 4WJG2 4K8YA 2O8MA 1FONA 1NS3A 3MNSA 1EX3A 1JXPA 1ABJH 3AW1A 3MO9A 4B75A 4WVPE 1MKXK 3K6YA 2P3FH 1AN1E 2RDLA 2BDHA 1GCTB 1GBCA 4AOQA 4NCYA 3WY8A 1GVZA 1E0FD 3HK3B 4A1TA 3SU2A 1V2OT 3Q76A 4CH2B 1OYTH 1SLUB 1O2IA 1SGCA 2ZECA 2JH6D 4GVUA 3ZVGA 4YT7H 2PR3A 1EAWA 1CA0C 3GCOA 3M5LA 3ZYEA 5LPFA 1HUTH 3P8NA 1BTXA 3TNSA 1BRUP 2PTNA 4ZUHA 3P95A 1WTGH 2EEKA 4F55A 1CT0E 2YNAA 1RTFB 1GI5A 4UD9H 4E06H 1KLTA 4JYVH 9ESTA 2ZP0H 4B2BA 4KGAA 2KR7A 1AY6H 4XBCA 1GBDA 3ESTA 3KYGA 1W8BH 5HM9A 5ESTE 4GUXA 2AMPA 4ZH8A 2VVCA 1HJ9A 1WXRA 5CE1A 2J98B 1H8HD 4P00A 5C1XA 2R3YA 1V2WT 4GHTA 1GMDF 1GHXH 3F0PA 3NZIA 4YOGA 3WWBA 3SJ8A 1ESAA 1YY3A 1QQUA 4FUJA 4KP0A 4IC6A 1QJ1B 3KQDA 2DE8A 3ZZBA 2GV7A 5DO4H 3T62A 3ZV9A 1FY5A 4HFPB 3F9HA 1O0DH 4JK5A 2GCTC 4AG1A 2ZTYA 2OC0A 3RXOA 1EJNA 2PGQB 5GNDA 3RXEA 1O2KA 2NU1E 3U28C 1FIWA 4DCDA 1YLDA 3EE7A 2WYGA 1KDQA 1BB0B 2XCFA 3PLKA 3KQ5A 2J95A 1IQFA 1G37A 3VPKA 1YWUA 1X7AC 5EXNA 1PPEE 2RCEA 3ATIA 2BDGA 2KAIB 3S7KB 3HGNA 3TPIZ 4OS5A 5A8YA 1DXWA 1MUEB 3B23B 1S5SA 5B6OA 3M61U 1P2QA 1BMAA 1V2LT 2FO9A 4X2YA 3L3TA 4CRBA 3TU7H 3S0NA 1D4PB 1YPHE 5C5OA 2O8WA 1FNIA 2XW9A 1O35A 2Y6TA 4B2CA 5DSFA 4AB8A 1G3CA 1G36A 1T8NA 1EZSC 1Z6EA 3SNCA 1C1WH 3RXSA 3SUGA 1TMBH 5FBIA 2WPHS 3N7OA 5GCHG 3V7TA 1AGJA 5C0TA 1AUJA 4DIIH 8LPRA 3FP7E 1BITA 1GBLA 1TA6A 1PJPA 1YKTA 2FTLE 4FUFA 1EP6A 1OWDA 2VBCA 1BQYA 3LOXA 3RC6A 2UUJB 1QL8A 3SU5A 1O3NA 5JPMH 3GY8A 4MNXA 3FP8E 1D6RA 1ELCA 4WMEA 1FIZA 1YC0A 1EPTC 1OOKB 2BM2A 4AGKA 1A1RA 4B2AA 1RIWC 1Z1JA 4UFEH 3STJA 2FP7B 4O97A 1UK2A 1BJUA 5FAHA 1Z8JB 5A2MH 1P9UA 5K7RA 2Q6GA 2C93B 1SGEE 2XXLA 2ZPSA 4WMFA 1UTOA 1K21H 1ZOMA 3TVJB 3ZVBA 5DP5A 1LVYA 3SOSA 1L1NA 2IN2A 3BG4B 1MBQA 3KIDU 1O36A 1S83A 5HXFA 1DWBH 2V35A 2QV1A 2R0KA 4D7FA 1QTFA 1PPHE 4FUHA 4YT6H 3PTBA 1C5RA 4PROA 3EAJA 3RXQA 1GJ8B 3E8LA 3PB1E 3KHVA 3W94A 1LCYA 3OY6U 1C5UA 3LKWA 1CGIE 1UTLM 1ANCA 4B73A 3QGNB 4ASUD 1EATA 1YF4A 2I6QA 2A7CA 3QGJA 1A3BH 4ABJA 1TPOA 3FANA 1K1MA 1OWEA 2ALVA 3FOAA 1IHSH 1GI1A 1MTNC 4WY3A 5A09A 2YOLA 4I33A 1V6DA 1YPHC 2WPMS 1YP9A 1PPZA 1DXPA 1CHOF 3MU5A 4NZQA 1TONA 4MQAA 3T26A 1H4WA 1N8OB 3M5NA 4IMQA 2UUYA 4WXVA 5F8ZA 5C20A 2K1QA 2ANKH 1OWHA 1VKYA 2J98A 6LPRA 2BZ6H 3KNXA 3U8TH 2ZA5A 1DVAH 1KXAA 1O3PB 2WPIS 4TWYA 1XUJA 1GGDB 2AERH 2ZCLP 1XUIA 2TGPZ 5CMXH 1MKWH 1MCTA 4Y7AA 4I7YH 5FX6A 1YPMH 1AE8H 1SHHB 2ANYA 5C17A 5HKKD 1GMDG 2FWWA 1OXGA 2A5IA 2Z94A 3TIUA 3W95A 4INKA 2DE9A 2JIZD 1NRNH 5C1YA 2BY8X 2R2WU 5E2OA 3LGVA 3RLYH 5E0JA 5F53A 2I6SA 1NM6A 2A4RA 1JMOH 2ZO3H 2XBWA 2C8YB 1O2ZA 3U1IB 2ZKSA 3EA7A 1SGIB 2KAIA 2TRMA 3E6PH 2A7HA 3LPRA 1UK3A 1BTZA 7GCHF 3BEFB 1NRSH 1XM1A 1WTHD 1C1PA 1BMFD 1SQTA 2F9UA 4Y0ZE 3RMLH 1HAOH 2AFQB 1AMHA 3PV5A 4AG2A 1VITH 2D1JA 4YO9A 2HLCA 3CNRA 3QO6A 2VNTA 1F0UA 1TRMA 3QTVH 5AFZH 2V3HH 2HALA 4DG4A 1ELGA 1QNJA 1TGCA 4ACAA 1MTVA 3U1JB 1SQAA 2GDDA 3RC5A 3CENA 5EXMA 1IQHA 1AI8H 4YOIA 4ZMAH 5EPYA 1HAHH 4TSFD 1O3BA 1TLDA 4M9FA 4NG9H 4CRCA 1SGRE 2CMYA 2LP6A 3KL6A 1NRRH 3RM2H 4DW2U 2BZAA 3ZZDA 1WAYB 1TB6H 3QN7A 5HGGA 3LIWA 1KIGH 1O3EA 1CGHA 1AFQC 5EJZA 2PW8H 3BN9A 3BV9B 2VVUA 1LVOA 2VGCC 4Q7XA 1C2MA 1DITH 2FTMA 1AO5A 2F9OA 4DVAU 2SGAA 5L30H 3MH7A 3VGCB 2D26C
chains in the Genus database with same CATH topology
1RGQA 3NPSA 4ABHA 2GCHF 1V2VT 2HOBA 1A0HB 4VGCB 1DOJA 1TGSZ 1SPJA 1GBEA 3Q3KA 1QRZA 2F3CE 1MZDA 1Y3UA 2A31A 3AAUA 1T4VH 4JZDH 1C5MD 4MLFB 1PQ5A 1VJAU 1G3BA 3SHAH 1F5LA 3ZYDA 1BTWA 1P57B 4LXBH 2BYAX 1DE7H 2GMTB 1UTJA 2SNVA 1DT2A 3OU0A 1C1NA 4UONA 2PSXA 1O2GH 4FUGA 3M3TA 1EKBB 1ZTJA 3K2UA 1ZHMA 4K5ZA 1TE0A 3MYWA 1ZJKA 3MH4A 4F4OC 2VB0A 1WYKA 3QK1A 1DY9A 2J4IA 2ZFRH 1ESBA 3LGYA 3RU4T 1RJXB 3DFJA 1PPBH 2WPKS 4KTCA 3GCHB 1YPEH 3MWIU 5DP3A 3EYDA 2HPQH 1S6HA 3NXPA 5DKMA 4B1TA 4E7NA 4R8TB 1QB6A 1Y5AT 1TGBA 2G55A 1K1NA 1K2I1 2EI6A 1XKAC 2HNTF 1AU8A 1FXYA 4Y71A 1DWEH 3BG4C 1C5QA 1O5AB 3IWMA 4XBDA 2AYWA 4E05H 1KSNA 1O3FA 4CRFA 3FAOA 1V2UT 2R2MB 3V3MA 2AGEX 4XE4A 1HXEH 1LHCH 1KXCA 4E7RG 1F2SE 4MVNA 2UUKB 1CHOG 1IHTH 3ZZAA 1HBTH 1SQOA 2C3SA 1KLJH 2ZDVH 4NGAH 3JZ1B 1C5WB 1GBAA 4X1PU 2GCTB 2AMDA 4ABGA 2NU2E 1CE5A 1MU8B 2QGRA 5J4QA 2CHAC 4WH8A 1MKWK 2B0FA 1CT4E 1EAIA 3M3SA 3CP7A 1A3EH 1P01A 2HVXA 1NY22 1S85A 2AMQA 4MNYA 2XNIA 3JZ2B 1CU1A 3ENSB 3T27A 1AVGH 3MH6A 1A4WH 1N8OC 2J94A 3LDXH 1W14U 3TH2H 1GI3A 1GJ9B 1WQSA 2W26A 3PMJA 3PROA 4ABEA 1O2LA 2BVRH 1DWDH 3FZZA 2VU8E 2ZU2A 4MNWA 4Z0KA 2GDEH 1ELEE 4WMDA 5F8TA 4ABFA 2CJIA 3SV2H 3SZNA 2BY5X 1ID5H 1D6WA 1GGDC 3VB7A 4LOYH 1EJAA 1GI2A 4GCHF 5GXPA 3SORA 2BDAA 7GCHG 1THPB 1V2PT 1GBFA 2JKHA 4OGYA 1SC8U 3VXFH 4CREA 1TNIA 1TPAE 5EQSA 1EASA 4U32A 3SNEA 2GX4A 3O8RA 1C5NH 5IYTA 1Y3YA 3M35A 1NRPH 2GT8A 3PMHB 3P6ZB 2ZHQH 2ZU5A 4X8SH 2FOGA 5AF9H 4DT7B 5A0AE 2B9LA 3SI3H 2A1DB 4X8TH 5EXLA 1Y5UT 2R0LA 3UPEA 1VCQA 3UNSA 1D9IA 3QWCH 1IQGA 3KGPA 4BNRA 4Z6AH 1P05A 4OS2A 1YLCA 1HJAB 5L6NH 4H42U 1GHWH 1F5KU 1OWIA 5FPSA 3ZZ6A 3RU4D 4X6PA 1EPTB 2BQ7B 3ZZCA 1MBMA 1DWCH 1ZSLA 4A6LA 1O3IA 3U9AH 2PFEA 2ZGBH 2PKAB 1DUEA 4U01A 2PSYA 2GCHG 2FYRA 4FUIA 1JIMA 2C8XB 2R3UA 4NIXA 5FHTA 1W7XH 3MNBA 2ZHWH 1EOLA 2ODYB 4AZ2B 5A8ZA 4K60A 2PKSC 1A46H 3EQ0H 1O3DA 1YM0A 4Y8XA 2EA3A 3SV6A 1O2XA 2ZCHP 4Y11E 4A1VA 4MTBA 4Q80A 1NPMA 1D3TB 1EJMA 1O2HA 3NK8A 1O30A 1HDTH 2ZHDA 5FBEA 1GCDA 1N6XA 3RM0H 1F7ZA 4JK6A 2OD3B 1SGFA 3V12A 2ZG0H 2F91A 4X6OA 4D8NA 1V2ST 1IQLA 3A88A 4OS4A 1EB1H 4I8GA 1KXEA 1BDAA 1L0ZA 3SJKA 4DY7B 1MTNB 4JCNA 3QLPH 1ETTH 4IN1A 4MPUA 2AGGX 1XVOA 1K1PA 2O8TA 2GMTC 1SSXA 2BLVA 2SGFE 2H1UA 1QURH 2AEIH 5AHGH 1AVWA 1LQEA 3MMGA 4DGJA 4Y6DA 2OINA 2QXHA 2OTVA 1Z7KA 1UCYE 1A61H 1V2KT 2FOAA 2FS8A 2ZTZA 1N1LA 2J2UA 4NIWA 3RXAA 2ZDAH 1U6QA 3PWBA 3SBKA 2IPHA 1C5VA 2A32A 4U2WA 2C8WB 1MU6B 4WXIA 1HRTH 3B8JA 3A87A 3ZZ7A 1ZJDA 2FOFA 2BOHB 2ZQ1A 2VWLA 3GCHC 4BAHB 1TRNA 1P10A 2OQUA 5E2PA 2HNTE 1IQMA 5EQRA 1ELBA 3UIRA 1V2JT 3A7VA 4FVBA 1HFDA 2OBOA 1O38A 1C1TA 2XRCA 1Q3XA 2A4QA 1GI6A 1AVXA 2BX3A 3IG6B 2FEQH 1PFXC 3NKKA 1K9OE 1W0YH 2RA0A 4MPXA 1W11U 1SGQE 1NC6A 4IC5A 4CR5A 2FXRA 3O8DA 1C1MA 2A45B 1XXFA 1AIXH 2BXUH 3GYMA 1GI0A 3GICB 4ZXYH 3UNQA 3UUZA 2XYAA 4ZKRU 1G3EA 1RFNA 1EB2A 3K9XB 3UOPA 4FUCA 4IN2A 1TBQH 2BX4A 4JZEH 1DFPA 2BDIA 3HATH 1TPPA 1TIOA 1HAXB 1L1GA 2Z3DA 1VCWA 4H6SB 1BTUA 3S9CA 4JYUH 1QFKH 4AYYB 2Z9GA 1C5OH 1GDUA 2BTCE 4A92A 2C90B 1C1RA 1GBMA 4JZ1A 1T4UH 2GD4B 4U30A 3QUMP 4ISHH 3MO6A 4Y79A 5SGAE 2H9TH 4GCHG 4Q2KA 3OSYA 1ETSH 3BEIB 1FQ3A 1AFQB 1OWKA 3GY4A 3ZVFA 2OXSA 2VGCB 1UTPA 4ISIH 1TOCB 3ZZ3A 1B7XB 3RXRA 1C1SA 4YTAA 1EUFA 1NTPA 1YPJH 4AFSA 2ZFTA 4MG3A 1TWXB 2GV6A 1C5ZB 1W13U 4YLUA 1P02A 1GMCF 1UTNA 1BZXE 5EPNA 2P8OB 2VH6A 5GJ4B 4R0IA 3BIVH 3VB4A 3LGTA 3O8BA 3ATLA 3F6UH 1EPTA 3ZVCA 4NIVA 1KYNA 1N6YA 2TIOA 3TJOA 1A7SA 1Y5BT 3SGAE 3IITA 1V2NT 3MU1A 3BTHE 2PKAA 1D3PB 2OBQA 2BLWA 1AKSB 1UHBB 2HNTC 3A8BA 1HYLA 2NWNA 1ZZZA 7ESTE 1QJ6B 1UTKA 1Z71A 2A2XH 1GJAB 2OUAA 1LMWB 3K6ZA 3UY9A 4UEHH 3SNAA 2OQ5A 3PV4A 1ARCA 2GZ9A 5JB8S 2ZCKP 2Y82A 4TY7A 8GCHF 3TLOA 1BMMH 1PYTD 1ZHRA 1ESTA 4THNH 3GY3A 3VB5A 2VWMA 1EZUC 2AIQA 3RXMA 1ZPCA 3DT0H 1HJAC 1ZRKA 3BTDE 4WF8A 1QBNA 1GJCB 5EG4A 1GJ5H 2WV5A 3GDVA 5E8EH 3BIUH 2DUCA 1ABIH 4K8BA 1C2GA 2FZZA 2SGDE 5TCAA 3DHKH 2HWLB 4CRGA 1TQ7B 1C4U2 3TJNA 1BRCE 5EGMA 2ZDNA 2D8WA 4IW4E 2WYJA 1P2MA 1SBWA 1GDQA 3CS0A 2FX4A 3GCNA 1ELVA 3TJVA 5IDKA 3E3TA 1YCPH 3LC5A 1NO9H 1O5FH 1TPSA 2FODA 1D3QB 3M7QA 4IS5A 4AORA 4X1NU 2VIPA 2Z9IA 1SOTA 2ZQ2A 1GL1A 3A8CA 1TNLA 3GYLB 3M7TA 5DGJA 1VCPA 1O5GH 1KXDA 2BVSH 5GIBA 1FY8E 2CXVA 1LDTT 8ESTE 1FI8A 1HGTH 1THSH 1GBIA 4IBLH 4MDSA 1FUJA 1C9TA 1XKBC 2BDYA 1QB9A 2CHAB 1WCZA 1PPGE 1NFXA 3AAVA 3Q77A 2Y5GA 1CA8B 3TGKE 4BTTB 1UVPA 1QIXB 1HCGA 3LGUA 2H9EH 2BD8A 1FJSA 3NWUA 4O3TA 4BANB 1L1JA 1YPGH 3A80A 2UWPA 3UR6A 1JWTA 4BAQB 1DANH 3HKIB 1C5SA 3ZZ8A 1GMHF 3MFJA 1BMLA 4I8JA 3SGQE 1FAKH 1C2KA 2FOCA 4ZROA 3ZZ5A 1QCPA 3SU0A 5EU8A 1O3OA 2Y80A 3GDUA 4TYDA 3SNBA 2J38A 5E0GA 1DLKB 4ISOA 5BPEA 1OWJA 3DFLA 2BMGB 1HAPH 4MPWA 1BIOA 4NFFA 1HAGE 2P93A 4AFQA 3I78A 1SG8B 1BBRE 4FVDA 6CHAB 1GBTA 2Y81A 3H5CB 1ZYOA 4KELA 5T6FA 1TMTH 1RS0A 2PGBB 3OTJE 1OSSA 1QGFA 3M37A 2H6MA 4XBBA 2TPIZ 2H2ZA 4FU9A 3RUOA 4DJZB 1JRSA 2QXGA 1GBJA 1DS2E 1NN6A 2QC2A 1HB0B 1T8MA 1E37B 2XC5A 2ZGHA 1Z1IA 1O2MA 2GP9B 2G4TA 1RXPA 1CGJE 1SMFE 4D7GA 1FPCH 3F9GA 2JETC 4ESTE 3GDSA 3A83A 3RMOH 4K1SA 2P95A 1BTYA 1TQ0B 3EA8A 2CV3A 2TGAA 3TJUA 1GI7B 5EOKA 4TPYA 1H8DH 4XOJA 1C2LA 2J92A 3S9AA 1TRYA 1Z8IB 1OKXA 4Y8ZA 1GMCG 2FI5E 2QY0B 1MQ5A 1AKSA 1UHBA 3SQHE 1C1OA 2G51A 1SGNE 1Y3VA 3KQEA 3PMAB 1C2IA 2PKSB 1LKAA 1PPFE 3ATMA 3PYHA 1O2TA 4A7IB 4ISLA 1DUAA 2AH4X 3GY2A 1QB1A 1DSUA 1O3JA 1O5EH 2GT7A 3RXIA 2IJOB 3KN2A 3M7UA 1UVTH 2QN5T 1ZGVA 1ELAA 3ZVDA 3LONA 2EC9H 3E16B 2ZFFH 2VVVA 2ZNKH 2P8OC 3Q3YA 1Y59T 3AW0A 1VITF 1TX6A 2BDBA 2BQWB 1Q31A 1FN8A 2BLOA 1MMJN 2ZGCA 1SGDE 2GGVB 2HGTH 2ESTE 3PO1C 4XFQA 3L33A 8GCHG 4X8VH 3TGIE 1GDNA 1J15A 2C4FH 4FU7A 3DUXH 1EQ9A 1UCYH 2A4OA 1PQAA 1O2JA 3E0PB 1KXBA 5FPYA 3PM3A 4CR9A 1OYQA 3STIA 2G5VA 2ZWLH 1CBWB 4D76A 3T29A 2JH5D 1V2RT 1ZRBA 1O2VA 3T28A 3C27B 1IQIA 2BD5A 1O3CA 3P8GA 1AWHB 4AX9H 1ZPBA 2ZU1A 3VB3A 4LZ4B 2ZF0H 1YCPK 4XSKU 2VIQA 5JDUB 1DSTA 1HAIH 2XCNA 1IAUA 1P8VC 1K1LA 2VWOA 3MI4A 1AD8H 3U98H 5C2ZA 1P3EA 5DP7A 4CHAB 1NFYA 4X0WU 3SUDA 5E0HA 2GTBA 3ODDA 1O2SA 3VEQB 3GY7A 1A2CH 1T32A 2A5KA 1QHRB 2XTTB 5T6GA 1L4DA 3RXDA 4ZHLU 5J4SA 2G8TA 1NRQH 1FY4A 3RXBA 1J14A 2W3KA 1FPHH 2YNBA 1S82A 2STBE 4NSVA 2Q6FA 1GVKB 1MQ6A 1OS8A 5BRRE 2ZU3A 1P03A 3L6PA 5ABWA 1XX9A 3UTUH 2BD2A 2AIPA 2D2DA 5DPAA 1K22H 3RLWH 4ZXXH 2BOKA 2Q6DA 1B0EA 1LQDB 4I8KA 1NU9A 3PMBB 1GG6C 1SI5H 1GMHG 2XWBI 3MU8A 1T31A 2SGPE 2WPJS 2Y5FA 3BTGE 1L2EA 1AQ7A 2G4UA 1LHFH 3SJOA 4M7GA 2LPRA 2CF9H 1YPLH 4UFGH 1FZZA 1SFIA 1V3XA 2ASUB 1CO7E 3D65E 3EDXB 2W3IA 2VIOA 2ANMH 2OP9A 1C2JA 1O37A 2CN0H 3KF2A 1HV7A 1C5XB 4ZKNU 2J34A 2ANWA 3TK5A 2V6NA 1BRBE 2B7DH 1ZPZA 1ANDA 3P17H 2J9NA 2FS9A 1GI8B 1E34B 1OX1A 2PUQH 3E0NB 1P2NA 3FZDA 4ASHA 1G32B 2AGIX 2STAE 1FLEE 3URCA 3ATKA 6CHAC 2W7SA 2ALPA 3SN8A 4FXGH 1GI4A 3RXPA 1P11E 1FY3A 3TK6A 1GVLA 2SNWA 4FU8A 1TAWA 4ABAA 2VIVA 2P16A 1BHXF 4Y8YA 4UFFH 2EI7A 4ZHAA 4BTUB 1C4V2 1GL0E 2OC1A 1LKBA 4O3UA 1XVMA 1NT1A 1IQKA 3G01A 1C5YB 3UQOA 3H7TA 5DP4A 1ELTA 4X1QU 2BVXH 1P04A 3SJ9A 1Y8TA 3A7ZA 3SUEA 1XMNB 3EGKH 3MNXA 3E91A 2BD7A 2P59A 3LGIA 1HPGA 2HRVA 3UWJH 1O3LA 1O3AA 3RXKA 2ZU4A 1F0SA 2QCYA 2PTCE 1LPKB 4GPGA 3A89A 4QT8C 3VB6A 1KTTB 1BT7A 4I31A 1EZXC 4K1EA 1P9SA 3MHWU 3VXEH 4YOJA 2B8OH 3BTFE 2BD9A 5JBBS 1GJBB 1WU1A 3MH5A 1Q2WA 4YZUA 1VITG 4HTCH 2ULLA 3KEEA 1UCYK 4RN6A 4O03A 1THRH 4NA9H 1BJVA 3RXTA 1NROH 1ZR0A 4CRDA 2HPPH 5LPRA 1NU7B 2AS9A 1TALA 2ZGJA 1MTUA 2XC0A 5DG6A 3BTME 2W5EA 4GAWA 1HNEE 1TNHA 2WPLS 1Z8RA 1IOEA 1W12U 4INLA 5PTPA 4KTUA 4SGBE 3SV9A 3OYPA 1SLXB 3M36A 3A84A 1V2MT 2P3TB 1A0JA 4FUBA 1AUTC 1NFUA 3GY6A 3UR9A 2A4GA 5EODA 4ZKOU 2FOEA 2ZFQH 1UTMA 1RTLA 1XUKA 1BHXB 1RTKA 2FOHA 3FP6E 4K2YA 5A0CA 1W0ZU 4I8HA 1CBWC 3SU1A 1ZSJA 3LH3A 4BAKB 3M5MA 3P8OA 2SGEE 1E38B 2A5AA 4Q7YA 5A8XA 1J16A 4I8LA 1BBRH 2BLQA 2G00A 4YESB 2FOMB 3MO3A 2BY7X 2BXTH 4BXSA 5C3NA 1ZMJA 3A7YA 3T2NA 1QL9A 1C1UH 4YLQH 3UOUA 1YCPM 2FESH 1S84A 2ZDLA 4CHAC 3LU9B 1T8LA 2XBVA 3SQEE 2FYQA 4TWWA 2VJ1A 1O3HA