2LP6A

Refined solution nmr structure of the 50s ribosomal protein l35ae from pyrococcus furiosus, northeast structural genomics consortium target (nesg) pfr48
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
b'MRIKGVVLSYRRSKENQHNNVMIIKPLDVNSREEASKLIGRLVLWKSPSGKILKGKIVRVHGTKGAVRARFEKGLPGQALGDYVEIVLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L35Ae
publication title Solution NMR structure of the ribosomal protein RP-L35Ae from Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Ribosomal protein
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2012-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01247 Ribosomal_L35Ae Ribosomal protein L35Ae
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 2lp6A00
4AC9A 4ACAA 1SQRA 4ACBA 2LP6A
chains in the Genus database with same CATH superfamily
1NC6A 1SGTA 1NBME 1DT2A 1WDIA 4UE7H 2IPQX 1XUGA 7LPRA 4INKA 3LPRA 1TQ0B 1LKAA 2W7UA 3U8TH 5GXPA 4MNWA 3NWUA 3M5LA 3UY9A 1K1OA 2AGIX 3A8CA 1O3HA 3VEQB 3TGIE 3SNBA 3UREA 4ZHAA 1BMMH 1KLJH 1OXGA 3SU6A 1EB1H 8LPRA 2C8XB 5JBBS 3S7KB 1EJAA 2Y80A 4WMDA 1GHBF 8ESTE 3BEFB 1GBIA 3E8LA 3QO6A 1P2QA 2F91A 1FXYA 2QXIA 1P3CA 1RJXB 2OTVA 5DP5A 4AYVB 4AG1A 3P8NA 1TNGA 4TPIZ 5DP7A 3ZZDA 1C5TA 3F9GA 4WH6A 1EAIA 4I8GA 2PP6A 2GGVB 3TLOA 3RXAA 1HAOH 3BTFE 1A4WH 3LKWA 1XVMA 4GHQA 4HGCA 5T3HA 1GVLA 1YKTA 6GCHF 1GWAA 2J5UA 4YOIA 1W11U 2QF5A 1MTNB 2AHME 2J9NA 5C20A 1O3DA 1H9IE 2EEKA 2FOFA 1UTJA 3KIDU 4MLFB 5FCRA 3MO6A 1EPTB 1TGBA 3RM2H 1CE5A 1SGYE 4XSKU 4K2YA 1ORFA 1BMAA 3GCNA 3TVJB 1NESE 5ESTE 4I8LA 1KIGH 3SNEA 1C4Y2 5JPMH 4I31A 1TRMA 1YF4A 1BRCE 2XNDD 3F0OA 1RD3B 3HKJB 2B5TB 1KXEA 3P8FA 2ZF0H 1BZXE 1NFXA 3RXDA 3PLKA 1JIRA 1GVKB 1SQAA 4YT6H 2FOHA 3MOCA 3PROA 4ABDA 2A31A 3N7OA 1TX8A 1TALA 3P95A 4AFZA 5T1VA 1SHHB 3SUEA 2QXHA 1BHXB 1DY8A 2ZTZA 2FYRA 2ZQ1A 4FUFA 3SZNA 3JZ1B 3TIUA 1K22H 2A7CA 4DVAU 2ZDNA 1JRTA 1NROH 1TRYA 3GY2A 4AC9A 1AO5A 1SQOA 1ZZZA 2WZQA 3SN8A 1ZYOA 3GY7A 1C2HA 2O8MA 2XBXA 1GI7B 2Z9LA 4DG4A 3CS0A 2P3FH 1HUTH 1HJAB 2XC5A 3QTVH 1UCYK 1XUHA 3A7XA 1PYTC 2BXUH 2G4TA 2RG3A 1AMHA 1D3PB 2ALPA 1TLDA 2DUCA 3GYLB 2FESH 1RTKA 4H42U 1MMJN 2P8OB 4X8TH 1AVWA 3TGKE 1BBRH 1C5NH 4VGCC 2F4LA 1BTUA 2Q1JA 1XMNB 3S9AA 1O3NA 2GT8A 2OQ5A 3F6UH 2KX4A 5GCHG 3M7QA 2F3CE 4JK5A 4Q2KA 1K1PA 1TE0A 1O5BB 3RMLH 1O35A 2EI6A 2XW9A 1INCA 1O2WA 1P2JA 1RIWB 3U8OH 2JETB 2G00A 1RTFB 1TOMH 5GCHF 4UFFH 3SOSA 4JMYA 1GJBB 2PTNA 3QK1A 1UW7A 3URCA 3TJUA 2WV5A 1GBMA 1WXRA 1OP0A 3EDXB 3OE7D 2VIDA 4RKJB 2KCAA 2WV4A 1AFQB 1C4V2 4XBBA 5HGGA 4AGJA 1G3CA 1MCTA 1BB0B 1HDTH 3O8RA 3OFND 2CN0H 1THRH 4TT3D 1LVYA 2H6MA 5E0GA 1WAYB 2JETC 4JZDH 2FO9A 1GHVH 4CREA 1BUIA 4CRGA 1UVUH 1BA8B 2ZPQA 1HXEH 1A1RA 1WTGH 3BTKE 4I86A 2GZ9A 1H4WA 2PSXA 5IDKA 2A2QH 2ZDMA 1V2NT 3L33A 4OGYA 3D65E 5FPSA 1AFQC 3QX5H 1G3DA 1BTPA 4DW2U 3NPSA 3GYMA 3BIUH 1Z7KA 5E2PA 2JH0D 1YLDA 2K0QA 3MH4A 5JDUB 1QB6A 3KYGA 3KGPA 4CRAA 2B0FA 1MQ5A 1RXPA 1JWTA 4D76A 1OWJA 3KQDA 1ELVA 1S82A 1LPGB 5C1XA 4X6MA 2F9NA 1SGPE 1GPZA 1V2TT 2TGTA 1TPOA 3GY8A 1P2IA 1QURH 2BDIA 1IQEA 2V7QD 2ZP0H 2FEQH 4ZXXH 4D8NA 1WCZA 3F2FA 1SOTA 4AZ2B 1EZXC 1QBNA 3H09A 1TNHA 1MD7A 4GAWA 1O3IA 1K1JA 1GJDB 3HK6B 1FMGA 3RM0H 1O32A 1O37A 3SU5A 5ABWA 1UVTH 4ZKNU 1GMCG 3FKSD 1GHAG 1CT4E 2HPQH 1A2CH 3G01A 3RMNH 3N7DA 2ALVA 3E16B 2O8LA 2VBCA 4XBCA 3E1XB 1W0ZU 3OAAD 5LPFA 2J98A 2ZFTA 3M5NA 1O3GA 5GDSH 1O30A 1K2I1 3E91A 2TIOA 4IBLH 5FBEA 1J8AA 2HPPH 1YY3A 5GWZA 3AW0A 3K6YA 1LHCH 1O3EA 4ZKSU 1NM6A 2A4OA 1GJ5H 3TPIZ 3DSOA 1WUNH 1MU6B 3UTUH 1C5WB 4XDEA 3SU2A 3V0XA 3SGBE 2PHBA 1GJ9B 1HAGE 1QNJA 1NFUA 5CHAC 1WV7H 1NS3A 2ZGJA 2BQWB 3K2UA 1H9HE 4AB8A 2R0KA 2F9BH 3UR6A 3S7HB 1P2NA 4MDSA 2EA3A 2EI7A 1KMHB 2TRMA 4D7GA 4GVUA 3MWIU 3QZQA 3SJOA 1FNIA 1ANBA 9LPRA 1F0RA 5A8XA 2D26C 2BMGB 5L2YH 2TGAA 1KDQB 3N7EA 1ESAA 2LNCA 3A7TA 4AYYB 1O0DH 4Y79A 4NFFA 2PR3A 3ZV8A 4P02A 2Y5HA 4ABHA 1ZR0A 3F68H 1NTPA 1TNKA 3V3MA 3ZYDA 4BAQB 4AFSA 1EASA 1GI9B 2W7SA 5BPEA 1ZPBA 3LC3A 5C0UA 3VGCB 1D6WA 2ZU2A 3T27A 4IN2A 1HFDA 1ELAA 1TX7A 2AYWA 4X1RU 1JRSA 1AUTC 5EU8A 4WJG2 1PPGE 5FPYA 2QF0A 2GVFA 3SV2H 1O2TA 1E38B 1WBGB 4UFEH 2AMQA 1C2IA 4K1SA 1SC8U 2FOAA 2ZDAH 3F0PA 1FLEE 1G9IE 2HVXA 2FI5E 1Y59T 1GMHG 2VH6A 4YM9A 2GZ8A 5PTPA 1T8MA 3QWCH 1O39A 2A1DB 3TJNA 4CRFA 2ZI2H 1GGDC 3VGCC 3I78A 1QIXB 4DOQA 5C0TA 1GMHF 3HATH 1BMNH 1V2OT 3AK5A 5CMXH 1NU7B 3P70B 1O2SA 1HJ9A 1TNIA 3DSGA 2Z3CA 1GCTB 2PGBB 1SOZA 5HKKD 2BXTH 2LP6A 3BTWE 2CMYA 3E90B 1DICA 3SJ8A 1QL9A 1HAYB 7ESTE 1C1VH 3T28A 1BTZA 4LZ1H 4OS1A 4XRNA 1C5YB 2QGRA 1LQEA 1O3AA 2SGPE 1TA2A 1C5ZB 3NCLA 2Z9JA 2R2WU 4H6TA 4Q63A 3GDVA 5DP8A 2VIOA 1S83A 2UWLA 1XUJA 4INLA 1DSTA 3OEHD 1QR3E 5J4SA 2A4QA 3M5MA 1S85A 2YMSC 4KGAA 4JZ1A 1QL8A 2AGEX 4GCHF 4TYDA 4XOJA 1GI4A 3PM3A 3SUDA 2BDHA 5DSFA 3BTEE 4CHAB 1F92A 1KYNA 1XXFA 4OS2A 3EGKH 1MAYA 2SGQE 3A87A 1T31A 3NZIA 5DP3A 3Q3YA 4AGKA 1TPPA 1EX3A 3QGNB 1K1MA 4WWYA 1MABB 4BAHB 4DIIH 5IYTA 5I25A 3GDSA 3W1EA 1IQFA 2J38A 3PWCA 2ZPRA 1NZQH 2FYQA 2TBSA 1N6YA 3MH6A 1ZRBA 5EIYA 1EAUA 1VITF 3ZZ7A 2ZDVH 1IHSH 5K0HA 4NIYA 5LH8A 3FOAA 1VKYA 5DN6D 1ACBE 1O38A 3DA9B 1AE5A 3H7TA 1SGRE 5F6MA 4A1XA 2J92A 2VVVA 5A0CA 1MZDA 4NCYA 1VGCB 4BXWA 7KMEH 4A92A 4DT4A 1V2VT 3WW7A 2PGQB 4ABIA 4NGAH 1PPHE 3GY5A 4KTUA 4TPYA 2F9PA 1DWBH 3C27B 1UTMA 3LGWA 3MFJA 1UTQA 3MNCA 3PWBA 4YT7H 1C2EA 1QGFA 2KAIA 1MTSA 1QBOA 4WXVA 2ASUB 4LXBH 3F9HA 2J2UA 5EXNA 3PO1B 2P59A 3D62A 2UUFB 1PYTD 3T2NA 3A7ZA 1N1LA 2WPKS 2TGPZ 1GBCA 3ZZ9A 1TPAE 2FZZA 3MHWU 1C9PA 1BJVA 3MO3A 3PYHA 1C2JA 4LOYH 4AFQA 1AZZA 1T8NA 3E0NB 3L6PA 1SMFE 2BY7X 4GHTA 2VVCA 3A8AA 4CR9A 2FTLE 4JZIA 2H9EH 1RGQA 1YPHE 1G32B 1SPJA 2CXVA 2STAE 3UNRA 1DITH 1TMUH 1PPFE 2XBWA 2O8WA 1MD8A 1IQNA 1YCPM 2J94A 4NIVA 1T7CA 4E06H 1W7GH 4ESTE 3UIRA 2ZCHP 3U69H 3F1SB 4FUJA 4FU7A 1DWEH 1S81A 2A32A 3RXGA 2O8UA 2A0QB 1NT1A 2QF3A 2F83A 1Z8IB 2BX3A 1C5QA 3HK3B 2WPMS 3A7YA 4ZROA 1ZSJA 4ABFA 4FUIA 3RUOA 1TPSA 4KP0A 3RXEA 2PWXA 4MPVA 1O2IA 1CVWH 1V2WT 2GCHG 4J1YA 3ZVBA 4X1NU 1TBQH 3WWFA 1QHRB 1C4U2 3EYDA 1GDUA 1N6XA 6CHAB 2A2XH 3K65B 2M5TA 1KSNA 2GV6A 2G81E 1W7XH 2GCHF 5B6OA 1AB9C 1F2SE 1Z6JH 3GICB 2VGCB 1NFYA 1BTWA 1AN1E 1OHHD 1H8DH 2BLWA 2R3YA 2QA9E 5C67A 2R0LA 1SLUB 1YP9A 3QZRA 3U1JB 3HGPA 1G30B 1J17T 3K9XB 1O2MA 1HAZB 1SGQE 2OQUA 2IOTA 1O3KA 2CHAB 4YOJA 1W3CA 5JYIA 4GLYA 1GJ7B 3ZZBA 4ISLA 1GG6B 3SV9A 3UNSA 1DLKB 4Z6AH 5C3NA 4B71A 1O5FH 1OYTH 1GVZA 3M7UA 3PLPA 4FUEA 2VGCC 4NA8A 2ZNKH 2FX4A 3T62A 5SGAE 2UWOA 2ZKSA 1WQSA 2THFB 1TRNA 1JIMA 2V3OH 1OKXA 3SNCA 3F9EA 4Y6DA 5EQSA 1Z8GA 3LJOA 2FDAA 1SGIB 1D4PB 2A7HA 1Z8JB 4AOQA 2D8WA 2A5AA 1ZHPA 1P9UA 2OCVB 1O5EH 4YO9A 2FWWA 1YCPH 3BTDE 1MAXA 2QF4A 2ZHQH 2QC2A 5F8XA 1FY8E 3RXMA 1LKBA 1AWHB 1ABIH 1V2KT 1C2KA 2FS8A 1UJ1A 3F9FA 1A61H 2O9QA 1DANH 1ELFA 5HMAA 1OPHB 1PPEE 1QFKH 4B76A 1B5GH 4X2VA 1W10U 4NIXA 2B7DH 2FOEA 4I8KA 3A8DA 1T32A 5EG4A 2W6JD 3LH1A 1HXFH 4M7GA 4MPWA 4B6FA 1FY5A 1HIAA 1PJPA 5C1YA 2ZWLH 5EXMA 3LDXH 3RC5A 2HWLB 1SSXA 4IMQA 1C1TA 1GBKA 1UO6A 2QXJA 5BRRE 4X2YA 3RC6A 1UTLM 2HLDD 2BLVA 5EW2H 1NU9A 5T6DA 1QRZA 3SNDA 3SW2B 1SGDE 1P02A 1FY1A 1CA8B 2F43B 1K21H 2C4FH 2LPRA 3OEED 4X1PU 3DUXH 3A81A 1LVBA 3A82A 2QN5T 2ODYB 3P92A 3MYWA 1UK4A 3U98H 2UUKB 4FUDA 3DFJA 5A2MH 3SU4A 5EQQA 1YPJH 5C2ZA 3RU4D 4A1VA 3FVFB 3MU1A 1O2RA 2VU8E 2QV1A 1S0QA 3ENSB 1TGNA 3QUMP 4YTAA 3M3TA 2XWAA 4OGXA 3T29A 1BTHH 4U30A 1HJ8A 2HLCA 3TU7H 2OC1A 2BD7A 2G55A 4XBDA 2G8TA 3VB5A 4D9QA 2HNTE 3WY8A 4TWWA 2BTCE 2XC0A 6LPRA 1TAWA 1DM4B 5FX6A 5TJXA 4VGCB 4O3TA 3GY3A 2FIRH 2ZGHA 3M61U 3OU0A 2ZFSA 4A5TS 1LQDB 1F7ZA 1Z1IA 2H1UA 2PUQH 3RP2A 4FU9A 3TITA 5L6NH 2ZTXA 1KXCA 2RFKC 1EAXA 2C3SA 3W95A 3RXCA 3H7OA 1C5UA 3TJOA 4F4OC 3BN9A 5DP9A 3MO9A 4CH2B 3RXLA 1SGFG 2JJ2D 3KYFA 1Y5AT 3F2HA 2PUXB 3LGUA 1OWHA 1GI3A 2AMDA 3MNSA 2EI8A 1TA6A 3ZVCA 3L3TA 1WYKA 1AWFH 3EA9A 1KY9A 1DFPA 1GI2A 1K1NA 4Y7BA 1QRWA 2H9HA 2XCNA 1P2KA 4B73A 2P16A 2WYGA 3ATKA 1ABJH 2YMSD 2ANYA 4OS4A 4MG3A 2FI4E 1UCYE 2Y82A 1UVSH 1FONA 7GCHG 3SHCH 4D9RA 2ZU4A 1CT2E 1P04A 1O2OA 1FQ3A 2WINI 3SQHE 1WQVH 4JYUH 2J98B 3SHAH 2G4UA 1MKWH 1OWIA 4ZH8A 2GX4A 1CT0E 4E05H 2JKHA 1TGCA 2BD4A 1MBQA 4THNH 4XD7D 1Y5UT 1D3DB 2ZFQH 4PROA 4UFGH 4ACBA 5EW1H 2CF8H 1VJAU 1XUIA 3TH3H 3ZYEA 4FUGA 3PMAB 4OM9A 3SBKA 3MMGA 3SJIA 2BY5X 2OXSA 4X6OA 1EKBB 2ZQ2A 4O03A 2FPZA 1B0EA 1J15A 5E0JA 5TCAA 3RMOH 4B1TA 4DIHH 5F8TA 1C1SA 2BM2A 3SU1A 5EODA 2BHGA 1W2KH 4BOHA 4AX9H 1E1QD 3F2GA 1BOQA 2RA0A 5DP6A 1E79D 5LGOA 4INHA 2ZU5A 2PFEA 5GPIB 1QTFA 1FY3A 1SL3A 1YLNA 1C1UH 5AF9H 3TK9A 2F9UA 1IQJA 4RKOB 3Q00A 1RS0A 1O2QA 3D49H 4WH8A 1GJCB 1HGTH 4NIWA 4Y8XA 1VR1H 2QAAA 2ANMH 4GPGA 3I29A 3ITIA 5AFZH 3A83A 4Z0KA 1K0HA 5FBIA 3RXKA 3EE7A 1ANCA 3FZZA 1FX0B 1AI8H 3UAIC 4M9FA 3RU4E 1GBJA 5EXLA 5C17A 4ISOA 3STIA 2XCFA 5C5NA 3Q3XA 4CRBA 1HCGA 1O2ZA 2O8TA 2A45B 1LDTT 4R8TB 1S6LA 1Y3VA 3BIVH 1AKSA 2VIPA 4ZCNA 6ESTA 4CRDA 4X0WU 3RLWH 3PB1E 1C5OH 1VITH 1N8OB 4WF8A 2ZFRH 3T5FH 5CHAB 1CA0C 1GMCF 2A5IA 3UWJH 4I7YH 1GHAF 1HPGA 1P2OA 2XTTB 4X1SU 1G3BA 3OY5U 4AFUA 2P3UB 1IQLA 1GI5A 4K8YA 4TSFD 3RXOA 2BY9X 3SV6A 1C5LH 1KXAA 2C93B 1P01A 3TJVA 4RI0A 2IPHA 1AU8A 1OP8A 3TH2H 3AASA 1N8OC 1XUFA 3ZV9A 3GY4A 2FOBA 2ZA5A 1OSSA 2UUYA 1C1PA 1SQTA 4B75A 1S5SA 4FVBA 2FOCA 2VIWA 3LIWA 1F0TA 1SLVB 3NK8A 1DUAA 3JZ2B 2HOBA 1V2JT 1O2NA 1UVPA 1E0FD 1MKXH 8GCHF 1AE8H 1L0ZA 3P8GA 1F5LA 2D2DA 1EP6A 2OLGA 5KEDA 5LPEA 2NU4E 4RT0A 2ZG0H 3RXFA 1MH0A 1VCWA 2C8YB 1OWKA 2AIQA 3MU4A 1ZMNA 2C90B 2FTMA 3S9BA 4B6EA 1GGDB 1QB9A 1AGJA 1G2LA 4RN6A 2BX4A 1YPGH 4ABEA 1CHGA 3M37A 3CP7A 1HRTH 2VIVA 4U01A 1A5GH 4Y11E 1YGCH 3N99A 4Y10E 5DJ7A 2Z3DA 1O3LA 2UWPA 1OOKB 2KCPA 1GBHA 2FP7B 4LK4A 1QBVH 3QTOH 4DT7B 1GL1A 1LTOA 1SGEE 2FS9A 2CGAA 5AFYH 2WPHS 1Y5BT 1FPCH 4TWYA 4UFDH 4YZUA 5JBCS 4LZ4B 4I8JA 1NFWA 4TY6A 1NRQH 5GNDA 1IQGA 1EJNA 2WYJA 4P00A 3PTNA 1TNLA 4H6SB 2SNWA 2ZZUH 4E7RG 1CQQA 2UUJB 2ZIQH 2GJGA 2XBVA 8KME2 3A89A 1UTOA 5L2ZH 4FOUC 2YMSB 1DDJA 5JB8S 3CENA 2D1JA 1Q3XA 1MZAA 3SZEA 3V13A 2DE8A 3DFLA 1O33A 4ZHLU 1V2MT 1NRSH 1O3MA 1O3FA 1O2XA 1AHTH 2FLRH 2STBE 2JJ1D 3A7WA 3BSQA 4MNXA 4Q7YA 3OY6U 1LCYA 2JIZD 1CSOE 5KGOA 1FN6A 1Y3XA 4YXWD 4BAKB 2WPJS 2XBYA 2RCEA 3SJ9A 3UFAA 1GBAA 5CE1A 2NU1E 1QA0A 3AW1A 3FO8D 4BTUB 4J2YB 2PKSC 5HM2A 3TNSA 4QT8C 1OP2A 1H1BA 3M5OA 2VIQA 5DKMA 2ZCLP 5AHGH 4AORA 2F9OA 1CGJE 4U2WA 1TMTH 4R0IA 1TX6A 3O8BA 3A7VA 4MTBA 1BHXF 4ZXYH 5C1UA 2VJ1A 3A86A 1CU1A 5DK1A 3ATMA 1SFQB 4HTCH 1GJAB 5E2OA 4CBNA 1JMOH 2AIPA 3GCHC 3SGQE 4NWKA 2WV9A 5CHBA 3VB4A 5HIZA 1QRXA 1UTPA 2P94A 2SGDE 3PRBA 4KTSA 2BDAA 1GBBA 3RXSA 1KTSB 1DLEA 1QQUA 3BTTE 3BF6H 1YM0A 1V3XA 3GISB 1UTNA 4KKDA 5JB9S 4BTIB 1G36A 1TABE 4IC6A 1SKYE 3SYJA 1C1MA 1H9LB 1LHGH 1ETRH 3MTYA 1YPLH 1WOFA 1W8BH 3Q77A 1COWD 1W0KD 5GJ4B 1HAVA 2QXGA 5CDFE 4ZHMU 1GMDG 1KXBA 2XXLA 4B74A 2FM2A 3SNAA 3DD2H 1VZQH 2IN2A 2QCYA 3F3BA 4MQAA 3FP8E 1GMDF 4O3UA 1J16A 2CV3A 1LVOA 2PKAA 1FI8A 1LPKB 2HNTF 4KTCA 2Z9GA 2V0BA 1EP5A 1DXWA 3UWIA 1P06A 3LGYA 5A8ZA 2ZFFH 2BQ6B 5A09A 3CNRA 1U6QA 4YLUA 3MU0A 4AB9A 5HYOA 3LONA 1UMAH 2A4RA 2J97A 4JZEH 2R2MB 4ABBA 1T4VH 3BEUA 3RXUA 1GHYH 1THSH 5HXFA 5EPYA 3EA8A 3GOVB 1TGSZ 4O97A 1W0YH 2OD3B 2XRCA 2CJIA 2FX6A 3OSYA 9ESTA 2B9LA 2NU3E 1E37B 2Z3EA 4HI3A 2NU0E 1HAHH 1O5AB 1EZSC 5I46H 2JH5D 2PV9B 1Y3YA 1P10A 3EE0B 3TGJE 1AB9B 1IAUA 1D9IA 2FODA 4CRCA 2BDCA 4JK6A 1W0JD 2GD4B 3V7TA 1C1QA 4HG6A 1P2MA 1X7AC 1L1JA 1HIAB 2YOLA 2ZHWH 4F49A 1BBRK 1OYQA 1L2EA 1SHYA 3MQKC 1Y3UA 1O34A 1T8OA 1W12U 4Q7ZA 1P05A 1ZOMA 2BOHB 2ZO3H 1DS2E 1PQ8A 2BZAA 3PV2A 3RXVA 1UHBA 1V6DA 3GCOA 1JXPA 2B8OH 1GBEA 2GDDA 1H8HD 1ELDE 2EC9H 1Y8TA 1TWXB 2FI3E 1OWEA 1SQRA 2KR7A 4OS6A 1C5RA 4BANB 1YYY1 1PFXC 3VXFH 4DCDA 1F0SA 2PTCE 1BBRE 2A7JA 1BTXA 2ZU1A 4H4FA 4CBOA 1P0SH 3U1IB 1O3BA 2H5CA 1O2LA 1DPOA 2H9TH 1GJ8B 1DOJA 3VXEH 2V3HH 1ZTKA 3QLPH 3ZZ8A 1ETSH 1PQ7A 1RTLA 3ZZ6A 1G3EA 1GCDA 4JYVH 3DSPA 2BZ6H 1L1GA 2KZ4A 1GBFA 5FPTA 2ZHFH 1P03A 3M35A 4Y0YE 2GZ7A 4BNRA 1YWUA 1TMBH 4NZQA 1KXDA 4JYTA 1PPCE 3EQ0H 1ELEE 4Q80A 5L30H 2DE9A 2J95A 1A5HA 2AEIH 3FP7E 1P12E 2OC8A 2BB4A 1K1IA 1NPMA 3TH4H 1C1NA 3QGJA 1YPHC 2WUCA 2ZC9H 1S6FA 1C5PA 1MTWA 5JBTA 5F03A 5HM9A 1TB6H 3OX7U 2VWLA 3UOPA 2QE7D 4DJZB 1O3JA 5ETXA 5G4BA 3S0NA 3TK5A 1FIWA 4FUCA 2CF9H 1T8LA 2Y81A 1EXFA 2ZTYA 3FN8A 3PTBA 1O36A 2ULLA 3A88A 1E36B 1GHBG 3NXPA 1CO7E 3I77A 3KCGH 5JBAS 1Z6EA 2ZHDA 4CR5A 3SUFA 1XX9A 2G5NA 1GDNA 3AAUA 4IS5A 2F9VA 4I32A 1TIOA 4WXIA 2PLXA 4D7FA 5FCKA 1CGIE 2IJOB 1UTKA 1O5DH 2H5DA 2XOKD 3D23A 1QJ1B 1Q31A 2RA3A 1FAKH 4KELA 1CBWB 2Y6TA 1QJ6B 3RXJA 3Q76A 1ZGIA 1FDPA 1ETTH 6GCHG 1JOUB 1CHOG 1TONA 1O31A 3VB3A 2P93A 1ANEA 1LMWB 2LELA 4AG2A 2R3UA 3O8CA 3HPTB 1SG8B 2JH6D 4BAMB 1MU8B 2G52A 1EZQA 3KEEA 1AUJA 4X8SH 4Z1MD 1CHOF 2VWNA 3OYPA 3ZVGA 1PPZA 5EGMA 1V2UT 1ZTJA 3C1KA 1BQYA 1CBWC 1IHTH 1B7XB 2VWMA 5E0HA 5DG6A 3ATLA 4AN7A 4ABJA 1EOJA 1V2QT 1BTYA 3BTQE 1MKXK 1MBMA 1XXDA 2NWNA 3BTGE 4RSPA 4ISIH 1HAIH 3OTJE 1SLWB 4ABGA 5A0BA 2AH4X 4X2XA 4U32A 1MQ6A 1MTNC 1BIOA 2GV7A 1SBWA 3BTME 1SLXB 3KQEA 4MNYA 3RU4T 3LH3A 1UK3A 2RDLA 2VINA 3SUGA 3ATIA 1FY4A 1S6HA 1EPTC 3MNXA 4MNVA 5AVDA 3IITA 2WUBA 4X2WA 3PMJA 2QYIA 2ZEBA 1P09A 1ANDA 2I6QA 5DGJA 5FHTA 1FJSA 3SQEE 1QY6A 2ZGBH 4WMFA 2G5VA 4TY7A 4F48B 4ZUHA 1SFIA 1L1NA 1KXFA 1LPZB 2R9PA 1AKSB 2ZCKP 3RC4A 2M2AA 1XUKA 2A5KA 3R0FA 4UD9H 3A80A 1AZ8A 1ZSKA 1O5CB 1M9UA 1BRAA 2BVXH 2P3TB 1ARCA 2W6ID 1SB1H 3HKIB 1YC0A 1ZHRA 4IC5A 4WMEA 1C1OA 1UVOA 1E35B 1O2YA 1BMFD 2Q6GA 3ZZ5A 1C1WH 3UNQA 7GCHF 1C5MD 3HGNA 1Z8RA 1QCPA 1ESBA 1SGCA 1HJAC 4RT1A 1DVAH 1DSUA 4X8VH 5GIBA 1GL0E 4WY3A 1HB0B 2EY4C 1FAXA 2CK3D 4Y76A 4JCNA 3SORA 4Y7AA 3FZDA 1UK2A 5T6FA 2P8OC 1W13U 1C2DA 1F5KU 2SGAA 1ZJKA 3M36A 1NRPH 1A0JA 1TNJA 1GBTA 4DGJA 2OBOA 5EPNA 2BDYA 1EPTA 4F55A 2BY8X 2Z9KA 1Q2WA 1IQHA 3ATWA 4NG9H 3CS7A 4MVNA 1A3BH 2GCTB 2HGTH 1RIWC 3Q3KA 1V2LT 4DY7B 5H4IB 2AERH 4UDWH 3RXHA 1QQ4A 4X6NA 2HNTC 2BOKA 1H8ED 5A8YA 1YPKH 3RMMH 2P95A 4MPXA 2AGGX 3M3SA 1BJUA 2QIQA 5F53A 3GCTG 1FPHH 1O2HA 4YESB 1GI0A 1MUEB 1O2JA 4K3JA 3ZVFA 2GCTC 5DPAA 1ZRKA 1CA0B 4XFQA 3MI4A 3MNBA 1BITA 3KN2A 5C94A 3SU3A 2OC0A 3GCTF 2WPIS 2BY6X 1EB2A 5KECA 1VCQA 2C8WB 1CGHA 1C1RA 4GUXA 1B0FA 4ABAA 1E1RD 2W3IA 3T25A 1OS8A 1W14U 2ZPSA 3LC5A 1HAXB 1LHFH 2KFWA 2WPLS 3PLBA 1O2KA 1P8VC 1SR5C 2PSYA 2J34A 3SI3H 2Z94A 2FOGA 1NN6A 2ZECA 3EA7A 4OS7A 3NKKA 3SU0A 1C2FA 2NU2E 4IMZA 2W3KA 1ZPZA 3ZVDA 3E6PH 1FV9A 2TGDA 1HYLA 3LGTA 5IK2D 2G51A 1DX5M 3SGAE 2SNVA 4NA9H 4NSVA 1HAPH 3U8RH 2BVRH 2WHXA 2KCYA 1V2PT 2FOMB 4X8UH 1GBLA 1V2ST 3IG6B 5TCCA 1AVGH 1ZHMA 1S84A 1Z71A 1FN8A 4K8BA 3RXTA 1FIZA 5DP4A 5EJZA 5FAHA 4IN1A 5FL7D 1DWCH 2V6NA 3UPEA 4A7IB 4IW4E 2ZHEH 1GI1A 4B2CA 4OS5A 3QDZB 4HFPB 3ELAH 2ANKH 2BD5A 4HZHA 3ZVEA 4BAOB 1NRNH 2K1QA 3LOXA 1BRBE 1ZSLA 1HV7A 1V2RT 1RRKA 2OUAA 1IQIA 1EJMA 1ELTA 1A3EH 3P6ZB 1A0HB 1P3EA 1O3CA 1GHXH 2ZU3A 1MTVA 3LGVA 1ARBA 1XKAC 5E8EH 1PQAA 2L6OA 4K60A 2OC7A 2YNAA 3ZIAD 1BMLA 2OBQA 4UONA 3TNTA 3ESTA 3KQCA 1RFNA 4K69A 1ELGA 2BD3A 1D3TB 1IQMA 3W94A 2OK5A 2AFQB 1A46H 2SGFE 4O9VA 3KQ5A 1THPB 1A0LA 1GDQA 1BT7A 1HAVB 1UCYH 2W26A 1LVMA 3RXBA 1GHZA 3URDA 1J14A 4NZLA 1IOEA 1BDAA 3MU8A 2GDEH 4E7NA 1T4UH 3PMHB 3LJJA 1NO9H 4BXSA 3VG8A 4FVDA 3DT0H 2BD9A 2KAIB 4B2AA 1F0UA 1YBWA 5EJLA 3E3TA 2Z7FE 2PKAB 1C5SA 3ZZAA 2Q6FA 2BDBA 4MPUA 4ACAA 2PKSB 3ZZ4A 2BLOA 3BTHE 2KCOA 1C2LA 3M3VA 1C5XB 3H5CB 3BEIB 1VCPA 1BRUP 1FZZA 1TFXA 5FX5A 3B8JA 2BD8A 1TOCB 1A5IA 1AQ7A 1G37A 1O2GH 2XYAA 3FP6E 3M7TA 3WWBA 1EFRD 2I6SA 3RXRA 3GCHB 2Z9IA 4Y71A 3GS9A 4K1EA 3TK6A 1MCVA 1YCPK 1O5GH 1EOLA 3BV9B 2BQ7B 3PV4A 4FUBA 1C2GA 3DHKH 2GP9B 2VB0A 1LHEH 3ODFA 2VVUA 4FUHA 1TBZH 4GCHG 4Y8YA 2BYAX 2ILNA 5J4QA 4Q4LA 1IQKA 2KM0A 3FFGA 4FETA 4ZKRU 1GCTC 3RLYH 1K9OE 2ODPA 2FLBH 1ZGVA 2HRVA 2ODQA 2VWOA 2WPDD 2BDGA 2WSSD 3S69A 1PQ5A 3PMBB 1KLIH 4K1TA 3UOUA 2Y5FA 2SGEE 3STJA 4SGAE 1KDQA 1C5VA 1XM1A 2H2ZA 1EQ9A 1EATA 1QB1A 4GSOA 3VFEA 5T6GA 1HNEE 2ZDKA 1VITG 5DO4H 1ZTLA 3MU5A 1TYNA 3ZVAA 1UHBB 3SJKA 3MH7A 1G2MA 1GI8B 5FXLA 1HBTH 3U28C 5A0AE 3LT3A 1PPBH 4X1QU 4SGBE 2GTBA 2J4IA 3U9AH 4CHAC 3UR9A 1ELCA 1AY6H 1DY9A 3SO3A 3VB7A 1TBRH 1GHWH 1K28D 3MH5A 4ISHH 5EOKA 1XKBC 3RXIA 1QA7A 1QZ8A 2K8IA 1KTTB 1NBMD 1MTUA 3SI4H 1J9CH 4XE4A 1ESTA 1ZLRA 1YPEH 2Q6DA 3KNXA 5EQRA 1XVOA 3KF2A 4FU8A 3KQBA 3LU9B 3UB0A 4BTTB 1DWDH 2XWBI 5F8ZA 4A6LA 2GT7A 1K1LA 2A4GA 4ISNA 1S0RA 1H8IH 3AAVA 4YOGA 3E0PB 1O3OA 1AIXH 1P9SA 4FXGH 3BG8A 4ASUD 2FXRA 1E34B 1SGNE 4IGDA 3O8DA 5EJ1A 2VH0A 1VGCC 3RDZA 1QL7A 2OINA 1GI6A 2Y7XA 3AVZA 4NA7A 3DCLA 1VJ9U 1HLTH 2V35A 3S9CA 3P8OA 4NFEA 1SI5H 1D3QB 3R3GB 3ODDA 2BD2A 3VPKA 1ZMJA 2EQNA 1D6RA 1O2UA 2AS9A 2FMJA 3T26A 4YLQH 2AMPA 3PO1C 1ELBA 3KL6A 3KHVA 2ZGCA 2HVYB 2ANWA 1WU1A 3FAOA 1SVPA 2IJD1 2BVSH 1QJ7B 4DURA 1WSSH 3PV5A 1LO6A 5ESBA 4Y8ZA 1O2VA 3IWMA 4NSYA 1DXPA 1FUJA 1JBUH 3OTPA 3RXPA 1DUEA 1WTHD 4UEHH 2ZDLA 2BLQA 4CH8B 2JDID 1F5RA 5K7RA 1L4ZA 1DE7H 5LPRA 1C2MA 2RDEA 3GDUA 2XC4A 1SGFA 2Z6BD 5HIYA 2C8ZB 1MKWK 3UQVA 1GJ4H 1A7SA 1P57B 5B6LA 3SV8A 2ZGXH 4I8HA 3VB6A 1BCUH 4X6PA 4B2BA 2TPIZ 5C5OA 1EAWA 1EZUC 1TQ7B 3PRDA 2GMTB 3B23B 4WVPE 1LHDH 2SFAA 4K5ZA 2HALA 1ZPCA 1ID5H 3K6ZA 4JZFH 2V3MA 2Y7ZA 4A1TA 1L4DA 1EUFA 3P17H 2OP9A 3BG4B 4ZMAH 3GY6A 1YLCA 1O3PB 1GBDA 4NWLA 4ZAEA 3V12A 3EAJA 1TGTA 6CHAC 1Y3WA 2XNIA 3NUMA 3QN7A 1AD8H 2VNTA 3NRLA 1ZJDA 1GJ6A 1ZMLA 1KLTA 2GKVE 1OWDA 1P11E 3ZZCA 1AVXA 3A85A 3UQOA 1NRRH 2YNBA 2ESTE 4Y0ZE 1YPMH 2GMTC 2W5EA 1Z1JA 1OX1A 2Y5GA 8GCHG 3FANA 1O2PA 1NY22 2ZFPH 3LGIA 3A8BA 2L74A 2PW8H 3SV7A 3UUZA 3ZZ3A 4ASHA 4ZKOU 3BG4C 1AFEH 3A84A 1C9TA 2CHAC 2QY0B 3B9FH 4Q7XA 4I33A 3RXQA 1GG6C
chains in the Genus database with same CATH topology
4AC9A 4ACAA 1SQRA 4ACBA 2LP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AC9 A;  4ACA A;  1SQR A;  4ACB A;  2LP6 A; 
#chains in the Genus database with same CATH topology
 1NC6 A;  1SGT A;  1NBM E;  1DT2 A;  1WDI A;  4UE7 H;  2IPQ X;  1XUG A;  7LPR A;  4INK A;  3LPR A;  1TQ0 B;  1LKA A;  2W7U A;  3U8T H;  5GXP A;  4MNW A;  3NWU A;  3M5L A;  3UY9 A;  1K1O A;  2AGI X;  3A8C A;  1O3H A;  3VEQ B;  3TGI E;  3SNB A;  3URE A;  4ZHA A;  1BMM H;  1KLJ H;  1OXG A;  3SU6 A;  1EB1 H;  8LPR A;  2C8X B;  5JBB S;  3S7K B;  1EJA A;  2Y80 A;  4WMD A;  1GHB F;  8EST E;  3BEF B;  1GBI A;  3E8L A;  3QO6 A;  1P2Q A;  2F91 A;  1FXY A;  2QXI A;  1P3C A;  1RJX B;  2OTV A;  5DP5 A;  4AYV B;  4AG1 A;  3P8N A;  1TNG A;  4TPI Z;  5DP7 A;  3ZZD A;  1C5T A;  3F9G A;  4WH6 A;  1EAI A;  4I8G A;  2PP6 A;  2GGV B;  3TLO A;  3RXA A;  1HAO H;  3BTF E;  1A4W H;  3LKW A;  1XVM A;  4GHQ A;  4HGC A;  5T3H A;  1GVL A;  1YKT A;  6GCH F;  1GWA A;  2J5U A;  4YOI A;  1W11 U;  2QF5 A;  1MTN B;  2AHM E;  2J9N A;  5C20 A;  1O3D A;  1H9I E;  2EEK A;  2FOF A;  1UTJ A;  3KID U;  4MLF B;  5FCR A;  3MO6 A;  1EPT B;  1TGB A;  3RM2 H;  1CE5 A;  1SGY E;  4XSK U;  4K2Y A;  1ORF A;  1BMA A;  3GCN A;  3TVJ B;  1NES E;  5EST E;  4I8L A;  1KIG H;  3SNE A;  1C4Y 2;  5JPM H;  4I31 A;  1TRM A;  1YF4 A;  1BRC E;  2XND D;  3F0O A;  1RD3 B;  3HKJ B;  2B5T B;  1KXE A;  3P8F A;  2ZF0 H;  1BZX E;  1NFX A;  3RXD A;  3PLK A;  1JIR A;  1GVK B;  1SQA A;  4YT6 H;  2FOH A;  3MOC A;  3PRO A;  4ABD A;  2A31 A;  3N7O A;  1TX8 A;  1TAL A;  3P95 A;  4AFZ A;  5T1V A;  1SHH B;  3SUE A;  2QXH A;  1BHX B;  1DY8 A;  2ZTZ A;  2FYR A;  2ZQ1 A;  4FUF A;  3SZN A;  3JZ1 B;  3TIU A;  1K22 H;  2A7C A;  4DVA U;  2ZDN A;  1JRT A;  1NRO H;  1TRY A;  3GY2 A;  4AC9 A;  1AO5 A;  1SQO A;  1ZZZ A;  2WZQ A;  3SN8 A;  1ZYO A;  3GY7 A;  1C2H A;  2O8M A;  2XBX A;  1GI7 B;  2Z9L A;  4DG4 A;  3CS0 A;  2P3F H;  1HUT H;  1HJA B;  2XC5 A;  3QTV H;  1UCY K;  1XUH A;  3A7X A;  1PYT C;  2BXU H;  2G4T A;  2RG3 A;  1AMH A;  1D3P B;  2ALP A;  1TLD A;  2DUC A;  3GYL B;  2FES H;  1RTK A;  4H42 U;  1MMJ N;  2P8O B;  4X8T H;  1AVW A;  3TGK E;  1BBR H;  1C5N H;  4VGC C;  2F4L A;  1BTU A;  2Q1J A;  1XMN B;  3S9A A;  1O3N A;  2GT8 A;  2OQ5 A;  3F6U H;  2KX4 A;  5GCH G;  3M7Q A;  2F3C E;  4JK5 A;  4Q2K A;  1K1P A;  1TE0 A;  1O5B B;  3RML H;  1O35 A;  2EI6 A;  2XW9 A;  1INC A;  1O2W A;  1P2J A;  1RIW B;  3U8O H;  2JET B;  2G00 A;  1RTF B;  1TOM H;  5GCH F;  4UFF H;  3SOS A;  4JMY A;  1GJB B;  2PTN A;  3QK1 A;  1UW7 A;  3URC A;  3TJU A;  2WV5 A;  1GBM A;  1WXR A;  1OP0 A;  3EDX B;  3OE7 D;  2VID A;  4RKJ B;  2KCA A;  2WV4 A;  1AFQ B;  1C4V 2;  4XBB A;  5HGG A;  4AGJ A;  1G3C A;  1MCT A;  1BB0 B;  1HDT H;  3O8R A;  3OFN D;  2CN0 H;  1THR H;  4TT3 D;  1LVY A;  2H6M A;  5E0G A;  1WAY B;  2JET C;  4JZD H;  2FO9 A;  1GHV H;  4CRE A;  1BUI A;  4CRG A;  1UVU H;  1BA8 B;  2ZPQ A;  1HXE H;  1A1R A;  1WTG H;  3BTK E;  4I86 A;  2GZ9 A;  1H4W A;  2PSX A;  5IDK A;  2A2Q H;  2ZDM A;  1V2N T;  3L33 A;  4OGY A;  3D65 E;  5FPS A;  1AFQ C;  3QX5 H;  1G3D A;  1BTP A;  4DW2 U;  3NPS A;  3GYM A;  3BIU H;  1Z7K A;  5E2P A;  2JH0 D;  1YLD A;  2K0Q A;  3MH4 A;  5JDU B;  1QB6 A;  3KYG A;  3KGP A;  4CRA A;  2B0F A;  1MQ5 A;  1RXP A;  1JWT A;  4D76 A;  1OWJ A;  3KQD A;  1ELV A;  1S82 A;  1LPG B;  5C1X A;  4X6M A;  2F9N A;  1SGP E;  1GPZ A;  1V2T T;  2TGT A;  1TPO A;  3GY8 A;  1P2I A;  1QUR H;  2BDI A;  1IQE A;  2V7Q D;  2ZP0 H;  2FEQ H;  4ZXX H;  4D8N A;  1WCZ A;  3F2F A;  1SOT A;  4AZ2 B;  1EZX C;  1QBN A;  3H09 A;  1TNH A;  1MD7 A;  4GAW A;  1O3I A;  1K1J A;  1GJD B;  3HK6 B;  1FMG A;  3RM0 H;  1O32 A;  1O37 A;  3SU5 A;  5ABW A;  1UVT H;  4ZKN U;  1GMC G;  3FKS D;  1GHA G;  1CT4 E;  2HPQ H;  1A2C H;  3G01 A;  3RMN H;  3N7D A;  2ALV A;  3E16 B;  2O8L A;  2VBC A;  4XBC A;  3E1X B;  1W0Z U;  3OAA D;  5LPF A;  2J98 A;  2ZFT A;  3M5N A;  1O3G A;  5GDS H;  1O30 A;  1K2I 1;  3E91 A;  2TIO A;  4IBL H;  5FBE A;  1J8A A;  2HPP H;  1YY3 A;  5GWZ A;  3AW0 A;  3K6Y A;  1LHC H;  1O3E A;  4ZKS U;  1NM6 A;  2A4O A;  1GJ5 H;  3TPI Z;  3DSO A;  1WUN H;  1MU6 B;  3UTU H;  1C5W B;  4XDE A;  3SU2 A;  3V0X A;  3SGB E;  2PHB A;  1GJ9 B;  1HAG E;  1QNJ A;  1NFU A;  5CHA C;  1WV7 H;  1NS3 A;  2ZGJ A;  2BQW B;  3K2U A;  1H9H E;  4AB8 A;  2R0K A;  2F9B H;  3UR6 A;  3S7H B;  1P2N A;  4MDS A;  2EA3 A;  2EI7 A;  1KMH B;  2TRM A;  4D7G A;  4GVU A;  3MWI U;  3QZQ A;  3SJO A;  1FNI A;  1ANB A;  9LPR A;  1F0R A;  5A8X A;  2D26 C;  2BMG B;  5L2Y H;  2TGA A;  1KDQ B;  3N7E A;  1ESA A;  2LNC A;  3A7T A;  4AYY B;  1O0D H;  4Y79 A;  4NFF A;  2PR3 A;  3ZV8 A;  4P02 A;  2Y5H A;  4ABH A;  1ZR0 A;  3F68 H;  1NTP A;  1TNK A;  3V3M A;  3ZYD A;  4BAQ B;  4AFS A;  1EAS A;  1GI9 B;  2W7S A;  5BPE A;  1ZPB A;  3LC3 A;  5C0U A;  3VGC B;  1D6W A;  2ZU2 A;  3T27 A;  4IN2 A;  1HFD A;  1ELA A;  1TX7 A;  2AYW A;  4X1R U;  1JRS A;  1AUT C;  5EU8 A;  4WJG 2;  1PPG E;  5FPY A;  2QF0 A;  2GVF A;  3SV2 H;  1O2T A;  1E38 B;  1WBG B;  4UFE H;  2AMQ A;  1C2I A;  4K1S A;  1SC8 U;  2FOA A;  2ZDA H;  3F0P A;  1FLE E;  1G9I E;  2HVX A;  2FI5 E;  1Y59 T;  1GMH G;  2VH6 A;  4YM9 A;  2GZ8 A;  5PTP A;  1T8M A;  3QWC H;  1O39 A;  2A1D B;  3TJN A;  4CRF A;  2ZI2 H;  1GGD C;  3VGC C;  3I78 A;  1QIX B;  4DOQ A;  5C0T A;  1GMH F;  3HAT H;  1BMN H;  1V2O T;  3AK5 A;  5CMX H;  1NU7 B;  3P70 B;  1O2S A;  1HJ9 A;  1TNI A;  3DSG A;  2Z3C A;  1GCT B;  2PGB B;  1SOZ A;  5HKK D;  2BXT H;  2LP6 A;  3BTW E;  2CMY A;  3E90 B;  1DIC A;  3SJ8 A;  1QL9 A;  1HAY B;  7EST E;  1C1V H;  3T28 A;  1BTZ A;  4LZ1 H;  4OS1 A;  4XRN A;  1C5Y B;  2QGR A;  1LQE A;  1O3A A;  2SGP E;  1TA2 A;  1C5Z B;  3NCL A;  2Z9J A;  2R2W U;  4H6T A;  4Q63 A;  3GDV A;  5DP8 A;  2VIO A;  1S83 A;  2UWL A;  1XUJ A;  4INL A;  1DST A;  3OEH D;  1QR3 E;  5J4S A;  2A4Q A;  3M5M A;  1S85 A;  2YMS C;  4KGA A;  4JZ1 A;  1QL8 A;  2AGE X;  4GCH F;  4TYD A;  4XOJ A;  1GI4 A;  3PM3 A;  3SUD A;  2BDH A;  5DSF A;  3BTE E;  4CHA B;  1F92 A;  1KYN A;  1XXF A;  4OS2 A;  3EGK H;  1MAY A;  2SGQ E;  3A87 A;  1T31 A;  3NZI A;  5DP3 A;  3Q3Y A;  4AGK A;  1TPP A;  1EX3 A;  3QGN B;  1K1M A;  4WWY A;  1MAB B;  4BAH B;  4DII H;  5IYT A;  5I25 A;  3GDS A;  3W1E A;  1IQF A;  2J38 A;  3PWC A;  2ZPR A;  1NZQ H;  2FYQ A;  2TBS A;  1N6Y A;  3MH6 A;  1ZRB A;  5EIY A;  1EAU A;  1VIT F;  3ZZ7 A;  2ZDV H;  1IHS H;  5K0H A;  4NIY A;  5LH8 A;  3FOA A;  1VKY A;  5DN6 D;  1ACB E;  1O38 A;  3DA9 B;  1AE5 A;  3H7T A;  1SGR E;  5F6M A;  4A1X A;  2J92 A;  2VVV A;  5A0C A;  1MZD A;  4NCY A;  1VGC B;  4BXW A;  7KME H;  4A92 A;  4DT4 A;  1V2V T;  3WW7 A;  2PGQ B;  4ABI A;  4NGA H;  1PPH E;  3GY5 A;  4KTU A;  4TPY A;  2F9P A;  1DWB H;  3C27 B;  1UTM A;  3LGW A;  3MFJ A;  1UTQ A;  3MNC A;  3PWB A;  4YT7 H;  1C2E A;  1QGF A;  2KAI A;  1MTS A;  1QBO A;  4WXV A;  2ASU B;  4LXB H;  3F9H A;  2J2U A;  5EXN A;  3PO1 B;  2P59 A;  3D62 A;  2UUF B;  1PYT D;  3T2N A;  3A7Z A;  1N1L A;  2WPK S;  2TGP Z;  1GBC A;  3ZZ9 A;  1TPA E;  2FZZ A;  3MHW U;  1C9P A;  1BJV A;  3MO3 A;  3PYH A;  1C2J A;  4LOY H;  4AFQ A;  1AZZ A;  1T8N A;  3E0N B;  3L6P A;  1SMF E;  2BY7 X;  4GHT A;  2VVC A;  3A8A A;  4CR9 A;  2FTL E;  4JZI A;  2H9E H;  1RGQ A;  1YPH E;  1G32 B;  1SPJ A;  2CXV A;  2STA E;  3UNR A;  1DIT H;  1TMU H;  1PPF E;  2XBW A;  2O8W A;  1MD8 A;  1IQN A;  1YCP M;  2J94 A;  4NIV A;  1T7C A;  4E06 H;  1W7G H;  4EST E;  3UIR A;  2ZCH P;  3U69 H;  3F1S B;  4FUJ A;  4FU7 A;  1DWE H;  1S81 A;  2A32 A;  3RXG A;  2O8U A;  2A0Q B;  1NT1 A;  2QF3 A;  2F83 A;  1Z8I B;  2BX3 A;  1C5Q A;  3HK3 B;  2WPM S;  3A7Y A;  4ZRO A;  1ZSJ A;  4ABF A;  4FUI A;  3RUO A;  1TPS A;  4KP0 A;  3RXE A;  2PWX A;  4MPV A;  1O2I A;  1CVW H;  1V2W T;  2GCH G;  4J1Y A;  3ZVB A;  4X1N U;  1TBQ H;  3WWF A;  1QHR B;  1C4U 2;  3EYD A;  1GDU A;  1N6X A;  6CHA B;  2A2X H;  3K65 B;  2M5T A;  1KSN A;  2GV6 A;  2G81 E;  1W7X H;  2GCH F;  5B6O A;  1AB9 C;  1F2S E;  1Z6J H;  3GIC B;  2VGC B;  1NFY A;  1BTW A;  1AN1 E;  1OHH D;  1H8D H;  2BLW A;  2R3Y A;  2QA9 E;  5C67 A;  2R0L A;  1SLU B;  1YP9 A;  3QZR A;  3U1J B;  3HGP A;  1G30 B;  1J17 T;  3K9X B;  1O2M A;  1HAZ B;  1SGQ E;  2OQU A;  2IOT A;  1O3K A;  2CHA B;  4YOJ A;  1W3C A;  5JYI A;  4GLY A;  1GJ7 B;  3ZZB A;  4ISL A;  1GG6 B;  3SV9 A;  3UNS A;  1DLK B;  4Z6A H;  5C3N A;  4B71 A;  1O5F H;  1OYT H;  1GVZ A;  3M7U A;  3PLP A;  4FUE A;  2VGC C;  4NA8 A;  2ZNK H;  2FX4 A;  3T62 A;  5SGA E;  2UWO A;  2ZKS A;  1WQS A;  2THF B;  1TRN A;  1JIM A;  2V3O H;  1OKX A;  3SNC A;  3F9E A;  4Y6D A;  5EQS A;  1Z8G A;  3LJO A;  2FDA A;  1SGI B;  1D4P B;  2A7H A;  1Z8J B;  4AOQ A;  2D8W A;  2A5A A;  1ZHP A;  1P9U A;  2OCV B;  1O5E H;  4YO9 A;  2FWW A;  1YCP H;  3BTD E;  1MAX A;  2QF4 A;  2ZHQ H;  2QC2 A;  5F8X A;  1FY8 E;  3RXM A;  1LKB A;  1AWH B;  1ABI H;  1V2K T;  1C2K A;  2FS8 A;  1UJ1 A;  3F9F A;  1A61 H;  2O9Q A;  1DAN H;  1ELF A;  5HMA A;  1OPH B;  1PPE E;  1QFK H;  4B76 A;  1B5G H;  4X2V A;  1W10 U;  4NIX A;  2B7D H;  2FOE A;  4I8K A;  3A8D A;  1T32 A;  5EG4 A;  2W6J D;  3LH1 A;  1HXF H;  4M7G A;  4MPW A;  4B6F A;  1FY5 A;  1HIA A;  1PJP A;  5C1Y A;  2ZWL H;  5EXM A;  3LDX H;  3RC5 A;  2HWL B;  1SSX A;  4IMQ A;  1C1T A;  1GBK A;  1UO6 A;  2QXJ A;  5BRR E;  4X2Y A;  3RC6 A;  1UTL M;  2HLD D;  2BLV A;  5EW2 H;  1NU9 A;  5T6D A;  1QRZ A;  3SND A;  3SW2 B;  1SGD E;  1P02 A;  1FY1 A;  1CA8 B;  2F43 B;  1K21 H;  2C4F H;  2LPR A;  3OEE D;  4X1P U;  3DUX H;  3A81 A;  1LVB A;  3A82 A;  2QN5 T;  2ODY B;  3P92 A;  3MYW A;  1UK4 A;  3U98 H;  2UUK B;  4FUD A;  3DFJ A;  5A2M H;  3SU4 A;  5EQQ A;  1YPJ H;  5C2Z A;  3RU4 D;  4A1V A;  3FVF B;  3MU1 A;  1O2R A;  2VU8 E;  2QV1 A;  1S0Q A;  3ENS B;  1TGN A;  3QUM P;  4YTA A;  3M3T A;  2XWA A;  4OGX A;  3T29 A;  1BTH H;  4U30 A;  1HJ8 A;  2HLC A;  3TU7 H;  2OC1 A;  2BD7 A;  2G55 A;  4XBD A;  2G8T A;  3VB5 A;  4D9Q A;  2HNT E;  3WY8 A;  4TWW A;  2BTC E;  2XC0 A;  6LPR A;  1TAW A;  1DM4 B;  5FX6 A;  5TJX A;  4VGC B;  4O3T A;  3GY3 A;  2FIR H;  2ZGH A;  3M61 U;  3OU0 A;  2ZFS A;  4A5T S;  1LQD B;  1F7Z A;  1Z1I A;  2H1U A;  2PUQ H;  3RP2 A;  4FU9 A;  3TIT A;  5L6N H;  2ZTX A;  1KXC A;  2RFK C;  1EAX A;  2C3S A;  3W95 A;  3RXC A;  3H7O A;  1C5U A;  3TJO A;  4F4O C;  3BN9 A;  5DP9 A;  3MO9 A;  4CH2 B;  3RXL A;  1SGF G;  2JJ2 D;  3KYF A;  1Y5A T;  3F2H A;  2PUX B;  3LGU A;  1OWH A;  1GI3 A;  2AMD A;  3MNS A;  2EI8 A;  1TA6 A;  3ZVC A;  3L3T A;  1WYK A;  1AWF H;  3EA9 A;  1KY9 A;  1DFP A;  1GI2 A;  1K1N A;  4Y7B A;  1QRW A;  2H9H A;  2XCN A;  1P2K A;  4B73 A;  2P16 A;  2WYG A;  3ATK A;  1ABJ H;  2YMS D;  2ANY A;  4OS4 A;  4MG3 A;  2FI4 E;  1UCY E;  2Y82 A;  1UVS H;  1FON A;  7GCH G;  3SHC H;  4D9R A;  2ZU4 A;  1CT2 E;  1P04 A;  1O2O A;  1FQ3 A;  2WIN I;  3SQH E;  1WQV H;  4JYU H;  2J98 B;  3SHA H;  2G4U A;  1MKW H;  1OWI A;  4ZH8 A;  2GX4 A;  1CT0 E;  4E05 H;  2JKH A;  1TGC A;  2BD4 A;  1MBQ A;  4THN H;  4XD7 D;  1Y5U T;  1D3D B;  2ZFQ H;  4PRO A;  4UFG H;  4ACB A;  5EW1 H;  2CF8 H;  1VJA U;  1XUI A;  3TH3 H;  3ZYE A;  4FUG A;  3PMA B;  4OM9 A;  3SBK A;  3MMG A;  3SJI A;  2BY5 X;  2OXS A;  4X6O A;  1EKB B;  2ZQ2 A;  4O03 A;  2FPZ A;  1B0E A;  1J15 A;  5E0J A;  5TCA A;  3RMO H;  4B1T A;  4DIH H;  5F8T A;  1C1S A;  2BM2 A;  3SU1 A;  5EOD A;  2BHG A;  1W2K H;  4BOH A;  4AX9 H;  1E1Q D;  3F2G A;  1BOQ A;  2RA0 A;  5DP6 A;  1E79 D;  5LGO A;  4INH A;  2ZU5 A;  2PFE A;  5GPI B;  1QTF A;  1FY3 A;  1SL3 A;  1YLN A;  1C1U H;  5AF9 H;  3TK9 A;  2F9U A;  1IQJ A;  4RKO B;  3Q00 A;  1RS0 A;  1O2Q A;  3D49 H;  4WH8 A;  1GJC B;  1HGT H;  4NIW A;  4Y8X A;  1VR1 H;  2QAA A;  2ANM H;  4GPG A;  3I29 A;  3ITI A;  5AFZ H;  3A83 A;  4Z0K A;  1K0H A;  5FBI A;  3RXK A;  3EE7 A;  1ANC A;  3FZZ A;  1FX0 B;  1AI8 H;  3UAI C;  4M9F A;  3RU4 E;  1GBJ A;  5EXL A;  5C17 A;  4ISO A;  3STI A;  2XCF A;  5C5N A;  3Q3X A;  4CRB A;  1HCG A;  1O2Z A;  2O8T A;  2A45 B;  1LDT T;  4R8T B;  1S6L A;  1Y3V A;  3BIV H;  1AKS A;  2VIP A;  4ZCN A;  6EST A;  4CRD A;  4X0W U;  3RLW H;  3PB1 E;  1C5O H;  1VIT H;  1N8O B;  4WF8 A;  2ZFR H;  3T5F H;  5CHA B;  1CA0 C;  1GMC F;  2A5I A;  3UWJ H;  4I7Y H;  1GHA F;  1HPG A;  1P2O A;  2XTT B;  4X1S U;  1G3B A;  3OY5 U;  4AFU A;  2P3U B;  1IQL A;  1GI5 A;  4K8Y A;  4TSF D;  3RXO A;  2BY9 X;  3SV6 A;  1C5L H;  1KXA A;  2C93 B;  1P01 A;  3TJV A;  4RI0 A;  2IPH A;  1AU8 A;  1OP8 A;  3TH2 H;  3AAS A;  1N8O C;  1XUF A;  3ZV9 A;  3GY4 A;  2FOB A;  2ZA5 A;  1OSS A;  2UUY A;  1C1P A;  1SQT A;  4B75 A;  1S5S A;  4FVB A;  2FOC A;  2VIW A;  3LIW A;  1F0T A;  1SLV B;  3NK8 A;  1DUA A;  3JZ2 B;  2HOB A;  1V2J T;  1O2N A;  1UVP A;  1E0F D;  1MKX H;  8GCH F;  1AE8 H;  1L0Z A;  3P8G A;  1F5L A;  2D2D A;  1EP6 A;  2OLG A;  5KED A;  5LPE A;  2NU4 E;  4RT0 A;  2ZG0 H;  3RXF A;  1MH0 A;  1VCW A;  2C8Y B;  1OWK A;  2AIQ A;  3MU4 A;  1ZMN A;  2C90 B;  2FTM A;  3S9B A;  4B6E A;  1GGD B;  1QB9 A;  1AGJ A;  1G2L A;  4RN6 A;  2BX4 A;  1YPG H;  4ABE A;  1CHG A;  3M37 A;  3CP7 A;  1HRT H;  2VIV A;  4U01 A;  1A5G H;  4Y11 E;  1YGC H;  3N99 A;  4Y10 E;  5DJ7 A;  2Z3D A;  1O3L A;  2UWP A;  1OOK B;  2KCP A;  1GBH A;  2FP7 B;  4LK4 A;  1QBV H;  3QTO H;  4DT7 B;  1GL1 A;  1LTO A;  1SGE E;  2FS9 A;  2CGA A;  5AFY H;  2WPH S;  1Y5B T;  1FPC H;  4TWY A;  4UFD H;  4YZU A;  5JBC S;  4LZ4 B;  4I8J A;  1NFW A;  4TY6 A;  1NRQ H;  5GND A;  1IQG A;  1EJN A;  2WYJ A;  4P00 A;  3PTN A;  1TNL A;  4H6S B;  2SNW A;  2ZZU H;  4E7R G;  1CQQ A;  2UUJ B;  2ZIQ H;  2GJG A;  2XBV A;  8KME 2;  3A89 A;  1UTO A;  5L2Z H;  4FOU C;  2YMS B;  1DDJ A;  5JB8 S;  3CEN A;  2D1J A;  1Q3X A;  1MZA A;  3SZE A;  3V13 A;  2DE8 A;  3DFL A;  1O33 A;  4ZHL U;  1V2M T;  1NRS H;  1O3M A;  1O3F A;  1O2X A;  1AHT H;  2FLR H;  2STB E;  2JJ1 D;  3A7W A;  3BSQ A;  4MNX A;  4Q7Y A;  3OY6 U;  1LCY A;  2JIZ D;  1CSO E;  5KGO A;  1FN6 A;  1Y3X A;  4YXW D;  4BAK B;  2WPJ S;  2XBY A;  2RCE A;  3SJ9 A;  3UFA A;  1GBA A;  5CE1 A;  2NU1 E;  1QA0 A;  3AW1 A;  3FO8 D;  4BTU B;  4J2Y B;  2PKS C;  5HM2 A;  3TNS A;  4QT8 C;  1OP2 A;  1H1B A;  3M5O A;  2VIQ A;  5DKM A;  2ZCL P;  5AHG H;  4AOR A;  2F9O A;  1CGJ E;  4U2W A;  1TMT H;  4R0I A;  1TX6 A;  3O8B A;  3A7V A;  4MTB A;  1BHX F;  4ZXY H;  5C1U A;  2VJ1 A;  3A86 A;  1CU1 A;  5DK1 A;  3ATM A;  1SFQ B;  4HTC H;  1GJA B;  5E2O A;  4CBN A;  1JMO H;  2AIP A;  3GCH C;  3SGQ E;  4NWK A;  2WV9 A;  5CHB A;  3VB4 A;  5HIZ A;  1QRX A;  1UTP A;  2P94 A;  2SGD E;  3PRB A;  4KTS A;  2BDA A;  1GBB A;  3RXS A;  1KTS B;  1DLE A;  1QQU A;  3BTT E;  3BF6 H;  1YM0 A;  1V3X A;  3GIS B;  1UTN A;  4KKD A;  5JB9 S;  4BTI B;  1G36 A;  1TAB E;  4IC6 A;  1SKY E;  3SYJ A;  1C1M A;  1H9L B;  1LHG H;  1ETR H;  3MTY A;  1YPL H;  1WOF A;  1W8B H;  3Q77 A;  1COW D;  1W0K D;  5GJ4 B;  1HAV A;  2QXG A;  5CDF E;  4ZHM U;  1GMD G;  1KXB A;  2XXL A;  4B74 A;  2FM2 A;  3SNA A;  3DD2 H;  1VZQ H;  2IN2 A;  2QCY A;  3F3B A;  4MQA A;  3FP8 E;  1GMD F;  4O3U A;  1J16 A;  2CV3 A;  1LVO A;  2PKA A;  1FI8 A;  1LPK B;  2HNT F;  4KTC A;  2Z9G A;  2V0B A;  1EP5 A;  1DXW A;  3UWI A;  1P06 A;  3LGY A;  5A8Z A;  2ZFF H;  2BQ6 B;  5A09 A;  3CNR A;  1U6Q A;  4YLU A;  3MU0 A;  4AB9 A;  5HYO A;  3LON A;  1UMA H;  2A4R A;  2J97 A;  4JZE H;  2R2M B;  4ABB A;  1T4V H;  3BEU A;  3RXU A;  1GHY H;  1THS H;  5HXF A;  5EPY A;  3EA8 A;  3GOV B;  1TGS Z;  4O97 A;  1W0Y H;  2OD3 B;  2XRC A;  2CJI A;  2FX6 A;  3OSY A;  9EST A;  2B9L A;  2NU3 E;  1E37 B;  2Z3E A;  4HI3 A;  2NU0 E;  1HAH H;  1O5A B;  1EZS C;  5I46 H;  2JH5 D;  2PV9 B;  1Y3Y A;  1P10 A;  3EE0 B;  3TGJ E;  1AB9 B;  1IAU A;  1D9I A;  2FOD A;  4CRC A;  2BDC A;  4JK6 A;  1W0J D;  2GD4 B;  3V7T A;  1C1Q A;  4HG6 A;  1P2M A;  1X7A C;  1L1J A;  1HIA B;  2YOL A;  2ZHW H;  4F49 A;  1BBR K;  1OYQ A;  1L2E A;  1SHY A;  3MQK C;  1Y3U A;  1O34 A;  1T8O A;  1W12 U;  4Q7Z A;  1P05 A;  1ZOM A;  2BOH B;  2ZO3 H;  1DS2 E;  1PQ8 A;  2BZA A;  3PV2 A;  3RXV A;  1UHB A;  1V6D A;  3GCO A;  1JXP A;  2B8O H;  1GBE A;  2GDD A;  1H8H D;  1ELD E;  2EC9 H;  1Y8T A;  1TWX B;  2FI3 E;  1OWE A;  1SQR A;  2KR7 A;  4OS6 A;  1C5R A;  4BAN B;  1YYY 1;  1PFX C;  3VXF H;  4DCD A;  1F0S A;  2PTC E;  1BBR E;  2A7J A;  1BTX A;  2ZU1 A;  4H4F A;  4CBO A;  1P0S H;  3U1I B;  1O3B A;  2H5C A;  1O2L A;  1DPO A;  2H9T H;  1GJ8 B;  1DOJ A;  3VXE H;  2V3H H;  1ZTK A;  3QLP H;  3ZZ8 A;  1ETS H;  1PQ7 A;  1RTL A;  3ZZ6 A;  1G3E A;  1GCD A;  4JYV H;  3DSP A;  2BZ6 H;  1L1G A;  2KZ4 A;  1GBF A;  5FPT A;  2ZHF H;  1P03 A;  3M35 A;  4Y0Y E;  2GZ7 A;  4BNR A;  1YWU A;  1TMB H;  4NZQ A;  1KXD A;  4JYT A;  1PPC E;  3EQ0 H;  1ELE E;  4Q80 A;  5L30 H;  2DE9 A;  2J95 A;  1A5H A;  2AEI H;  3FP7 E;  1P12 E;  2OC8 A;  2BB4 A;  1K1I A;  1NPM A;  3TH4 H;  1C1N A;  3QGJ A;  1YPH C;  2WUC A;  2ZC9 H;  1S6F A;  1C5P A;  1MTW A;  5JBT A;  5F03 A;  5HM9 A;  1TB6 H;  3OX7 U;  2VWL A;  3UOP A;  2QE7 D;  4DJZ B;  1O3J A;  5ETX A;  5G4B A;  3S0N A;  3TK5 A;  1FIW A;  4FUC A;  2CF9 H;  1T8L A;  2Y81 A;  1EXF A;  2ZTY A;  3FN8 A;  3PTB A;  1O36 A;  2ULL A;  3A88 A;  1E36 B;  1GHB G;  3NXP A;  1CO7 E;  3I77 A;  3KCG H;  5JBA S;  1Z6E A;  2ZHD A;  4CR5 A;  3SUF A;  1XX9 A;  2G5N A;  1GDN A;  3AAU A;  4IS5 A;  2F9V A;  4I32 A;  1TIO A;  4WXI A;  2PLX A;  4D7F A;  5FCK A;  1CGI E;  2IJO B;  1UTK A;  1O5D H;  2H5D A;  2XOK D;  3D23 A;  1QJ1 B;  1Q31 A;  2RA3 A;  1FAK H;  4KEL A;  1CBW B;  2Y6T A;  1QJ6 B;  3RXJ A;  3Q76 A;  1ZGI A;  1FDP A;  1ETT H;  6GCH G;  1JOU B;  1CHO G;  1TON A;  1O31 A;  3VB3 A;  2P93 A;  1ANE A;  1LMW B;  2LEL A;  4AG2 A;  2R3U A;  3O8C A;  3HPT B;  1SG8 B;  2JH6 D;  4BAM B;  1MU8 B;  2G52 A;  1EZQ A;  3KEE A;  1AUJ A;  4X8S H;  4Z1M D;  1CHO F;  2VWN A;  3OYP A;  3ZVG A;  1PPZ A;  5EGM A;  1V2U T;  1ZTJ A;  3C1K A;  1BQY A;  1CBW C;  1IHT H;  1B7X B;  2VWM A;  5E0H A;  5DG6 A;  3ATL A;  4AN7 A;  4ABJ A;  1EOJ A;  1V2Q T;  1BTY A;  3BTQ E;  1MKX K;  1MBM A;  1XXD A;  2NWN A;  3BTG E;  4RSP A;  4ISI H;  1HAI H;  3OTJ E;  1SLW B;  4ABG A;  5A0B A;  2AH4 X;  4X2X A;  4U32 A;  1MQ6 A;  1MTN C;  1BIO A;  2GV7 A;  1SBW A;  3BTM E;  1SLX B;  3KQE A;  4MNY A;  3RU4 T;  3LH3 A;  1UK3 A;  2RDL A;  2VIN A;  3SUG A;  3ATI A;  1FY4 A;  1S6H A;  1EPT C;  3MNX A;  4MNV A;  5AVD A;  3IIT A;  2WUB A;  4X2W A;  3PMJ A;  2QYI A;  2ZEB A;  1P09 A;  1AND A;  2I6Q A;  5DGJ A;  5FHT A;  1FJS A;  3SQE E;  1QY6 A;  2ZGB H;  4WMF A;  2G5V A;  4TY7 A;  4F48 B;  4ZUH A;  1SFI A;  1L1N A;  1KXF A;  1LPZ B;  2R9P A;  1AKS B;  2ZCK P;  3RC4 A;  2M2A A;  1XUK A;  2A5K A;  3R0F A;  4UD9 H;  3A80 A;  1AZ8 A;  1ZSK A;  1O5C B;  1M9U A;  1BRA A;  2BVX H;  2P3T B;  1ARC A;  2W6I D;  1SB1 H;  3HKI B;  1YC0 A;  1ZHR A;  4IC5 A;  4WME A;  1C1O A;  1UVO A;  1E35 B;  1O2Y A;  1BMF D;  2Q6G A;  3ZZ5 A;  1C1W H;  3UNQ A;  7GCH F;  1C5M D;  3HGN A;  1Z8R A;  1QCP A;  1ESB A;  1SGC A;  1HJA C;  4RT1 A;  1DVA H;  1DSU A;  4X8V H;  5GIB A;  1GL0 E;  4WY3 A;  1HB0 B;  2EY4 C;  1FAX A;  2CK3 D;  4Y76 A;  4JCN A;  3SOR A;  4Y7A A;  3FZD A;  1UK2 A;  5T6F A;  2P8O C;  1W13 U;  1C2D A;  1F5K U;  2SGA A;  1ZJK A;  3M36 A;  1NRP H;  1A0J A;  1TNJ A;  1GBT A;  4DGJ A;  2OBO A;  5EPN A;  2BDY A;  1EPT A;  4F55 A;  2BY8 X;  2Z9K A;  1Q2W A;  1IQH A;  3ATW A;  4NG9 H;  3CS7 A;  4MVN A;  1A3B H;  2GCT B;  2HGT H;  1RIW C;  3Q3K A;  1V2L T;  4DY7 B;  5H4I B;  2AER H;  4UDW H;  3RXH A;  1QQ4 A;  4X6N A;  2HNT C;  2BOK A;  1H8E D;  5A8Y A;  1YPK H;  3RMM H;  2P95 A;  4MPX A;  2AGG X;  3M3S A;  1BJU A;  2QIQ A;  5F53 A;  3GCT G;  1FPH H;  1O2H A;  4YES B;  1GI0 A;  1MUE B;  1O2J A;  4K3J A;  3ZVF A;  2GCT C;  5DPA A;  1ZRK A;  1CA0 B;  4XFQ A;  3MI4 A;  3MNB A;  1BIT A;  3KN2 A;  5C94 A;  3SU3 A;  2OC0 A;  3GCT F;  2WPI S;  2BY6 X;  1EB2 A;  5KEC A;  1VCQ A;  2C8W B;  1CGH A;  1C1R A;  4GUX A;  1B0F A;  4ABA A;  1E1R D;  2W3I A;  3T25 A;  1OS8 A;  1W14 U;  2ZPS A;  3LC5 A;  1HAX B;  1LHF H;  2KFW A;  2WPL S;  3PLB A;  1O2K A;  1P8V C;  1SR5 C;  2PSY A;  2J34 A;  3SI3 H;  2Z94 A;  2FOG A;  1NN6 A;  2ZEC A;  3EA7 A;  4OS7 A;  3NKK A;  3SU0 A;  1C2F A;  2NU2 E;  4IMZ A;  2W3K A;  1ZPZ A;  3ZVD A;  3E6P H;  1FV9 A;  2TGD A;  1HYL A;  3LGT A;  5IK2 D;  2G51 A;  1DX5 M;  3SGA E;  2SNV A;  4NA9 H;  4NSV A;  1HAP H;  3U8R H;  2BVR H;  2WHX A;  2KCY A;  1V2P T;  2FOM B;  4X8U H;  1GBL A;  1V2S T;  3IG6 B;  5TCC A;  1AVG H;  1ZHM A;  1S84 A;  1Z71 A;  1FN8 A;  4K8B A;  3RXT A;  1FIZ A;  5DP4 A;  5EJZ A;  5FAH A;  4IN1 A;  5FL7 D;  1DWC H;  2V6N A;  3UPE A;  4A7I B;  4IW4 E;  2ZHE H;  1GI1 A;  4B2C A;  4OS5 A;  3QDZ B;  4HFP B;  3ELA H;  2ANK H;  2BD5 A;  4HZH A;  3ZVE A;  4BAO B;  1NRN H;  2K1Q A;  3LOX A;  1BRB E;  1ZSL A;  1HV7 A;  1V2R T;  1RRK A;  2OUA A;  1IQI A;  1EJM A;  1ELT A;  1A3E H;  3P6Z B;  1A0H B;  1P3E A;  1O3C A;  1GHX H;  2ZU3 A;  1MTV A;  3LGV A;  1ARB A;  1XKA C;  5E8E H;  1PQA A;  2L6O A;  4K60 A;  2OC7 A;  2YNA A;  3ZIA D;  1BML A;  2OBQ A;  4UON A;  3TNT A;  3EST A;  3KQC A;  1RFN A;  4K69 A;  1ELG A;  2BD3 A;  1D3T B;  1IQM A;  3W94 A;  2OK5 A;  2AFQ B;  1A46 H;  2SGF E;  4O9V A;  3KQ5 A;  1THP B;  1A0L A;  1GDQ A;  1BT7 A;  1HAV B;  1UCY H;  2W26 A;  1LVM A;  3RXB A;  1GHZ A;  3URD A;  1J14 A;  4NZL A;  1IOE A;  1BDA A;  3MU8 A;  2GDE H;  4E7N A;  1T4U H;  3PMH B;  3LJJ A;  1NO9 H;  4BXS A;  3VG8 A;  4FVD A;  3DT0 H;  2BD9 A;  2KAI B;  4B2A A;  1F0U A;  1YBW A;  5EJL A;  3E3T A;  2Z7F E;  2PKA B;  1C5S A;  3ZZA A;  2Q6F A;  2BDB A;  4MPU A;  4ACA A;  2PKS B;  3ZZ4 A;  2BLO A;  3BTH E;  2KCO A;  1C2L A;  3M3V A;  1C5X B;  3H5C B;  3BEI B;  1VCP A;  1BRU P;  1FZZ A;  1TFX A;  5FX5 A;  3B8J A;  2BD8 A;  1TOC B;  1A5I A;  1AQ7 A;  1G37 A;  1O2G H;  2XYA A;  3FP6 E;  3M7T A;  3WWB A;  1EFR D;  2I6S A;  3RXR A;  3GCH B;  2Z9I A;  4Y71 A;  3GS9 A;  4K1E A;  3TK6 A;  1MCV A;  1YCP K;  1O5G H;  1EOL A;  3BV9 B;  2BQ7 B;  3PV4 A;  4FUB A;  1C2G A;  3DHK H;  2GP9 B;  2VB0 A;  1LHE H;  3ODF A;  2VVU A;  4FUH A;  1TBZ H;  4GCH G;  4Y8Y A;  2BYA X;  2ILN A;  5J4Q A;  4Q4L A;  1IQK A;  2KM0 A;  3FFG A;  4FET A;  4ZKR U;  1GCT C;  3RLY H;  1K9O E;  2ODP A;  2FLB H;  1ZGV A;  2HRV A;  2ODQ A;  2VWO A;  2WPD D;  2BDG A;  2WSS D;  3S69 A;  1PQ5 A;  3PMB B;  1KLI H;  4K1T A;  3UOU A;  2Y5F A;  2SGE E;  3STJ A;  4SGA E;  1KDQ A;  1C5V A;  1XM1 A;  2H2Z A;  1EQ9 A;  1EAT A;  1QB1 A;  4GSO A;  3VFE A;  5T6G A;  1HNE E;  2ZDK A;  1VIT G;  5DO4 H;  1ZTL A;  3MU5 A;  1TYN A;  3ZVA A;  1UHB B;  3SJK A;  3MH7 A;  1G2M A;  1GI8 B;  5FXL A;  1HBT H;  3U28 C;  5A0A E;  3LT3 A;  1PPB H;  4X1Q U;  4SGB E;  2GTB A;  2J4I A;  3U9A H;  4CHA C;  3UR9 A;  1ELC A;  1AY6 H;  1DY9 A;  3SO3 A;  3VB7 A;  1TBR H;  1GHW H;  1K28 D;  3MH5 A;  4ISH H;  5EOK A;  1XKB C;  3RXI A;  1QA7 A;  1QZ8 A;  2K8I A;  1KTT B;  1NBM D;  1MTU A;  3SI4 H;  1J9C H;  4XE4 A;  1EST A;  1ZLR A;  1YPE H;  2Q6D A;  3KNX A;  5EQR A;  1XVO A;  3KF2 A;  4FU8 A;  3KQB A;  3LU9 B;  3UB0 A;  4BTT B;  1DWD H;  2XWB I;  5F8Z A;  4A6L A;  2GT7 A;  1K1L A;  2A4G A;  4ISN A;  1S0R A;  1H8I H;  3AAV A;  4YOG A;  3E0P B;  1O3O A;  1AIX H;  1P9S A;  4FXG H;  3BG8 A;  4ASU D;  2FXR A;  1E34 B;  1SGN E;  4IGD A;  3O8D A;  5EJ1 A;  2VH0 A;  1VGC C;  3RDZ A;  1QL7 A;  2OIN A;  1GI6 A;  2Y7X A;  3AVZ A;  4NA7 A;  3DCL A;  1VJ9 U;  1HLT H;  2V35 A;  3S9C A;  3P8O A;  4NFE A;  1SI5 H;  1D3Q B;  3R3G B;  3ODD A;  2BD2 A;  3VPK A;  1ZMJ A;  2EQN A;  1D6R A;  1O2U A;  2AS9 A;  2FMJ A;  3T26 A;  4YLQ H;  2AMP A;  3PO1 C;  1ELB A;  3KL6 A;  3KHV A;  2ZGC A;  2HVY B;  2ANW A;  1WU1 A;  3FAO A;  1SVP A;  2IJD 1;  2BVS H;  1QJ7 B;  4DUR A;  1WSS H;  3PV5 A;  1LO6 A;  5ESB A;  4Y8Z A;  1O2V A;  3IWM A;  4NSY A;  1DXP A;  1FUJ A;  1JBU H;  3OTP A;  3RXP A;  1DUE A;  1WTH D;  4UEH H;  2ZDL A;  2BLQ A;  4CH8 B;  2JDI D;  1F5R A;  5K7R A;  1L4Z A;  1DE7 H;  5LPR A;  1C2M A;  2RDE A;  3GDU A;  2XC4 A;  1SGF A;  2Z6B D;  5HIY A;  2C8Z B;  1MKW K;  3UQV A;  1GJ4 H;  1A7S A;  1P57 B;  5B6L A;  3SV8 A;  2ZGX H;  4I8H A;  3VB6 A;  1BCU H;  4X6P A;  4B2B A;  2TPI Z;  5C5O A;  1EAW A;  1EZU C;  1TQ7 B;  3PRD A;  2GMT B;  3B23 B;  4WVP E;  1LHD H;  2SFA A;  4K5Z A;  2HAL A;  1ZPC A;  1ID5 H;  3K6Z A;  4JZF H;  2V3M A;  2Y7Z A;  4A1T A;  1L4D A;  1EUF A;  3P17 H;  2OP9 A;  3BG4 B;  4ZMA H;  3GY6 A;  1YLC A;  1O3P B;  1GBD A;  4NWL A;  4ZAE A;  3V12 A;  3EAJ A;  1TGT A;  6CHA C;  1Y3W A;  2XNI A;  3NUM A;  3QN7 A;  1AD8 H;  2VNT A;  3NRL A;  1ZJD A;  1GJ6 A;  1ZML A;  1KLT A;  2GKV E;  1OWD A;  1P11 E;  3ZZC A;  1AVX A;  3A85 A;  3UQO A;  1NRR H;  2YNB A;  2EST E;  4Y0Z E;  1YPM H;  2GMT C;  2W5E A;  1Z1J A;  1OX1 A;  2Y5G A;  8GCH G;  3FAN A;  1O2P A;  1NY2 2;  2ZFP H;  3LGI A;  3A8B A;  2L74 A;  2PW8 H;  3SV7 A;  3UUZ A;  3ZZ3 A;  4ASH A;  4ZKO U;  3BG4 C;  1AFE H;  3A84 A;  1C9T A;  2CHA C;  2QY0 B;  3B9F H;  4Q7X A;  4I33 A;  3RXQ A;  1GG6 C; 
#chains in the Genus database with same CATH homology
 4AC9 A;  4ACA A;  1SQR A;  4ACB A;  2LP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...