4INHA

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
178
structure length
172
Chain Sequence
b'DDDKAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 172
sequence length 178
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4inhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4inhA01
2FTLE 1SQAA 3UWJH 2VGCB 1K2I1 2FOAA 4AG2A 2G51A 2YNBA 3RLWH 1SGRE 2KAIA 4K1EA 1F0UA 4TWYA 1WBGB 4WWYA 1MQ5A 3K9XB 3S9CA 1VITH 1G37A 2Z9KA 1S6HA 1O3KA 4NFEA 4JZFH 1BJUA 1OWHA 2FPZA 2P59A 1HIAA 1VCWA 4CRCA 9ESTA 2OC0A 2O8UA 2PSYA 4JZIA 2BY7X 1DUAA 5F03A 2BLVA 2FZZA 1QFKH 2GCTC 1C5XB 3GY8A 4HGCA 3OTJE 4BTUB 3GDSA 2H9TH 1BMMH 3UTUH 2C90B 2Z6BD 3AASA 2GZ8A 1F7ZA 1HAGE 3SUDA 1CT2E 1SG8B 4BAKB 1WOFA 1BMAA 1RJXB 4M7GA 1C5MD 1ELCA 2V0BA 1C2FA 5EU8A 3ZV9A 3KIDU 1V2KT 1AIXH 1O0DH 4OS1A 2SNWA 3RC5A 1V2NT 1G3CA 3RXFA 3LGTA 1LMWB 3BEFB 1MU8B 1C2KA 1O2XA 3E0PB 4GSOA 2OCVB 1GHAF 3F1SB 3RXVA 4GHQA 1P01A 1P2IA 2Y81A 4IMQA 4D7FA 1C5NH 1NO9H 1P12E 1SGIB 4INKA 2VIOA 1HGTH 2BVXH 4AB8A 2P8OC 3TPIZ 1TRMA 1UTMA 4B73A 2V35A 3P95A 4JZ1A 1GI4A 1O2VA 4AORA 1EJAA 3UFAA 2R9PA 1QQUA 2BX3A 1UTQA 3SU2A 3MMGA 1ETSH 3GISB 3B23B 1BTHH 3TK5A 2H2ZA 1Q31A 4IC5A 2Z3CA 3ATKA 4YESB 1DICA 1EJMA 3V12A 2STBE 3I77A 4JK6A 1HJ8A 2ODYB 1GHZA 4MPXA 1FMGA 2BTCE 1YM0A 2ZTZA 1QHRB 3RXUA 2W3IA 4JYUH 1C5WB 2VIVA 5HMAA 3SW2B 5SGAE 4LK4A 5EQRA 1RRKA 2JH0D 2O8MA 3PMHB 2GT7A 1IQIA 1GBHA 3FVFB 4FUDA 1VITG 4WJG2 3N7OA 2PTCE 1PPHE 1MBMA 5IDKA 1BTXA 4QT8C 1C5PA 6CHAB 5DGJA 2GVFA 2XCFA 2P3TB 4JMYA 4FU8A 1D6RA 1GI6A 2OP9A 4E06H 1J8AA 1DY9A 2F9NA 5F8ZA 3OX7U 3K2UA 3MH6A 2BLWA 2W5EA 4FU9A 3RC4A 1BUIA 1TA2A 2Z3EA 5E2PA 3SU1A 1MMJN 4TPIZ 3FANA 1MCTA 1UCYH 1O2RA 1OYTH 5FX6A 2ODQA 3R0FA 1AVGH 3CS7A 4AN7A 4AZ2B 1ELGA 3VXFH 1O3CA 3SZNA 1FI8A 1GL0E 1M9UA 1GCTB 3ATWA 7LPRA 4Q7ZA 1AKSB 2GZ7A 1T31A 1TNLA 1DLKB 1G3BA 4D76A 3QUMP 1XUJA 4MNVA 3DA9B 2TBSA 3RXAA 3A82A 1EZSC 2JH5D 3OY6U 3MO9A 5EQSA 2I6QA 1O2IA 4BAHB 1SBWA 3SJ8A 3VEQB 3VB3A 2BHGA 1UTLM 2ZCKP 5PTPA 2PGBB 3D65E 1NRQH 2ANYA 2A45B 1W0ZU 4TY6A 2HNTC 3P8NA 4KTSA 5FCRA 1KXBA 4ABAA 1INCA 5JBBS 1BRUP 1UO6A 1TBZH 4DCDA 1NTPA 1OKXA 2QXHA 1WQVH 3RXCA 2ZGXH 5C1XA 5JDUB 2AGIX 2GMTB 1O2HA 2FESH 3NUMA 1QB1A 1SMFE 3L3TA 1P3EA 4I8HA 3M3SA 5HGGA 3RXLA 4CRGA 2BQ6B 1V2WT 2GV6A 1GCDA 2ZFSA 1Q3XA 1AKSA 4MTBA 2BD3A 5TCAA 2PUXB 2F9BH 1TQ0B 3A88A 1K1OA 2C8YB 2ZWLH 4J1YA 5LH8A 3SNAA 3UQOA 4UE7H 3FFGA 1F2SE 1RIWB 1HJ9A 1BRCE 3MFJA 4WXIA 5FX5A 1FXYA 1CE5A 2NU4E 2XNIA 1O2PA 4GCHG 1UTJA 4CBNA 2AS9A 1BRBE 5AFZH 2Z9GA 1UVUH 2XC5A 1QL8A 1RTKA 2O8WA 1GDNA 1A5HA 1WU1A 3IG6B 2OC1A 1V2VT 3LU9B 3SJIA 1UTOA 3MO3A 3WY8A 4CR9A 4BOHA 1HAYB 5TJXA 1MAYA 4DW2U 4Y71A 3DHKH 3GY5A 3PM3A 3ZYEA 1ZSKA 1ZSLA 2BD9A 1TNIA 3LH1A 1FY8E 3NWUA 5DKMA 1H4WA 3MU0A 2BXTH 1ZJDA 2F91A 2UUKB 3HKJB 4Q80A 3DUXH 2ZPRA 1VZQH 3LC5A 4AX9H 1C5UA 3M3VA 4GVUA 1DLEA 2ZZUH 3BIVH 4YZUA 3UNQA 1ELVA 3CS0A 1ZGIA 4ZMAH 2F9UA 2UWOA 5E0HA 1Y5AT 3KL6A 2ZKSA 1WAYB 4KTUA 4THNH 1HCGA 1W7XH 1ESTA 3M36A 2Y7XA 4K5ZA 1IOEA 2FLRH 1N6YA 1K1JA 3BTKE 1LPZB 3URDA 1RTFB 2AIPA 4D9RA 2AGGX 8ESTE 2ZFPH 3T27A 1SGEE 2VWMA 1SGFG 4Q2KA 1O3BA 5C5NA 1ZR0A 1MD7A 5DP5A 1SI5H 2ZGHA 1T8LA 3UQVA 1UTPA 2SGPE 3M3TA 1AY6H 3VPKA 1TMTH 1O30A 1BDAA 2FO9A 1TNHA 5E0JA 1NM6A 3G01A 1ELBA 4XDEA 4E7RG 1LHFH 6LPRA 1RGQA 5I25A 2ZHQH 4YO9A 4VGCC 3T28A 1KY9A 3LKWA 2ZU4A 1IQLA 2B5TB 5C1YA 3SGBE 1BBRK 1GMHG 2CHAB 1NPMA 1T32A 4ISNA 1A1RA 5LPFA 1KXDA 1TA6A 1PPEE 4B74A 3CP7A 1EPTA 2ZHDA 4MNXA 3MO6A 2FLBH 2H6MA 3ZZCA 1J15A 1UVPA 2D26C 1EKBB 1K1LA 2BD2A 2XC0A 1C2JA 2A5KA 1C5QA 1JIRA 1OOKB 4GHTA 4GLYA 3S7HB 1GI7B 1O34A 4OS5A 1G36A 5F8TA 3KGPA 2ANWA 6GCHG 1C2LA 2R2MB 1BIOA 3GY3A 1IHTH 2I6SA 4Y7BA 1NRRH 1SGTA 1WUNH 3D23A 4BXSA 3PWBA 3FP7E 4IN2A 2BDCA 1NFWA 3QLPH 1ZYOA 3NKKA 2BOHB 5A2MH 1C2MA 2G8TA 4BTIB 1GJCB 1MTWA 2OINA 2A4OA 2EC9H 1TFXA 5B6OA 2QF0A 1HB0B 1LO6A 5IYTA 2PGQB 2CXVA 1LHGH 2VWNA 3VGCB 1C1WH 1SGPE 2IN2A 3M37A 4UD9H 4A1VA 2ZQ1A 1OSSA 2ZHWH 4Z0KA 3M7TA 5F6MA 3BTFE 1HUTH 4ABDA 4HZHA 3Q3XA 1P2JA 2ZU1A 3H5CB 2EI7A 2JH6D 2O8TA 1P57B 4H6SB 1JMOH 2QCYA 2JETB 1KDQB 3GY2A 4DT7B 4BAOB 1H8IH 4CRAA 1C4U2 3TITA 3PMJA 1ANCA 1VGCC 3SJKA 1PPZA 1O3LA 2BM2A 4A6LA 4NWKA 4RSPA 1O32A 4TPYA 1UVOA 1W7GH 5FPTA 3MWIU 1RD3B 3E1XB 2IJOB 1A2CH 1YF4A 2BDGA 1TX7A 3M5MA 1MU6B 1CA0C 2GKVE 3ZVBA 1MTNC 1Y3WA 2WV4A 1W2KH 1XKAC 1T8OA 2GD4B 3ZZ9A 5J4QA 1O3EA 1EQ9A 1UCYE 2WPKS 2NU3E 1BTZA 3GCHC 2GX4A 3UWIA 2Z94A 5EG4A 2PV9B 1HAHH 3PWCA 4MPWA 1TNJA 1KDQA 4WH6A 1G30B 1AU8A 2ZPQA 1GJ6A 1QIXB 2VIWA 3PMBB 4Y6DA 2Z7FE 4NZLA 1PPCE 3KHVA 4B2CA 1HNEE 1JRSA 5JYIA 3RXGA 5DG6A 3RXBA 4DOQA 4X6MA 3HK3B 8KME2 1Z8RA 3PV4A 3ZZ6A 2Z9JA 1AWFH 2B8OH 3QWCH 1CHOF 3QZRA 1UJ1A 3HPTB 3MU4A 1C2GA 4Y79A 4KP0A 1SPJA 1NN6A 2A31A 2C8WB 3RXOA 1KTSB 5DO4H 2AH4X 2OQUA 1ABJH 1THPB 4H6TA 1GG6C 3MNCA 1BA8B 1WSSH 4UDWH 1XM1A 3PO1B 1LVMA 1AUJA 1P06A 5LPRA 1BTWA 8GCHF 4K8BA 3A84A 1T4UH 1LDTT 1QB6A 1B0EA 2TGPZ 4ISHH 1CBWB 1GL1A 4Y8YA 4FUCA 1DXWA 1D4PB 2B0FA 4YOIA 3ZZDA 2QN5T 4DIIH 4I8KA 5E2OA 1Y5UT 2BX4A 1E36B 2ZP0H 4BANB 1DANH 1D6WA 2UWLA 2ODPA 1O5DH 3LJOA 1N8OB 2ZFRH 1QNJA 3GCNA 1KXFA 1QA0A 1TMBH 2XBXA 1OXGA 4WMDA 3PMAB 1QRWA 3A7WA 3GCOA 3LGVA 1C5SA 1OWJA 3MNXA 2BZ6H 2F9OA 1H9HE 1O3AA 3P6ZB 3ZVFA 1HXFH 1GJBB 1W13U 2ZCHP 1MBQA 1GI2A 1S81A 1NY22 5DP3A 3RM0H 1EP6A 4X8UH 1A5IA 2R3UA 1EZXC 1GJ7B 2STAE 1KLIH 3UR6A 2XBYA 1O2ZA 1GMCF 3KCGH 2AFQB 4ABIA 4CBOA 1W14U 1K21H 2VIDA 1GHAG 5JBAS 3VB7A 1ACBE 2RCEA 4X1NU 2Q6GA 3MU8A 1Z8JB 1TGBA 2C93B 3GY6A 3F6UH 2G81E 1AB9C 4FVDA 1AVXA 3EE0B 2YNAA 1O2KA 1ANDA 4FUHA 4X6NA 4AFSA 1DVAH 1ELEE 1ZSJA 3AW1A 1T8NA 1L2EA 5ETXA 1SGNE 3TJNA 1YLDA 3OYPA 3L6PA 1YYY1 1ANBA 2ZDNA 4YTAA 3U98H 2SNVA 1N1LA 1YPGH 2VGCC 1MTVA 1SGCA 4F4OC 1E0FD 5FBEA 1AI8H 3P8GA 2NWNA 1O5FH 4DGJA 3MU5A 4TYDA 3T25A 3T26A 3LT3A 4MQAA 3B8JA 4AYYB 3BTGE 1EOJA 2BY9X 4YOJA 2CN0H 4ZUHA 3LGWA 3M7UA 4Y76A 1NS3A 3TNSA 1S5SA 3RXPA 1EJNA 1TE0A 3RXQA 3EDXB 3VFEA 3S0NA 1YPHE 4RN6A 1YPHC 3KN2A 1C1TA 3LGYA 1ORFA 2OQ5A 1S0QA 1LHDH 3SJOA 3E90B 3RUOA 1A4WH 1Y59T 2R0LA 2OC8A 3RXRA 5FPYA 2GCHG 4ABEA 4OGXA 1D9IA 4SGAE 4U32A 3BEIB 4FUFA 3KQEA 4K2YA 1MUEB 1SQTA 2FTMA 5DP7A 3A8DA 4XFQA 2GDEH 1MZAA 3EA8A 1BB0B 4Q7XA 1MKWH 1GJ8B 2RA3A 1O5EH 2CV3A 1HV7A 3M5OA 2G55A 1F0SA 2A0QB 4JCNA 1SB1H 1ZLRA 3S9AA 3SNDA 1L4ZA 2VVVA 5J4SA 2CJIA 1P04A 1DUEA 2PWXA 5T6FA 2A4RA 1GGDB 1O3OA 5A8XA 1AFQB 1QURH 1YPMH 2QA9E 1ELAA 4I7YH 1CQQA 3MTYA 2J9NA 1B7XB 1ESAA 4IMZA 4ESTE 5ESBA 4LZ4B 4BNRA 4XSKU 1ANEA 1UHBB 1S6FA 5DPAA 2FWWA 3F9HA 1AO5A 1G3EA 7KMEH 2PKAB 2A2XH 2DE8A 2JKHA 1JOUB 1TB6H 3NZIA 1YPJH 3SU5A 2VB0A 4A5TS 2Y5FA 3HKIB 4U01A 1F0TA 2VU8E 2VVCA 2W3KA 3PLBA 3RU4D 1LQEA 2H9HA 1NU9A 2FX6A 3SHAH 4O03A 1AE8H 1PJPA 4X0WU 1VCPA 2ZF0H 1D3QB 1MTSA 2C3SA 4X6OA 2AYWA 1YLCA 2W7SA 3TNTA 5EW1H 3E16B 1HFDA 1ID5H 2A5IA 2H1UA 2ZFFH 2SGQE 3FP6E 1P3CA 3NPSA 1VJ9U 1G2MA 9LPRA 2OBOA 1DM4B 2Z9LA 2Y5GA 2XCNA 4X1PU 5FCKA 1EATA 5GCHF 3BTTE 1C9PA 6CHAC 2LNCA 1TMUH 1KXEA 2WINI 2HNTE 1Z6EA 1O2UA 1UHBA 2V6NA 2OD3B 1XUKA 1SFIA 2XBWA 3ITIA 2BY5X 5JB9S 1QBOA 1W10U 1WQSA 1FUJA 4Y0YE 2PKSB 2QC2A 2PKAA 3BTWE 3SGQE 3V7TA 1NRPH 4D8NA 1EAIA 3SOSA 1CGHA 1VR1H 5C20A 1Q2WA 3EQ0H 4BXWA 2FOHA 1O3HA 2ZEBA 1HDTH 2A5AA 2BD4A 2ZU5A 3SU0A 3E6PH 4H42U 1L0ZA 3GYLB 3KF2A 1BQYA 1S0RA 1GHBF 1EUFA 1IQJA 4K1TA 3M7QA 3PTBA 1MTUA 1GCTC 2ZC9H 2R3YA 3SBKA 2WYJA 1ZGVA 1MD8A 4BAQB 1K28D 1FDPA 1O3NA 3U8OH 1OWIA 4A1XA 2BVRH 2TPIZ 1XKBC 1GI3A 3P17H 1W0YH 4Y8ZA 4AG1A 1V6DA 2FM2A 4ZKSU 4FUBA 3QTOH 3ATIA 5TCCA 1O33A 1V2TT 1GBAA 1C1VH 3PYHA 2J2UA 2BOKA 1XUIA 4NA7A 4NIVA 4IW4E 1O3DA 4ZHMU 4J2YB 4ISIH 1GPZA 1QGFA 1SQOA 1CT4E 1P2KA 1DWCH 1FN8A 1KSNA 1GBTA 3BSQA 3ZZAA 2ZECA 4MVNA 2BMGB 2ZDKA 4ABBA 1UVSH 2Z3DA 1W3CA 3C1KA 2QV1A 2GMTC 1L4DA 1MQ6A 1GHYH 3P70B 2VVUA 2HVXA 2FS9A 1DS2E 1TAWA 2CGAA 4X6PA 1SFQB 2RDLA 3A80A 2BB4A 3JZ1B 2WV5A 3QZQA 3RC6A 3D49H 2ZDAH 4B71A 1IQGA 4YLQH 1RXPA 4U2WA 3TH4H 2FI3E 2M5TA 2TGTA 5AVDA 1TX6A 1RIWC 2WUBA 3M35A 1IHSH 1YCPK 1XXDA 4NFFA 2J94A 4IC6A 2G4UA 1HAOH 4OS2A 5JB8S 1OPHB 4BTTB 2PUQH 4DY7B 5HM9A 1YGCH 1KXAA 1EPTB 1C2IA 1RTLA 2R0KA 3SUGA 1QJ7B 3DT0H 1XUGA 5GDSH 5DK1A 1GBMA 1WTGH 2CMYA 4ZXYH 3SORA 1ARBA 1HAPH 4R8TB 3SU6A 3SJ9A 2ZO3H 2NU1E 3E91A 1A0JA 1JXPA 1JIMA 4FUEA 3MU1A 5DP6A 1BHXF 1C1PA 1CO7E 4KELA 2XWBI 1UTNA 2PSXA 4O3UA 1BMLA 4NZQA 3V13A 4ZKOU 1LVBA 1TGCA 1FY3A 3HGPA 4BAMB 1E35B 1QA7A 1Y3YA 2W26A 4JZEH 1FPHH 3K6YA 2BDIA 3P92A 2UWPA 3ZVAA 1P2MA 2FXRA 3SUFA 1EB2A 1XVOA 4LZ1H 1TRNA 4X1RU 3TK6A 2F9VA 1GBKA 2XC4A 3U8RH 1TNGA 1TNKA 5A0BA 3EA9A 2BY6X 2ZTYA 4FUJA 1T7CA 1QBVH 3HK6B 1TONA 1PPBH 1JBUH 1ZTJA 2ZNKH 4WMEA 2PFEA 2PW8H 3SUEA 1P05A 1ZTLA 5EGMA 1C5RA 1ABIH 1AD8H 4ABFA 1O3FA 1NT1A 2XBVA 4AYVB 5EPYA 1QJ1B 1P2NA 5EQQA 2G4TA 1O2QA 1FZZA 4YOGA 1AN1E 7GCHF 5JPMH 2FOFA 5L30H 4HI3A 2HWLB 1GHWH 1F92A 3RXIA 1GI1A 4B2AA 1JWTA 1AUTC 1O2WA 1P03A 4LOYH 4CR5A 1V2OT 5CMXH 2OTVA 2ANKH 2EEKA 1HJAB 5EW2H 1GVZA 3GDUA 1UK4A 3ZVGA 2Y80A 3ZVDA 3TJUA 4MDSA 1AMHA 3C27B 1FIZA 3PROA 2QXGA 2D8WA 1O5BB 3DFLA 1ETRH 1YPKH 2AMQA 1FY4A 5G4BA 1GI8B 1O3PB 2FOBA 3ENSB 1ZZZA 5EPNA 1BJVA 2P3UB 3RXKA 3SV9A 1TGNA 4MPVA 2CHAC 3GDVA 1QRZA 3ELAH 5GWZA 4PROA 1EZUC 4NIYA 2FX4A 3SNBA 3I29A 3LJJA 3A87A 4Y10E 1CGJE 1TPPA 2GTBA 2WPJS 1FAKH 1VCQA 3P8FA 3QDZB 1TPAE 2BD8A 3EGKH 1K1NA 4MNYA 1OWDA 1C1QA 1NFYA 3Q76A 3E0NB 2P3FH 2XRCA 3U9AH 2WUCA 1E38B 3UNSA 3LOXA 1MCVA 3VXEH 3LH3A 1QY6A 3QGNB 1A7SA 1SOZA 2A7HA 2G00A 2THFB 2AERH 1GDUA 2OUAA 4E7NA 3RMOH 1BHXB 4UEHH 2Z9IA 3TU7H 4B75A 2FYQA 1PPGE 1SVPA 3MI4A 5CHAB 3KNXA 1NZQH 2ZIQH 1BTUA 4X2VA 3QGJA 3QK1A 5T3HA 3OU0A 5T6DA 1GJAB 5BRRE 1O5GH 4K60A 2FOGA 2ZI2H 1S85A 4K69A 4CREA 1NU7B 4IBLH 1S82A 2Q1JA 3NXPA 2CF9H 2LPRA 3ATLA 1SLVB 2A2QH 1V2JT 3T2NA 4E05H 1TGSZ 2QYIA 4NA9H 5EXNA 1U6QA 5A8ZA 2XWAA 5EXLA 2VH6A 3B9FH 2F9PA 3VGCC 3DD2H 1EX3A 3A7VA 3BG4B 2ZFQH 1ELDE 2H5DA 1ELFA 1CHOG 2TIOA 4SGBE 4YT7H 1NC6A 3RXMA 1VJAU 3O8RA 4ABJA 1EB1H 4B2BA 2QXJA 1C5VA 3ZVEA 3PLKA 3VB6A 1P2QA 4I8JA 5K7RA 1DT2A 1Z7KA 2JETC 4OS7A 3OY5U 1EXFA 8GCHG 1MZDA 1SL3A 4A7IB 2C8XB 2BDYA 2OC7A 3AAVA 2ZU2A 3BEUA 3S69A 2FIRH 1T4VH 1C1UH 1ELTA 4DG4A 3SU3A 2P16A 4CHAB 1QTFA 1WV7H 3MNBA 2SGDE 4CRBA 1DPOA 3ZZ4A 2PLXA 1OP8A 1BBRH 1THRH 2VWOA 1TOMH 4D9QA 3KQDA 1KLJH 1EAXA 2F3CE 2PHBA 1AVWA 4GPGA 1C9TA 1GMDF 4O9VA 2HOBA 3S9BA 1K22H 1PQ7A 1BTYA 2FDAA 1LVYA 3A7TA 1DOJA 2GGVB 2P93A 3RLYH 2ULLA 1OX1A 3SNCA 1SGFA 3O8CA 3FAOA 3A83A 1OWKA 5LPEA 3HGNA 2SGAA 1TIOA 2BLOA 3BTEE 1O38A 1OYQA 2GCTB 1GMCG 1XUHA 2A1DB 2BYAX 2VIPA 3GICB 1FV9A 2BQWB 1AE5A 1QJ6B 4DVAU 4JYTA 1ZHRA 1GHVH 4KTCA 1YKTA 1O3IA 2FMJA 1P2OA 5FPSA 3P8OA 5HM2A 4ZKRU 4ZHLU 3SN8A 5K0HA 2V3OH 1UCYK 3RU4E 1CU1A 1CHGA 3A7XA 1FN6A 4MLFB 1K9OE 1OP0A 1QBNA 4D7GA 2RA0A 1D3PB 3EA7A 1E37B 4LXBH 2ZGJA 3GCTF 3IWMA 1Y5BT 1GJ5H 4JK5A 4ABGA 1GBLA 3RXJA 1F5RA 3OSYA 3Q77A 3PO1C 4KKDA 2ZTXA 2ZG0H 4NSYA 4Y0ZE 2P8OB 2O8LA 4F49A 1KYNA 4I33A 4GUXA 3SI4H 4YM9A 1O5CB 2OBQA 1O2LA 1CBWC 1PQ8A 1ZJKA 2ANMH 3M61U 3MH7A 2HNTF 1P10A 2BDBA 1TRYA 2AGEX 1O36A 1ESBA 1SGDE 1J14A 2WPIS 1ZMLA 1HAXB 1N8OC 3QO6A 3W95A 2ZGBH 3UPEA 3GY7A 1DE7H 1ZHPA 4X1SU 4ABHA 4Y7AA 2XXLA 3A8BA 1O37A 2ZPSA 3UY9A 4AOQA 4B1TA 1GBBA 1O2SA 1W8BH 3BTME 5FXLA 4O97A 1CVWH 1PYTC 1EAUA 1TABE 2J38A 5BPEA 1HYLA 4K3JA 4RKJB 2ZHEH 4X8SH 3U8TH 1O2MA 3F9EA 4INHA 1BMNH 2EI6A 2SGEE 3MH4A 1TPSA 1ZPBA 3KQBA 3M5NA 1V2QT 2ZCLP 1O3GA 5FHTA 1C2EA 2EA3A 1TPOA 3V3MA 1NFUA 3ZZ5A 3AVZA 4WMFA 3E3TA 1GHXH 2W7UA 3FP8E 1F0RA 4A92A 1GJ9B 3LGIA 4TWWA 3TJVA 1GI9B 4ZAEA 3BTDE 1TALA 2F83A 4WVPE 1AQ7A 1EZQA 3QN7A 4X8VH 2ALVA 3I78A 3CENA 4I31A 5JBCS 4WF8A 4YT6H 5ABWA 1ZMJA 3SV8A 3NCLA 3SI3H 3NK8A 1YPEH 4ZXXH 1YBWA 3ATMA 1OS8A 1ZMNA 1HAIH 4XBDA 2FODA 5EOKA 1D3DB 3STIA 3ZZ7A 2OXSA 1XXFA 2A7JA 1Z6JH 1EASA 2PTNA 3BTQE 1TQ7B 3BF6H 3K65B 3T29A 3FZZA 1P9UA 3O8DA 3D62A 3PTNA 1V2MT 2Y6TA 5C67A 1F5KU 2BDAA 1NRNH 2ESTE 3A7YA 4RKOB 1O35A 2BVSH 2BXUH 1HAZB 1LHEH 1BITA 1QRXA 1GI0A 4UFGH 3URCA 1O5AB 2G52A 1O31A 5A8YA 1A0LA 1A3BH 2GT8A 4I8LA 4NG9H 4XBCA 4YLUA 2XTTB 1IQFA 2GCHF 3LIWA 3A8CA 3U1JB 2DUCA 5GCHG 1HLTH 3QX5H 2ALPA 1T8MA 4MPUA 8LPRA 1EP5A 5I46H 3TK9A 1TWXB 2VINA 1SLWB 1C5ZB 1GJ4H 1SR5C 1DSUA 2DE9A 1C1RA 2QF3A 1HRTH 1J16A 1DDJA 1VITF 4AGJA 3TH3H 4AB9A 1JRTA 3A86A 1C5TA 1G2LA 1BT7A 1C4Y2 1QQ4A 1WTHD 3STJA 3TH2H 1QL7A 1HXEH 1GHBG 4WY3A 2TGAA 1GGDC 3LONA 4IN1A 2FOMB 1AFQC 2IOTA 1XUFA 4OGYA 3K6ZA 3ODDA 2A4GA 5A09A 3SV6A 2J4IA 2QGRA 3A7ZA 5L2ZH 3RP2A 1A5GH 2GZ9A 4R0IA 3RXHA 1N6XA 3RXDA 3S7KB 4ASHA 2G5NA 2ZHFH 3TGKE 1Y3VA 5DP9A 1UTKA 1V2UT 1YC0A 2FI5E 2ASUB 2O9QA 3BTHE 5GJ4B 1AFEH 4CRFA 3RMNH 1P02A 1KLTA 5H4IB 1NESE 1PYTD 3U69H 3BG8A 2ZDVH 4MG3A 1IAUA 2SGFE 2VNTA 1C1SA 3MOCA 1SC8U 5A0CA 1LKBA 2HLCA 1MAXA 1V2RT 2K1QA 1O3JA 1SHHB 2HPPH 1V2LT 4TY7A 5GPIB 4HFPB 2AMDA 3A8AA 1LKAA 5T6GA 1O2GH 1Z1IA 1ZRKA 1LHCH 1FJSA 1FONA 3L33A 3O8BA 1ZPCA 3PLPA 6ESTA 1LPKB 1FY5A 1S84A 1P9SA 4FXGH 2ZU3A 4UONA 1Z71A 1BRAA 2UUFB 1GBIA 1K1PA 2GV7A 1MH0A 2BD5A 1CT0E 2PKSC 1KTTB 1QB9A 3GOVB 5HXFA 3RU4T 3TGJE 2IPHA 1LVOA 3AAUA 3RXEA 2ZQ2A 1GBEA 4NWLA 1FY1A 1DFPA 1GJDB 2ILNA 1BBRE 1P11E 3BIUH 3ZV8A 1C2HA 5GXPA 1NROH 3SGAE 3QTVH 1WYKA 1ETTH 3RXTA 4HTCH 2C4FH 2Q6DA 1J9CH 4Q7YA 1TX8A 1G9IE 4WH8A 3SNEA 1DWEH 4DURA 3GY4A 2UUYA 2Y7ZA 4GCHF 3LGUA 4ZKNU 2HPQH 1BOQA 3Q3KA 5C3NA 1LPGB 5FBIA 2FEQH 2AMPA 2D2DA 2YOLA 4VGCB 2BLQA 1XVMA 4AGKA 1Y3XA 1ZTKA 1AZ8A 3SV7A 2Q6FA 1MKXK 1W11U 4X2WA 1G3DA 1UVTH 5DP8A 3SV2H 1A3EH 1IQKA 2XYAA 3R3GB 1SLUB 1O39A 3MH5A 4NIWA 1Z8GA 1ZOMA 2FP7B 3KQCA 3TLOA 2J95A 1GBDA 4ZROA 1S83A 4A1TA 3T62A 2H9EH 4NGAH 1A46H 4GAWA 1UK3A 1V3XA 2P95A 3UIRA 1TBQH 3A85A 1K1MA 1KXCA 2VH0A 7GCHG 1BZXE 5AF9H 1W12U 1EAWA 1SLXB 3M5LA 1J17T 4KGAA 5JBTA 1FIWA 4NIXA 2BD7A 1C1NA 1X7AC 4ZH8A 1V2PT 2QY0B 2WPMS 2Y82A 4X8TH 2H5CA 2G5VA 5FAHA 3UUZA 1ARCA 1PFXC 1SGQE 1QL9A 4UFEH 1RS0A 1TLDA 3TGIE 4INLA 1WCZA 1Z8IB 2WPHS 1C4V2 2UUJB 1C1OA 1CSOE 1EPTC 4XBBA 4Y11E 1B5GH 1K1IA 1TGTA 2TRMA 2FS8A 2NU2E 3F9GA 3FZDA 4FUIA 2Y5HA 1KIGH 4U30A 1CGIE 1TOCB 1C1MA 4ISOA 3UR9A 2EI8A 4OS4A 4CRDA 3PB1E 2FOEA 5C1UA 2A7CA 3ZZ3A 2QIQA 1L1GA 1ZHMA 4X2YA 1DWBH 1SSXA 1XMNB 4JZDH 1GWAA 1GBJA 1SGYE 3H7OA 3F9FA 4JYVH 2ZA5A 1SHYA 3LC3A 1Z1JA 4CH2B 3BN9A 1E34B 1RFNA 5C5OA 2ZDMA 5L6NH 4AFZA 3UNRA 1A61H 1H8DH 1GBCA 2PR3A 2FYRA 3MHWU 3RM2H 1NFXA 1IQNA 2AIQA 4XE4A 3UREA 1AGJA 1GMHF 1VGCB 1IQHA 3H7TA 3E8LA 4X1QU 2D1JA 5F8XA 1IQMA 1L1NA 1QR3E 1V2ST 1O2TA 2V3HH 1IQEA 2WPLS 3A89A 4Y8XA 1Y8TA 1BCUH 3UOUA 5GIBA 1GVLA 1SOTA 4I32A 4XOJA 3SQHE 1CA0B 5DP4A 2A32A 1GVKB 3ZZ8A 1MTNB 1O2JA 2R2WU 1HBTH 2A4QA 1DSTA 3DFJA 1L1JA 1DXPA 5AFYH 1O3MA 4NA8A 4NCYA 4FUGA 4ZHAA 3GCHB 2ZGCA 3EYDA 3AW0A 3RDZA 2OLGA 3ZVCA 5LGOA 3LDXH 2ZFTA 6GCHF 4CH8B 4OS6A 1TBRH 1TYNA 1FPCH 4UFDH 1P0SH 3ZZBA 2TGDA 1HJAC 4K1SA 4O3TA 3ESTA 5AHGH 4UFFH 4B76A 1C5OH 1AHTH 3EAJA 3Q3YA 1FAXA 3MYWA 1LTOA 1ZRBA 2QXIA 3MNSA 1DX5M 1PQAA 4DIHH 3RMMH 5E0GA 3U1IB 1THSH 1B0FA 1EOLA 1YCPH 2BQ7B 2ZDLA 4I8GA 3UOPA 2AEIH 2HALA 1FLEE 5ESTE 1DITH 5CE1A 4K8YA 1O2OA 1AZZA 2C8ZB 3RXSA 2CF8H 3TIUA 5HYOA 5A0AE 1YCPM 2B7DH 1H9IE 4X2XA 1F5LA 1PQ5A 2GP9B 1XX9A 1MKXH 1PPFE 5EXMA 1GG6B 2RG3A 5C2ZA 2FOCA 1D3TB 1GMDG 3ZYDA 5EODA 4MNWA 1H9LB 3TJOA 1DWDH 1CA8B 1YPLH 1OP2A 1G32B 4ISLA 2BY8X 3W94A 1FNIA 1H1BA 2XW9A 3JZ2B 1QCPA 5CHAC 1BTPA 1NRSH 1UMAH 3KEEA 2SFAA 3TVJB 1HAVB 1Y3UA 2BZAA 1GI5A 4FU7A 7ESTE 1A0HB 1O2YA 1C5LH 3SQEE 5DJ7A 4AFQA 1DY8A 3RMLH 1MKWK 3BV9B 3V0XA 3SU4A 3F68H 1LQDB 2BDHA 2KAIB 1O2NA 1ZPZA 2NU0E 3Q00A 1C5YB 1GDQA 1AWHB 3BG4C 2P94A 3VB5A 1GBFA 1UK2A 2VJ1A 5E8EH 2VIQA 1P8VC 3T5FH 4IGDA 1LCYA 2QAAA 1C2DA 1HIAB 1YP9A 2FI4E 2WYGA 3A81A 3GCTG 1OWEA 4DJZB 3IITA 2GDDA 4Z6AH 3SHCH 2B9LA 4AFUA 4NSVA 4FVBA 2J34A 2J92A 1P09A 1AB9B 3ODFA 3VB4A 3HATH 3SO3A 1HPGA 4WXVA 1HAVA 4H4FA 5L2YH 3GYMA 3LPRA 4IS5A 2VWLA 2HGTH 4CHAC 1FQ3A 2HRVA
chains in the Genus database with same CATH superfamily
2FTLE 1SQAA 3UWJH 2VGCB 1K2I1 2FOAA 4AG2A 2G51A 4YXWD 2YNBA 3RLWH 1SGRE 2KAIA 4K1EA 1F0UA 4TWYA 1WBGB 4WWYA 1MQ5A 3K9XB 3S9CA 1VITH 1G37A 2Z9KA 1S6HA 1O3KA 4NFEA 4JZFH 1BJUA 1OWHA 2FPZA 2P59A 1HIAA 1VCWA 4CRCA 9ESTA 2OC0A 2O8UA 2PSYA 4JZIA 2BY7X 1DUAA 5F03A 2BLVA 2FZZA 1QFKH 4F48B 2GCTC 1C5XB 3GY8A 4HGCA 3OTJE 2IJD1 4BTUB 3GDSA 2H9TH 1BMMH 3UTUH 2C90B 2Z6BD 3AASA 2GZ8A 1F7ZA 1HAGE 5HKKD 3SUDA 1CT2E 1SG8B 4BAKB 1WOFA 1BMAA 4I86A 1RJXB 4M7GA 1C5MD 1ELCA 2V0BA 1C2FA 5EU8A 3OFND 2K0QA 3ZV9A 3KIDU 1V2KT 1AIXH 1O0DH 4OS1A 2SNWA 3RC5A 1V2NT 1G3CA 3RXFA 3LGTA 1LMWB 3BEFB 5EJ1A 1MU8B 1C2KA 1O2XA 3E0PB 4GSOA 2OCVB 1GHAF 3F1SB 3RXVA 4GHQA 1P01A 1P2IA 3KYFA 4ZCNA 2Y81A 4IMQA 4D7FA 1C5NH 1NO9H 1P12E 1SGIB 4INKA 2VIOA 1HGTH 2BVXH 5C17A 4AB8A 2P8OC 3TPIZ 1TRMA 1UTMA 4ACBA 2PP6A 4B73A 2V35A 3P95A 4JZ1A 1GI4A 1O2VA 4AORA 1EJAA 3UFAA 2R9PA 1QQUA 2BX3A 1UTQA 3SU2A 3MMGA 1ETSH 3GISB 3B23B 1BTHH 3TK5A 1E1RD 2H2ZA 1Q31A 4IC5A 2Z3CA 3ATKA 4YESB 1DICA 1EJMA 3V12A 2STBE 3I77A 4JK6A 1HJ8A 2ODYB 1GHZA 4MPXA 1FMGA 2BTCE 1YM0A 2ZTZA 1QHRB 3RXUA 5KECA 2W3IA 2KZ4A 4JYUH 1C5WB 2VIVA 5HMAA 3SW2B 5SGAE 4LK4A 5EQRA 1RRKA 1E1QD 2JH0D 2O8MA 2CK3D 3PMHB 2GT7A 1IQIA 1GBHA 3FVFB 4FUDA 1VITG 4WJG2 3N7OA 2PTCE 2KCOA 1PPHE 1MBMA 5IDKA 2LELA 1BTXA 4QT8C 1C5PA 6CHAB 5DGJA 2GVFA 2XCFA 2P3TB 4JMYA 4FU8A 1D6RA 1GI6A 2OP9A 3FOAA 4E06H 1J8AA 4RT1A 1DY9A 2F9NA 5F8ZA 3OX7U 3K2UA 3MH6A 5KEDA 2BLWA 2W5EA 3F0PA 4FU9A 3RC4A 1BUIA 1TA2A 2Z3EA 2LP6A 5E2PA 3SU1A 1MMJN 4TPIZ 3FANA 1MCTA 3WW7A 1UCYH 1O2RA 1OYTH 5FX6A 2ODQA 3R0FA 1AVGH 3CS7A 4AN7A 4AZ2B 1ELGA 3VXFH 1O3CA 3SZNA 1FI8A 1GL0E 1M9UA 1GCTB 3ATWA 7LPRA 2WSSD 4Q7ZA 1AKSB 2GZ7A 1T31A 1TNLA 1DLKB 1G3BA 4D76A 3KYGA 3QUMP 1XUJA 5FL7D 4MNVA 3DA9B 2TBSA 3RXAA 3A82A 1EZSC 2JH5D 3OY6U 3MO9A 5EQSA 2I6QA 1O2IA 4BAHB 1SBWA 3SJ8A 3VEQB 3VB3A 2BHGA 1UTLM 2ZCKP 5PTPA 2PGBB 3D65E 1NRQH 2ANYA 2A45B 1W0ZU 4TY6A 2HNTC 3P8NA 3F2FA 4KTSA 5FCRA 1KXBA 4ABAA 1INCA 5JBBS 1BRUP 1UO6A 1TBZH 4DCDA 1NTPA 1OKXA 2QXHA 1WQVH 3RXCA 2ZGXH 5C1XA 5JDUB 2AGIX 2GMTB 1O2HA 2FESH 3N99A 3NUMA 1QB1A 1SMFE 3L3TA 1P3EA 4I8HA 3M3SA 5HGGA 3RXLA 4CRGA 2BQ6B 1V2WT 2GV6A 1GCDA 2ZFSA 1Q3XA 1AKSA 3EE7A 4MTBA 2BD3A 5TCAA 2PUXB 2F9BH 1TQ0B 3A88A 1K1OA 2C8YB 2ZWLH 4J1YA 5LH8A 3SNAA 3UQOA 4UE7H 3FFGA 1F2SE 3DSOA 1RIWB 1HJ9A 1BRCE 3MFJA 4WXIA 5FX5A 1FXYA 1CE5A 2NU4E 2XNIA 1O2PA 4GCHG 1UTJA 4CBNA 2AS9A 1BRBE 5AFZH 2Z9GA 1UVUH 2XC5A 1QL8A 1RTKA 2O8WA 1GDNA 1A5HA 1WU1A 3IG6B 2OC1A 1V2VT 3LU9B 3SJIA 1UTOA 3GS9A 3MO3A 3WY8A 4CR9A 4BOHA 1HAYB 5TJXA 1MAYA 4DW2U 4Y71A 3DHKH 3GY5A 3PM3A 3ZYEA 1ZSKA 1ZSLA 4XRNA 2BD9A 1TNIA 3LH1A 1FY8E 3NWUA 5DKMA 1H4WA 3MU0A 2BXTH 1ZJDA 2F91A 2UUKB 3HKJB 4Q80A 3DUXH 2ZPRA 3DSGA 1VZQH 3LC5A 1H8HD 4AX9H 1C5UA 3M3VA 4GVUA 1DLEA 2ZZUH 3BIVH 4YZUA 3UNQA 2KX4A 1ELVA 3CS0A 1ZGIA 3OEHD 4ZMAH 2F9UA 2UWOA 5E0HA 1Y5AT 3KL6A 2ZKSA 1WAYB 4KTUA 4THNH 1HCGA 1W7XH 4OM9A 1ESTA 3M36A 2Y7XA 4K5ZA 1IOEA 2FLRH 1N6YA 1K1JA 3BTKE 1LPZB 3URDA 1RTFB 2AIPA 4D9RA 2AGGX 8ESTE 2ZFPH 3T27A 1SGEE 2VWMA 1SGFG 4Q2KA 1O3BA 5C5NA 5HIYA 1ZR0A 1MD7A 5DP5A 1SI5H 2ZGHA 3FN8A 1T8LA 3UQVA 1UTPA 2SGPE 2YMSD 3M3TA 1AY6H 3VPKA 1TMTH 1O30A 1BDAA 2FO9A 1TNHA 5E0JA 1NM6A 3G01A 1ELBA 4XDEA 3VG8A 4E7RG 1LHFH 6LPRA 1RGQA 5I25A 2ZHQH 4YO9A 4VGCC 3T28A 1KY9A 3LKWA 2ZU4A 1IQLA 2B5TB 5C1YA 3SGBE 1BBRK 1GMHG 2V3MA 3CNRA 2CHAB 1NPMA 1T32A 4ISNA 1A1RA 5LPFA 1KXDA 1TA6A 1PPEE 4B74A 3CP7A 1EPTA 4Q63A 2ZHDA 4MNXA 3UB0A 3MO6A 2FLBH 2H6MA 3ZZCA 1J15A 1UVPA 2D26C 1EKBB 1K1LA 2BD2A 2K8IA 4M9FA 2XC0A 1C2JA 2A5KA 1C5QA 1JIRA 1OOKB 4GHTA 4GLYA 3S7HB 2KCAA 1GI7B 1O34A 4OS5A 1G36A 5F8TA 3KGPA 2ANWA 6GCHG 1C2LA 2R2MB 1BIOA 3GY3A 1IHTH 2I6SA 4Y7BA 1NRRH 1SGTA 1WUNH 3D23A 4BXSA 3PWBA 3FP7E 4IN2A 2BDCA 1NFWA 3QLPH 1ZYOA 3NKKA 2BOHB 5A2MH 1C2MA 2G8TA 4BTIB 2XNDD 1GJCB 1MTWA 2OINA 2A4OA 2EC9H 1TFXA 5B6OA 2QF0A 1HB0B 1LO6A 1COWD 5IYTA 2PGQB 2CXVA 1LHGH 2VWNA 3VGCB 1C1WH 1SGPE 2IN2A 3M37A 4UD9H 4A1VA 2ZQ1A 1OSSA 2ZHWH 4Z0KA 3M7TA 5F6MA 3BTFE 1HUTH 4ABDA 4HZHA 3Q3XA 1P2JA 2ZU1A 3H5CB 2EI7A 2JH6D 2O8TA 1P57B 4H6SB 1JMOH 2QCYA 2JETB 1KDQB 3GY2A 4DT7B 2J5UA 4BAOB 1H8IH 5DN6D 4CRAA 1C4U2 3TITA 3PMJA 1ANCA 1VGCC 3SJKA 1PPZA 1O3LA 2BM2A 4A6LA 4NWKA 4RSPA 1O32A 4TPYA 1UVOA 1W7GH 5FPTA 3MWIU 1RD3B 3E1XB 2IJOB 1A2CH 1YF4A 2BDGA 1TX7A 3M5MA 1MU6B 2W6JD 1CA0C 2GKVE 3ZVBA 1MTNC 1Y3WA 2WV4A 1W2KH 1XKAC 1T8OA 2GD4B 3ZZ9A 5J4QA 1O3EA 1EQ9A 1UW7A 1UCYE 2WPKS 2NU3E 1BTZA 3GCHC 2KCYA 2GX4A 3UWIA 2Z94A 5EG4A 2PV9B 1HAHH 3PWCA 4MPWA 1TNJA 1KDQA 4WH6A 1G30B 1AU8A 2ZPQA 1GJ6A 1QIXB 2VIWA 3PMBB 4Y6DA 2Z7FE 4NZLA 1S6LA 1PPCE 3KHVA 4B2CA 1HNEE 1JRSA 5JYIA 2JIZD 3RXGA 5DG6A 3RXBA 4DOQA 4X6MA 3HK3B 8KME2 1Z8RA 3PV4A 3ZZ6A 2Z9JA 1AWFH 2B8OH 3QWCH 1CHOF 3QZRA 1UJ1A 3HPTB 3MU4A 1C2GA 4Y79A 4KP0A 1SPJA 1NN6A 2A31A 2C8WB 3RXOA 1KTSB 5DO4H 2AH4X 2OQUA 1ABJH 1THPB 4H6TA 1GG6C 3MNCA 3F3BA 1BA8B 1WSSH 4UDWH 1XM1A 2IPQX 3PO1B 1LVMA 1AUJA 4B6FA 2GJGA 1P06A 5LPRA 1BTWA 8GCHF 3FKSD 4K8BA 3A84A 1T4UH 1LDTT 1QB6A 1B0EA 2TGPZ 4ISHH 1CBWB 1GL1A 4Y8YA 4FUCA 1DXWA 1D4PB 2B0FA 4YOIA 3ZZDA 2QN5T 4DIIH 4I8KA 5E2OA 1Y5UT 2BX4A 5C0TA 1E36B 2ZP0H 4BANB 1DANH 1D6WA 2UWLA 2ODPA 1O5DH 3LJOA 1WDIA 1N8OB 2ZFRH 1QNJA 3GCNA 1KXFA 1QA0A 1TMBH 2XBXA 1OXGA 4WMDA 3PMAB 1QRWA 3A7WA 3GCOA 3LGVA 1C5SA 1OWJA 3MNXA 2BZ6H 2F9OA 1H9HE 1O3AA 3P6ZB 3ZVFA 1HXFH 1GJBB 1W13U 2ZCHP 1MBQA 1GI2A 1S81A 1NY22 5DP3A 3RM0H 1EP6A 4X8UH 1A5IA 2R3UA 1EZXC 1GJ7B 2STAE 1KLIH 3UR6A 2XBYA 1O2ZA 1GMCF 3KCGH 2AFQB 4ABIA 4CBOA 1W14U 1K21H 2M2AA 1K0HA 2VIDA 1GHAG 5JBAS 3VB7A 1ACBE 2RCEA 4X1NU 2Q6GA 3MU8A 1Z8JB 1TGBA 2C93B 3GY6A 3F6UH 2G81E 1AB9C 4FVDA 1AVXA 3EE0B 2YNAA 1O2KA 1ANDA 4FUHA 4X6NA 4AFSA 1DVAH 1ELEE 1ZSJA 3AW1A 4XD7D 1T8NA 1L2EA 5ETXA 1SGNE 3TJNA 1YLDA 3OYPA 3L6PA 1YYY1 1ANBA 2ZDNA 4YTAA 3U98H 2SNVA 1N1LA 1YPGH 2VGCC 1MTVA 1SGCA 4F4OC 1E0FD 5C0UA 5FBEA 1AI8H 3P8GA 2NWNA 1O5FH 4DGJA 3MU5A 4TYDA 3T25A 3T26A 3LT3A 4MQAA 3B8JA 4AYYB 3BTGE 1EOJA 2BY9X 4YOJA 2CN0H 4ZUHA 3LGWA 3M7UA 4Y76A 1NS3A 3TNSA 1S5SA 3RXPA 1EJNA 1TE0A 3RXQA 3EDXB 3VFEA 3S0NA 1YPHE 2V7QD 4RN6A 1YPHC 3KN2A 1C1TA 3LGYA 1ORFA 2OQ5A 1S0QA 1LHDH 1VKYA 3SJOA 3E90B 3RUOA 1A4WH 1Y59T 2R0LA 2OC8A 3RXRA 5FPYA 2GCHG 4ABEA 4OGXA 1D9IA 4SGAE 4U32A 3BEIB 4FUFA 3KQEA 4K2YA 1MUEB 1SQTA 2FTMA 5DP7A 3A8DA 4XFQA 2GDEH 1MZAA 3EA8A 1BB0B 4Q7XA 1MKWH 1GJ8B 2RA3A 1O5EH 2CV3A 1HV7A 3M5OA 2G55A 1F0SA 2A0QB 4JCNA 1SB1H 1ZLRA 3S9AA 3SNDA 1L4ZA 2VVVA 5J4SA 2CJIA 1P04A 1DUEA 2PWXA 5T6FA 2A4RA 1GGDB 1O3OA 5A8XA 1AFQB 1QURH 1YPMH 2QA9E 1ELAA 4I7YH 1CQQA 3MTYA 2J9NA 1B7XB 1ESAA 4IMZA 1W0JD 4ESTE 5ESBA 4LZ4B 4BNRA 4XSKU 1ANEA 1UHBB 1S6FA 5DPAA 2FWWA 3F9HA 1AO5A 1G3EA 3OAAD 7KMEH 2PKAB 2A2XH 2DE8A 2JKHA 1JOUB 1TB6H 3NZIA 1YPJH 3SU5A 2VB0A 4A5TS 2Y5FA 3HKIB 4U01A 5C94A 1F0TA 2VU8E 2VVCA 2W3KA 3PLBA 3RU4D 5T1VA 1LQEA 2H9HA 1NU9A 2FX6A 3SHAH 4O03A 1AE8H 1PJPA 4X0WU 1VCPA 2ZF0H 1D3QB 1MTSA 2C3SA 4X6OA 2AYWA 1YLCA 2W7SA 3TNTA 5EW1H 3E16B 1HFDA 1ID5H 2A5IA 2H1UA 2ZFFH 2SGQE 3UAIC 3FP6E 1P3CA 3NPSA 1VJ9U 1G2MA 2F4LA 9LPRA 2OBOA 1DM4B 2Z9LA 2Y5GA 2XCNA 1WXRA 4X1PU 5FCKA 1EATA 5GCHF 3BTTE 1C9PA 6CHAC 2LNCA 1TMUH 1KXEA 2WINI 2HNTE 1Z6EA 1O2UA 1UHBA 2V6NA 2OD3B 1XUKA 1SFIA 2XBWA 3ITIA 2BY5X 5JB9S 1QBOA 1W10U 1WQSA 1FUJA 1H8ED 2PKSB 1KMHB 2QC2A 4Y0YE 2PKAA 3BTWE 3SGQE 3V7TA 4DT4A 1NRPH 4D8NA 1EAIA 3SOSA 1CGHA 1VR1H 5C20A 1Q2WA 3EQ0H 4BXWA 2FOHA 1O3HA 2ZEBA 1HDTH 2A5AA 2BD4A 2ZU5A 3SU0A 3E6PH 4H42U 1L0ZA 3GYLB 3KF2A 1BQYA 1S0RA 1GHBF 1EUFA 1IQJA 4K1TA 3M7QA 3PTBA 1MTUA 1GCTC 2ZC9H 2R3YA 3SBKA 2WYJA 1ZGVA 1MD8A 4BAQB 1K28D 1FDPA 1O3NA 3U8OH 1OWIA 2QF5A 4A1XA 2BVRH 2TPIZ 1XKBC 1GI3A 3F2HA 3P17H 1W0YH 4Y8ZA 4AG1A 1V6DA 2FM2A 5F53A 4ZKSU 4FUBA 3QTOH 3ATIA 5TCCA 1O33A 1V2TT 3SZEA 1GBAA 1C1VH 3PYHA 2J2UA 2JDID 2BOKA 1XUIA 4NA7A 4NIVA 4IW4E 1O3DA 1YY3A 4ZHMU 4J2YB 4ISIH 1GPZA 1QGFA 1SQOA 1CT4E 1P2KA 1DWCH 1FN8A 1KSNA 1GBTA 3BSQA 3ZZAA 2ZECA 4MVNA 2BMGB 2ZDKA 4ABBA 1UVSH 2Z3DA 1W3CA 3C1KA 2QV1A 2GMTC 1L4DA 1MQ6A 1GHYH 3P70B 2VVUA 1W0KD 2HVXA 2FS9A 1DS2E 1TAWA 2CGAA 4X6PA 1SFQB 2RDLA 3A80A 2BB4A 2KR7A 3JZ1B 2WV5A 3QZQA 3RC6A 3D49H 2ZDAH 4B71A 1IQGA 4YLQH 1RXPA 4U2WA 3OE7D 4HG6A 3TH4H 2FI3E 3PRBA 2M5TA 2TGTA 5AVDA 1TX6A 1RIWC 1NBMD 2WUBA 3M35A 1IHSH 1YCPK 1XXDA 5GNDA 4NFFA 2J94A 4IC6A 2G4UA 1HAOH 4OS2A 5JB8S 1OPHB 4BTTB 2PUQH 4DY7B 5HM9A 1YGCH 1KXAA 1EPTB 1C2IA 1RTLA 2R0KA 3SUGA 1QJ7B 3DT0H 1XUGA 5GDSH 5DK1A 1GBMA 1WTGH 2CMYA 4ZXYH 3SORA 1ARBA 1HAPH 4R8TB 3PV2A 3SU6A 3SJ9A 2ZO3H 2NU1E 3E91A 1A0JA 1JXPA 1JIMA 4AC9A 4FUEA 3MU1A 5DP6A 1BHXF 1C1PA 1CO7E 4KELA 2XWBI 1UTNA 2PSXA 4O3UA 1BMLA 4NZQA 3V13A 4ZKOU 1LVBA 1TGCA 1FY3A 3HGPA 4BAMB 1E35B 1BMFD 4P02A 1QA7A 1Y3YA 2W26A 4JZEH 1FPHH 3K6YA 2BDIA 3P92A 2UWPA 3ZVAA 1P2MA 2FXRA 3SUFA 1EB2A 1XVOA 4LZ1H 1TRNA 4X1RU 3TK6A 2F9VA 1GBKA 2XC4A 3U8RH 1TNGA 1TNKA 5A0BA 3EA9A 2BY6X 2ZTYA 4FUJA 1T7CA 1QBVH 3HK6B 1TONA 1PPBH 1JBUH 1ZTJA 2ZNKH 4WMEA 2PFEA 2PW8H 3SUEA 1P05A 1ZTLA 5EGMA 1C5RA 1ABIH 1AD8H 4ABFA 1O3FA 1NT1A 2XBVA 4AYVB 5EPYA 1QJ1B 1P2NA 5EQQA 2G4TA 1O2QA 1FZZA 4YOGA 1AN1E 7GCHF 5JPMH 2FOFA 5L30H 4HI3A 2HWLB 1GHWH 1F92A 3RXIA 2RDEA 1GI1A 4B2AA 1JWTA 1AUTC 1O2WA 3SYJA 2KFWA 1P03A 4LOYH 4CR5A 1V2OT 2J98B 5CMXH 2OTVA 2ANKH 2EEKA 1HJAB 5EW2H 1GVZA 3GDUA 1UK4A 3DCLA 2Y80A 3ZVGA 3ZVDA 3TJUA 4MDSA 1AMHA 3C27B 1FIZA 3PROA 2QXGA 2D8WA 1O5BB 3DFLA 3W1EA 1ETRH 1YPKH 2AMQA 1FY4A 5G4BA 1GI8B 1O3PB 2FOBA 3ENSB 1ZZZA 5EPNA 1BJVA 2P3UB 3RXKA 3SV9A 1TGNA 4MPVA 2CHAC 3GDVA 1QRZA 3ELAH 5GWZA 4PROA 1EZUC 4NIYA 2FX4A 3SNBA 3I29A 3LJJA 3A87A 4Y10E 5B6LA 1CGJE 1TPPA 2GTBA 2WPJS 1FAKH 1VCQA 3P8FA 3QDZB 1TPAE 2BD8A 3EGKH 1K1NA 4MNYA 1OWDA 1C1QA 1NFYA 3Q76A 3E0NB 2P3FH 2XRCA 3U9AH 2WUCA 1E38B 3UNSA 3LOXA 1MCVA 3VXEH 2L6OA 3LH3A 1QY6A 3QGNB 1A7SA 1SOZA 2A7HA 2G00A 2THFB 2AERH 2J98A 1GDUA 2OUAA 4E7NA 3RMOH 1BHXB 4UEHH 2Z9IA 3TU7H 4B75A 2FYQA 1PPGE 1SVPA 3MI4A 5CHAB 3KNXA 3ZIAD 4TT3D 1NZQH 2ZIQH 2WV9A 1BTUA 4X2VA 3QGJA 3QK1A 5T3HA 2F43B 3OU0A 5T6DA 1GJAB 5BRRE 1O5GH 1YLNA 4K60A 2FOGA 2ZI2H 1S85A 4K69A 4CREA 1NU7B 4IBLH 1S82A 2Q1JA 3NXPA 2CF9H 2LPRA 3ATLA 1SLVB 1FX0B 2A2QH 1V2JT 3T2NA 4E05H 1TGSZ 2QYIA 4NA9H 5EXNA 1U6QA 5A8ZA 2XWAA 5EXLA 2VH6A 3B9FH 2F9PA 3VGCC 3DD2H 1EX3A 3A7VA 1E79D 3BG4B 2ZFQH 5EJZA 1ELDE 2H5DA 1ELFA 1CHOG 2TIOA 4SGBE 4YT7H 1NC6A 3RXMA 1VJAU 3O8RA 2KCPA 4ABJA 1EB1H 4B2BA 2QXJA 1C5VA 3ZVEA 3PLKA 3VB6A 1P2QA 4I8JA 5K7RA 1DT2A 1Z7KA 2JETC 4OS7A 3OY5U 1EXFA 3KQ5A 8GCHG 1MZDA 3AK5A 1SL3A 4A7IB 2C8XB 2BDYA 2OC7A 3AAVA 2ZU2A 3BEUA 3S69A 2FIRH 1T4VH 3WWFA 1C1UH 1ELTA 4DG4A 4F55A 3SU3A 2P16A 4CHAB 1QTFA 1WV7H 3MNBA 1EFRD 2SGDE 4CRBA 1DPOA 3ZZ4A 2PLXA 1OP8A 1BBRH 1THRH 2VWOA 1TOMH 4D9QA 3KQDA 3WWBA 1KLJH 1EAXA 2F3CE 2PHBA 1AVWA 4GPGA 1C9TA 1GMDF 4O9VA 2HOBA 3S9BA 1K22H 1PQ7A 1BTYA 2FDAA 1LVYA 3A7TA 1DOJA 2GGVB 2P93A 3RLYH 2ULLA 1OX1A 3SNCA 1SGFA 3O8CA 3FAOA 3A83A 1OWKA 5LPEA 3HGNA 5DSFA 2SGAA 1TIOA 2BLOA 3BTEE 1O38A 1OYQA 2GCTB 1GMCG 1XUHA 2A1DB 2BYAX 2VIPA 3GICB 1FV9A 2BQWB 1AE5A 1QJ6B 4DVAU 4JYTA 1ZHRA 1GHVH 4KTCA 1YKTA 1O3IA 2QF4A 2FMJA 1P2OA 5FPSA 3P8OA 5HM2A 4ZKRU 4ZHLU 3SN8A 5K0HA 2V3OH 1UCYK 3RU4E 1CU1A 1CHGA 3A7XA 1FN6A 4MLFB 1K9OE 1OP0A 3U28C 1QBNA 4D7GA 2RA0A 1D3PB 3EA7A 2OK5A 1E37B 4LXBH 2ZGJA 3GCTF 3IWMA 1Y5BT 1GJ5H 4JK5A 4ABGA 1GBLA 3RXJA 1F5RA 3OSYA 3Q77A 3PO1C 4KKDA 2ZTXA 2ZG0H 4NSYA 4Y0ZE 2P8OB 2O8LA 4F49A 1KYNA 4I33A 4GUXA 3SI4H 4YM9A 1O5CB 3OTPA 1SKYE 2OBQA 1O2LA 1CBWC 3DSPA 4ASUD 1PQ8A 1ZJKA 2ANMH 3M61U 3MH7A 2HNTF 1P10A 2BDBA 1TRYA 2AGEX 1O36A 1ESBA 1SGDE 1J14A 2WPIS 1ZMLA 1HAXB 1N8OC 3QO6A 3W95A 2ZGBH 3UPEA 3GY7A 1DE7H 1ZHPA 4X1SU 4ABHA 4Y7AA 2XXLA 3A8BA 1O37A 2ZPSA 3UY9A 4AOQA 4B1TA 1GBBA 1O2SA 1W8BH 3BTME 5FXLA 4O97A 1CVWH 1PYTC 1EAUA 1TABE 2J38A 5BPEA 1HYLA 4K3JA 4RKJB 2ZHEH 4X8SH 3U8TH 1O2MA 3F9EA 4INHA 1YWUA 1BMNH 2EI6A 2SGEE 3MH4A 1TPSA 5CDFE 1ZPBA 3KQBA 3M5NA 1V2QT 2ZCLP 1O3GA 5FHTA 1C2EA 2EA3A 1TPOA 3V3MA 1NFUA 3ZZ5A 3AVZA 4WMFA 3E3TA 1GHXH 2W7UA 3FP8E 1F0RA 4A92A 1GJ9B 3LGIA 4TWWA 3TJVA 1GI9B 4ZAEA 3BTDE 1TALA 2F83A 4WVPE 1AQ7A 1EZQA 3QN7A 4P00A 4X8VH 2ALVA 3I78A 3CENA 4I31A 4Q4LA 5JBCS 4WF8A 4YT6H 5ABWA 1ZMJA 3SV8A 3NCLA 3SI3H 3NK8A 1YPEH 4ZXXH 1YBWA 5HIZA 3ATMA 1OS8A 1ZMNA 1HAIH 4XBDA 2FODA 5EOKA 1D3DB 3STIA 3ZZ7A 2OXSA 1XXFA 2A7JA 1Z6JH 1EASA 2PTNA 3BTQE 1TQ7B 3BF6H 3K65B 3T29A 3FZZA 1P9UA 3O8DA 3D62A 3PTNA 1V2MT 2Y6TA 5C67A 1F5KU 2BDAA 1NRNH 2ESTE 3A7YA 4RKOB 1O35A 2BVSH 2BXUH 1HAZB 1LHEH 2YMSB 1BITA 1QRXA 1GI0A 1NBME 4UFGH 3URCA 3MQKC 1O5AB 2G52A 1O31A 5A8YA 1A0LA 1A3BH 3PV5A 2GT8A 4I8LA 4NG9H 4XBCA 4YLUA 2XTTB 1IQFA 2GCHF 3LIWA 3A8CA 3U1JB 2DUCA 5GCHG 1HLTH 3F0OA 3QX5H 2ALPA 1T8MA 4MPUA 8LPRA 2JJ2D 1EP5A 5I46H 3TK9A 1TWXB 2VINA 5EJLA 1SLWB 1C5ZB 1GJ4H 1SR5C 1DSUA 2DE9A 1C1RA 2QF3A 1HRTH 1J16A 1DDJA 1VITF 4AGJA 3TH3H 4AB9A 1JRTA 3A86A 1QZ8A 1C5TA 1G2LA 1BT7A 1C4Y2 1QQ4A 1WTHD 3STJA 5IK2D 3TH2H 1QL7A 1HXEH 1GHBG 4WY3A 2TGAA 1GGDC 3LONA 4IN1A 2FOMB 1AFQC 2IOTA 1XUFA 2RFKC 4OGYA 3K6ZA 3ODDA 2A4GA 5A09A 3SV6A 2J4IA 2QGRA 2YMSC 3A7ZA 5L2ZH 3RP2A 1A5GH 2GZ9A 3H09A 4R0IA 1N6XA 3RXDA 3RXHA 3S7KB 4ASHA 2G5NA 2ZHFH 3TGKE 1Y3VA 5DP9A 1UTKA 1V2UT 1YC0A 2FI5E 2ASUB 2O9QA 3BTHE 5GJ4B 1AFEH 4CRFA 3RMNH 1P02A 1KLTA 4FOUC 5H4IB 1NESE 1PYTD 3U69H 3BG8A 2ZDVH 4MG3A 1IAUA 2SGFE 2VNTA 1C1SA 3MOCA 1SC8U 5A0CA 1LKBA 2HLCA 1MAXA 1V2RT 3NRLA 2K1QA 1O3JA 1SHHB 2HPPH 1V2LT 2KM0A 4TY7A 5GPIB 4HFPB 2AMDA 3A8AA 1LKAA 5T6GA 1O2GH 1Z1IA 1ZRKA 1LHCH 1FJSA 1FONA 3L33A 3O8BA 1ZPCA 3PLPA 6ESTA 1LPKB 1FY5A 1S84A 4FETA 1P9SA 4FXGH 2ZU3A 4UONA 1Z71A 1BRAA 2UUFB 1GBIA 1K1PA 2GV7A 1MH0A 2BD5A 1CT0E 2PKSC 2QE7D 1KTTB 1QB9A 3GOVB 5HXFA 3RU4T 3TGJE 2IPHA 1LVOA 3AAUA 3RXEA 2ZQ2A 1GBEA 4NWLA 1FY1A 1DFPA 1GJDB 2ILNA 1BBRE 1P11E 3BIUH 3ZV8A 4RT0A 1C2HA 5GXPA 1NROH 3SGAE 4Z1MD 3QTVH 1WYKA 1ETTH 3RXTA 4HTCH 2C4FH 2Q6DA 1J9CH 4Q7YA 1TX8A 1G9IE 4WH8A 3SNEA 1DWEH 4DURA 2JJ1D 3GY4A 2UUYA 2Y7ZA 4GCHF 3LGUA 4ZKNU 2HPQH 1BOQA 3Q3KA 5C3NA 1LPGB 5FBIA 2FEQH 1MABB 2AMPA 2D2DA 2YOLA 4VGCB 2BLQA 1XVMA 4AGKA 2HVYB 1Y3XA 1ZTKA 1AZ8A 3SV7A 2Q6FA 1MKXK 1W11U 4X2WA 1G3DA 1UVTH 5DP8A 3SV2H 1A3EH 1IQKA 2XYAA 3R3GB 2WZQA 1SLUB 1O39A 3MH5A 4NIWA 1Z8GA 1ZOMA 2FP7B 3KQCA 3TLOA 2J95A 1GBDA 3PRDA 4ZROA 2XOKD 1S83A 5CHBA 4A1TA 3T62A 2H9EH 4NGAH 1A46H 4GAWA 1UK3A 1V3XA 2P95A 3UIRA 1OHHD 1TBQH 3A85A 1K1MA 1KXCA 2VH0A 7GCHG 1BZXE 5AF9H 1W12U 1EAWA 1SLXB 3M5LA 1J17T 4KGAA 5JBTA 1FIWA 4NIXA 2BD7A 1C1NA 1X7AC 4ZH8A 1V2PT 2QY0B 2WPMS 2Y82A 4X8TH 2H5CA 2G5VA 5FAHA 3UUZA 1ARCA 1PFXC 1SGQE 1QL9A 4UFEH 1RS0A 1TLDA 3TGIE 4INLA 1WCZA 1Z8IB 2WPHS 1C4V2 2UUJB 5KGOA 1C1OA 1CSOE 1EPTC 4XBBA 4Y11E 1B5GH 1K1IA 1TGTA 2TRMA 2FS8A 2NU2E 3F9GA 3FZDA 4FUIA 2Y5HA 1KIGH 4U30A 1CGIE 1TOCB 1C1MA 4ISOA 3UR9A 2EI8A 4OS4A 4CRDA 3PB1E 2FOEA 5C1UA 2A7CA 3ZZ3A 2QIQA 1L1GA 1ZHMA 2AHME 4X2YA 1DWBH 1SSXA 1XMNB 2L74A 4JZDH 1GWAA 1GBJA 1SGYE 3H7OA 3F9FA 4JYVH 2ZA5A 1SHYA 3LC3A 1Z1JA 4CH2B 3BN9A 1E34B 1RFNA 5C5OA 2ZDMA 5L6NH 4AFZA 3UNRA 1A61H 1H8DH 1GBCA 2PR3A 2FYRA 3MHWU 3RM2H 1NFXA 1IQNA 2AIQA 4XE4A 3UREA 1AGJA 1GMHF 1VGCB 1IQHA 3H7TA 3E8LA 4X1QU 2D1JA 2EY4C 5F8XA 1IQMA 1L1NA 1QR3E 1V2ST 1O2TA 2V3HH 1IQEA 2VBCA 2WPLS 3A89A 4Y8XA 1Y8TA 2W6ID 1BCUH 3UOUA 5GIBA 1GVLA 1SOTA 3FO8D 4I32A 4XOJA 3SQHE 1CA0B 5DP4A 2A32A 1GVKB 3ZZ8A 1MTNB 1O2JA 2R2WU 1HBTH 3N7EA 2A4QA 1DSTA 3DFJA 1L1JA 1DXPA 5AFYH 1O3MA 4NA8A 4NCYA 4FUGA 3F2GA 4ZHAA 3GCHB 2ZGCA 2J97A 3EYDA 3AW0A 3RDZA 2OLGA 3ZVCA 5LGOA 3LDXH 2ZFTA 6GCHF 4CH8B 4OS6A 1TBRH 1TYNA 1FPCH 4UFDH 1P0SH 3ZZBA 2TGDA 1HJAC 4K1SA 4O3TA 3ESTA 5AHGH 4UFFH 4B76A 1C5OH 5EIYA 1AHTH 3EAJA 3Q3YA 1FAXA 3MYWA 1LTOA 1ZRBA 2QXIA 3MNSA 1DX5M 1PQAA 4DIHH 3RMMH 5E0GA 3U1IB 1THSH 2EQNA 1B0FA 1EOLA 1YCPH 2BQ7B 2ZDLA 4I8GA 3UOPA 2AEIH 2HALA 1FLEE 5ESTE 1DITH 5CE1A 4K8YA 1O2OA 1AZZA 2WPDD 2C8ZB 3RXSA 2CF8H 3TIUA 5HYOA 5A0AE 1YCPM 2B7DH 1H9IE 4X2XA 2HLDD 1F5LA 1PQ5A 2GP9B 1XX9A 1MKXH 1PPFE 2WHXA 5EXMA 1GG6B 2RG3A 5C2ZA 2FOCA 4RI0A 1D3TB 1GMDG 3ZYDA 5EODA 4MNWA 1H9LB 3TJOA 1DWDH 4B6EA 1CA8B 1YPLH 1OP2A 1G32B 4ISLA 2BY8X 3W94A 1FNIA 1H1BA 2XW9A 3JZ2B 1QCPA 5CHAC 1BTPA 1NRSH 1UMAH 3KEEA 3OEED 2SFAA 3TVJB 1HAVB 1Y3UA 2BZAA 1GI5A 4ACAA 4FU7A 7ESTE 1A0HB 1O2YA 1C5LH 3SQEE 5DJ7A 4AFQA 1DY8A 3RMLH 1MKWK 3BV9B 3V0XA 3SU4A 3F68H 1LQDB 2BDHA 2KAIB 1O2NA 1ZPZA 2NU0E 3Q00A 1C5YB 1GDQA 1AWHB 3BG4C 2P94A 3VB5A 1GBFA 1UK2A 2VJ1A 5E8EH 2VIQA 1P8VC 3N7DA 3T5FH 4IGDA 1LCYA 2QAAA 1C2DA 1HIAB 1YP9A 2FI4E 2WYGA 3A81A 3GCTG 1OWEA 4DJZB 3IITA 2GDDA 4Z6AH 3SHCH 2B9LA 4AFUA 4NSVA 4FVBA 2J34A 2J92A 1P09A 1AB9B 3ODFA 3VB4A 3HATH 3SO3A 1HPGA 4WXVA 1HAVA 4H4FA 5L2YH 4TSFD 3GYMA 3LPRA 4IS5A 2VWLA 2HGTH 4CHAC 1SQRA 1FQ3A 2HRVA
chains in the Genus database with same CATH topology
2FTLE 1SQAA 3UWJH 2VGCB 1K2I1 2FOAA 4AG2A 2G51A 2YNBA 3RLWH 1SGRE 2KAIA 4K1EA 1F0UA 4TWYA 1WBGB 4WWYA 1MQ5A 3K9XB 3S9CA 1VITH 1G37A 2Z9KA 1S6HA 1O3KA 4NFEA 4JZFH 1BJUA 1OWHA 2FPZA 2P59A 1HIAA 1VCWA 4CRCA 9ESTA 2OC0A 2O8UA 2PSYA 4JZIA 2BY7X 1DUAA 5F03A 2BLVA 2FZZA 1QFKH 2GCTC 1C5XB 3GY8A 4HGCA 3OTJE 4BTUB 3GDSA 2H9TH 1BMMH 3UTUH 2C90B 2Z6BD 3AASA 2GZ8A 1F7ZA 1HAGE 3SUDA 1CT2E 1SG8B 4BAKB 1WOFA 1BMAA 1RJXB 4M7GA 1C5MD 1ELCA 2V0BA 1C2FA 5EU8A 3ZV9A 3KIDU 1V2KT 1AIXH 1O0DH 4OS1A 2SNWA 3RC5A 1V2NT 1G3CA 3RXFA 3LGTA 1LMWB 3BEFB 1MU8B 1C2KA 1O2XA 3E0PB 4GSOA 2OCVB 1GHAF 3F1SB 3RXVA 4GHQA 1P01A 1P2IA 2Y81A 4IMQA 4D7FA 1C5NH 1NO9H 1P12E 1SGIB 4INKA 2VIOA 1HGTH 2BVXH 4AB8A 2P8OC 3TPIZ 1TRMA 1UTMA 4B73A 2V35A 3P95A 4JZ1A 1GI4A 1O2VA 4AORA 1EJAA 3UFAA 2R9PA 1QQUA 2BX3A 1UTQA 3SU2A 3MMGA 1ETSH 3GISB 3B23B 1BTHH 3TK5A 2H2ZA 1Q31A 4IC5A 2Z3CA 3ATKA 4YESB 1DICA 1EJMA 3V12A 2STBE 3I77A 4JK6A 1HJ8A 2ODYB 1GHZA 4MPXA 1FMGA 2BTCE 1YM0A 2ZTZA 1QHRB 3RXUA 2W3IA 4JYUH 1C5WB 2VIVA 5HMAA 3SW2B 5SGAE 4LK4A 5EQRA 1RRKA 2JH0D 2O8MA 3PMHB 2GT7A 1IQIA 1GBHA 3FVFB 4FUDA 1VITG 4WJG2 3N7OA 2PTCE 1PPHE 1MBMA 5IDKA 1BTXA 4QT8C 1C5PA 6CHAB 5DGJA 2GVFA 2XCFA 2P3TB 4JMYA 4FU8A 1D6RA 1GI6A 2OP9A 4E06H 1J8AA 1DY9A 2F9NA 5F8ZA 3OX7U 3K2UA 3MH6A 2BLWA 2W5EA 4FU9A 3RC4A 1BUIA 1TA2A 2Z3EA 5E2PA 3SU1A 1MMJN 4TPIZ 3FANA 1MCTA 1UCYH 1O2RA 1OYTH 5FX6A 2ODQA 3R0FA 1AVGH 3CS7A 4AN7A 4AZ2B 1ELGA 3VXFH 1O3CA 3SZNA 1FI8A 1GL0E 1M9UA 1GCTB 3ATWA 7LPRA 4Q7ZA 1AKSB 2GZ7A 1T31A 1TNLA 1DLKB 1G3BA 4D76A 3QUMP 1XUJA 4MNVA 3DA9B 2TBSA 3RXAA 3A82A 1EZSC 2JH5D 3OY6U 3MO9A 5EQSA 2I6QA 1O2IA 4BAHB 1SBWA 3SJ8A 3VEQB 3VB3A 2BHGA 1UTLM 2ZCKP 5PTPA 2PGBB 3D65E 1NRQH 2ANYA 2A45B 1W0ZU 4TY6A 2HNTC 3P8NA 4KTSA 5FCRA 1KXBA 4ABAA 1INCA 5JBBS 1BRUP 1UO6A 1TBZH 4DCDA 1NTPA 1OKXA 2QXHA 1WQVH 3RXCA 2ZGXH 5C1XA 5JDUB 2AGIX 2GMTB 1O2HA 2FESH 3NUMA 1QB1A 1SMFE 3L3TA 1P3EA 4I8HA 3M3SA 5HGGA 3RXLA 4CRGA 2BQ6B 1V2WT 2GV6A 1GCDA 2ZFSA 1Q3XA 1AKSA 4MTBA 2BD3A 5TCAA 2PUXB 2F9BH 1TQ0B 3A88A 1K1OA 2C8YB 2ZWLH 4J1YA 5LH8A 3SNAA 3UQOA 4UE7H 3FFGA 1F2SE 1RIWB 1HJ9A 1BRCE 3MFJA 4WXIA 5FX5A 1FXYA 1CE5A 2NU4E 2XNIA 1O2PA 4GCHG 1UTJA 4CBNA 2AS9A 1BRBE 5AFZH 2Z9GA 1UVUH 2XC5A 1QL8A 1RTKA 2O8WA 1GDNA 1A5HA 1WU1A 3IG6B 2OC1A 1V2VT 3LU9B 3SJIA 1UTOA 3MO3A 3WY8A 4CR9A 4BOHA 1HAYB 5TJXA 1MAYA 4DW2U 4Y71A 3DHKH 3GY5A 3PM3A 3ZYEA 1ZSKA 1ZSLA 2BD9A 1TNIA 3LH1A 1FY8E 3NWUA 5DKMA 1H4WA 3MU0A 2BXTH 1ZJDA 2F91A 2UUKB 3HKJB 4Q80A 3DUXH 2ZPRA 1VZQH 3LC5A 4AX9H 1C5UA 3M3VA 4GVUA 1DLEA 2ZZUH 3BIVH 4YZUA 3UNQA 1ELVA 3CS0A 1ZGIA 4ZMAH 2F9UA 2UWOA 5E0HA 1Y5AT 3KL6A 2ZKSA 1WAYB 4KTUA 4THNH 1HCGA 1W7XH 1ESTA 3M36A 2Y7XA 4K5ZA 1IOEA 2FLRH 1N6YA 1K1JA 3BTKE 1LPZB 3URDA 1RTFB 2AIPA 4D9RA 2AGGX 8ESTE 2ZFPH 3T27A 1SGEE 2VWMA 1SGFG 4Q2KA 1O3BA 5C5NA 1ZR0A 1MD7A 5DP5A 1SI5H 2ZGHA 1T8LA 3UQVA 1UTPA 2SGPE 3M3TA 1AY6H 3VPKA 1TMTH 1O30A 1BDAA 2FO9A 1TNHA 5E0JA 1NM6A 3G01A 1ELBA 4XDEA 4E7RG 1LHFH 6LPRA 1RGQA 5I25A 2ZHQH 4YO9A 4VGCC 3T28A 1KY9A 3LKWA 2ZU4A 1IQLA 2B5TB 5C1YA 3SGBE 1BBRK 1GMHG 2CHAB 1NPMA 1T32A 4ISNA 1A1RA 5LPFA 1KXDA 1TA6A 1PPEE 4B74A 3CP7A 1EPTA 2ZHDA 4MNXA 3MO6A 2FLBH 2H6MA 3ZZCA 1J15A 1UVPA 2D26C 1EKBB 1K1LA 2BD2A 2XC0A 1C2JA 2A5KA 1C5QA 1JIRA 1OOKB 4GHTA 4GLYA 3S7HB 1GI7B 1O34A 4OS5A 1G36A 5F8TA 3KGPA 2ANWA 6GCHG 1C2LA 2R2MB 1BIOA 3GY3A 1IHTH 2I6SA 4Y7BA 1NRRH 1SGTA 1WUNH 3D23A 4BXSA 3PWBA 3FP7E 4IN2A 2BDCA 1NFWA 3QLPH 1ZYOA 3NKKA 2BOHB 5A2MH 1C2MA 2G8TA 4BTIB 1GJCB 1MTWA 2OINA 2A4OA 2EC9H 1TFXA 5B6OA 2QF0A 1HB0B 1LO6A 5IYTA 2PGQB 2CXVA 1LHGH 2VWNA 3VGCB 1C1WH 1SGPE 2IN2A 3M37A 4UD9H 4A1VA 2ZQ1A 1OSSA 2ZHWH 4Z0KA 3M7TA 5F6MA 3BTFE 1HUTH 4ABDA 4HZHA 3Q3XA 1P2JA 2ZU1A 3H5CB 2EI7A 2JH6D 2O8TA 1P57B 4H6SB 1JMOH 2QCYA 2JETB 1KDQB 3GY2A 4DT7B 4BAOB 1H8IH 4CRAA 1C4U2 3TITA 3PMJA 1ANCA 1VGCC 3SJKA 1PPZA 1O3LA 2BM2A 4A6LA 4NWKA 4RSPA 1O32A 4TPYA 1UVOA 1W7GH 5FPTA 3MWIU 1RD3B 3E1XB 2IJOB 1A2CH 1YF4A 2BDGA 1TX7A 3M5MA 1MU6B 1CA0C 2GKVE 3ZVBA 1MTNC 1Y3WA 2WV4A 1W2KH 1XKAC 1T8OA 2GD4B 3ZZ9A 5J4QA 1O3EA 1EQ9A 1UCYE 2WPKS 2NU3E 1BTZA 3GCHC 2GX4A 3UWIA 2Z94A 5EG4A 2PV9B 1HAHH 3PWCA 4MPWA 1TNJA 1KDQA 4WH6A 1G30B 1AU8A 2ZPQA 1GJ6A 1QIXB 2VIWA 3PMBB 4Y6DA 2Z7FE 4NZLA 1PPCE 3KHVA 4B2CA 1HNEE 1JRSA 5JYIA 3RXGA 5DG6A 3RXBA 4DOQA 4X6MA 3HK3B 8KME2 1Z8RA 3PV4A 3ZZ6A 2Z9JA 1AWFH 2B8OH 3QWCH 1CHOF 3QZRA 1UJ1A 3HPTB 3MU4A 1C2GA 4Y79A 4KP0A 1SPJA 1NN6A 2A31A 2C8WB 3RXOA 1KTSB 5DO4H 2AH4X 2OQUA 1ABJH 1THPB 4H6TA 1GG6C 3MNCA 1BA8B 1WSSH 4UDWH 1XM1A 3PO1B 1LVMA 1AUJA 1P06A 5LPRA 1BTWA 8GCHF 4K8BA 3A84A 1T4UH 1LDTT 1QB6A 1B0EA 2TGPZ 4ISHH 1CBWB 1GL1A 4Y8YA 4FUCA 1DXWA 1D4PB 2B0FA 4YOIA 3ZZDA 2QN5T 4DIIH 4I8KA 5E2OA 1Y5UT 2BX4A 1E36B 2ZP0H 4BANB 1DANH 1D6WA 2UWLA 2ODPA 1O5DH 3LJOA 1N8OB 2ZFRH 1QNJA 3GCNA 1KXFA 1QA0A 1TMBH 2XBXA 1OXGA 4WMDA 3PMAB 1QRWA 3A7WA 3GCOA 3LGVA 1C5SA 1OWJA 3MNXA 2BZ6H 2F9OA 1H9HE 1O3AA 3P6ZB 3ZVFA 1HXFH 1GJBB 1W13U 2ZCHP 1MBQA 1GI2A 1S81A 1NY22 5DP3A 3RM0H 1EP6A 4X8UH 1A5IA 2R3UA 1EZXC 1GJ7B 2STAE 1KLIH 3UR6A 2XBYA 1O2ZA 1GMCF 3KCGH 2AFQB 4ABIA 4CBOA 1W14U 1K21H 2VIDA 1GHAG 5JBAS 3VB7A 1ACBE 2RCEA 4X1NU 2Q6GA 3MU8A 1Z8JB 1TGBA 2C93B 3GY6A 3F6UH 2G81E 1AB9C 4FVDA 1AVXA 3EE0B 2YNAA 1O2KA 1ANDA 4FUHA 4X6NA 4AFSA 1DVAH 1ELEE 1ZSJA 3AW1A 1T8NA 1L2EA 5ETXA 1SGNE 3TJNA 1YLDA 3OYPA 3L6PA 1YYY1 1ANBA 2ZDNA 4YTAA 3U98H 2SNVA 1N1LA 1YPGH 2VGCC 1MTVA 1SGCA 4F4OC 1E0FD 5FBEA 1AI8H 3P8GA 2NWNA 1O5FH 4DGJA 3MU5A 4TYDA 3T25A 3T26A 3LT3A 4MQAA 3B8JA 4AYYB 3BTGE 1EOJA 2BY9X 4YOJA 2CN0H 4ZUHA 3LGWA 3M7UA 4Y76A 1NS3A 3TNSA 1S5SA 3RXPA 1EJNA 1TE0A 3RXQA 3EDXB 3VFEA 3S0NA 1YPHE 4RN6A 1YPHC 3KN2A 1C1TA 3LGYA 1ORFA 2OQ5A 1S0QA 1LHDH 3SJOA 3E90B 3RUOA 1A4WH 1Y59T 2R0LA 2OC8A 3RXRA 5FPYA 2GCHG 4ABEA 4OGXA 1D9IA 4SGAE 4U32A 3BEIB 4FUFA 3KQEA 4K2YA 1MUEB 1SQTA 2FTMA 5DP7A 3A8DA 4XFQA 2GDEH 1MZAA 3EA8A 1BB0B 4Q7XA 1MKWH 1GJ8B 2RA3A 1O5EH 2CV3A 1HV7A 3M5OA 2G55A 1F0SA 2A0QB 4JCNA 1SB1H 1ZLRA 3S9AA 3SNDA 1L4ZA 2VVVA 5J4SA 2CJIA 1P04A 1DUEA 2PWXA 5T6FA 2A4RA 1GGDB 1O3OA 5A8XA 1AFQB 1QURH 1YPMH 2QA9E 1ELAA 4I7YH 1CQQA 3MTYA 2J9NA 1B7XB 1ESAA 4IMZA 4ESTE 5ESBA 4LZ4B 4BNRA 4XSKU 1ANEA 1UHBB 1S6FA 5DPAA 2FWWA 3F9HA 1AO5A 1G3EA 7KMEH 2PKAB 2A2XH 2DE8A 2JKHA 1JOUB 1TB6H 3NZIA 1YPJH 3SU5A 2VB0A 4A5TS 2Y5FA 3HKIB 4U01A 1F0TA 2VU8E 2VVCA 2W3KA 3PLBA 3RU4D 1LQEA 2H9HA 1NU9A 2FX6A 3SHAH 4O03A 1AE8H 1PJPA 4X0WU 1VCPA 2ZF0H 1D3QB 1MTSA 2C3SA 4X6OA 2AYWA 1YLCA 2W7SA 3TNTA 5EW1H 3E16B 1HFDA 1ID5H 2A5IA 2H1UA 2ZFFH 2SGQE 3FP6E 1P3CA 3NPSA 1VJ9U 1G2MA 9LPRA 2OBOA 1DM4B 2Z9LA 2Y5GA 2XCNA 4X1PU 5FCKA 1EATA 5GCHF 3BTTE 1C9PA 6CHAC 2LNCA 1TMUH 1KXEA 2WINI 2HNTE 1Z6EA 1O2UA 1UHBA 2V6NA 2OD3B 1XUKA 1SFIA 2XBWA 3ITIA 2BY5X 5JB9S 1QBOA 1W10U 1WQSA 1FUJA 4Y0YE 2PKSB 2QC2A 2PKAA 3BTWE 3SGQE 3V7TA 1NRPH 4D8NA 1EAIA 3SOSA 1CGHA 1VR1H 5C20A 1Q2WA 3EQ0H 4BXWA 2FOHA 1O3HA 2ZEBA 1HDTH 2A5AA 2BD4A 2ZU5A 3SU0A 3E6PH 4H42U 1L0ZA 3GYLB 3KF2A 1BQYA 1S0RA 1GHBF 1EUFA 1IQJA 4K1TA 3M7QA 3PTBA 1MTUA 1GCTC 2ZC9H 2R3YA 3SBKA 2WYJA 1ZGVA 1MD8A 4BAQB 1K28D 1FDPA 1O3NA 3U8OH 1OWIA 4A1XA 2BVRH 2TPIZ 1XKBC 1GI3A 3P17H 1W0YH 4Y8ZA 4AG1A 1V6DA 2FM2A 4ZKSU 4FUBA 3QTOH 3ATIA 5TCCA 1O33A 1V2TT 1GBAA 1C1VH 3PYHA 2J2UA 2BOKA 1XUIA 4NA7A 4NIVA 4IW4E 1O3DA 4ZHMU 4J2YB 4ISIH 1GPZA 1QGFA 1SQOA 1CT4E 1P2KA 1DWCH 1FN8A 1KSNA 1GBTA 3BSQA 3ZZAA 2ZECA 4MVNA 2BMGB 2ZDKA 4ABBA 1UVSH 2Z3DA 1W3CA 3C1KA 2QV1A 2GMTC 1L4DA 1MQ6A 1GHYH 3P70B 2VVUA 2HVXA 2FS9A 1DS2E 1TAWA 2CGAA 4X6PA 1SFQB 2RDLA 3A80A 2BB4A 3JZ1B 2WV5A 3QZQA 3RC6A 3D49H 2ZDAH 4B71A 1IQGA 4YLQH 1RXPA 4U2WA 3TH4H 2FI3E 2M5TA 2TGTA 5AVDA 1TX6A 1RIWC 2WUBA 3M35A 1IHSH 1YCPK 1XXDA 4NFFA 2J94A 4IC6A 2G4UA 1HAOH 4OS2A 5JB8S 1OPHB 4BTTB 2PUQH 4DY7B 5HM9A 1YGCH 1KXAA 1EPTB 1C2IA 1RTLA 2R0KA 3SUGA 1QJ7B 3DT0H 1XUGA 5GDSH 5DK1A 1GBMA 1WTGH 2CMYA 4ZXYH 3SORA 1ARBA 1HAPH 4R8TB 3SU6A 3SJ9A 2ZO3H 2NU1E 3E91A 1A0JA 1JXPA 1JIMA