4I33A

Crystal structure of hcv ns3/4a r155k protease complexed with compound 4
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFKAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Molecular Mechanism by Which a Potent Hepatitis C Virus NS3-NS4A Protease Inhibitor Overcomes Emergence of Resistance.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i33A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4i33A01
1TAWA 2IN2A 4UFFH 4KGAA 3GDUA 1N8OC 3O8RA 3QGNB 2A5IA 2HPPH 1EB1H 5DP3A 2V3OH 2VWLA 1L2EA 3E90B 4ZUHA 1Q31A 3MO6A 3PLKA 2BZAA 1CVWH 2XWAA 1K28D 2JH5D 1YCPM 2ZDNA 3K9XB 5DGJA 3ZVEA 1W12U 3RDZA 3VGCC 5GXPA 4XBDA 4AYVB 1AE5A 2A0QB 3M5OA 3SBKA 1BBRH 2HOBA 2D2DA 5T6FA 4MPWA 3OYPA 1K9OE 2GT7A 3SW2B 2QA9E 1XX9A 1OWDA 1O36A 3CP7A 4X2YA 4DY7B 4RN6A 3PTBA 4K1EA 1TE0A 1TLDA 2BVRH 2B5TB 2EC9H 4K5ZA 5EW2H 4B1TA 2O8TA 3RU4E 5E0JA 4KTSA 4O3TA 3NUMA 3VPKA 1HPGA 2TGTA 2RA0A 1GJCB 3BEUA 2WPHS 3F9GA 4AYYB 1F0SA 2JH0D 2CJIA 1P2JA 1ZPCA 2QF3A 1SG8B 4E7NA 1AFQC 4OS5A 2ZF0H 3MTYA 5DPAA 5A8ZA 1KXAA 2W7UA 4ZXYH 2F9VA 1PPFE 1Z6JH 2HPQH 4JZFH 2GZ7A 2EI8A 1O3MA 3E6PH 3L33A 1TGTA 5E2OA 1IHSH 1LVOA 4DIHH 1NC6A 2G4TA 2PFEA 1O34A 1OYTH 4CBNA 3TGJE 2BD5A 3FVFB 2BQWB 2GVFA 2HNTC 3F9EA 1CHOF 1GJ5H 1DT2A 1KXEA 2FEQH 3K65B 3AAUA 1UTNA 3FP8E 2V35A 1DANH 4NIXA 1GJAB 3QLPH 1DUAA 2WUCA 4BANB 4TYDA 3SGBE 1E37B 1QJ6B 1DLKB 3OY5U 2ZFSA 4B6EA 1S6HA 2BLQA 5EG4A 4WMEA 3F6UH 2R3YA 3I29A 4IN1A 4Y7BA 1WUNH 3ZZCA 2VINA 2J34A 2CGAA 5F6MA 3E91A 2P8OB 2NU2E 4O3UA 1O2NA 1FPHH 1MTSA 2J9NA 3BEFB 3Q3KA 4I8LA 4H6SB 1GMDG 3SQHE 1AB9B 1QGFA 4FVDA 1HFDA 5T3HA 3SV8A 2FO9A 4ZMAH 1T8NA 1YCPK 1IQGA 3LU9B 2R2WU 2B9LA 2NU0E 2ZFQH 1IOEA 1O3JA 4TY7A 4ISHH 1WXRA 3TNTA 3TJOA 3B9FH 1GVZA 1ZMNA 3RXRA 1Y3UA 2P8OC 3Q3XA 1A7SA 1ELDE 1GJ4H 4Q80A 1MZAA 3RMNH 1K21H 3GY8A 3SYJA 2NWNA 1NTPA 1GJ9B 3LONA 1A4WH 8ESTE 3LIWA 3EDXB 4F4OC 1AY6H 4A92A 1GWAA 2FYRA 3NK8A 1ELTA 1XM1A 3UY9A 1O5GH 1AGJA 4HZHA 1JOUB 2J2UA 3SUDA 2AIQA 1A5GH 1TQ0B 1UO6A 2Z3CA 1HIAA 5H4IB 1MKWK 1BMNH 2VNTA 1Z8RA 2G52A 1HYLA 3A88A 2G81E 2PUXB 2ODPA 3E3TA 1TRMA 3SV2H 2V6NA 4TPYA 5FBEA 2PGQB 3AK5A 1WQSA 4D8NA 1A2CH 1BUIA 1UTPA 1BRAA 3SHAH 1BHXF 3GCTF 4OGXA 1LTOA 3A7YA 2ZA5A 1O39A 4NIYA 2VGCB 4B73A 4INLA 4NSVA 3JZ1B 2ZFRH 4IBLH 2FZZA 1FY1A 1KTTB 1UVPA 3RUOA 2FS9A 3SJOA 1QJ1B 1C1NA 1GI3A 2Z9GA 1K1JA 3OSYA 4Q7ZA 3SU4A 1PJPA 3W95A 3SGAE 2ZDAH 1NRRH 2PGBB 5EU8A 5GPIB 2HVXA 5CHAC 1TNGA 1TPAE 3GICB 3LH1A 4DT7B 4YO9A 2W7SA 1DLEA 3NKKA 3K2UA 1GI5A 1V2MT 2WZQA 3UNRA 1EJAA 5EPYA 1ARCA 5T1VA 1L1GA 5LPRA 5EXLA 1HBTH 3NXPA 3MOCA 2YNBA 5C20A 3RXEA 3SNDA 4INHA 1YLCA 1DVAH 1ZMJA 1QY6A 1K22H 3TGIE 1S85A 2A1DB 1P2MA 3PV2A 2ZQ1A 4Q7XA 2O9QA 2IOTA 3I77A 1GBBA 5FPSA 3SJ9A 2C8ZB 1F92A 3KQBA 2ALVA 4A1TA 5JB9S 1ID5H 1RJXB 2RDLA 4YOGA 2H5CA 2J4IA 1EZXC 5HXFA 2PTCE 2ZU3A 3ZZAA 3QUMP 4KTUA 1AUJA 2BLWA 3MH6A 3MI4A 2VWNA 2V3HH 2C8YB 1GHYH 4ZXXH 4X6OA 1UCYH 1YC0A 2G8TA 1GL1A 2AYWA 2F9OA 4Z0KA 1IAUA 1J16A 2A4RA 3DUXH 3RC6A 5GCHF 3C1KA 1V2JT 4CREA 4YTAA 1YYY1 5F03A 2F91A 3MWIU 1KXCA 1TPSA 5DG6A 4ZKOU 2H1UA 3LGIA 4X8VH 2Y5GA 2XXLA 3MH4A 1V2ST 1D3PB 1SR5C 3GCHC 2BDBA 1BB0B 3BTQE 2ZHWH 2AGEX 4R0IA 1IQFA 1AE8H 1GBEA 1RD3B 1V2OT 2BDCA 2YNAA 4ZKRU 1XUJA 1UTLM 1O2QA 4FU9A 3URDA 3LGUA 1GJ6A 4E05H 2ZTZA 1P0SH 1Z1IA 2STAE 3BV9B 3PWCA 1O2SA 1SL3A 1NN6A 5JBAS 2P3UB 1DY8A 1GI2A 1TMTH 4JK6A 1J9CH 1EAIA 1DWBH 4CRCA 4ZH8A 1G2MA 1ZTKA 2BY5X 3ZVCA 2G5VA 3MNBA 2OQ5A 4JZDH 3EAJA 3ZZ6A 4NFFA 1NU9A 1EAXA 1SFQB 4CRGA 3E0NB 1TGCA 2FXRA 4GPGA 5FX5A 1RIWB 2C8XB 2H2ZA 1C1RA 4JZIA 3ODDA 3MMGA 1P09A 1G30B 2Y5FA 2AEIH 3LC5A 5SGAE 1QA7A 3BTTE 1BRCE 1GBMA 1CSOE 1SGTA 1F2SE 1MCTA 3H5CB 3UNSA 1ELVA 1ZGVA 1TBZH 1SGYE 2BD9A 3HPTB 2A5AA 1WV7H 2GT8A 1P10A 1UK3A 1E35B 3BG4B 1TWXB 1HXFH 3A82A 4AZ2B 1LHDH 1RIWC 1BZXE 4NCYA 3RC4A 2B8OH 1S83A 4Z6AH 1C1QA 3TJNA 4TY6A 2KAIA 1AVGH 1SVPA 1SGDE 2WPLS 2K1QA 1Y3XA 5TJXA 2BDHA 2LPRA 3SJ8A 1KXBA 5ESBA 1Z71A 1IQIA 3BSQA 1OWIA 4J1YA 5C2ZA 1FJSA 1TBQH 3A84A 4Y76A 4X8SH 3HK6B 2TGPZ 4INKA 3BG4C 1C5XB 1J17T 2AFQB 2BD2A 1GJDB 3RXPA 4NA8A 2ZHEH 2AGGX 2FDAA 2PKSC 2QCYA 3T28A 5C67A 1BJUA 3STIA 2ZEBA 3DD2H 4DCDA 3C27B 2OD3B 2XC4A 3QX5H 4U30A 2J95A 1SGFG 4FUHA 1QA0A 2TBSA 5A0CA 5HM9A 2BXTH 5LH8A 3FANA 1P05A 3SI4H 1OKXA 3A7TA 1C5UA 2GDDA 2BQ6B 2AERH 3L6PA 1SLUB 3MNSA 4ISLA 2OBOA 5TCAA 5JDUB 1P2OA 2VBCA 1AQ7A 5FCKA 2WYGA 3LPRA 1TBRH 1OPHB 1OP2A 2JETB 3HK3B 3PO1B 2TIOA 1HAVA 3TK5A 1ELAA 1GBJA 4UDWH 4JMYA 2I6QA 2ZGJA 4YOJA 3UNQA 1T4VH 3R3GB 3VXEH 3SGQE 1E38B 1ORFA 2OC8A 1RS0A 1S0RA 3IITA 4YT6H 3U8OH 4CBOA 2BX4A 4XE4A 1VJ9U 1B0EA 1ELFA 4OS6A 4XOJA 1DM4B 1O2UA 4WXVA 1GCTB 1O2IA 3LGVA 1V2NT 4OGYA 2WYJA 4ZHLU 1AN1E 1F5LA 1GI7B 4K2YA 1P2KA 4GHQA 2XBWA 3RXJA 2BVXH 3PO1C 2H9HA 1O3CA 4LZ1H 1ZYOA 1P3EA 1TALA 1T8MA 1MZDA 4YESB 5FBIA 1SGNE 1Y3VA 2ZGXH 2Y6TA 4GCHF 5A8YA 5LPFA 2ZPSA 4K8YA 1OP0A 1HUTH 1G32B 1TNIA 4FU7A 1BJVA 3A7XA 1ANEA 3PMBB 3MU4A 2ZDVH 3ZVBA 1ZPBA 2GKVE 3A81A 2BYAX 4LZ4B 1AD8H 1E34B 1O5EH 1GI8B 2ZFPH 3BIUH 1WSSH 2F9NA 4BAHB 1HB0B 4JZ1A 2LNCA 1BDAA 2OCVB 3O8BA 3GY3A 1PQ5A 1TONA 1YKTA 3TVJB 3SU2A 5L30H 2HNTF 1ZLRA 1GGDC 1GHVH 1ESAA 1EXFA 4MDSA 4K69A 1FY4A 1UVSH 1DS2E 4K60A 3KF2A 4DURA 1RRKA 1QRZA 1FUJA 3T2NA 2D1JA 1P2NA 1D6WA 2HRVA 3ZV8A 1S84A 1HIAB 1O2YA 3MO3A 2FPZA 3M7UA 3VB5A 4WY3A 4WMDA 1SHYA 3SNBA 4XBBA 1FXYA 1LHFH 3H7TA 5FXLA 4XFQA 4B71A 1KIGH 4MTBA 1P8VC 1F7ZA 1QRXA 2XBXA 1O3PB 1QJ7B 1C2IA 4DOQA 1SSXA 2ZDLA 1AWFH 2ODYB 4NG9H 1G3EA 3OTJE 3SJKA 1QBVH 3VEQB 3A8DA 1CHGA 5JBBS 4LOYH 1O37A 2Z9IA 4Y10E 1MBMA 1ANCA 3GCTG 1VCWA 1GVLA 3QZRA 2P3TB 1PFXC 1YPEH 5AFZH 4X2XA 1ZGIA 3GY2A 2GZ9A 2XC0A 3MYWA 4A7IB 1IQNA 1O3BA 4ZHMU 1QQ4A 1LVMA 3RXGA 1O2RA 1O5AB 2ANKH 4ISOA 4UFGH 2ZP0H 4AFUA 3FP7E 4BAOB 1TNJA 3M5NA 1ZSLA 5T6DA 4NIVA 2QN5T 5T6GA 1CGIE 3TK6A 2O8WA 4MVNA 4B6FA 3STJA 3SNEA 1QRWA 3GYLB 2FLRH 4IS5A 1MTUA 5HGGA 3SNAA 2CF8H 1KLTA 3ZVDA 2VB0A 1J14A 5BPEA 3BTGE 1V3XA 2D8WA 3LKWA 1BRUP 3PLBA 4ABEA 2GDEH 1G2LA 1LQDB 1GJ8B 2OK5A 3RXUA 4CRBA 2XBYA 2ZECA 1K1PA 2FI3E 2Y7XA 1AKSA 1KSNA 3SV9A 3M5LA 1JRTA 1NROH 1MTVA 4Y8XA 2O8MA 2QAAA 2Y7ZA 1VZQH 2ZKSA 3ZYDA 3DFJA 5LPEA 1C4V2 1KYNA 1A5IA 5DO4H 5ESTE 3E8LA 3ZZ4A 2A5KA 3SU3A 1C5YB 1OXGA 1KY9A 1UTJA 1GBLA 2R2MB 5DP4A 2ZHQH 2WV9A 1G37A 5DP9A 2ODQA 2VIQA 1LHCH 5DP5A 1HJ9A 3A8CA 1H9LB 3CS7A 1UVUH 1SFIA 2SFAA 3BN9A 2ZZUH 1THPB 1TNLA 2BD8A 4CRDA 2QV1A 3GY7A 5E8EH 1C2JA 1NRSH 2M5TA 1U6QA 2CF9H 5GCHG 4AB9A 4DVAU 1HAOH 3UR9A 2Q6DA 4FVBA 3PV4A 3MH5A 4X6PA 3CENA 3TLOA 3AVZA 3M3SA 6ESTA 1EATA 3MFJA 2BHGA 1IQHA 3M35A 3V3MA 1W7XH 1CGHA 1G3CA 2UUJB 4FUJA 3ZVFA 4Q2KA 1FQ3A 1LQEA 4IMQA 3F9HA 1O3GA 1MUEB 5B6OA 1D9IA 1JRSA 1O2TA 1A46H 2J38A 1EPTA 4JYUH 1AZZA 2H9EH 1FZZA 1P01A 1SI5H 1ZOMA 2AMPA 1O3KA 2A4GA 1D4PB 2HWLB 1GHBG 4Y71A 2GCTB 1B7XB 4BAQB 2BX3A 2BTCE 3FZZA 4U32A 3I78A 1DUEA 1HAIH 2J94A 1P2IA 2FOEA 1C5LH 3KHVA 8LPRA 1NESE 1E36B 8KME2 1ANBA 1NT1A 4LXBH 3RXOA 3LGTA 1XVMA 4RKJB 2W26A 3U8TH 1ZTLA 2Z7FE 3F68H 4BXWA 1XMNB 1RTLA 2FX6A 5J4QA 1CT4E 5TCCA 2FX4A 1AB9C 2SGDE 2GCTC 1TA6A 3BTEE 1W14U 1L4ZA 1T32A 5FPYA 1EZUC 2BLVA 3ZZ5A 3RXCA 1GHZA 5GNDA 1UHBA 4ABJA 1DWEH 2QGRA 3PMHB 1C1UH 1UTMA 3G01A 2SNVA 4FUGA 1EZQA 4YOIA 2KAIB 2R3UA 4UFDH 1AIXH 1UK2A 1W7GH 1O3EA 3ENSB 1IQJA 1GJBB 3RM2H 1RXPA 5C1XA 2XBVA 4GLYA 2H5DA 3PMJA 6CHAB 3U9AH 3AASA 2ZTXA 3KNXA 1RTKA 2FTLE 2C93B 3TGKE 1ARBA 1HJ8A 2CV3A 2F3CE 3Q3YA 1QTFA 1XUGA 1C2HA 2A2QH 2VH6A 1VITH 4I32A 4A1XA 1EZSC 2UWLA 2GP9B 2ESTE 1TB6H 2BD3A 2CMYA 1FONA 1CT0E 1OWEA 1YPLH 5EQRA 4NWKA 2PUQH 2C8WB 4NA9H 1UJ1A 1UVTH 3UUZA 1O2GH 4IGDA 3A89A 4BTUB 1DX5M 3DA9B 2PLXA 3QN7A 3M5MA 1LMWB 3OU0A 4WVPE 1X7AC 2QC2A 2VGCC 5C5OA 1HAXB 2WUBA 2R0KA 1HAGE 4I8KA 3H09A 5C1UA 4LK4A 1HAVB 5E2PA 1UTKA 3TH3H 3RC5A 1ELBA 3SUEA 3KQCA 3RXQA 1PPZA 2BZ6H 4DGJA 5EXNA 5L2ZH 3AAVA 5JYIA 3VXFH 5DJ7A 1PYTD 2G55A 2HALA 1VCQA 2FOBA 3PTNA 1A0HB 1VITG 1LKAA 3VFEA 4YZUA 2ZIQH 1O2JA 3Q00A 3RXHA 3ZV9A 2O8LA 2OBQA 1E0FD 1QNJA 1YCPH 4AG1A 2SGQE 4DJZB 1EB2A 1K1NA 4UD9H 3KGPA 4DW2U 1O5FH 5E0GA 5EOKA 4X2WA 1XVOA 1WCZA 1EOLA 5HM2A 2BDAA 1XKBC 5J4SA 3FFGA 2BM2A 1P3CA 4AFSA 1DOJA 1H9HE 3EA8A 1GHAG 3RXLA 1SBWA 1NFUA 4M7GA 1DSUA 2C3SA 3T29A 1H1BA 1OOKB 3LGYA 1V2UT 2ZQ2A 3D62A 1CBWB 3LOXA 3TIUA 2BDIA 2P93A 1DE7H 4GCHG 4SGAE 1LHGH 1UTQA 3A7VA 4B2AA 1TGSZ 3JZ2B 4R8TB 4MNYA 1C9PA 1L0ZA 1NFWA 4RSPA 1S82A 1MKWH 2ALPA 3BTKE 1W11U 1EAUA 2XCFA 1ZRBA 2SGFE 5K0HA 3ZVAA 1GHBF 3LT3A 3TU7H 7ESTE 2ZU2A 5ABWA 3BTME 4MLFB 1OSSA 3M37A 2VIWA 4RI0A 3GY6A 4CR5A 1GMHF 5IDKA 1CBWC 1LDTT 1PPHE 1OWJA 3V0XA 3SI3H 4ABIA 2FWWA 4WH6A 1XUIA 1D3DB 4GVUA 1BA8B 4AG2A 1O3DA 3MU0A 2CHAB 3PROA 2QY0B 4O03A 3VB3A 1B0FA 2VU8E 1CE5A 2BOHB 1ACBE 3TH2H 1Y5AT 1THRH 5EPNA 1ZHMA 1BCUH 1SQOA 1YBWA 1F0RA 1YPJH 3BTFE 1Z8GA 1GBIA 1FPCH 1O0DH 3ATLA 1FLEE 3O8DA 3KQDA 3M36A 1AUTC 3HKJB 1BQYA 1DICA 1C5RA 3BG8A 2Z9LA 5CE1A 1K1LA 1UK4A 2CHAC 2VIOA 1XXDA 4A6LA 4WF8A 2O8UA 3UQOA 1C1WH 1ZJKA 2XRCA 3DHKH 1H8IH 3S9BA 1TRYA 2PR3A 2AH4X 2PHBA 5A8XA 1BOQA 2QXHA 5DP6A 2WPMS 1F0TA 1TOMH 3K6ZA 1EKBB 3A7ZA 1NFXA 3NZIA 2TGDA 1ABJH 3LDXH 2Q6GA 1V2LT 2AGIX 2F9UA 4BTTB 1ELCA 1TFXA 5B6LA 3A85A 3ZZ8A 2GCHG 3F9FA 3RXMA 3MNCA 1CU1A 1DSTA 4ZROA 1ZHRA 3QZQA 1MCVA 1C4Y2 1S6FA 1TYNA 3UIRA 1NPMA 1P12E 3ESTA 1NU7B 4YLQH 3TNSA 1AKSB 5DKMA 2BMGB 4AFQA 2Y81A 3P17H 1CA8B 2SGAA 2OUAA 1O5BB 3QGJA 1BMMH 2PTNA 1WOFA 1Z1JA 5AF9H 4MPUA 1SPJA 5DP8A 4O9VA 2GGVB 3FAOA 5EQQA 3RXSA 1ZHPA 1YF4A 4K3JA 1C1SA 1M9UA 3LC3A 4WJG2 4ABHA 1GHWH 6GCHG 1DXWA 1WBGB 1CGJE 2VIPA 1W3CA 4IMZA 3UOUA 2UUFB 1JIRA 3HGNA 3ODFA 4FUEA 4BOHA 4NWLA 1HGTH 3EGKH 1OX1A 1C5TA 1C2EA 1O5DH 3RXKA 1HAYB 1VITF 4Q7YA 3W94A 1BT7A 1BBRE 2ZGBH 1HCGA 2P95A 1O3FA 4AGJA 4FUCA 1UMAH 4MNXA 1C2KA 1PQ8A 2FOMB 4MG3A 1NRPH 2OTVA 1C5OH 1D6RA 1L1JA 2ZDMA 2ZCLP 2Y5HA 1A1RA 4KTCA 2AIPA 2F9BH 1HLTH 2JETC 3E1XB 3TH4H 3IG6B 5AHGH 9ESTA 1GHAF 2QF0A 5EXMA 1GI4A 3LGWA 4A5TS 1EPTB 1K1OA 1ESTA 5A0AE 2BDGA 2QXGA 5FPTA 2RG3A 2Z94A 3A7WA 2A31A 1QCPA 5EQSA 1QR3E 5L2YH 4QT8C 2ZPQA 3UOPA 2JH6D 3T5FH 1W8BH 3U8RH 3OTPA 4TWWA 4I31A 4ABFA 4OM9A 1FY5A 5DP7A 2WPIS 1MD7A 3NPSA 4ABBA 3S7HB 1O2KA 1GBTA 1JIMA 1GCTC 3LH3A 3U98H 1RFNA 4I8JA 2TGAA 2UUKB 1AVWA 1PPEE 1Z6EA 3OX7U 3A86A 4I33A 1YPMH 5A0BA 1FAKH 3KN2A 1QQUA 1AO5A 2Z6BD 2THFB 3S9CA 1EPTC 1GI9B 1PQAA 2FM2A 1SGCA 1BTXA 2ZCKP 2PV9B 5FCRA 1SGIB 1Y5BT 4FUDA 4CRFA 1P11E 1XUFA 3R0FA 2FIRH 1ABIH 2ZNKH 3PLPA 4ZAEA 1H9IE 1P04A 1V2PT 3TPIZ 1FMGA 1EP5A 3SORA 1UHBB 1OWKA 2FMJA 1Z8JB 2ZHFH 1TABE 2YOLA 2BVSH 2IPHA 2GV6A 1ZMLA 1TQ7B 4ESTE 2XTTB 3U69H 1P57B 1Y5UT 3UWJH 2FP7B 3Q76A 2VWMA 1NFYA 2C90B 2FLBH 1QL9A 1TX6A 3IWMA 1TPPA 1A61H 4J2YB 1MAYA 3RXFA 4D9QA 1SHHB 1C2GA 2UWPA 3OY6U 2ZPRA 3KEEA 1K1MA 1P2QA 3MU1A 4DG4A 1K2I1 3VB7A 2ILNA 2BD4A 1O2HA 2PKAA 3GOVB 1JWTA 1ZJDA 1O3NA 3B8JA 1O3OA 2GZ8A 1DFPA 3EYDA 1WTHD 2P16A 1SB1H 1GJ7B 3LJJA 1V2RT 3ZVGA 2DUCA 4HTCH 3RMMH 3ZZDA 1C5NH 4JZEH 1WTGH 4YM9A 1YPHE 4ZKNU 3RLWH 1XUKA 3UREA 5JBTA 1FN6A 2Z3DA 5LGOA 2GCHF 4X6MA 1C2MA 2ANWA 3B23B 1AWHB 1N6YA 1SC8U 1TA2A 1G3DA 2XNIA 1AVXA 4AN7A 1QL7A 1TMUH 1O2VA 4VGCB 1MKXK 1V6DA 3TK9A 4UONA 1TRNA 2P59A 5GJ4B 1KLIH 4BNRA 4OS4A 5JBCS 2SGPE 1MTNB 3NCLA 1AFQB 1BTPA 4AFZA 4Y6DA 2TPIZ 5C3NA 1GMCG 3GY5A 2BLOA 1PPBH 2FOCA 3RMOH 1HV7A 1TNKA 2I6SA 1GBFA 3VB6A 4AX9H 4TWYA 4KKDA 3NWUA 1A3BH 1EOJA 6GCHF 1BTYA 5F8ZA 2P94A 3BTWE 5ETXA 1K1IA 3ELAH 2VIVA 2SNWA 3MNXA 4Y7AA 2FI4E 3AW1A 2BD7A 2ZTYA 7GCHG 4VGCC 3MO9A 1SOTA 4OS1A 5BRRE 1C9TA 3T25A 1PQ7A 4Y79A 1SMFE 1MTNC 2OINA 1ANDA 1CA0B 3ZZBA 2BDYA 3GISB 1EQ9A 4K1TA 3BIVH 2VH0A 1WU1A 1CO7E 3DFLA 4X2VA 4X1PU 3BTHE 2Q6FA 4U2WA 2PSYA 2NU1E 5E0HA 3N7OA 3QK1A 1LPZB 3RM0H 1IQMA 4AOQA 2RA3A 1GDUA 1BMLA 1RGQA 2CXVA 1WQVH 1A3EH 2OXSA 2XW9A 1SGEE 2G00A 4BTIB 2ZU1A 1AHTH 3ATKA 1F5KU 3RXBA 1H4WA 4GHTA 4HGCA 1CA0C 3PV5A 4ABAA 2OC0A 3PB1E 1O3AA 3PM3A 1DDJA 4D76A 2CN0H 1MTWA 1QB6A 4D7GA 1VJAU 2IJOB 1UVOA 2H6MA 4D7FA 1GI0A 2BY8X 1QL8A 1T8OA 3T62A 1O2PA 4GSOA 1EUFA 1AFEH 1HDTH 1TGNA 2A4QA 1TX7A 2AMQA 3PWBA 5PTPA 3Q77A 3SO3A 2SGEE 5FHTA 1BITA 5GIBA 4B2BA 1LPKB 2FI5E 1TX8A 1NM6A 1IQKA 1O2WA 4WMFA 1H8DH 4CH8B 1UCYE 2Z9KA 1GMHG 2ZDKA 1BTZA 1B5GH 4UFEH 1YPGH 2HNTE 4H42U 1C2FA 2WINI 3BEIB 1BRBE 1GI1A 2ZWLH 4NGAH 3V7TA 1HAPH 1J8AA 3SJIA 3P70B 5A09A 1C1MA 2GX4A 2FODA 4UEHH 2F4LA 3A8AA 1UTOA 1D3QB 4X1NU 1ZZZA 2BY6X 5IYTA 1C2LA 1EAWA 1LVYA 2XWBI 4CHAB 1NO9H 3F1SB 3P8OA 4JCNA 3URCA 1THSH 1UCYK 4JYVH 7KMEH 1N1LA 1LKBA 2W5EA 5L6NH 1MKXH 1NRQH 1O31A 2ZFTA 3ATIA 3BF6H 2BY7X 2EI7A 2Q1JA 2ZU4A 1KXDA 2R0LA 3M3TA 1Q2WA 3SQEE 4ABGA 1MH0A 1KDQA 4Y0ZE 1TGBA 4I8HA 5EGMA 4ISNA 7LPRA 4JYTA 1CT2E 3PYHA 1G36A 3P8FA 1JMOH 1KLJH 1BTUA 2OC1A 5F8TA 1MBQA 1MQ6A 2QXJA 1FIZA 4CHAC 3U1JB 3HGPA 1IQLA 3SHCH 1FN8A 4BXSA 3WY8A 2ZFFH 4HI3A 1C2DA 4UE7H 1V2QT 3SV6A 5CHAB 2QYIA 3A87A 4ABDA 1LHEH 1V2WT 4FU8A 2OLGA 2OC7A 1EJNA 1V2TT 3A8BA 1ZPZA 4MNWA 3U1IB 2A7HA 1Y3YA 1LO6A 3D49H 4NA7A 4WH8A 3S69A 2F83A 3UTUH 2ZHDA 1T8LA 1DY9A 1W2KH 1TMBH 3M61U 5I46H 1N6XA 1T7CA 1O3LA 6CHAC 4F49A 4DIIH 4H4FA 2W3IA 1FY8E 1XUHA 2IJD1 3V13A 1P06A 2FTMA 4E7RG 1O3IA 1AZ8A 1GBCA 4Y0YE 1GMCF 1GL0E 3SNCA 4OS7A 3M3VA 2Y82A 2DE9A 3A83A 4YLUA 5GDSH 3ZZ3A 3HATH 1NY22 4GUXA 2B7DH 4X0WU 2ZGHA 4D9RA 1V2KT 1VCPA 3SUGA 4IN2A 4IC6A 1TIOA 1JXPA 2W3KA 1NZQH 4RKOB 3P8GA 1AI8H 7GCHF 3M7QA 1C4U2 4X8TH 4NSYA 3LJOA 5F8XA 1SLXB 6LPRA 2FOFA 3SUFA 3EQ0H 1BMAA 2UUYA 1QB1A 1W10U 1A0LA 3T27A 1GBDA 1P9UA 1A5HA 2TRMA 1ZSJA 3UR6A 1C1TA 1GVKB 3ATWA 1AMHA 1DWDH 4KP0A 4Y8ZA 4H6TA 1W13U 1LCYA 3ZZ9A 2A4OA 4Y8YA 4ISIH 3SU1A 1ETRH 1HRTH 2STBE 5C5NA 1F0UA 2A32A 1OYQA 1O2ZA 2VWOA 2FESH 1J15A 3MU8A 2FOAA 4XSKU 2ANYA 2XC5A 3GCHB 3SU0A 2ZC9H 1SQAA 2OQUA 1C1VH 3RXVA 3MH7A 4B2CA 4BAKB 1EP6A 2PSXA 1DXPA 4ASHA 1BIOA 1XKAC 1ESBA 2VVCA 4Y11E 1BHXB 2XCNA 1C5WB 2BXUH 2GTBA 4A1VA 1SQTA 3P8NA 1ELGA 5FAHA 1WYKA 1QBNA 1BTWA 5AFYH 1L1NA 5AVDA 3KQEA 1P9SA 4NZLA 3RXTA 1O3HA 1EJMA 1YP9A 1O30A 3P95A 3E0PB 5EODA 5JB8S 1Y8TA 3A80A 2BB4A 2VVUA 8GCHG 4FUFA 3UPEA 1GMDF 1FAXA 1OS8A 1ELEE 2QXIA 3CS0A 3M7TA 4NIWA 1XXFA 1C1OA 4PROA 2UWOA 3UFAA 3QDZB 3GCNA 5G4BA 3RP2A 1Z7KA 9LPRA 1MMJN 1DPOA 1HNEE 1Q3XA 5A2MH 2PKAB 1MQ5A 4AB8A 4X8UH 4I8GA 1O2MA 3FZDA 1SGFA 4SGBE 1GBAA 1Z8IB 1PYTC 2OP9A 3SU5A 1HXEH 3QTOH 4B75A 2AS9A 5K7RA 3RXAA 2GMTB 1YM0A 1IQEA 2ZG0H 3KL6A 5I25A 4IC5A 1O2LA 1T4UH 1O33A 2Z9JA 2WV5A 2R9PA 1O38A 3BTDE 2ASUB 3UQVA 2P3FH 2HGTH 4MPXA 2EA3A 1KTSB 2DE8A 4MNVA 4WWYA 2GD4B 4E06H 4OS2A 1RTFB 1YPKH 1EASA 1YLDA 2F9PA 3SU6A 3ZZ7A 1GDQA 1QHRB 2PKSB 3QO6A 3H7OA 2BY9X 2EEKA 2GMTC 1PPGE 1QB9A 1W0YH 3D23A 1SGQE 1YGCH 2ANMH 3P92A 3L3TA 2A7CA 1O32A 2JKHA 1S5SA 3TJVA 1QURH 3EA7A 5DK1A 1Y59T 2EI6A 1NRNH 4CRAA 1S81A 1S0QA 2VJ1A 4KELA 3UWIA 4ZHAA 1GG6B 1NS3A 1O2XA 1V2VT 5C1YA 3S7KB 2WV4A 2FYQA 1TPOA 1VGCB 2H9TH 3D65E 3O8CA 4X6NA 2FS8A 2NU4E 1GBHA 3RU4T 2D26C 1GHXH 4BAMB 1FDPA 3GDVA 2GV7A 3SN8A 4CH2B 2WPJS 1SLWB 4B76A 2A7JA 3SV7A 1ETTH 1HJAB 3QTVH 1ZSKA 1O2OA 3SZNA 1G9IE 4NFEA 4WXIA 2VVVA 3RXDA 1FV9A 4GAWA 3TITA 1PPCE 1MAXA 1OWHA 2BQ7B 1JBUH 2G5NA 2BOKA 1HAZB 3GDSA 3KIDU 3RLYH 1GG6C 1LVBA 1GCDA 2WHXA 2NU3E 1FI8A 1LPGB 1ETSH 1C1PA 1VGCC 1C5MD 1DITH 2ULLA 1SOZA 1GBKA 1W0ZU 3ZYEA 5HMAA 1TNHA 1BBRK 1C5SA 3SOSA 3RU4D 3EE0B 3HKIB 3TJUA 1DWCH 1HJAC 2ZCHP 4IW4E 2Z3EA 1CHOG 5HYOA 2Y80A 2FOHA 3MU5A 3T26A 1ZRKA 2PW8H 1GI6A 1WAYB 4YT7H 1L4DA 2XYAA 2HLCA 3SZEA 5JPMH 1GDNA 1G3BA 1KXFA 4MPVA 3V12A 1A0JA 1ZTJA 4O97A 3GY4A 3AW0A 4AORA 1C5QA 2J92A 2RCEA 1QIXB 2G4UA 3EA9A 3MHWU 4M9FA 2ZU5A 3E16B 1GGDB 4X1SU 2PWXA 1MD8A 1BTHH 1O5CB 1P03A 1D3TB 1TOCB 3S9AA 5EW1H 4FXGH 3S0NA 1AU8A 4HFPB 5GWZA 3GYMA 2A45B 5CMXH 3DT0H 2C4FH 4AGKA 1IHTH 1FY3A 4K8BA 4JK5A 8GCHF 4THNH 3ITIA 2A2XH 2QIQA 1QBOA 2B0FA 2WPKS 3ATMA 3RMLH 3GCOA 1T31A 4K1SA 1INCA 4X1QU 4FUIA 3VB4A 3P6ZB 2V0BA 2ZO3H 4MQAA 1VR1H 1KDQB 1GPZA 1MU6B 2ZI2H 1YPHC 2AMDA 1SLVB 2FOGA 3QWCH 1OP8A 1ZR0A 3K6YA 1QFKH 1O35A 4TPIZ 4NZQA 1FIWA 4B74A 2G51A 1N8OB 1FNIA 4FUBA 1SGRE 1C5VA 1EX3A 1F5RA 3KCGH 1MU8B 5FX6A 3FP6E 4I7YH 4CR9A 3RXIA 1HAHH 3VGCB 1SGPE 1C5PA 1C5ZB 1Y3WA 4U01A 4XDEA 2ZGCA 4XBCA 4ZKSU 4X1RU 2VIDA 1P02A 1CQQA 3PMAB
chains in the Genus database with same CATH superfamily
1TAWA 2IN2A 4UFFH 4KGAA 3GDUA 1N8OC 3O8RA 2V3MA 3QGNB 2A5IA 2HPPH 3FKSD 1EB1H 5DP3A 2V3OH 2VWLA 1L2EA 3E90B 4ZUHA 1Q31A 3MO6A 3PLKA 2BZAA 1CVWH 2XWAA 1K28D 2JH5D 1YCPM 2ZDNA 3K9XB 5DGJA 3ZVEA 1W12U 3RDZA 3VGCC 5GXPA 4XBDA 4AYVB 1AE5A 2A0QB 3M5OA 4FOUC 3SBKA 1BBRH 2HOBA 2D2DA 5T6FA 4MPWA 3OYPA 1K9OE 2GT7A 3SW2B 2HVYB 2QA9E 1XX9A 1OWDA 1O36A 3CP7A 4X2YA 4DY7B 4RN6A 3PTBA 4K1EA 1TE0A 1TLDA 2BVRH 2B5TB 2EC9H 4K5ZA 5EW2H 4B1TA 2O8TA 3RU4E 5E0JA 4KTSA 4O3TA 3NUMA 3VPKA 1HPGA 2TGTA 2RA0A 1GJCB 2KFWA 3BEUA 2WPHS 3F9GA 4AYYB 1F0SA 2JH0D 2CJIA 1P2JA 1ZPCA 2QF3A 1SG8B 4E7NA 1AFQC 4OS5A 2ZF0H 3MTYA 5DPAA 5A8ZA 1KXAA 2W7UA 4ZXYH 2F9VA 1PPFE 1Z6JH 2HPQH 4JZFH 2QF4A 1UW7A 2GZ7A 2EI8A 1O3MA 3E6PH 3L33A 1TGTA 3OFND 1IHSH 5E2OA 1LVOA 4DIHH 1NC6A 2G4TA 2PFEA 1O34A 2JDID 1OYTH 4CBNA 3TGJE 2BD5A 3FVFB 2BQWB 2GVFA 2HNTC 3F9EA 1CHOF 1MABB 1GJ5H 1DT2A 1KXEA 2FEQH 3K65B 3AAUA 1UTNA 3FP8E 1OHHD 2V35A 1DANH 3FO8D 4NIXA 1GJAB 2WSSD 1DUAA 2WUCA 4BANB 3QLPH 4TYDA 3SGBE 1E37B 1QJ6B 1DLKB 3OY5U 2ZFSA 4B6EA 1S6HA 2BLQA 5EG4A 4WMEA 4HG6A 3F6UH 2R3YA 3I29A 4IN1A 4Y7BA 1WUNH 5EJLA 3ZZCA 5C0TA 2VINA 4XD7D 2J34A 2CGAA 5F6MA 3E91A 2P8OB 2NU2E 4O3UA 1O2NA 1FPHH 1MTSA 2J9NA 3BEFB 3Q3KA 4I8LA 4H6SB 1GMDG 3SQHE 1AB9B 1QGFA 4FVDA 1HFDA 5T3HA 2J5UA 2FO9A 3SV8A 4ZMAH 1T8NA 1YCPK 1IQGA 3LU9B 2R2WU 2B9LA 2NU0E 2ZFQH 1IOEA 1O3JA 3KYFA 4TY7A 4ISHH 1WXRA 3TNTA 3OAAD 3TJOA 3B9FH 1GVZA 1YLNA 1ZMNA 3RXRA 2CK3D 1Y3UA 2P8OC 2RDEA 3Q3XA 1A7SA 1ELDE 1GJ4H 4Q80A 1MZAA 3RMNH 1K21H 3GY8A 3SYJA 2NWNA 1NTPA 1GJ9B 3LONA 1A4WH 8ESTE 3LIWA 3EDXB 4F4OC 1AY6H 4A92A 1GWAA 2FYRA 3NK8A 1ELTA 1XM1A 3UY9A 1O5GH 3F0PA 1AGJA 4HZHA 1JOUB 2J2UA 5EJ1A 3SUDA 2AIQA 1A5GH 1TQ0B 1UO6A 2Z3CA 1HIAA 5H4IB 1MKWK 1BMNH 2VNTA 1Z8RA 2G52A 1HYLA 3A88A 2G81E 2PUXB 2ODPA 3E3TA 1TRMA 3SV2H 2V6NA 4TPYA 5FBEA 2PGQB 3AK5A 1WQSA 4D8NA 1A2CH 1BUIA 1UTPA 1BRAA 3SHAH 1BHXF 3GCTF 4OGXA 1LTOA 3A7YA 2ZA5A 1O39A 4NIYA 2VGCB 4TT3D 4B73A 4INLA 2M2AA 4NSVA 3JZ1B 1QZ8A 2ZFRH 4IBLH 2FZZA 1FY1A 1KTTB 1UVPA 3RUOA 2FS9A 3SJOA 1QJ1B 1C1NA 1GI3A 2Z9GA 1K1JA 3OSYA 4Q7ZA 3SU4A 1PJPA 3W95A 3SGAE 2ZDAH 1NRRH 2PGBB 5EU8A 5GPIB 2HVXA 5CHAC 1TNGA 1TPAE 3GICB 3LH1A 4DT7B 4YO9A 2W7SA 1DLEA 3NKKA 3K2UA 1GI5A 1V2MT 2WZQA 3UNRA 1EJAA 5EPYA 1ARCA 5T1VA 1L1GA 3VG8A 5LPRA 5EXLA 1HBTH 3NXPA 3MOCA 2YNBA 5C20A 3RXEA 3SNDA 4INHA 1YLCA 1DVAH 1ZMJA 1QY6A 1K22H 3TGIE 1S85A 2A1DB 1P2MA 3PV2A 2ZQ1A 4Q7XA 2O9QA 2IOTA 3I77A 1GBBA 5FPSA 3SJ9A 2C8ZB 1F92A 3KQBA 2ALVA 4A1TA 5JB9S 1ID5H 1RJXB 2RDLA 4YOGA 2H5CA 2J4IA 1EZXC 5HXFA 2PTCE 2ZU3A 3ZZAA 3QUMP 4KTUA 1AUJA 2BLWA 3MH6A 3MI4A 2VWNA 2V3HH 2C8YB 1GHYH 4ZXXH 4X6OA 5EJZA 1UCYH 1YC0A 2G8TA 1GL1A 2AYWA 2F9OA 4Z0KA 1IAUA 1J16A 2A4RA 3DUXH 3RC6A 5GCHF 3C1KA 3OEED 1V2JT 4CREA 4YTAA 1YYY1 5F03A 2F91A 3MWIU 1KXCA 1TPSA 5DG6A 4ZKOU 2H1UA 2WPDD 3LGIA 4X8VH 2Y5GA 2XXLA 3MH4A 1V2ST 1D3PB 1SR5C 3GCHC 2BDBA 1BB0B 3BTQE 4Z1MD 2ZHWH 2AGEX 4R0IA 1IQFA 1AE8H 1GBEA 1RD3B 1V2OT 2BDCA 2YNAA 4ZKRU 1XUJA 1UTLM 1O2QA 4FU9A 3URDA 3LGUA 1GJ6A 4E05H 2ZTZA 1P0SH 1Z1IA 2STAE 3BV9B 3PWCA 2EQNA 1O2SA 1SL3A 1NN6A 5JBAS 2P3UB 1DY8A 1GI2A 1TMTH 4JK6A 1J9CH 1EAIA 4RT1A 1DWBH 4CRCA 4ZH8A 1G2MA 1ZTKA 2BY5X 3ZVCA 2G5VA 3MNBA 2OQ5A 4JZDH 3EAJA 3ZZ6A 4NFFA 1NU9A 1EAXA 1SFQB 4CRGA 3E0NB 1TGCA 2FXRA 4GPGA 5FX5A 1RIWB 2C8XB 2H2ZA 1C1RA 4JZIA 3ODDA 3MMGA 1P09A 1G30B 2Y5FA 2AEIH 3LC5A 4F48B 5SGAE 1QA7A 3NRLA 3BTTE 1BRCE 1GBMA 1CSOE 1SGTA 1F2SE 1MCTA 3H5CB 3UNSA 1ELVA 1ZGVA 1TBZH 1SGYE 2BD9A 3HPTB 2A5AA 1WV7H 2GT8A 1P10A 1UK3A 1E35B 3BG4B 1TWXB 1HXFH 3A82A 4AZ2B 1LHDH 1RIWC 1BZXE 4NCYA 3RC4A 2B8OH 1S83A 4Z6AH 1C1QA 3TJNA 4TY6A 2KAIA 1AVGH 1SVPA 1SGDE 2WPLS 2K1QA 1Y3XA 5TJXA 2BDHA 2LPRA 3SJ8A 1KXBA 5ESBA 1Z71A 1IQIA 3BSQA 1OWIA 4J1YA 5C2ZA 1FJSA 1TBQH 3A84A 4Y76A 4X8SH 3HK6B 2TGPZ 4INKA 3DSGA 3BG4C 1C5XB 1J17T 2AFQB 2BD2A 1GJDB 3RXPA 4NA8A 2ZHEH 2AGGX 2FDAA 2PKSC 2QCYA 3OE7D 3T28A 5C67A 1BJUA 3STIA 2ZEBA 3DD2H 4DCDA 3C27B 2OD3B 2XC4A 3QX5H 4U30A 2J95A 1SGFG 2L6OA 4FUHA 1QA0A 2TBSA 5A0CA 5HM9A 2BXTH 5LH8A 3FANA 1P05A 3SI4H 1OKXA 3A7TA 1C5UA 2GDDA 2BQ6B 2AERH 3L6PA 1SLUB 3MNSA 4ISLA 2OBOA 5TCAA 5JDUB 1P2OA 2VBCA 1AQ7A 5FCKA 2WYGA 3LPRA 1TBRH 1OPHB 1OP2A 2JETB 3HK3B 3PO1B 2TIOA 1HAVA 3TK5A 1ELAA 1GBJA 4UDWH 4JMYA 3F2HA 2I6QA 2ZGJA 4YOJA 3UNQA 1T4VH 3R3GB 3VXEH 3SGQE 1E38B 1ORFA 2OC8A 1RS0A 1S0RA 3IITA 4YT6H 3U8OH 4CBOA 2BX4A 4XE4A 5HIYA 1VJ9U 1B0EA 1ELFA 4OS6A 1W0JD 4XOJA 1DM4B 1O2UA 4WXVA 1GCTB 1O2IA 3LGVA 1V2NT 4OGYA 2WYJA 4ZHLU 4P02A 1AN1E 1F5LA 1GI7B 4K2YA 1P2KA 4GHQA 2XBWA 3RXJA 2BVXH 3PO1C 1VKYA 2H9HA 1O3CA 4LZ1H 1ZYOA 1P3EA 1TALA 1T8MA 1MZDA 4YESB 5FBIA 1SGNE 1Y3VA 4Q4LA 2ZGXH 2Y6TA 4GCHF 5A8YA 5LPFA 2ZPSA 4K8YA 1OP0A 1HUTH 1G32B 1TNIA 4FU7A 1BJVA 2J98A 3A7XA 1ANEA 2LELA 3PMBB 3MU4A 2ZDVH 3ZVBA 1ZPBA 2GKVE 3A81A 2BYAX 4LZ4B 3WWBA 1AD8H 1E34B 1O5EH 1GI8B 2ZFPH 3BIUH 1WSSH 2F9NA 4BAHB 1HB0B 4JZ1A 2LNCA 1BDAA 3WWFA 2OCVB 3O8BA 3GY3A 1PQ5A 1TONA 1YKTA 3TVJB 3SU2A 5L30H 2HNTF 1ZLRA 1GGDC 1GHVH 1ESAA 1EXFA 4MDSA 4K69A 1FY4A 1UVSH 1DS2E 4K60A 3KF2A 4DURA 1RRKA 2XOKD 1QRZA 1FUJA 3T2NA 2D1JA 1P2NA 1D6WA 2HRVA 3ZV8A 1S84A 1HIAB 1O2YA 3MO3A 2FPZA 3M7UA 3VB5A 4WY3A 4WMDA 1SHYA 3SNBA 4XBBA 1FXYA 1LHFH 4DT4A 3H7TA 5FXLA 2L74A 4XFQA 4B71A 1KIGH 4MTBA 1P8VC 1F7ZA 1QRXA 2XBXA 1O3PB 1QJ7B 1C2IA 4DOQA 1SSXA 2ZDLA 1AWFH 3UB0A 2ODYB 4NG9H 1G3EA 3OTJE 3SJKA 1QBVH 3VEQB 2W6ID 3A8DA 1CHGA 5JBBS 5CDFE 4LOYH 1O37A 2Z9IA 4Y10E 1MBMA 1ANCA 3GCTG 1VCWA 1GVLA 3QZRA 2P3TB 1PFXC 1YPEH 5AFZH 4X2XA 1ZGIA 3GY2A 2GZ9A 2XC0A 3MYWA 4A7IB 1IQNA 1O3BA 2W6JD 4ZHMU 1QQ4A 1LVMA 3RXGA 1O2RA 1O5AB 2ANKH 4ISOA 4UFGH 2ZP0H 4AFUA 3FP7E 4BAOB 4ACAA 1TNJA 3M5NA 1ZSLA 5T6DA 4NIVA 2QN5T 5T6GA 1CGIE 3TK6A 2O8WA 4MVNA 4B6FA 3STJA 3SNEA 1QRWA 2QE7D 3GYLB 2FLRH 4IS5A 1MTUA 5HGGA 3SNAA 2CF8H 1KLTA 3ZVDA 2VB0A 4AC9A 1J14A 5BPEA 3BTGE 1V3XA 2D8WA 3LKWA 1BRUP 3PLBA 4ABEA 3DSOA 2GDEH 1G2LA 1LQDB 1GJ8B 1WDIA 2OK5A 3RXUA 4CRBA 2XBYA 2ZECA 1K1PA 2FI3E 2Y7XA 1AKSA 1KSNA 3SV9A 3M5LA 1JRTA 1NROH 1MTVA 4Y8XA 2O8MA 2QAAA 2Y7ZA 1VZQH 2ZKSA 3ZYDA 3DFJA 5LPEA 1C4V2 1KYNA 1A5IA 5DO4H 5ESTE 2KCYA 2KM0A 3E8LA 3ZZ4A 2A5KA 3SU3A 5DSFA 1C5YB 1OXGA 1KY9A 1UTJA 1GBLA 2R2MB 5DP4A 2WV9A 2ZHQH 1G37A 5DP9A 2ODQA 2VIQA 1LHCH 5DP5A 1HJ9A 3A8CA 1H9LB 3CS7A 1UVUH 1SFIA 2SFAA 3BN9A 2ZZUH 1THPB 1TNLA 2BD8A 1NBMD 4CRDA 2QV1A 3GY7A 5E8EH 1C2JA 1NRSH 2M5TA 5KEDA 1U6QA 2CF9H 5GCHG 4AB9A 4DVAU 1HAOH 3UR9A 2Q6DA 4FVBA 3PV4A 3MH5A 4X6PA 3CENA 3TLOA 3AVZA 3M3SA 6ESTA 1EATA 3MFJA 2BHGA 1IQHA 3KYGA 3M35A 3V3MA 3WW7A 1W7XH 1CGHA 1G3CA 2UUJB 4FUJA 3ZVFA 4Q2KA 1FQ3A 1LQEA 4IMQA 3F9HA 1O3GA 1MUEB 5B6OA 1D9IA 1JRSA 1O2TA 5IK2D 1A46H 2J38A 1EPTA 4JYUH 1AZZA 2H9EH 1FZZA 1P01A 1SI5H 1ZOMA 2AMPA 1O3KA 2A4GA 1D4PB 2HWLB 1GHBG 4Y71A 1YY3A 2GCTB 1B7XB 4BAQB 2BX3A 2BTCE 3FZZA 4U32A 3I78A 3FN8A 1DUEA 1HAIH 2J94A 1P2IA 2FOEA 1C5LH 3KHVA 8LPRA 1NESE 1E36B 8KME2 1ANBA 1NT1A 2AHME 4LXBH 3RXOA 3LGTA 1XVMA 4RKJB 2W26A 3U8TH 1ZTLA 2Z7FE 3F68H 4BXWA 2KCPA 1XMNB 1RTLA 2FX6A 5J4QA 1CT4E 5TCCA 2FX4A 1AB9C 2SGDE 2GCTC 1TA6A 3BTEE 1W14U 1L4ZA 1T32A 5FPYA 1EZUC 2BLVA 3ZZ5A 3RXCA 1GHZA 5GNDA 1UHBA 4ABJA 1DWEH 2QGRA 3PMHB 1C1UH 1UTMA 3G01A 2SNVA 4FUGA 1EZQA 4YOIA 2KAIB 2R3UA 4UFDH 2EY4C 1AIXH 1UK2A 1W7GH 1O3EA 3ENSB 1IQJA 1GJBB 3RM2H 1RXPA 5C1XA 1YWUA 2XBVA 4GLYA 2H5DA 3PMJA 6CHAB 3U9AH 3AASA 4Q63A 2ZTXA 3KNXA 1RTKA 2FTLE 2C93B 3TGKE 1ARBA 1HJ8A 2CV3A 2F3CE 3Q3YA 1QTFA 1XUGA 1C2HA 2A2QH 2VH6A 1VITH 4I32A 4A1XA 1EZSC 2UWLA 2GP9B 2ESTE 1TB6H 2BD3A 2CMYA 1FONA 1CT0E 1OWEA 1YPLH 5EQRA 4NWKA 2PUQH 2C8WB 4NA9H 1UJ1A 1UVTH 3UUZA 1O2GH 4IGDA 3A89A 1E1QD 4BTUB 1DX5M 3DA9B 2PLXA 3QN7A 3M5MA 1LMWB 3OU0A 4WVPE 1X7AC 2QC2A 2VGCC 5C5OA 3W1EA 1HAXB 2WUBA 2R0KA 1HAGE 1NBME 4I8KA 3H09A 5C1UA 4LK4A 1HAVB 5E2PA 1UTKA 3TH3H 3RC5A 1ELBA 3SUEA 3KQCA 3RXQA 1PPZA 2BZ6H 4DGJA 5EXNA 5L2ZH 3AAVA 2YMSD 5JYIA 3VXFH 5DJ7A 1PYTD 2G55A 2HALA 1VCQA 2FOBA 3PTNA 1A0HB 1VITG 1LKAA 3VFEA 4YZUA 1K0HA 2ZIQH 1O2JA 3Q00A 3RXHA 3ZV9A 2O8LA 2OBQA 1E0FD 1QNJA 1YCPH 4AG1A 2SGQE 4DJZB 1EB2A 1K1NA 4UD9H 3KGPA 4DW2U 1O5FH 5E0GA 5EOKA 4X2WA 1XVOA 1WCZA 1EOLA 5HM2A 2BDAA 1XKBC 5J4SA 3FFGA 2BM2A 1P3CA 4AFSA 1DOJA 1H9HE 3EA8A 1GHAG 2J98B 3RXLA 1SBWA 1NFUA 3DSPA 1DSUA 4M7GA 2C3SA 3T29A 1H1BA 1OOKB 3LGYA 1V2UT 2ZQ2A 3D62A 1CBWB 3LOXA 3TIUA 2BDIA 2P93A 1DE7H 4GCHG 3N99A 4SGAE 1LHGH 1UTQA 3A7VA 4B2AA 1TGSZ 3JZ2B 4R8TB 4MNYA 1C9PA 1L0ZA 1NFWA 4RSPA 1S82A 1MKWH 2ALPA 3BTKE 1W11U 1EAUA 2XCFA 1ZRBA 2IPQX 2SGFE 5K0HA 3ZVAA 1GHBF 3LT3A 3TU7H 7ESTE 2ZU2A 5ABWA 3BTME 4MLFB 1OSSA 3M37A 2VIWA 4RI0A 3GY6A 4CR5A 1GMHF 5IDKA 1CBWC 1LDTT 1PPHE 1OWJA 3V0XA 3SI3H 4ABIA 2FWWA 4WH6A 1XUIA 1D3DB 4GVUA 1BA8B 4AG2A 1O3DA 3MU0A 2CHAB 3PROA 2QY0B 4O03A 3VB3A 1B0FA 2VU8E 1CE5A 2BOHB 1ACBE 3TH2H 2KR7A 1Y5AT 1THRH 5EPNA 1ZHMA 4I86A 1BCUH 1SQOA 1YBWA 1F0RA 1YPJH 3BTFE 1Z8GA 1GBIA 1FPCH 1O0DH 3ATLA 1FLEE 3O8DA 3KQDA 3M36A 1AUTC 5C0UA 3HKJB 1BQYA 1DICA 3PRBA 1C5RA 3BG8A 2Z9LA 5CE1A 1K1LA 1UK4A 2CHAC 2VIOA 1XXDA 4A6LA 4WF8A 2O8UA 3UQOA 1C1WH 1ZJKA 2XRCA 3DHKH 1H8IH 3S9BA 1TRYA 2PR3A 2AH4X 3N7EA 2PHBA 5A8XA 1BOQA 2QXHA 5DP6A 2WPMS 1F0TA 1TOMH 3K6ZA 1EKBB 3A7ZA 1NFXA 3NZIA 2TGDA 1ABJH 3LDXH 2Q6GA 1V2LT 2AGIX 2F9UA 4BTTB 1ELCA 1TFXA 5B6LA 2KCAA 3A85A 3ZZ8A 2GCHG 3F9FA 3RXMA 2LP6A 3MNCA 1CU1A 1DSTA 4ZROA 1ZHRA 3QZQA 1MCVA 1C4Y2 1S6FA 1TYNA 3UIRA 1NPMA 1P12E 3ESTA 1NU7B 4YLQH 3TNSA 1AKSB 5DKMA 2BMGB 4AFQA 2Y81A 3P17H 1CA8B 2SGAA 2OUAA 1O5BB 3QGJA 1BMMH 2PTNA 1WOFA 1Z1JA 3F2GA 5AF9H 4MPUA 1SPJA 5DP8A 4O9VA 2K8IA 2GGVB 3FAOA 5EQQA 3RXSA 1ZHPA 1YF4A 4K3JA 1C1SA 1M9UA 3LC3A 4WJG2 4ABHA 1GHWH 6GCHG 1DXWA 1WBGB 1CGJE 2VIPA 1W3CA 4IMZA 4YXWD 3UOUA 2UUFB 1JIRA 3HGNA 3ODFA 4FUEA 4BOHA 4NWLA 1HGTH 3EGKH 1OX1A 1C5TA 1C2EA 1O5DH 3RXKA 1HAYB 1VITF 4Q7YA 3W94A 1BT7A 1BBRE 2ZGBH 1HCGA 2P95A 1O3FA 4F55A 4AGJA 4FUCA 1UMAH 4MNXA 1C2KA 1PQ8A 2FOMB 4MG3A 1NRPH 2OTVA 1C5OH 1D6RA 1L1JA 2ZDMA 2ZCLP 2Y5HA 1A1RA 4KTCA 2AIPA 2F9BH 1HLTH 2JETC 3E1XB 3TH4H 3IG6B 5AHGH 9ESTA 1GHAF 2QF0A 5EXMA 1GI4A 3LGWA 4A5TS 1EPTB 1K1OA 1ESTA 2QF5A 5A0AE 2BDGA 2QXGA 5FPTA 2RG3A 2Z94A 3A7WA 2A31A 1QCPA 5EQSA 1QR3E 2XNDD 5L2YH 4QT8C 2ZPQA 3UOPA 2JH6D 3T5FH 1W8BH 3U8RH 3OTPA 4TWWA 4I31A 4ABFA 4OM9A 1FY5A 5DP7A 2WPIS 1MD7A 3NPSA 4ABBA 3S7HB 1O2KA 1GBTA 1JIMA 1GCTC 3LH3A 3U98H 1KMHB 1RFNA 4I8JA 2TGAA 2JJ1D 2UUKB 1AVWA 1PPEE 1Z6EA 3OX7U 3A86A 4I33A 1YPMH 5A0BA 1FAKH 3KN2A 1QQUA 1AO5A 2Z6BD 2THFB 3S9CA 1EPTC 1GI9B 1PQAA 1H8HD 2FM2A 1SGCA 1BTXA 2ZCKP 2PV9B 5FCRA 1SGIB 1Y5BT 4FUDA 4CRFA 1P11E 1XUFA 3R0FA 2FIRH 1ABIH 2ZNKH 3PLPA 4ZAEA 1H9IE 1P04A 1V2PT 3TPIZ 1FMGA 1EP5A 3SORA 1UHBB 1OWKA 2FMJA 1Z8JB 4XRNA 2ZHFH 1TABE 2YOLA 2BVSH 2IPHA 2GV6A 1ZMLA 1TQ7B 4ESTE 2XTTB 3U69H 1P57B 1Y5UT 3UWJH 2FP7B 3Q76A 2VWMA 4P00A 1NFYA 2C90B 2FLBH 1QL9A 1TX6A 2KX4A 1TPPA 3IWMA 1A61H 4J2YB 1MAYA 3RXFA 4D9QA 1SHHB 1C2GA 2UWPA 3OY6U 2ZPRA 3KEEA 1K1MA 1P2QA 3MU1A 4DG4A 1K2I1 3VB7A 2ILNA 2BD4A 1O2HA 2PKAA 3GOVB 2JIZD 1JWTA 1W0KD 1ZJDA 1O3NA 3B8JA 1O3OA 2GZ8A 1DFPA 3EYDA 1WTHD 2P16A 1SB1H 1GJ7B 3LJJA 1V2RT 3ZVGA 2DUCA 4HTCH 3RMMH 3ZZDA 1C5NH 4JZEH 1WTGH 4YM9A 1YPHE 4ZKNU 3RLWH 1XUKA 2KZ4A 3UREA 5JBTA 1FN6A 2Z3DA 5LGOA 2GCHF 4X6MA 1C2MA 2ANWA 3B23B 1AWHB 1N6YA 1SC8U 1TA2A 1G3DA 2XNIA 1AVXA 4AN7A 1QL7A 1TMUH 1O2VA 4VGCB 1MKXK 3KQ5A 1V6DA 3TK9A 4UONA 1TRNA 2P59A 5GJ4B 1KLIH 4BNRA 4OS4A 5CHBA 5JBCS 2SGPE 1MTNB 1S6LA 3NCLA 1AFQB 1BTPA 4AFZA 4Y6DA 2TPIZ 5C3NA 1GMCG 3GY5A 2BLOA 1PPBH 2FOCA 2K0QA 3RMOH 1HV7A 1TNKA 2I6SA 1GBFA 3VB6A 4AX9H 4TWYA 4KKDA 3NWUA 1A3BH 1EOJA 6GCHF 1BTYA 5F8ZA 2P94A 3BTWE 5ETXA 1K1IA 3ELAH 2VIVA 2SNWA 3MNXA 4Y7AA 2FI4E 3AW1A 2BD7A 5KGOA 2ZTYA 7GCHG 4VGCC 3MO9A 1SOTA 4OS1A 1SQRA 5BRRE 1C9TA 3T25A 1PQ7A 4Y79A 4ZCNA 1SMFE 1MTNC 2OINA 1ANDA 1CA0B 3ZZBA 2BDYA 3GISB 1EQ9A 4K1TA 3BIVH 3EE7A 2VH0A 1WU1A 1CO7E 3DFLA 4X2VA 4X1PU 3BTHE 2Q6FA 4U2WA 5C17A 2PSYA 2NU1E 5E0HA 1FX0B 3N7OA 3QK1A 1LPZB 3RM0H 1IQMA 4AOQA 2RA3A 1GDUA 1BMLA 1RGQA 2CXVA 1WQVH 1A3EH 2OXSA 1E1RD 2XW9A 1SGEE 2G00A 5EIYA 4BTIB 2ZU1A 1AHTH 3ATKA 1F5KU 3RXBA 1H4WA 4GHTA 3PV5A 1CA0C 4HGCA 4ABAA 4ASUD 2OC0A 4RT0A 3PB1E 1O3AA 3PM3A 1DDJA 1H8ED 4D76A 2CN0H 1MTWA 1QB6A 4D7GA 1VJAU 2IJOB 1UVOA 2H6MA 4D7FA 1GI0A 2BY8X 1QL8A 1T8OA 3F3BA 3T62A 1O2PA 4GSOA 1EUFA 1AFEH 1HDTH 1TGNA 2A4QA 1TX7A 2AMQA 3PWBA 5PTPA 3Q77A 2V7QD 4FETA 3SO3A 2SGEE 5DN6D 5FHTA 1BITA 5GIBA 4B2BA 1LPKB 2FI5E 1TX8A 1NM6A 1IQKA 1O2WA 4WMFA 1BMFD 1H8DH 3DCLA 4CH8B 1UCYE 2Z9KA 1GMHG 2ZDKA 1BTZA 1B5GH 4UFEH 1YPGH 2HNTE 4H42U 1C2FA 2WINI 2F43B 3BEIB 1BRBE 1GI1A 2ZWLH 4NGAH 4TSFD 3V7TA 1HAPH 1J8AA 3SJIA 3P70B 5A09A 1C1MA 2GX4A 2FODA 2F4LA 4UEHH 3A8AA 1UTOA 1D3QB 4X1NU 1ZZZA 2BY6X 5IYTA 1C2LA 1EAWA 1LVYA 2XWBI 4CHAB 1NO9H 3F1SB 3P8OA 4JCNA 3URCA 1THSH 1UCYK 4JYVH 7KMEH 1N1LA 1LKBA 2W5EA 5L6NH 1MKXH 1NRQH 1O31A 2ZFTA 3ATIA 3BF6H 2BY7X 2EI7A 2Q1JA 2ZU4A 1KXDA 3MQKC 1EFRD 2R0LA 3M3TA 1Q2WA 3SQEE 4ABGA 1MH0A 1KDQA 1COWD 4Y0ZE 1TGBA 4I8HA 5EGMA 4ISNA 7LPRA 4JYTA 1CT2E 3PYHA 1G36A 3P8FA 1JMOH 1KLJH 1BTUA 2OC1A 5F8TA 1MBQA 1MQ6A 2QXJA 1FIZA 4CHAC 3U1JB 3HGPA 1IQLA 3SHCH 1FN8A 4BXSA 3WY8A 2ZFFH 4HI3A 1C2DA 4UE7H 1V2QT 3SV6A 5CHAB 2QYIA 3A87A 4ABDA 1LHEH 1V2WT 4FU8A 2OLGA 2OC7A 1EJNA 5F53A 1V2TT 3A8BA 1ZPZA 4MNWA 3U1IB 2A7HA 1Y3YA 1LO6A 3D49H 4NA7A 4WH8A 3S69A 2F83A 3UTUH 2ZHDA 1T8LA 1DY9A 1W2KH 1TMBH 3M61U 5I46H 1N6XA 1T7CA 1O3LA 6CHAC 4F49A 4DIIH 4H4FA 2W3IA 1FY8E 1XUHA 2IJD1 3V13A 1P06A 2FTMA 4E7RG 1O3IA 1AZ8A 1GBCA 4Y0YE 1GMCF 1GL0E 3SNCA 4OS7A 3M3VA 2Y82A 2JJ2D 2DE9A 3A83A 4YLUA 5GDSH 3ZZ3A 3HATH 1NY22 4GUXA 2B7DH 4X0WU 2ZGHA 4D9RA 1V2KT 1VCPA 3SUGA 4IN2A 4IC6A 1TIOA 1JXPA 2W3KA 1NZQH 4RKOB 3P8GA 1AI8H 7GCHF 3M7QA 1C4U2 4X8TH 4NSYA 3LJOA 5F8XA 1SLXB 6LPRA 2FOFA 3SUFA 3EQ0H 1BMAA 2UUYA 5C94A 1QB1A 1W10U 1A0LA 3T27A 1GBDA 1P9UA 1A5HA 2TRMA 1ZSJA 3UR6A 1C1TA 1GVKB 3ATWA 5HKKD 1AMHA 1DWDH 2PP6A 4KP0A 4Y8ZA 4H6TA 1W13U 1LCYA 3ZZ9A 2A4OA 3FOAA 4Y8YA 4ISIH 3SU1A 1ETRH 1HRTH 2STBE 5C5NA 1F0UA 2A32A 1OYQA 1O2ZA 3U28C 2VWOA 3F2FA 2FESH 1J15A 3MU8A 2FOAA 4XSKU 2ANYA 2XC5A 3GCHB 3SU0A 2ZC9H 1SQAA 2HLDD 2OQUA 1C1VH 3RXVA 3MH7A 4B2CA 4BAKB 3N7DA 1EP6A 2PSXA 1DXPA 4ASHA 1BIOA 1XKAC 1ESBA 2VVCA 4Y11E 1BHXB 2XCNA 1C5WB 2BXUH 3ZIAD 2GTBA 4A1VA 1SQTA 3P8NA 2KCOA 1ELGA 5FAHA 1WYKA 1QBNA 1BTWA 5AFYH 1L1NA 5AVDA 3KQEA 1P9SA 4NZLA 3RXTA 1O3HA 1EJMA 1YP9A 2YMSB 1O30A 3P95A 3E0PB 5EODA 5JB8S 1Y8TA 3A80A 3CNRA 2BB4A 2VVUA 8GCHG 4FUFA 3UPEA 1GMDF 1FAXA 2J97A 1OS8A 1ELEE 2GJGA 2QXIA 3CS0A 3M7TA 4NIWA 1XXFA 1C1OA 4PROA 2UWOA 3UFAA 3QDZB 3GCNA 5G4BA 3RP2A 1Z7KA 9LPRA 1MMJN 1DPOA 1HNEE 1Q3XA 5A2MH 2PKAB 1MQ5A 4AB8A 4X8UH 4I8GA 5KECA 2YMSC 1O2MA 3FZDA 1SGFA 4SGBE 1GBAA 1Z8IB 1PYTC 2OP9A 3SU5A 1HXEH 3QTOH 4B75A 2AS9A 5K7RA 3RXAA 2GMTB 1YM0A 1IQEA 2ZG0H 3KL6A 5I25A 3PRDA 4IC5A 1E79D 1O2LA 1T4UH 1O33A 2Z9JA 2WV5A 2R9PA 1O38A 3BTDE 2ASUB 3UQVA 2P3FH 2HGTH 4MPXA 2EA3A 1KTSB 2DE8A 4MNVA 4WWYA 2GD4B 4E06H 4OS2A 1RTFB 1YPKH 1EASA 1YLDA 2F9PA 3SU6A 3ZZ7A 1GDQA 1QHRB 2PKSB 3QO6A 3H7OA 2RFKC 2BY9X 2EEKA 3UAIC 2GMTC 1PPGE 1QB9A 1W0YH 3F0OA 3D23A 1SGQE 1YGCH 2ANMH 3P92A 3L3TA 2A7CA 1O32A 2JKHA 1S5SA 3TJVA 1QURH 3EA7A 5DK1A 1Y59T 2EI6A 1NRNH 4CRAA 1S81A 1S0QA 2VJ1A 4KELA 3UWIA 4ZHAA 1GG6B 1NS3A 1O2XA 1V2VT 5C1YA 3S7KB 2WV4A 2FYQA 1TPOA 1VGCB 2H9TH 3D65E 3O8CA 4X6NA 2FS8A 2NU4E 1GBHA 3RU4T 2D26C 1GHXH 4BAMB 1FDPA 3GDVA 2GV7A 3SN8A 4CH2B 2WPJS 1SLWB 4B76A 2A7JA 3SV7A 1ETTH 1HJAB 3QTVH 1ZSKA 1O2OA 3SZNA 1G9IE 4NFEA 4WXIA 2VVVA 3RXDA 1FV9A 4GAWA 3TITA 1PPCE 1MAXA 1OWHA 2BQ7B 1JBUH 2G5NA 2BOKA 1HAZB 3GDSA 3KIDU 3RLYH 1GG6C 1LVBA 1GCDA 2WHXA 2NU3E 1FI8A 1LPGB 1ETSH 1C1PA 1VGCC 1C5MD 1DITH 2ULLA 4ACBA 1SOZA 1GBKA 1W0ZU 3ZYEA 5HMAA 1TNHA 1BBRK 1C5SA 3SOSA 3RU4D 5FL7D 3EE0B 3HKIB 3TJUA 1DWCH 1HJAC 2ZCHP 4IW4E 2Z3EA 3GS9A 1CHOG 5HYOA 2Y80A 2FOHA 3MU5A 3T26A 1ZRKA 2PW8H 1GI6A 1WAYB 4YT7H 1L4DA 2XYAA 2HLCA 3SZEA 5JPMH 1GDNA 5HIZA 1G3BA 1KXFA 4MPVA 3V12A 1A0JA 1ZTJA 4O97A 3GY4A 3AW0A 4AORA 1C5QA 2J92A 2RCEA 1QIXB 2G4UA 3EA9A 3MHWU 4M9FA 2ZU5A 3E16B 1GGDB 4X1SU 2PWXA 1MD8A 1BTHH 1O5CB 1P03A 1D3TB 1TOCB 3S9AA 5EW1H 4FXGH 3S0NA 1AU8A 4HFPB 5GWZA 3GYMA 2A45B 5CMXH 3DT0H 2C4FH 4AGKA 1IHTH 1FY3A 4K8BA 4JK5A 8GCHF 4THNH 3ITIA 2A2XH 2QIQA 1QBOA 2B0FA 2WPKS 3ATMA 3RMLH 3GCOA 1T31A 4K1SA 1INCA 4X1QU 4FUIA 3VB4A 3P6ZB 2V0BA 2ZO3H 4MQAA 1VR1H 1KDQB 1GPZA 1MU6B 2ZI2H 1YPHC 2AMDA 1SLVB 2FOGA 3QWCH 1OP8A 1ZR0A 3K6YA 1QFKH 1O35A 4TPIZ 4NZQA 1FIWA 4B74A 1SKYE 2G51A 1N8OB 1FNIA 4FUBA 1SGRE 1C5VA 1EX3A 1F5RA 3KCGH 1MU8B 5FX6A 3FP6E 4I7YH 4CR9A 3OEHD 3RXIA 1HAHH 3VGCB 1SGPE 1C5PA 1C5ZB 1Y3WA 4U01A 4XDEA 2ZGCA 4XBCA 4ZKSU 4X1RU 2VIDA 1P02A 1CQQA 3PMAB
chains in the Genus database with same CATH topology
1TAWA 2IN2A 4UFFH 4KGAA 3GDUA 1N8OC 3O8RA 3QGNB 2A5IA 2HPPH 3FKSD 1EB1H 5DP3A 2V3OH 2VWLA 1L2EA 3E90B 4ZUHA 1Q31A 3MO6A 3PLKA 2BZAA 1CVWH 2XWAA 1K28D 2JH5D 1YCPM 2ZDNA 3K9XB 5DGJA 3ZVEA 1W12U 3RDZA 3VGCC 5GXPA 4XBDA 4AYVB 1AE5A 2A0QB 3M5OA 3SBKA 1BBRH 2HOBA 2D2DA 5T6FA 4MPWA 3OYPA 1K9OE 2GT7A 3SW2B 2QA9E 1XX9A 1OWDA 1O36A 3CP7A 4X2YA 4DY7B 4RN6A 3PTBA 4K1EA 1TE0A 1TLDA 2BVRH 2B5TB 2EC9H 4K5ZA 5EW2H 4B1TA 2O8TA 3RU4E 5E0JA 4KTSA 4O3TA 3NUMA 3VPKA 1HPGA 2TGTA 2RA0A 1GJCB 2KFWA 3BEUA 2WPHS 3F9GA 4AYYB 1F0SA 2JH0D 2CJIA 1P2JA 1ZPCA 2QF3A 1SG8B 4E7NA 1AFQC 4OS5A 2ZF0H 3MTYA 5DPAA 5A8ZA 1KXAA 2W7UA 4ZXYH 2F9VA 1PPFE 1Z6JH 2HPQH 4JZFH 2QF4A 2GZ7A 2EI8A 1O3MA 3E6PH 3L33A 1TGTA 5E2OA 1IHSH 3OFND 1LVOA 4DIHH 1NC6A 2G4TA 2PFEA 1O34A 2JDID 1OYTH 4CBNA 3TGJE 2BD5A 3FVFB 2BQWB 2GVFA 2HNTC 3F9EA 1CHOF 1MABB 1GJ5H 1DT2A 1KXEA 2FEQH 3K65B 3AAUA 1UTNA 3FP8E 1OHHD 2V35A 1DANH 4NIXA 3FO8D 1GJAB 3QLPH 1DUAA 2WUCA 4BANB 2WSSD 4TYDA 3SGBE 1E37B 1QJ6B 1DLKB 3OY5U 2ZFSA 4B6EA 1S6HA 2BLQA 5EG4A 4WMEA 3F6UH 2R3YA 3I29A 4IN1A 4Y7BA 1WUNH 3ZZCA 5C0TA 2VINA 4XD7D 2J34A 2CGAA 5F6MA 3E91A 2P8OB 2NU2E 4O3UA 1O2NA 1FPHH 1MTSA 2J9NA 3BEFB 3Q3KA 4I8LA 4H6SB 1GMDG 3SQHE 1AB9B 1QGFA 4FVDA 1HFDA 5T3HA 3SV8A 2FO9A 4ZMAH 2J5UA 1T8NA 1YCPK 1IQGA 3LU9B 2R2WU 2B9LA 2NU0E 2ZFQH 1IOEA 1O3JA 4TY7A 4ISHH 1WXRA 3TNTA 3OAAD 3TJOA 3B9FH 1GVZA 1ZMNA 3RXRA 2CK3D 1Y3UA 2P8OC 3Q3XA 1A7SA 1ELDE 1GJ4H 4Q80A 1MZAA 3RMNH 1K21H 3GY8A 3SYJA 2NWNA 1NTPA 1GJ9B 3LONA 1A4WH 8ESTE 3LIWA 3EDXB 4F4OC 1AY6H 4A92A 1GWAA 2FYRA 3NK8A 1ELTA 1XM1A 3UY9A 1O5GH 3F0PA 1AGJA 4HZHA 1JOUB 2J2UA 3SUDA 2AIQA 1A5GH 1TQ0B 1UO6A 2Z3CA 1HIAA 5H4IB 1MKWK 1BMNH 2VNTA 1Z8RA 2G52A 1HYLA 3A88A 2G81E 2PUXB 2ODPA 3E3TA 1TRMA 3SV2H 2V6NA 4TPYA 5FBEA 2PGQB 3AK5A 1WQSA 4D8NA 1A2CH 1BUIA 1UTPA 1BRAA 3SHAH 1BHXF 3GCTF 4OGXA 1LTOA 3A7YA 2ZA5A 1O39A 4NIYA 2VGCB 4B73A 4TT3D 4INLA 2M2AA 4NSVA 3JZ1B 2ZFRH 4IBLH 2FZZA 1FY1A 1KTTB 1UVPA 3RUOA 2FS9A 3SJOA 1QJ1B 1C1NA 1GI3A 2Z9GA 1K1JA 3OSYA 4Q7ZA 3SU4A 1PJPA 3W95A 3SGAE 2ZDAH 1NRRH 2PGBB 5EU8A 5GPIB 2HVXA 5CHAC 1TNGA 1TPAE 3GICB 3LH1A 4DT7B 4YO9A 2W7SA 1DLEA 3NKKA 3K2UA 1GI5A 1V2MT 2WZQA 3UNRA 1EJAA 5EPYA 1ARCA 5T1VA 1L1GA 3VG8A 5LPRA 5EXLA 1HBTH 3NXPA 3MOCA 2YNBA 5C20A 3RXEA 3SNDA 4INHA 1YLCA 1DVAH 1ZMJA 1QY6A 1K22H 3TGIE 1S85A 2A1DB 1P2MA 3PV2A 2ZQ1A 4Q7XA 2O9QA 2IOTA 3I77A 1GBBA 5FPSA 3SJ9A 2C8ZB 1F92A 3KQBA 2ALVA 4A1TA 5JB9S 1ID5H 1RJXB 2RDLA 4YOGA 2H5CA 2J4IA 1EZXC 5HXFA 2PTCE 2ZU3A 3ZZAA 3QUMP 4KTUA 1AUJA 2BLWA 3MH6A 3MI4A 2VWNA 2V3HH 2C8YB 1GHYH 4ZXXH 4X6OA 1UCYH 1YC0A 2G8TA 1GL1A 2AYWA 2F9OA 4Z0KA 1IAUA 1J16A 2A4RA 3DUXH 3RC6A 5GCHF 3C1KA 3OEED 1V2JT 4CREA 4YTAA 1YYY1 5F03A 2F91A 3MWIU 1KXCA 1TPSA 5DG6A 4ZKOU 2H1UA 2WPDD 3LGIA 4X8VH 2Y5GA 2XXLA 3MH4A 1V2ST 1D3PB 1SR5C 3GCHC 2BDBA 1BB0B 3BTQE 4Z1MD 2ZHWH 2AGEX 4R0IA 1IQFA 1AE8H 1GBEA 1RD3B 1V2OT 2BDCA 2YNAA 4ZKRU 1XUJA 1UTLM 1O2QA 4FU9A 3URDA 3LGUA 1GJ6A 4E05H 2ZTZA 1P0SH 1Z1IA 2STAE 3BV9B 3PWCA 1O2SA 1SL3A 1NN6A 5JBAS 2P3UB 1DY8A 1GI2A 1TMTH 4JK6A 1J9CH 1EAIA 1DWBH 4CRCA 4ZH8A 1G2MA 1ZTKA 2BY5X 3ZVCA 2G5VA 3MNBA 2OQ5A 4JZDH 3EAJA 3ZZ6A 4NFFA 1NU9A 1EAXA 1SFQB 4CRGA 3E0NB 1TGCA 2FXRA 4GPGA 5FX5A 1RIWB 2C8XB 2H2ZA 1C1RA 4JZIA 3ODDA 3MMGA 1P09A 1G30B 2Y5FA 2AEIH 3LC5A 5SGAE 1QA7A 3NRLA 3BTTE 1BRCE 1GBMA 1CSOE 1SGTA 1F2SE 1MCTA 3H5CB 3UNSA 1ELVA 1ZGVA 1TBZH 1SGYE 2BD9A 3HPTB 2A5AA 1WV7H 2GT8A 1P10A 1UK3A 1E35B 3BG4B 1TWXB 1HXFH 3A82A 4AZ2B 1LHDH 1RIWC 1BZXE 4NCYA 3RC4A 2B8OH 1S83A 4Z6AH 1C1QA 3TJNA 4TY6A 2KAIA 1AVGH 1SVPA 1SGDE 2WPLS 2K1QA 1Y3XA 5TJXA 2BDHA 2LPRA 3SJ8A 1KXBA 5ESBA 1Z71A 1IQIA 3BSQA 1OWIA 4J1YA 5C2ZA 1FJSA 1TBQH 3A84A 4Y76A 4X8SH 3HK6B 2TGPZ 4INKA 3BG4C 1C5XB 1J17T 2AFQB 2BD2A 1GJDB 3RXPA 4NA8A 2ZHEH 2AGGX 2FDAA 2PKSC 2QCYA 3T28A 5C67A 3OE7D 1BJUA 3STIA 2ZEBA 3DD2H 4DCDA 3C27B 2OD3B 2XC4A 3QX5H 4U30A 2J95A 1SGFG 2L6OA 4FUHA 1QA0A 2TBSA 5A0CA 5HM9A 2BXTH 5LH8A 3FANA 1P05A 3SI4H 1OKXA 3A7TA 1C5UA 2GDDA 2BQ6B 2AERH 3L6PA 1SLUB 3MNSA 4ISLA 2OBOA 5TCAA 5JDUB 1P2OA 2VBCA 1AQ7A 5FCKA 2WYGA 3LPRA 1TBRH 1OPHB 1OP2A 2JETB 3HK3B 3PO1B 2TIOA 1HAVA 3TK5A 1ELAA 1GBJA 4UDWH 4JMYA 3F2HA 2I6QA 2ZGJA 4YOJA 3UNQA 1T4VH 3R3GB 3VXEH 3SGQE 1E38B 1ORFA 2OC8A 1RS0A 1S0RA 3IITA 4YT6H 3U8OH 4CBOA 2BX4A 4XE4A 1VJ9U 1B0EA 1ELFA 4OS6A 1W0JD 4XOJA 1DM4B 1O2UA 4WXVA 1GCTB 1O2IA 3LGVA 1V2NT 4OGYA 2WYJA 4ZHLU 1AN1E 1F5LA 1GI7B 4K2YA 1P2KA 4GHQA 2XBWA 3RXJA 2BVXH 3PO1C 2H9HA 1O3CA 4LZ1H 1ZYOA 1P3EA 1TALA 1T8MA 1MZDA 4YESB 5FBIA 1SGNE 1Y3VA 4Q4LA 2ZGXH 2Y6TA 4GCHF 5A8YA 5LPFA 2ZPSA 4K8YA 1OP0A 1HUTH 1G32B 1TNIA 4FU7A 1BJVA 3A7XA 1ANEA 2LELA 3PMBB 3MU4A 2ZDVH 3ZVBA 1ZPBA 2GKVE 3A81A 2BYAX 4LZ4B 3WWBA 1AD8H 1E34B 1O5EH 1GI8B 2ZFPH 3BIUH 1WSSH 2F9NA 4BAHB 1HB0B 4JZ1A 2LNCA 1BDAA 3WWFA 2OCVB 3O8BA 3GY3A 1PQ5A 1TONA 1YKTA 3TVJB 3SU2A 5L30H 2HNTF 1ZLRA 1GGDC 1GHVH 1ESAA 1EXFA 4MDSA 4K69A 1FY4A 1UVSH 1DS2E 4K60A 3KF2A 4DURA 1RRKA 2XOKD 1QRZA 1FUJA 3T2NA 2D1JA 1P2NA 1D6WA 2HRVA 3ZV8A 1S84A 1HIAB 1O2YA 3MO3A 2FPZA 3M7UA 3VB5A 4WY3A 4WMDA 1SHYA 3SNBA 4XBBA 1FXYA 1LHFH 4DT4A 3H7TA 5FXLA 4XFQA 4B71A 1KIGH 4MTBA 1P8VC 1F7ZA 1QRXA 2XBXA 1O3PB 1QJ7B 1C2IA 4DOQA 1SSXA 2ZDLA 1AWFH 3UB0A 2ODYB 4NG9H 1G3EA 3OTJE 3SJKA 1QBVH 3VEQB 2W6ID 3A8DA 1CHGA 5JBBS 5CDFE 4LOYH 1O37A 2Z9IA 4Y10E 1MBMA 1ANCA 3GCTG 1VCWA 1GVLA 3QZRA 2P3TB 1PFXC 1YPEH 5AFZH 4X2XA 1ZGIA 3GY2A 2GZ9A 2XC0A 3MYWA 4A7IB 1IQNA 1O3BA 2W6JD 4ZHMU 1QQ4A 1LVMA 3RXGA 1O2RA 1O5AB 2ANKH 4ISOA 4UFGH 2ZP0H 4AFUA 3FP7E 4BAOB 1TNJA 3M5NA 1ZSLA 5T6DA 4NIVA 2QN5T 5T6GA 1CGIE 3TK6A 2O8WA 4MVNA 4B6FA 3STJA 3SNEA 1QRWA 2QE7D 3GYLB 2FLRH 4IS5A 1MTUA 5HGGA 3SNAA 2CF8H 1KLTA 3ZVDA 2VB0A 1J14A 5BPEA 3BTGE 1V3XA 2D8WA 3LKWA 1BRUP 3PLBA 4ABEA 3DSOA 2GDEH 1G2LA 1LQDB 1GJ8B 2OK5A 3RXUA 4CRBA 2XBYA 2ZECA 1K1PA 2FI3E 2Y7XA 1AKSA 1KSNA 3SV9A 3M5LA 1JRTA 1NROH 1MTVA 4Y8XA 2O8MA 2QAAA 2Y7ZA 1VZQH 2ZKSA 3ZYDA 3DFJA 5LPEA 1C4V2 1KYNA 1A5IA 5DO4H 5ESTE 2KCYA 2KM0A 3E8LA 3ZZ4A 2A5KA 3SU3A 5DSFA 1C5YB 1OXGA 1KY9A 1UTJA 1GBLA 2R2MB 5DP4A 2ZHQH 2WV9A 1G37A 5DP9A 2ODQA 2VIQA 1LHCH 5DP5A 1HJ9A 3A8CA 1H9LB 3CS7A 1UVUH 1SFIA 2SFAA 3BN9A 2ZZUH 1THPB 1TNLA 2BD8A 4CRDA 1NBMD 2QV1A 3GY7A 5E8EH 1C2JA 1NRSH 2M5TA 1U6QA 2CF9H 5GCHG 4AB9A 4DVAU 1HAOH 3UR9A 2Q6DA 4FVBA 3PV4A 3MH5A 4X6PA 3CENA 3TLOA 3AVZA 3M3SA 6ESTA 1EATA 3MFJA 2BHGA 1IQHA 3M35A 3V3MA 3WW7A 1W7XH 1CGHA 1G3CA 2UUJB 4FUJA 3ZVFA 4Q2KA 1FQ3A 1LQEA 4IMQA 3F9HA 1O3GA 1MUEB 5B6OA 1D9IA 1JRSA 1O2TA 5IK2D 1A46H 2J38A 1EPTA 4JYUH 1AZZA 2H9EH 1FZZA 1P01A 1SI5H 1ZOMA 2AMPA 1O3KA 2A4GA 1D4PB 2HWLB 1GHBG 4Y71A 2GCTB 1B7XB 4BAQB 2BX3A 2BTCE 3FZZA 4U32A 3I78A 3FN8A 1DUEA 1HAIH 2J94A 1P2IA 2FOEA 1C5LH 3KHVA 8LPRA 1NESE 1E36B 8KME2 1ANBA 1NT1A 2AHME 4LXBH 3RXOA 3LGTA 1XVMA 4RKJB 2W26A 3U8TH 1ZTLA 2Z7FE 3F68H 4BXWA 2KCPA 1XMNB 1RTLA 2FX6A 5J4QA 1CT4E 5TCCA 2FX4A 1AB9C 2SGDE 2GCTC 1TA6A 3BTEE 1W14U 1L4ZA 1T32A 5FPYA 1EZUC 2BLVA 3ZZ5A 3RXCA 1GHZA 5GNDA 1UHBA 4ABJA 1DWEH 2QGRA 3PMHB 1C1UH 1UTMA 3G01A 2SNVA 4FUGA 1EZQA 4YOIA 2KAIB 2R3UA 4UFDH 1AIXH 1UK2A 1W7GH 1O3EA 3ENSB 1IQJA 1GJBB 3RM2H 1RXPA 5C1XA 2XBVA 4GLYA 2H5DA 3PMJA 6CHAB 3U9AH 3AASA 4Q63A 2ZTXA 3KNXA 1RTKA 2FTLE 2C93B 3TGKE 1ARBA 1HJ8A 2CV3A 2F3CE 3Q3YA 1QTFA 1XUGA 1C2HA 2A2QH 2VH6A 1VITH 4I32A 4A1XA 1EZSC 2UWLA 2GP9B 2ESTE 1TB6H 2BD3A 2CMYA 1FONA 1CT0E 1OWEA 1YPLH 5EQRA 4NWKA 2PUQH 2C8WB 4NA9H 1UJ1A 1UVTH 3UUZA 1O2GH 4IGDA 3A89A 1E1QD 4BTUB 1DX5M 3DA9B 2PLXA 3QN7A 3M5MA 1LMWB 3OU0A 4WVPE 1X7AC 2QC2A 2VGCC 5C5OA 3W1EA 1HAXB 2WUBA 2R0KA 1HAGE 1NBME 4I8KA 3H09A 5C1UA 4LK4A 1HAVB 5E2PA 1UTKA 3TH3H 3RC5A 1ELBA 3SUEA 3KQCA 3RXQA 1PPZA 2BZ6H 4DGJA 5EXNA 5L2ZH 3AAVA 2YMSD 5JYIA 3VXFH 5DJ7A 1PYTD 2G55A 2HALA 1VCQA 2FOBA