3QGJA

1.3a structure of alpha-lytic protease bound to ac-alaalapro-alanal
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
197
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-lytic protease
publication title Substrate Binding Defines Ser195 Position in the Catalytic Triad of Serine Proteases, Not His57 protonation
rcsb
total genus 59
structure length 197
sequence length 198
chains with identical sequence C
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2011-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3qgjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3qgjA01
4HI3A 1W8BH 2W7UA 4XOJA 1TMBH 2XYAA 4KTUA 1ZPZA 3M5OA 3PMAB 4FUJA 4NFFA 3QK1A 1GJ7B 1KLJH 3ATMA 1EPTC 1O34A 1C5WB 3SO3A 2BLVA 5EQRA 1ZGVA 2BY8X 2AS9A 3SV6A 2QC2A 3PMHB 3GDSA 4ABFA 2KAIA 1K1OA 1L0ZA 2OQUA 2P8OB 2ZFPH 1O2MA 2ZCLP 1Y3WA 3TIUA 1GL0E 3MU4A 3T26A 1C2IA 1EQ9A 1GHYH 2WV5A 5SGAE 1RGQA 3QLPH 6LPRA 4I31A 1TWXB 2OXSA 3T62A 1IHSH 1UO6A 2R9PA 1UK3A 3E0PB 4X8UH 5EGMA 4PROA 3CS7A 5FBEA 4MNWA 2BQWB 1V2LT 2ZDMA 5JPMH 1K22H 2Z3CA 1UCYK 1TNHA 2QY0B 3F1SB 3RXGA 4H4FA 2Z9IA 1XUIA 3RXRA 3UOUA 1IQFA 1HAVB 2FI3E 1Z8GA 4X1RU 1DLKB 5PTPA 2A5AA 3LONA 2ZA5A 5CE1A 1QBOA 2FOAA 3AASA 3SV8A 3SN8A 1D3QB 1DWCH 3A7TA 1SGPE 4BAKB 4J2YB 4NIYA 3SGQE 3SQHE 1CBWC 2G55A 4SGAE 1HAHH 2WPKS 3RMOH 4Y11E 4OS6A 1C2LA 1L1GA 1TX6A 2FWWA 3S7KB 2A7CA 4D8NA 3A7VA 1C5RA 2B5TB 2GDDA 2ZECA 3P8OA 5AVDA 1EAXA 2ZQ1A 1TLDA 2IN2A 4NWKA 7GCHG 1EZQA 1QJ1B 4FUHA 1AN1E 1PPZA 3ZYEA 1O2TA 1FV9A 3RLWH 3UREA 2F9NA 1Z8RA 2HPQH 3DHKH 1TNKA 4Y6DA 4BTTB 1HYLA 6GCHF 2ZI2H 1GBMA 3MHWU 2ZHEH 3MNCA 4ZAEA 5E2OA 1HFDA 2WYGA 1BIOA 3RXTA 1HPGA 2HRVA 3BG8A 3B8JA 3VXFH 5C5NA 3GY6A 1HRTH 1SGTA 5FHTA 5B6OA 1T8NA 5H4IB 5JDUB 1JWTA 4K5ZA 4WH8A 1TFXA 1QJ7B 3RM0H 1C5XB 2VVCA 4X1SU 2M5TA 3RXCA 3SJKA 2CHAC 3H7OA 1G3EA 5BRRE 3QGNB 1DWEH 3Q00A 7LPRA 3QTOH 1MTSA 1O33A 3QTVH 1NT1A 3IG6B 4X2WA 7KMEH 4ABJA 3VB5A 4B74A 1DVAH 2GCTC 2ZIQH 1GI1A 3RXJA 2OC1A 3ZZ5A 4K1TA 1AVWA 1BTWA 5AFYH 4K60A 1A61H 4X2VA 2UWLA 1GBFA 3PWCA 4IW4E 1C5OH 1DY8A 1ESBA 1QCPA 2Z9KA 4JK6A 1PQAA 1BRAA 2ZG0H 5AFZH 3P8NA 1B7XB 1KLIH 1V2OT 3KNXA 3WY8A 3ZV9A 4DIHH 4JYTA 5GDSH 1K21H 3V13A 1YYY1 5FCKA 4Y8XA 2D8WA 3BG4C 5ETXA 6ESTA 4ZROA 2XCFA 2OD3B 3KQDA 3SNEA 2FLBH 1F5RA 1YCPM 4I8LA 3Q76A 2FYQA 3BTTE 1QNJA 4NA8A 3LC5A 1H4WA 2OLGA 1O3JA 4CRBA 4MPVA 2ILNA 1LKAA 1SGQE 1GI5A 1BBRK 4NSYA 1KXFA 1CA8B 1XUKA 5FXLA 2XNIA 4DJZB 1EATA 3V3MA 2BD7A 1NU9A 1SQOA 5DGJA 1SGDE 1WCZA 2A7JA 3OYPA 3QWCH 2FODA 1BMLA 2AEIH 2ZKSA 1FUJA 1D6RA 1FPHH 1TPPA 1T32A 1T4UH 3TK5A 1QL7A 1SC8U 1WTGH 2XBYA 4YLQH 2O8LA 6CHAC 1F0TA 1A0LA 3TGIE 3LGUA 5J4SA 4GVUA 3MWIU 6GCHG 1RJXB 1L2EA 2RDLA 3KEEA 4IS5A 3MNXA 1LPZB 3GYLB 3S9BA 2VH0A 3E90B 4CR9A 4UFGH 5TCAA 1EPTA 5HM2A 1P3EA 5DP3A 3TH4H 1V2JT 1PYTC 1XKAC 5T6FA 1SGCA 1GCTB 2ZFFH 3ZVEA 1H9IE 2ZWLH 1PPEE 1BRUP 1IQEA 2PTNA 1FPCH 2OINA 3E16B 2ZGBH 3M3TA 4ISOA 3SUGA 4FUDA 2PFEA 5A0CA 4HZHA 3DD2H 4ZMAH 1S5SA 4ASHA 1TX8A 1FAKH 4JK5A 1MU6B 2C3SA 3TJOA 1T31A 1QB9A 4YLUA 3RXFA 1QRWA 1F0RA 1VGCC 2AGIX 4ISLA 1P2QA 4ZUHA 1PFXC 3SV2H 1ELVA 1BOQA 3MU8A 1C5MD 1THSH 1AUTC 4MNYA 2CF9H 2WINI 1W11U 4JZFH 2R3YA 1A0HB 4GUXA 1P05A 4AOQA 3SUFA 1ZJDA 4WXIA 1CT0E 1VZQH 1FIWA 3RU4T 4I7YH 3TJVA 1X7AC 4BANB 3EA9A 1ZYOA 2XCNA 3F9EA 2WPJS 4CRCA 1NRQH 1UTLM 2ZFRH 1VCQA 3E8LA 5GCHG 1O3GA 3HPTB 1K9OE 4FUBA 2H6MA 4RKOB 3MI4A 4X6MA 8GCHF 1UHBA 2Z3DA 1WU1A 4Y79A 3GCTF 1A46H 1Z6JH 2VWLA 1ZSJA 3B23B 1L1JA 3PYHA 2VWMA 5I25A 1F2SE 1GBEA 1XKBC 3PWBA 1C2EA 3SORA 3P8GA 1GVLA 4FU9A 4U01A 1ANBA 4FUEA 2SGFE 3F9HA 4K8BA 2C8WB 5EODA 1SLUB 1TONA 3MH6A 3ZZ4A 1P3CA 3TLOA 3QZRA 1DWBH 3TH2H 2QV1A 3A7WA 4ABBA 3OTJE 1N6YA 1Z8JB 2FOGA 4JZ1A 1V2RT 3M5NA 1IOEA 3A83A 3UTUH 1Y59T 2EEKA 2PW8H 2EC9H 1OYQA 1ACBE 1K28D 2OC7A 1C2MA 1C9TA 5EXNA 3BEUA 1RTFB 1VITF 2O8UA 3VEQB 2A2QH 2FTMA 2JETB 2ZTZA 4DVAU 1N8OB 1SR5C 2AMQA 1Y3UA 7ESTE 1TALA 1OWKA 1CT2E 1HAGE 2VIVA 5JBCS 3T5FH 1TBZH 1XUFA 3ZVFA 1DFPA 1T8LA 3N7OA 4B73A 5HYOA 1C2JA 4DY7B 2ZC9H 1O5FH 1VJAU 4ZKNU 1WSSH 1V2UT 1ABJH 1N1LA 2GZ9A 3S0NA 4NG9H 4ESTE 2ODPA 1EJAA 5EPNA 1P2OA 3UUZA 5K7RA 4AFZA 1FY3A 1O3OA 2FOFA 1YPLH 4YT7H 1UCYE 1K1LA 1AFQB 3QN7A 1T4VH 2AFQB 2TGPZ 2ZDKA 5AHGH 3TGKE 3P8FA 2THFB 1NRNH 3E1XB 1AHTH 2OCVB 1E0FD 1HB0B 2PKSB 1CT4E 1FDPA 2TPIZ 1V2MT 2ZCKP 1JMOH 4JZEH 1GJDB 2ZFSA 2HNTF 3MOCA 4JMYA 1O30A 1P57B 3PMBB 4I8JA 1T8MA 2UUKB 1BRCE 3FZDA 1CA0B 3ZVBA 2P3FH 4FUGA 1UJ1A 2GT7A 2P3TB 8LPRA 3H7TA 2Y81A 1ARBA 1WBGB 3ELAH 2FESH 1EZXC 3QZQA 1GG6B 3P6ZB 1GHBF 4I33A 2I6QA 3ZZ9A 4UE7H 1SHYA 2SNVA 4WMFA 2VB0A 1AKSB 2CV3A 1YPJH 2KAIB 1B0FA 3TU7H 2BHGA 4MVNA 4LOYH 3SNCA 2QXGA 3PV4A 1VITG 4KGAA 5L2YH 1ZHMA 2XBVA 3A86A 1DUEA 1V3XA 1GBLA 1GGDB 2P94A 4U32A 3SUEA 5BPEA 2PSYA 2PGQB 2Y80A 2BOHB 1LHEH 1GBKA 2BDIA 4BAMB 1FY1A 1S6FA 4DT7B 3UWJH 2G81E 1O2YA 3SU5A 2GMTB 1ETTH 2ZHFH 1DSUA 1SGIB 1XX9A 1O3DA 3RXBA 3GY4A 1F5KU 2FTLE 1P04A 1SLXB 3MO9A 2STBE 2FOHA 3SU0A 1S82A 5EG4A 1M9UA 1G3DA 3K2UA 5HXFA 3MU0A 3SGBE 3RMNH 2NU3E 1BHXB 1GBIA 4MNVA 4K1SA 4Y71A 4TPYA 2V3OH 5TJXA 2FLRH 2XC5A 1MKXH 1YPMH 1C1NA 4RSPA 2RCEA 2WV4A 3PO1C 1O2WA 3A85A 1HJAB 2G4TA 5EU8A 2P93A 3QO6A 5E0JA 5DP6A 3RXKA 3ATKA 2CXVA 1BBRE 3AAVA 1HAYB 3GCNA 3NWUA 1EKBB 2GDEH 3R3GB 2BVSH 3M5LA 2TGAA 3RXEA 1Y3XA 2UUYA 1ANDA 5LPRA 1S85A 2GVFA 3BTHE 1TRNA 3EA7A 1GHBG 2ZFTA 1BA8B 1EAIA 2G00A 1T8OA 2FOCA 4BAQB 1HV7A 4NCYA 1ELCA 4Z6AH 4Q80A 3SGAE 1Z6EA 3GCHB 2BOKA 5FAHA 2Z7FE 5JB9S 2ESTE 4Q2KA 1HIAA 3TJUA 2OTVA 5FX5A 4BTIB 2FO9A 3A87A 2AH4X 2GX4A 1IQKA 2AYWA 3ZVGA 2H5DA 1C5ZB 4AX9H 1ELEE 1K1PA 4WXVA 4IN2A 2OQ5A 1AWHB 4ZXXH 2C8YB 5FPTA 4O03A 3TNTA 1WQVH 4TWYA 2UUFB 2ZPQA 2VIWA 1TA6A 4TPIZ 1VCPA 3TNSA 1SFQB 3UR6A 2BB4A 1O2OA 1TQ0B 1DPOA 2A31A 1O32A 3SI3H 4O9VA 1P11E 3GDVA 1F7ZA 1ANCA 1LPKB 3STJA 1UTMA 1DXPA 1WV7H 1SOZA 1KDQA 5ESTE 5GXPA 1A5HA 1HNEE 1MQ6A 1MU8B 1O2NA 3BEFB 5JB8S 1C1OA 1U6QA 1F5LA 1TIOA 1PPHE 3OY5U 4CBOA 1L1NA 4CH8B 4Y8ZA 1P2NA 4F4OC 8ESTE 4GCHG 1XUGA 1P0SH 3RXIA 4D76A 1Z8IB 2F83A 1FY4A 3W94A 2AGEX 4GHQA 3UOPA 3K9XB 4WMEA 4ABEA 1OXGA 2A4OA 5E2PA 4CHAB 1A4WH 3A8BA 2JH6D 3SV9A 1DSTA 5F8ZA 1E37B 3RXSA 1KXCA 3L3TA 2BLQA 4ZH8A 3BTDE 1DWDH 1WTHD 1CHOF 1ELFA 1T7CA 3DUXH 3RXMA 1MQ5A 1YLDA 5A8YA 1J9CH 3F6UH 3AW1A 3E91A 3FP7E 1AB9C 4AN7A 2BTCE 1WUNH 2JH0D 2PUXB 3A8CA 2BDCA 4KTSA 2VIOA 4D7GA 1SLVB 2VIQA 1J16A 1Z1JA 3UR9A 1J8AA 2AGGX 4A1XA 3I29A 4TWWA 2QF3A 1WYKA 1O2KA 2H9EH 2H1UA 3TJNA 1SMFE 1LKBA 3A81A 3MMGA 1MKWH 1UCYH 4VGCC 3Q3KA 1TPOA 3KN2A 3S9CA 3D62A 1AVXA 2ZGCA 1A5GH 4TY7A 3OY6U 5HMAA 1GJBB 1MZAA 1RD3B 4KP0A 4NGAH 1H9HE 1SGRE 1FN6A 3FP6E 2W7SA 1Q3XA 1W13U 2YNAA 4FUFA 4Y7AA 4NIWA 3I77A 4ZKRU 1WQSA 2Y7ZA 5E0GA 1C1VH 3PTNA 1NU7B 1NC6A 1YM0A 1NRSH 1GHZA 3SHAH 4XBCA 1P2IA 1O3KA 4FUCA 4QT8C 3KQBA 1P02A 1ANEA 5A09A 1CBWB 1O2UA 2BY7X 2TGTA 2W26A 2PHBA 1BTHH 2TBSA 2BY6X 1V2WT 3VFEA 2Y7XA 2Y6TA 1VCWA 1UHBB 4DURA 1C1RA 2D26C 1SI5H 2QCYA 3LIWA 4OGXA 5EOKA 1TQ7B 5C1UA 1MZDA 1EB1H 1O2JA 1UVSH 2SGQE 4MNXA 5A0AE 1BMNH 1ZMNA 1LO6A 1O39A 2BM2A 3NZIA 3RP2A 1LPGB 2WPHS 1THRH 1V2QT 1TX7A 5FBIA 5F8XA 1FMGA 1TRMA 2XBWA 2FI5E 3U1IB 1CHOG 1RTLA 4I32A 3ZZBA 3ZYDA 3E6PH 2D1JA 1GJAB 3RDZA 1P09A 4X6OA 1GBCA 3MH7A 1J17T 1N6XA 3U8OH 3UFAA 1AD8H 1BTZA 1O0DH 3R0FA 3RXLA 1XMNB 4XBBA 1BHXF 1LMWB 2O9QA 1GBBA 2ANYA 2LPRA 5J4QA 2CHAB 1NESE 2W3IA 3NPSA 1GCDA 3LH1A 1G36A 5CHAC 3U9AH 1D3PB 4D9QA 4AG1A 1SGFG 3EYDA 5DP5A 1G32B 2BLWA 4ABHA 1UTJA 2PLXA 1UVOA 4MLFB 1O31A 4AG2A 3Q3YA 1ZZZA 3M3VA 3A7ZA 1AVGH 1UMAH 1TBQH 3DT0H 3ZZ8A 3UNRA 2FOMB 1PQ8A 2BLOA 1G2LA 3RXVA 1HDTH 1KSNA 2CMYA 4ABAA 2ZU5A 2BZ6H 1H9LB 1J14A 1GI4A 2NU1E 1S6HA 1P10A 3LT3A 1CU1A 1BTPA 4B2AA 4BXSA 4JYVH 3SNAA 2DE8A 1SGNE 4NZLA 3S7HB 2C4FH 1F0UA 1BBRH 3LH3A 3PM3A 4A1TA 2G51A 2LNCA 4ISIH 1HAPH 3VGCC 9ESTA 3ZZ7A 4GLYA 1G2MA 1K1IA 4GAWA 1MBQA 1G37A 3A82A 4R0IA 2WPLS 4GHTA 1V2ST 2ZU2A 3NK8A 4A92A 1IQGA 1GDUA 4NIXA 1K1JA 4XE4A 1GBTA 2GZ7A 4CRAA 2AMDA 4U30A 1PQ5A 4HGCA 4UDWH 1TNJA 2QXJA 3UNQA 1DM4B 3NKKA 3M61U 3TK9A 1OOKB 3K6ZA 3FFGA 2ZDAH 3MNSA 3P95A 3ZZDA 2NU0E 5DK1A 6CHAB 2J94A 2ZEBA 5DP7A 3GY2A 2K1QA 1P12E 1GI6A 1A3BH 1C1SA 1KYNA 1NS3A 1DITH 1NFWA 1NFYA 3PLBA 1KY9A 2JETC 1QQ4A 2EI7A 4DG4A 2F9UA 1TGNA 3EGKH 5C1XA 1ZTKA 3TK6A 3EDXB 3T27A 3HKIB 2VGCC 1ZTJA 1Y5BT 2BDAA 3DA9B 3RXUA 4CRGA 2PUQH 4IN1A 3LPRA 1OWEA 1O3CA 4FVDA 1KXEA 1O2VA 1BMAA 1GI2A 3A89A 2ZU3A 1SGEE 2ZTXA 2ZPRA 1FY5A 1TPSA 2FOBA 4XFQA 1ZSKA 2OBQA 3ZZ3A 1AQ7A 1C2KA 3RUOA 1DDJA 1IAUA 1AZZA 2A4GA 2R0KA 1GJ5H 5DP9A 1VGCB 1C2DA 1AFQC 3SUDA 1C9PA 3QUMP 2BD9A 2BDYA 2PGBB 1K1NA 3QDZB 3V12A 4YOJA 3F9FA 4TYDA 4E7NA 3BTKE 3RLYH 1A3EH 3ZVAA 2A5IA 4WF8A 4HTCH 2G5VA 5K0HA 1AO5A 1C5VA 4H6SB 1ZTLA 2FZZA 4BOHA 1MUEB 4MPUA 1FAXA 3JZ1B 1NTPA 2HLCA 3M5MA 2QYIA 1EASA 1VR1H 4BAHB 3UQOA 3L6PA 3RXAA 3MU1A 1FI8A 1G3BA 3AAUA 2H9TH 3A7XA 1YCPK 3M37A 4IMZA 3S69A 1CHGA 1O5BB 1O3PB 1YBWA 1EXFA 2VIPA 1AU8A 3C27B 1G3CA 1SB1H 2OBOA 1DY9A 1GG6C 4AYVB 3MO6A 5EW1H 4K8YA 3MH5A 1TYNA 1GDQA 1A1RA 2NWNA 3BTEE 3BTME 1YC0A 4I8KA 1C4U2 4M7GA 2YNBA 1HCGA 2Q6FA 1RIWB 2Z94A 4FU8A 4BNRA 3SU4A 1ZPCA 2FM2A 1KTTB 3UNSA 4H42U 2BX3A 1C1PA 3OU0A 1KXDA 2AMPA 3RMLH 4NZQA 1HIAB 8GCHG 1MD7A 1SQAA 3SJOA 1QY6A 3BTFE 2GZ8A 1SVPA 1OKXA 2FEQH 4DOQA 3GCTG 1P2KA 3FANA 5T3HA 1EP6A 1MAYA 3Q3XA 2GMTC 1O37A 5L2ZH 5DG6A 5A2MH 3KHVA 5GJ4B 1LTOA 2ZDVH 5EXMA 2ZHWH 1SG8B 1W10U 4MPXA 5A8ZA 1GWAA 1W14U 1UK4A 1MD8A 1GDNA 1HLTH 1UTNA 3MU5A 2A32A 2FMJA 4KELA 4SGBE 2A0QB 1KDQB 1QL8A 2C90B 2FS8A 1LHCH 1GBJA 1LVBA 1MTVA 1TGTA 2Y82A 5LGOA 1FJSA 1G9IE 2FOEA 1O2PA 1HJAC 2R2WU 1QQUA 1TA2A 1YPKH 2IJOB 1MTNB 3FP8E 4OS5A 1FZZA 3PLKA 1ABIH 2GV6A 3LJOA 1PJPA 2HGTH 2AERH 1ETSH 3RXQA 1TGSZ 2BQ7B 4X8TH 1AE8H 1OYTH 5HGGA 5F6MA 1BT7A 4DCDA 4B2BA 1S83A 1TPAE 3FVFB 5JBAS 2J4IA 1O3IA 3RU4E 1NFUA 2Z3EA 1LCYA 5IYTA 2B9LA 1RFNA 2ANMH 3GYMA 4E06H 4A7IB 4TY6A 3F9GA 1E38B 3GCHC 1G30B 3SW2B 1L4DA 1LDTT 1TB6H 1UTPA 4XSKU 1UK2A 2H5CA 2XTTB 4UFEH 5A8XA 4X8SH 2SFAA 1IQMA 2SNWA 1C5LH 2TRMA 4A5TS 1BRBE 3ATIA 4AORA 1BJUA 5I46H 2FI4E 1FLEE 1AMHA 4YOGA 1SGYE 4B75A 3PROA 1UVUH 1HAXB 3M3SA 1C4V2 1GHWH 1GMHF 2BD3A 3O8BA 1J15A 4MDSA 2SGPE 3FAOA 1DANH 1MAXA 2J92A 4X8VH 4YT6H 3QGJA 1EJMA 4MG3A 3GY7A 1C5NH 1NM6A 1C1UH 2BMGB 2VVVA 1Z7KA 1MCVA 3O8CA 2NU2E 2RA3A 1CGHA 4E7RG 3BIUH 2ODQA 2P8OC 1C2FA 1V2KT 2XXLA 4KTCA 4CH2B 4UONA 4OS1A 1OWJA 5C67A 1UVPA 4MTBA 2P95A 1AY6H 2QAAA 1MH0A 2HALA 1RTKA 1QA7A 1QL9A 1WAYB 2A4RA 2FYRA 2G4UA 4INKA 3RC4A 5JBBS 2G5NA 5GWZA 1CGIE 3SJ8A 1ZMLA 1A0JA 1IHTH 4YO9A 1C5QA 2BX4A 3BV9B 3LDXH 3TPIZ 1ZMJA 2BY5X 2RA0A 4WMDA 2OUAA 2ULLA 1O2ZA 1SGFA 3PB1E 2PV9B 5L30H 1UTOA 4FXGH 3PO1B 5FX6A 2HOBA 4UFDH 1ZOMA 2ZDNA 2GT8A 5HM9A 1C2GA 1W2KH 4INHA 4AYYB 1GI3A 1JOUB 4K2YA 4CHAC 3SI4H 2I6SA 1HGTH 3TH3H 1TGCA 1YLCA 1EOJA 2CGAA 1QTFA 5IDKA 1EP5A 3BIVH 2IPHA 3RC6A 3BTQE 2BD4A 1ZRBA 1HJ8A 2F9PA 3H5CB 1ZR0A 5FPYA 3I78A 1O5GH 1YPHC 3A84A 1TBRH 4X2XA 1ELBA 1KXAA 1HUTH 1AKSA 2GV7A 4R8TB 2BD5A 2VU8E 1O3HA 4JZIA 5FPSA 2W3KA 5AF9H 1BDAA 1V2VT 1O3AA 2BXUH 3U98H 1P2MA 1LQDB 1TRYA 5DKMA 4K1EA 3MTYA 2ODYB 2GCHF 3MFJA 3ZZ6A 3OSYA 1GMHG 4OS4A 3RC5A 2PSXA 1W3CA 4B1TA 2B0FA 2OP9A 3ENSB 1QFKH 3RXOA 1ESTA 1LHDH 4LXBH 4X1PU 4CBNA 2XC4A 2J2UA 4F49A 4NA9H 2ZZUH 1LVYA 2PKAA 3UY9A 1OWIA 4DGJA 3SZNA 2XW9A 1MKWK 4GSOA 1SL3A 4ABIA 1EPTB 3SOSA 1TMTH 5JYIA 1C5YB 3GICB 1YF4A 4YZUA 1PPGE 1OP8A 4LK4A 2WPIS 3ZZCA 1Q31A 1AUJA 1PPBH 4K69A 2HNTC 1AIXH 3ODDA 3VB7A 2EI8A 4AFUA 1E35B 1IQHA 2RG3A 4WJG2 2ZF0H 1H8IH 1O3LA 1JRTA 1GI0A 2HVXA 5ESBA 1S81A 1P9UA 2W5EA 1NO9H 4DW2U 4ISHH 3T25A 1V2TT 5E0HA 1GPZA 2HWLB 4AZ2B 1D3TB 1C5TA 4B76A 2GKVE 2J95A 2QXHA 1GBAA 1HBTH 5EQSA 3KQCA 2FPZA 1CE5A 1EAWA 3RXHA 1D3DB 3ZVDA 1JXPA 2Z9LA 2BD8A 3SU3A 2C8ZB 1EAUA 1TMUH 2XBXA 5C20A 1GBHA 1SLWB 3O8DA 1ZGIA 2WPMS 1HXEH 2WUBA 1Q2WA 3HATH 3SV7A 2VNTA 3LGYA 2V35A 1HAIH 2BY9X 4AFQA 4WWYA 4B71A 4I8GA 4YM9A 4Y0ZE 4NSVA 1BCUH 1H1BA 2O8WA 2UWOA 5A0BA 4X1QU 4BTUB 2FXRA 2B7DH 3ODFA 1QIXB 1ELTA 2GCHG 2TGDA 1CVWH 1GJ9B 1DE7H 2F9BH 1O2SA 3LGWA 1AB9B 9LPRA 1RXPA 2UUJB 1NROH 3U8RH 4Q7XA 1LHGH 4CR5A 1W0ZU 5T6GA 5C5OA 2Z9JA 2A1DB 4LZ1H 5EQQA 3M36A 4VGCB 3SHCH 3P92A 2OC8A 2WYJA 5F03A 3NCLA 2VINA 1HJ9A 2H2ZA 1QB1A 4NWLA 4H6TA 1C1QA 1GCTC 2WUCA 4Q7YA 1E34B 1AWFH 3E3TA 3LC3A 2A4QA 4WH6A 2O8TA 1BB0B 1O2QA 1AE5A 4X0WU 1BTYA 4Y7BA 2BYAX 1O2RA 1O2XA 2Q6DA 3HGPA 3LJJA 2DE9A 3Q77A 2O8MA 4B2CA 3GY8A 4MQAA 1IQJA 1P06A 2V6NA 1FY8E 1XXFA 3K65B 3F68H 4IC6A 4IMQA 2GP9B 1TNIA 2ZGXH 3IITA 5GCHF 2GCTB 2FP7B 3SBKA 1PPFE 2STAE 1NN6A 1INCA 1PYTD 1YPHE 1A2CH 1V2NT 2PR3A 1JIMA 1GJ4H 3RMMH 2SGDE 3FZZA 2XC0A 4MPWA 1GVKB 2F9OA 4NA7A 1HAVA 1E36B 4FUIA 1AGJA 4GPGA 2VJ1A 1FN8A 5JBTA 3ZVCA 4E05H 1SHHB 1EUFA 2SGAA 1OWDA 2VIDA 5F8TA 3BG4B 4U2WA 2ZU4A 1DUAA 1C5PA 4A6LA 1FXYA 1FNIA 3U69H 3P70B 1PPCE 1ZRKA 1ZHPA 3ITIA 2Q1JA 1THPB 1XUHA 2V0BA 1TNGA 3A80A 4ZKSU 1Y5UT 4FU7A 4Z0KA 4AGJA 2ZHDA 1SQTA 3A8DA 1TOCB 4J1YA 1A5IA 1W0YH 3K6YA 4THNH 5TCCA 1LVMA 4AB8A 3JZ2B 2ZDLA 1RS0A 1B5GH 1HAZB 2P16A 3C1KA 1O5CB 2HNTE 3U1JB 1IQLA 3QX5H 1O5AB 2FIRH 1RRKA 2XWBI 2TIOA 1UTQA 2J38A 1O2IA 4WVPE 3B9FH 1TGBA 3BN9A 5DJ7A 1LQEA 1S0RA 1UTKA 2J34A 4O3TA 2SGEE 2BQ6B 3NUMA 1SSXA 5CHAB 3PTBA 2J9NA 1NPMA 1ESAA 1QR3E 4AFSA 1O3MA 1WOFA 1YPGH 4RN6A 1GHXH 1NFXA 1OP2A 2R2MB 3A88A 2ZTYA 3V7TA 1SFIA 2A2XH 4ABGA 1DX5M 2R0LA 2Y5HA 1HAOH 2GTBA 2Q6GA 1Y5AT 1GJ8B 2ZO3H 2BDGA 3LGIA 2BDBA 3RU4D 4IC5A 2A5KA 3TVJB 2Y5GA 1N8OC 1D9IA 1BMMH 1OPHB 1P8VC 1NRPH 4INLA 2YOLA 3NXPA 1QHRB 1CGJE 1XXDA 4WY3A 3TGJE 4Y10E 1F0SA 3RXPA 8KME2 3PMJA 2F3CE 4ZHMU 3SNDA 3LOXA 1EJNA 2ZFQH 3M7QA 1SPJA 3VB4A 1TE0A 2ZQ2A 3AW0A 3VGCB 1XM1A 2GD4B 4AB9A 1GL1A 3M7UA 1A7SA 1MTWA 2A45B 2QA9E 1S84A 4JCNA 2Y5FA 1GI8B 5E8EH 1ETRH 5DO4H 2R3UA 3W95A 2ANWA 5DPAA 4ZXYH 1ID5H 5C3NA 1ELDE 3IWMA 3KCGH 2VWOA 1ELGA 2VWNA 1TOMH 1O38A 2PWXA 3D23A 1RIWC 2QXIA 2AIQA 1DLEA 5EXLA 3SJIA 3EA8A 2ZHQH 3BSQA 3BTWE 1EZSC 2PKSC 1JIRA 1VJ9U 3L33A 3LKWA 3M7TA 1Z71A 2ZGHA 1KXBA 3TITA 2BDHA 1ZHRA 1AZ8A 1QURH 2NU4E 5G4BA 3MYWA 1GVZA 1CQQA 1CA0C 2ZPSA 4LZ4B 4NIVA 3DFLA 4O97A 1FQ3A 1QJ6B 3VB6A 5C2ZA 4UD9H 1LVOA 1HXFH 1V2PT 2F9VA 1PQ7A 1O35A 2VGCB 2VVUA 1QB6A 1KTSB 1TAWA 4KKDA 2CF8H 2P3UB 2FS9A 1BUIA 2C93B 4OGYA 1P2JA 2H9HA 3UQVA 3BF6H 2A7HA 2IOTA 1QRXA 3LGTA 3O8RA 1JBUH 2GGVB 1GHAF 2C8XB 3GCOA 2QN5T 5LH8A 3ZV8A 1BITA 1SBWA 1GMCF 1GGDC 1C5SA 1IQIA 1DOJA 3M35A 4OS2A 2Z9GA 3VPKA 1MMJN 1ZSLA 1O3FA 4I8HA 1CO7E 3U8TH 3CP7A 5T6DA 1BZXE 1O3BA 1NRRH 1Y8TA 2OC0A 3GY3A 1MTNC 1NZQH 1D6WA 4X6NA 5DP4A 1ELAA 1YPEH 4CREA 1YCPH 4Q7ZA 3SNBA 3ZZAA 1O3EA 1F92A 2XWAA 3SQEE 3URCA 1EB2A 3T2NA 1Y3VA 1O5DH 4Y0YE 3EE0B 1ARCA 1Z1IA 1EX3A 2ALVA 4NFEA 4JYUH 3E0NB 1ZPBA 4FVBA 4CRFA 4A1VA 1JRSA 4BAOB 1KLTA 2CN0H 5L6NH 1C1MA 1EOLA 4DIIH 2G8TA 2G52A 1S0QA 2PTCE 2FX4A 3BTGE 3LU9B 3P17H 1YKTA 2QF0A 3AVZA 3EAJA 1B0EA 3URDA 3UWIA 2ANKH 3CENA 1C2HA 2VH6A 4K3JA 4UEHH 2ZNKH 4ABDA 1LHFH 1Y3YA 3GY5A 1ZJKA 3D49H 1TNLA 2ALPA 3RXDA 4BXWA 3D65E 1MKXK 1YP9A 2ZGJA 3OX7U 3MNBA 1XUJA 4XBDA 5FCRA 1GMDF 5GIBA 1BQYA 1QBNA 1GI9B 4ZHLU 1UVTH 3PLPA 3RM2H 1DS2E 5EW2H 3A7YA 3KL6A 4UFFH 3VXEH 1GI7B 2XRCA 3STIA 1P03A 4IBLH 1AI8H 1OP0A 3MO3A 3ESTA 1C1TA 5EPYA 5LPEA 4RKJB 1QRZA 2PKAB 1VITH 3HGNA 4X2YA 2HPPH 2QGRA 1TABE 3A8AA 2EI6A 3HK6B 1DICA 1GHVH 4ISNA 3MH4A 1GHAG 3G01A 1K2I1 4Y8YA 2BVXH 3ATLA 1ZLRA 4OS7A 2JKHA 1SOTA 1K1MA 4YOIA 3SU2A 1MCTA 3UPEA 1O3NA 3SJ9A 1AFEH 1D4PB 1GMCG 2JH5D 1H8DH 3BEIB 4HFPB 2BVRH 2ZU1A 1V6DA 1O5EH 4Y76A 1L4ZA 3KF2A 1EZUC 4D7FA 1BJVA 3T29A 5C1YA 2Z6BD 3HKJB 3KGPA 4XDEA 2FDAA 1W7GH 1DT2A 4X6PA 5DP8A 5CMXH 1O2HA 1GJ6A 4X1NU 3DFJA 1OX1A 4AGKA 2F91A 4YTAA 3GISB 4GCHF 2P59A 1C4Y2 3KQEA 1NY22 2DUCA 1O2GH 2AIPA 1FONA 1QBVH 3GOVB 4JZDH 3ATWA 1GJCB 3GDUA 1MTUA 5GPIB 3LGVA 4CRDA 1BTUA 1W7XH 3T28A 3UIRA 4IGDA 2V3HH 4O3UA 2QIQA 1P01A 3SU6A 4D9RA 1QGFA 2BZAA 3V0XA 1FIZA 3SU1A 2B8OH 1C1WH 2BXTH 1QA0A 1W12U 1C5UA 1OWHA 1CSOE 1XVOA 3S9AA 1MBMA 2BD2A 1IQNA 4ZHAA 5LPFA 1O36A 2ZCHP 4YESB 1BTXA 1GBDA 1YGCH 2ZP0H 2D2DA 1O2LA 1DXWA 3CS0A 1OSSA 1GMDG 2UWPA 4ZKOU 1KIGH 3VB3A 1XVMA 3HK3B 5ABWA 2EA3A 2ASUB 2FX6A 3EQ0H 7GCHF 1OS8A 2CJIA 1P9SA 3KIDU 1ORFA
chains in the Genus database with same CATH superfamily
4HI3A 1W8BH 2W7UA 4XOJA 5C17A 1TMBH 2XYAA 4KTUA 1ZPZA 3M5OA 3PMAB 4FUJA 4NFFA 3QK1A 1GJ7B 1KLJH 3ATMA 1EPTC 1O34A 1C5WB 3SO3A 2BLVA 5EQRA 1ZGVA 2BY8X 2AS9A 3SV6A 2QC2A 3PMHB 3GDSA 4ABFA 2KAIA 1K1OA 1L0ZA 2OQUA 5CDFE 2P8OB 2ZFPH 1O2MA 2ZCLP 1Y3WA 3TIUA 1GL0E 3MU4A 3T26A 1C2IA 1EQ9A 1GHYH 2WV5A 5SGAE 1RGQA 3QLPH 6LPRA 5HKKD 4I31A 1TWXB 2OXSA 3T62A 1IHSH 1UO6A 2R9PA 1UK3A 3E0PB 4X8UH 5EGMA 4PROA 3CS7A 5FBEA 4MNWA 2BQWB 1V2LT 2ZDMA 5JPMH 1K22H 2Z3CA 1UCYK 3F0PA 1TNHA 2QY0B 3F1SB 3RXGA 4H4FA 2Z9IA 1XUIA 3RXRA 3UOUA 1IQFA 1HAVB 2FI3E 1Z8GA 4X1RU 1DLKB 5PTPA 2A5AA 2WSSD 3LONA 2ZA5A 5CE1A 1QBOA 2FOAA 3AASA 3SV8A 3SN8A 1D3QB 1DWCH 3A7TA 1SGPE 4BAKB 4RI0A 4J2YB 4NIYA 3SGQE 3SQHE 1CBWC 2G55A 4SGAE 1HAHH 2WPKS 3RMOH 4Y11E 4OS6A 1C2LA 1L1GA 1TX6A 3GS9A 2FWWA 3S7KB 2A7CA 4D8NA 3A7VA 5EJ1A 1C5RA 2B5TB 2GDDA 2ZECA 3P8OA 5AVDA 1EAXA 2ZQ1A 1TLDA 2IN2A 4NWKA 7GCHG 1EZQA 1QJ1B 4FUHA 1AN1E 1PPZA 2W6JD 3ZYEA 1O2TA 1FV9A 3RLWH 3UREA 2F9NA 1Z8RA 2HPQH 3DHKH 1TNKA 4Y6DA 4BTTB 1HYLA 6GCHF 2ZI2H 1GBMA 3MHWU 2ZHEH 3MNCA 4ZAEA 5E2OA 1HFDA 2WYGA 1BIOA 3RXTA 1HPGA 2HRVA 2YMSC 3BG8A 3B8JA 3VXFH 5C5NA 3GY6A 1HRTH 1SGTA 3FOAA 5FHTA 5B6OA 1T8NA 5H4IB 5JDUB 1JWTA 4K5ZA 4WH8A 1TFXA 1QJ7B 3RM0H 1C5XB 2VVCA 4X1SU 2M5TA 3RXCA 3SJKA 2CHAC 3H7OA 1G3EA 5BRRE 3QGNB 1DWEH 3Q00A 7LPRA 3QTOH 1MTSA 1O33A 3QTVH 1NT1A 3IG6B 4X2WA 7KMEH 4ABJA 3VB5A 4B74A 1DVAH 2GCTC 2ZIQH 1GI1A 3RXJA 2OC1A 3ZZ5A 4K1TA 1AVWA 1BTWA 5AFYH 4K60A 1A61H 4X2VA 2UWLA 1GBFA 3PWCA 4IW4E 1C5OH 1DY8A 1ESBA 1QCPA 2Z9KA 4JK6A 1PQAA 1BRAA 2ZG0H 5AFZH 3P8NA 1B7XB 1KLIH 1V2OT 3KNXA 4XD7D 3WY8A 3ZV9A 4DIHH 4JYTA 5GDSH 1K21H 3V13A 1YYY1 5FCKA 4Y8XA 2D8WA 3BG4C 5ETXA 6ESTA 4ZROA 2JIZD 2XCFA 2OD3B 3KQDA 3SNEA 2FLBH 1F5RA 1YCPM 4I8LA 3Q76A 1YWUA 2FYQA 3BTTE 1QNJA 4NA8A 4P00A 3LC5A 1H4WA 2OLGA 3DSGA 1O3JA 4CRBA 4MPVA 2ILNA 1LKAA 1SGQE 1GI5A 1BBRK 4NSYA 1KXFA 1CA8B 1XUKA 5FXLA 2XNIA 4DJZB 1EATA 3FN8A 3V3MA 2BD7A 1NU9A 1SQOA 5DGJA 1SGDE 1WCZA 2A7JA 3OYPA 3QWCH 2FODA 1BMLA 2AEIH 2ZKSA 1FUJA 1D6RA 1FPHH 1TPPA 1T32A 1T4UH 3TK5A 1QL7A 1SC8U 1WTGH 2XBYA 4YLQH 2O8LA 6CHAC 1F0TA 1A0LA 3TGIE 3LGUA 5J4SA 4GVUA 3MWIU 6GCHG 1RJXB 1L2EA 2RDLA 3KEEA 4IS5A 3MNXA 1LPZB 3GYLB 3S9BA 2VH0A 3E90B 4CR9A 4UFGH 5TCAA 1EPTA 5HM2A 1P3EA 5DP3A 3TH4H 1V2JT 1PYTC 1XKAC 5T6FA 1SGCA 1GCTB 2ZFFH 3ZVEA 3UB0A 1H9IE 2ZWLH 1PPEE 1BRUP 1IQEA 2PTNA 1FPCH 2OINA 3E16B 2ZGBH 3M3TA 4ISOA 3SUGA 4FUDA 2PFEA 5A0CA 4HZHA 3DD2H 4ZMAH 1S5SA 4ASHA 2M2AA 1TX8A 1FAKH 4JK5A 1MU6B 2C3SA 3TJOA 1T31A 1QB9A 4YLUA 3RXFA 1QRWA 1F0RA 1VGCC 2L74A 2AGIX 4ISLA 1P2QA 4ZUHA 1PFXC 3SV2H 1ELVA 1BOQA 3MU8A 1C5MD 1THSH 1AUTC 4MNYA 2CF9H 2WINI 1W11U 4JZFH 3KYFA 2R3YA 1A0HB 4GUXA 1P05A 4AOQA 1KMHB 3SUFA 1ZJDA 4WXIA 1CT0E 1VZQH 1FIWA 3RU4T 4I7YH 3TJVA 1X7AC 2J97A 3EA9A 1ZYOA 2XCNA 3F9EA 4BANB 2WPJS 3KQ5A 4CRCA 1NRQH 1UTLM 2ZFRH 1VCQA 3E8LA 5GCHG 1O3GA 3HPTB 1K9OE 4FUBA 2H6MA 4RKOB 3MI4A 4X6MA 8GCHF 1UHBA 2Z3DA 3FO8D 1WU1A 5FL7D 4Y79A 2XOKD 3GCTF 1A46H 1Z6JH 2VWLA 1ZSJA 1NBMD 3B23B 3OAAD 1L1JA 3PYHA 2VWMA 5I25A 1F2SE 1GBEA 1XKBC 3PWBA 4OM9A 1C2EA 3PRDA 3SORA 3P8GA 1GVLA 4FU9A 4U01A 1ANBA 4FUEA 2SGFE 3F9HA 4K8BA 1QZ8A 2C8WB 5EODA 1SLUB 1TONA 3MH6A 3ZZ4A 2WZQA 1P3CA 3TLOA 3QZRA 1DWBH 3TH2H 2QV1A 3A7WA 4ABBA 3OTJE 1N6YA 1Z8JB 2FOGA 4ZCNA 4JZ1A 1V2RT 3M5NA 1IOEA 3A83A 3UTUH 1Y59T 2EEKA 2PW8H 2EC9H 1OYQA 1ACBE 1K28D 2OC7A 1C2MA 1C9TA 5EXNA 3BEUA 1RTFB 1VITF 4B6FA 2O8UA 4TT3D 3VEQB 2A2QH 2FTMA 2JETB 5KEDA 2ZTZA 4DVAU 1N8OB 1SR5C 2AMQA 1Y3UA 7ESTE 1TALA 1OWKA 1CT2E 1HAGE 2VIVA 5JBCS 3T5FH 1TBZH 1XUFA 3ZVFA 1DFPA 1T8LA 3N7OA 4B73A 5HYOA 1C2JA 4DY7B 2ZC9H 1O5FH 1VJAU 4ZKNU 1WSSH 1V2UT 1ABJH 1N1LA 2GZ9A 3S0NA 4NG9H 4ESTE 2ODPA 1EJAA 5EPNA 1P2OA 3UUZA 5K7RA 4AFZA 1FY3A 1O3OA 3WWFA 2FOFA 1YPLH 4YT7H 1UCYE 1K1LA 1AFQB 3QN7A 1T4VH 2AFQB 2TGPZ 2ZDKA 5AHGH 3TGKE 3P8FA 2THFB 1NRNH 4DT4A 3E1XB 1AHTH 2OCVB 1E0FD 1HB0B 2PKSB 1CT4E 1FDPA 2TPIZ 1V2MT 2ZCKP 1JMOH 4JZEH 1GJDB 2ZFSA 2HNTF 3MOCA 4JMYA 1O30A 1P57B 3PMBB 4I8JA 1T8MA 2UUKB 1BRCE 3FZDA 1CA0B 3ZVBA 2P3FH 4FUGA 1UJ1A 2GT7A 2P3TB 8LPRA 3H7TA 2Y81A 1ARBA 1WBGB 3ELAH 2FESH 1EZXC 3QZQA 1GG6B 3P6ZB 1GHBF 4I33A 2I6QA 3ZZ9A 4UE7H 1SHYA 2SNVA 4WMFA 2VB0A 1AKSB 2CV3A 2KZ4A 1YPJH 2KAIB 1B0FA 3TU7H 2BHGA 4MVNA 4LOYH 3SNCA 2QXGA 3PV4A 1VITG 4KGAA 5L2YH 1ZHMA 2XBVA 3A86A 1DUEA 1V3XA 1GBLA 1GGDB 2P94A 4U32A 3SUEA 5BPEA 2PSYA 2PGQB 2Y80A 2BOHB 1LHEH 2L6OA 1GBKA 2BDIA 4BAMB 1FY1A 1S6FA 4DT7B 3UWJH 2G81E 1O2YA 3SU5A 2GMTB 1ETTH 2ZHFH 1DSUA 1SGIB 1XX9A 1O3DA 3RXBA 3GY4A 1F5KU 2FTLE 1P04A 1SLXB 2OK5A 3MO9A 5EJZA 2STBE 2FOHA 3SU0A 1S82A 5EG4A 1M9UA 1G3DA 3K2UA 3OFND 3MU0A 3SGBE 3RMNH 1BHXB 2NU3E 1GBIA 5HXFA 4MNVA 4K1SA 4Y71A 4TPYA 2V3OH 2RFKC 5TJXA 2FLRH 2XC5A 1MKXH 1YPMH 1C1NA 4RSPA 2RCEA 2WV4A 2PP6A 3PO1C 1O2WA 3A85A 1HJAB 2G4TA 5EU8A 2P93A 5EIYA 3QO6A 5E0JA 5DP6A 3RXKA 3ATKA 4AC9A 5C94A 2CXVA 1BBRE 3AAVA 1HAYB 3GCNA 3NWUA 5C0TA 1EKBB 2GDEH 3R3GB 2BVSH 3M5LA 2TGAA 3RXEA 1Y3XA 2UUYA 1ANDA 5LPRA 1S85A 3F2FA 2GVFA 3BTHE 1TRNA 3EA7A 1GHBG 2ZFTA 1BA8B 1EAIA 2G00A 1T8OA 2FOCA 4BAQB 3AK5A 1HV7A 4NCYA 1ELCA 4Z6AH 4Q80A 3SGAE 1Z6EA 3GCHB 2BOKA 5FAHA 2Z7FE 5JB9S 5KGOA 2ESTE 4Q2KA 1HIAA 3TJUA 2KCYA 2OTVA 5FX5A 4BTIB 2FO9A 3A87A 2JJ1D 2AH4X 2GX4A 1IQKA 2AYWA 3ZVGA 2H5DA 5KECA 1C5ZB 2EQNA 4AX9H 1ELEE 1K1PA 4WXVA 4IN2A 2OQ5A 1AWHB 4ZXXH 2C8YB 5FPTA 4O03A 3TNTA 1S6LA 1WQVH 4TWYA 2UUFB 2ZPQA 2EY4C 2VIWA 1TA6A 4TPIZ 1VCPA 3TNSA 1SFQB 3UR6A 2BB4A 1O2OA 1TQ0B 1DPOA 2A31A 1O32A 5HIYA 4O9VA 3SI3H 1P11E 3GDVA 1F7ZA 1ANCA 1LPKB 3STJA 1UTMA 1DXPA 1WV7H 1SOZA 1KDQA 5ESTE 5GXPA 5HIZA 1A5HA 1HNEE 1MQ6A 1MU8B 1O2NA 3BEFB 5JB8S 1C1OA 1U6QA 1F5LA 1TIOA 4YXWD 1PPHE 3OY5U 4CBOA 5C0UA 1L1NA 4CH8B 4Y8ZA 3MQKC 1P2NA 4F4OC 8ESTE 4GCHG 1XUGA 4TSFD 1P0SH 3RXIA 4D76A 1Z8IB 2F83A 1FY4A 3W94A 2AGEX 4GHQA 3N7EA 2JJ2D 1W0KD 3K9XB 4WMEA 3UOPA 4ABEA 1OXGA 1MABB 2A4OA 5E2PA 4CHAB 1A4WH 3A8BA 2JH6D 3SV9A 1DSTA 5F8ZA 1E37B 3DSOA 3RXSA 1KXCA 3L3TA 2BLQA 3W1EA 4ZH8A 3BTDE 1DWDH 1WTHD 1CHOF 1ELFA 1T7CA 3DUXH 3RXMA 3SZEA 1MQ5A 1YLDA 5A8YA 1J9CH 3F6UH 2JDID 3AW1A 3E91A 3FP7E 1AB9C 4AN7A 2BTCE 1WUNH 2JH0D 2PUXB 3A8CA 2BDCA 4KTSA 2VIOA 4D7GA 1SLVB 2VIQA 1J16A 1Z1JA 3UR9A 1J8AA 2AGGX 4A1XA 3I29A 4TWWA 2QF3A 1WYKA 1O2KA 2H9EH 2H1UA 3TJNA 1SMFE 1LKBA 3A81A 3MMGA 1MKWH 1UCYH 4VGCC 3Q3KA 1TPOA 4FOUC 3KN2A 3S9CA 3D62A 1AVXA 2ZGCA 1A5GH 4TY7A 3OY6U 5HMAA 1GJBB 1MZAA 1RD3B 4KP0A 4NGAH 1H9HE 1SGRE 1FN6A 3FP6E 2KCOA 2W7SA 1Q3XA 1W13U 2YNAA 4FUFA 4Y7AA 4NIWA 3I77A 4ZKRU 2CK3D 1WQSA 2Y7ZA 5E0GA 1C1VH 3PTNA 1NU7B 1NC6A 1YM0A 1COWD 1NRSH 1GHZA 3SHAH 4XBCA 1P2IA 1O3KA 4FUCA 4QT8C 3KQBA 4ACBA 1P02A 1ANEA 5A09A 1CBWB 1O2UA 3OEHD 1FX0B 2BY7X 2TGTA 2W26A 2PHBA 1BTHH 2TBSA 2BY6X 1V2WT 3VFEA 2WHXA 2Y7XA 2Y6TA 1VCWA 1UHBB 4DURA 1C1RA 2D26C 1SI5H 2QCYA 3LIWA 4OGXA 5EOKA 1TQ7B 5C1UA 1MZDA 1EB1H 1O2JA 1UVSH 1VKYA 2SGQE 4MNXA 5A0AE 1BMNH 1ZMNA 1LO6A 1O39A 2BM2A 3NZIA 3RP2A 2WPDD 1LPGB 2J98A 2WPHS 1THRH 1V2QT 1TX7A 5FBIA 5F8XA 1FMGA 1TRMA 2XBWA 2FI5E 3U1IB 1CHOG 1RTLA 4I32A 3ZZBA 3ZYDA 3E6PH 2D1JA 1GJAB 3RDZA 1P09A 4X6OA 1GBCA 3MH7A 1J17T 1N6XA 3U8OH 3UFAA 1AD8H 1BTZA 1O0DH 3R0FA 3RXLA 1XMNB 4XBBA 1BHXF 1LMWB 2O9QA 1GBBA 2ANYA 2LPRA 5J4QA 2CHAB 1NESE 2W3IA 3NPSA 1GCDA 3LH1A 1G36A 5CHAC 3U9AH 1D3PB 4D9QA 4AG1A 1SGFG 3EYDA 5DP5A 1G32B 2BLWA 4ABHA 1UTJA 2PLXA 1UVOA 4MLFB 1O31A 4AG2A 1YLNA 3Q3YA 1ZZZA 3M3VA 3A7ZA 1AVGH 1UMAH 1TBQH 3DT0H 3ZZ8A 3UNRA 2FOMB 1PQ8A 2BLOA 1G2LA 3RXVA 1HDTH 1SKYE 1KSNA 2CMYA 4ABAA 2ZU5A 2BZ6H 5IK2D 1H9LB 1J14A 1GI4A 2NU1E 1S6HA 1P10A 3LT3A 1CU1A 1BTPA 4B2AA 4BXSA 4JYVH 3SNAA 2DE8A 1SGNE 4NZLA 3S7HB 2C4FH 1F0UA 1BBRH 3LH3A 3PM3A 4A1TA 2KCPA 2G51A 2LNCA 4ISIH 1HAPH 3VGCC 9ESTA 3ZZ7A 4GLYA 1G2MA 1K1IA 4GAWA 1MBQA 1G37A 3A82A 4R0IA 2WPLS 4GHTA 1V2ST 2ZU2A 3NK8A 4FETA 1IQGA 4A92A 1GDUA 4NIXA 5T1VA 1K1JA 4XE4A 1GBTA 2GZ7A 4CRAA 2AMDA 4U30A 1PQ5A 4HGCA 4UDWH 1TNJA 2QXJA 3UNQA 3PV5A 1DM4B 3NKKA 3M61U 3TK9A 1OOKB 3K6ZA 3FFGA 2ZDAH 3MNSA 3P95A 3ZZDA 2NU0E 5DK1A 6CHAB 2KR7A 2J94A 2ZEBA 5DP7A 3GY2A 2K1QA 1P12E 1GI6A 1A3BH 1C1SA 1KYNA 1NS3A 4HG6A 1DITH 1NFWA 1NFYA 3PLBA 1KY9A 2JETC 1QQ4A 2EI7A 4DG4A 2F9UA 1TGNA 3EGKH 3WWBA 5C1XA 1ZTKA 3TK6A 3EDXB 3T27A 3HKIB 2VGCC 1ZTJA 1Y5BT 2BDAA 3DA9B 3RXUA 4CRGA 2PUQH 4IN1A 3LPRA 1OWEA 3NRLA 3DCLA 1O3CA 4FVDA 1KXEA 1O2VA 1BMAA 1GI2A 3A89A 2ZU3A 1SGEE 2ZTXA 2ZPRA 1FY5A 1TPSA 2FOBA 4XFQA 1ZSKA 2OBQA 3ZZ3A 1AQ7A 1C2KA 3RUOA 1DDJA 2KM0A 1IAUA 1AZZA 2A4GA 2V7QD 2R0KA 1GJ5H 5DP9A 1VGCB 1C2DA 1AFQC 3SUDA 1C9PA 3QUMP 2BD9A 2IJD1 2BDYA 2PGBB 1K1NA 3QDZB 3V12A 4YOJA 3F9FA 4TYDA 4E7NA 3BTKE 3RLYH 1A3EH 3ZVAA 2A5IA 4WF8A 4HTCH 2G5VA 5K0HA 1AO5A 1C5VA 4H6SB 1ZTLA 2FZZA 4BOHA 1MUEB 4MPUA 1FAXA 3JZ1B 1NTPA 2HLCA 3M5MA 2QYIA 1EASA 4RT0A 1VR1H 4BAHB 3UQOA 3L6PA 3RXAA 3MU1A 1FI8A 1G3BA 3AAUA 2H9TH 3A7XA 1YCPK 3M37A 4IMZA 3S69A 1CHGA 1O5BB 1O3PB 1YBWA 1EXFA 2VIPA 4M9FA 1AU8A 3C27B 1G3CA 1SB1H 2OBOA 1DY9A 1GG6C 1W0JD 4AYVB 3MO6A 5EW1H 4K8YA 3MH5A 1TYNA 1GDQA 1A1RA 2NWNA 3BTEE 3BTME 1YC0A 4I8KA 1C4U2 4M7GA 2YNBA 1HCGA 2Q6FA 1RIWB 2Z94A 4FU8A 4BNRA 3SU4A 1ZPCA 2FM2A 1KTTB 3UNSA 4H42U 2BX3A 2QF5A 1C1PA 5DSFA 3OU0A 1KXDA 2AMPA 3RMLH 4NZQA 1HIAB 8GCHG 1MD7A 1SQAA 3SJOA 1QY6A 3BTFE 2GZ8A 1SVPA 1OKXA 2FEQH 4DOQA 3GCTG 1P2KA 3FANA 5T3HA 1EP6A 1MAYA 3Q3XA 2GMTC 1O37A 5L2ZH 5DG6A 5A2MH 3KHVA 5GJ4B 1LTOA 2ZDVH 5EXMA 2ZHWH 1SG8B 1W10U 4MPXA 3F2GA 5A8ZA 1GWAA 1W14U 2KCAA 5DN6D 5F53A 1UK4A 1MD8A 1GDNA 1HLTH 1UTNA 3MU5A 2A32A 2FMJA 4KELA 4SGBE 2A0QB 1KDQB 1QL8A 2C90B 2FS8A 1LHCH 1GBJA 1LVBA 1MTVA 1TGTA 2Y82A 5LGOA 1FJSA 1G9IE 2FOEA 1O2PA 1HJAC 2R2WU 4B6EA 1QQUA 1TA2A 1YPKH 2IJOB 1MTNB 3FP8E 4OS5A 1FZZA 3PLKA 1ABIH 2GV6A 3LJOA 1PJPA 2HGTH 2AERH 1ETSH 3RXQA 3OE7D 3OTPA 1TGSZ 2BQ7B 4X8TH 1AE8H 1OYTH 5HGGA 1EFRD 5F6MA 1BT7A 4DCDA 4B2BA 1S83A 1TPAE 3FVFB 5JBAS 2J4IA 1O3IA 3RU4E 1NFUA 2Z3EA 3N7DA 1LCYA 5IYTA 2B9LA 1RFNA 2ANMH 3GYMA 4E06H 4A7IB 4TY6A 3F9GA 1E38B 3GCHC 1G30B 3SW2B 1L4DA 1LDTT 1TB6H 1UTPA 4XSKU 1UK2A 2H5CA 2XTTB 4UFEH 5A8XA 4X8SH 2SFAA 1IQMA 2SNWA 1C5LH 2TRMA 4A5TS 1BRBE 3ATIA 4AORA 1BJUA 5I46H 2FI4E 1FLEE 1AMHA 4YOGA 1SGYE 4B75A 2LP6A 3PROA 1UVUH 1HAXB 3M3SA 1C4V2 1GHWH 1GMHF 2BD3A 3O8BA 1J15A 4MDSA 2SGPE 1NBME 3FAOA 1DANH 1MAXA 2J92A 4X8VH 4YT6H 3QGJA 1EJMA 4MG3A 3GY7A 3FKSD 1C5NH 1NM6A 1E79D 1C1UH 2BMGB 2VVVA 1Z7KA 3VG8A 1MCVA 2K8IA 3O8CA 2NU2E 2RA3A 1CGHA 4E7RG 3BIUH 2ODQA 2P8OC 1C2FA 1V2KT 2XXLA 4KTCA 4CH2B 4UONA 4OS1A 1OWJA 5C67A 1UVPA 3KYGA 4MTBA 2P95A 1AY6H 2QAAA 1MH0A 2HALA 2HLDD 1RTKA 1QA7A 1QL9A 1WAYB 2A4RA 2FYRA 2G4UA 4INKA 3RC4A 5JBBS 2G5NA 5GWZA 1CGIE 3SJ8A 1ZMLA 1A0JA 1IHTH 4YO9A 1C5QA 2BX4A 3U28C 3BV9B 3LDXH 3TPIZ 1ZMJA 2BY5X 3CNRA 2RA0A 3DSPA 4WMDA 2OUAA 2ULLA 1O2ZA 3EE7A 1SGFA 3PB1E 2PV9B 5L30H 1UTOA 4FXGH 3PO1B 5FX6A 2HOBA 4UFDH 1ZOMA 2ZDNA 2GT8A 5HM9A 1C2GA 1W2KH 4INHA 4AYYB 1GI3A 1JOUB 4K2YA 4CHAC 3SI4H 2I6SA 1HGTH 2J98B 3TH3H 1TGCA 1YLCA 1EOJA 2CGAA 1QTFA 5IDKA 1EP5A 3BIVH 2IPHA 3RC6A 3BTQE 2BD4A 1ZRBA 1HJ8A 2F9PA 3H5CB 1ZR0A 5FPYA 3I78A 1O5GH 1YPHC 3A84A 1TBRH 4X2XA 1ELBA 1KXAA 1HUTH 1AKSA 2GV7A 4R8TB 1E1RD 2BD5A 2VU8E 1O3HA 4JZIA 5FPSA 2W3KA 5AF9H 1BDAA 1V2VT 1O3AA 2BXUH 3U98H 1P2MA 1LQDB 1TRYA 5DKMA 4K1EA 3MTYA 2ODYB 2GCHF 3MFJA 3ZZ6A 3OSYA 1GMHG 4OS4A 3RC5A 2PSXA 1W3CA 4Z1MD 4B1TA 2B0FA 2OP9A 3ENSB 1QFKH 3RXOA 1ESTA 1LHDH 4LXBH 4X1PU 4CBNA 2XC4A 2J2UA 4F49A 4NA9H 2ZZUH 1LVYA 2PKAA 3UY9A 1OWIA 4DGJA 3SZNA 2XW9A 1MKWK 4GSOA 1SL3A 4ABIA 1EPTB 3SOSA 1TMTH 5JYIA 1C5YB 3GICB 1YF4A 4YZUA 1PPGE 1OP8A 4LK4A 2WPIS 3ZZCA 1Q31A 1AUJA 1PPBH 4K69A 3SYJA 2HNTC 1AIXH 3ODDA 3VB7A 2EI8A 1WDIA 4AFUA 1E35B 1IQHA 2RG3A 4WJG2 2ZF0H 1H8IH 1O3LA 1JRTA 1GI0A 2HVXA 5ESBA 3F2HA 4ASUD 1S81A 1P9UA 2W5EA 1NO9H 2YMSD 4DW2U 4ISHH 3T25A 1V2TT 5E0HA 1GPZA 2HWLB 4AZ2B 1D3TB 1C5TA 4B76A 2GKVE 2J95A 2QXHA 1GBAA 1HBTH 5EQSA 3KQCA 2FPZA 1CE5A 1EAWA 3RXHA 1D3DB 3ZVDA 1K0HA 1JXPA 2Z9LA 2BD8A 3SU3A 2C8ZB 1EAUA 1TMUH 2XBXA 5C20A 1GBHA 1SLWB 3O8DA 1ZGIA 2WPMS 1HXEH 2WUBA 1Q2WA 3HATH 3SV7A 2VNTA 3LGYA 2V35A 1HAIH 2BY9X 4AFQA 4WWYA 4B71A 4I8GA 4YM9A 4Y0ZE 4NSVA 1BCUH 3N99A 1H1BA 2O8WA 2UWOA 5A0BA 4X1QU 4BTUB 2FXRA 2B7DH 3ODFA 1QIXB 1ELTA 2GCHG 2TGDA 1CVWH 1GJ9B 1DE7H 2F9BH 1O2SA 3LGWA 1AB9B 9LPRA 1RXPA 2UUJB 1NROH 3U8RH 4Q7XA 1LHGH 4CR5A 3H09A 1W0ZU 5T6GA 5C5OA 2Z9JA 2A1DB 4LZ1H 1SQRA 5EQQA 3M36A 4VGCB 3SHCH 3P92A 2OC8A 2WYJA 5F03A 3NCLA 2VINA 1HJ9A 2H2ZA 1QB1A 4NWLA 4H6TA 4Q63A 1C1QA 1GCTC 2WUCA 4Q7YA 1E34B 1AWFH 3E3TA 3LC3A 2A4QA 2YMSB 4WH6A 2O8TA 1BB0B 1O2QA 1AE5A 4X0WU 1BTYA 4Y7BA 2BYAX 1O2RA 1O2XA 2Q6DA 3HGPA 3LJJA 2DE9A 3Q77A 2O8MA 4B2CA 3GY8A 4MQAA 1IQJA 1P06A 2V6NA 1H8HD 1FY8E 1XXFA 3K65B 3F68H 4IC6A 4IMQA 2GP9B 1TNIA 2ZGXH 1H8ED 3IITA 5GCHF 5B6LA 2GCTB 2FP7B 3SBKA 1PPFE 2J5UA 1NN6A 2STAE 1INCA 1PYTD 1YPHE 1A2CH 1V2NT 2PR3A 1JIMA 1GJ4H 3RMMH 2SGDE 3FZZA 3PRBA 2XC0A 4MPWA 1GVKB 2F9OA 4NA7A 1HAVA 1E36B 2QF4A 4FUIA 1AGJA 4GPGA 2VJ1A 1FN8A 5JBTA 3ZVCA 4E05H 1SHHB 1EUFA 2SGAA 1OWDA 2VIDA 5F8TA 3BG4B 4U2WA 2ZU4A 1DUAA 1C5PA 4A6LA 1FXYA 1FNIA 3U69H 3P70B 1PPCE 2QE7D 1ZRKA 1ZHPA 3ITIA 2Q1JA 1THPB 1XUHA 2V0BA 1TNGA 3A80A 4ZKSU 1Y5UT 4FU7A 4Z0KA 4AGJA 2ZHDA 1SQTA 3A8DA 1TOCB 4J1YA 1A5IA 1W0YH 3K6YA 4THNH 5TCCA 1LVMA 4AB8A 3JZ2B 2ZDLA 1RS0A 5CHBA 1B5GH 1HAZB 2P16A 3C1KA 1O5CB 2HNTE 3U1JB 1IQLA 3QX5H 3WW7A 1O5AB 2FIRH 1RRKA 2XWBI 2TIOA 1UTQA 2J38A 1O2IA 4WVPE 3B9FH 1TGBA 3BN9A 5DJ7A 1LQEA 1S0RA 1UTKA 2J34A 4O3TA 2SGEE 2BQ6B 3NUMA 1SSXA 4RT1A 5CHAB 3PTBA 2J9NA 1WXRA 1NPMA 1ESAA 1QR3E 4AFSA 1O3MA 1WOFA 1YPGH 4RN6A 1GHXH 1NFXA 1OP2A 2R2MB 2RDEA 2ZTYA 3A88A 3V7TA 1SFIA 2A2XH 4ABGA 1DX5M 2R0LA 2Y5HA 1HAOH 2GTBA 2Q6GA 1Y5AT 1GJ8B 2ZO3H 2BDGA 3LGIA 2BDBA 3F3BA 3RU4D 4IC5A 2A5KA 3TVJB 2Y5GA 1N8OC 1D9IA 1BMMH 1OPHB 1P8VC 1NRPH 4INLA 1YY3A 2YOLA 3NXPA 1QHRB 1CGJE 1XXDA 4WY3A 3TGJE 4Y10E 1F0SA 3RXPA 8KME2 3PMJA 2F3CE 4ZHMU 3SNDA 3LOXA 1EJNA 2ZFQH 3M7QA 1SPJA 3VB4A 1TE0A 2ZQ2A 2KX4A 3AW0A 1XM1A 2GD4B 3VGCB 2V3MA 4AB9A 1GL1A 3M7UA 1A7SA 1MTWA 2A45B 2QA9E 1S84A 4JCNA 2Y5FA 1GI8B 5E8EH 1ETRH 5DO4H 2R3UA 3W95A 2ANWA 5DPAA 4ZXYH 1ID5H 5C3NA 1ELDE 3IWMA 3KCGH 2VWOA 1ELGA 2VWNA 1TOMH 1O38A 2PWXA 3D23A 1RIWC 2QXIA 2AIQA 1DLEA 5EXLA 3SJIA 3EA8A 2F4LA 2ZHQH 3BSQA 3BTWE 1EZSC 2PKSC 1JIRA 1VJ9U 3L33A 3LKWA 3M7TA 1Z71A 2ZGHA 1KXBA 3TITA 2BDHA 1ZHRA 1E1QD 1AZ8A 1QURH 2NU4E 2K0QA 2WV9A 5G4BA 3MYWA 2GJGA 1GVZA 1CQQA 1CA0C 2ZPSA 4LZ4B 4NIVA 3DFLA 4O97A 1FQ3A 1QJ6B 3VB6A 5C2ZA 4UD9H 1LVOA 1HXFH 1V2PT 2F9VA 1PQ7A 1O35A 2VGCB 2VVUA 1QB6A 1KTSB 1TAWA 3PV2A 4KKDA 2CF8H 2P3UB 2AHME 2FS9A 1BUIA 2C93B 4OGYA 1P2JA 4XRNA 2H9HA 3UQVA 3BF6H 2A7HA 2IOTA 1QRXA 3LGTA 3O8RA 1JBUH 2GGVB 1GHAF 2C8XB 3GCOA 2F43B 2QN5T 5LH8A 3ZV8A 1BITA 4F55A 1SBWA 1GMCF 1GGDC 1C5SA 1IQIA 1DOJA 3M35A 3OEED 4OS2A 2Z9GA 2IPQX 1MMJN 1ZSLA 3VPKA 1O3FA 4I8HA 1CO7E 3U8TH 3CP7A 5T6DA 1BZXE 1O3BA 2XNDD 1NRRH 1Y8TA 2OC0A 3GY3A 1MTNC 1NZQH 1D6WA 4X6NA 5DP4A 1ELAA 1YPEH 4CREA 1YCPH 4Q7ZA 4Q4LA 3SNBA 3ZZAA 1O3EA 1F92A 2XWAA 3SQEE 3URCA 1EB2A 3T2NA 1Y3VA 1O5DH 4Y0YE 3EE0B 1ARCA 1Z1IA 1EX3A 2ALVA 4NFEA 4JYUH 3E0NB 1ZPBA 4FVBA 4CRFA 4A1VA 1JRSA 4BAOB 3UAIC 1KLTA 2CN0H 5L6NH 1C1MA 1EOLA 4DIIH 2G8TA 2G52A 1S0QA 2PTCE 2FX4A 3BTGE 3LU9B 3P17H 1YKTA 2QF0A 3AVZA 3EAJA 1B0EA 3URDA 3ZIAD 3UWIA 2ANKH 3CENA 1C2HA 2VH6A 4K3JA 4UEHH 2ZNKH 4ABDA 1LHFH 1Y3YA 3GY5A 1ZJKA 3D49H 1TNLA 2ALPA 3RXDA 4BXWA 3D65E 1MKXK 1YP9A 2ZGJA 3OX7U 3MNBA 1XUJA 4XBDA 5FCRA 2KFWA 1GMDF 5GIBA 1BQYA 1QBNA 1GI9B 4ZHLU 1UVTH 3PLPA 3RM2H 1DS2E 5EW2H 3A7YA 3KL6A 4UFFH 4P02A 3VXEH 1GI7B 2XRCA 3STIA 1P03A 4IBLH 1AI8H 1OP0A 3MO3A 3ESTA 1C1TA 5EPYA 5LPEA 1OHHD 4RKJB 1QRZA 2PKAB 1VITH 3HGNA 4X2YA 2HPPH 2QGRA 1TABE 2W6ID 2EI6A 3A8AA 2VBCA 3HK6B 1DICA 1GHVH 4ISNA 3MH4A 1GHAG 3G01A 1K2I1 4Y8YA 2BVXH 3ATLA 1ZLRA 4OS7A 2JKHA 1SOTA 1K1MA 4YOIA 3SU2A 1MCTA 3UPEA 1O3NA 3SJ9A 1AFEH 1D4PB 1GMCG 4I86A 2JH5D 1H8DH 3BEIB 4HFPB 2BVRH 2ZU1A 1V6DA 1O5EH 4Y76A 1L4ZA 3KF2A 1EZUC 4D7FA 1BJVA 3T29A 5C1YA 2Z6BD 3HKJB 3KGPA 4XDEA 2FDAA 1W7GH 1DT2A 4X6PA 5DP8A 5CMXH 1O2HA 1GJ6A 4X1NU 3DFJA 1OX1A 4AGKA 2F91A 4YTAA 3GISB 4GCHF 2P59A 1C4Y2 3KQEA 1NY22 2DUCA 1O2GH 2AIPA 1FONA 1QBVH 3GOVB 4JZDH 3ATWA 1GJCB 3GDUA 1MTUA 5GPIB 3LGVA 4CRDA 1BTUA 5EJLA 1W7XH 3T28A 3UIRA 4IGDA 1BMFD 2V3HH 4O3UA 2QIQA 1P01A 3SU6A 4D9RA 2LELA 1QGFA 2BZAA 3V0XA 1FIZA 3SU1A 2B8OH 1C1WH 2BXTH 1QA0A 1W12U 1C5UA 1OWHA 1CSOE 1XVOA 3S9AA 1MBMA 2BD2A 1IQNA 4ZHAA 5LPFA 1UW7A 1O36A 2ZCHP 4YESB 1BTXA 1GBDA 1YGCH 2ZP0H 2D2DA 1O2LA 3F0OA 4ACAA 1DXWA 3CS0A 1OSSA 1GMDG 5GNDA 2UWPA 4ZKOU 1KIGH 3VB3A 1XVMA 3HK3B 2HVYB 5ABWA 2EA3A 2ASUB 2FX6A 3EQ0H 7GCHF 1OS8A 2CJIA 1P9SA 3KIDU 1ORFA 4F48B
chains in the Genus database with same CATH topology
4HI3A 1W8BH 2W7UA 4XOJA 1TMBH 2XYAA 4KTUA 1ZPZA 3M5OA 3PMAB 4FUJA 4NFFA 3QK1A 1GJ7B 1KLJH 3ATMA 1EPTC 1O34A 1C5WB 3SO3A 2BLVA 5EQRA 1ZGVA 2BY8X 2AS9A 3SV6A 2QC2A 3PMHB 3GDSA 4ABFA 2KAIA 1K1OA 1L0ZA 2OQUA 2P8OB 2ZFPH 1O2MA 2ZCLP 1Y3WA 3TIUA 1GL0E 3MU4A 3T26A 1C2IA 1EQ9A 1GHYH 2WV5A 5SGAE 1RGQA 3QLPH 6LPRA 4I31A 1TWXB 2OXSA 3T62A 1IHSH 1UO6A 2R9PA 1UK3A 3E0PB 4X8UH 5EGMA 4PROA 3CS7A 5FBEA 4MNWA 2BQWB 1V2LT 2ZDMA 5JPMH 1K22H 2Z3CA 1UCYK 1TNHA 2QY0B 3F1SB 3RXGA 4H4FA 2Z9IA 1XUIA 3RXRA 3UOUA 1IQFA 1HAVB 2FI3E 1Z8GA 4X1RU 1DLKB 5PTPA 2A5AA 3LONA 2ZA5A 5CE1A 1QBOA 2FOAA 3AASA 3SV8A 3SN8A 1D3QB 1DWCH 3A7TA 1SGPE 4BAKB 4J2YB 4NIYA 3SGQE 3SQHE 1CBWC 2G55A 4SGAE 1HAHH 2WPKS 3RMOH 4Y11E 4OS6A 1C2LA 1L1GA 1TX6A 2FWWA 3S7KB 2A7CA 4D8NA 3A7VA 1C5RA 2B5TB 2GDDA 2ZECA 3P8OA 5AVDA 1EAXA 2ZQ1A 1TLDA 2IN2A 4NWKA 7GCHG 1EZQA 1QJ1B 4FUHA 1AN1E 1PPZA 3ZYEA 1O2TA 1FV9A 3RLWH 3UREA 2F9NA 1Z8RA 2HPQH 3DHKH 1TNKA 4Y6DA 4BTTB 1HYLA 6GCHF 2ZI2H 1GBMA 3MHWU 2ZHEH 3MNCA 4ZAEA 5E2OA 1HFDA 2WYGA 1BIOA 3RXTA 1HPGA 2HRVA 3BG8A 3B8JA 3VXFH 5C5NA 3GY6A 1HRTH 1SGTA 5FHTA 5B6OA 1T8NA 5H4IB 5JDUB 1JWTA 4K5ZA 4WH8A 1TFXA 1QJ7B 3RM0H 1C5XB 2VVCA 4X1SU 2M5TA 3RXCA 3SJKA 2CHAC 3H7OA 1G3EA 5BRRE 3QGNB 1DWEH 3Q00A 7LPRA 3QTOH 1MTSA 1O33A 3QTVH 1NT1A 3IG6B 4X2WA 7KMEH 4ABJA 3VB5A 4B74A 1DVAH 2GCTC 2ZIQH 1GI1A 3RXJA 2OC1A 3ZZ5A 4K1TA 1AVWA 1BTWA 5AFYH 4K60A 1A61H 4X2VA 2UWLA 1GBFA 3PWCA 4IW4E 1C5OH 1DY8A 1ESBA 1QCPA 2Z9KA 4JK6A 1PQAA 1BRAA 2ZG0H 5AFZH 3P8NA 1B7XB 1KLIH 1V2OT 3KNXA 3WY8A 3ZV9A 4DIHH 4JYTA 5GDSH 1K21H 3V13A 1YYY1 5FCKA 4Y8XA 2D8WA 3BG4C 5ETXA 6ESTA 4ZROA 2XCFA 2OD3B 3KQDA 3SNEA 2FLBH 1F5RA 1YCPM 4I8LA 3Q76A 2FYQA 3BTTE 1QNJA 4NA8A 3LC5A 1H4WA 2OLGA 1O3JA 4CRBA 4MPVA 2ILNA 1LKAA 1SGQE 1GI5A 1BBRK 4NSYA 1KXFA 1CA8B 1XUKA 5FXLA 2XNIA 4DJZB 1EATA 3V3MA 2BD7A 1NU9A 1SQOA 5DGJA 1SGDE 1WCZA 2A7JA 3OYPA 3QWCH 2FODA 1BMLA 2AEIH 2ZKSA 1FUJA 1D6RA 1FPHH 1TPPA 1T32A 1T4UH 3TK5A 1QL7A 1SC8U 1WTGH 2XBYA 4YLQH 2O8LA 6CHAC 1F0TA 1A0LA 3TGIE 3LGUA 5J4SA 4GVUA 3MWIU 6GCHG 1RJXB 1L2EA 2RDLA 3KEEA 4IS5A 3MNXA 1LPZB 3GYLB 3S9BA 2VH0A 3E90B 4CR9A 4UFGH 5TCAA 1EPTA 5HM2A 1P3EA 5DP3A 3TH4H 1V2JT 1PYTC 1XKAC 5T6FA 1SGCA 1GCTB 2ZFFH 3ZVEA 1H9IE 2ZWLH 1PPEE 1BRUP 1IQEA 2PTNA 1FPCH 2OINA 3E16B 2ZGBH 3M3TA 4ISOA 3SUGA 4FUDA 2PFEA 5A0CA 4HZHA 3DD2H 4ZMAH 1S5SA 4ASHA 1TX8A 1FAKH 4JK5A 1MU6B 2C3SA 3TJOA 1T31A 1QB9A 4YLUA 3RXFA 1QRWA 1F0RA 1VGCC 2AGIX 4ISLA 1P2QA 4ZUHA 1PFXC 3SV2H 1ELVA 1BOQA 3MU8A 1C5MD 1THSH 1AUTC 4MNYA 2CF9H 2WINI 1W11U 4JZFH 2R3YA 1A0HB 4GUXA 1P05A 4AOQA 3SUFA 1ZJDA 4WXIA 1CT0E 1VZQH 1FIWA 3RU4T 4I7YH 3TJVA 1X7AC 4BANB 3EA9A 1ZYOA 2XCNA 3F9EA 2WPJS 4CRCA 1NRQH 1UTLM 2ZFRH 1VCQA 3E8LA 5GCHG 1O3GA 3HPTB 1K9OE 4FUBA 2H6MA 4RKOB 3MI4A 4X6MA 8GCHF 1UHBA 2Z3DA 1WU1A 4Y79A 3GCTF 1A46H 1Z6JH 2VWLA 1ZSJA 3B23B 1L1JA 3PYHA 2VWMA 5I25A 1F2SE 1GBEA 1XKBC 3PWBA 1C2EA 3SORA 3P8GA 1GVLA 4FU9A 4U01A 1ANBA 4FUEA 2SGFE 3F9HA 4K8BA 2C8WB 5EODA 1SLUB 1TONA 3MH6A 3ZZ4A 1P3CA 3TLOA 3QZRA 1DWBH 3TH2H 2QV1A 3A7WA 4ABBA 3OTJE 1N6YA 1Z8JB 2FOGA 4JZ1A 1V2RT 3M5NA 1IOEA 3A83A 3UTUH 1Y59T 2EEKA 2PW8H 2EC9H 1OYQA 1ACBE 1K28D 2OC7A 1C2MA 1C9TA 5EXNA 3BEUA 1RTFB 1VITF 2O8UA 3VEQB 2A2QH 2FTMA 2JETB 2ZTZA 4DVAU 1N8OB 1SR5C 2AMQA 1Y3UA 7ESTE 1TALA 1OWKA 1CT2E 1HAGE 2VIVA 5JBCS 3T5FH 1TBZH 1XUFA 3ZVFA 1DFPA 1T8LA 3N7OA 4B73A 5HYOA 1C2JA 4DY7B 2ZC9H 1O5FH 1VJAU 4ZKNU 1WSSH 1V2UT 1ABJH 1N1LA 2GZ9A 3S0NA 4NG9H 4ESTE 2ODPA 1EJAA 5EPNA 1P2OA 3UUZA 5K7RA 4AFZA 1FY3A 1O3OA 2FOFA 1YPLH 4YT7H 1UCYE 1K1LA 1AFQB 3QN7A 1T4VH 2AFQB 2TGPZ 2ZDKA 5AHGH 3TGKE 3P8FA 2THFB 1NRNH 3E1XB 1AHTH 2OCVB 1E0FD 1HB0B 2PKSB 1CT4E 1FDPA 2TPIZ 1V2MT 2ZCKP 1JMOH 4JZEH 1GJDB 2ZFSA 2HNTF 3MOCA 4JMYA 1O30A 1P57B 3PMBB 4I8JA 1T8MA 2UUKB 1BRCE 3FZDA 1CA0B 3ZVBA 2P3FH 4FUGA 1UJ1A 2GT7A 2P3TB 8LPRA 3H7TA 2Y81A 1ARBA 1WBGB 3ELAH 2FESH 1EZXC 3QZQA 1GG6B 3P6ZB 1GHBF 4I33A 2I6QA 3ZZ9A 4UE7H 1SHYA 2SNVA 4WMFA 2VB0A 1AKSB 2CV3A 1YPJH 2KAIB 1B0FA 3TU7H 2BHGA 4MVNA 4LOYH 3SNCA 2QXGA 3PV4A 1VITG 4KGAA 5L2YH 1ZHMA 2XBVA 3A86A 1DUEA 1V3XA 1GBLA 1GGDB 2P94A 4U32A 3SUEA 5BPEA 2PSYA 2PGQB 2Y80A 2BOHB 1LHEH 1GBKA 2BDIA 4BAMB 1FY1A 1S6FA 4DT7B 3UWJH 2G81E 1O2YA 3SU5A 2GMTB 1ETTH 2ZHFH 1DSUA 1SGIB 1XX9A 1O3DA 3RXBA 3GY4A 1F5KU 2FTLE 1P04A 1SLXB 3MO9A 2STBE 2FOHA 3SU0A 1S82A 5EG4A 1M9UA 1G3DA 3K2UA 5HXFA 3MU0A 3SGBE 3RMNH 2NU3E 1BHXB 1GBIA 4MNVA 4K1SA 4Y71A 4TPYA 2V3OH 5TJXA 2FLRH 2XC5A 1MKXH 1YPMH 1C1NA 4RSPA 2RCEA 2WV4A 3PO1C 1O2WA 3A85A 1HJAB 2G4TA 5EU8A 2P93A 3QO6A 5E0JA 5DP6A 3RXKA 3ATKA 2CXVA 1BBRE 3AAVA 1HAYB 3GCNA 3NWUA 1EKBB 2GDEH 3R3GB 2BVSH 3M5LA 2TGAA 3RXEA 1Y3XA 2UUYA 1ANDA 5LPRA 1S85A 2GVFA 3BTHE 1TRNA 3EA7A 1GHBG 2ZFTA 1BA8B 1EAIA 2G00A 1T8OA 2FOCA 4BAQB 1HV7A 4NCYA 1ELCA 4Z6AH 4Q80A 3SGAE 1Z6EA 3GCHB 2BOKA 5FAHA 2Z7FE 5JB9S 2ESTE 4Q2KA 1HIAA 3TJUA 2OTVA 5FX5A 4BTIB 2FO9A 3A87A 2AH4X 2GX4A 1IQKA 2AYWA 3ZVGA 2H5DA 1C5ZB 4AX9H 1ELEE 1K1PA 4WXVA 4IN2A 2OQ5A 1AWHB 4ZXXH 2C8YB 5FPTA 4O03A 3TNTA 1WQVH 4TWYA 2UUFB 2ZPQA 2VIWA 1TA6A 4TPIZ 1VCPA 3TNSA 1SFQB 3UR6A 2BB4A 1O2OA 1TQ0B 1DPOA 2A31A 1O32A 3SI3H 4O9VA 1P11E 3GDVA 1F7ZA 1ANCA 1LPKB 3STJA 1UTMA 1DXPA 1WV7H 1SOZA 1KDQA 5ESTE 5GXPA 1A5HA 1HNEE 1MQ6A 1MU8B 1O2NA 3BEFB 5JB8S 1C1OA 1U6QA 1F5LA 1TIOA 1PPHE 3OY5U 4CBOA 1L1NA 4CH8B 4Y8ZA 1P2NA 4F4OC 8ESTE 4GCHG 1XUGA 1P0SH 3RXIA 4D76A 1Z8IB 2F83A 1FY4A 3W94A 2AGEX 4GHQA 3UOPA 3K9XB 4WMEA 4ABEA 1OXGA 2A4OA 5E2PA 4CHAB 1A4WH 3A8BA 2JH6D 3SV9A 1DSTA 5F8ZA 1E37B 3RXSA 1KXCA 3L3TA 2BLQA 4ZH8A 3BTDE 1DWDH 1WTHD 1CHOF 1ELFA 1T7CA 3DUXH 3RXMA 1MQ5A 1YLDA 5A8YA 1J9CH 3F6UH 3AW1A 3E91A 3FP7E 1AB9C 4AN7A 2BTCE 1WUNH 2JH0D 2PUXB 3A8CA 2BDCA 4KTSA 2VIOA 4D7GA 1SLVB 2VIQA 1J16A 1Z1JA 3UR9A 1J8AA 2AGGX 4A1XA 3I29A 4TWWA 2QF3A 1WYKA 1O2KA 2H9EH 2H1UA 3TJNA 1SMFE 1LKBA 3A81A 3MMGA 1MKWH 1UCYH 4VGCC 3Q3KA 1TPOA 3KN2A 3S9CA 3D62A 1AVXA 2ZGCA 1A5GH 4TY7A 3OY6U 5HMAA 1GJBB 1MZAA 1RD3B 4KP0A 4NGAH 1H9HE 1SGRE 1FN6A 3FP6E 2W7SA 1Q3XA 1W13U 2YNAA 4FUFA 4Y7AA 4NIWA 3I77A 4ZKRU 1WQSA 2Y7ZA 5E0GA 1C1VH 3PTNA 1NU7B 1NC6A 1YM0A 1NRSH 1GHZA 3SHAH 4XBCA 1P2IA 1O3KA 4FUCA 4QT8C 3KQBA 1P02A 1ANEA 5A09A 1CBWB 1O2UA 2BY7X 2TGTA 2W26A 2PHBA 1BTHH 2TBSA 2BY6X 1V2WT 3VFEA 2Y7XA 2Y6TA 1VCWA 1UHBB 4DURA 1C1RA 2D26C 1SI5H 2QCYA 3LIWA 4OGXA 5EOKA 1TQ7B 5C1UA 1MZDA 1EB1H 1O2JA 1UVSH 2SGQE 4MNXA 5A0AE 1BMNH 1ZMNA 1LO6A 1O39A 2BM2A 3NZIA 3RP2A 1LPGB 2WPHS 1THRH 1V2QT 1TX7A 5FBIA 5F8XA 1FMGA 1TRMA 2XBWA 2FI5E 3U1IB 1CHOG 1RTLA 4I32A 3ZZBA 3ZYDA 3E6PH 2D1JA 1GJAB 3RDZA 1P09A 4X6OA 1GBCA 3MH7A 1J17T 1N6XA 3U8OH 3UFAA 1AD8H 1BTZA 1O0DH 3R0FA 3RXLA 1XMNB 4XBBA 1BHXF 1LMWB 2O9QA 1GBBA 2ANYA 2LPRA 5J4QA 2CHAB 1NESE 2W3IA 3NPSA 1GCDA 3LH1A 1G36A 5CHAC 3U9AH 1D3PB 4D9QA 4AG1A 1SGFG 3EYDA 5DP5A 1G32B 2BLWA 4ABHA 1UTJA 2PLXA 1UVOA 4MLFB 1O31A 4AG2A 3Q3YA 1ZZZA 3M3VA 3A7ZA 1AVGH 1UMAH 1TBQH 3DT0H 3ZZ8A 3UNRA 2FOMB 1PQ8A 2BLOA 1G2LA 3RXVA 1HDTH 1KSNA 2CMYA 4ABAA 2ZU5A 2BZ6H 1H9LB 1J14A 1GI4A 2NU1E 1S6HA 1P10A 3LT3A 1CU1A 1BTPA 4B2AA 4BXSA 4JYVH 3SNAA 2DE8A 1SGNE 4NZLA 3S7HB 2C4FH 1F0UA 1BBRH 3LH3A 3PM3A 4A1TA 2G51A 2LNCA 4ISIH 1HAPH 3VGCC 9ESTA 3ZZ7A 4GLYA 1G2MA 1K1IA 4GAWA 1MBQA 1G37A 3A82A 4R0IA 2WPLS 4GHTA 1V2ST 2ZU2A 3NK8A 4A92A 1IQGA 1GDUA 4NIXA 1K1JA 4XE4A 1GBTA 2GZ7A 4CRAA 2AMDA 4U30A 1PQ5A 4HGCA 4UDWH 1TNJA 2QXJA 3UNQA 1DM4B 3NKKA 3M61U 3TK9A 1OOKB 3K6ZA 3FFGA 2ZDAH 3MNSA 3P95A 3ZZDA 2NU0E 5DK1A 6CHAB 2J94A 2ZEBA 5DP7A 3GY2A 2K1QA 1P12E 1GI6A 1A3BH 1C1SA 1KYNA 1NS3A 1DITH 1NFWA 1NFYA 3PLBA 1KY9A 2JETC 1QQ4A 2EI7A 4DG4A 2F9UA 1TGNA 3EGKH 5C1XA 1ZTKA 3TK6A 3EDXB 3T27A 3HKIB 2VGCC 1ZTJA 1Y5BT 2BDAA 3DA9B 3RXUA 4CRGA 2PUQH 4IN1A 3LPRA 1OWEA 1O3CA 4FVDA 1KXEA 1O2VA 1BMAA 1GI2A 3A89A 2ZU3A 1SGEE 2ZTXA 2ZPRA 1FY5A 1TPSA 2FOBA 4XFQA 1ZSKA 2OBQA 3ZZ3A 1AQ7A 1C2KA 3RUOA 1DDJA 1IAUA 1AZZA 2A4GA 2R0KA 1GJ5H 5DP9A 1VGCB 1C2DA 1AFQC 3SUDA 1C9PA 3QUMP 2BD9A