2LP6A

Refined solution nmr structure of the 50s ribosomal protein l35ae from pyrococcus furiosus, northeast structural genomics consortium target (nesg) pfr48
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MRIKGVVLSYRRSKENQHNNVMIIKPLDVNSREEASKLIGRLVLWKSPSGKILKGKIVRVHGTKGAVRARFEKGLPGQALGDYVEIVLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L35Ae
publication title Solution NMR structure of the ribosomal protein RP-L35Ae from Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2012-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01247 Ribosomal_L35Ae Ribosomal protein L35Ae
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 2lp6A00
4ACAA 1SQRA 4ACBA 4AC9A 2LP6A
chains in the Genus database with same CATH superfamily
4VGCB 4TY6A 3UY9A 5C3NA 1KY9A 3E16B 2EC9H 2V7QD 1ETTH 1KXBA 3BF6H 3KNXA 3A86A 3M7QA 3KGPA 1K0HA 1HRTH 1M9UA 2A2XH 3V3MA 1QTFA 4MNYA 4OM9A 4GUXA 2FWWA 3NKKA 3PV4A 4Z0KA 4E7NA 3FO8D 1EPTB 2PUQH 4DJZB 1C4Y2 1E38B 2AS9A 1ELFA 4FUIA 1E0FD 2VWOA 5K0HA 3M35A 5EG4A 4XBBA 1O5BB 4NSYA 2WPDD 3KQEA 1W8BH 1MZAA 1SGDE 2FOHA 3U1IB 1TX6A 1A4WH 1SGFG 1O2OA 3EDXB 2Q6DA 1K1NA 2Y7XA 1UVUH 1C2HA 1QHRB 1TBZH 3OAAD 1EQ9A 1C5VA 1O3LA 4UFFH 2VVVA 3FP6E 4SGAE 1DITH 3ZVFA 3Q3YA 1O2RA 2Z9JA 3LJJA 1AKSA 3M7UA 1DWEH 3PWBA 4AYVB 1YY3A 4ZROA 2HRVA 1O3JA 4WH6A 2HWLB 3MO9A 1BQYA 5L30H 4Y7BA 2Y5HA 3LU9B 1TRNA 1BOQA 4NA9H 1K1PA 2C4FH 3RMMH 1OWJA 5A2MH 4TSFD 3P92A 5F8ZA 1MUEB 5EQRA 1O2NA 1FY3A 2EI7A 1O33A 3PRBA 1JRTA 3VGCC 1EP6A 3C1KA 3ZZ7A 1BB0B 2BZAA 4D7FA 2W26A 2ZC9H 3K2UA 1WXRA 1C1OA 3B23B 1V2JT 2QE7D 4XBCA 3O8RA 3RXJA 1WV7H 3P70B 5A0CA 5A8ZA 3SV2H 1EB2A 6CHAB 4WY3A 3MOCA 4DT7B 1C1QA 2L6OA 4B6FA 1IQHA 3F9FA 1E1RD 1GGDB 1OSSA 1GJ8B 5K7RA 2ILNA 1VZQH 3UQVA 1AE5A 2BDYA 3GICB 3RXRA 1UVSH 4X1NU 2ZPSA 2SGEE 1QBVH 1GCTC 2GD4B 1TOCB 1O38A 3MO6A 2VINA 3A8CA 1EZQA 4BTTB 4UD9H 2OC7A 2WUBA 3PV2A 4WF8A 1IQFA 1QB9A 4DY7B 3RLYH 3E0NB 3PROA 3CS0A 1P57B 5E8EH 3OE7D 1VKYA 1ARBA 1TRMA 1GI8B 3SUDA 3WY8A 1LQEA 1C1WH 4E7RG 5DKMA 1J8AA 3UR6A 5DPAA 4X1PU 1GJ7B 1YPGH 1SSXA 4DOQA 3RXEA 3DFJA 3RXQA 2D2DA 3SBKA 1AUJA 1AIXH 3SUEA 1OP8A 5I25A 2A5AA 1O2PA 3CNRA 2DUCA 4NZQA 2KZ4A 5E0JA 3VFEA 1TIOA 3D49H 3P8FA 1Z7KA 3EA8A 1ZRBA 2WINI 1P02A 3RXKA 3TVJB 4TPYA 4XRNA 1CGHA 1F0UA 2A4OA 1ZGVA 1SGCA 2BD3A 3K6YA 3TLOA 2K1QA 5CDFE 1N1LA 1K2I1 4AYYB 4WH8A 1CU1A 3I77A 4AORA 4J1YA 1T8MA 5ESBA 4HI3A 4IGDA 1TBQH 4XOJA 5L2ZH 2B9LA 4FETA 2AGIX 1L2EA 1V2RT 2PWXA 2XWAA 2VIPA 3F1SB 2BD8A 5EW2H 3ODFA 2A7CA 3SHAH 1FY4A 1UTJA 4B75A 3TJNA 2Q1JA 1LPGB 4WWYA 1V2TT 5FX5A 1SQRA 1GJ6A 4CH8B 3RXGA 5AF9H 5B6OA 2ANWA 1UHBB 4TPIZ 1EOJA 3V7TA 3HPTB 3D23A 3VXEH 4CRDA 4YOIA 3LJOA 5A09A 2O8MA 2ZDNA 1FJSA 1MQ5A 2ZFFH 1XXFA 2W7UA 3FVFB 2ESTE 4Y10E 5CHAC 1W7GH 1L0ZA 1FIWA 3DCLA 1G3CA 3B8JA 1HAXB 3ZV8A 5FCKA 3PMAB 3KEEA 1KIGH 4XSKU 3TK9A 1MTNB 2Z9KA 1C1RA 2ZCKP 1MKWK 1GJ5H 1CO7E 3RC4A 4Z1MD 1A2CH 2O8TA 3A7XA 1GJCB 3UOPA 1MKXH 2UUFB 2W6ID 2ZWLH 3BEUA 2ZGBH 4NSVA 4MNXA 1V2VT 1LPKB 8GCHF 1SMFE 2AYWA 3PMJA 2ZIQH 3STIA 3LGUA 1MBQA 2WPMS 4M9FA 1EAXA 1DLEA 1GBJA 1YPLH 1C5SA 2OQUA 1SVPA 1DWCH 5EODA 5PTPA 3K65B 4Y79A 1V2KT 1VCQA 4X1RU 1IQIA 3EE0B 4P02A 1HV7A 3MTYA 2W5EA 2QF5A 4FU9A 1EOLA 4Y6DA 2RA0A 4ISLA 2IN2A 4HGCA 5LGOA 1D3TB 3MH4A 4O03A 1KTTB 1IHTH 3MNXA 1C5TA 4ESTE 4RKOB 2HNTC 2EEKA 5ETXA 4YTAA 1K22H 1CBWC 1JRSA 3GYMA 4ZXYH 2ZCHP 1GVZA 1IHSH 3QTOH 1BBRE 1FAXA 4GHTA 3S9CA 2ZGHA 1HJ8A 1DUAA 5GWZA 1UTLM 5BPEA 3W95A 1H1BA 2WSSD 1G3EA 3U1JB 1GBTA 5DP5A 1PQAA 1QURH 1H8DH 5DO4H 4NCYA 3KQBA 1GMCF 1GBCA 2XW9A 2XOKD 1A0HB 1O3PB 5JPMH 3UOUA 1DWDH 3GYLB 1ABJH 1LCYA 4FUHA 3A88A 1O2YA 4ABFA 3S7HB 3LPRA 1WDIA 1ZOMA 1CVWH 3W1EA 4RKJB 5FX6A 3SYJA 3U98H 1UHBA 1KLJH 4D9QA 1Z1IA 2FPZA 1D3DB 1S84A 4AX9H 1C5UA 4CH2B 4MG3A 1P03A 2AHME 3OEHD 1WTGH 4Q63A 2OC0A 4Q7YA 1V2LT 3MMGA 1FPCH 2XBYA 2SGDE 1EZUC 3VXFH 2F83A 2HALA 9ESTA 1DM4B 1P2OA 7LPRA 1XUIA 2VIQA 1AWFH 1OP2A 2F9UA 4K8BA 1NY22 2YNAA 2ZFRH 3AW1A 4B6EA 4MLFB 1TX7A 2R2WU 1LHGH 2OXSA 1GI2A 2D26C 3MO3A 2ZHDA 2EI6A 1H8IH 1H9LB 2PFEA 2SNVA 4NIVA 3DSGA 1S0RA 2AH4X 3MU0A 3ATIA 2NU1E 3KYFA 5J4SA 1GHXH 2J38A 4GHQA 2VIWA 3LGVA 2VH0A 2QCYA 2Q6FA 1P2JA 4YLUA 1C1UH 3OEED 1YYY1 1QL8A 4OS4A 1NFWA 2BD4A 3D62A 4IC6A 2QXJA 1C1SA 3T25A 1Z8RA 3T62A 1INCA 1IQMA 2FI4E 1S82A 4FU8A 3RU4E 1C5OH 2AGGX 1E1QD 3EA7A 8GCHG 1ZHPA 1XVMA 2H2ZA 2WPIS 3SJOA 2GDEH 1CT0E 2ODYB 4DW2U 1HXEH 5JYIA 1LPZB 1C1NA 1QJ6B 1PYTD 2BQWB 2GDDA 3B9FH 1O0DH 1CHOG 2P3FH 2BLVA 4WMDA 1W0YH 1O3IA 5CHBA 5JDUB 3ZVAA 2ZDAH 1YPMH 5TCAA 3MQKC 4AFSA 1NU9A 4B2CA 1E35B 1GDQA 2GV7A 1YF4A 5E2OA 1UVTH 1GMDF 1PQ7A 2OC8A 4BTIB 5EPNA 1YPKH 3UNSA 3RXMA 1QRWA 1YGCH 2G81E 1PPCE 1UMAH 2F9PA 5FPSA 5T3HA 3QK1A 2IPQX 3KCGH 3A8DA 1C2LA 1P2MA 2BOKA 3AAUA 4KTUA 1ABIH 3RM2H 4RSPA 3UNQA 5GJ4B 4TWWA 2JETC 2LPRA 4LK4A 4A5TS 2Z6BD 1MH0A 2BY9X 2XC0A 5DP7A 3TNTA 1IQNA 2R0KA 1QJ1B 2OCVB 3ZZ6A 4X8UH 4YT7H 2WV9A 4AG1A 4YLQH 1GJ4H 1O2WA 1F0SA 1RS0A 2BD5A 3GDSA 1C9TA 3ATLA 3CS7A 1GMCG 1EZSC 3EQ0H 1LTOA 1SLWB 1IQKA 2A4GA 4X6MA 4DVAU 3MYWA 1O36A 2P3UB 4FUEA 1ANCA 4ZAEA 1ZTKA 3ATWA 4FVBA 1QGFA 8LPRA 1DSTA 1MZDA 2ODPA 4Q80A 1KLIH 4B74A 4NWKA 1VJ9U 5CMXH 2ZF0H 2Z3DA 1GI6A 3VB4A 4DG4A 1FY8E 2ULLA 1GG6C 1ELTA 2BB4A 2DE8A 3GCTF 1W2KH 2VGCB 2D8WA 1G2MA 2ZDLA 2P94A 2A1DB 5DP9A 1GBDA 1GVLA 4X1SU 1O3AA 4K1TA 4AFZA 2OD3B 5HIZA 4FU7A 3RC6A 1LKAA 3T28A 4F55A 2P8OB 3ZV9A 5EIYA 4CR9A 2F91A 5GDSH 1GHZA 2SNWA 3A87A 1GI0A 3SJIA 2UWPA 1GDNA 1DT2A 4ZKNU 2BD2A 2XCNA 2PKSB 5DK1A 3TJOA 4ABJA 5C5OA 3DSPA 4INHA 4U01A 2PTNA 2GMTB 3TJVA 2FOFA 2PV9B 1H9IE 5AFZH 4CRFA 1ZHMA 3KQ5A 5DJ7A 5GIBA 1T32A 2QN5T 1Z6JH 3M3TA 4GSOA 3OTJE 1EP5A 8KME2 5FL7D 2K8IA 2PSYA 1BRAA 1PQ5A 2H5CA 4X1QU 3NUMA 3QX5H 3SNEA 1JIRA 1HGTH 3P8NA 3RXUA 1AGJA 2SFAA 1OWEA 2FS9A 2FESH 2R3YA 3SQEE 2IPHA 2XC5A 3MU8A 1HAPH 1KSNA 2TIOA 2XYAA 2FXRA 5EJ1A 3S9AA 3A8BA 1KXEA 1C5RA 1O30A 2F3CE 4GCHG 4ZCNA 1YKTA 3I78A 1NO9H 3RXOA 1KXFA 4OS1A 1COWD 3GDVA 2VVCA 4IBLH 4BOHA 2VH6A 3T5FH 3F68H 1EPTC 1GMDG 2OC1A 1A5HA 1AUTC 4KP0A 1ELGA 3QLPH 3S69A 3HKIB 1SGQE 3QGNB 1GI9B 1TB6H 4Q7XA 2FODA 2G4TA 2RA3A 1F92A 1O2ZA 1Y3YA 1DY8A 1O3EA 2XTTB 1SHYA 4NA7A 3C27B 1AFQB 1WSSH 1UTNA 5G4BA 1BIOA 3PLKA 1Z1JA 1UTMA 2ALPA 2Y81A 2M5TA 3NPSA 2HNTE 3KHVA 1YLNA 2VIDA 3N7DA 1TABE 5FBEA 2XNDD 2ZU4A 2LP6A 1FY5A 2W7SA 5LPEA 1V2OT 2HPQH 1NT1A 2BY7X 2TGDA 4IN1A 1DXPA 2PKAA 4B73A 1AVGH 1H9HE 1C4V2 1ZMLA 1B7XB 3NXPA 4CRBA 1G30B 3SU1A 2OK5A 1FI8A 4ZH8A 5C67A 1P01A 1O32A 2ZU2A 1SFIA 1VCPA 1FPHH 1T8LA 3A7VA 2GCTC 1S0QA 1TNIA 2QC2A 1Y3VA 2WV5A 3DSOA 4M7GA 1VITH 1O2UA 1L1JA 4U2WA 2TPIZ 1ZPZA 3A81A 5C0TA 4Y11E 4IMZA 2KFWA 5SGAE 3PLPA 1TE0A 1ANDA 1X7AC 1YCPK 4YT6H 2V3OH 1L1NA 2CJIA 2A31A 7GCHF 4ZHLU 4I8HA 4I31A 1O2KA 1CGJE 2QF0A 5JBCS 1V2ST 4WVPE 2Z94A 3GY5A 1UK4A 5DP8A 2UUJB 3TK5A 1HCGA 5J4QA 3UWJH 2CF8H 5LPRA 4Y8ZA 3FP7E 4GAWA 4JZFH 1ACBE 4ACBA 2FZZA 1JOUB 1SGTA 1OS8A 2GKVE 2PTCE 3BG4B 4TY7A 2VIVA 1TAWA 2EI8A 3PMHB 1BTHH 4ZHMU 3RXIA 2H6MA 3AK5A 3LC3A 2QA9E 3P6ZB 4I8KA 2AIQA 2GT8A 3BEFB 2IOTA 5BRRE 1S83A 1RFNA 3WWBA 2PGBB 2FX4A 3RXCA 3SJ9A 1GJDB 4U32A 1A0JA 2WHXA 1FV9A 3SGBE 3PWCA 4YOGA 1YPEH 2FOEA 3LGIA 4K69A 5AHGH 2H9TH 3M37A 2ZA5A 5F53A 2GTBA 1PYTC 1U6QA 2ZGXH 1TGTA 1F5KU 1HUTH 1P9SA 1LVYA 1WQSA 1TA2A 1P12E 3U8RH 3UWIA 2A45B 3GY2A 3NWUA 5F03A 3FZDA 3BTKE 1SOTA 2ZHEH 2ZG0H 1XM1A 2BY5X 4AN7A 1LHCH 3VB5A 1W7XH 2WPLS 3L33A 2WPJS 1GBKA 3FANA 2G51A 4JMYA 1MABB 1O3CA 2O9QA 1HDTH 2ZGCA 1QCPA 2W6JD 1TRYA 4IC5A 4D76A 4AG2A 3EAJA 1LHDH 4XD7D 4LZ1H 1EAUA 1GPZA 2ZPRA 3F6UH 1NC6A 4NIWA 3ZZ8A 1C5MD 3U28C 3OSYA 2O8WA 4BAQB 1IAUA 1DX5M 2OUAA 1ZSLA 1NTPA 3ZZBA 1H8ED 1GBHA 5GCHF 4FUDA 2ZDVH 2NWNA 1T8NA 1YWUA 1BHXB 3T29A 1ESBA 4XE4A 1A1RA 5C1UA 1AI8H 1CHGA 3T27A 1K1JA 1MTNC 2JDID 3HK6B 2F9BH 5EPYA 2XBWA 3FN8A 3R3GB 1MKXK 3E3TA 3UTUH 1G3BA 1VGCB 5JBAS 4I33A 3SORA 1FQ3A 2NU0E 5A0BA 3EYDA 1C5NH 1V2WT 1FONA 1W3CA 2AGEX 1OHHD 2FM2A 2G55A 2ANKH 2FS8A 1DSUA 1HNEE 4WMEA 2NU4E 1GMHF 4K8YA 1O31A 2OLGA 1S6FA 2GGVB 1Y3UA 2PP6A 3RXTA 1D3PB 2SGAA 3IWMA 3SV7A 1ELEE 3RLWH 1HAGE 1RTKA 3T2NA 1C1TA 1Z71A 1WUNH 3VB6A 1F0TA 4K1SA 1C2EA 2P16A 3JZ1B 3MH7A 3O8DA 2Z9GA 1FDPA 1LDTT 1W12U 1ANBA 5GPIB 4Y7AA 3H7OA 5EOKA 4QT8C 4ACAA 1K21H 1TMTH 5HMAA 1PPZA 4MPVA 1ELAA 1WU1A 4ZXXH 3ZYEA 1RTFB 6LPRA 1GBEA 3BG8A 1G36A 2ZGJA 2ZHWH 1J14A 2F9NA 2O8UA 1BDAA 4WJG2 1TNGA 1C1MA 1BZXE 2V3MA 1O2VA 2Z9IA 1DY9A 2BOHB 3ZIAD 3AW0A 2GJGA 2HLCA 3GY6A 2J34A 5CE1A 4X2VA 4KTSA 3N99A 1J9CH 4MPWA 1OWKA 1J17T 4SGBE 3ZVBA 2GP9B 4AB9A 1TNJA 1MAXA 1EXFA 1PQ8A 4JYTA 3QDZB 1XKAC 2QAAA 4HG6A 2TGAA 3RP2A 1BMNH 1F0RA 1OKXA 1UTOA 3LOXA 1P04A 1QZ8A 2H9HA 1O39A 1P2NA 3CENA 2XC4A 3M61U 5EXNA 2VWNA 5C20A 3FZZA 1O3OA 3MI4A 4H6TA 3SGQE 1MAYA 3AVZA 4CR5A 3HATH 1NROH 3VB7A 2ZQ1A 2VJ1A 3LGYA 1HB0B 2C8ZB 2CF9H 2LELA 3P95A 1AB9B 3F9GA 2R0LA 3ZZAA 1P05A 5ABWA 2G8TA 2BHGA 2JJ1D 2Y5FA 3G01A 3ZZ4A 1O2HA 3GY7A 1BTXA 1UCYH 2FYQA 2C8XB 5FPTA 4BTUB 1YPJH 3E91A 3FKSD 1V2QT 1AE8H 1Y5UT 2OP9A 3UAIC 4JYUH 1CA8B 1QQUA 2A2QH 1P3EA 2ZTYA 1DFPA 1VITF 1ELDE 2B5TB 2V6NA 3M3VA 4IN2A 3NRLA 2BXUH 3KL6A 2I6QA 3SI4H 3Q77A 4D7GA 4ABBA 2BX3A 4I86A 3U8TH 2A4RA 1EAIA 2ZFQH 2THFB 3DA9B 2FTLE 1F5LA 4TYDA 7KMEH 2BLQA 4CRAA 2PLXA 5JBBS 5EGMA 1GMHG 3Q3XA 3R0FA 2BZ6H 2FP7B 2YOLA 3RXLA 2CHAB 1B5GH 1T4UH 2J92A 5HM2A 2I6SA 4ISIH 2BDIA 3A7YA 2XBVA 2OINA 4K5ZA 1EKBB 5B6LA 3L3TA 1A7SA 3LT3A 1QY6A 2Y82A 2QYIA 1KXAA 1BHXF 1HJAB 2ZFTA 3DFLA 1THSH 1YM0A 4AGKA 1P11E 3RXSA 1V2MT 2G5VA 2JH5D 4YO9A 4ABIA 1W0KD 3WW7A 4I8GA 1XVOA 3TH3H 1HXFH 1NPMA 4OS6A 3RC5A 1GHAF 3OTPA 1WBGB 4RN6A 3H7TA 1SQTA 3BTTE 1DE7H 3SV9A 1AN1E 4NG9H 1YC0A 2TRMA 1CGIE 2D1JA 3MU5A 3TGJE 1GI7B 1L4ZA 2ZECA 4NZLA 1V3XA 1QB1A 1Y59T 2GVFA 2A5KA 2F9OA 1GJBB 4A1VA 3EGKH 1GI1A 1EJAA 1KXCA 2QXIA 3ESTA 1IQGA 1Z8JB 2FMJA 1G3DA 1ZR0A 4MPXA 3FP8E 3TU7H 4INKA 4Y0YE 2UUYA 5T6DA 2ZTXA 2G00A 2O8LA 3EA9A 1NS3A 1THPB 4ISHH 1C2JA 1P2KA 3RDZA 4ABEA 5DP3A 5F8XA 3F3BA 1MQ6A 2OTVA 3DD2H 1CT2E 1MTVA 4X6PA 2ASUB 3FAOA 2VGCC 1ZTLA 3BTGE 4CHAB 1SGEE 3A84A 3QUMP 5DN6D 2FEQH 3ZZCA 4CBNA 4BAKB 4MQAA 5EW1H 1AU8A 1EAWA 1BT7A 1FX0B 1TOMH 1EX3A 3QWCH 1O3FA 5C1XA 4LZ4B 3MWIU 3IG6B 2AIPA 1A0LA 1QNJA 2BQ6B 1ETRH 3Q76A 5A8XA 1IOEA 1EZXC 3BTEE 2PKSC 4FUFA 1SGPE 1ZMNA 4D9RA 1CA0B 4CRCA 2GMTC 2KCOA 3SUFA 4I32A 3V12A 2ODQA 4IMQA 4LXBH 5C94A 1AMHA 1C1VH 3PO1B 4YM9A 3IITA 4JK5A 2L74A 4CREA 1TBRH 5IK2D 2UWOA 3U69H 3E0PB 4ASUD 1O3NA 5JB8S 2QIQA 2BQ7B 7ESTE 1KDQA 4JCNA 2Z7FE 4ABDA 1Y3XA 4YESB 1KMHB 2STAE 4Z6AH 2HLDD 1UVPA 1T7CA 2FYRA 1D9IA 3BTQE 5FHTA 1RIWC 1OYTH 1O2JA 3SHCH 5I46H 2FI5E 2HVYB 3KYGA 2V3HH 1SGFA 3ELAH 4K1EA 1UTQA 2PKAB 4E06H 2TBSA 1SR5C 4A1TA 4CRGA 1D4PB 3HGPA 2ZTZA 4OGYA 1C5ZB 5F8TA 1TPSA 2ALVA 2EA3A 3BTFE 1O35A 1UO6A 2ZCLP 3RMLH 4GPGA 5FCRA 1O2MA 1MTWA 1AFQC 1HAIH 3TGIE 1FZZA 1QRZA 2A32A 2JIZD 1HAOH 1YPHC 4UEHH 1BJVA 4ZHAA 1K28D 4X6NA 4NA8A 1HYLA 1ZHRA 5EJLA 5LPFA 1XUFA 1AO5A 2YMSB 3U8OH 2ZDMA 1QL7A 4JZIA 3NK8A 3SO3A 4HZHA 3FFGA 1JIMA 1OXGA 2CMYA 2C3SA 3SNBA 2BDHA 1T31A 1EFRD 2XRCA 2P95A 5C5NA 1TALA 4BXSA 1Z8GA 3ATMA 4ZKSU 4VGCC 1TPPA 2ZHFH 1ESTA 4MDSA 4MPUA 2Y7ZA 1B0EA 1E36B 2JETB 3F2FA 3Q00A 1LO6A 3E6PH 2J2UA 3F0PA 3PTNA 4KGAA 1UJ1A 4WXVA 4DIIH 1RGQA 1XX9A 1C2KA 1F5RA 4UFEH 1Z8IB 1HJ9A 1SC8U 1TNHA 1MBMA 1JBUH 2FOCA 1NFXA 1O34A 2G52A 3E8LA 3ZVGA 2BDAA 3ZZDA 5F6MA 2ZO3H 1S85A 5EXLA 1RXPA 2H5DA 1AQ7A 5C0UA 5L6NH 2WPHS 3TGKE 2QV1A 3OYPA 3GS9A 4K2YA 4X2XA 2AMPA 1T4VH 4JZEH 1MU8B 1N6YA 2JJ2D 1WTHD 1ZPBA 1P10A 4UFDH 4INLA 4IW4E 1PPEE 4A6LA 1QBOA 2XCFA 2PHBA 1BRCE 3NCLA 1K1OA 3PRDA 2DE9A 1N8OB 1ID5H 1BBRH 1Q3XA 1SL3A 1IQJA 1HAVB 2GCHF 1BCUH 1WQVH 1C2MA 5HM9A 2HGTH 1CQQA 1O37A 3LGWA 1B0FA 5HXFA 3EE7A 3ENSB 1O3BA 4BAHB 3SU5A 2ZU1A 1AVWA 3LH3A 3SU4A 2ZFSA 1Y8TA 1A3EH 1PPFE 5H4IB 4XBDA 2BLWA 2KAIB 1BA8B 1TNLA 1C5XB 2BY8X 4AFUA 1SLXB 1DWBH 2JH6D 1G2LA 3GISB 1BUIA 1C2IA 3GCTG 2C93B 4HFPB 2BTCE 3ZVCA 1DVAH 4A92A 1O2QA 3M36A 4NFEA 2XWBI 4I8JA 1DXWA 6CHAC 3SZEA 1Q2WA 4MNWA 1NFYA 2FOGA 3A85A 1GGDC 5JBTA 1J15A 2OBQA 3BEIB 2C8YB 1DICA 9LPRA 2BX4A 3PV5A 1TWXB 2VBCA 2SGFE 1ZGIA 1T8OA 1O2XA 3V13A 2QXGA 1K1LA 2FOBA 1A5GH 4B71A 3KF2A 4D8NA 3QO6A 1XXDA 2QGRA 1V2NT 4AFQA 2KCYA 1DS2E 2C90B 1KTSB 3TPIZ 2J95A 3GDUA 4JK6A 1HLTH 1ZJDA 1EASA 2VU8E 2PGQB 3OFND 2HPPH 1RTLA 1LKBA 1SGYE 2J98B 3BTWE 3PM3A 3F9HA 2Y80A 1SKYE 1GBIA 1W11U 3HK3B 5EU8A 5FAHA 2QF4A 1OX1A 4Y8YA 2IJD1 5GXPA 1DLKB 4LOYH 3STJA 1BRBE 1SB1H 1GL0E 5LH8A 1VGCC 1GL1A 3UPEA 4NGAH 1HPGA 3GCHB 2R3UA 1LMWB 1FY1A 4FUBA 4FXGH 4IS5A 4PROA 2XXLA 4X2WA 1ORFA 5FPYA 2B8OH 3A7ZA 2V0BA 5KGOA 3A7TA 1HIAB 3H5CB 1NZQH 4GVUA 3FOAA 1P9UA 2ZKSA 1SQAA 3RUOA 1S6LA 1PFXC 2AMQA 3Q3KA 3QN7A 1HAVA 2GCTB 4A1XA 4Q4LA 4X0WU 1ZLRA 2QY0B 5HKKD 1YLCA 1SGRE 1HAYB 1K9OE 1KXDA 1ETSH 1EUFA 2J4IA 2K0QA 2GT7A 1TQ0B 1NBMD 1NBME 2KAIA 1HFDA 5HGGA 3SUGA 2F9VA 2GCHG 5TCCA 3LH1A 3W94A 3RU4T 1XUJA 1OWIA 1YCPH 1PPBH 1S5SA 1C9PA 1AZ8A 1JWTA 1YLDA 1BITA 1G32B 2C8WB 4B2AA 1V6DA 5E2PA 2KX4A 1O5EH 2YMSD 3MU1A 1C5WB 1O2IA 1SGNE 1SPJA 3LGTA 5ESTE 3SGAE 1C2FA 2OBOA 1NRPH 1O3GA 3ZZ3A 2Y6TA 2BXTH 4P00A 2Q6GA 3N7OA 1XUGA 1V2UT 2CN0H 1GJ9B 1W0ZU 5C1YA 3MHWU 3TH4H 2W3IA 4Y8XA 2V35A 1G9IE 4RT0A 1EB1H 3LIWA 1ELBA 5DP4A 1FIZA 5E0GA 4XFQA 3SNCA 2FI3E 2VIOA 2KCAA 1O3HA 1QL9A 2Y5GA 4B76A 1EPTA 2FX6A 1FNIA 2IJOB 7GCHG 3RM0H 4RT1A 3AASA 4AB8A 1ZJKA 2P59A 2GZ9A 1C5LH 1SI5H 1TPAE 1QJ7B 1RJXB 2BYAX 4E05H 2J98A 1BTUA 1AB9C 6GCHF 4DT4A 4ZKOU 2G5NA 3GCOA 2ZZUH 2JKHA 2XNIA 2YNBA 1QA0A 1UTPA 1UCYK 3GY8A 4UE7H 1AFEH 3VGCB 1XMNB 1P09A 3UB0A 2BLOA 1O3MA 4I7YH 3LDXH 3RMNH 1Q31A 1YPHE 2BD9A 1ZPCA 3A7WA 5KEDA 2R2MB 3TIUA 2BMGB 2ZNKH 1ANEA 2STBE 1BMFD 3UQOA 3I29A 2P93A 1SQOA 1P06A 1LHFH 1E34B 1OWHA 1HIAA 1V2PT 3M7TA 1W13U 2A0QB 1ELVA 1PJPA 2A7JA 4Y71A 3UR9A 3BTME 3RXVA 3M5MA 3DT0H 1NM6A 4Q2KA 1CT4E 2BVXH 1GCTB 1P3CA 5EQSA 3M5OA 4KTCA 1O2GH 1O3KA 5IDKA 1QR3E 4HTCH 2PW8H 3PTBA 4BAOB 4I8LA 2BM2A 1GBLA 2J94A 1LVOA 2CHAC 1P2IA 4KELA 1QBNA 1H4WA 5FBIA 1GJAB 1QQ4A 1MMJN 2BY6X 3E1XB 3NZIA 1P2QA 3ITIA 4ISNA 2A7HA 1CSOE 4O3UA 4UDWH 3F2GA 3T26A 1L1GA 1HJAC 4X8SH 4U30A 3RXPA 3D65E 3RXDA 4AZ2B 1A3BH 4THNH 2TGPZ 4WXIA 3H09A 5AVDA 2VNTA 1F7ZA 1K1MA 2Z9LA 2EY4C 1BRUP 4ASHA 2P3TB 3ZVEA 3M3SA 1FMGA 1JMOH 4H4FA 2CK3D 1QFKH 2ZHQH 2WPKS 3MU4A 4X2YA 3SOSA 2LNCA 1ZTJA 1W14U 3TNSA 5DP6A 2F43B 3M5LA 3SQHE 2QF3A 1D6RA 1GCDA 4K3JA 4OGXA 5A0AE 1L4DA 1CHOF 2KR7A 1TNKA 3O8CA 1TMBH 1GVKB 5GCHG 2GV6A 1E79D 3RMOH 3SNAA 2WYGA 3QTVH 4R8TB 2QXHA 1Z6EA 4O9VA 4Y76A 4DCDA 3PMBB 4CBOA 2FOAA 3SU3A 1WYKA 1GHVH 1QRXA 4MNVA 1VR1H 2CXVA 1C1PA 4FOUC 1LVBA 1VCWA 3SJ8A 4Y0ZE 2H1UA 1TGSZ 4OS5A 1MD8A 1YCPM 1GBBA 1FLEE 2VVUA 3LKWA 1MD7A 4BNRA 1GHYH 3P8GA 5DG6A 3SU0A 4ZMAH 3UREA 1XKBC 1UK3A 1C5QA 3F9EA 5GNDA 1RRKA 4NWLA 3A82A 3OY6U 5E0HA 3A8AA 1LHEH 2PSXA 1NU7B 1MCTA 3VG8A 5CHAB 5JB9S 1NESE 4CHAC 2Z3CA 4BAMB 3SW2B 1HBTH 1OYQA 1E37B 1KDQB 2ZP0H 4OS7A 1N6XA 4TWYA 3SV8A 4GLYA 3UIRA 6GCHG 1BTYA 1C5YB 1MKWH 1MTUA 3SI3H 3SZNA 3KIDU 4AGJA 1Y5AT 3BTDE 2JH0D 2AMDA 4O3TA 1GI3A 5T1VA 3SN8A 3RXHA 2RCEA 4K60A 1CA0C 1GWAA 4XDEA 3UFAA 2NU3E 1KYNA 1ELCA 3BSQA 1OPHB 2ZEBA 1OP0A 3MNBA 4AC9A 1ZMJA 3PO1C 1ESAA 1GBFA 2J97A 1ZZZA 2UWLA 4ISOA 4Q7ZA 3GY3A 1LVMA 4H6SB 1BTWA 2WYJA 1SFQB 3QZRA 5A8YA 1MTSA 2TGTA 5EXMA 3VB3A 4FUCA 1XUHA 3S0NA 3UNRA 2SGQE 2J9NA 2KM0A 1CE5A 4DIHH 3OX7U 1OWDA 1GDUA 4YZUA 3OY5U 1CBWB 1D3QB 2KCPA 4JZ1A 4YOJA 4TT3D 2VWLA 3TJUA 4JYVH 3BTHE 1UVOA 1UTKA 3E90B 3QGJA 3A83A 4A7IB 1EJMA 3LONA 3P17H 3PB1E 1WAYB 2H9EH 2W3KA 1A61H 1VJAU 4DGJA 3A89A 2GZ8A 1WOFA 1FN8A 1OOKB 1F2SE 2BVSH 5C2ZA 5L2YH 1AZZA 3RU4D 4X8VH 5IYTA 1TA6A 3OU0A 2BVRH 3AAVA 1TGNA 2HVXA 1C2DA 1GHWH 1S81A 2P8OC 1AD8H 1O5FH 2Z3EA 2ZU5A 5AFYH 4GCHF 3F2HA 1FN6A 2VB0A 3PLBA 3BIVH 5KECA 3TK6A 1O5AB 2BDGA 3RXAA 1PPHE 1DUEA 2YMSC 4X6OA 1VITG 5HYOA 1MU6B 3MNCA 1FXYA 3GOVB 2ZI2H 1WCZA 1DOJA 1W0JD 2G4UA 4RI0A 1BMMH 1W10U 3CP7A 2A4QA 4AOQA 1AWHB 1PPGE 5HIYA 3O8BA 2RFKC 1H8HD 3L6PA 3HGNA 4R0IA 5C17A 4X8TH 1SHHB 1AY6H 1O5GH 1IQLA 3K6ZA 2FLBH 5DSFA 3KQCA 4FUGA 1O5DH 2FTMA 1TYNA 2EQNA 4WMFA 4B2BA 5T6GA 4H42U 3TH2H 1FAKH 3BN9A 4J2YB 1ZSJA 2NU2E 2B0FA 2PUXB 2AERH 2WUCA 4DURA 4O97A 1LQDB 3MH6A 1THRH 1GHBF 1D6WA 1DDJA 1SOZA 1NRSH 4ZUHA 3S7KB 3VEQB 2BD7A 3URCA 2PR3A 2UUKB 1BMLA 3WWFA 1JXPA 4FVDA 1YBWA 2ZPQA 3K9XB 1NRNH 1MCVA 1C4U2 1GHAG 1SLVB 1S6HA 3P8OA 2XBXA 3KQDA 2WV4A 4F4OC 3UUZA 3DUXH 3SJKA 3DHKH 2ZFPH 4F48B 3ATKA 1BBRK 4NIYA 1N8OC 1QIXB 1UK2A 1TGCA 1O5CB 1SBWA 2HOBA 1NN6A 3LC5A 1BJUA 3SU2A 1DPOA 3MFJA 1ZSKA 1P0SH 2SGPE 1K1IA 1AVXA 1KLTA 3JZ2B 2CGAA 1GI4A 3RXFA 1FUJA 2WZQA 1ZYOA 2FO9A 2GX4A 1GBAA 4MVNA 1A5IA 3SV6A 2M2AA 1ARCA 3M5NA 2F4LA 3MH5A 1BTZA 2CV3A 3KN2A 3F0OA 1YP9A 2FDAA 4ABAA 1TFXA 4ZKRU 1NFUA 1GI5A 1XUKA 3SNDA 5T6FA 3ZZ9A 3V0XA 4KKDA 3ZVDA 3RXBA 3HKJB 2AFQB 2RDEA 1O2LA 4YXWD 2B7DH 1UW7A 2FIRH 1TQ7B 1O2TA 2HNTF 4UFGH 3ZZ5A 1RIWB 5TJXA 1P8VC 1SG8B 3GY4A 1BMAA 3BIUH 3TITA 3URDA 4BANB 3GCNA 1SGIB 4FUJA 3ODDA 5EQQA 3SU6A 4OS2A 5FXLA 3N7EA 2RDLA 4NFFA 1HAHH 1TMUH 1TPOA 1AKSB 1GG6B 1O2SA 2A5IA 3BG4C 1RD3B 2FLRH 2ZDKA 3MNSA 1ZRKA 1TONA 6ESTA 3QZQA 4F49A 1QA7A 5DGJA 1BTPA 3ZYDA 1DANH 1NRRH 1J16A 2VWMA 2R9PA 3PYHA 1G37A 1A46H 3U9AH 4B1TA 2ANMH 1IQEA 1TX8A 2ZU3A 3BV9B 1SLUB 4MTBA 4NIXA 1EJNA 1UCYE 1GBMA 2RG3A 4UONA 1C5PA 3GCHC 1HAZB 4JZDH 1Y3WA 1Y5BT 2ZQ2A 4BXWA 3VPKA 3A80A 2ANYA 4ABHA 2BDBA 1QB6A 1C2GA 1EATA 1TLDA 1AHTH 2GZ7A 2FOMB 3S9BA 4ABGA 1GHBG 1O3DA 2OQ5A 2AEIH 1TGBA 8ESTE 1NRQH 2J5UA 2BDCA 5EJZA
chains in the Genus database with same CATH topology
4ACAA 1SQRA 4ACBA 4AC9A 2LP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ACA A;  1SQR A;  4ACB A;  4AC9 A;  2LP6 A; 
#chains in the Genus database with same CATH topology
 4VGC B;  4TY6 A;  3UY9 A;  5C3N A;  1KY9 A;  3E16 B;  2EC9 H;  2V7Q D;  1ETT H;  1KXB A;  3BF6 H;  3KNX A;  3A86 A;  3M7Q A;  3KGP A;  1K0H A;  1HRT H;  1M9U A;  2A2X H;  3V3M A;  1QTF A;  4MNY A;  4OM9 A;  4GUX A;  2FWW A;  3NKK A;  3PV4 A;  4Z0K A;  4E7N A;  3FO8 D;  1EPT B;  2PUQ H;  4DJZ B;  1C4Y 2;  1E38 B;  2AS9 A;  1ELF A;  4FUI A;  1E0F D;  2VWO A;  5K0H A;  3M35 A;  5EG4 A;  4XBB A;  1O5B B;  4NSY A;  2WPD D;  3KQE A;  1W8B H;  1MZA A;  1SGD E;  2FOH A;  3U1I B;  1TX6 A;  1A4W H;  1SGF G;  1O2O A;  3EDX B;  2Q6D A;  1K1N A;  2Y7X A;  1UVU H;  1C2H A;  1QHR B;  1TBZ H;  3OAA D;  1EQ9 A;  1C5V A;  1O3L A;  4UFF H;  2VVV A;  3FP6 E;  4SGA E;  1DIT H;  3ZVF A;  3Q3Y A;  1O2R A;  2Z9J A;  3LJJ A;  1AKS A;  3M7U A;  1DWE H;  3PWB A;  4AYV B;  1YY3 A;  4ZRO A;  2HRV A;  1O3J A;  4WH6 A;  2HWL B;  3MO9 A;  1BQY A;  5L30 H;  4Y7B A;  2Y5H A;  3LU9 B;  1TRN A;  1BOQ A;  4NA9 H;  1K1P A;  2C4F H;  3RMM H;  1OWJ A;  5A2M H;  4TSF D;  3P92 A;  5F8Z A;  1MUE B;  5EQR A;  1O2N A;  1FY3 A;  2EI7 A;  1O33 A;  3PRB A;  1JRT A;  3VGC C;  1EP6 A;  3C1K A;  3ZZ7 A;  1BB0 B;  2BZA A;  4D7F A;  2W26 A;  2ZC9 H;  3K2U A;  1WXR A;  1C1O A;  3B23 B;  1V2J T;  2QE7 D;  4XBC A;  3O8R A;  3RXJ A;  1WV7 H;  3P70 B;  5A0C A;  5A8Z A;  3SV2 H;  1EB2 A;  6CHA B;  4WY3 A;  3MOC A;  4DT7 B;  1C1Q A;  2L6O A;  4B6F A;  1IQH A;  3F9F A;  1E1R D;  1GGD B;  1OSS A;  1GJ8 B;  5K7R A;  2ILN A;  1VZQ H;  3UQV A;  1AE5 A;  2BDY A;  3GIC B;  3RXR A;  1UVS H;  4X1N U;  2ZPS A;  2SGE E;  1QBV H;  1GCT C;  2GD4 B;  1TOC B;  1O38 A;  3MO6 A;  2VIN A;  3A8C A;  1EZQ A;  4BTT B;  4UD9 H;  2OC7 A;  2WUB A;  3PV2 A;  4WF8 A;  1IQF A;  1QB9 A;  4DY7 B;  3RLY H;  3E0N B;  3PRO A;  3CS0 A;  1P57 B;  5E8E H;  3OE7 D;  1VKY A;  1ARB A;  1TRM A;  1GI8 B;  3SUD A;  3WY8 A;  1LQE A;  1C1W H;  4E7R G;  5DKM A;  1J8A A;  3UR6 A;  5DPA A;  4X1P U;  1GJ7 B;  1YPG H;  1SSX A;  4DOQ A;  3RXE A;  3DFJ A;  3RXQ A;  2D2D A;  3SBK A;  1AUJ A;  1AIX H;  3SUE A;  1OP8 A;  5I25 A;  2A5A A;  1O2P A;  3CNR A;  2DUC A;  4NZQ A;  2KZ4 A;  5E0J A;  3VFE A;  1TIO A;  3D49 H;  3P8F A;  1Z7K A;  3EA8 A;  1ZRB A;  2WIN I;  1P02 A;  3RXK A;  3TVJ B;  4TPY A;  4XRN A;  1CGH A;  1F0U A;  2A4O A;  1ZGV A;  1SGC A;  2BD3 A;  3K6Y A;  3TLO A;  2K1Q A;  5CDF E;  1N1L A;  1K2I 1;  4AYY B;  4WH8 A;  1CU1 A;  3I77 A;  4AOR A;  4J1Y A;  1T8M A;  5ESB A;  4HI3 A;  4IGD A;  1TBQ H;  4XOJ A;  5L2Z H;  2B9L A;  4FET A;  2AGI X;  1L2E A;  1V2R T;  2PWX A;  2XWA A;  2VIP A;  3F1S B;  2BD8 A;  5EW2 H;  3ODF A;  2A7C A;  3SHA H;  1FY4 A;  1UTJ A;  4B75 A;  3TJN A;  2Q1J A;  1LPG B;  4WWY A;  1V2T T;  5FX5 A;  1SQR A;  1GJ6 A;  4CH8 B;  3RXG A;  5AF9 H;  5B6O A;  2ANW A;  1UHB B;  4TPI Z;  1EOJ A;  3V7T A;  3HPT B;  3D23 A;  3VXE H;  4CRD A;  4YOI A;  3LJO A;  5A09 A;  2O8M A;  2ZDN A;  1FJS A;  1MQ5 A;  2ZFF H;  1XXF A;  2W7U A;  3FVF B;  2EST E;  4Y10 E;  5CHA C;  1W7G H;  1L0Z A;  1FIW A;  3DCL A;  1G3C A;  3B8J A;  1HAX B;  3ZV8 A;  5FCK A;  3PMA B;  3KEE A;  1KIG H;  4XSK U;  3TK9 A;  1MTN B;  2Z9K A;  1C1R A;  2ZCK P;  1MKW K;  1GJ5 H;  1CO7 E;  3RC4 A;  4Z1M D;  1A2C H;  2O8T A;  3A7X A;  1GJC B;  3UOP A;  1MKX H;  2UUF B;  2W6I D;  2ZWL H;  3BEU A;  2ZGB H;  4NSV A;  4MNX A;  1V2V T;  1LPK B;  8GCH F;  1SMF E;  2AYW A;  3PMJ A;  2ZIQ H;  3STI A;  3LGU A;  1MBQ A;  2WPM S;  4M9F A;  1EAX A;  1DLE A;  1GBJ A;  1YPL H;  1C5S A;  2OQU A;  1SVP A;  1DWC H;  5EOD A;  5PTP A;  3K65 B;  4Y79 A;  1V2K T;  1VCQ A;  4X1R U;  1IQI A;  3EE0 B;  4P02 A;  1HV7 A;  3MTY A;  2W5E A;  2QF5 A;  4FU9 A;  1EOL A;  4Y6D A;  2RA0 A;  4ISL A;  2IN2 A;  4HGC A;  5LGO A;  1D3T B;  3MH4 A;  4O03 A;  1KTT B;  1IHT H;  3MNX A;  1C5T A;  4EST E;  4RKO B;  2HNT C;  2EEK A;  5ETX A;  4YTA A;  1K22 H;  1CBW C;  1JRS A;  3GYM A;  4ZXY H;  2ZCH P;  1GVZ A;  1IHS H;  3QTO H;  1BBR E;  1FAX A;  4GHT A;  3S9C A;  2ZGH A;  1HJ8 A;  1DUA A;  5GWZ A;  1UTL M;  5BPE A;  3W95 A;  1H1B A;  2WSS D;  1G3E A;  3U1J B;  1GBT A;  5DP5 A;  1PQA A;  1QUR H;  1H8D H;  5DO4 H;  4NCY A;  3KQB A;  1GMC F;  1GBC A;  2XW9 A;  2XOK D;  1A0H B;  1O3P B;  5JPM H;  3UOU A;  1DWD H;  3GYL B;  1ABJ H;  1LCY A;  4FUH A;  3A88 A;  1O2Y A;  4ABF A;  3S7H B;  3LPR A;  1WDI A;  1ZOM A;  1CVW H;  3W1E A;  4RKJ B;  5FX6 A;  3SYJ A;  3U98 H;  1UHB A;  1KLJ H;  4D9Q A;  1Z1I A;  2FPZ A;  1D3D B;  1S84 A;  4AX9 H;  1C5U A;  4CH2 B;  4MG3 A;  1P03 A;  2AHM E;  3OEH D;  1WTG H;  4Q63 A;  2OC0 A;  4Q7Y A;  1V2L T;  3MMG A;  1FPC H;  2XBY A;  2SGD E;  1EZU C;  3VXF H;  2F83 A;  2HAL A;  9EST A;  1DM4 B;  1P2O A;  7LPR A;  1XUI A;  2VIQ A;  1AWF H;  1OP2 A;  2F9U A;  4K8B A;  1NY2 2;  2YNA A;  2ZFR H;  3AW1 A;  4B6E A;  4MLF B;  1TX7 A;  2R2W U;  1LHG H;  2OXS A;  1GI2 A;  2D26 C;  3MO3 A;  2ZHD A;  2EI6 A;  1H8I H;  1H9L B;  2PFE A;  2SNV A;  4NIV A;  3DSG A;  1S0R A;  2AH4 X;  3MU0 A;  3ATI A;  2NU1 E;  3KYF A;  5J4S A;  1GHX H;  2J38 A;  4GHQ A;  2VIW A;  3LGV A;  2VH0 A;  2QCY A;  2Q6F A;  1P2J A;  4YLU A;  1C1U H;  3OEE D;  1YYY 1;  1QL8 A;  4OS4 A;  1NFW A;  2BD4 A;  3D62 A;  4IC6 A;  2QXJ A;  1C1S A;  3T25 A;  1Z8R A;  3T62 A;  1INC A;  1IQM A;  2FI4 E;  1S82 A;  4FU8 A;  3RU4 E;  1C5O H;  2AGG X;  1E1Q D;  3EA7 A;  8GCH G;  1ZHP A;  1XVM A;  2H2Z A;  2WPI S;  3SJO A;  2GDE H;  1CT0 E;  2ODY B;  4DW2 U;  1HXE H;  5JYI A;  1LPZ B;  1C1N A;  1QJ6 B;  1PYT D;  2BQW B;  2GDD A;  3B9F H;  1O0D H;  1CHO G;  2P3F H;  2BLV A;  4WMD A;  1W0Y H;  1O3I A;  5CHB A;  5JDU B;  3ZVA A;  2ZDA H;  1YPM H;  5TCA A;  3MQK C;  4AFS A;  1NU9 A;  4B2C A;  1E35 B;  1GDQ A;  2GV7 A;  1YF4 A;  5E2O A;  1UVT H;  1GMD F;  1PQ7 A;  2OC8 A;  4BTI B;  5EPN A;  1YPK H;  3UNS A;  3RXM A;  1QRW A;  1YGC H;  2G81 E;  1PPC E;  1UMA H;  2F9P A;  5FPS A;  5T3H A;  3QK1 A;  2IPQ X;  3KCG H;  3A8D A;  1C2L A;  1P2M A;  2BOK A;  3AAU A;  4KTU A;  1ABI H;  3RM2 H;  4RSP A;  3UNQ A;  5GJ4 B;  4TWW A;  2JET C;  2LPR A;  4LK4 A;  4A5T S;  2Z6B D;  1MH0 A;  2BY9 X;  2XC0 A;  5DP7 A;  3TNT A;  1IQN A;  2R0K A;  1QJ1 B;  2OCV B;  3ZZ6 A;  4X8U H;  4YT7 H;  2WV9 A;  4AG1 A;  4YLQ H;  1GJ4 H;  1O2W A;  1F0S A;  1RS0 A;  2BD5 A;  3GDS A;  1C9T A;  3ATL A;  3CS7 A;  1GMC G;  1EZS C;  3EQ0 H;  1LTO A;  1SLW B;  1IQK A;  2A4G A;  4X6M A;  4DVA U;  3MYW A;  1O36 A;  2P3U B;  4FUE A;  1ANC A;  4ZAE A;  1ZTK A;  3ATW A;  4FVB A;  1QGF A;  8LPR A;  1DST A;  1MZD A;  2ODP A;  4Q80 A;  1KLI H;  4B74 A;  4NWK A;  1VJ9 U;  5CMX H;  2ZF0 H;  2Z3D A;  1GI6 A;  3VB4 A;  4DG4 A;  1FY8 E;  2ULL A;  1GG6 C;  1ELT A;  2BB4 A;  2DE8 A;  3GCT F;  1W2K H;  2VGC B;  2D8W A;  1G2M A;  2ZDL A;  2P94 A;  2A1D B;  5DP9 A;  1GBD A;  1GVL A;  4X1S U;  1O3A A;  4K1T A;  4AFZ A;  2OD3 B;  5HIZ A;  4FU7 A;  3RC6 A;  1LKA A;  3T28 A;  4F55 A;  2P8O B;  3ZV9 A;  5EIY A;  4CR9 A;  2F91 A;  5GDS H;  1GHZ A;  2SNW A;  3A87 A;  1GI0 A;  3SJI A;  2UWP A;  1GDN A;  1DT2 A;  4ZKN U;  2BD2 A;  2XCN A;  2PKS B;  5DK1 A;  3TJO A;  4ABJ A;  5C5O A;  3DSP A;  4INH A;  4U01 A;  2PTN A;  2GMT B;  3TJV A;  2FOF A;  2PV9 B;  1H9I E;  5AFZ H;  4CRF A;  1ZHM A;  3KQ5 A;  5DJ7 A;  5GIB A;  1T32 A;  2QN5 T;  1Z6J H;  3M3T A;  4GSO A;  3OTJ E;  1EP5 A;  8KME 2;  5FL7 D;  2K8I A;  2PSY A;  1BRA A;  1PQ5 A;  2H5C A;  4X1Q U;  3NUM A;  3QX5 H;  3SNE A;  1JIR A;  1HGT H;  3P8N A;  3RXU A;  1AGJ A;  2SFA A;  1OWE A;  2FS9 A;  2FES H;  2R3Y A;  3SQE E;  2IPH A;  2XC5 A;  3MU8 A;  1HAP H;  1KSN A;  2TIO A;  2XYA A;  2FXR A;  5EJ1 A;  3S9A A;  3A8B A;  1KXE A;  1C5R A;  1O30 A;  2F3C E;  4GCH G;  4ZCN A;  1YKT A;  3I78 A;  1NO9 H;  3RXO A;  1KXF A;  4OS1 A;  1COW D;  3GDV A;  2VVC A;  4IBL H;  4BOH A;  2VH6 A;  3T5F H;  3F68 H;  1EPT C;  1GMD G;  2OC1 A;  1A5H A;  1AUT C;  4KP0 A;  1ELG A;  3QLP H;  3S69 A;  3HKI B;  1SGQ E;  3QGN B;  1GI9 B;  1TB6 H;  4Q7X A;  2FOD A;  2G4T A;  2RA3 A;  1F92 A;  1O2Z A;  1Y3Y A;  1DY8 A;  1O3E A;  2XTT B;  1SHY A;  4NA7 A;  3C27 B;  1AFQ B;  1WSS H;  1UTN A;  5G4B A;  1BIO A;  3PLK A;  1Z1J A;  1UTM A;  2ALP A;  2Y81 A;  2M5T A;  3NPS A;  2HNT E;  3KHV A;  1YLN A;  2VID A;  3N7D A;  1TAB E;  5FBE A;  2XND D;  2ZU4 A;  2LP6 A;  1FY5 A;  2W7S A;  5LPE A;  1V2O T;  2HPQ H;  1NT1 A;  2BY7 X;  2TGD A;  4IN1 A;  1DXP A;  2PKA A;  4B73 A;  1AVG H;  1H9H E;  1C4V 2;  1ZML A;  1B7X B;  3NXP A;  4CRB A;  1G30 B;  3SU1 A;  2OK5 A;  1FI8 A;  4ZH8 A;  5C67 A;  1P01 A;  1O32 A;  2ZU2 A;  1SFI A;  1VCP A;  1FPH H;  1T8L A;  3A7V A;  2GCT C;  1S0Q A;  1TNI A;  2QC2 A;  1Y3V A;  2WV5 A;  3DSO A;  4M7G A;  1VIT H;  1O2U A;  1L1J A;  4U2W A;  2TPI Z;  1ZPZ A;  3A81 A;  5C0T A;  4Y11 E;  4IMZ A;  2KFW A;  5SGA E;  3PLP A;  1TE0 A;  1AND A;  1X7A C;  1YCP K;  4YT6 H;  2V3O H;  1L1N A;  2CJI A;  2A31 A;  7GCH F;  4ZHL U;  4I8H A;  4I31 A;  1O2K A;  1CGJ E;  2QF0 A;  5JBC S;  1V2S T;  4WVP E;  2Z94 A;  3GY5 A;  1UK4 A;  5DP8 A;  2UUJ B;  3TK5 A;  1HCG A;  5J4Q A;  3UWJ H;  2CF8 H;  5LPR A;  4Y8Z A;  3FP7 E;  4GAW A;  4JZF H;  1ACB E;  4ACB A;  2FZZ A;  1JOU B;  1SGT A;  1OS8 A;  2GKV E;  2PTC E;  3BG4 B;  4TY7 A;  2VIV A;  1TAW A;  2EI8 A;  3PMH B;  1BTH H;  4ZHM U;  3RXI A;  2H6M A;  3AK5 A;  3LC3 A;  2QA9 E;  3P6Z B;  4I8K A;  2AIQ A;  2GT8 A;  3BEF B;  2IOT A;  5BRR E;  1S83 A;  1RFN A;  3WWB A;  2PGB B;  2FX4 A;  3RXC A;  3SJ9 A;  1GJD B;  4U32 A;  1A0J A;  2WHX A;  1FV9 A;  3SGB E;  3PWC A;  4YOG A;  1YPE H;  2FOE A;  3LGI A;  4K69 A;  5AHG H;  2H9T H;  3M37 A;  2ZA5 A;  5F53 A;  2GTB A;  1PYT C;  1U6Q A;  2ZGX H;  1TGT A;  1F5K U;  1HUT H;  1P9S A;  1LVY A;  1WQS A;  1TA2 A;  1P12 E;  3U8R H;  3UWI A;  2A45 B;  3GY2 A;  3NWU A;  5F03 A;  3FZD A;  3BTK E;  1SOT A;  2ZHE H;  2ZG0 H;  1XM1 A;  2BY5 X;  4AN7 A;  1LHC H;  3VB5 A;  1W7X H;  2WPL S;  3L33 A;  2WPJ S;  1GBK A;  3FAN A;  2G51 A;  4JMY A;  1MAB B;  1O3C A;  2O9Q A;  1HDT H;  2ZGC A;  1QCP A;  2W6J D;  1TRY A;  4IC5 A;  4D76 A;  4AG2 A;  3EAJ A;  1LHD H;  4XD7 D;  4LZ1 H;  1EAU A;  1GPZ A;  2ZPR A;  3F6U H;  1NC6 A;  4NIW A;  3ZZ8 A;  1C5M D;  3U28 C;  3OSY A;  2O8W A;  4BAQ B;  1IAU A;  1DX5 M;  2OUA A;  1ZSL A;  1NTP A;  3ZZB A;  1H8E D;  1GBH A;  5GCH F;  4FUD A;  2ZDV H;  2NWN A;  1T8N A;  1YWU A;  1BHX B;  3T29 A;  1ESB A;  4XE4 A;  1A1R A;  5C1U A;  1AI8 H;  1CHG A;  3T27 A;  1K1J A;  1MTN C;  2JDI D;  3HK6 B;  2F9B H;  5EPY A;  2XBW A;  3FN8 A;  3R3G B;  1MKX K;  3E3T A;  3UTU H;  1G3B A;  1VGC B;  5JBA S;  4I33 A;  3SOR A;  1FQ3 A;  2NU0 E;  5A0B A;  3EYD A;  1C5N H;  1V2W T;  1FON A;  1W3C A;  2AGE X;  1OHH D;  2FM2 A;  2G55 A;  2ANK H;  2FS8 A;  1DSU A;  1HNE E;  4WME A;  2NU4 E;  1GMH F;  4K8Y A;  1O31 A;  2OLG A;  1S6F A;  2GGV B;  1Y3U A;  2PP6 A;  3RXT A;  1D3P B;  2SGA A;  3IWM A;  3SV7 A;  1ELE E;  3RLW H;  1HAG E;  1RTK A;  3T2N A;  1C1T A;  1Z71 A;  1WUN H;  3VB6 A;  1F0T A;  4K1S A;  1C2E A;  2P16 A;  3JZ1 B;  3MH7 A;  3O8D A;  2Z9G A;  1FDP A;  1LDT T;  1W12 U;  1ANB A;  5GPI B;  4Y7A A;  3H7O A;  5EOK A;  4QT8 C;  4ACA A;  1K21 H;  1TMT H;  5HMA A;  1PPZ A;  4MPV A;  1ELA A;  1WU1 A;  4ZXX H;  3ZYE A;  1RTF B;  6LPR A;  1GBE A;  3BG8 A;  1G36 A;  2ZGJ A;  2ZHW H;  1J14 A;  2F9N A;  2O8U A;  1BDA A;  4WJG 2;  1TNG A;  1C1M A;  1BZX E;  2V3M A;  1O2V A;  2Z9I A;  1DY9 A;  2BOH B;  3ZIA D;  3AW0 A;  2GJG A;  2HLC A;  3GY6 A;  2J34 A;  5CE1 A;  4X2V A;  4KTS A;  3N99 A;  1J9C H;  4MPW A;  1OWK A;  1J17 T;  4SGB E;  3ZVB A;  2GP9 B;  4AB9 A;  1TNJ A;  1MAX A;  1EXF A;  1PQ8 A;  4JYT A;  3QDZ B;  1XKA C;  2QAA A;  4HG6 A;  2TGA A;  3RP2 A;  1BMN H;  1F0R A;  1OKX A;  1UTO A;  3LOX A;  1P04 A;  1QZ8 A;  2H9H A;  1O39 A;  1P2N A;  3CEN A;  2XC4 A;  3M61 U;  5EXN A;  2VWN A;  5C20 A;  3FZZ A;  1O3O A;  3MI4 A;  4H6T A;  3SGQ E;  1MAY A;  3AVZ A;  4CR5 A;  3HAT H;  1NRO H;  3VB7 A;  2ZQ1 A;  2VJ1 A;  3LGY A;  1HB0 B;  2C8Z B;  2CF9 H;  2LEL A;  3P95 A;  1AB9 B;  3F9G A;  2R0L A;  3ZZA A;  1P05 A;  5ABW A;  2G8T A;  2BHG A;  2JJ1 D;  2Y5F A;  3G01 A;  3ZZ4 A;  1O2H A;  3GY7 A;  1BTX A;  1UCY H;  2FYQ A;  2C8X B;  5FPT A;  4BTU B;  1YPJ H;  3E91 A;  3FKS D;  1V2Q T;  1AE8 H;  1Y5U T;  2OP9 A;  3UAI C;  4JYU H;  1CA8 B;  1QQU A;  2A2Q H;  1P3E A;  2ZTY A;  1DFP A;  1VIT F;  1ELD E;  2B5T B;  2V6N A;  3M3V A;  4IN2 A;  3NRL A;  2BXU H;  3KL6 A;  2I6Q A;  3SI4 H;  3Q77 A;  4D7G A;  4ABB A;  2BX3 A;  4I86 A;  3U8T H;  2A4R A;  1EAI A;  2ZFQ H;  2THF B;  3DA9 B;  2FTL E;  1F5L A;  4TYD A;  7KME H;  2BLQ A;  4CRA A;  2PLX A;  5JBB S;  5EGM A;  1GMH G;  3Q3X A;  3R0F A;  2BZ6 H;  2FP7 B;  2YOL A;  3RXL A;  2CHA B;  1B5G H;  1T4U H;  2J92 A;  5HM2 A;  2I6S A;  4ISI H;  2BDI A;  3A7Y A;  2XBV A;  2OIN A;  4K5Z A;  1EKB B;  5B6L A;  3L3T A;  1A7S A;  3LT3 A;  1QY6 A;  2Y82 A;  2QYI A;  1KXA A;  1BHX F;  1HJA B;  2ZFT A;  3DFL A;  1THS H;  1YM0 A;  4AGK A;  1P11 E;  3RXS A;  1V2M T;  2G5V A;  2JH5 D;  4YO9 A;  4ABI A;  1W0K D;  3WW7 A;  4I8G A;  1XVO A;  3TH3 H;  1HXF H;  1NPM A;  4OS6 A;  3RC5 A;  1GHA F;  3OTP A;  1WBG B;  4RN6 A;  3H7T A;  1SQT A;  3BTT E;  1DE7 H;  3SV9 A;  1AN1 E;  4NG9 H;  1YC0 A;  2TRM A;  1CGI E;  2D1J A;  3MU5 A;  3TGJ E;  1GI7 B;  1L4Z A;  2ZEC A;  4NZL A;  1V3X A;  1QB1 A;  1Y59 T;  2GVF A;  2A5K A;  2F9O A;  1GJB B;  4A1V A;  3EGK H;  1GI1 A;  1EJA A;  1KXC A;  2QXI A;  3EST A;  1IQG A;  1Z8J B;  2FMJ A;  1G3D A;  1ZR0 A;  4MPX A;  3FP8 E;  3TU7 H;  4INK A;  4Y0Y E;  2UUY A;  5T6D A;  2ZTX A;  2G00 A;  2O8L A;  3EA9 A;  1NS3 A;  1THP B;  4ISH H;  1C2J A;  1P2K A;  3RDZ A;  4ABE A;  5DP3 A;  5F8X A;  3F3B A;  1MQ6 A;  2OTV A;  3DD2 H;  1CT2 E;  1MTV A;  4X6P A;  2ASU B;  3FAO A;  2VGC C;  1ZTL A;  3BTG E;  4CHA B;  1SGE E;  3A84 A;  3QUM P;  5DN6 D;  2FEQ H;  3ZZC A;  4CBN A;  4BAK B;  4MQA A;  5EW1 H;  1AU8 A;  1EAW A;  1BT7 A;  1FX0 B;  1TOM H;  1EX3 A;  3QWC H;  1O3F A;  5C1X A;  4LZ4 B;  3MWI U;  3IG6 B;  2AIP A;  1A0L A;  1QNJ A;  2BQ6 B;  1ETR H;  3Q76 A;  5A8X A;  1IOE A;  1EZX C;  3BTE E;  2PKS C;  4FUF A;  1SGP E;  1ZMN A;  4D9R A;  1CA0 B;  4CRC A;  2GMT C;  2KCO A;  3SUF A;  4I32 A;  3V12 A;  2ODQ A;  4IMQ A;  4LXB H;  5C94 A;  1AMH A;  1C1V H;  3PO1 B;  4YM9 A;  3IIT A;  4JK5 A;  2L74 A;  4CRE A;  1TBR H;  5IK2 D;  2UWO A;  3U69 H;  3E0P B;  4ASU D;  1O3N A;  5JB8 S;  2QIQ A;  2BQ7 B;  7EST E;  1KDQ A;  4JCN A;  2Z7F E;  4ABD A;  1Y3X A;  4YES B;  1KMH B;  2STA E;  4Z6A H;  2HLD D;  1UVP A;  1T7C A;  2FYR A;  1D9I A;  3BTQ E;  5FHT A;  1RIW C;  1OYT H;  1O2J A;  3SHC H;  5I46 H;  2FI5 E;  2HVY B;  3KYG A;  2V3H H;  1SGF A;  3ELA H;  4K1E A;  1UTQ A;  2PKA B;  4E06 H;  2TBS A;  1SR5 C;  4A1T A;  4CRG A;  1D4P B;  3HGP A;  2ZTZ A;  4OGY A;  1C5Z B;  5F8T A;  1TPS A;  2ALV A;  2EA3 A;  3BTF E;  1O35 A;  1UO6 A;  2ZCL P;  3RML H;  4GPG A;  5FCR A;  1O2M A;  1MTW A;  1AFQ C;  1HAI H;  3TGI E;  1FZZ A;  1QRZ A;  2A32 A;  2JIZ D;  1HAO H;  1YPH C;  4UEH H;  1BJV A;  4ZHA A;  1K28 D;  4X6N A;  4NA8 A;  1HYL A;  1ZHR A;  5EJL A;  5LPF A;  1XUF A;  1AO5 A;  2YMS B;  3U8O H;  2ZDM A;  1QL7 A;  4JZI A;  3NK8 A;  3SO3 A;  4HZH A;  3FFG A;  1JIM A;  1OXG A;  2CMY A;  2C3S A;  3SNB A;  2BDH A;  1T31 A;  1EFR D;  2XRC A;  2P95 A;  5C5N A;  1TAL A;  4BXS A;  1Z8G A;  3ATM A;  4ZKS U;  4VGC C;  1TPP A;  2ZHF H;  1EST A;  4MDS A;  4MPU A;  2Y7Z A;  1B0E A;  1E36 B;  2JET B;  3F2F A;  3Q00 A;  1LO6 A;  3E6P H;  2J2U A;  3F0P A;  3PTN A;  4KGA A;  1UJ1 A;  4WXV A;  4DII H;  1RGQ A;  1XX9 A;  1C2K A;  1F5R A;  4UFE H;  1Z8I B;  1HJ9 A;  1SC8 U;  1TNH A;  1MBM A;  1JBU H;  2FOC A;  1NFX A;  1O34 A;  2G52 A;  3E8L A;  3ZVG A;  2BDA A;  3ZZD A;  5F6M A;  2ZO3 H;  1S85 A;  5EXL A;  1RXP A;  2H5D A;  1AQ7 A;  5C0U A;  5L6N H;  2WPH S;  3TGK E;  2QV1 A;  3OYP A;  3GS9 A;  4K2Y A;  4X2X A;  2AMP A;  1T4V H;  4JZE H;  1MU8 B;  1N6Y A;  2JJ2 D;  1WTH D;  1ZPB A;  1P10 A;  4UFD H;  4INL A;  4IW4 E;  1PPE E;  4A6L A;  1QBO A;  2XCF A;  2PHB A;  1BRC E;  3NCL A;  1K1O A;  3PRD A;  2DE9 A;  1N8O B;  1ID5 H;  1BBR H;  1Q3X A;  1SL3 A;  1IQJ A;  1HAV B;  2GCH F;  1BCU H;  1WQV H;  1C2M A;  5HM9 A;  2HGT H;  1CQQ A;  1O37 A;  3LGW A;  1B0F A;  5HXF A;  3EE7 A;  3ENS B;  1O3B A;  4BAH B;  3SU5 A;  2ZU1 A;  1AVW A;  3LH3 A;  3SU4 A;  2ZFS A;  1Y8T A;  1A3E H;  1PPF E;  5H4I B;  4XBD A;  2BLW A;  2KAI B;  1BA8 B;  1TNL A;  1C5X B;  2BY8 X;  4AFU A;  1SLX B;  1DWB H;  2JH6 D;  1G2L A;  3GIS B;  1BUI A;  1C2I A;  3GCT G;  2C93 B;  4HFP B;  2BTC E;  3ZVC A;  1DVA H;  4A92 A;  1O2Q A;  3M36 A;  4NFE A;  2XWB I;  4I8J A;  1DXW A;  6CHA C;  3SZE A;  1Q2W A;  4MNW A;  1NFY A;  2FOG A;  3A85 A;  1GGD C;  5JBT A;  1J15 A;  2OBQ A;  3BEI B;  2C8Y B;  1DIC A;  9LPR A;  2BX4 A;  3PV5 A;  1TWX B;  2VBC A;  2SGF E;  1ZGI A;  1T8O A;  1O2X A;  3V13 A;  2QXG A;  1K1L A;  2FOB A;  1A5G H;  4B71 A;  3KF2 A;  4D8N A;  3QO6 A;  1XXD A;  2QGR A;  1V2N T;  4AFQ A;  2KCY A;  1DS2 E;  2C90 B;  1KTS B;  3TPI Z;  2J95 A;  3GDU A;  4JK6 A;  1HLT H;  1ZJD A;  1EAS A;  2VU8 E;  2PGQ B;  3OFN D;  2HPP H;  1RTL A;  1LKB A;  1SGY E;  2J98 B;  3BTW E;  3PM3 A;  3F9H A;  2Y80 A;  1SKY E;  1GBI A;  1W11 U;  3HK3 B;  5EU8 A;  5FAH A;  2QF4 A;  1OX1 A;  4Y8Y A;  2IJD 1;  5GXP A;  1DLK B;  4LOY H;  3STJ A;  1BRB E;  1SB1 H;  1GL0 E;  5LH8 A;  1VGC C;  1GL1 A;  3UPE A;  4NGA H;  1HPG A;  3GCH B;  2R3U A;  1LMW B;  1FY1 A;  4FUB A;  4FXG H;  4IS5 A;  4PRO A;  2XXL A;  4X2W A;  1ORF A;  5FPY A;  2B8O H;  3A7Z A;  2V0B A;  5KGO A;  3A7T A;  1HIA B;  3H5C B;  1NZQ H;  4GVU A;  3FOA A;  1P9U A;  2ZKS A;  1SQA A;  3RUO A;  1S6L A;  1PFX C;  2AMQ A;  3Q3K A;  3QN7 A;  1HAV A;  2GCT B;  4A1X A;  4Q4L A;  4X0W U;  1ZLR A;  2QY0 B;  5HKK D;  1YLC A;  1SGR E;  1HAY B;  1K9O E;  1KXD A;  1ETS H;  1EUF A;  2J4I A;  2K0Q A;  2GT7 A;  1TQ0 B;  1NBM D;  1NBM E;  2KAI A;  1HFD A;  5HGG A;  3SUG A;  2F9V A;  2GCH G;  5TCC A;  3LH1 A;  3W94 A;  3RU4 T;  1XUJ A;  1OWI A;  1YCP H;  1PPB H;  1S5S A;  1C9P A;  1AZ8 A;  1JWT A;  1YLD A;  1BIT A;  1G32 B;  2C8W B;  4B2A A;  1V6D A;  5E2P A;  2KX4 A;  1O5E H;  2YMS D;  3MU1 A;  1C5W B;  1O2I A;  1SGN E;  1SPJ A;  3LGT A;  5EST E;  3SGA E;  1C2F A;  2OBO A;  1NRP H;  1O3G A;  3ZZ3 A;  2Y6T A;  2BXT H;  4P00 A;  2Q6G A;  3N7O A;  1XUG A;  1V2U T;  2CN0 H;  1GJ9 B;  1W0Z U;  5C1Y A;  3MHW U;  3TH4 H;  2W3I A;  4Y8X A;  2V35 A;  1G9I E;  4RT0 A;  1EB1 H;  3LIW A;  1ELB A;  5DP4 A;  1FIZ A;  5E0G A;  4XFQ A;  3SNC A;  2FI3 E;  2VIO A;  2KCA A;  1O3H A;  1QL9 A;  2Y5G A;  4B76 A;  1EPT A;  2FX6 A;  1FNI A;  2IJO B;  7GCH G;  3RM0 H;  4RT1 A;  3AAS A;  4AB8 A;  1ZJK A;  2P59 A;  2GZ9 A;  1C5L H;  1SI5 H;  1TPA E;  1QJ7 B;  1RJX B;  2BYA X;  4E05 H;  2J98 A;  1BTU A;  1AB9 C;  6GCH F;  4DT4 A;  4ZKO U;  2G5N A;  3GCO A;  2ZZU H;  2JKH A;  2XNI A;  2YNB A;  1QA0 A;  1UTP A;  1UCY K;  3GY8 A;  4UE7 H;  1AFE H;  3VGC B;  1XMN B;  1P09 A;  3UB0 A;  2BLO A;  1O3M A;  4I7Y H;  3LDX H;  3RMN H;  1Q31 A;  1YPH E;  2BD9 A;  1ZPC A;  3A7W A;  5KED A;  2R2M B;  3TIU A;  2BMG B;  2ZNK H;  1ANE A;  2STB E;  1BMF D;  3UQO A;  3I29 A;  2P93 A;  1SQO A;  1P06 A;  1LHF H;  1E34 B;  1OWH A;  1HIA A;  1V2P T;  3M7T A;  1W13 U;  2A0Q B;  1ELV A;  1PJP A;  2A7J A;  4Y71 A;  3UR9 A;  3BTM E;  3RXV A;  3M5M A;  3DT0 H;  1NM6 A;  4Q2K A;  1CT4 E;  2BVX H;  1GCT B;  1P3C A;  5EQS A;  3M5O A;  4KTC A;  1O2G H;  1O3K A;  5IDK A;  1QR3 E;  4HTC H;  2PW8 H;  3PTB A;  4BAO B;  4I8L A;  2BM2 A;  1GBL A;  2J94 A;  1LVO A;  2CHA C;  1P2I A;  4KEL A;  1QBN A;  1H4W A;  5FBI A;  1GJA B;  1QQ4 A;  1MMJ N;  2BY6 X;  3E1X B;  3NZI A;  1P2Q A;  3ITI A;  4ISN A;  2A7H A;  1CSO E;  4O3U A;  4UDW H;  3F2G A;  3T26 A;  1L1G A;  1HJA C;  4X8S H;  4U30 A;  3RXP A;  3D65 E;  3RXD A;  4AZ2 B;  1A3B H;  4THN H;  2TGP Z;  4WXI A;  3H09 A;  5AVD A;  2VNT A;  1F7Z A;  1K1M A;  2Z9L A;  2EY4 C;  1BRU P;  4ASH A;  2P3T B;  3ZVE A;  3M3S A;  1FMG A;  1JMO H;  4H4F A;  2CK3 D;  1QFK H;  2ZHQ H;  2WPK S;  3MU4 A;  4X2Y A;  3SOS A;  2LNC A;  1ZTJ A;  1W14 U;  3TNS A;  5DP6 A;  2F43 B;  3M5L A;  3SQH E;  2QF3 A;  1D6R A;  1GCD A;  4K3J A;  4OGX A;  5A0A E;  1L4D A;  1CHO F;  2KR7 A;  1TNK A;  3O8C A;  1TMB H;  1GVK B;  5GCH G;  2GV6 A;  1E79 D;  3RMO H;  3SNA A;  2WYG A;  3QTV H;  4R8T B;  2QXH A;  1Z6E A;  4O9V A;  4Y76 A;  4DCD A;  3PMB B;  4CBO A;  2FOA A;  3SU3 A;  1WYK A;  1GHV H;  1QRX A;  4MNV A;  1VR1 H;  2CXV A;  1C1P A;  4FOU C;  1LVB A;  1VCW A;  3SJ8 A;  4Y0Z E;  2H1U A;  1TGS Z;  4OS5 A;  1MD8 A;  1YCP M;  1GBB A;  1FLE E;  2VVU A;  3LKW A;  1MD7 A;  4BNR A;  1GHY H;  3P8G A;  5DG6 A;  3SU0 A;  4ZMA H;  3URE A;  1XKB C;  1UK3 A;  1C5Q A;  3F9E A;  5GND A;  1RRK A;  4NWL A;  3A82 A;  3OY6 U;  5E0H A;  3A8A A;  1LHE H;  2PSX A;  1NU7 B;  1MCT A;  3VG8 A;  5CHA B;  5JB9 S;  1NES E;  4CHA C;  2Z3C A;  4BAM B;  3SW2 B;  1HBT H;  1OYQ A;  1E37 B;  1KDQ B;  2ZP0 H;  4OS7 A;  1N6X A;  4TWY A;  3SV8 A;  4GLY A;  3UIR A;  6GCH G;  1BTY A;  1C5Y B;  1MKW H;  1MTU A;  3SI3 H;  3SZN A;  3KID U;  4AGJ A;  1Y5A T;  3BTD E;  2JH0 D;  2AMD A;  4O3T A;  1GI3 A;  5T1V A;  3SN8 A;  3RXH A;  2RCE A;  4K60 A;  1CA0 C;  1GWA A;  4XDE A;  3UFA A;  2NU3 E;  1KYN A;  1ELC A;  3BSQ A;  1OPH B;  2ZEB A;  1OP0 A;  3MNB A;  4AC9 A;  1ZMJ A;  3PO1 C;  1ESA A;  1GBF A;  2J97 A;  1ZZZ A;  2UWL A;  4ISO A;  4Q7Z A;  3GY3 A;  1LVM A;  4H6S B;  1BTW A;  2WYJ A;  1SFQ B;  3QZR A;  5A8Y A;  1MTS A;  2TGT A;  5EXM A;  3VB3 A;  4FUC A;  1XUH A;  3S0N A;  3UNR A;  2SGQ E;  2J9N A;  2KM0 A;  1CE5 A;  4DIH H;  3OX7 U;  1OWD A;  1GDU A;  4YZU A;  3OY5 U;  1CBW B;  1D3Q B;  2KCP A;  4JZ1 A;  4YOJ A;  4TT3 D;  2VWL A;  3TJU A;  4JYV H;  3BTH E;  1UVO A;  1UTK A;  3E90 B;  3QGJ A;  3A83 A;  4A7I B;  1EJM A;  3LON A;  3P17 H;  3PB1 E;  1WAY B;  2H9E H;  2W3K A;  1A61 H;  1VJA U;  4DGJ A;  3A89 A;  2GZ8 A;  1WOF A;  1FN8 A;  1OOK B;  1F2S E;  2BVS H;  5C2Z A;  5L2Y H;  1AZZ A;  3RU4 D;  4X8V H;  5IYT A;  1TA6 A;  3OU0 A;  2BVR H;  3AAV A;  1TGN A;  2HVX A;  1C2D A;  1GHW H;  1S81 A;  2P8O C;  1AD8 H;  1O5F H;  2Z3E A;  2ZU5 A;  5AFY H;  4GCH F;  3F2H A;  1FN6 A;  2VB0 A;  3PLB A;  3BIV H;  5KEC A;  3TK6 A;  1O5A B;  2BDG A;  3RXA A;  1PPH E;  1DUE A;  2YMS C;  4X6O A;  1VIT G;  5HYO A;  1MU6 B;  3MNC A;  1FXY A;  3GOV B;  2ZI2 H;  1WCZ A;  1DOJ A;  1W0J D;  2G4U A;  4RI0 A;  1BMM H;  1W10 U;  3CP7 A;  2A4Q A;  4AOQ A;  1AWH B;  1PPG E;  5HIY A;  3O8B A;  2RFK C;  1H8H D;  3L6P A;  3HGN A;  4R0I A;  5C17 A;  4X8T H;  1SHH B;  1AY6 H;  1O5G H;  1IQL A;  3K6Z A;  2FLB H;  5DSF A;  3KQC A;  4FUG A;  1O5D H;  2FTM A;  1TYN A;  2EQN A;  4WMF A;  4B2B A;  5T6G A;  4H42 U;  3TH2 H;  1FAK H;  3BN9 A;  4J2Y B;  1ZSJ A;  2NU2 E;  2B0F A;  2PUX B;  2AER H;  2WUC A;  4DUR A;  4O97 A;  1LQD B;  3MH6 A;  1THR H;  1GHB F;  1D6W A;  1DDJ A;  1SOZ A;  1NRS H;  4ZUH A;  3S7K B;  3VEQ B;  2BD7 A;  3URC A;  2PR3 A;  2UUK B;  1BML A;  3WWF A;  1JXP A;  4FVD A;  1YBW A;  2ZPQ A;  3K9X B;  1NRN H;  1MCV A;  1C4U 2;  1GHA G;  1SLV B;  1S6H A;  3P8O A;  2XBX A;  3KQD A;  2WV4 A;  4F4O C;  3UUZ A;  3DUX H;  3SJK A;  3DHK H;  2ZFP H;  4F48 B;  3ATK A;  1BBR K;  4NIY A;  1N8O C;  1QIX B;  1UK2 A;  1TGC A;  1O5C B;  1SBW A;  2HOB A;  1NN6 A;  3LC5 A;  1BJU A;  3SU2 A;  1DPO A;  3MFJ A;  1ZSK A;  1P0S H;  2SGP E;  1K1I A;  1AVX A;  1KLT A;  3JZ2 B;  2CGA A;  1GI4 A;  3RXF A;  1FUJ A;  2WZQ A;  1ZYO A;  2FO9 A;  2GX4 A;  1GBA A;  4MVN A;  1A5I A;  3SV6 A;  2M2A A;  1ARC A;  3M5N A;  2F4L A;  3MH5 A;  1BTZ A;  2CV3 A;  3KN2 A;  3F0O A;  1YP9 A;  2FDA A;  4ABA A;  1TFX A;  4ZKR U;  1NFU A;  1GI5 A;  1XUK A;  3SND A;  5T6F A;  3ZZ9 A;  3V0X A;  4KKD A;  3ZVD A;  3RXB A;  3HKJ B;  2AFQ B;  2RDE A;  1O2L A;  4YXW D;  2B7D H;  1UW7 A;  2FIR H;  1TQ7 B;  1O2T A;  2HNT F;  4UFG H;  3ZZ5 A;  1RIW B;  5TJX A;  1P8V C;  1SG8 B;  3GY4 A;  1BMA A;  3BIU H;  3TIT A;  3URD A;  4BAN B;  3GCN A;  1SGI B;  4FUJ A;  3ODD A;  5EQQ A;  3SU6 A;  4OS2 A;  5FXL A;  3N7E A;  2RDL A;  4NFF A;  1HAH H;  1TMU H;  1TPO A;  1AKS B;  1GG6 B;  1O2S A;  2A5I A;  3BG4 C;  1RD3 B;  2FLR H;  2ZDK A;  3MNS A;  1ZRK A;  1TON A;  6EST A;  3QZQ A;  4F49 A;  1QA7 A;  5DGJ A;  1BTP A;  3ZYD A;  1DAN H;  1NRR H;  1J16 A;  2VWM A;  2R9P A;  3PYH A;  1G37 A;  1A46 H;  3U9A H;  4B1T A;  2ANM H;  1IQE A;  1TX8 A;  2ZU3 A;  3BV9 B;  1SLU B;  4MTB A;  4NIX A;  1EJN A;  1UCY E;  1GBM A;  2RG3 A;  4UON A;  1C5P A;  3GCH C;  1HAZ B;  4JZD H;  1Y3W A;  1Y5B T;  2ZQ2 A;  4BXW A;  3VPK A;  3A80 A;  2ANY A;  4ABH A;  2BDB A;  1QB6 A;  1C2G A;  1EAT A;  1TLD A;  1AHT H;  2GZ7 A;  2FOM B;  3S9B A;  4ABG A;  1GHB G;  1O3D A;  2OQ5 A;  2AEI H;  1TGB A;  8EST E;  1NRQ H;  2J5U A;  2BDC A;  5EJZ A; 
#chains in the Genus database with same CATH homology
 4ACA A;  1SQR A;  4ACB A;  4AC9 A;  2LP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...