4INHA

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
178
structure length
172
Chain Sequence
DDDKAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Genome polyprotein
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
total genus 41
structure length 172
sequence length 178
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4inhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4inhA01
1SVPA 3PTBA 1RGQA 1YPJH 4I8KA 1TWXB 2BX4A 2VIPA 1OYQA 1BTUA 4ABEA 3MOCA 2VWMA 1GBDA 1YPMH 4IS5A 4UFDH 2H6MA 2BX3A 3V0XA 1EPTB 4XBDA 2F9OA 4OS5A 1C4Y2 3NCLA 2ZO3H 3V13A 3BG8A 1H9IE 1MAYA 1ANDA 3EA9A 1P01A 4YLUA 1ACBE 4D76A 1HPGA 1K1NA 2JH0D 2BXUH 1AI8H 1W10U 3M5MA 3NWUA 2BLOA 2FLBH 3GDUA 1GHBF 1TMUH 4E06H 1ANEA 5TJXA 4Y79A 1O2LA 1UHBB 1KTTB 3Q3XA 1Z6JH 4A7IB 3ZZCA 3M3VA 4Q2KA 2FO9A 2JH6D 1GI3A 3ELAH 3LGTA 1L4ZA 1YKTA 1TRNA 2D1JA 2ULLA 3GISB 3GY2A 3LIWA 5JBCS 1T4VH 1EOLA 3BV9B 3LT3A 1TQ0B 1ZGIA 3D49H 2BVXH 1S6FA 1LO6A 2G52A 1O2NA 1BBRE 1XXDA 3B8JA 4Y6DA 3QZQA 2GTBA 2ZQ1A 3M5LA 4FU9A 4GCHG 3RXOA 1S84A 4AN7A 4HGCA 1D9IA 2M5TA 3BN9A 4WJG2 1P0SH 3URDA 4MNWA 1A5IA 3DUXH 4F4OC 1V2PT 1ZLRA 5FX6A 2PKAA 1TBZH 1HAHH 1EAUA 5T6FA 1TMTH 5A8YA 1AGJA 2F9NA 1TB6H 1DLKB 2QC2A 1AVGH 3B23B 2FTMA 5FXLA 1C9TA 2QXGA 1GJDB 2NU1E 1O2IA 2FODA 5GPIB 4X8SH 3K65B 3HKJB 4DOQA 5E0JA 2AIPA 1NRSH 2VINA 4IMQA 3SNCA 2ZU1A 2AS9A 1XUIA 1LQDB 2ZDMA 2ZTZA 5EW2H 4X1RU 1BT7A 4CRAA 4CRCA 3TJNA 1F92A 1KSNA 1Z1JA 4A5TS 3T5FH 3U8RH 1P2KA 1C1SA 2FTLE 3ZYDA 2FOCA 1INCA 4INHA 4O3UA 3EAJA 4CR9A 1QJ6B 3UFAA 2BDCA 1O2RA 1W2KH 3Q76A 4BOHA 5JYIA 1IQEA 2VIVA 2PLXA 1FUJA 1C5XB 1EZQA 2Y81A 2HPQH 4ZKOU 1TA6A 1QR3E 1CSOE 4IW4E 1QIXB 1Y3UA 4MNYA 2A31A 2PV9B 2QAAA 3M5NA 1FY8E 3S9CA 3GCNA 1VITG 1MKWH 5CHAB 4MNVA 1EP6A 3BIVH 1D3QB 1GJ4H 2DE8A 1C2KA 3BG4C 2BD4A 1UK3A 1Y3YA 3PLBA 1O2GH 1SGRE 1ELBA 2QXHA 2XBVA 2UWOA 2ALPA 5EQSA 1MQ5A 1V2OT 3AAVA 3WY8A 3F9EA 2BDHA 2FM2A 1HRTH 2VGCB 3UNSA 4WXVA 1C2DA 3RXHA 1TONA 4B74A 1ZHRA 2GVFA 1IQHA 1AVXA 1XKAC 4FUHA 1J15A 2GV6A 3W94A 1FNIA 1ELAA 2GMTB 1V2UT 2PFEA 1BRBE 1KXCA 1AQ7A 2ZCLP 1EZSC 3U8OH 1KDQA 1BBRK 3CS0A 2VH0A 1P02A 4ZROA 4JCNA 2EEKA 1HGTH 2AGGX 1ELDE 1GBJA 1FI8A 2O8LA 1MH0A 2H1UA 2ZGHA 4X6OA 2PUQH 3P95A 2H5DA 2VB0A 1NFUA 4XDEA 3U1JB 4AFZA 2CHAC 1P9SA 1C1OA 2OD3B 2V3OH 6ESTA 2B5TB 4M7GA 4QT8C 2WPJS 5C3NA 1SGYE 1Y8TA 2LPRA 2FI4E 1F0TA 1OP8A 1MZAA 2OBQA 4X6MA 1O39A 1Z7KA 2JH5D 2OQ5A 2F3CE 3QDZB 1GVLA 2VVCA 3TK5A 2KAIB 4U01A 4OS1A 3C27B 1C2MA 4I8JA 3LOXA 1WUNH 1C5TA 1T4UH 3KIDU 3BG4B 3SU0A 2PGQB 2XXLA 3GY3A 1F5KU 3SHCH 2YOLA 1QBNA 1DE7H 4H6SB 1C1NA 1C5UA 2B7DH 2XRCA 3LPRA 4O97A 1O36A 4TWWA 5GCHF 3SGQE 1F0RA 2AGIX 1TGTA 4ZAEA 4YT7H 5L6NH 2PSYA 4XFQA 3LGUA 1YF4A 1SQOA 1G9IE 2ZU3A 2WPIS 4ESTE 2A5KA 1O3DA 1Z1IA 4CH2B 4XBBA 2I6QA 1V2ST 2GX4A 3ZZAA 1ZR0A 2XC5A 1GBKA 2J38A 2OINA 3NK8A 1BB0B 1O3PB 2XW9A 1SOZA 2QXJA 2GZ8A 4K2YA 1A61H 1A0JA 2QYIA 3LGVA 1KXEA 1O2KA 1UO6A 1WCZA 2TGTA 2BTCE 4K60A 2UWLA 2A7CA 2QF3A 4NWLA 2O9QA 1ZSJA 3H7OA 5T6GA 1QY6A 5I46H 2ASUB 2CHAB 3Q00A 1HAIH 4I7YH 2TBSA 3A80A 2D26C 2P3FH 4AYVB 3GCTF 1GI1A 1MTNC 1JMOH 1SGQE 1ZHMA 5JB8S 1D4PB 3KEEA 2Z3EA 3K9XB 2V35A 3DFJA 2ZPSA 3HK6B 4ABIA 3T26A 4UD9H 2Y5FA 1T8NA 1YPHC 2HALA 1SGTA 1TNGA 5IDKA 2CF9H 2ZDLA 5DP3A 1V3XA 1C5VA 2RDLA 1ZGVA 1KXFA 5EXMA 2AMQA 4UDWH 1E38B 3SNBA 1OP0A 3EQ0H 1O5EH 1EXFA 2J4IA 2R3YA 1W8BH 2GDEH 5ESTE 3DA9B 2ZU2A 1CU1A 3S9AA 3SW2B 1BITA 2D2DA 4ZXYH 1BTPA 2BD3A 3RXVA 1CA0C 3E6PH 3KCGH 3SU6A 1AE8H 4LZ4B 4J1YA 2A45B 2PKSC 1B0EA 1C4U2 3U9AH 1O2PA 3SU3A 1KLIH 1TIOA 3ZVCA 3TGJE 1LPKB 1O3JA 1OWHA 1SFQB 3A7YA 2QXIA 2GCTC 4R8TB 3SGAE 4OGYA 1NFWA 3AVZA 3RU4T 3UOPA 1YPHE 4CHAB 4D7FA 3A7ZA 1NU9A 4AFQA 2ZGJA 1H8IH 3VFEA 1GBIA 3RC5A 6GCHF 2ZI2H 2Y80A 3NKKA 1CHOG 1V2NT 6CHAC 2BXTH 1UCYH 1BUIA 4ZHMU 1UTPA 4RKJB 1BRUP 1ELFA 1RTFB 3A86A 1KXDA 2PWXA 1FZZA 1GCDA 2FOBA 1PQ8A 1S82A 2AGEX 1EOJA 1SC8U 3M35A 1L0ZA 4MNXA 1BQYA 2BM2A 1W13U 1SB1H 1HUTH 1LHEH 4DJZB 1W0ZU 1HFDA 2C93B 1LVYA 1YP9A 1Y5AT 1WU1A 1CGIE 4K1EA 1DSTA 4K3JA 3A7WA 1VCWA 3SQHE 3SGBE 1G3BA 2HRVA 1O5GH 4MQAA 3AW1A 2BD5A 3GOVB 1EAXA 4LZ1H 5HXFA 5A0AE 1F5RA 4GUXA 2WPLS 1N8OC 1QBVH 3D62A 1W7XH 1V2JT 1F2SE 1CA0B 1CGHA 2ANYA 2DE9A 4HZHA 4MPVA 4X6NA 2GZ7A 4MPXA 2XBYA 2ZECA 5DKMA 1DDJA 1THPB 1GMDF 1HXEH 1HAYB 2AYWA 3UR9A 3P17H 1NM6A 1N6YA 3UQVA 1EJNA 3VB6A 1SOTA 2UUFB 2EC9H 1FPHH 1YCPK 2BY7X 5PTPA 2XCNA 1N6XA 2BD7A 2FX4A 1C2JA 4AGJA 4DIIH 2Z6BD 3QLPH 1Q3XA 2BDGA 4RKOB 4ABAA 1KXAA 4ZKSU 3SV8A 3HGPA 1ZTJA 2R0LA 1WQVH 2SGQE 5IYTA 1Q31A 2XBWA 4K1TA 2A2XH 2XC0A 3QWCH 3MU1A 6CHAB 5C5OA 3UTUH 3SV9A 1PPCE 4RSPA 1QGFA 3K2UA 1SGFG 2FYQA 2ZF0H 2HLCA 5L2ZH 2J34A 3QN7A 1EAIA 1OSSA 1O3AA 3GY4A 4JYVH 1HXFH 3SU1A 3P70B 2CV3A 1HAOH 2BOHB 3CP7A 2OCVB 4XBCA 2VJ1A 4OS2A 2IPHA 3A83A 3ZZ3A 1C2HA 1P57B 1C1MA 1HCGA 1N8OB 2QIQA 2XC4A 1ANCA 4O03A 4A1VA 3RXSA 3ITIA 1O2MA 2YNBA 1TQ7B 4NFEA 3TU7H 3DFLA 1C5WB 2BLVA 2VIQA 1A1RA 1TFXA 5GXPA 1C1QA 5J4SA 4SGAE 2G51A 1UTKA 5CMXH 1RXPA 2ZHWH 1O2YA 4DVAU 1MU8B 4ABGA 1BIOA 1F7ZA 1AD8H 2F9VA 1NROH 3ZZ5A 3E91A 3A82A 2ZA5A 1C1PA 3TIUA 3MYWA 3QGJA 1NS3A 1TABE 1PPEE 1SLUB 5AFZH 1TPPA 5AF9H 4X0WU 1AFEH 5BPEA 3RXBA 1FONA 1QRXA 3QGNB 5LPEA 1WTGH 2W7SA 1EJMA 3AASA 1C5PA 1TX6A 5F8TA 2G8TA 1KLJH 3RC6A 1O2ZA 3CENA 4NA9H 1O33A 3RXPA 4MTBA 4DURA 1CT4E 1GHAF 1E37B 4Y10E 2Z9KA 2GV7A 5DG6A 3MTYA 1Q2WA 1DPOA 3C1KA 1DWDH 1QL9A 1QQ4A 1LKBA 2W3IA 2ZGCA 4AORA 1CT2E 4UE7H 2ZNKH 1GHWH 2Z94A 1WYKA 1QB6A 3PWBA 2J2UA 4I32A 5DP7A 1JOUB 4A6LA 4Q7YA 1AKSA 3E0PB 3FVFB 1BHXB 3MH5A 3BF6H 1O2HA 5GDSH 3TNSA 2ZFRH 1UTOA 1ETTH 1C2GA 7ESTE 2PW8H 3TK9A 4HI3A 3KL6A 4YESB 1BBRH 1P3CA 2G81E 1J8AA 4KP0A 1FY1A 1W0YH 4E7NA 4ZKNU 1SHHB 2PTCE 1V2RT 2SGEE 2W7UA 3QK1A 1GPZA 5C1YA 2NU2E 1CVWH 3M37A 3SNAA 5AHGH 1VJAU 1IQLA 1RRKA 2R2MB 1G32B 4XOJA 1GI5A 5DP4A 1JBUH 3SOSA 3V12A 1LHFH 3ATIA 1ZPZA 1XM1A 1GBTA 1SR5C 3NXPA 5ESBA 3VXFH 1GG6C 3F6UH 2F9BH 3ZZDA 3PO1C 8GCHG 1O2VA 3ZYEA 3EDXB 3Q77A 4UONA 1BTHH 3PYHA 2B0FA 4GAWA 1TALA 3GYLB 3A7TA 4MVNA 1ELVA 4ZKRU 3PMBB 3SNDA 5LH8A 1QJ1B 5DO4H 1UK4A 3PLPA 2Z9LA 1N1LA 3ZV8A 1TGSZ 1FMGA 2WPHS 9ESTA 1P9UA 2ZGBH 4GHQA 5CHAC 1BMAA 1VR1H 2OC8A 4O9VA 4RN6A 3UIRA 1P05A 4J2YB 3A88A 1ZRBA 1P03A 1FAKH 3SU4A 5K7RA 3GDVA 3SV2H 1L4DA 1OPHB 2Q1JA 4X8TH 1V6DA 5ETXA 1VZQH 2VGCC 1X7AC 2R9PA 3TJVA 2ZIQH 3OY5U 1NZQH 5EQQA 2TRMA 4YO9A 4WMEA 4X1SU 2BD8A 5L30H 1G3EA 4WMDA 1C2FA 1FY4A 1HAVB 4DW2U 2ANMH 2GMTC 2FXRA 5DP6A 4Y11E 1TNLA 1C1VH 1K1JA 1HAGE 4Y0ZE 5C20A 4LXBH 2A1DB 1WV7H 5HMAA 3BTKE 3PROA 4NZQA 3ZZ6A 1UJ1A 1O2UA 2B9LA 1KTSB 1VJ9U 1QTFA 3SO3A 1ESAA 4B2CA 1P3EA 1BTWA 5H4IB 1HAZB 3TH2H 4AYYB 2HPPH 3LGWA 2A7JA 3RDZA 3RP2A 4Z6AH 3R0FA 3LJJA 3A8CA 2FEQH 4YLQH 1NN6A 4WMFA 1PQ7A 1OKXA 3JZ2B 1ORFA 1ZPCA 3KGPA 1GG6B 4CH8B 3PO1B 2QA9E 1BCUH 1H1BA 1MD8A 4HTCH 3KN2A 1XUJA 2ZCHP 2GCHF 4AGKA 2AMPA 2UUJB 1PQ5A 1QRWA 2OC1A 2PUXB 5L2YH 3QO6A 3PV4A 4Y8ZA 1GVZA 1ID5H 3MNSA 1GWAA 3BEFB 2F9PA 1OYTH 5EXNA 5A2MH 2AERH 1SSXA 1BRCE 3TNTA 4SGBE 3V3MA 2HNTF 1HDTH 4Y0YE 3BTHE 4GVUA 3MNXA 1H8DH 1C2IA 3SJ8A 1NTPA 2RG3A 1B0FA 3MO6A 1ZJKA 4MLFB 1P2QA 1NPMA 3NUMA 2C90B 2G4TA 3RMNH 2HOBA 4BXSA 1FDPA 3MH4A 4CR5A 1TGNA 1Z8GA 4E05H 3L33A 4IGDA 5HM2A 3ATWA 3D65E 1BMNH 1C1WH 3SJ9A 3HPTB 4GLYA 1O2SA 1HIAA 1DFPA 5K0HA 3UWJH 4FU8A 2SGDE 1K1LA 1WBGB 2WV5A 4B71A 3BTME 1THRH 1QB1A 4OS6A 1T32A 4JZIA 3UNQA 4AX9H 3P6ZB 2ZG0H 2BLQA 1DSUA 1TE0A 1LHCH 3SQEE 1ZMJA 1EZXC 2H2ZA 1A2CH 3SN8A 1RIWC 4AZ2B 3H5CB 3EA7A 1ABJH 1DWCH 1SMFE 2PR3A 2OQUA 3ATKA 2ZDVH 1O3EA 2AFQB 3FP7E 3SBKA 1SI5H 3AAUA 1ETRH 4A1TA 3BSQA 2P93A 4ABDA 2FOEA 2FIRH 3I78A 5EG4A 2RA0A 1C5OH 2A5AA 4MPUA 3KQCA 2QY0B 1C1RA 3CS7A 2BZAA 7GCHF 2WUBA 2OTVA 3OX7U 3ATMA 4X1NU 1PPBH 1YPEH 4H42U 1PYTD 4THNH 2BDAA 2ZP0H 1QRZA 2VIDA 3SJIA 1TNJA 1GMHG 1P12E 4I8HA 3BTWE 4HFPB 3UNRA 1O35A 2YNAA 4Y7AA 4DCDA 1V2KT 2JETB 4MG3A 1T8LA 1IQIA 1M9UA 2W5EA 3RMLH 3ZVGA 1WOFA 1SLWB 1BA8B 3SV7A 1ESTA 3SUEA 1YCPH 4NCYA 1AE5A 3M3SA 1LTOA 1NO9H 3Q3YA 3AW0A 3F9HA 4INLA 2A4GA 1AO5A 3TJOA 2OC7A 3UOUA 1XKBC 2XBXA 4X6PA 4DG4A 2V3HH 4CHAC 4ISNA 3BTQE 3LGIA 5FBEA 4NA8A 2CN0H 1EAWA 1C5QA 1O3NA 1HAXB 1OOKB 4FUIA 4FVBA 3KQEA 3H7TA 1TBRH 1KLTA 1O34A 2UUKB 1AZ8A 3O8BA 3UWIA 1K28D 1RIWB 1XXFA 4NIWA 1IHTH 1MZDA 1CA8B 1EB1H 1UVUH 1RS0A 4UFFH 5EOKA 2C3SA 1GBLA 2OBOA 3T27A 1C5MD 4FUFA 4JK6A 3MH7A 3UPEA 3HKIB 4GCHF 1PYTC 3MU8A 5F03A 1A5HA 3I29A 5T6DA 4WXIA 1EPTA 1S85A 3RLWH 3RUOA 1G30B 3O8DA 1GI2A 4WVPE 1HJAC 1GHYH 1P8VC 1QJ7B 3ZVFA 1SQTA 4IMZA 3ZZ9A 3UQOA 3LKWA 3A8BA 1DLEA 2J94A 1GMCG 2P8OC 4YOJA 3P8NA 3SORA 1E36B 3MU5A 2ZHEH 5F8ZA 1UK2A 2G5VA 2FOGA 2TGAA 1UHBA 2OUAA 4NZLA 5FX5A 2VWOA 3E8LA 4BXWA 2TPIZ 2ZHDA 1GGDC 3GDSA 1BTXA 1VCPA 1H9HE 2ZHQH 1Y59T 4U32A 2UUYA 3A81A 1BJUA 3K6YA 1GHZA 1AUJA 4GSOA 1FIWA 2P95A 2P59A 4BANB 4D8NA 1LKAA 4AB9A 1O5CB 1GHVH 1K22H 2K1QA 5DPAA 3VXEH 4JZEH 2TIOA 1D3PB 2A4QA 1RTLA 3BEUA 1RTKA 4INKA 4KKDA 2UWPA 2PKAB 4NWKA 1QBOA 4FUGA 5JBTA 2BY6X 1AZZA 1VITF 2CJIA 2ZFPH 2EA3A 1G3DA 2ZDAH 1TPSA 1AIXH 2QV1A 3LDXH 3UY9A 1E35B 1O32A 1DY9A 2R2WU 1UTNA 5EQRA 1TX8A 1GHBG 1QURH 4YTAA 2ZTXA 1YBWA 2TGDA 4BAHB 1MKXK 3ODFA 1FQ3A 1C5LH 4JZDH 1UTQA 1CO7E 4O3TA 1HJAB 3DT0H 1EB2A 2ZFSA 2BHGA 2WPMS 3MO3A 3PM3A 4UFEH 4Y8XA 4YOIA 1BMLA 1GDQA 4CBNA 4GHTA 2P8OB 1F0SA 5GJ4B 4K5ZA 1OWKA 2RA3A 1S81A 1P2IA 3GY7A 3VGCC 1NRNH 4X2YA 5BRRE 1A0HB 3TPIZ 1DS2E 3EGKH 2ZHFH 1G3CA 2ODPA 3S7HB 1C5YB 1U6QA 3ZVBA 1YC0A 1GGDB 3STIA 3MO9A 4NA7A 3RMMH 2J95A 1LVOA 1GDUA 1YGCH 1Z8IB 5TCAA 1O30A 4FUCA 3HATH 1GJBB 1IAUA 4TPYA 2R0KA 5F6MA 4IBLH 3MHWU 3VB5A 2V6NA 3MU4A 3PMJA 1T8MA 1D3DB 1GL0E 1F0UA 2Q6DA 4AOQA 1AHTH 3M61U 4ABJA 1PQAA 5JDUB 3T62A 1OXGA 3ZV9A 1J14A 3S0NA 1ZSLA 1EP5A 5FAHA 4U2WA 1JWTA 1NU7B 3T2NA 3LC3A 1DUAA 1O2TA 3ZVEA 4B75A 2EI8A 4CRDA 3E90B 1LMWB 1KDQB 1V2MT 2AMDA 1P2OA 2Z7FE 2O8UA 2ZFFH 1HJ8A 4DGJA 1AWHB 1O5AB 1OS8A 3ZVDA 2Y6TA 2EI6A 3JZ1B 1L1GA 3T29A 1W3CA 1NRQH 2AIQA 3MWIU 2GCHG 2BMGB 2BDIA 1MAXA 1TOMH 1L1NA 1MTUA 2Z3DA 3VEQB 3GICB 1S0QA 4ABFA 1AB9C 5C67A 1SBWA 3VGCB 1A4WH 1SGDE 1ELTA 1LVMA 1O3HA 5SGAE 4X1QU 5CE1A 1EX3A 4F49A 3FFGA 4UEHH 3B9FH 2R3UA 3P8FA 3RU4D 1GI8B 5EGMA 3ZZ8A 2ZGXH 2BYAX 3UUZA 3KNXA 2KAIA 1XUFA 5DP5A 5E2PA 3F1SB 1SHYA 2TGPZ 1UTLM 5E8EH 3W95A 1Z8RA 3TK6A 2VVVA 1JIMA 5JPMH 4BAQB 3M5OA 1QNJA 2BY5X 2FDAA 1P2JA 2ZFTA 4D9QA 1G2LA 1ETSH 1V2VT 1A3EH 1O3IA 1JRTA 2QCYA 5JBAS 3G01A 1T7CA 2ZPQA 3GYMA 3SI4H 3TH4H 4WH6A 4FU7A 4I33A 1JXPA 2H9TH 2VWLA 3SJKA 1GVKB 2O8WA 3KQBA 1BOQA 3RXKA 1O3OA 1DANH 1QCPA 2BQ6B 1LPZB 2G55A 4PROA 5AVDA 1QFKH 1IQKA 1FV9A 4ISHH 2Y5GA 2C8ZB 1E34B 1GJ6A 1UTJA 3A85A 4ZMAH 3V7TA 1MBQA 1SGFA 3ENSB 5FPSA 1MTWA 1GBHA 1C4V2 4IN2A 3MNCA 4IN1A 4BAKB 1ABIH 3PWCA 1PPHE 1O3CA 5A0CA 4ZHLU 1HBTH 3P92A 2GKVE 3RLYH 1P09A 1YPGH 1MCTA 1W12U 3LH3A 1KIGH 3PB1E 4WF8A 4NIYA 1A3BH 3A8AA 1PFXC 3M7TA 3D23A 1AB9B 1CT0E 4H6TA 4Y7BA 1JIRA 1PPZA 2FOFA 1TX7A 4KGAA 1TPOA 1OP2A 3P8OA 2W26A 3HK3B 4NG9H 3EYDA 3L3TA 3S69A 1B5GH 4KELA 1MTVA 5FPTA 5GCHG 4X2WA 1BTZA 8LPRA 5I25A 1XX9A 3OSYA 1CHOF 3QTVH 2WUCA 2P3TB 4B2BA 4KTCA 4X8UH 1LPGB 2O8TA 2ODYB 1QL8A 3MU0A 1PPGE 2F83A 3PMAB 1XVMA 1NESE 3FAOA 2NU0E 2ZCKP 3VB7A 1BRAA 4BTIB 2EI7A 1AVWA 3A8DA 1ZSKA 4LOYH 1EASA 2BDYA 4I8GA 5T3HA 3BTFE 3FP8E 3RXEA 3RXAA 3RU4E 2BDBA 1BTYA 1MQ6A 1QB9A 3I77A 2B8OH 3SUFA 3DD2H 5C1XA 3O8CA 4X2VA 1ELGA 1W7GH 3GCTG 2OP9A 3SUDA 1HYLA 4YT6H 2LNCA 3GY5A 1AU8A 3OU0A 5DP9A 3QTOH 3PLKA 1TMBH 3LC5A 3A7VA 1D3TB 2VVUA 1SGPE 2RCEA 5E0HA 3VB4A 1SFIA 4Q80A 2FZZA 3O8RA 1WQSA 1MTSA 8ESTE 1O3KA 2CGAA 3M3TA 1ZYOA 1XUGA 1ZMNA 1FPCH 1HB0B 1O5DH 2SNVA 2ANKH 3SZNA 1THSH 4FXGH 4Q7ZA 1FN8A 3GY6A 4JYUH 1LHGH 2VIWA 1C9PA 1LVBA 1ZOMA 3TGKE 3MNBA 1A5GH 1IOEA 2VNTA 1GBBA 4WH8A 1YLCA 3TGIE 2OC0A 3RXFA 1UVSH 3TJUA 1QA7A 1PJPA 1GJ9B 1GJCB 2THFB 1KYNA 3OY6U 1ELCA 1O3BA 1IQNA 4DY7B 1ARBA 3L6PA 2PHBA 1TA2A 1LQEA 1ZTLA 1GCTC 2HVXA 4CRBA 1EKBB 1D6WA 1C2EA 3F68H 1QHRB 2C4FH 2NU3E 1C5RA 5LPFA 3MI4A 1YLDA 3T25A 1FXYA 2BLWA 2FOMB 3M7UA 4ISIH 3BEIB 1YM0A 1ZHPA 2D8WA 2FWWA 1TBQH 2QF0A 3FANA 5DJ7A 1TLDA 2H9EH 3GY8A 3IG6B 1Y3XA 4JMYA 4GPGA 3QX5H 1DICA 3KHVA 5EPYA 6GCHG 3U8TH 4FUBA 4K8YA 4ZUHA 1EUFA 1FJSA 3KQDA 1IQGA 4JZFH 4AFSA 2Y7ZA 4JK5A 5DP8A 1J17T 5LGOA 4YOGA 1RD3B 1NRRH 3F9FA 1HLTH 1P10A 2JETC 3RXMA 1IHSH 2IN2A 2Y5HA 1GBFA 1V2WT 1GI0A 1J9CH 1MD7A 2QGRA 1HAPH 2BVRH 4LK4A 4TY7A 4JYTA 2ZDKA 3U98H 7KMEH 2VIOA 2ILNA 3S7KB 4NIXA 2WV4A 3UR6A 4OS4A 4FUJA 1V2TT 1K21H 1UVPA 1GHXH 1XMNB 5C1UA 2OLGA 5JB9S 2SGPE 3BTGE 2BZ6H 2GDDA 3MMGA 5HM9A 2WYGA 2IJOB 1GI9B 2FLRH 5J4QA 1YPKH 2XWBI 1AY6H 2SGAA 2Z3CA 1MU6B 1GMDG 2ZZUH 1SGCA 1SPJA 1GCTB 3ESTA 2Z9GA 1O5FH 2XWAA 1T31A 2VH6A 2ZTYA 3GCOA 1YYY1 1O2OA 4KTSA 4I8LA 4TY6A 1IQMA 3U1IB 5EW1H 5EODA 1FY5A 2J9NA 3RXRA 1FIZA 2BD2A 4ASHA 1GBMA 3OYPA 2NWNA 3LJOA 5B6OA 2FOAA 1GJ7B 2A0QB 2CMYA 3SNEA 1F5LA 1FAXA 2BD9A 2STBE 3FZZA 2HNTC 2ALVA 3FP6E 1MKXH 2P16A 1L2EA 2HWLB 5FCKA 3LH1A 1YPLH 1ZJDA 6LPRA 1TNHA 1DY8A 4Q7XA 2FP7B 3RM2H 3BIUH 2F9UA 1SGEE 4Y8YA 4XSKU 3RXTA 1S6HA 2G5NA 3NPSA 4BTUB 3URCA 1TRMA 4E7RG 5FBIA 2ANWA 4DT7B 2C8XB 1PPFE 4H4FA 4BTTB 4WY3A 1P04A 1TYNA 1MBMA 3IITA 1DWEH 8KME2 1GJAB 1SLXB 1XUHA 2DUCA 4TYDA 1BDAA 2ZU4A 1A7SA 3BTTE 3S9BA 4JZ1A 1SQAA 1O2XA 2CF8H 2XCFA 3E3TA 5F8XA 4ZHAA 4MPWA 3QZRA 5HYOA 2Y82A 5EPNA 1AWFH 1MCVA 8GCHF 1TNKA 2ODQA 3RMOH 2J92A 2SFAA 2HNTE 3ATLA 1C5ZB 2A4RA 1FY3A 4ABHA 4A1XA 1FN6A 1AKSB 7LPRA 3KF2A 2I6SA 3ZZBA 1MMJN 1G37A 3BTDE 1VCQA 2BB4A 4MDSA 1UVOA 1RJXB 1OWDA 5E0GA 2H9HA 4B76A 2Y7XA 2ESTE 1ARCA 9LPRA 4ZH8A 1P06A 1NFYA 1AFQC 4ISLA 1AUTC 5GWZA 3VPKA 1LCYA 2AH4X 2ZEBA 3GCHC 5HGGA 1IQFA 1S0RA 4Y71A 1O5BB 1TAWA 1SG8B 2G4UA 1O3FA 3RXGA 1LHDH 2A5IA 3FZDA 3EE0B 1ANBA 3TVJB 5DGJA 3QUMP 2Q6FA 2PGBB 4X1PU 3LONA 2FPZA 1OWIA 1A0LA 1DWBH 1GHAG 4TWYA 2F91A 1MKWK 4K8BA 1K2I1 4D7GA 3ODDA 3BTEE 4ABBA 1EZUC 1G2MA 2GP9B 1P11E 3EA8A 2FS8A 3A89A 2C8YB 4A92A 1GL1A 4XE4A 1OX1A 3LGYA 2GT7A 1DOJA 1AN1E 1OWEA 2PTNA 2JKHA 1IQJA 1Y5UT 3Q3KA 2WYJA 1CHGA 1BJVA 5A8ZA 2A7HA 3RXIA 1NFXA 1Y3VA 3TLOA 1ZTKA 1HV7A 4AFUA 2CXVA 4KTUA 1H9LB 2ZC9H 1Z71A 3STJA 2XTTB 4Z0KA 3MFJA 5EXLA 2O8MA 4NGAH 1O3LA 4ISOA 4CRFA 2SGFE 3IWMA 3U69H 4Y76A 1QL7A 1YCPM 4NFFA 1ESBA 1QQUA 4DIHH 1HAVA 3DHKH 1S5SA 1DITH 4TPIZ 4NSYA 1ELEE 1RFNA 1W14U 1TPAE 1TOCB 4CBOA 1MTNB 1O2WA 1AFQB 2Z9JA 2BQ7B 3ZVAA 2ZQ2A 1D6RA 1GBCA 1SL3A 2P3UB 3GCHB 2FS9A 3RXUA 4IC5A 4X2XA 4ZXXH 3MH6A 3E1XB 5TCCA 4YZUA 1ZRKA 1GI6A 1XVOA 2G00A 3NZIA 2A32A 4K69A 2BVSH 3M36A 1UMAH 3P8GA 1P2NA 2WPKS 5JBBS 1EQ9A 3A7XA 5A8XA 4OGXA 1O3GA 2ZPRA 1T8OA 4YM9A 3RC4A 3M7QA 2SNWA 2ZU5A 3SU5A 1S83A 2BOKA 4BNRA 2FI3E 1BHXF 1J16A 1ZZZA 1HNEE 1GBEA 3T28A 1C1UH 2W3KA 1VGCC 1Y5BT 1O31A 4X8VH 2PKSB 1P2MA 1K9OE 5AFYH 2FI5E 4NIVA 2VU8E 2FMJA 2OXSA 5DK1A 1K1MA 2GCTB 1UCYE 1NY22 4FUDA 1L1JA 1VITH 1DT2A 1MUEB 1BZXE 4CRGA 2NU4E 1AMHA 1DX5M 1SGNE 1CGJE 1DM4B 1GI7B 2GGVB 4NSVA 2ZDNA 5LPRA 1Z8JB 3TH3H 1CBWC 1C2LA 2FX6A 1DVAH 3LU9B 4WWYA 1GI4A 2ZFQH 3TITA 1HIAB 1TGCA 3SV6A 5C5NA 2PSXA 1NRPH 1UTMA 1C5NH 1JRSA 1GMHF 1GDNA 4K1SA 3SI3H 1Y3WA 4IC6A 2Q6GA 2P94A 4I31A 1HJ9A 4VGCC 3HGNA 4UFGH 4AB8A 4FUEA 4B2AA 1W11U 1WAYB 1BMMH 5A0BA 2ZKSA 1KY9A 1K1OA 1TRYA 3SU2A 1G36A 3RXJA 4BAOB 1A46H 5EU8A 2AEIH 2V0BA 1B7XB 3RM0H 1O38A 2QN5T 1CE5A 2GZ9A 4FVDA 3A84A 4OS7A 1C5SA 3VB3A 5FPYA 2H5CA 1O2QA 1O0DH 3K6ZA 3RXCA 1DUEA 4U30A 5C2ZA 3UREA 1C1TA 1ZMLA 5E2OA 2BY9X 1WSSH 3A87A 2VWNA 4CREA 1VGCB 1ZPBA 2HGTH 1EPTC 1O2JA 1UVTH 1GJ5H 1CQQA 3SHAH 3RXLA 1TNIA 1K1PA 5FHTA 2XYAA 2GD4B 2BQWB 5FCRA 2A4OA 5GIBA 2BY8X 1O3MA 4R0IA 1OWJA 1Z6EA 2GT8A 3E16B 4AG1A 2FOHA 1EJAA 1DXWA 2C8WB 1K1IA 2STAE 4B1TA 1CBWB 1EATA 1WTHD 2Z9IA 3F9GA 4D9RA 4AG2A 2WINI 4BAMB 3E0NB 1GJ8B 5A09A 1V2QT 3ZZ7A 1KXBA 1NC6A 3RXDA 3N7OA 1GMCF 1UCYK 1XUKA 1SGIB 3SUGA 3R3GB 2ZWLH 1FLEE 4B73A 3OTJE 1E0FD 4VGCB 5G4BA 1O37A 2IOTA 2FESH 1QA0A 3RXQA 1GBAA 1TGBA 5ABWA 1SLVB 1H4WA 3PTNA 1NT1A 2XNIA 3SJOA 2A2QH 7GCHG 1DXPA 1LDTT 3PMHB 1V2LT 3ZZ4A 2FYRA
chains in the Genus database with same CATH superfamily
1SVPA 3PTBA 1RGQA 1YPJH 4I8KA 1TWXB 2BX4A 2VIPA 1OYQA 1BTUA 4ABEA 3MOCA 2VWMA 1GBDA 1YPMH 4IS5A 4UFDH 2H6MA 2BX3A 3V0XA 1EPTB 4XBDA 2F9OA 4OS5A 1C4Y2 3NCLA 2YMSC 2ZO3H 3V13A 3BG8A 1H9IE 1MAYA 1ANDA 3EA9A 1P01A 4YLUA 1ACBE 4D76A 3SZEA 2L74A 1HPGA 1K1NA 2JH0D 2BXUH 1AI8H 2QE7D 4HG6A 1W10U 3M5MA 3NWUA 2BLOA 2FLBH 3GDUA 1GHBF 1TMUH 4E06H 1ANEA 5TJXA 4Y79A 1O2LA 1UHBB 1KTTB 2V7QD 3Q3XA 1Z6JH 4A7IB 3ZZCA 3M3VA 4Q2KA 2FO9A 2JH6D 4ACAA 1GI3A 3ELAH 3LGTA 1L4ZA 1YKTA 1TRNA 2D1JA 2ULLA 3GISB 3GY2A 3LIWA 5JBCS 1T4VH 1EOLA 3BV9B 5FL7D 3LT3A 1TQ0B 1ZGIA 3D49H 2BVXH 1S6FA 1LO6A 2G52A 1O2NA 1BBRE 1XXDA 3B8JA 4Y6DA 3QZQA 2GTBA 2ZQ1A 3M5LA 4FU9A 4GCHG 3RXOA 1S84A 4AN7A 1K0HA 4HGCA 1D9IA 2M5TA 3BN9A 4WJG2 1P0SH 3URDA 4MNWA 2WSSD 1A5IA 3DUXH 4F4OC 1V2PT 1ZLRA 5FX6A 2PKAA 1TBZH 1HAHH 1EAUA 5T6FA 1TMTH 5A8YA 1AGJA 2F9NA 1TB6H 1DLKB 2QC2A 1AVGH 3B23B 2FTMA 5FXLA 1C9TA 2QXGA 1GJDB 2NU1E 1O2IA 2FODA 5GPIB 4X8SH 3K65B 3HKJB 4DOQA 5E0JA 2AIPA 1NRSH 2VINA 4IMQA 3SNCA 2ZU1A 2AS9A 1XUIA 1LQDB 2YMSB 2ZDMA 2ZTZA 5EW2H 4X1RU 1BT7A 4CRAA 4CRCA 3TJNA 1F92A 1KSNA 1Z1JA 4A5TS 3T5FH 3U8RH 1P2KA 2K0QA 1C1SA 2FTLE 3ZYDA 2FOCA 5HKKD 1INCA 4INHA 4O3UA 3EAJA 4CR9A 1QJ6B 3UFAA 2BDCA 1O2RA 1W2KH 3Q76A 4BOHA 5C17A 2KCOA 5JYIA 1IQEA 2VIVA 2PLXA 1FUJA 1C5XB 1EZQA 2Y81A 2HPQH 4ZKOU 2J98A 1TA6A 1QR3E 1CSOE 4IW4E 1QIXB 1Y3UA 4MNYA 2A31A 2PV9B 2QAAA 3M5NA 1FY8E 3S9CA 3GCNA 1VITG 1MKWH 5CHAB 4MNVA 1EP6A 3EE7A 3BIVH 1D3QB 1GJ4H 2DE8A 1C2KA 3BG4C 2BD4A 1UK3A 2JJ1D 1Y3YA 3PLBA 1O2GH 1SGRE 1ELBA 2QXHA 2XBVA 2UWOA 2ALPA 3OFND 5EQSA 1MQ5A 1V2OT 3AAVA 3WY8A 3F9EA 2BDHA 2FM2A 1HRTH 1QZ8A 2VGCB 3UNSA 4WXVA 1C2DA 3RXHA 1TONA 4B74A 1ZHRA 2GVFA 3GS9A 1IQHA 1AVXA 1XKAC 4FUHA 1J15A 2GV6A 3W94A 1FNIA 1ELAA 2GMTB 1V2UT 2PFEA 1BRBE 1KXCA 1AQ7A 2ZCLP 1EZSC 3U8OH 1KDQA 1BBRK 3CS0A 2VH0A 1P02A 4ZROA 4JCNA 2EEKA 1HGTH 2AGGX 1ELDE 1GBJA 1FI8A 2O8LA 1MH0A 2H1UA 3NRLA 2ZGHA 4X6OA 2PUQH 3P95A 2H5DA 2VB0A 1NFUA 4XDEA 3U1JB 4AFZA 2CHAC 1P9SA 1C1OA 2OD3B 2V3OH 6ESTA 3OE7D 2B5TB 4M7GA 4QT8C 5C0TA 2WPJS 5C3NA 1SGYE 1Y8TA 2GJGA 2FI4E 2LPRA 1F0TA 1OP8A 1MZAA 2OBQA 4X6MA 1O39A 1Z7KA 2JH5D 3F0PA 2OQ5A 2F3CE 2KR7A 1GVLA 2VVCA 3QDZB 2KAIB 3TK5A 5DSFA 4U01A 4OS1A 3C27B 1C2MA 4I8JA 3LOXA 2KX4A 1WUNH 1C5TA 1T4UH 3KIDU 3BG4B 3SU0A 2PGQB 2XXLA 3GY3A 1F5KU 3SHCH 2YOLA 1QBNA 1DE7H 4H6SB 1C1NA 1C5UA 2B7DH 2XRCA 3LPRA 4O97A 1O36A 4TWWA 5GCHF 3SGQE 1EFRD 1F0RA 2AGIX 1TGTA 4ZAEA 4YT7H 5L6NH 2PSYA 4XFQA 3LGUA 1YF4A 1SQOA 1G9IE 2ZU3A 2WPIS 4ESTE 2A5KA 1O3DA 3VG8A 1Z1IA 4CH2B 4XBBA 4OM9A 2I6QA 1V2ST 2GX4A 3ZZAA 1ZR0A 2XC5A 1GBKA 2J38A 2OINA 3NK8A 1BB0B 5GNDA 1O3PB 2XW9A 1SOZA 2QXJA 2GZ8A 4K2YA 1A61H 1A0JA 2QYIA 3LGVA 1NBMD 1KXEA 1O2KA 1UO6A 1WCZA 2TGTA 2BTCE 4K60A 2UWLA 2A7CA 2QF3A 4NWLA 2O9QA 1ZSJA 3H7OA 5T6GA 1QY6A 5I46H 2ASUB 2CHAB 3Q00A 1HAIH 4I7YH 2TBSA 3A80A 2D26C 2P3FH 4AYVB 3GCTF 1GI1A 1MTNC 1JMOH 1SGQE 1ZHMA 5JB8S 1D4PB 3KEEA 2Z3EA 3K9XB 2V35A 3DFJA 2ZPSA 3HK6B 4ABIA 2KCYA 3T26A 2WV9A 4UD9H 5C94A 2Y5FA 1T8NA 1YPHC 2HALA 1SGTA 1TNGA 5IDKA 2CF9H 2ZDLA 5DP3A 1V3XA 1C5VA 2RDLA 1ZGVA 1KXFA 5EXMA 2AMQA 4UDWH 1E38B 3SNBA 1OP0A 3EQ0H 1O5EH 1EXFA 2J4IA 2R3YA 3OEED 1W8BH 2GDEH 5ESTE 3DA9B 2ZU2A 1CU1A 3S9AA 3SW2B 4P00A 1BITA 2D2DA 4ZXYH 1WDIA 1BTPA 2BD3A 3RXVA 1CA0C 3E6PH 3KCGH 3SU6A 1AE8H 4LZ4B 4J1YA 2A45B 1B0EA 1C4U2 2PKSC 3U9AH 1O2PA 3SU3A 1KLIH 1TIOA 3ZVCA 3TGJE 1LPKB 1O3JA 5C0UA 1OWHA 1SFQB 3A7YA 2QXIA 2GCTC 4R8TB 3SGAE 3CNRA 4OGYA 1NFWA 3AVZA 5HIYA 3RU4T 3UOPA 1YPHE 4CHAB 4D7FA 3A7ZA 1YLNA 1NU9A 4AFQA 2ZGJA 1H8IH 2F43B 3VFEA 1GBIA 3RC5A 6GCHF 2ZI2H 2Y80A 3NKKA 1CHOG 1V2NT 6CHAC 2BXTH 1UCYH 1BUIA 4ZHMU 1UTPA 4RKJB 1BRUP 3UB0A 1ELFA 1RTFB 3A86A 1KXDA 2JDID 2PWXA 1FZZA 1GCDA 2FOBA 1PQ8A 1S82A 2AGEX 1EOJA 1SC8U 2W6JD 3M35A 1L0ZA 4MNXA 1BQYA 2BM2A 1W13U 1SB1H 1HUTH 1LHEH 2WHXA 4DJZB 1W0ZU 1HFDA 2C93B 1LVYA 1YP9A 1Y5AT 1WU1A 1CGIE 4K1EA 1DSTA 4K3JA 1NBME 1VCWA 3A7WA 3SGBE 3SQHE 1G3BA 2HRVA 1O5GH 4MQAA 3AW1A 2BD5A 2J97A 3GOVB 1EAXA 4LZ1H 5HXFA 5A0AE 1F5RA 4GUXA 2WPLS 1N8OC 5KECA 1QBVH 3D62A 1W7XH 1V2JT 3DSGA 1F2SE 1CA0B 1CGHA 2ANYA 2DE9A 4HZHA 4MPVA 4X6NA 2GZ7A 4MPXA 2XBYA 2ZECA 5DKMA 1DDJA 1THPB 1GMDF 1HXEH 1HAYB 2AYWA 3UR9A 3P17H 1NM6A 1N6YA 3UQVA 1EJNA 3VB6A 3ZIAD 1SOTA 2UUFB 4XD7D 2EC9H 1FPHH 1YCPK 2BY7X 5PTPA 2XCNA 1N6XA 2BD7A 2FX4A 1C2JA 4AGJA 4DIIH 2Z6BD 3QLPH 1Q3XA 2BDGA 4RKOB 4ABAA 1KXAA 4ZKSU 2HVYB 3SV8A 3HGPA 1ZTJA 2R0LA 1WQVH 2SGQE 5IYTA 1Q31A 2XBWA 4K1TA 2A2XH 2XC0A 3QWCH 3MU1A 6CHAB 5C5OA 3UTUH 3SV9A 1PPCE 4RSPA 1QGFA 3K2UA 1SGFG 2FYQA 4FETA 2ZF0H 2HLCA 5L2ZH 2J34A 3QN7A 1EAIA 1OSSA 1O3AA 3GY4A 4JYVH 1HXFH 3SU1A 3P70B 2CV3A 1HAOH 2BOHB 3OEHD 3CP7A 2OCVB 4XBCA 2VJ1A 4OS2A 2IPHA 3A83A 3ZZ3A 1C2HA 1P57B 1C1MA 1HCGA 1N8OB 1WXRA 2QIQA 2XC4A 1ANCA 4O03A 4A1VA 3RXSA 3ITIA 1O2MA 2YNBA 1TQ7B 4NFEA 3TU7H 3DFLA 1C5WB 2BLVA 2VIQA 1A1RA 1TFXA 3DSOA 5GXPA 1C1QA 5J4SA 4SGAE 2G51A 1UTKA 4Q63A 5CMXH 1RXPA 4Z1MD 2ZHWH 1O2YA 5F53A 4DVAU 2YMSD 1MU8B 4ABGA 1BIOA 1F7ZA 1AD8H 2F9VA 1NROH 3ZZ5A 3E91A 3A82A 2ZA5A 1C1PA 3TIUA 3MYWA 3QGJA 1NS3A 1TABE 1PPEE 1SLUB 5AFZH 1TPPA 5AF9H 4X0WU 1AFEH 5BPEA 3RXBA 1FONA 1QRXA 3QGNB 5LPEA 1WTGH 2W7SA 1EJMA 3AASA 4F55A 1C5PA 1TX6A 5F8TA 2G8TA 1KLJH 5DN6D 3RC6A 1O2ZA 3CENA 4NA9H 1O33A 3RXPA 4MTBA 4DURA 1CT4E 1GHAF 1E37B 4Y10E 2Z9KA 2GV7A 5DG6A 3KYFA 3MTYA 1Q2WA 1DPOA 3C1KA 1DWDH 1QL9A 1QQ4A 1LKBA 2W3IA 2ZGCA 4AORA 1CT2E 4UE7H 2ZNKH 1GHWH 2Z94A 1WYKA 1QB6A 3PWBA 2J2UA 4I32A 5DP7A 1JOUB 4A6LA 2RFKC 4Q7YA 1AKSA 3E0PB 3FVFB 1BHXB 3W1EA 3MH5A 3BF6H 1O2HA 2WZQA 5GDSH 3TNSA 2ZFRH 1UTOA 1ETTH 1C2GA 7ESTE 2PW8H 3TK9A 4HI3A 3FOAA 3KL6A 4YESB 1BBRH 1P3CA 2G81E 1J8AA 4KP0A 1FY1A 1W0YH 4E7NA 4ZKNU 1SHHB 2PTCE 1V2RT 2SGEE 2W7UA 3QK1A 1GPZA 5C1YA 2NU2E 1CVWH 3M37A 3SNAA 5AHGH 1VJAU 1IQLA 1RRKA 2R2MB 1G32B 4XOJA 1GI5A 5DP4A 1JBUH 3SOSA 3V12A 1LHFH 3ATIA 1ZPZA 1XM1A 1GBTA 1SR5C 2XNDD 3NXPA 5ESBA 3VXFH 1GG6C 3F6UH 2F9BH 3ZZDA 3PO1C 8GCHG 1O2VA 3ZYEA 3EDXB 3Q77A 4XRNA 4UONA 1BTHH 3PYHA 2B0FA 4GAWA 1TALA 3GYLB 3A7TA 4MVNA 1ELVA 4ZKRU 3PMBB 3SNDA 5LH8A 1QJ1B 5DO4H 1UK4A 3PLPA 2Z9LA 1N1LA 3ZV8A 1TGSZ 1FMGA 2WPHS 9ESTA 1P9UA 2ZGBH 4GHQA 3F3BA 5CHAC 1BMAA 1VR1H 2OC8A 1W0JD 4O9VA 2M2AA 4RN6A 3UIRA 1P05A 4J2YB 3A88A 1ZRBA 1P03A 1FAKH 3SU4A 5K7RA 3GDVA 3SV2H 1L4DA 1OPHB 2Q1JA 4X8TH 1V6DA 5ETXA 1VZQH 2VGCC 1X7AC 2R9PA 3TJVA 2ZIQH 3OY5U 1NZQH 5EQQA 1OHHD 2TRMA 4YO9A 4WMEA 4X1SU 2BD8A 5L30H 1G3EA 5EJZA 4WMDA 1C2FA 1FY4A 1HAVB 4DW2U 2ANMH 2GMTC 2FXRA 5DP6A 4Y11E 1TNLA 1C1VH 1K1JA 1HAGE 4Y0ZE 5C20A 4LXBH 2A1DB 1WV7H 5HMAA 3BTKE 3PROA 4FOUC 4NZQA 3ZZ6A 1UJ1A 1O2UA 2B9LA 1KTSB 1VJ9U 1QTFA 3SO3A 1ESAA 4B2CA 1P3EA 1BTWA 5H4IB 1HAZB 3TH2H 4AYYB 2HPPH 3LGWA 2A7JA 1MABB 3RDZA 3RP2A 4Z6AH 3R0FA 3LJJA 3A8CA 2FEQH 4YLQH 1NN6A 3WWBA 4WMFA 1PQ7A 1OKXA 3JZ2B 1ORFA 1ZPCA 3KGPA 1GG6B 4CH8B 3PO1B 2QA9E 1BCUH 1H1BA 1MD8A 4HTCH 3KN2A 1XUJA 2ZCHP 4TSFD 2GCHF 4AGKA 2AMPA 2UUJB 1PQ5A 1QRWA 2OC1A 2PUXB 5L2YH 3QO6A 3PV4A 4Y8ZA 1GVZA 1ID5H 3MNSA 1GWAA 3BEFB 2F9PA 1OYTH 5EXNA 5A2MH 2AERH 1SSXA 1BRCE 3TNTA 4SGBE 3F2GA 3V3MA 2HNTF 1HDTH 4Y0YE 3BTHE 4GVUA 3MNXA 4F48B 1H8DH 1C2IA 3SJ8A 2JJ2D 1BMFD 1NTPA 2RG3A 1B0FA 3MO6A 1ZJKA 4MLFB 1P2QA 1NPMA 3NUMA 2C90B 2G4TA 3RMNH 2HOBA 2KCAA 1FDPA 3MH4A 4BXSA 4CR5A 1TGNA 1Z8GA 4E05H 3WW7A 3L33A 2AHME 4IGDA 3ATWA 5HM2A 3D65E 1BMNH 1C1WH 3SJ9A 3HPTB 4GLYA 1O2SA 1HIAA 1DFPA 5K0HA 3UWJH 4FU8A 2SGDE 1K1LA 1WBGB 2WV5A 4B71A 3BTME 1THRH 1QB1A 4OS6A 1T32A 4JZIA 3UNQA 4AX9H 3P6ZB 2ZG0H 2CK3D 2BLQA 1DSUA 1TE0A 1LHCH 3SQEE 1ZMJA 1EZXC 2H2ZA 3KQ5A 1A2CH 3SN8A 1RIWC 4AZ2B 3H5CB 3EA7A 1ABJH 1DWCH 1SMFE 2PR3A 2XOKD 2OQUA 3ATKA 1FX0B 2ZDVH 1O3EA 2AFQB 3FP7E 3SBKA 1SI5H 3AAUA 1ETRH 3MQKC 4A1TA 3BSQA 2P93A 4ABDA 2FOEA 2FIRH 3I78A 5EG4A 2RA0A 1C5OH 2A5AA 4MPUA 3KQCA 2QY0B 1C1RA 3CS7A 2BZAA 7GCHF 1E1QD 2WUBA 2OTVA 3OX7U 3ATMA 4X1NU 1PPBH 1YPEH 4H42U 4RI0A 1PYTD 4B6EA 4THNH 2BDAA 2ZP0H 2OK5A 1QRZA 2VIDA 3SJIA 1TNJA 5EJ1A 1COWD 1GMHG 1P12E 4I8HA 3BTWE 4HFPB 3UNRA 1O35A 2YNAA 4Y7AA 4DCDA 1V2KT 2JETB 4MG3A 1T8LA 1IQIA 1M9UA 2W5EA 3RMLH 3ZVGA 1WOFA 1SLWB 1BA8B 3SV7A 1ESTA 3SUEA 1YCPH 4NCYA 1AE5A 3M3SA 1LTOA 1NO9H 3Q3YA 3AW0A 3F9HA 4INLA 2A4GA 1AO5A 3TJOA 2OC7A 3UOUA 1XKBC 2XBXA 4X6PA 4DG4A 2V3HH 4CHAC 4ISNA 3BTQE 3LGIA 5FBEA 4NA8A 2CN0H 1EAWA 1C5QA 1O3NA 1HAXB 1OOKB 4FUIA 4FVBA 3KQEA 3H7TA 1TBRH 1KLTA 3AK5A 1O34A 2UUKB 1AZ8A 3O8BA 3UWIA 1K28D 1RIWB 1XXFA 4NIWA 1IHTH 2J5UA 1MZDA 1CA8B 1EB1H 1UVUH 3N7EA 1RS0A 4UFFH 5EOKA 2C3SA 1GBLA 2OBOA 3T27A 1C5MD 4FUFA 2KZ4A 4JK6A 3MH7A 3UPEA 3HKIB 2HLDD 4GCHF 1PYTC 3MU8A 5F03A 1A5HA 3I29A 5T6DA 4WXIA 1EPTA 1S85A 3RLWH 3RUOA 1G30B 3O8DA 3OAAD 1GI2A 1S6LA 4WVPE 1HJAC 1GHYH 1P8VC 1QJ7B 3ZVFA 1SQTA 4IMZA 3ZZ9A 3UQOA 3LKWA 3A8BA 1DLEA 2J94A 1GMCG 2P8OC 4YOJA 3P8NA 3SORA 1E36B 3MU5A 2ZHEH 5F8ZA 1UK2A 2G5VA 2FOGA 2TGAA 1UHBA 2OUAA 4NZLA 5FX5A 2VWOA 3E8LA 4BXWA 2TPIZ 2ZHDA 1GGDC 3GDSA 1BTXA 1VCPA 1H9HE 2ZHQH 1Y59T 4U32A 2UUYA 3A81A 1BJUA 3K6YA 1GHZA 1AUJA 4GSOA 1FIWA 2P95A 2P59A 4BANB 1W0KD 4D8NA 1LKAA 4AB9A 1O5CB 1GHVH 1K22H 4RT0A 2K1QA 5DPAA 3VXEH 4JZEH 2TIOA 1D3PB 2A4QA 1RTLA 3BEUA 1RTKA 4INKA 4KKDA 2UWPA 2PKAB 4NWKA 1QBOA 4FUGA 5JBTA 2BY6X 1AZZA 1VITF 2CJIA 2ZFPH 2EA3A 3F0OA 1G3DA 2ZDAH 1TPSA 1AIXH 2QV1A 3LDXH 3UY9A 1E35B 1O32A 4M9FA 1DY9A 2R2WU 1UTNA 2F4LA 5EQRA 1TX8A 1GHBG 1QURH 4YTAA 2ZTXA 1YBWA 2TGDA 4BAHB 1MKXK 3ODFA 1FQ3A 1C5LH 4JZDH 1UTQA 1CO7E 4O3TA 1HJAB 3DT0H 1EB2A 1SKYE 2ZFSA 3H09A 2BHGA 2WPMS 3MO3A 3PM3A 4UFEH 4Y8XA 4YOIA 3U28C 1BMLA 1GDQA 4CBNA 4GHTA 2P8OB 1F0SA 2KCPA 5GJ4B 4K5ZA 1OWKA 2RA3A 1S81A 1P2IA 3GY7A 1KMHB 3VGCC 1NRNH 4X2YA 5BRRE 1A0HB 3TPIZ 1DS2E 3EGKH 2ZHFH 1G3CA 2ODPA 3S7HB 1C5YB 1U6QA 3ZVBA 1YC0A 1GGDB 2J98B 3STIA 3MO9A 4NA7A 3RMMH 2EQNA 2J95A 1LVOA 1GDUA 1YGCH 1Z8IB 5TCAA 1O30A 4FUCA 3HATH 1GJBB 1IAUA 4TPYA 2R0KA 4ZCNA 5F6MA 5KEDA 4IBLH 3MHWU 3VB5A 2V6NA 3MU4A 3UAIC 3PMJA 1T8MA 1D3DB 1GL0E 1F0UA 2Q6DA 4AOQA 1AHTH 3M61U 4ABJA 1PQAA 5JDUB 3T62A 1OXGA 3ZV9A 1J14A 3S0NA 1ZSLA 1EP5A 5FAHA 4U2WA 1JWTA 1NU7B 3T2NA 3LC3A 4P02A 1DUAA 1O2TA 5EJLA 3ZVEA 4B75A 2EI8A 4CRDA 3E90B 3PV5A 1LMWB 1KDQB 1V2MT 2AMDA 1P2OA 2Z7FE 4ACBA 2O8UA 2ZFFH 1HJ8A 4DGJA 1AWHB 1O5AB 1OS8A 3PRDA 3ZVDA 2Y6TA 2EI6A 3JZ1B 1L1GA 3T29A 1W3CA 1NRQH 2AIQA 3MWIU 2GCHG 2BMGB 2BDIA 1MAXA 1TOMH 1L1NA 1MTUA 2Z3DA 3VEQB 3GICB 1S0QA 4ABFA 1AB9C 5C67A 1YWUA 1SBWA 3VGCB 1A4WH 1SGDE 1ELTA 1LVMA 1O3HA 5SGAE 4X1QU 5CE1A 1EX3A 4F49A 3FFGA 4UEHH 3B9FH 2R3UA 3P8FA 3RU4D 3DCLA 1GI8B 5EGMA 3ZZ8A 2ZGXH 2BYAX 3UUZA 3KNXA 2KAIA 1XUFA 5DP5A 5E2PA 3F1SB 1SHYA 2TGPZ 1UTLM 5E8EH 3W95A 1Z8RA 3TK6A 3SYJA 2VVVA 1JIMA 5JPMH 5KGOA 4BAQB 3M5OA 1QNJA 2BY5X 2FDAA 1P2JA 2ZFTA 4D9QA 1G2LA 1ETSH 1V2VT 1A3EH 1O3IA 1JRTA 2QCYA 3FKSD 3G01A 1T7CA 2ZPQA 3GYMA 3SI4H 5JBAS 3TH4H 4WH6A 4FU7A 4I33A 1JXPA 2H9TH 2VWLA 3SJKA 1GVKB 2O8WA 3KQBA 1BOQA 3RXKA 1E79D 1O3OA 1DANH 1QCPA 2BQ6B 1LPZB 2G55A 2KFWA 3PRBA 4PROA 5AVDA 1QFKH 1IQKA 1FV9A 4B6FA 4ISHH 2Y5GA 2C8ZB 1E34B 1GJ6A 1UTJA 3A85A 4ZMAH 3V7TA 1MBQA 1SGFA 3ENSB 5FPSA 4I86A 1MTWA 1GBHA 1C4V2 4IN2A 3MNCA 4IN1A 4BAKB 1ABIH 3PWCA 1PPHE 1O3CA 5A0CA 4ZHLU 1HBTH 3P92A 5CHBA 2GKVE 3RLYH 2K8IA 1P09A 1YPGH 1MCTA 1W12U 3LH3A 1KIGH 3PB1E 4WF8A 5EIYA 4NIYA 1A3BH 3A8AA 1PFXC 3M7TA 3D23A 1AB9B 1CT0E 4H6TA 4Y7BA 1JIRA 1PPZA 2FOFA 1TX7A 4KGAA 1TPOA 1OP2A 3P8OA 2W26A 3HK3B 4NG9H 3EYDA 3L3TA 3S69A 1B5GH 4DT4A 5B6LA 4KELA 1MTVA 5FPTA 5GCHG 4X2WA 1BTZA 8LPRA 5I25A 1XX9A 3OSYA 1CHOF 3QTVH 2WUCA 2P3TB 4B2BA 4KTCA 4X8UH 1LPGB 2O8TA 2ODYB 1QL8A 3MU0A 1PPGE 2F83A 3PMAB 1XVMA 1NESE 1UW7A 3FAOA 2NU0E 2ZCKP 3VB7A 1BRAA 4BTIB 2EI7A 1AVWA 3A8DA 1ZSKA 4LOYH 1EASA 2BDYA 4I8GA 5T3HA 3BTFE 3FP8E 3RXEA 3RXAA 3RU4E 2BDBA 1BTYA 4AC9A 1MQ6A 1QB9A 3I77A 2B8OH 3SUFA 3DD2H 5C1XA 3O8CA 4X2VA 1ELGA 1W7GH 3GCTG 2OP9A 3SUDA 1HYLA 4YT6H 2LNCA 3GY5A 1AU8A 3OU0A 1E1RD 5DP9A 3QTOH 3PLKA 1TMBH 3LC5A 3A7VA 1D3TB 2VVUA 1SGPE 2RCEA 5E0HA 3VB4A 1SFIA 4Q80A 2FZZA 3O8RA 1WQSA 1MTSA 8ESTE 1O3KA 2CGAA 3M3TA 1ZYOA 1XUGA 1ZMNA 1FPCH 4Q4LA 1HB0B 1O5DH 2SNVA 2ANKH 3FO8D 3SZNA 1THSH 4FXGH 4Q7ZA 1FN8A 3GY6A 4JYUH 1LHGH 2VIWA 1C9PA 1LVBA 1ZOMA 3TGKE 3MNBA 1A5GH 1IOEA 2VNTA 1GBBA 4WH8A 1YLCA 3TGIE 2OC0A 5T1VA 3RXFA 1UVSH 3TJUA 1QA7A 1PJPA 1GJ9B 1GJCB 2THFB 1KYNA 3OY6U 2WPDD 1ELCA 1O3BA 1IQNA 4DY7B 1ARBA 3L6PA 2PHBA 1TA2A 1LQEA 1ZTLA 1GCTC 2HVXA 4CRBA 1EKBB 1D6WA 1C2EA 3F68H 1QHRB 2C4FH 2NU3E 1C5RA 5LPFA 3MI4A 1YLDA 3T25A 1FXYA 2BLWA 2FOMB 3M7UA 4ISIH 1YY3A 3BEIB 1YM0A 1ZHPA 2D8WA 2W6ID 2FWWA 1TBQH 2QF0A 3FANA 5DJ7A 1TLDA 3FN8A 2H9EH 3GY8A 3IG6B 1Y3XA 4JMYA 4GPGA 3QX5H 1DICA 3KHVA 5EPYA 6GCHG 2JIZD 3U8TH 4FUBA 1VKYA 4K8YA 1EUFA 4ZUHA 1FJSA 3KQDA 1IQGA 4JZFH 4AFSA 2Y7ZA 4JK5A 5DP8A 1J17T 5LGOA 4YOGA 1RD3B 1NRRH 3F9FA 1HLTH 1P10A 2JETC 3RXMA 1IHSH 1H8ED 2IN2A 2Y5HA 1GBFA 1V2WT 1GI0A 3N99A 1J9CH 1MD7A 2QGRA 1HAPH 2BVRH 4LK4A 4TY7A 4JYTA 2ZDKA 3U98H 7KMEH 2VIOA 2ILNA 3S7KB 4NIXA 2WV4A 3UR6A 4OS4A 4FUJA 1V2TT 1K21H 1UVPA 1GHXH 1XMNB 5C1UA 2OLGA 5JB9S 2SGPE 3BTGE 2BZ6H 2GDDA 3MMGA 5HM9A 2WYGA 2IJOB 1GI9B 2FLRH 5J4QA 1YPKH 2XWBI 1AY6H 2SGAA 2Z3CA 1MU6B 1GMDG 2ZZUH 1SGCA 1SPJA 1GCTB 3ESTA 2Z9GA 1O5FH 2XWAA 1T31A 2VH6A 2ZTYA 3GCOA 1YYY1 1O2OA 4KTSA 3OTPA 4I8LA 4TY6A 1IQMA 3U1IB 5EW1H 5EODA 1FY5A 2J9NA 3RXRA 1FIZA 2BD2A 4ASHA 1GBMA 3OYPA 2NWNA 3LJOA 5B6OA 2FOAA 1GJ7B 2A0QB 2CMYA 3SNEA 1F5LA 1FAXA 2BD9A 2STBE 3FZZA 2HNTC 2ALVA 3FP6E 1MKXH 2P16A 1L2EA 2HWLB 5FCKA 3LH1A 1YPLH 1ZJDA 6LPRA 1TNHA 2PP6A 1DY8A 4Q7XA 2FP7B 3RM2H 3BIUH 2F9UA 1SGEE 3F2FA 4Y8YA 4XSKU 3RXTA 1S6HA 2G5NA 3NPSA 4BTUB 3URCA 1TRMA 4E7RG 5FBIA 2ANWA 4DT7B 2C8XB 1PPFE 4H4FA 4BTTB 4WY3A 1P04A 1TYNA 1MBMA 3IITA 2QF4A 1DWEH 8KME2 1GJAB 1SLXB 1XUHA 2DUCA 4TYDA 1BDAA 2ZU4A 1A7SA 3BTTE 3S9BA 4JZ1A 1SQAA 1O2XA 2CF8H 2XCFA 3E3TA 3F2HA 5F8XA 4ZHAA 4MPWA 3QZRA 5HYOA 2IPQX 2Y82A 5EPNA 1AWFH 1MCVA 8GCHF 1TNKA 2ODQA 3RMOH 2J92A 2SFAA 2HNTE 3ATLA 3DSPA 1C5ZB 2A4RA 1FY3A 4ABHA 4A1XA 1FN6A 1AKSB 7LPRA 3KF2A 2I6SA 3ZZBA 1MMJN 1G37A 3BTDE 1VCQA 2BB4A 4MDSA 1UVOA 1RJXB 2L6OA 1OWDA 5E0GA 2H9HA 4B76A 2Y7XA 2ESTE 1H8HD 1ARCA 9LPRA 4ZH8A 1P06A 1NFYA 1AFQC 4ISLA 1AUTC 5GWZA 3VPKA 1LCYA 2AH4X 2ZEBA 3GCHC 5HGGA 1IQFA 1S0RA 4Y71A 1O5BB 1TAWA 1SG8B 5CDFE 2EY4C 2G4UA 1O3FA 3RXGA 1LHDH 2RDEA 2A5IA 3FZDA 3EE0B 1ANBA 3TVJB 5IK2D 5DGJA 3QUMP 2Q6FA 2PGBB 3N7DA 4X1PU 3LONA 2FPZA 1OWIA 1A0LA 1DWBH 1GHAG 4TWYA 2F91A 1MKWK 4K8BA 1SQRA 1K2I1 4D7GA 2QF5A 3ODDA 3BTEE 4ABBA 1EZUC 1G2MA 2GP9B 1P11E 3EA8A 2FS8A 3A89A 2C8YB 4A92A 1GL1A 4XE4A 1OX1A 3LGYA 2GT7A 1DOJA 1AN1E 1OWEA 2PTNA 2JKHA 1IQJA 1Y5UT 3Q3KA 2WYJA 1CHGA 1BJVA 5A8ZA 2A7HA 3RXIA 1NFXA 1Y3VA 3TLOA 1ZTKA 1HV7A 4AFUA 2CXVA 4KTUA 1H9LB 2ZC9H 2V3MA 1Z71A 3STJA 2XTTB 4Z0KA 3MFJA 5EXLA 2O8MA 4NGAH 1O3LA 4ISOA 4CRFA 2SGFE 3IWMA 3U69H 4Y76A 1QL7A 1YCPM 4NFFA 1ESBA 1QQUA 4DIHH 1HAVA 3DHKH 1S5SA 1DITH 4TPIZ 4NSYA 1ELEE 1RFNA 1W14U 1TPAE 1TOCB 4CBOA 1MTNB 1O2WA 1AFQB 2Z9JA 2BQ7B 3ZVAA 2ZQ2A 1D6RA 1GBCA 1SL3A 2P3UB 3GCHB 2FS9A 3RXUA 4IC5A 4X2XA 4ZXXH 3KYGA 3MH6A 3E1XB 5TCCA 4YZUA 1ZRKA 1GI6A 1XVOA 2G00A 3NZIA 2A32A 4K69A 2BVSH 4RT1A 3M36A 1UMAH 3P8GA 1P2NA 2WPKS 5JBBS 1EQ9A 3A7XA 5A8XA 4OGXA 1O3GA 2ZPRA 1T8OA 4YM9A 3RC4A 3M7QA 2SNWA 2ZU5A 3SU5A 1S83A 2BOKA 4BNRA 2FI3E 1BHXF 1J16A 1ZZZA 1HNEE 5HIZA 1GBEA 3T28A 1C1UH 2W3KA 1VGCC 1Y5BT 1O31A 4X8VH 2PKSB 1P2MA 1K9OE 5AFYH 2FI5E 4NIVA 2VU8E 2FMJA 2OXSA 5DK1A 1K1MA 2GCTB 1UCYE 1NY22 4FUDA 2VBCA 1L1JA 1VITH 1DT2A 4ASUD 1MUEB 1BZXE 4CRGA 2NU4E 1AMHA 1DX5M 1SGNE 1CGJE 1DM4B 1GI7B 2GGVB 4NSVA 2ZDNA 5LPRA 1Z8JB 3TH3H 1CBWC 1C2LA 2FX6A 1DVAH 3LU9B 4WWYA 1GI4A 2ZFQH 3TITA 1HIAB 1TGCA 3SV6A 5C5NA 2PSXA 1NRPH 1UTMA 1C5NH 1JRSA 1GMHF 1GDNA 4K1SA 3SI3H 1Y3WA 4IC6A 2Q6GA 2P94A 4I31A 1HJ9A 4VGCC 3HGNA 4UFGH 4AB8A 4FUEA 4B2AA 1W11U 4TT3D 4YXWD 1WAYB 2LELA 1BMMH 5A0BA 2ZKSA 1KY9A 1K1OA 1TRYA 3SU2A 1G36A 3RXJA 4BAOB 1A46H 5EU8A 2AEIH 2V0BA 1B7XB 3RM0H 1O38A 2QN5T 1CE5A 2IJD1 2GZ9A 4FVDA 3A84A 4OS7A 1C5SA 3VB3A 5FPYA 2H5CA 1O2QA 1O0DH 3K6ZA 3RXCA 2LP6A 1DUEA 4U30A 5C2ZA 3UREA 1C1TA 1ZMLA 5E2OA 2BY9X 1WSSH 3A87A 3PV2A 2VWNA 4CREA 1VGCB 1ZPBA 2HGTH 1EPTC 1O2JA 1UVTH 1GJ5H 1CQQA 3SHAH 3RXLA 1TNIA 1K1PA 5FHTA 2XYAA 2GD4B 2BQWB 5FCRA 2A4OA 5GIBA 2BY8X 1O3MA 4R0IA 1OWJA 2KM0A 1Z6EA 2GT8A 3E16B 4AG1A 2FOHA 1EJAA 1DXWA 2C8WB 1K1IA 2STAE 4B1TA 1CBWB 1EATA 1WTHD 2Z9IA 3F9GA 4D9RA 4AG2A 2WINI 4BAMB 3E0NB 1GJ8B 5A09A 1V2QT 3ZZ7A 1KXBA 1NC6A 3RXDA 3N7OA 1GMCF 1UCYK 1XUKA 1SGIB 3SUGA 3R3GB 2ZWLH 1FLEE 4B73A 3OTJE 1E0FD 4VGCB 5G4BA 1O37A 2IOTA 2FESH 1QA0A 3RXQA 1GBAA 1TGBA 5ABWA 1SLVB 1H4WA 3WWFA 3PTNA 1NT1A 2XNIA 3SJOA 2A2QH 7GCHG 1DXPA 1LDTT 3PMHB 1V2LT 3ZZ4A 2FYRA
chains in the Genus database with same CATH topology
1SVPA 3PTBA 1RGQA 1YPJH 4I8KA 1TWXB 2BX4A 2VIPA 1OYQA 1BTUA 4ABEA 3MOCA 2VWMA 1GBDA 1YPMH 4IS5A 4UFDH 2H6MA 2BX3A 3V0XA 1EPTB 4XBDA 2F9OA 4OS5A 1C4Y2 3NCLA 2ZO3H 3V13A 3BG8A 1H9IE 1MAYA 1ANDA 3EA9A 1P01A 4YLUA 1ACBE 4D76A 1HPGA 1K1NA 2JH0D 2BXUH 1AI8H 1W10U 3M5MA 3NWUA 2BLOA 2FLBH 3GDUA 1GHBF 1TMUH 4E06H 1ANEA 5TJXA 4Y79A 1O2LA 1UHBB 1KTTB 3Q3XA 1Z6JH 4A7IB 3ZZCA 3M3VA 4Q2KA 2FO9A 2JH6D 1GI3A 3ELAH 3LGTA 1L4ZA 1YKTA 1TRNA 2D1JA 2ULLA 3GISB 3GY2A 3LIWA 5JBCS 1T4VH 1EOLA 3BV9B 3LT3A 1TQ0B 1ZGIA 3D49H 2BVXH 1S6FA 1LO6A 2G52A 1O2NA 1BBRE 1XXDA 3B8JA 4Y6DA 3QZQA 2GTBA 2ZQ1A 3M5LA 4FU9A 4GCHG 3RXOA 1S84A 4AN7A 4HGCA 1D9IA 2M5TA 3BN9A 4WJG2 1P0SH 3URDA 4MNWA 1A5IA 3DUXH 4F4OC 1V2PT 1ZLRA 5FX6A 2PKAA 1TBZH 1HAHH 1EAUA 5T6FA 1TMTH 5A8YA 1AGJA 2F9NA 1TB6H 1DLKB 2QC2A 1AVGH 3B23B 2FTMA 5FXLA 1C9TA 2QXGA 1GJDB 2NU1E 1O2IA 2FODA 5GPIB 4X8SH 3K65B 3HKJB 4DOQA 5E0JA 2AIPA 1NRSH 2VINA 4IMQA 3SNCA 2ZU1A 2AS9A 1XUIA 1LQDB 2ZDMA 2ZTZA 5EW2H 4X1RU 1BT7A 4CRAA 4CRCA 3TJNA 1F92A 1KSNA 1Z1JA 4A5TS 3T5FH 3U8RH 1P2KA 1C1SA 2FTLE 3ZYDA 2FOCA 1INCA 4INHA 4O3UA 3EAJA 4CR9A 1QJ6B 3UFAA 2BDCA 1O2RA 1W2KH 3Q76A 4BOHA 5JYIA 1IQEA 2VIVA 2PLXA 1FUJA 1C5XB 1EZQA 2Y81A 2HPQH 4ZKOU 1TA6A 1QR3E 1CSOE 4IW4E 1QIXB 1Y3UA 4MNYA 2A31A 2PV9B 2QAAA 3M5NA 1FY8E 3S9CA 3GCNA 1VITG 1MKWH 5CHAB 4MNVA 1EP6A 3BIVH 1D3QB 1GJ4H 2DE8A 1C2KA 3BG4C 2BD4A 1UK3A 1Y3YA 3PLBA 1O2GH 1SGRE 1ELBA 2QXHA 2XBVA 2UWOA 2ALPA 5EQSA 1MQ5A 1V2OT 3AAVA 3WY8A 3F9EA 2BDHA 2FM2A 1HRTH 2VGCB 3UNSA 4WXVA 1C2DA 3RXHA 1TONA 4B74A 1ZHRA 2GVFA 1IQHA 1AVXA 1XKAC 4FUHA 1J15A 2GV6A 3W94A 1FNIA 1ELAA 2GMTB 1V2UT 2PFEA 1BRBE 1KXCA 1AQ7A 2ZCLP 1EZSC 3U8OH 1KDQA 1BBRK 3CS0A 2VH0A 1P02A 4ZROA 4JCNA 2EEKA 1HGTH 2AGGX 1ELDE 1GBJA 1FI8A 2O8LA 1MH0A 2H1UA 2ZGHA 4X6OA 2PUQH 3P95A 2H5DA 2VB0A 1NFUA 4XDEA 3U1JB 4AFZA 2CHAC 1P9SA 1C1OA 2OD3B 2V3OH 6ESTA 2B5TB 4M7GA 4QT8C 2WPJS 5C3NA 1SGYE 1Y8TA 2LPRA 2FI4E 1F0TA 1OP8A 1MZAA 2OBQA 4X6MA 1O39A 1Z7KA 2JH5D 2OQ5A 2F3CE 3QDZB 1GVLA 2VVCA 3TK5A 2KAIB 4U01A 4OS1A 3C27B 1C2MA 4I8JA 3LOXA 1WUNH 1C5TA 1T4UH 3KIDU 3BG4B 3SU0A 2PGQB 2XXLA 3GY3A 1F5KU 3SHCH 2YOLA 1QBNA 1DE7H 4H6SB 1C1NA 1C5UA 2B7DH 2XRCA 3LPRA 4O97A 1O36A 4TWWA 5GCHF 3SGQE 1F0RA 2AGIX 1TGTA 4ZAEA 4YT7H 5L6NH 2PSYA 4XFQA 3LGUA 1YF4A 1SQOA 1G9IE 2ZU3A 2WPIS 4ESTE 2A5KA 1O3DA 1Z1IA 4CH2B 4XBBA 2I6QA 1V2ST 2GX4A 3ZZAA 1ZR0A 2XC5A 1GBKA 2J38A 2OINA 3NK8A 1BB0B 1O3PB 2XW9A 1SOZA 2QXJA 2GZ8A 4K2YA 1A61H 1A0JA 2QYIA 3LGVA 1KXEA 1O2KA 1UO6A 1WCZA 2TGTA 2BTCE 4K60A 2UWLA 2A7CA 2QF3A 4NWLA 2O9QA 1ZSJA 3H7OA 5T6GA 1QY6A 5I46H 2ASUB 2CHAB 3Q00A 1HAIH 4I7YH 2TBSA 3A80A 2D26C 2P3FH 4AYVB 3GCTF 1GI1A 1MTNC 1JMOH 1SGQE 1ZHMA 5JB8S 1D4PB 3KEEA 2Z3EA 3K9XB 2V35A 3DFJA 2ZPSA 3HK6B 4ABIA 3T26A 4UD9H 2Y5FA 1T8NA 1YPHC 2HALA 1SGTA 1TNGA 5IDKA 2CF9H 2ZDLA 5DP3A 1V3XA 1C5VA 2RDLA 1ZGVA 1KXFA 5EXMA 2AMQA 4UDWH 1E38B 3SNBA 1OP0A 3EQ0H 1O5EH 1EXFA 2J4IA 2R3YA 1W8BH 2GDEH 5ESTE 3DA9B 2ZU2A 1CU1A 3S9AA 3SW2B 1BITA 2D2DA 4ZXYH 1BTPA 2BD3A 3RXVA 1CA0C 3E6PH 3KCGH 3SU6A 1AE8H 4LZ4B 4J1YA 2A45B 2PKSC 1B0EA 1C4U2 3U9AH 1O2PA 3SU3A 1KLIH 1TIOA 3ZVCA 3TGJE 1LPKB 1O3JA 1OWHA 1SFQB 3A7YA 2QXIA 2GCTC 4R8TB 3SGAE 4OGYA 1NFWA 3AVZA 3RU4T 3UOPA 1YPHE 4CHAB 4D7FA 3A7ZA 1NU9A 4AFQA 2ZGJA 1H8IH 3VFEA 1GBIA 3RC5A 6GCHF 2ZI2H 2Y80A 3NKKA 1CHOG 1V2NT 6CHAC 2BXTH 1UCYH 1BUIA 4ZHMU 1UTPA 4RKJB 1BRUP 1ELFA 1RTFB 3A86A 1KXDA 2PWXA 1FZZA 1GCDA 2FOBA 1PQ8A 1S82A 2AGEX 1EOJA 1SC8U 3M35A 1L0ZA 4MNXA 1BQYA 2BM2A 1W13U 1SB1H 1HUTH 1LHEH 4DJZB 1W0ZU 1HFDA 2C93B 1LVYA 1YP9A 1Y5AT 1WU1A 1CGIE 4K1EA 1DSTA 4K3JA 3A7WA 1VCWA 3SQHE 3SGBE 1G3BA 2HRVA 1O5GH 4MQAA 3AW1A 2BD5A 3GOVB 1EAXA 4LZ1H 5HXFA 5A0AE 1F5RA 4GUXA 2WPLS 1N8OC 1QBVH 3D62A 1W7XH 1V2JT 1F2SE 1CA0B 1CGHA 2ANYA 2DE9A 4HZHA 4MPVA 4X6NA 2GZ7A 4MPXA 2XBYA 2ZECA 5DKMA 1DDJA 1THPB 1GMDF 1HXEH 1HAYB 2AYWA 3UR9A 3P17H 1NM6A 1N6YA 3UQVA 1EJNA 3VB6A 1SOTA 2UUFB 2EC9H 1FPHH 1YCPK 2BY7X 5PTPA 2XCNA 1N6XA 2BD7A 2FX4A 1C2JA 4AGJA 4DIIH 2Z6BD 3QLPH 1Q3XA 2BDGA 4RKOB 4ABAA 1KXAA 4ZKSU 3SV8A 3HGPA 1ZTJA 2R0LA 1WQVH 2SGQE 5IYTA 1Q31A 2XBWA 4K1TA 2A2XH 2XC0A 3QWCH 3MU1A 6CHAB 5C5OA 3UTUH 3SV9A 1PPCE 4RSPA 1QGFA 3K2UA 1SGFG 2FYQA 2ZF0H 2HLCA 5L2ZH 2J34A 3QN7A 1EAIA 1OSSA 1O3AA 3GY4A 4JYVH 1HXFH 3SU1A 3P70B 2CV3A 1HAOH 2BOHB 3CP7A 2OCVB 4XBCA 2VJ1A 4OS2A 2IPHA 3A83A 3ZZ3A 1C2HA 1P57B 1C1MA 1HCGA 1N8OB 2QIQA 2XC4A 1ANCA 4O03A 4A1VA 3RXSA 3ITIA 1O2MA 2YNBA 1TQ7B 4NFEA 3TU7H 3DFLA 1C5WB 2BLVA 2VIQA 1A1RA 1TFXA 5GXPA 1C1QA 5J4SA 4SGAE 2G51A 1UTKA 5CMXH 1RXPA 2ZHWH 1O2YA 4DVAU 1MU8B 4ABGA 1BIOA 1F7ZA 1AD8H 2F9VA 1NROH 3ZZ5A 3E91A 3A82A 2ZA5A 1C1PA 3TIUA 3MYWA 3QGJA 1NS3A 1TABE 1PPEE 1SLUB 5AFZH 1TPPA 5AF9H 4X0WU 1AFEH 5BPEA 3RXBA 1FONA 1QRXA 3QGNB 5LPEA 1WTGH 2W7SA 1EJMA 3AASA 1C5PA 1TX6A 5F8TA 2G8TA 1KLJH 3RC6A 1O2ZA 3CENA 4NA9H 1O33A 3RXPA 4MTBA 4DURA 1CT4E 1GHAF 1E37B 4Y10E 2Z9KA 2GV7A 5DG6A 3MTYA 1Q2WA 1DPOA 3C1KA 1DWDH 1QL9A 1QQ4A 1LKBA 2W3IA 2ZGCA 4AORA 1CT2E 4UE7H 2ZNKH 1GHWH 2Z94A 1WYKA 1QB6A 3PWBA 2J2UA 4I32A 5DP7A 1JOUB 4A6LA 4Q7YA 1AKSA 3E0PB 3FVFB 1BHXB 3MH5A 3BF6H 1O2HA 5GDSH 3TNSA 2ZFRH 1UTOA 1ETTH 1C2GA 7ESTE 2PW8H 3TK9A 4HI3A 3KL6A 4YESB 1BBRH 1P3CA 2G81E 1J8AA 4KP0A 1FY1A 1W0YH 4E7NA 4ZKNU 1SHHB 2PTCE 1V2RT 2SGEE 2W7UA 3QK1A 1GPZA 5C1YA 2NU2E 1CVWH 3M37A 3SNAA 5AHGH 1VJAU 1IQLA 1RRKA 2R2MB 1G32B 4XOJA 1GI5A 5DP4A 1JBUH 3SOSA 3V12A 1LHFH 3ATIA 1ZPZA 1XM1A 1GBTA 1SR5C 3NXPA 5ESBA 3VXFH 1GG6C 3F6UH 2F9BH 3ZZDA 3PO1C 8GCHG 1O2VA 3ZYEA 3EDXB 3Q77A 4UONA 1BTHH 3PYHA 2B0FA 4GAWA 1TALA 3GYLB 3A7TA 4MVNA 1ELVA 4ZKRU 3PMBB 3SNDA 5LH8A 1QJ1B 5DO4H 1UK4A 3PLPA 2Z9LA 1N1LA 3ZV8A 1TGSZ 1FMGA 2WPHS 9ESTA 1P9UA 2ZGBH 4GHQA 5CHAC 1BMAA 1VR1H 2OC8A 4O9VA 4RN6A 3UIRA 1P05A 4J2YB 3A88A 1ZRBA 1P03A 1FAKH 3SU4A 5K7RA 3GDVA 3SV2H 1L4DA 1OPHB 2Q1JA 4X8TH 1V6DA 5ETXA 1VZQH 2VGCC 1X7AC 2R9PA 3TJVA 2ZIQH 3OY5U 1NZQH 5EQQA 2TRMA 4YO9A 4WMEA 4X1SU 2BD8A 5L30H 1G3EA 4WMDA 1C2FA 1FY4A 1HAVB 4DW2U 2ANMH 2GMTC 2FXRA 5DP6A 4Y11E 1TNLA 1C1VH 1K1JA 1HAGE 4Y0ZE 5C20A 4LXBH 2A1DB 1WV7H 5HMAA 3BTKE 3PROA 4NZQA 3ZZ6A 1UJ1A 1O2UA 2B9LA 1KTSB 1VJ9U 1QTFA 3SO3A 1ESAA 4B2CA 1P3EA 1BTWA 5H4IB 1HAZB 3TH2H 4AYYB 2HPPH 3LGWA 2A7JA 3RDZA 3RP2A 4Z6AH 3R0FA 3LJJA 3A8CA 2FEQH 4YLQH 1NN6A 4WMFA 1PQ7A 1OKXA 3JZ2B 1ORFA 1ZPCA 3KGPA 1GG6B 4CH8B 3PO1B 2QA9E 1BCUH 1H1BA 1MD8A 4HTCH 3KN2A 1XUJA 2ZCHP 2GCHF 4AGKA 2AMPA 2UUJB 1PQ5A 1QRWA 2OC1A 2PUXB 5L2YH 3QO6A 3PV4A 4Y8ZA 1GVZA 1ID5H 3MNSA 1GWAA 3BEFB 2F9PA 1OYTH 5EXNA 5A2MH 2AERH 1SSXA 1BRCE 3TNTA 4SGBE 3V3MA 2HNTF 1HDTH 4Y0YE 3BTHE 4GVUA 3MNXA 1H8DH 1C2IA 3SJ8A 1NTPA 2RG3A 1B0FA 3MO6A 1ZJKA 4MLFB 1P2QA 1NPMA 3NUMA 2C90B 2G4TA 3RMNH 2HOBA 4BXSA 1FDPA 3MH4A 4CR5A 1TGNA 1Z8GA 4E05H 3L33A 4IGDA 5HM2A 3ATWA 3D65E 1BMNH 1C1WH 3SJ9A 3HPTB 4GLYA 1O2SA 1HIAA 1DFPA 5K0HA 3UWJH 4FU8A 2SGDE 1K1LA 1WBGB 2WV5A 4B71A 3BTME 1THRH 1QB1A 4OS6A 1T32A 4JZIA 3UNQA 4AX9H 3P6ZB 2ZG0H 2BLQA 1DSUA 1TE0A 1LHCH 3SQEE 1ZMJA 1EZXC 2H2ZA 1A2CH 3SN8A 1RIWC 4AZ2B 3H5CB 3EA7A 1ABJH 1DWCH 1SMFE 2PR3A 2OQUA 3ATKA 2ZDVH 1O3EA 2AFQB 3FP7E 3SBKA 1SI5H 3AAUA 1ETRH 4A1TA 3BSQA 2P93A 4ABDA 2FOEA 2FIRH 3I78A 5EG4A 2RA0A 1C5OH 2A5AA 4MPUA 3KQCA 2QY0B 1C1RA 3CS7A 2BZAA 7GCHF 2WUBA 2OTVA 3OX7U 3ATMA 4X1NU 1PPBH 1YPEH 4H42U 1PYTD 4THNH 2BDAA 2ZP0H 1QRZA 2VIDA 3SJIA 1TNJA 1GMHG 1P12E 4I8HA 3BTWE 4HFPB 3UNRA 1O35A 2YNAA 4Y7AA 4DCDA 1V2KT 2JETB 4MG3A 1T8LA 1IQIA 1M9UA 2W5EA 3RMLH 3ZVGA 1WOFA 1SLWB 1BA8B 3SV7A 1ESTA 3SUEA 1YCPH 4NCYA 1AE5A 3M3SA 1LTOA 1NO9H 3Q3YA 3AW0A 3F9HA 4INLA 2A4GA 1AO5A 3TJOA 2OC7A 3UOUA 1XKBC 2XBXA 4X6PA 4DG4A 2V3HH 4CHAC 4ISNA 3BTQE 3LGIA 5FBEA 4NA8A 2CN0H 1EAWA 1C5QA 1O3NA 1HAXB 1OOKB 4FUIA 4FVBA 3KQEA 3H7TA 1TBRH 1KLTA 1O34A 2UUKB 1AZ8A 3O8BA 3UWIA 1K28D 1RIWB 1XXFA 4NIWA 1IHTH 1MZDA 1CA8B 1EB1H 1UVUH 1RS0A 4UFFH 5EOKA 2C3SA 1GBLA 2OBOA 3T27A 1C5MD 4FUFA 4JK6A 3MH7A 3UPEA 3HKIB 4GCHF 1PYTC