2LP6A

Refined solution nmr structure of the 50s ribosomal protein l35ae from pyrococcus furiosus, northeast structural genomics consortium target (nesg) pfr48
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MRIKGVVLSYRRSKENQHNNVMIIKPLDVNSREEASKLIGRLVLWKSPSGKILKGKIVRVHGTKGAVRARFEKGLPGQALGDYVEIVLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L35Ae
publication title Solution NMR structure of the ribosomal protein RP-L35Ae from Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Ribosomal protein
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2012-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01247 Ribosomal_L35Ae Ribosomal protein L35Ae
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 2lp6A00
4ACBA 4ACAA 1SQRA 4AC9A 2LP6A
chains in the Genus database with same CATH superfamily
2HALA 4RT1A 1GBTA 4A1VA 5HM2A 4IW4E 4CBNA 4K2YA 2PSYA 3OAAD 3SZNA 2BY6X 1TABE 2PKSC 2WYJA 3ZZDA 2Z3EA 1C1TA 1O2HA 2XBYA 2KAIB 1UTPA 3SGAE 4GHTA 4TWWA 2P3TB 1EOLA 4MPXA 2BXUH 2AERH 2P94A 1TYNA 1PPHE 2J95A 2BQWB 3ZV8A 1G36A 2W6ID 1TMTH 2BHGA 4ISOA 1O3FA 2CF8H 2Z94A 3GCHC 1YY3A 1EJNA 2VWOA 3CS0A 2H6MA 4FUIA 1CHGA 2GCTC 3IWMA 4DT4A 1FONA 3D65E 1AD8H 3M5MA 1TPOA 4Q63A 3LGTA 4RT0A 2FOAA 4TPYA 1V2RT 3QX5H 2XTTB 3F9FA 2ULLA 4I32A 2G4UA 3A83A 2ZDAH 4ZXYH 1GVKB 2Y82A 1NS3A 1ZR0A 1TALA 4X2YA 3QO6A 1QRXA 3FO8D 3U1JB 1IOEA 3F2HA 3A8CA 4Y76A 5L6NH 1AZZA 3MQKC 3MH7A 4Y0ZE 2GZ8A 2G5VA 1TFXA 4YT6H 1HJAC 1A1RA 4DT7B 2QV1A 4FUCA 3JZ1B 2DUCA 2XW9A 3IITA 1FPCH 1K22H 1C5QA 5C2ZA 3F9HA 1KLJH 2G55A 2ZGBH 3UB0A 1F7ZA 9ESTA 4ISHH 2V3HH 4X1PU 3BTQE 3VGCB 2HVXA 2HOBA 3VB5A 2VVVA 5E8EH 6GCHF 1MKWK 1IAUA 3LJOA 4Q80A 2ANKH 3SOSA 3UNQA 3ELAH 4TYDA 1C5YB 2XOKD 2GTBA 2TPIZ 3MWIU 1XKBC 2AGIX 4X2XA 1OOKB 1OXGA 2HRVA 1W7GH 2VWMA 4BNRA 1FN8A 1TPSA 1HJ8A 1KXAA 4GAWA 1EAIA 4RN6A 4AG2A 1FLEE 1O2KA 3UIRA 3RXEA 2O8MA 5EOKA 1O33A 4Y7BA 4MNXA 4WJG2 1KXCA 2FLBH 3DSGA 2FOHA 1XX9A 1ACBE 1P2MA 7GCHF 1WXRA 2WYGA 1YCPK 1P0SH 3OSYA 2VIDA 2V3OH 3SI4H 1UTQA 2ZC9H 1TMBH 1LHFH 2ZTYA 1DWEH 1OYQA 2RDEA 4FU8A 1UVSH 1QURH 1BRAA 1GPZA 1C5SA 4NCYA 3LONA 5G4BA 3W94A 2R0KA 2ZU5A 4MTBA 3TK9A 1HDTH 2A45B 1P04A 5DP3A 2I6QA 4WY3A 4XFQA 3BTKE 1F0TA 1BMAA 1WQSA 1C1OA 2CHAC 3M7UA 4IN2A 1C1VH 2BQ7B 3DSPA 1GL0E 4ISLA 3U98H 1Y5UT 5DP4A 1QQUA 4GVUA 2FODA 2L74A 1PPCE 1S85A 2KCAA 2AMPA 4CRDA 4U30A 3MO3A 2FOBA 2QGRA 1QB6A 2UWOA 1EZUC 2XC0A 3GCHB 3MU0A 4K5ZA 3RXBA 5CHAC 1RS0A 2FLRH 2YMSD 1TE0A 1DWBH 1GBDA 3WWBA 6CHAB 1AN1E 3OTPA 5EU8A 2OC0A 2JJ1D 1A3BH 2OQ5A 3URDA 3BEIB 1HXFH 1P01A 4JZDH 1TQ0B 1O2NA 2J4IA 1JBUH 5A8YA 1WV7H 2ZF0H 3Q3YA 4BTTB 4BAOB 1GI8B 1S84A 3BTWE 1CT4E 3RXRA 2Y7XA 3PLKA 3A7YA 1IQMA 1TNLA 1CT0E 5J4QA 3BTME 5C1UA 2ZGXH 2ZHDA 3S9CA 1ANBA 2FWWA 5EQRA 1ZSJA 1F2SE 2AMQA 3S69A 1HJAB 1EAXA 3ITIA 1C5ZB 3U28C 3KYGA 3NK8A 2GVFA 3ATWA 1HGTH 1XM1A 1FIZA 3MFJA 4F55A 4D7FA 2B0FA 4BOHA 4HG6A 1S6HA 2FTLE 1GBKA 5GNDA 3T29A 3FFGA 1G3BA 1XXFA 1SB1H 1W14U 2QIQA 1TGCA 4INKA 1MBMA 3H5CB 3RC5A 1E37B 3GCNA 3RM0H 1O5GH 4ZHMU 2PGBB 3P8NA 1C2MA 5BRRE 1TOCB 2ZZUH 1O37A 4WXVA 3DA9B 1BRBE 1DXPA 3RXLA 2FOCA 2P16A 1GHXH 4FVBA 4FUDA 2EI6A 4NA9H 1S6FA 3MU8A 4MG3A 3GCOA 1Y5BT 1AE5A 2W3KA 3RXJA 2Z9IA 1TIOA 4E7RG 1SHHB 1A46H 1O5CB 2Z6BD 1Y59T 1ZHMA 4XBCA 1K1PA 1OWEA 1ANDA 1WAYB 1NPMA 2B5TB 1O2TA 1KIGH 1GHBF 1GI9B 5C1YA 1T32A 1C1PA 2GCHG 1LPZB 1UO6A 1OP0A 3F1SB 4A5TS 1BITA 4CHAC 2CN0H 2XNIA 1GJDB 1P06A 4ABEA 1GBEA 1C2KA 3A87A 3STJA 1VR1H 3F9EA 2AHME 1GBMA 1W7XH 1CBWC 1RGQA 2VNTA 1RTFB 4I86A 3MHWU 2VIQA 1T8LA 1C5NH 1O2IA 1QJ7B 5HGGA 1N8OC 3SGQE 1PQ5A 5HXFA 3UOPA 1FQ3A 1EOJA 3ZZ6A 3ODFA 2BDBA 3LKWA 1HYLA 4K1TA 2SGEE 2BY8X 1Z8JB 2BD7A 1FX0B 1WCZA 1EFRD 2ZGCA 1K1IA 3QTOH 3M3TA 1CE5A 1V2PT 3F2GA 1E1RD 4X1SU 5A0BA 1QHRB 1BBRE 2KR7A 4GCHG 5GCHF 1DX5M 1H9IE 3K65B 3KCGH 1EXFA 1W13U 5JB9S 1SGDE 2TBSA 3ZVEA 2ZA5A 3FP7E 4J2YB 1KTTB 5CHBA 1MTUA 1V2VT 4K8BA 1BA8B 3SHCH 1C5RA 1TBRH 1TGTA 1J16A 2QA9E 2ZP0H 2OBQA 4H6SB 1GBJA 1MUEB 1KXBA 3QUMP 2WV5A 3B23B 3SV6A 4I8JA 1HBTH 4FUBA 1EJAA 5IYTA 3SJIA 1S0QA 1RTKA 5DPAA 1YPHE 1O2JA 1SGIB 1DICA 4X2VA 4GPGA 3S7KB 4CRAA 3GY2A 2BY5X 5GIBA 1UTNA 1VITF 2P93A 1AWFH 2FX4A 1AVGH 2YOLA 2GMTC 2OC1A 3VB3A 1UHBB 2J98B 1B0FA 4HTCH 1SQOA 4I8GA 3R3GB 5FBIA 5EPNA 4AGJA 4WMDA 1T4VH 5F8XA 4Z0KA 1ETRH 1TPAE 1PJPA 4DOQA 3ATIA 1OPHB 4B73A 1Z1IA 3VXFH 1AFQC 1S6LA 1W0JD 3T27A 5C5NA 3ZV9A 5C3NA 1GVZA 2VVUA 1O38A 3PROA 1DS2E 1AI8H 3A85A 5E2OA 2BD5A 2YMSC 2FX6A 1CO7E 4FUGA 4A92A 5AF9H 3ZZCA 3L6PA 1AU8A 1SQTA 1NRRH 1WYKA 3BEUA 5LPRA 1C4U2 4HGCA 2FS8A 4UFEH 1W2KH 1YBWA 2NU1E 1YM0A 2FI4E 1BOQA 1P2KA 2KCYA 1AWHB 5FPTA 2Y5GA 2Z3CA 4OS2A 3SJ8A 1DPOA 1MZDA 2I6SA 4UEHH 1BHXB 1FY5A 1O2ZA 1C5MD 2JKHA 2HVYB 1PQ7A 1UVUH 1RIWB 4YLUA 1GJAB 1LMWB 4ASUD 8GCHG 1ZJDA 3FKSD 5L2ZH 3CP7A 2UWLA 5LPFA 1TBQH 4FXGH 1B5GH 1DOJA 2V6NA 4X6NA 2QCYA 2G8TA 1T8OA 1HAGE 3RLWH 3AVZA 1FV9A 3DFJA 1CVWH 4NFEA 3DCLA 4E06H 1D3QB 1MKWH 4GUXA 1CBWB 3NXPA 2A31A 4YOJA 1QA7A 1PYTD 4JK6A 1O2MA 3SI3H 4FUJA 4DGJA 3TGIE 1DLEA 1MTSA 2BX4A 2CMYA 2NU4E 2HPPH 2OBOA 5CE1A 4CRCA 2ZHFH 1A5GH 1O3IA 1HJ9A 2SGFE 3A7WA 1HAPH 1SBWA 1KTSB 3O8DA 2BD3A 5C1XA 4ZROA 1C2JA 1NFWA 2ZO3H 1O3LA 1LHCH 1OSSA 1YP9A 4ACAA 3ZZ9A 3S9BA 2G51A 2R9PA 1TGSZ 2B9LA 5JBBS 1E38B 1EAUA 1N1LA 3KF2A 1UTJA 3PV2A 3JZ2B 2UWPA 5ESBA 1O3OA 2PWXA 1ELFA 3MU4A 2THFB 4MDSA 1K21H 4ZH8A 1LVMA 3RMOH 3U8RH 1GBAA 1LVYA 1TRMA 3PO1B 1K1MA 4CRGA 1OHHD 3TJVA 2QF4A 4BAKB 2Q1JA 2Z7FE 4ZXXH 4B71A 1H8HD 3NWUA 3KEEA 1EP5A 4J1YA 1MD7A 2CXVA 1ZGVA 4O03A 2XBVA 4IBLH 1ESAA 1GGDC 3KIDU 1AVWA 3SNCA 1YLCA 1MABB 3SYJA 5K7RA 4YLQH 1FJSA 1A0JA 1UCYE 2R2MB 3SU3A 4ISIH 2GGVB 1YPMH 2BVRH 4INHA 2LP6A 1B0EA 3BF6H 2JH6D 5LPEA 1A5HA 2J5UA 4ABAA 1KSNA 1AGJA 1T8MA 1QQ4A 5B6LA 3D23A 3UR6A 3KQCA 3B8JA 1O2PA 1XUFA 5C5OA 2ZPRA 1HAVB 1RFNA 1CA0B 1SL3A 1GI0A 1LCYA 1V2OT 1O3GA 4IC6A 4K60A 3VGCC 2TGTA 2J97A 2F9UA 3HKIB 4F48B 3ZYEA 1MKXK 2WV4A 4I33A 1TNHA 2TIOA 3ZVGA 2YMSB 1O39A 1AKSB 3QZQA 1KDQB 2QYIA 3P17H 2NWNA 5EIYA 1GI3A 2PUXB 3RXCA 3TPIZ 5B6OA 1SQAA 1S0RA 2A4RA 1NRNH 3SBKA 4H42U 1C4V2 1S82A 2GDDA 2FI3E 2EI7A 3GCTG 3UOUA 4WH8A 1BTPA 2ZDNA 4K69A 8LPRA 2A2XH 1QY6A 3ZVCA 3WW7A 1TX7A 2G52A 4YT7H 3ZZ8A 3U69H 1C2GA 1TOMH 3RXTA 3GOVB 1MBQA 2GP9B 2ALVA 3U8TH 3VB4A 2GD4B 1OWKA 1TNJA 4KP0A 1DWCH 3P6ZB 3STIA 4P02A 1HFDA 2OINA 4ZCNA 1O5FH 3SU0A 1AB9C 1AMHA 2UUYA 4AZ2B 3KGPA 2CF9H 1YLDA 1C5XB 1ESBA 1JMOH 1GI5A 3MU1A 4Q2KA 1YPJH 2XWBI 3MO9A 7KMEH 1NROH 1D3TB 3SJ9A 3TGJE 2FO9A 1TRNA 4YZUA 4YM9A 2WPDD 4D76A 3M36A 1JIRA 1HAZB 4NGAH 1ZSLA 1G9IE 1GHZA 1V6DA 4JCNA 1XUKA 1SLVB 5I25A 1XUIA 2HNTC 4DVAU 2FPZA 4NIXA 3RLYH 2PSXA 2STAE 3FAOA 4DW2U 2VVCA 3Q76A 1UTMA 2VINA 3RU4E 1VCPA 2AIQA 2EC9H 2OD3B 2WPHS 3P95A 4DG4A 4X8TH 2PHBA 3EYDA 3RXFA 1ZHPA 4MNWA 3HPTB 1MTWA 1C1QA 2G81E 1OWDA 2VBCA 3ODDA 1GL1A 1DY8A 4AG1A 1K9OE 2GZ9A 4A1XA 6CHAC 1HAHH 1C5LH 1LHEH 2F4LA 1KMHB 1C5PA 1TWXB 5SGAE 1QBOA 1ELVA 1YPLH 4JYVH 4LK4A 2SGDE 1N6XA 1HCGA 4RSPA 2FP7B 3PV5A 1P05A 3P8FA 2ZHQH 1CSOE 1ABIH 2Q6DA 2A0QB 2ZGHA 2KCPA 3GY7A 2A5AA 2BDHA 2DE8A 3OE7D 1RD3B 1NFUA 1QGFA 1GGDB 2FOMB 2C8YB 4O9VA 2A7HA 3EGKH 2HLCA 3SV2H 1G3EA 1F0RA 4NZLA 2J92A 4BANB 1IQJA 1H9LB 1O3PB 2HGTH 4MLFB 1UK3A 3SO3A 1G37A 4NIWA 1GMCG 1CHOG 4SGAE 2FTMA 3UQVA 4AOQA 4XBDA 1ZRKA 2ZNKH 2ZFFH 1GVLA 1HPGA 3C1KA 1V2UT 5C67A 4XE4A 1LVOA 1ELBA 2XRCA 4AFUA 2VIOA 3CNRA 1TAWA 3TVJB 1ZTJA 5EGMA 3LGVA 5FL7D 2Y6TA 1AE8H 2IJD1 1BBRK 1YF4A 3R0FA 1V2WT 1L4DA 1Z8IB 4I8KA 4HZHA 3RXMA 1JRSA 1IHSH 2BB4A 1G3CA 3I77A 3W95A 4JK5A 2ZFQH 1HLTH 1S83A 4B2CA 1KLIH 5HMAA 1DUAA 2WPLS 3RXSA 2GZ7A 3OEED 1XUJA 3SJOA 2C8ZB 2PKAB 3M3VA 1QBNA 1ZLRA 2WZQA 1SPJA 1TMUH 4MVNA 3ZZ5A 2XCNA 5A09A 3G01A 3A7XA 3UY9A 5EODA 1GBLA 3FANA 1EX3A 3LPRA 1QTFA 1DANH 1GHWH 1D9IA 1AB9B 1PPZA 3BN9A 3SN8A 1WDIA 5K0HA 1HAOH 1HAVA 5LH8A 2BDAA 1GMDG 2PTNA 1Z8RA 1J17T 1SLUB 3M5OA 5AVDA 1SR5C 5KGOA 3SNDA 2F9NA 4D7GA 5EG4A 4X1RU 2O8WA 1TX8A 2PUQH 1V3XA 1KDQA 3BEFB 2VGCB 3UR9A 1GBIA 4WVPE 5FCKA 2AEIH 4U32A 3SNAA 1THRH 5A8ZA 1JOUB 3F2FA 4AB8A 1P11E 4WMEA 4WXIA 3O8BA 1UTLM 3ATKA 3AW0A 1H9HE 2XC5A 3GY8A 1IHTH 2PW8H 2Z9LA 2ZU1A 2TGDA 5AHGH 2ILNA 1MD8A 1WTHD 4XRNA 4Y8YA 3UQOA 3W1EA 1SGCA 1O30A 2AGEX 3LGYA 1DXWA 1KY9A 4IGDA 3U1IB 1VJAU 3KL6A 5ESTE 1ZPCA 2BDIA 2QE7D 3E90B 1YPKH 3GY6A 3GDVA 1U6QA 3PLBA 2FOGA 3UFAA 1YPGH 3NUMA 4Y7AA 3L3TA 3SV7A 5DN6D 2AS9A 1F92A 2KAIA 2XBXA 4JMYA 1SG8B 2WPJS 1WQVH 3UAIC 2ANYA 2HLDD 2H9TH 4ZHAA 1NBMD 4CH2B 3GICB 1LPGB 4ZAEA 3LGUA 2P95A 4MNYA 1HAXB 4B6FA 1V2NT 1MMJN 5DP7A 1YKTA 1O0DH 2FYRA 1GDUA 1TX6A 2J9NA 4MNVA 1HB0B 2C3SA 1KXFA 4RKOB 1SGRE 2M5TA 3I29A 3NPSA 1ELGA 3MI4A 4RI0A 5HKKD 4M7GA 1LDTT 3SUFA 3HGPA 3K6ZA 4NG9H 1ANEA 1UW7A 2OUAA 2QXIA 4I8HA 4ZHLU 1UK2A 1UVOA 3V12A 4ZMAH 3HATH 4NSVA 5TCAA 1K1JA 4NSYA 5HYOA 1V2JT 4FUHA 1YWUA 7ESTE 3ZZ4A 1V2ST 1QRWA 1BTUA 3NKKA 2A32A 1Z8GA 2IJOB 2F3CE 2VIPA 2JH5D 1W0ZU 2BYAX 1THPB 1O5AB 1LQEA 3EA7A 1P12E 2FS9A 5C17A 4KGAA 4FVDA 3LC3A 4F4OC 1QL7A 1O5EH 1W0KD 1RIWC 1EZSC 1L1JA 3V7TA 1GDNA 3RMLH 2HPQH 2SGQE 1O3MA 3F0PA 1MAXA 3EE7A 2H5CA 1GHAG 3ESTA 2H5DA 1YYY1 1GJ4H 3LU9B 4UDWH 2HWLB 1UCYK 2QF0A 3RMNH 2W7UA 3BV9B 2GCHF 3D62A 2A1DB 3A86A 1BTYA 1MKXH 2C8XB 3A80A 2J38A 2K8IA 4VGCB 1OYTH 4FUEA 5C94A 1J15A 1SVPA 3A82A 1NESE 1TB6H 4TY6A 1GJ9B 3A7ZA 4XOJA 5ABWA 1QIXB 2BVSH 1UVTH 4CRFA 4OGXA 2Y81A 1H8IH 2FOFA 5DJ7A 3EA9A 2JDID 4I31A 1MTNB 5EQSA 4Z6AH 3KQDA 2SNWA 3SUGA 5A0AE 1O2XA 3SUEA 2Q6GA 5EXNA 1GWAA 5E0GA 1O2WA 3AK5A 1ARCA 1IQGA 1SSXA 1HAYB 2ZEBA 1ZMJA 2BY9X 4DIHH 3QLPH 1EB1H 5JBTA 2BM2A 1Z7KA 1F5LA 1O3JA 2TRMA 3ZVFA 2KM0A 1V2MT 2W3IA 4GCHF 3H7TA 1BCUH 2ZGJA 2RA0A 2P3FH 1ZJKA 3PO1C 4GLYA 2QC2A 3QN7A 4UD9H 2WPIS 1HRTH 1L4ZA 1J8AA 2WSSD 1HNEE 3U9AH 1HIAB 1UK4A 3UNRA 2FI5E 1NT1A 1DDJA 1ZTLA 2LPRA 1EUFA 3LH1A 1EASA 1MU8B 5E2PA 2BD2A 1S81A 4LOYH 3DT0H 1NRPH 2QAAA 3E6PH 3UNSA 1H8DH 1C5OH 1E79D 6ESTA 2HNTF 1O2LA 4AC9A 3A7VA 1ELCA 1FUJA 1YPEH 3Q00A 2OLGA 1EPTB 5T6FA 3UPEA 1K1NA 1CQQA 2AH4X 2PGQB 1CA0C 2A4QA 1A3EH 1YPHC 2KCOA 1CA8B 2D8WA 5A8XA 1C4Y2 1O3CA 3BG4B 1JWTA 3TLOA 5C0UA 2A7JA 2CK3D 1C9PA 5DG6A 3NRLA 3UUZA 3BTTE 1PQAA 2XYAA 5J4SA 3ATLA 1BTZA 3HGNA 3UREA 1BRCE 3K6YA 2RFKC 2G5NA 3MNSA 2J94A 3OEHD 1MCTA 3ZYDA 1P02A 1THSH 4JYTA 4FU9A 1T7CA 3HK3B 1O2RA 4ASHA 1UJ1A 5DP9A 1XUHA 4X0WU 3RXVA 5FAHA 4FETA 3RP2A 5GWZA 5JDUB 4TT3D 1TGBA 1AUJA 4GHQA 3RU4D 1EB2A 1NFXA 3VG8A 1GI1A 1O5DH 4I7YH 1DM4B 3ZIAD 2C8WB 3VB6A 1A2CH 1PPEE 3P70B 4O3UA 5T6GA 1L2EA 3L33A 4XDEA 4LZ1H 1ZPBA 1VZQH 4BAMB 1OWIA 3LH3A 1ELDE 2ODYB 1BTHH 1EJMA 1OP2A 4X2WA 1GJ5H 4K1SA 2BOKA 4KELA 5T6DA 1Q31A 8GCHF 2ZDVH 4OM9A 3TU7H 1IQNA 1VGCC 5I46H 1O34A 4YO9A 3GY4A 4OS4A 5FHTA 1GI2A 1O3BA 1T8NA 1P2OA 4B76A 1SGPE 1QJ1B 1BBRH 4OS5A 1GCTB 1GJ7B 1SGFG 1N6YA 4U2WA 2FEQH 1XMNB 1Y3VA 4IC5A 1TONA 1LKBA 3U8OH 3K2UA 3UWIA 1MAYA 5DP8A 5L30H 2FDAA 3RXGA 2O8UA 3T2NA 4X8VH 2J2UA 2VB0A 1NO9H 1GBHA 1ZYOA 3URCA 2ZTZA 5CMXH 2ODQA 1LPKB 1P2QA 3MH6A 1MCVA 4HFPB 3MYWA 1UTOA 2BOHB 2VIWA 1QL8A 4O97A 2EEKA 2B7DH 2BLVA 1BRUP 1GMHG 3MO6A 3A8AA 3E91A 1W0YH 1SLWB 1H8ED 1LO6A 1FY1A 5HIZA 1FMGA 1JXPA 2P3UB 5F53A 2Z9GA 3RDZA 1FY4A 1X7AC 3O8CA 2SGPE 3SHAH 3RU4T 4ABHA 3LC5A 3F68H 5H4IB 1C2IA 2TGAA 1GI7B 2G4TA 3GY5A 4MQAA 2FZZA 1ZRBA 1A61H 1C1UH 3P8OA 2VIVA 5A2MH 1O5BB 3AAVA 3SORA 1BIOA 2VWLA 1ABJH 2VH0A 4Y6DA 2VH6A 2QF5A 4FOUC 4IN1A 1DSTA 3EQ0H 3ZVDA 4B1TA 4WF8A 5GPIB 4CH8B 1O36A 4Y71A 2FYQA 3QGJA 4TPIZ 3DFLA 1LKAA 1IQFA 1FPHH 1SGTA 2IPHA 3LGIA 2A4OA 2VWNA 4X6MA 3SZEA 1WOFA 1P03A 2ASUB 1IQEA 2ZCHP 1EKBB 2V35A 1WSSH 1Z71A 3AAUA 2GV6A 1LHDH 3NCLA 1G2LA 1QR3E 4YESB 5JBCS 2A7CA 1AHTH 3AW1A 4XBBA 1ZMNA 1TNIA 2ZFPH 1EZQA 1HIAA 3BTHE 3MNBA 5LGOA 5DGJA 4CBOA 4Q7YA 2RCEA 1O35A 2NU3E 2IN2A 4YOGA 2H1UA 1PPGE 3TH3H 1C1NA 2BDGA 4X8UH 3KHVA 3GCTF 2WV9A 2BLQA 1PPFE 1UHBA 2AGGX 2J98A 3FP6E 4ISNA 3FZDA 1WUNH 1V2LT 1SHYA 1KXEA 4ZUHA 3ZZ3A 3TK6A 2Y80A 4MPUA 3BTEE 1D4PB 1FY8E 2ZKSA 4CRBA 1VGCB 1SOZA 3EE0B 3QK1A 1G30B 3GY3A 2QXJA 4D9RA 1FNIA 2ZFTA 1E36B 2ZU4A 2A5KA 1P2JA 4NA7A 2W5EA 1BDAA 3A84A 4CR5A 4TY7A 3P92A 2FM2A 3SQEE 2GT7A 2QXHA 1W10U 3V13A 2VGCC 2Z3DA 1RXPA 3GS9A 3TJNA 3BG8A 2JH0D 1O2YA 3A89A 2EI8A 1DFPA 1Q2WA 1CGHA 4I8LA 2ZDMA 1NRSH 4Y79A 1EQ9A 2ZU3A 1AZ8A 2BX3A 3RXOA 3M5LA 1Z6JH 1FN6A 4YTAA 3RXUA 1NRQH 3BTFE 2F83A 1QNJA 5KEDA 3OX7U 3PV4A 3M61U 1BHXF 1MU6B 1C2LA 1O2SA 1OWJA 3N99A 2P59A 5F8TA 1MZAA 1UCYH 1P2NA 4JZEH 4CR9A 4UONA 3QGNB 1J14A 2FMJA 2ZDLA 3SNBA 1YCPM 1TRYA 3H7OA 3PTBA 2F9VA 2V7QD 3RXDA 1ANCA 1A0LA 3PLPA 1UTKA 3CS7A 5EXLA 4O3TA 1FZZA 2D2DA 3DD2H 4DCDA 1BB0B 4JYUH 4ABDA 5KECA 4AYVB 1PYTC 3RM2H 3O8RA 2C90B 3T62A 3CENA 3GDUA 3RXAA 1JIMA 1YLNA 4TSFD 2QXGA 1F5RA 1RTLA 4KTCA 2PR3A 2FOEA 1FXYA 5DKMA 4BXSA 1QBVH 2GT8A 2WPMS 2JJ2D 1SGEE 2FESH 1P09A 1NZQH 1GMCF 2ANWA 1CHOF 3SU6A 5F03A 5BPEA 1GG6B 2V0BA 6GCHG 4D9QA 3SGBE 3RXKA 1GBCA 1IQIA 2WHXA 3PRDA 5T1VA 2IPQX 2QN5T 1UVPA 3PWBA 2AIPA 4NIYA 4BTIB 2AYWA 1AIXH 2H9HA 3KYFA 5EXMA 3F3BA 3LT3A 4AYYB 2EA3A 2PV9B 3BSQA 3VEQB 1ORFA 3QDZB 4LZ4B 3N7DA 2BD8A 1XXDA 2PP6A 2LELA 3P8GA 5JB8S 5TJXA 3OYPA 3PYHA 1QJ6B 4NIVA 4ZKSU 1BJUA 1K2I1 1CT2E 2WUCA 7GCHG 1V2KT 1VITH 1SKYE 1DVAH 8KME2 3KQEA 3FZZA 1EZXC 3MOCA 4K1EA 9LPRA 3BTGE 3TJUA 4UFGH 1XKAC 2BQ6B 3PMBB 3T25A 1YC0A 2BDCA 1GCDA 4M9FA 5L2YH 2V3MA 2ZDKA 2O8LA 1A7SA 1QB1A 2WUBA 4IS5A 4TWYA 4ZKRU 1C1MA 1TQ7B 2ALPA 2DE9A 2ZCKP 2O9QA 1BUIA 5E0JA 1O32A 1AKSA 4VGCC 3UTUH 5GXPA 3SW2B 1C5UA 1GMDF 1Y8TA 1HV7A 5HIYA 4AN7A 2OC8A 2GX4A 2XCFA 1OWHA 1EP6A 2Y5FA 1BQYA 2BLOA 2ZG0H 3PMJA 1S5SA 3MNXA 2ZFRH 2XXLA 1ZMLA 1JRTA 2PKSB 3OFND 1MTNC 2BDYA 2ZQ2A 1Y3YA 3PMHB 3HKJB 5DP6A 3ZZ7A 1D6RA 3BTDE 1KYNA 2G00A 1DSUA 1TBZH 3OY6U 4FUFA 1GJ8B 1ID5H 1QFKH 1ELEE 2CJIA 4Q7XA 4YXWD 1NN6A 2NU0E 3FN8A 4NWKA 3SU4A 1BT7A 1MQ5A 4Y8ZA 2GCTB 3SUDA 2SFAA 2PFEA 1K1LA 2NU2E 1C5VA 4HI3A 1CGJE 2FXRA 2W7SA 1MH0A 1E0FD 1GI6A 3K9XB 3RMMH 5DK1A 2ZHWH 1C5WB 2Q6FA 1PQ8A 2H2ZA 3FOAA 1VCQA 3SV8A 2BVXH 1XVMA 1IQLA 2GV7A 1QZ8A 1COWD 2CGAA 4OS6A 4NZQA 5AFZH 3SNEA 3DUXH 4R0IA 1AUTC 2BZAA 4ABIA 4RKJB 3RUOA 1EPTC 1QB9A 3ENSB 3T28A 1K1OA 1O2OA 2WPKS 4WH6A 3OY5U 1NC6A 3BG4C 1CU1A 2A5IA 3S9AA 1C2DA 1DE7H 2EQNA 4UE7H 5CDFE 3ZZAA 4DURA 4DY7B 2UUKB 2ESTE 2K1QA 1A0HB 4ZKOU 4A6LA 2ZECA 4BAHB 2QY0B 3RC4A 2EY4C 2ZI2H 2FIRH 5FX5A 1O2UA 3M7TA 1W8BH 1SC8U 5JBAS 1W3CA 4Z1MD 3S7HB 4AFSA 1LTOA 3SJKA 2KX4A 5EQQA 5PTPA 2F91A 1BMFD 2R3UA 1ETTH 1SFIA 3F6UH 4NA8A 1TLDA 2AFQB 1GHBG 2XWAA 1A4WH 4WWYA 2GDEH 1QCPA 3C27B 1F0UA 2TGPZ 1QL9A 3PMAB 2ZPSA 4X1NU 1GI4A 2ODPA 1Y3WA 1SMFE 5EPYA 3WWFA 1HXEH 3PTNA 1TNKA 3TITA 4B2BA 1V2QT 2LNCA 5FCRA 4B75A 3F9GA 5EW1H 4Y10E 1GHAF 1FDPA 3ZVAA 5GJ4B 1SGNE 2PLXA 4DIIH 5FX6A 1J9CH 1HAIH 1O2QA 3OU0A 5TCCA 3TH4H 4AGKA 1GCTC 1T4UH 2BLWA 2JETC 2R0LA 1DITH 2ZTXA 4JZ1A 1E1QD 1NU7B 1ZSKA 1E35B 1FAXA 3Q3KA 4X1QU 1KLTA 1B7XB 4UFDH 1C1SA 1Y5AT 3ZZBA 2CHAB 2J34A 4FU7A 2IOTA 4YOIA 2ZWLH 5AFYH 1C1RA 1VCWA 4KTUA 1P9UA 1TNGA 4THNH 5F8ZA 2PKAA 1F0SA 1LHGH 4A1TA 1ETSH 1ELTA 3PWCA 1OKXA 1ESTA 4SGBE 4ABJA 1BTWA 5FBEA 4ACBA 5DO4H 1EATA 4JZIA 5GCHG 3SQHE 4E05H 3VFEA 4Y8XA 1BJVA 3SV9A 1BMNH 1C1WH 5CHAB 4KKDA 1P10A 1PFXC 3V3MA 2OTVA 1YGCH 1WTGH 4NWLA 1NFYA 4DJZB 1MQ6A 3H09A 1ARBA 1H4WA 2KFWA 1C2FA 1W11U 1SFQB 1WBGB 2OP9A 3TGKE 3M37A 1BMMH 2O8TA 2W6JD 4MPWA 1Y3XA 5C0TA 1D6WA 2QF3A 3E3TA 5EJLA 3PRBA 3MNCA 1BMLA 3MTYA 1ZHRA 3B9FH 1AVXA 3KN2A 2L6OA 3AASA 1SOTA 3D49H 1C2HA 3OTJE 1FY3A 1VITG 2F9PA 1BTXA 4B2AA 1DWDH 4GSOA 1K0HA 1AO5A 2D26C 1P3EA 3E0PB 3V0XA 3E0NB 1NTPA 4ESTE 2SGAA 3EAJA 2JIZD 3VXEH 1O3KA 3PM3A 4UFFH 1O3HA 3BIUH 3RXQA 1P9SA 3TJOA 2B8OH 1LVBA 3M35A 4IMZA 1SI5H 1L0ZA 5JPMH 2ANMH 3I78A 5EJ1A 3GDSA 3FVFB 4ABGA 2Y7ZA 3M7QA 3A81A 5GDSH 4R8TB 1O2GH 3MMGA 1D3PB 2P8OC 2RDLA 3DHKH 4E7NA 4ABFA 1AQ7A 1FI8A 5E0HA 1TA6A 5FPYA 3KQBA 3SU2A 4XSKU 4X6PA 5JYIA 4MPVA 4WMFA 2BZ6H 2H9EH 1OX1A 4X8SH 1ZPZA 3A88A 3ZVBA 3DSOA 3PB1E 1NBME 3QTVH 4AFQA 1SLXB 5ETXA 3RC6A 1P8VC 2ZPQA 1EAWA 1GBFA 4JZFH 3LJJA 1QA0A 2YNBA 2XC4A 1GHYH 2OQUA 5A0CA 4BXWA 3E16B 3LOXA 1HUTH 4QT8C 3GISB 5FPSA 2W26A 2D1JA 3KQ5A 1H1BA 2BD4A 1ELAA 1L1GA 1NY22 1TPPA 2JETB 2KZ4A 4CHAB 1SGFA 1TA2A 3GYLB 3M3SA 1INCA 3S0NA 1GDQA 5EW2H 4OS7A 2OCVB 4AX9H 2PTCE 2AMDA 1P3CA 2UUJB 4INLA 3TK5A 1QRZA 2OXSA 1DY9A 2GKVE 3VPKA 1C5TA 1GBBA 1Z6EA 3MH5A 2BD9A 1GHVH 1P2IA 1A5IA 2BTCE 3TNTA 3LIWA 4H6TA 4OS1A 4OGYA 2F9OA 4Y0YE 1N8OB 5DSFA 3EDXB 3SU1A 2F9BH 4A7IB 2ZU2A 1O31A 1FAKH 1VJ9U 1LQDB 4AORA 2WINI 1FIWA 4U01A 1AY6H 2OK5A 1NM6A 1OP8A 4K3JA 3HK6B 1M9UA 1WU1A 1IQKA 3EA8A 3UWJH 4P00A 3SU5A 4ABBA 1YCPH 3LDXH 2XNDD 5DP5A 1F5KU 1SGYE 1XVOA 4D8NA 1G32B 1G3DA 1CGIE 3ATMA 4KTSA 1KXDA 1GMHF 1RJXB 3N7EA 3N7OA 4F49A 3MU5A 3NZIA 1GJCB 3A7TA 4Q4LA 5C20A 7LPRA 2R2WU 3RXPA 1C2EA 5F6MA 1Y3UA 2ZHEH 4LXBH 4IMQA 3E8LA 1O3DA 1OS8A 3TH2H 2GJGA 4Y11E 2YNAA 2BY7X 1BZXE 1Z1JA 3A8BA 3RXHA 1VKYA 1Q3XA 3GYMA 2ZQ1A 4K8YA 4B6EA 1TGNA 2STBE 1G2MA 2GMTB 1RRKA 3A8DA 3MH4A 1XUGA 3T26A 4AFZA 3QWCH 4XD7D 1GG6C 1P57B 2ZCLP 1V2TT 5T3HA 2RG3A 1O3AA 2ZIQH 1O3NA 1GJ6A 1PPBH 1ZTKA 4PROA 5IDKA 2P8OB 4BTUB 5IK2D 1DLKB 6LPRA 1DUEA 2C4FH 1AFQB 5EJZA 4B74A 1K28D 1IQHA 2OC7A 1MTVA 3T5FH 1T31A 2A2QH 1D3DB 2M2AA 3E1XB 8ESTE 1SGQE 4X6OA 1NU9A 2C93B 3M5NA 3Q77A 3WY8A 2VU8E 1SQRA 4H4FA 2BMGB 4Q7ZA 2ZFSA 2Y5HA 3VB7A 1C9TA 3TIUA 2K0QA 1DT2A 1GJBB 3BIVH 1E34B 1ZGIA 1EPTA 4AB9A 1ZZZA 3FP8E 2VJ1A 2R3YA 3IG6B 1ZOMA 1O2VA 1UMAH 2CV3A 4BAQB 2UUFB 1W12U 1AFEH 2F43B 3KNXA 5FXLA 2BXTH 5HM9A 2Z9JA 3QZRA 2Z9KA 2RA3A 4NFFA 2A4GA 3LGWA 3Q3XA 4CREA 4ZKNU 2HNTE 1L1NA 3RXIA 2SNVA 3F0OA 2XBWA 1O3EA 3TNSA
chains in the Genus database with same CATH topology
4ACBA 4ACAA 1SQRA 4AC9A 2LP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ACB A;  4ACA A;  1SQR A;  4AC9 A;  2LP6 A; 
#chains in the Genus database with same CATH topology
 2HAL A;  4RT1 A;  1GBT A;  4A1V A;  5HM2 A;  4IW4 E;  4CBN A;  4K2Y A;  2PSY A;  3OAA D;  3SZN A;  2BY6 X;  1TAB E;  2PKS C;  2WYJ A;  3ZZD A;  2Z3E A;  1C1T A;  1O2H A;  2XBY A;  2KAI B;  1UTP A;  3SGA E;  4GHT A;  4TWW A;  2P3T B;  1EOL A;  4MPX A;  2BXU H;  2AER H;  2P94 A;  1TYN A;  1PPH E;  2J95 A;  2BQW B;  3ZV8 A;  1G36 A;  2W6I D;  1TMT H;  2BHG A;  4ISO A;  1O3F A;  2CF8 H;  2Z94 A;  3GCH C;  1YY3 A;  1EJN A;  2VWO A;  3CS0 A;  2H6M A;  4FUI A;  1CHG A;  2GCT C;  3IWM A;  4DT4 A;  1FON A;  3D65 E;  1AD8 H;  3M5M A;  1TPO A;  4Q63 A;  3LGT A;  4RT0 A;  2FOA A;  4TPY A;  1V2R T;  3QX5 H;  2XTT B;  3F9F A;  2ULL A;  4I32 A;  2G4U A;  3A83 A;  2ZDA H;  4ZXY H;  1GVK B;  2Y82 A;  1NS3 A;  1ZR0 A;  1TAL A;  4X2Y A;  3QO6 A;  1QRX A;  3FO8 D;  3U1J B;  1IOE A;  3F2H A;  3A8C A;  4Y76 A;  5L6N H;  1AZZ A;  3MQK C;  3MH7 A;  4Y0Z E;  2GZ8 A;  2G5V A;  1TFX A;  4YT6 H;  1HJA C;  1A1R A;  4DT7 B;  2QV1 A;  4FUC A;  3JZ1 B;  2DUC A;  2XW9 A;  3IIT A;  1FPC H;  1K22 H;  1C5Q A;  5C2Z A;  3F9H A;  1KLJ H;  2G55 A;  2ZGB H;  3UB0 A;  1F7Z A;  9EST A;  4ISH H;  2V3H H;  4X1P U;  3BTQ E;  3VGC B;  2HVX A;  2HOB A;  3VB5 A;  2VVV A;  5E8E H;  6GCH F;  1MKW K;  1IAU A;  3LJO A;  4Q80 A;  2ANK H;  3SOS A;  3UNQ A;  3ELA H;  4TYD A;  1C5Y B;  2XOK D;  2GTB A;  2TPI Z;  3MWI U;  1XKB C;  2AGI X;  4X2X A;  1OOK B;  1OXG A;  2HRV A;  1W7G H;  2VWM A;  4BNR A;  1FN8 A;  1TPS A;  1HJ8 A;  1KXA A;  4GAW A;  1EAI A;  4RN6 A;  4AG2 A;  1FLE E;  1O2K A;  3UIR A;  3RXE A;  2O8M A;  5EOK A;  1O33 A;  4Y7B A;  4MNX A;  4WJG 2;  1KXC A;  2FLB H;  3DSG A;  2FOH A;  1XX9 A;  1ACB E;  1P2M A;  7GCH F;  1WXR A;  2WYG A;  1YCP K;  1P0S H;  3OSY A;  2VID A;  2V3O H;  3SI4 H;  1UTQ A;  2ZC9 H;  1TMB H;  1LHF H;  2ZTY A;  1DWE H;  1OYQ A;  2RDE A;  4FU8 A;  1UVS H;  1QUR H;  1BRA A;  1GPZ A;  1C5S A;  4NCY A;  3LON A;  5G4B A;  3W94 A;  2R0K A;  2ZU5 A;  4MTB A;  3TK9 A;  1HDT H;  2A45 B;  1P04 A;  5DP3 A;  2I6Q A;  4WY3 A;  4XFQ A;  3BTK E;  1F0T A;  1BMA A;  1WQS A;  1C1O A;  2CHA C;  3M7U A;  4IN2 A;  1C1V H;  2BQ7 B;  3DSP A;  1GL0 E;  4ISL A;  3U98 H;  1Y5U T;  5DP4 A;  1QQU A;  4GVU A;  2FOD A;  2L74 A;  1PPC E;  1S85 A;  2KCA A;  2AMP A;  4CRD A;  4U30 A;  3MO3 A;  2FOB A;  2QGR A;  1QB6 A;  2UWO A;  1EZU C;  2XC0 A;  3GCH B;  3MU0 A;  4K5Z A;  3RXB A;  5CHA C;  1RS0 A;  2FLR H;  2YMS D;  1TE0 A;  1DWB H;  1GBD A;  3WWB A;  6CHA B;  1AN1 E;  3OTP A;  5EU8 A;  2OC0 A;  2JJ1 D;  1A3B H;  2OQ5 A;  3URD A;  3BEI B;  1HXF H;  1P01 A;  4JZD H;  1TQ0 B;  1O2N A;  2J4I A;  1JBU H;  5A8Y A;  1WV7 H;  2ZF0 H;  3Q3Y A;  4BTT B;  4BAO B;  1GI8 B;  1S84 A;  3BTW E;  1CT4 E;  3RXR A;  2Y7X A;  3PLK A;  3A7Y A;  1IQM A;  1TNL A;  1CT0 E;  5J4Q A;  3BTM E;  5C1U A;  2ZGX H;  2ZHD A;  3S9C A;  1ANB A;  2FWW A;  5EQR A;  1ZSJ A;  1F2S E;  2AMQ A;  3S69 A;  1HJA B;  1EAX A;  3ITI A;  1C5Z B;  3U28 C;  3KYG A;  3NK8 A;  2GVF A;  3ATW A;  1HGT H;  1XM1 A;  1FIZ A;  3MFJ A;  4F55 A;  4D7F A;  2B0F A;  4BOH A;  4HG6 A;  1S6H A;  2FTL E;  1GBK A;  5GND A;  3T29 A;  3FFG A;  1G3B A;  1XXF A;  1SB1 H;  1W14 U;  2QIQ A;  1TGC A;  4INK A;  1MBM A;  3H5C B;  3RC5 A;  1E37 B;  3GCN A;  3RM0 H;  1O5G H;  4ZHM U;  2PGB B;  3P8N A;  1C2M A;  5BRR E;  1TOC B;  2ZZU H;  1O37 A;  4WXV A;  3DA9 B;  1BRB E;  1DXP A;  3RXL A;  2FOC A;  2P16 A;  1GHX H;  4FVB A;  4FUD A;  2EI6 A;  4NA9 H;  1S6F A;  3MU8 A;  4MG3 A;  3GCO A;  1Y5B T;  1AE5 A;  2W3K A;  3RXJ A;  2Z9I A;  1TIO A;  4E7R G;  1SHH B;  1A46 H;  1O5C B;  2Z6B D;  1Y59 T;  1ZHM A;  4XBC A;  1K1P A;  1OWE A;  1AND A;  1WAY B;  1NPM A;  2B5T B;  1O2T A;  1KIG H;  1GHB F;  1GI9 B;  5C1Y A;  1T32 A;  1C1P A;  2GCH G;  1LPZ B;  1UO6 A;  1OP0 A;  3F1S B;  4A5T S;  1BIT A;  4CHA C;  2CN0 H;  2XNI A;  1GJD B;  1P06 A;  4ABE A;  1GBE A;  1C2K A;  3A87 A;  3STJ A;  1VR1 H;  3F9E A;  2AHM E;  1GBM A;  1W7X H;  1CBW C;  1RGQ A;  2VNT A;  1RTF B;  4I86 A;  3MHW U;  2VIQ A;  1T8L A;  1C5N H;  1O2I A;  1QJ7 B;  5HGG A;  1N8O C;  3SGQ E;  1PQ5 A;  5HXF A;  3UOP A;  1FQ3 A;  1EOJ A;  3ZZ6 A;  3ODF A;  2BDB A;  3LKW A;  1HYL A;  4K1T A;  2SGE E;  2BY8 X;  1Z8J B;  2BD7 A;  1FX0 B;  1WCZ A;  1EFR D;  2ZGC A;  1K1I A;  3QTO H;  3M3T A;  1CE5 A;  1V2P T;  3F2G A;  1E1R D;  4X1S U;  5A0B A;  1QHR B;  1BBR E;  2KR7 A;  4GCH G;  5GCH F;  1DX5 M;  1H9I E;  3K65 B;  3KCG H;  1EXF A;  1W13 U;  5JB9 S;  1SGD E;  2TBS A;  3ZVE A;  2ZA5 A;  3FP7 E;  4J2Y B;  1KTT B;  5CHB A;  1MTU A;  1V2V T;  4K8B A;  1BA8 B;  3SHC H;  1C5R A;  1TBR H;  1TGT A;  1J16 A;  2QA9 E;  2ZP0 H;  2OBQ A;  4H6S B;  1GBJ A;  1MUE B;  1KXB A;  3QUM P;  2WV5 A;  3B23 B;  3SV6 A;  4I8J A;  1HBT H;  4FUB A;  1EJA A;  5IYT A;  3SJI A;  1S0Q A;  1RTK A;  5DPA A;  1YPH E;  1O2J A;  1SGI B;  1DIC A;  4X2V A;  4GPG A;  3S7K B;  4CRA A;  3GY2 A;  2BY5 X;  5GIB A;  1UTN A;  1VIT F;  2P93 A;  1AWF H;  2FX4 A;  1AVG H;  2YOL A;  2GMT C;  2OC1 A;  3VB3 A;  1UHB B;  2J98 B;  1B0F A;  4HTC H;  1SQO A;  4I8G A;  3R3G B;  5FBI A;  5EPN A;  4AGJ A;  4WMD A;  1T4V H;  5F8X A;  4Z0K A;  1ETR H;  1TPA E;  1PJP A;  4DOQ A;  3ATI A;  1OPH B;  4B73 A;  1Z1I A;  3VXF H;  1AFQ C;  1S6L A;  1W0J D;  3T27 A;  5C5N A;  3ZV9 A;  5C3N A;  1GVZ A;  2VVU A;  1O38 A;  3PRO A;  1DS2 E;  1AI8 H;  3A85 A;  5E2O A;  2BD5 A;  2YMS C;  2FX6 A;  1CO7 E;  4FUG A;  4A92 A;  5AF9 H;  3ZZC A;  3L6P A;  1AU8 A;  1SQT A;  1NRR H;  1WYK A;  3BEU A;  5LPR A;  1C4U 2;  4HGC A;  2FS8 A;  4UFE H;  1W2K H;  1YBW A;  2NU1 E;  1YM0 A;  2FI4 E;  1BOQ A;  1P2K A;  2KCY A;  1AWH B;  5FPT A;  2Y5G A;  2Z3C A;  4OS2 A;  3SJ8 A;  1DPO A;  1MZD A;  2I6S A;  4UEH H;  1BHX B;  1FY5 A;  1O2Z A;  1C5M D;  2JKH A;  2HVY B;  1PQ7 A;  1UVU H;  1RIW B;  4YLU A;  1GJA B;  1LMW B;  4ASU D;  8GCH G;  1ZJD A;  3FKS D;  5L2Z H;  3CP7 A;  2UWL A;  5LPF A;  1TBQ H;  4FXG H;  1B5G H;  1DOJ A;  2V6N A;  4X6N A;  2QCY A;  2G8T A;  1T8O A;  1HAG E;  3RLW H;  3AVZ A;  1FV9 A;  3DFJ A;  1CVW H;  4NFE A;  3DCL A;  4E06 H;  1D3Q B;  1MKW H;  4GUX A;  1CBW B;  3NXP A;  2A31 A;  4YOJ A;  1QA7 A;  1PYT D;  4JK6 A;  1O2M A;  3SI3 H;  4FUJ A;  4DGJ A;  3TGI E;  1DLE A;  1MTS A;  2BX4 A;  2CMY A;  2NU4 E;  2HPP H;  2OBO A;  5CE1 A;  4CRC A;  2ZHF H;  1A5G H;  1O3I A;  1HJ9 A;  2SGF E;  3A7W A;  1HAP H;  1SBW A;  1KTS B;  3O8D A;  2BD3 A;  5C1X A;  4ZRO A;  1C2J A;  1NFW A;  2ZO3 H;  1O3L A;  1LHC H;  1OSS A;  1YP9 A;  4ACA A;  3ZZ9 A;  3S9B A;  2G51 A;  2R9P A;  1TGS Z;  2B9L A;  5JBB S;  1E38 B;  1EAU A;  1N1L A;  3KF2 A;  1UTJ A;  3PV2 A;  3JZ2 B;  2UWP A;  5ESB A;  1O3O A;  2PWX A;  1ELF A;  3MU4 A;  2THF B;  4MDS A;  1K21 H;  4ZH8 A;  1LVM A;  3RMO H;  3U8R H;  1GBA A;  1LVY A;  1TRM A;  3PO1 B;  1K1M A;  4CRG A;  1OHH D;  3TJV A;  2QF4 A;  4BAK B;  2Q1J A;  2Z7F E;  4ZXX H;  4B71 A;  1H8H D;  3NWU A;  3KEE A;  1EP5 A;  4J1Y A;  1MD7 A;  2CXV A;  1ZGV A;  4O03 A;  2XBV A;  4IBL H;  1ESA A;  1GGD C;  3KID U;  1AVW A;  3SNC A;  1YLC A;  1MAB B;  3SYJ A;  5K7R A;  4YLQ H;  1FJS A;  1A0J A;  1UCY E;  2R2M B;  3SU3 A;  4ISI H;  2GGV B;  1YPM H;  2BVR H;  4INH A;  2LP6 A;  1B0E A;  3BF6 H;  2JH6 D;  5LPE A;  1A5H A;  2J5U A;  4ABA A;  1KSN A;  1AGJ A;  1T8M A;  1QQ4 A;  5B6L A;  3D23 A;  3UR6 A;  3KQC A;  3B8J A;  1O2P A;  1XUF A;  5C5O A;  2ZPR A;  1HAV B;  1RFN A;  1CA0 B;  1SL3 A;  1GI0 A;  1LCY A;  1V2O T;  1O3G A;  4IC6 A;  4K60 A;  3VGC C;  2TGT A;  2J97 A;  2F9U A;  3HKI B;  4F48 B;  3ZYE A;  1MKX K;  2WV4 A;  4I33 A;  1TNH A;  2TIO A;  3ZVG A;  2YMS B;  1O39 A;  1AKS B;  3QZQ A;  1KDQ B;  2QYI A;  3P17 H;  2NWN A;  5EIY A;  1GI3 A;  2PUX B;  3RXC A;  3TPI Z;  5B6O A;  1SQA A;  1S0R A;  2A4R A;  1NRN H;  3SBK A;  4H42 U;  1C4V 2;  1S82 A;  2GDD A;  2FI3 E;  2EI7 A;  3GCT G;  3UOU A;  4WH8 A;  1BTP A;  2ZDN A;  4K69 A;  8LPR A;  2A2X H;  1QY6 A;  3ZVC A;  3WW7 A;  1TX7 A;  2G52 A;  4YT7 H;  3ZZ8 A;  3U69 H;  1C2G A;  1TOM H;  3RXT A;  3GOV B;  1MBQ A;  2GP9 B;  2ALV A;  3U8T H;  3VB4 A;  2GD4 B;  1OWK A;  1TNJ A;  4KP0 A;  1DWC H;  3P6Z B;  3STI A;  4P02 A;  1HFD A;  2OIN A;  4ZCN A;  1O5F H;  3SU0 A;  1AB9 C;  1AMH A;  2UUY A;  4AZ2 B;  3KGP A;  2CF9 H;  1YLD A;  1C5X B;  1ESB A;  1JMO H;  1GI5 A;  3MU1 A;  4Q2K A;  1YPJ H;  2XWB I;  3MO9 A;  7KME H;  1NRO H;  1D3T B;  3SJ9 A;  3TGJ E;  2FO9 A;  1TRN A;  4YZU A;  4YM9 A;  2WPD D;  4D76 A;  3M36 A;  1JIR A;  1HAZ B;  4NGA H;  1ZSL A;  1G9I E;  1GHZ A;  1V6D A;  4JCN A;  1XUK A;  1SLV B;  5I25 A;  1XUI A;  2HNT C;  4DVA U;  2FPZ A;  4NIX A;  3RLY H;  2PSX A;  2STA E;  3FAO A;  4DW2 U;  2VVC A;  3Q76 A;  1UTM A;  2VIN A;  3RU4 E;  1VCP A;  2AIQ A;  2EC9 H;  2OD3 B;  2WPH S;  3P95 A;  4DG4 A;  4X8T H;  2PHB A;  3EYD A;  3RXF A;  1ZHP A;  4MNW A;  3HPT B;  1MTW A;  1C1Q A;  2G81 E;  1OWD A;  2VBC A;  3ODD A;  1GL1 A;  1DY8 A;  4AG1 A;  1K9O E;  2GZ9 A;  4A1X A;  6CHA C;  1HAH H;  1C5L H;  1LHE H;  2F4L A;  1KMH B;  1C5P A;  1TWX B;  5SGA E;  1QBO A;  1ELV A;  1YPL H;  4JYV H;  4LK4 A;  2SGD E;  1N6X A;  1HCG A;  4RSP A;  2FP7 B;  3PV5 A;  1P05 A;  3P8F A;  2ZHQ H;  1CSO E;  1ABI H;  2Q6D A;  2A0Q B;  2ZGH A;  2KCP A;  3GY7 A;  2A5A A;  2BDH A;  2DE8 A;  3OE7 D;  1RD3 B;  1NFU A;  1QGF A;  1GGD B;  2FOM B;  2C8Y B;  4O9V A;  2A7H A;  3EGK H;  2HLC A;  3SV2 H;  1G3E A;  1F0R A;  4NZL A;  2J92 A;  4BAN B;  1IQJ A;  1H9L B;  1O3P B;  2HGT H;  4MLF B;  1UK3 A;  3SO3 A;  1G37 A;  4NIW A;  1GMC G;  1CHO G;  4SGA E;  2FTM A;  3UQV A;  4AOQ A;  4XBD A;  1ZRK A;  2ZNK H;  2ZFF H;  1GVL A;  1HPG A;  3C1K A;  1V2U T;  5C67 A;  4XE4 A;  1LVO A;  1ELB A;  2XRC A;  4AFU A;  2VIO A;  3CNR A;  1TAW A;  3TVJ B;  1ZTJ A;  5EGM A;  3LGV A;  5FL7 D;  2Y6T A;  1AE8 H;  2IJD 1;  1BBR K;  1YF4 A;  3R0F A;  1V2W T;  1L4D A;  1Z8I B;  4I8K A;  4HZH A;  3RXM A;  1JRS A;  1IHS H;  2BB4 A;  1G3C A;  3I77 A;  3W95 A;  4JK5 A;  2ZFQ H;  1HLT H;  1S83 A;  4B2C A;  1KLI H;  5HMA A;  1DUA A;  2WPL S;  3RXS A;  2GZ7 A;  3OEE D;  1XUJ A;  3SJO A;  2C8Z B;  2PKA B;  3M3V A;  1QBN A;  1ZLR A;  2WZQ A;  1SPJ A;  1TMU H;  4MVN A;  3ZZ5 A;  2XCN A;  5A09 A;  3G01 A;  3A7X A;  3UY9 A;  5EOD A;  1GBL A;  3FAN A;  1EX3 A;  3LPR A;  1QTF A;  1DAN H;  1GHW H;  1D9I A;  1AB9 B;  1PPZ A;  3BN9 A;  3SN8 A;  1WDI A;  5K0H A;  1HAO H;  1HAV A;  5LH8 A;  2BDA A;  1GMD G;  2PTN A;  1Z8R A;  1J17 T;  1SLU B;  3M5O A;  5AVD A;  1SR5 C;  5KGO A;  3SND A;  2F9N A;  4D7G A;  5EG4 A;  4X1R U;  2O8W A;  1TX8 A;  2PUQ H;  1V3X A;  1KDQ A;  3BEF B;  2VGC B;  3UR9 A;  1GBI A;  4WVP E;  5FCK A;  2AEI H;  4U32 A;  3SNA A;  1THR H;  5A8Z A;  1JOU B;  3F2F A;  4AB8 A;  1P11 E;  4WME A;  4WXI A;  3O8B A;  1UTL M;  3ATK A;  3AW0 A;  1H9H E;  2XC5 A;  3GY8 A;  1IHT H;  2PW8 H;  2Z9L A;  2ZU1 A;  2TGD A;  5AHG H;  2ILN A;  1MD8 A;  1WTH D;  4XRN A;  4Y8Y A;  3UQO A;  3W1E A;  1SGC A;  1O30 A;  2AGE X;  3LGY A;  1DXW A;  1KY9 A;  4IGD A;  3U1I B;  1VJA U;  3KL6 A;  5EST E;  1ZPC A;  2BDI A;  2QE7 D;  3E90 B;  1YPK H;  3GY6 A;  3GDV A;  1U6Q A;  3PLB A;  2FOG A;  3UFA A;  1YPG H;  3NUM A;  4Y7A A;  3L3T A;  3SV7 A;  5DN6 D;  2AS9 A;  1F92 A;  2KAI A;  2XBX A;  4JMY A;  1SG8 B;  2WPJ S;  1WQV H;  3UAI C;  2ANY A;  2HLD D;  2H9T H;  4ZHA A;  1NBM D;  4CH2 B;  3GIC B;  1LPG B;  4ZAE A;  3LGU A;  2P95 A;  4MNY A;  1HAX B;  4B6F A;  1V2N T;  1MMJ N;  5DP7 A;  1YKT A;  1O0D H;  2FYR A;  1GDU A;  1TX6 A;  2J9N A;  4MNV A;  1HB0 B;  2C3S A;  1KXF A;  4RKO B;  1SGR E;  2M5T A;  3I29 A;  3NPS A;  1ELG A;  3MI4 A;  4RI0 A;  5HKK D;  4M7G A;  1LDT T;  3SUF A;  3HGP A;  3K6Z A;  4NG9 H;  1ANE A;  1UW7 A;  2OUA A;  2QXI A;  4I8H A;  4ZHL U;  1UK2 A;  1UVO A;  3V12 A;  4ZMA H;  3HAT H;  4NSV A;  5TCA A;  1K1J A;  4NSY A;  5HYO A;  1V2J T;  4FUH A;  1YWU A;  7EST E;  3ZZ4 A;  1V2S T;  1QRW A;  1BTU A;  3NKK A;  2A32 A;  1Z8G A;  2IJO B;  2F3C E;  2VIP A;  2JH5 D;  1W0Z U;  2BYA X;  1THP B;  1O5A B;  1LQE A;  3EA7 A;  1P12 E;  2FS9 A;  5C17 A;  4KGA A;  4FVD A;  3LC3 A;  4F4O C;  1QL7 A;  1O5E H;  1W0K D;  1RIW C;  1EZS C;  1L1J A;  3V7T A;  1GDN A;  3RML H;  2HPQ H;  2SGQ E;  1O3M A;  3F0P A;  1MAX A;  3EE7 A;  2H5C A;  1GHA G;  3EST A;  2H5D A;  1YYY 1;  1GJ4 H;  3LU9 B;  4UDW H;  2HWL B;  1UCY K;  2QF0 A;  3RMN H;  2W7U A;  3BV9 B;  2GCH F;  3D62 A;  2A1D B;  3A86 A;  1BTY A;  1MKX H;  2C8X B;  3A80 A;  2J38 A;  2K8I A;  4VGC B;  1OYT H;  4FUE A;  5C94 A;  1J15 A;  1SVP A;  3A82 A;  1NES E;  1TB6 H;  4TY6 A;  1GJ9 B;  3A7Z A;  4XOJ A;  5ABW A;  1QIX B;  2BVS H;  1UVT H;  4CRF A;  4OGX A;  2Y81 A;  1H8I H;  2FOF A;  5DJ7 A;  3EA9 A;  2JDI D;  4I31 A;  1MTN B;  5EQS A;  4Z6A H;  3KQD A;  2SNW A;  3SUG A;  5A0A E;  1O2X A;  3SUE A;  2Q6G A;  5EXN A;  1GWA A;  5E0G A;  1O2W A;  3AK5 A;  1ARC A;  1IQG A;  1SSX A;  1HAY B;  2ZEB A;  1ZMJ A;  2BY9 X;  4DIH H;  3QLP H;  1EB1 H;  5JBT A;  2BM2 A;  1Z7K A;  1F5L A;  1O3J A;  2TRM A;  3ZVF A;  2KM0 A;  1V2M T;  2W3I A;  4GCH F;  3H7T A;  1BCU H;  2ZGJ A;  2RA0 A;  2P3F H;  1ZJK A;  3PO1 C;  4GLY A;  2QC2 A;  3QN7 A;  4UD9 H;  2WPI S;  1HRT H;  1L4Z A;  1J8A A;  2WSS D;  1HNE E;  3U9A H;  1HIA B;  1UK4 A;  3UNR A;  2FI5 E;  1NT1 A;  1DDJ A;  1ZTL A;  2LPR A;  1EUF A;  3LH1 A;  1EAS A;  1MU8 B;  5E2P A;  2BD2 A;  1S81 A;  4LOY H;  3DT0 H;  1NRP H;  2QAA A;  3E6P H;  3UNS A;  1H8D H;  1C5O H;  1E79 D;  6EST A;  2HNT F;  1O2L A;  4AC9 A;  3A7V A;  1ELC A;  1FUJ A;  1YPE H;  3Q00 A;  2OLG A;  1EPT B;  5T6F A;  3UPE A;  1K1N A;  1CQQ A;  2AH4 X;  2PGQ B;  1CA0 C;  2A4Q A;  1A3E H;  1YPH C;  2KCO A;  1CA8 B;  2D8W A;  5A8X A;  1C4Y 2;  1O3C A;  3BG4 B;  1JWT A;  3TLO A;  5C0U A;  2A7J A;  2CK3 D;  1C9P A;  5DG6 A;  3NRL A;  3UUZ A;  3BTT E;  1PQA A;  2XYA A;  5J4S A;  3ATL A;  1BTZ A;  3HGN A;  3URE A;  1BRC E;  3K6Y A;  2RFK C;  2G5N A;  3MNS A;  2J94 A;  3OEH D;  1MCT A;  3ZYD A;  1P02 A;  1THS H;  4JYT A;  4FU9 A;  1T7C A;  3HK3 B;  1O2R A;  4ASH A;  1UJ1 A;  5DP9 A;  1XUH A;  4X0W U;  3RXV A;  5FAH A;  4FET A;  3RP2 A;  5GWZ A;  5JDU B;  4TT3 D;  1TGB A;  1AUJ A;  4GHQ A;  3RU4 D;  1EB2 A;  1NFX A;  3VG8 A;  1GI1 A;  1O5D H;  4I7Y H;  1DM4 B;  3ZIA D;  2C8W B;  3VB6 A;  1A2C H;  1PPE E;  3P70 B;  4O3U A;  5T6G A;  1L2E A;  3L33 A;  4XDE A;  4LZ1 H;  1ZPB A;  1VZQ H;  4BAM B;  1OWI A;  3LH3 A;  1ELD E;  2ODY B;  1BTH H;  1EJM A;  1OP2 A;  4X2W A;  1GJ5 H;  4K1S A;  2BOK A;  4KEL A;  5T6D A;  1Q31 A;  8GCH F;  2ZDV H;  4OM9 A;  3TU7 H;  1IQN A;  1VGC C;  5I46 H;  1O34 A;  4YO9 A;  3GY4 A;  4OS4 A;  5FHT A;  1GI2 A;  1O3B A;  1T8N A;  1P2O A;  4B76 A;  1SGP E;  1QJ1 B;  1BBR H;  4OS5 A;  1GCT B;  1GJ7 B;  1SGF G;  1N6Y A;  4U2W A;  2FEQ H;  1XMN B;  1Y3V A;  4IC5 A;  1TON A;  1LKB A;  3U8O H;  3K2U A;  3UWI A;  1MAY A;  5DP8 A;  5L30 H;  2FDA A;  3RXG A;  2O8U A;  3T2N A;  4X8V H;  2J2U A;  2VB0 A;  1NO9 H;  1GBH A;  1ZYO A;  3URC A;  2ZTZ A;  5CMX H;  2ODQ A;  1LPK B;  1P2Q A;  3MH6 A;  1MCV A;  4HFP B;  3MYW A;  1UTO A;  2BOH B;  2VIW A;  1QL8 A;  4O97 A;  2EEK A;  2B7D H;  2BLV A;  1BRU P;  1GMH G;  3MO6 A;  3A8A A;  3E91 A;  1W0Y H;  1SLW B;  1H8E D;  1LO6 A;  1FY1 A;  5HIZ A;  1FMG A;  1JXP A;  2P3U B;  5F53 A;  2Z9G A;  3RDZ A;  1FY4 A;  1X7A C;  3O8C A;  2SGP E;  3SHA H;  3RU4 T;  4ABH A;  3LC5 A;  3F68 H;  5H4I B;  1C2I A;  2TGA A;  1GI7 B;  2G4T A;  3GY5 A;  4MQA A;  2FZZ A;  1ZRB A;  1A61 H;  1C1U H;  3P8O A;  2VIV A;  5A2M H;  1O5B B;  3AAV A;  3SOR A;  1BIO A;  2VWL A;  1ABJ H;  2VH0 A;  4Y6D A;  2VH6 A;  2QF5 A;  4FOU C;  4IN1 A;  1DST A;  3EQ0 H;  3ZVD A;  4B1T A;  4WF8 A;  5GPI B;  4CH8 B;  1O36 A;  4Y71 A;  2FYQ A;  3QGJ A;  4TPI Z;  3DFL A;  1LKA A;  1IQF A;  1FPH H;  1SGT A;  2IPH A;  3LGI A;  2A4O A;  2VWN A;  4X6M A;  3SZE A;  1WOF A;  1P03 A;  2ASU B;  1IQE A;  2ZCH P;  1EKB B;  2V35 A;  1WSS H;  1Z71 A;  3AAU A;  2GV6 A;  1LHD H;  3NCL A;  1G2L A;  1QR3 E;  4YES B;  5JBC S;  2A7C A;  1AHT H;  3AW1 A;  4XBB A;  1ZMN A;  1TNI A;  2ZFP H;  1EZQ A;  1HIA A;  3BTH E;  3MNB A;  5LGO A;  5DGJ A;  4CBO A;  4Q7Y A;  2RCE A;  1O35 A;  2NU3 E;  2IN2 A;  4YOG A;  2H1U A;  1PPG E;  3TH3 H;  1C1N A;  2BDG A;  4X8U H;  3KHV A;  3GCT F;  2WV9 A;  2BLQ A;  1PPF E;  1UHB A;  2AGG X;  2J98 A;  3FP6 E;  4ISN A;  3FZD A;  1WUN H;  1V2L T;  1SHY A;  1KXE A;  4ZUH A;  3ZZ3 A;  3TK6 A;  2Y80 A;  4MPU A;  3BTE E;  1D4P B;  1FY8 E;  2ZKS A;  4CRB A;  1VGC B;  1SOZ A;  3EE0 B;  3QK1 A;  1G30 B;  3GY3 A;  2QXJ A;  4D9R A;  1FNI A;  2ZFT A;  1E36 B;  2ZU4 A;  2A5K A;  1P2J A;  4NA7 A;  2W5E A;  1BDA A;  3A84 A;  4CR5 A;  4TY7 A;  3P92 A;  2FM2 A;  3SQE E;  2GT7 A;  2QXH A;  1W10 U;  3V13 A;  2VGC C;  2Z3D A;  1RXP A;  3GS9 A;  3TJN A;  3BG8 A;  2JH0 D;  1O2Y A;  3A89 A;  2EI8 A;  1DFP A;  1Q2W A;  1CGH A;  4I8L A;  2ZDM A;  1NRS H;  4Y79 A;  1EQ9 A;  2ZU3 A;  1AZ8 A;  2BX3 A;  3RXO A;  3M5L A;  1Z6J H;  1FN6 A;  4YTA A;  3RXU A;  1NRQ H;  3BTF E;  2F83 A;  1QNJ A;  5KED A;  3OX7 U;  3PV4 A;  3M61 U;  1BHX F;  1MU6 B;  1C2L A;  1O2S A;  1OWJ A;  3N99 A;  2P59 A;  5F8T A;  1MZA A;  1UCY H;  1P2N A;  4JZE H;  4CR9 A;  4UON A;  3QGN B;  1J14 A;  2FMJ A;  2ZDL A;  3SNB A;  1YCP M;  1TRY A;  3H7O A;  3PTB A;  2F9V A;  2V7Q D;  3RXD A;  1ANC A;  1A0L A;  3PLP A;  1UTK A;  3CS7 A;  5EXL A;  4O3T A;  1FZZ A;  2D2D A;  3DD2 H;  4DCD A;  1BB0 B;  4JYU H;  4ABD A;  5KEC A;  4AYV B;  1PYT C;  3RM2 H;  3O8R A;  2C90 B;  3T62 A;  3CEN A;  3GDU A;  3RXA A;  1JIM A;  1YLN A;  4TSF D;  2QXG A;  1F5R A;  1RTL A;  4KTC A;  2PR3 A;  2FOE A;  1FXY A;  5DKM A;  4BXS A;  1QBV H;  2GT8 A;  2WPM S;  2JJ2 D;  1SGE E;  2FES H;  1P09 A;  1NZQ H;  1GMC F;  2ANW A;  1CHO F;  3SU6 A;  5F03 A;  5BPE A;  1GG6 B;  2V0B A;  6GCH G;  4D9Q A;  3SGB E;  3RXK A;  1GBC A;  1IQI A;  2WHX A;  3PRD A;  5T1V A;  2IPQ X;  2QN5 T;  1UVP A;  3PWB A;  2AIP A;  4NIY A;  4BTI B;  2AYW A;  1AIX H;  2H9H A;  3KYF A;  5EXM A;  3F3B A;  3LT3 A;  4AYY B;  2EA3 A;  2PV9 B;  3BSQ A;  3VEQ B;  1ORF A;  3QDZ B;  4LZ4 B;  3N7D A;  2BD8 A;  1XXD A;  2PP6 A;  2LEL A;  3P8G A;  5JB8 S;  5TJX A;  3OYP A;  3PYH A;  1QJ6 B;  4NIV A;  4ZKS U;  1BJU A;  1K2I 1;  1CT2 E;  2WUC A;  7GCH G;  1V2K T;  1VIT H;  1SKY E;  1DVA H;  8KME 2;  3KQE A;  3FZZ A;  1EZX C;  3MOC A;  4K1E A;  9LPR A;  3BTG E;  3TJU A;  4UFG H;  1XKA C;  2BQ6 B;  3PMB B;  3T25 A;  1YC0 A;  2BDC A;  1GCD A;  4M9F A;  5L2Y H;  2V3M A;  2ZDK A;  2O8L A;  1A7S A;  1QB1 A;  2WUB A;  4IS5 A;  4TWY A;  4ZKR U;  1C1M A;  1TQ7 B;  2ALP A;  2DE9 A;  2ZCK P;  2O9Q A;  1BUI A;  5E0J A;  1O32 A;  1AKS A;  4VGC C;  3UTU H;  5GXP A;  3SW2 B;  1C5U A;  1GMD F;  1Y8T A;  1HV7 A;  5HIY A;  4AN7 A;  2OC8 A;  2GX4 A;  2XCF A;  1OWH A;  1EP6 A;  2Y5F A;  1BQY A;  2BLO A;  2ZG0 H;  3PMJ A;  1S5S A;  3MNX A;  2ZFR H;  2XXL A;  1ZML A;  1JRT A;  2PKS B;  3OFN D;  1MTN C;  2BDY A;  2ZQ2 A;  1Y3Y A;  3PMH B;  3HKJ B;  5DP6 A;  3ZZ7 A;  1D6R A;  3BTD E;  1KYN A;  2G00 A;  1DSU A;  1TBZ H;  3OY6 U;  4FUF A;  1GJ8 B;  1ID5 H;  1QFK H;  1ELE E;  2CJI A;  4Q7X A;  4YXW D;  1NN6 A;  2NU0 E;  3FN8 A;  4NWK A;  3SU4 A;  1BT7 A;  1MQ5 A;  4Y8Z A;  2GCT B;  3SUD A;  2SFA A;  2PFE A;  1K1L A;  2NU2 E;  1C5V A;  4HI3 A;  1CGJ E;  2FXR A;  2W7S A;  1MH0 A;  1E0F D;  1GI6 A;  3K9X B;  3RMM H;  5DK1 A;  2ZHW H;  1C5W B;  2Q6F A;  1PQ8 A;  2H2Z A;  3FOA A;  1VCQ A;  3SV8 A;  2BVX H;  1XVM A;  1IQL A;  2GV7 A;  1QZ8 A;  1COW D;  2CGA A;  4OS6 A;  4NZQ A;  5AFZ H;  3SNE A;  3DUX H;  4R0I A;  1AUT C;  2BZA A;  4ABI A;  4RKJ B;  3RUO A;  1EPT C;  1QB9 A;  3ENS B;  3T28 A;  1K1O A;  1O2O A;  2WPK S;  4WH6 A;  3OY5 U;  1NC6 A;  3BG4 C;  1CU1 A;  2A5I A;  3S9A A;  1C2D A;  1DE7 H;  2EQN A;  4UE7 H;  5CDF E;  3ZZA A;  4DUR A;  4DY7 B;  2UUK B;  2EST E;  2K1Q A;  1A0H B;  4ZKO U;  4A6L A;  2ZEC A;  4BAH B;  2QY0 B;  3RC4 A;  2EY4 C;  2ZI2 H;  2FIR H;  5FX5 A;  1O2U A;  3M7T A;  1W8B H;  1SC8 U;  5JBA S;  1W3C A;  4Z1M D;  3S7H B;  4AFS A;  1LTO A;  3SJK A;  2KX4 A;  5EQQ A;  5PTP A;  2F91 A;  1BMF D;  2R3U A;  1ETT H;  1SFI A;  3F6U H;  4NA8 A;  1TLD A;  2AFQ B;  1GHB G;  2XWA A;  1A4W H;  4WWY A;  2GDE H;  1QCP A;  3C27 B;  1F0U A;  2TGP Z;  1QL9 A;  3PMA B;  2ZPS A;  4X1N U;  1GI4 A;  2ODP A;  1Y3W A;  1SMF E;  5EPY A;  3WWF A;  1HXE H;  3PTN A;  1TNK A;  3TIT A;  4B2B A;  1V2Q T;  2LNC A;  5FCR A;  4B75 A;  3F9G A;  5EW1 H;  4Y10 E;  1GHA F;  1FDP A;  3ZVA A;  5GJ4 B;  1SGN E;  2PLX A;  4DII H;  5FX6 A;  1J9C H;  1HAI H;  1O2Q A;  3OU0 A;  5TCC A;  3TH4 H;  4AGK A;  1GCT C;  1T4U H;  2BLW A;  2JET C;  2R0L A;  1DIT H;  2ZTX A;  4JZ1 A;  1E1Q D;  1NU7 B;  1ZSK A;  1E35 B;  1FAX A;  3Q3K A;  4X1Q U;  1KLT A;  1B7X B;  4UFD H;  1C1S A;  1Y5A T;  3ZZB A;  2CHA B;  2J34 A;  4FU7 A;  2IOT A;  4YOI A;  2ZWL H;  5AFY H;  1C1R A;  1VCW A;  4KTU A;  1P9U A;  1TNG A;  4THN H;  5F8Z A;  2PKA A;  1F0S A;  1LHG H;  4A1T A;  1ETS H;  1ELT A;  3PWC A;  1OKX A;  1EST A;  4SGB E;  4ABJ A;  1BTW A;  5FBE A;  4ACB A;  5DO4 H;  1EAT A;  4JZI A;  5GCH G;  3SQH E;  4E05 H;  3VFE A;  4Y8X A;  1BJV A;  3SV9 A;  1BMN H;  1C1W H;  5CHA B;  4KKD A;  1P10 A;  1PFX C;  3V3M A;  2OTV A;  1YGC H;  1WTG H;  4NWL A;  1NFY A;  4DJZ B;  1MQ6 A;  3H09 A;  1ARB A;  1H4W A;  2KFW A;  1C2F A;  1W11 U;  1SFQ B;  1WBG B;  2OP9 A;  3TGK E;  3M37 A;  1BMM H;  2O8T A;  2W6J D;  4MPW A;  1Y3X A;  5C0T A;  1D6W A;  2QF3 A;  3E3T A;  5EJL A;  3PRB A;  3MNC A;  1BML A;  3MTY A;  1ZHR A;  3B9F H;  1AVX A;  3KN2 A;  2L6O A;  3AAS A;  1SOT A;  3D49 H;  1C2H A;  3OTJ E;  1FY3 A;  1VIT G;  2F9P A;  1BTX A;  4B2A A;  1DWD H;  4GSO A;  1K0H A;  1AO5 A;  2D26 C;  1P3E A;  3E0P B;  3V0X A;  3E0N B;  1NTP A;  4EST E;  2SGA A;  3EAJ A;  2JIZ D;  3VXE H;  1O3K A;  3PM3 A;  4UFF H;  1O3H A;  3BIU H;  3RXQ A;  1P9S A;  3TJO A;  2B8O H;  1LVB A;  3M35 A;  4IMZ A;  1SI5 H;  1L0Z A;  5JPM H;  2ANM H;  3I78 A;  5EJ1 A;  3GDS A;  3FVF B;  4ABG A;  2Y7Z A;  3M7Q A;  3A81 A;  5GDS H;  4R8T B;  1O2G H;  3MMG A;  1D3P B;  2P8O C;  2RDL A;  3DHK H;  4E7N A;  4ABF A;  1AQ7 A;  1FI8 A;  5E0H A;  1TA6 A;  5FPY A;  3KQB A;  3SU2 A;  4XSK U;  4X6P A;  5JYI A;  4MPV A;  4WMF A;  2BZ6 H;  2H9E H;  1OX1 A;  4X8S H;  1ZPZ A;  3A88 A;  3ZVB A;  3DSO A;  3PB1 E;  1NBM E;  3QTV H;  4AFQ A;  1SLX B;  5ETX A;  3RC6 A;  1P8V C;  2ZPQ A;  1EAW A;  1GBF A;  4JZF H;  3LJJ A;  1QA0 A;  2YNB A;  2XC4 A;  1GHY H;  2OQU A;  5A0C A;  4BXW A;  3E16 B;  3LOX A;  1HUT H;  4QT8 C;  3GIS B;  5FPS A;  2W26 A;  2D1J A;  3KQ5 A;  1H1B A;  2BD4 A;  1ELA A;  1L1G A;  1NY2 2;  1TPP A;  2JET B;  2KZ4 A;  4CHA B;  1SGF A;  1TA2 A;  3GYL B;  3M3S A;  1INC A;  3S0N A;  1GDQ A;  5EW2 H;  4OS7 A;  2OCV B;  4AX9 H;  2PTC E;  2AMD A;  1P3C A;  2UUJ B;  4INL A;  3TK5 A;  1QRZ A;  2OXS A;  1DY9 A;  2GKV E;  3VPK A;  1C5T A;  1GBB A;  1Z6E A;  3MH5 A;  2BD9 A;  1GHV H;  1P2I A;  1A5I A;  2BTC E;  3TNT A;  3LIW A;  4H6T A;  4OS1 A;  4OGY A;  2F9O A;  4Y0Y E;  1N8O B;  5DSF A;  3EDX B;  3SU1 A;  2F9B H;  4A7I B;  2ZU2 A;  1O31 A;  1FAK H;  1VJ9 U;  1LQD B;  4AOR A;  2WIN I;  1FIW A;  4U01 A;  1AY6 H;  2OK5 A;  1NM6 A;  1OP8 A;  4K3J A;  3HK6 B;  1M9U A;  1WU1 A;  1IQK A;  3EA8 A;  3UWJ H;  4P00 A;  3SU5 A;  4ABB A;  1YCP H;  3LDX H;  2XND D;  5DP5 A;  1F5K U;  1SGY E;  1XVO A;  4D8N A;  1G32 B;  1G3D A;  1CGI E;  3ATM A;  4KTS A;  1KXD A;  1GMH F;  1RJX B;  3N7E A;  3N7O A;  4F49 A;  3MU5 A;  3NZI A;  1GJC B;  3A7T A;  4Q4L A;  5C20 A;  7LPR A;  2R2W U;  3RXP A;  1C2E A;  5F6M A;  1Y3U A;  2ZHE H;  4LXB H;  4IMQ A;  3E8L A;  1O3D A;  1OS8 A;  3TH2 H;  2GJG A;  4Y11 E;  2YNA A;  2BY7 X;  1BZX E;  1Z1J A;  3A8B A;  3RXH A;  1VKY A;  1Q3X A;  3GYM A;  2ZQ1 A;  4K8Y A;  4B6E A;  1TGN A;  2STB E;  1G2M A;  2GMT B;  1RRK A;  3A8D A;  3MH4 A;  1XUG A;  3T26 A;  4AFZ A;  3QWC H;  4XD7 D;  1GG6 C;  1P57 B;  2ZCL P;  1V2T T;  5T3H A;  2RG3 A;  1O3A A;  2ZIQ H;  1O3N A;  1GJ6 A;  1PPB H;  1ZTK A;  4PRO A;  5IDK A;  2P8O B;  4BTU B;  5IK2 D;  1DLK B;  6LPR A;  1DUE A;  2C4F H;  1AFQ B;  5EJZ A;  4B74 A;  1K28 D;  1IQH A;  2OC7 A;  1MTV A;  3T5F H;  1T31 A;  2A2Q H;  1D3D B;  2M2A A;  3E1X B;  8EST E;  1SGQ E;  4X6O A;  1NU9 A;  2C93 B;  3M5N A;  3Q77 A;  3WY8 A;  2VU8 E;  1SQR A;  4H4F A;  2BMG B;  4Q7Z A;  2ZFS A;  2Y5H A;  3VB7 A;  1C9T A;  3TIU A;  2K0Q A;  1DT2 A;  1GJB B;  3BIV H;  1E34 B;  1ZGI A;  1EPT A;  4AB9 A;  1ZZZ A;  3FP8 E;  2VJ1 A;  2R3Y A;  3IG6 B;  1ZOM A;  1O2V A;  1UMA H;  2CV3 A;  4BAQ B;  2UUF B;  1W12 U;  1AFE H;  2F43 B;  3KNX A;  5FXL A;  2BXT H;  5HM9 A;  2Z9J A;  3QZR A;  2Z9K A;  2RA3 A;  4NFF A;  2A4G A;  3LGW A;  3Q3X A;  4CRE A;  4ZKN U;  2HNT E;  1L1N A;  3RXI A;  2SNV A;  3F0O A;  2XBW A;  1O3E A;  3TNS A; 
#chains in the Genus database with same CATH homology
 4ACB A;  4ACA A;  1SQR A;  4AC9 A;  2LP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...