3UR9A

1.65a resolution structure of norwalk virus protease containing a covalently bound dipeptidyl inhibitor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
175
structure length
164
Chain Sequence
HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like protease
publication title Broad-Spectrum Antivirals against 3C or 3C-Like Proteases of Picornaviruses, Noroviruses, and Coronaviruses.
pubmed doi rcsb
source organism Norovirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 37
structure length 164
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur9A01
1P8VC 1VR1H 2FOHA 2SGQE 1Z6JH 3SI4H 1L0ZA 2VJ1A 1VJAU 2DE9A 1SGCA 1DS2E 2F3CE 1SBWA 3PTBA 4H42U 1S85A 4TYDA 3PLPA 2CF8H 2ZZUH 2HNTF 3DA9B 1GI5A 3KIDU 1HJAB 3ZVFA 4HI3A 1TBRH 1OPHB 4XOJA 1UMAH 3R0FA 3GOVB 1C5VA 5EQSA 2P93A 2XW9A 1C2IA 1GBHA 2XTTB 1GHBG 1PPFE 3KF2A 2QN5T 4R8TB 1NO9H 1Z8JB 4X2WA 1O30A 1WTHD 2A7HA 1O5GH 5T6GA 3RXBA 2QC2A 2XC5A 1HXEH 3SNEA 2ESTE 3ZZ7A 1WQVH 4D8NA 6LPRA 3MH6A 4U2WA 4ZKSU 1KYNA 3RLWH 1D3QB 1D9IA 3S69A 4OS2A 3PMBB 5EXLA 3MH7A 5E2OA 1BTXA 5AHGH 5ABWA 1P9UA 2FOMB 2BD4A 1GBFA 1O5FH 4B2BA 1VCWA 2AGGX 1TYNA 1A0LA 1FPHH 2Y5HA 4XBBA 3PROA 1T32A 1W0YH 2BZ6H 1XX9A 1C1QA 1H9IE 3FP7E 1ZOMA 3SW2B 1OYQA 1EZQA 3TPIZ 3GCNA 5I25A 4K1EA 2VWNA 4B75A 3DFLA 3GY6A 2D1JA 3K6YA 4Y6DA 1TOMH 3T62A 1C1OA 7KMEH 3EA7A 2GV7A 4I32A 1UHBB 1CA0B 2R0LA 4ABHA 4DOQA 3LOXA 2XWBI 1B0EA 1O3BA 1EPTB 1WYKA 2GCHG 4NSVA 4I8LA 4AB8A 3KEEA 2ZU4A 4ZXYH 3T2NA 2H5DA 4O3UA 1AIXH 1E35B 1SG8B 1DANH 1UTMA 1G3EA 4I8KA 1GDNA 1HXFH 1TIOA 2ZHFH 5ETXA 3KGPA 1G3BA 3OSYA 2Q6GA 1M9UA 4ISOA 4JK6A 4Z0KA 3K65B 1DXWA 3V13A 2GGVB 1BRAA 1PYTD 3U1JB 2D2DA 1GBJA 3B9FH 5F8TA 3T25A 2ZFPH 1QNJA 3KL6A 4NCYA 2BDHA 1HRTH 1O3OA 1SQTA 1SLXB 1GPZA 5K0HA 2VWOA 3M36A 1GI4A 1P12E 3GDUA 1O2NA 3RXDA 2Z7FE 3QUMP 1TGNA 2QAAA 2BOHB 2QIQA 4UFGH 1MTWA 3TH2H 2OCVB 1FONA 1IQJA 1W0ZU 1GVZA 4LK4A 1Y3YA 3A86A 2BXTH 7GCHF 3S9BA 3NK8A 2P3UB 1ELGA 1FY8E 1GCTB 2GZ7A 3ZZDA 1C5NH 4K5ZA 1P09A 8ESTE 1XM1A 3GY5A 1UVOA 4A7IB 4YOJA 1QA7A 5DKMA 1B0FA 5E0JA 3PLKA 1S0RA 2BQ7B 2FTMA 1LCYA 2VNTA 4Q7YA 1GI2A 1AMHA 1GBKA 4BTUB 2FOAA 5LGOA 1MAYA 2W5EA 1Z1IA 2VWLA 5F6MA 1MZDA 3RXHA 1HLTH 1SGPE 1TRMA 1FMGA 1YBWA 1LVMA 2PV9B 1O3HA 3FZZA 3ZZAA 5L30H 4VGCC 1GBMA 2ZWLH 1F0SA 1QFKH 4X1QU 4X6NA 1NC6A 1GMCG 1Z7KA 1ZMNA 1F5KU 2BQ6B 5T6DA 1BZXE 1O2JA 1CHOG 5A0BA 9ESTA 1IQFA 3T28A 2C93B 2FS8A 3TNSA 3RMMH 1O39A 1O3FA 1OWKA 2XC4A 2BVRH 3MMGA 1DE7H 1LKBA 1HB0B 2ZA5A 3SJ8A 1ANEA 3SV6A 7LPRA 5JYIA 1O2UA 1P10A 4X1PU 2OXSA 3MO6A 3MI4A 2F91A 2ILNA 1FNIA 4UE7H 3EAJA 4FUEA 1EP6A 5JPMH 2SGAA 2W3KA 1TNJA 1OP0A 4K8YA 3SV2H 1FY3A 3M3TA 1P11E 4ABAA 4DW2U 1W2KH 1K1OA 1EAXA 3ODDA 3NZIA 1LDTT 5E2PA 3MU1A 3OYPA 1GBCA 2ZU3A 1O2ZA 3UQVA 3UPEA 3PWBA 1GVKB 3O8RA 5C20A 1F0UA 2CV3A 1MD7A 4IMQA 4BAQB 4YM9A 1A5HA 1C5YB 1ZMLA 5A2MH 4SGAE 2OD3B 3A89A 5J4SA 1CVWH 1GBBA 2UWPA 3P8NA 2PKSB 4U32A 2UWOA 1OS8A 1F7ZA 2VVVA 3PMJA 2ZDKA 3SBKA 1PPHE 2VVUA 4PROA 2AMDA 1AD8H 3RXRA 2BD2A 1AB9B 1YP9A 1N6YA 1EJMA 3RU4T 2BD9A 1DITH 3RC4A 1S84A 1ARCA 2STAE 2BLWA 1FY4A 3UOPA 4E06H 2JKHA 2ZHDA 3UNRA 1NPMA 3SI3H 1GL0E 4BXSA 1TNIA 3ATKA 2ZFQH 3M3SA 4CRGA 1HAGE 4CREA 4KP0A 2FP7B 4MPWA 2Y7ZA 3SJIA 1MMJN 1BMNH 1TONA 2ZHQH 4XSKU 1GHVH 1S82A 5GCHF 1ZGVA 1A61H 4NWKA 1ZRBA 1A0HB 1EB1H 1AE5A 1IOEA 1C1RA 2NWNA 3S0NA 2HOBA 3IG6B 1FN6A 1P57B 5EQQA 4RSPA 2ZPQA 1UVSH 2Z3DA 3D65E 4FUHA 2AFQB 4CRCA 3S7HB 1V2TT 5JBCS 4WY3A 4UDWH 1BCUH 1GI8B 3BV9B 2CHAB 1G37A 1NESE 1GHWH 1CQQA 1NFWA 2AERH 4JYVH 1T7CA 3LT3A 3BTKE 1GHAF 2FOFA 1MKWK 2ZU2A 1SLUB 2FZZA 1O2HA 2TGAA 1FY1A 4FU8A 3EE0B 2ZGXH 5AF9H 8KME2 2ZECA 3VB4A 2ZO3H 4ABDA 1EQ9A 1TAWA 1XKAC 2Z94A 4I8GA 4DGJA 1BTHH 1DUEA 1QR3E 3GCHB 4B71A 4ABBA 2F9NA 1G32B 3A85A 2Z9KA 3LGWA 3T26A 1O34A 1TBQH 4DT7B 1HJ8A 1MKXK 2HWLB 5C1UA 1NT1A 3ZZ8A 1W10U 2ZI2H 3M5NA 3VGCC 2G81E 1ELVA 2GCTB 3M5MA 1P2OA 4D7GA 1NTPA 1FJSA 1C1WH 4SGBE 3MNBA 1QBNA 1HAHH 3O8DA 2BHGA 1FIWA 1UCYE 1UK2A 2Y5FA 3UNSA 1BTUA 1P2JA 3LH3A 1TE0A 1INCA 1HPGA 2XBYA 1O2TA 3LDXH 3CENA 2ZCKP 1SMFE 1ELCA 5C1YA 1F0RA 2RG3A 4X8TH 1AFEH 5JDUB 5JBAS 2QF3A 4D9RA 1YC0A 3SZNA 5I46H 1KXBA 2NU2E 5GPIB 5LPEA 2D8WA 3C27B 4WXVA 4YOIA 3SV8A 2P95A 1QCPA 1ZHRA 1BMAA 3JZ1B 4A1VA 4H4FA 3U69H 3TK6A 1C5UA 1QL7A 3SGBE 2CJIA 1BB0B 3S7KB 1NFYA 3P95A 1QB9A 1THSH 3V3MA 4WMDA 2OC0A 5GJ4B 3P8FA 4X8VH 1V2KT 4Y0ZE 3NWUA 4ZKRU 2C8YB 1DY8A 3ZZCA 1IQIA 4AORA 4BTIB 1MBMA 3UNQA 1EOJA 5FCRA 3SO3A 5LPRA 1AVXA 1E34B 1W3CA 4FVBA 3GDSA 6CHAB 1ANDA 3QTOH 4X6OA 5EQRA 2VB0A 3S9AA 4A5TS 1SFQB 5F8ZA 2ZHEH 3NUMA 1EZSC 9LPRA 1SR5C 4NFEA 1A3BH 1O2KA 1J9CH 7GCHG 1QJ6B 1UVTH 2QXIA 1HAXB 1ZSKA 3SUGA 1BMMH 1TNHA 4MG3A 3SU0A 3OY5U 1GJDB 1MUEB 2FYRA 1KLJH 1J16A 3MNSA 1PPGE 4KELA 5EW1H 1MKWH 2A2XH 5FCKA 5DO4H 2Q1JA 1N1LA 3VB5A 4JZ1A 5FX5A 1EP5A 1ZPBA 4ISNA 1QURH 3SORA 1MCVA 2UWLA 1GBLA 1D3DB 4INKA 4FUBA 5G4BA 3GCOA 4B74A 6ESTA 2ZP0H 4FUIA 1D6RA 1BMLA 1SGEE 2WPKS 1MQ6A 1O3EA 1V2LT 2A7CA 3VB3A 2BM2A 2ZGBH 1TPPA 1GHYH 4RN6A 3R3GB 1L1NA 3QGNB 3DFJA 1HAZB 1YPHC 2ZGJA 1RTLA 2GDDA 3PTNA 2ZTYA 4IC6A 1CU1A 4A1XA 1O2YA 1O2MA 1P3EA 4I31A 4ZH8A 1RFNA 1AU8A 2WPHS 1OWDA 1O32A 1TNLA 1MU6B 5DG6A 5AFZH 1Y5AT 2C8XB 1C5LH 1TNGA 2P59A 3HKJB 3ITIA 3M7QA 5A09A 4Y11E 1TX6A 2BDIA 1QHRB 1P2QA 2XC0A 5IYTA 1GBTA 1GJ4H 2ZCLP 2GKVE 1K1NA 1PYTC 4ZXXH 4Q2KA 2PW8H 1TOCB 2HALA 3IITA 1DOJA 1HYLA 1A3EH 1GJ8B 3OU0A 3PM3A 3RDZA 1F5LA 2A5IA 2BB4A 3FVFB 1QQ4A 2A7JA 2FI5E 4B2AA 1O3GA 1BBRE 2PFEA 2P3FH 4HZHA 1GGDC 3M5OA 2GMTC 3SUFA 1LHGH 5LPFA 1SQOA 2H9EH 2GTBA 2JH6D 3FFGA 1VCQA 3M7TA 4D76A 1SHYA 3SQHE 1MCTA 2ZFFH 1TGTA 1V3XA 1AO5A 1L1JA 3MNXA 2H2ZA 3LC5A 1BA8B 2CN0H 3TH4H 3LKWA 1HCGA 1O3DA 3SU3A 1TQ7B 1CHGA 3GDVA 2A2QH 3VEQB 1ELDE 2J2UA 2ZTZA 4BTTB 3A7YA 2XXLA 5FHTA 4WXIA 1H8DH 3GICB 1J15A 2OBQA 3MH5A 4UD9H 1GI3A 3W94A 1AVGH 3PWCA 3AAVA 1GCDA 5GDSH 2R2MB 2ZF0H 1Y3XA 1K28D 1P9SA 1A46H 2RDLA 4JK5A 3RXLA 5EU8A 4AYYB 2EI6A 3D62A 5J4QA 1P06A 3LC3A 3SU2A 3LH1A 3HGNA 1NU9A 4DURA 2P94A 2J9NA 1UK3A 3RXFA 2EC9H 2A4QA 1AY6H 4INHA 2VIWA 2TPIZ 1O33A 2QXJA 1OWHA 1AZ8A 3UR6A 2P8OC 1W14U 5GCHG 1PFXC 1MTUA 4NZLA 2Y5GA 1SSXA 1ANBA 1HAVA 1C5XB 1YF4A 1J14A 1A4WH 2FLRH 2J92A 1PQAA 5CE1A 3ODFA 3GYLB 4AGKA 2VGCB 1V6DA 2O8WA 1KDQB 1K1IA 5A0CA 1MQ5A 2QXGA 1MU8B 5DGJA 3RXCA 2BDBA 2ODPA 3RXOA 5FAHA 1GHAG 2WV5A 5DP3A 2B5TB 5GXPA 1ESBA 2XBVA 2DUCA 1C5RA 1JMOH 1EAIA 2OP9A 5DP6A 5L2YH 1GBAA 1P04A 1AUTC 1GBDA 1EJNA 2UUFB 1IHTH 4NZQA 3I78A 2BVSH 1ZHMA 2ZIQH 4DVAU 1E38B 1O5DH 2ZU1A 1S83A 2J95A 2WPJS 3T27A 2KAIA 3EQ0H 1FPCH 1YPLH 3M35A 3TH3H 2A5AA 1TNKA 8GCHF 3LJOA 2EI7A 1W12U 5JBBS 4OS1A 2PKAB 1VGCC 3M7UA 1GJBB 3LU9B 3AAUA 3TJOA 1O2PA 2HRVA 1QB1A 2VINA 2A32A 3F9HA 4YESB 4Z6AH 1H4WA 1FAXA 3MU8A 3TVJB 1ARBA 1QJ1B 1O3MA 4ZKNU 4UFFH 3U98H 1SOZA 5EXMA 3STIA 3QX5H 3FP8E 2OQUA 3M61U 3HK6B 1GJ7B 1AFQC 1ZTLA 2PGQB 2EI8A 3RXAA 5EPYA 2TGDA 5C1XA 1NFXA 2OTVA 3KQBA 4TY6A 4WWYA 2IJOB 4YO9A 3RU4E 5FPTA 5TCCA 2FOBA 4FXGH 1O3NA 1JRSA 1RD3B 5C2ZA 2IN2A 1OWJA 1QGFA 5LH8A 2QGRA 1P2IA 4Y0YE 1IQMA 4ISLA 3ZV8A 1D6WA 3BIVH 1ACBE 3A8BA 3ZV9A 2CMYA 2GD4B 1OP2A 1UTOA 1XUJA 1C2DA 3TITA 3LPRA 2BDGA 3PO1C 1CA8B 4F4OC 1TMBH 2HLCA 4KTSA 1GWAA 4VGCB 2BY7X 1GG6B 2K1QA 1EOLA 1HIAA 2PUQH 2ODQA 5C5NA 3U1IB 2SNVA 3SJKA 1L2EA 1NRRH 1QA0A 1QY6A 1AWHB 1UCYK 2BVXH 1C4U2 1SGIB 2HNTE 4CHAB 1C5ZB 1OP8A 1EASA 1QRXA 1O2RA 1C2LA 4R0IA 2BY6X 1K2I1 2ZKSA 3OTJE 1TX7A 1P01A 1V2UT 2H1UA 5E0HA 3EGKH 3E1XB 5JB8S 1ZPCA 1TFXA 2ULLA 2BYAX 3SOSA 4BANB 4FUDA 2M5TA 2FI4E 2A4GA 2FX6A 3ZYDA 2BD5A 2ALVA 3RXQA 1T4UH 3LGVA 1GMDG 3SNCA 1QB6A 1SGFA 1F2SE 2BMGB 3URCA 1UTLM 1O36A 2FI3E 1A7SA 3LGUA 1RGQA 5HM2A 1YCPM 3MU4A 1DICA 1N8OB 1YPJH 4NIYA 4K1SA 2RA0A 3ZVGA 2OUAA 4BAHB 1TPAE 1P3CA 1Y5BT 1QBVH 4CBNA 1C9PA 1Z1JA 3A8CA 2Q6DA 3UREA 2BD8A 2ZHWH 2WYGA 2Y82A 1DXPA 4YOGA 1O2VA 1DWEH 2SFAA 2FMJA 1K1MA 3MU5A 5FPSA 1TPOA 1K1JA 1LPKB 3MH4A 5C5OA 1BQYA 1N6XA 4D7FA 1J8AA 1BTZA 1V2QT 3ZYEA 1DFPA 2PKSC 1V2ST 4E7NA 4NIWA 3RXUA 3HATH 3UWJH 4F49A 2I6SA 3RM2H 3SNAA 4ABGA 1LHFH 1XKBC 1SGTA 1PPZA 4X6MA 2WYJA 1ELFA 1Z6EA 3SN8A 4BAOB 1SB1H 1C5PA 1YM0A 2GZ9A 3Q3YA 4X8SH 2TRMA 1O2GH 2W26A 3CS0A 1O0DH 1T4VH 1KTTB 2XRCA 1NY22 3SNDA 1O2LA 1BDAA 4CRBA 3LJJA 2C90B 2J38A 2LNCA 1EJAA 1TBZH 1HAOH 3ATIA 1GJ9B 3GY4A 2ZDNA 3RMNH 3SQEE 1C5WB 1PJPA 4MPVA 1K21H 2WPMS 1GDUA 1L1GA 3KQEA 4J1YA 3E90B 1C1TA 1AKSA 4K3JA 3G01A 1LVOA 2BTCE 2TIOA 3A82A 4MQAA 3UFAA 3F68H 2CF9H 5CHAC 2C8ZB 1DWCH 3Q3XA 1BUIA 1RXPA 3P17H 3SGAE 1SGQE 2F9UA 1O5BB 2CHAC 4MPUA 1C2JA 3GY2A 4K2YA 3GISB 1O3AA 1TB6H 1DUAA 5GIBA 3ZZ5A 1BITA 3UOUA 1XVOA 3FP6E 4ABFA 1G2MA 1TABE 4KGAA 1S6HA 2PUXB 3BTDE 4OS5A 1MTNB 2O8LA 1MAXA 1JWTA 1IQNA 2SNWA 2GP9B 2WV4A 4X2YA 2H6MA 3A8AA 2AYWA 4AG1A 1LVBA 4FUJA 3VGCB 3V0XA 3HPTB 4A92A 2BDAA 2IPHA 2OINA 1DSTA 1NU7B 1K1LA 3MHWU 3BG4C 4NIVA 2ZTXA 5DP8A 3E8LA 2WUCA 2C8WB 4MVNA 1LQDB 2Y7XA 1PPBH 5EW2H 1TA6A 6GCHF 2FM2A 2JETB 1P2NA 1FUJA 1HIAB 2GCTC 3AW0A 4AOQA 1E36B 1GJ5H 1KTSB 1ZMJA 3ESTA 1OX1A 2OC8A 4MNYA 3RC6A 4NGAH 3O8BA 1TALA 2FEQH 1NN6A 1J17T 2AS9A 2OQ5A 2ZPSA 1ANCA 3M5LA 3M3VA 3OX7U 1W8BH 2H9TH 4LXBH 1XVMA 3RC5A 4GLYA 3VXEH 1O3IA 1Z8GA 3D23A 2VU8E 1P2KA 2BDCA 4HFPB 2F83A 1HDTH 1TGCA 1P05A 2R2WU 5T6FA 1KSNA 3P70B 3MU0A 2GV6A 1RIWB 3GY3A 1LQEA 1MD8A 1ELEE 1BRBE 1EB2A 4JZEH 3BTEE 8GCHG 1W7GH 4KKDA 3F6UH 2AMPA 2FDAA 4NWLA 3QGJA 4AGJA 1NM6A 1O38A 2BD7A 1O31A 4UFEH 3ZVBA 1D4PB 1UO6A 3ZVAA 4GHTA 2QXHA 2HNTC 3SUDA 3P8GA 3TGKE 2W7UA 1O5EH 2XCNA 5HYOA 1TRYA 2Z3EA 3MNCA 4AX9H 2V0BA 3E91A 3FAOA 4FU9A 1GMHF 1C5SA 2NU3E 3A7XA 4AG2A 2AIPA 1UHBA 6CHAC 1A5GH 1EX3A 3L3TA 1MZAA 2FXRA 1D3TB 3TJVA 3URDA 1O37A 4GVUA 1EPTA 1ESAA 1QTFA 4LOYH 4IS5A 5AFYH 3VPKA 1FDPA 1YYY1 4GCHF 4XBCA 2PLXA 3SV7A 3TK5A 1XUKA 5F03A 1YLDA 2VWMA 2VVCA 4B76A 1AZZA 1MTSA 2P3TB 1TWXB 2AGIX 4Y79A 4ZUHA 1ZR0A 2R0KA 3LGYA 2PWXA 1Y59T 1IQKA 2G4TA 4B2CA 1MKXH 5FBEA 1O2SA 2O8UA 2O8MA 4MDSA 3RXMA 1PPEE 1C1PA 1RTKA 2ZEBA 3QZRA 1ESTA 3D49H 4X0WU 4DIHH 5AVDA 3KQCA 1ZTKA 3H5CB 1O2WA 1DT2A 3GCTF 2BXUH 5A8YA 2VIVA 4YT6H 2AIQA 1ZPZA 2PHBA 3RU4D 4YTAA 3QLPH 1V2VT 3O8CA 2EEKA 3RXSA 4NIXA 2F9OA 2ZPRA 4IN2A 4GPGA 1W7XH 4JZDH 2P16A 1EAUA 2B8OH 3ZZBA 4MNXA 1QL9A 1WUNH 1NFUA 1YCPK 1YLCA 1V2WT 3ZVCA 3Q00A 3EDXB 3AVZA 1AUJA 1JIMA 1OWEA 2A4RA 1EAWA 2F9BH 1Y8TA 4UEHH 3FANA 2FPZA 1BTPA 1KXAA 1DLEA 1BIOA 4WH8A 2FYQA 1HAPH 3UY9A 2GMTB 1Y3WA 1CBWC 2GT7A 3K6ZA 3JZ2B 3SJ9A 2GDEH 2FOGA 1T8OA 1AE8H 3A7TA 4JCNA 4Y8YA 2I6QA 1H8IH 3U8OH 1C2MA 2AH4X 1C9TA 5JBTA 3A80A 3RP2A 4IMZA 1QRZA 3AW1A 3A8DA 2A1DB 1AQ7A 5A8XA 2Z3CA 4ZAEA 1O2QA 4D9QA 1S81A 4WMFA 1B5GH 1G9IE 4Y7AA 1K9OE 1DX5M 4MNWA 1DPOA 1H9LB 1OKXA 1HJAC 3EA9A 2Z9IA 3SJOA 5DJ7A 4ZROA 3ATWA 1IQGA 5SGAE 3E0NB 1PQ5A 4OS4A 3KQDA 5EODA 2ZG0H 2TBSA 1HFDA 4LZ1H 1UTQA 2BD3A 1XUIA 1FXYA 1FZZA 1ZJKA 4GUXA 3RLYH 2WUBA 3PLBA 2A4OA 3A7VA 1O3CA 1Y3VA 1JXPA 3ZZ4A 1UVUH 1C2EA 2BY8X 3F9FA 4X1SU 3A88A 1S0QA 2A45B 4DY7B 4FUGA 1HAYB 3VB7A 2OLGA 2P8OB 2R3UA 3SUEA 1BRUP 2VIPA 1XUHA 1GBIA 3BIUH 4ABJA 1ZSJA 5FX6A 1U6QA 3S9CA 2FLBH 1ZRKA 1L4DA 3H7OA 1SGRE 2OC7A 2FOEA 1V2JT 1GI7B 1T8LA 4X8UH 5BPEA 2H9HA 3HKIB 2FOCA 2W3IA 1CA0C 1Z71A 2VIDA 1KY9A 4NSYA 4YT7H 1FV9A 1Q3XA 2VGCC 3A7ZA 3KN2A 2QF0A 3SU1A 1AWFH 3CS7A 2XWAA 4MLFB 1EPTC 1TPSA 1SGYE 2D26C 3EYDA 2JH5D 1WAYB 3B8JA 4OGYA 2G52A 1SOTA 1ZTJA 4DG4A 3SNBA 1O5CB 3ATLA 1SLWB 1YPGH 3MTYA 4ASHA 5EG4A 1H1BA 1YCPH 3PMHB 1XXFA 5EXNA 2A31A 1SGNE 4B73A 3E16B 2Y80A 1OWIA 2FO9A 2J34A 5DP5A 3RXGA 4Y10E 3WY8A 3UR9A 2FESH 3I29A 3RXVA 5HXFA 4Y76A 5DK1A 1Q31A 4U30A 1FI8A 2Q6FA 4Y8ZA 3U8TH 4WF8A 3UUZA 1VGCB 1GI1A 3STJA 3EA8A 2NU0E 1S5SA 4ISHH 1AN1E 1CGJE 2FODA 2PSXA 1Q2WA 1FAKH 1T8MA 1O35A 4GAWA 1YPMH 4WJG2 1C5QA 6GCHG 3V7TA 4J2YB 5CMXH 1W11U 4K1TA 1BHXB 4Q7XA 2XBWA 2BY9X 3BTFE 1VITF 2VH6A 4JYTA 3PB1E 3VXFH 2XBXA 1WOFA 3BG8A 4TPYA 1V2NT 1GBEA 4IN1A 2F9VA 3SU5A 1V2RT 1CGHA 1VZQH 1AFQB 3A83A 2C3SA 4Y71A 3RMOH 1TA2A 1YPKH 3MOCA 3LIWA 2AMQA 1WBGB 2ANMH 1THRH 1JBUH 1FY5A 2ZU5A 3PV4A 1Y5UT 2GX4A 4FU7A 1QBOA 4CRAA 1GCTC 2ZCHP 4AN7A 1WV7H 3RUOA 3U9AH 4Q80A 3RXTA 3ATMA 1HAIH 2BLVA 3QN7A 4ESTE 1SQAA 1GI6A 4X2VA 4JZFH 1AVWA 1BTYA 1UK4A 3BSQA 3P6ZB 1C2FA 2G5NA 3TLOA 1GJ6A 1KXDA 4Q7ZA 2SGFE 3A81A 2ZDVH 1UTPA 3PO1B 1H9HE 3F9GA 1DLKB 4KTUA 2NU1E 4X1RU 1D3PB 1E0FD 1IAUA 4OS7A 1A5IA 2LPRA 2Y81A 1O2OA 3ZZ9A 3NKKA 3Q3KA 8LPRA 2Z9JA 1CGIE 4ZHAA 3QWCH 1DVAH 4JZIA 3PYHA 1L4ZA 2EA3A 1GG6C 1C1UH 1GMHG 1C2GA 1C4V2 1GI0A 1RS0A 1YPEH 3ZZ6A 4IGDA 1SC8U 2GT8A 3MFJA 1AGJA 1IQEA 4CR9A 1UTKA 2HPPH 5C67A 4THNH 1DWBH 2ALPA 2VIOA 3CP7A 4CHAC 1IQHA 1LHDH 1WSSH 4I7YH 1PQ7A 3Q77A 3L33A 3DUXH 4GCHG 2J4IA 2VH0A 4ABEA 3RXEA 2XCFA 3I77A 4BAKB 4E05H 3BTWE 2G4UA 4O3TA 1AHTH 2UUKB 3RXIA 5IDKA 5E8EH 4QT8C 1EXFA 1DDJA 1CT0E 1SPJA 4B1TA 1BTWA 2YNAA 5B6OA 5F8XA 2PGBB 4AZ2B 2CGAA 2ASUB 2B9LA 4AFSA 2UUJB 5GWZA 2BY5X 3F9EA 4MTBA 3SHCH 2XNIA 2ANKH 2Z9GA 4UFDH 3MWIU 1F5RA 4E7RG 2WPIS 1BRCE 1QRWA 4AFZA 3SGQE 2PSYA 1TMUH 3OY6U 4MNVA 1HBTH 2GVFA 1ZLRA 3IWMA 4K8BA 2O9QA 1HAVB 3SV9A 1LKAA 1VITH 2STBE 1ELBA 1N8OC 1C2KA 2OBOA 1W13U 3GCTG 1OYTH 1ETTH 3SU4A 5K7RA 3LONA 2W7SA 1PPCE 1QQUA 4HTCH 4DIIH 1F0TA 1UVPA 3U8RH 1Z8RA 1LHEH 1FIZA 1ZSLA 1YKTA 5FXLA 1WCZA 3BF6H 3TNTA 1NRSH 1T31A 1PQ8A 2J94A 3K9XB 3UWIA 2QCYA 1TLDA 5A0AE 1BHXF 4BXWA 4H6TA 1EUFA 1GHBF 1MBQA 4O9VA 1NRPH 4IW4E 1ABJH 1YPHE 1AB9C 1BJUA 2UUYA 1GHZA 2ZFRH 1O3KA 3A7WA 2BX4A 4XE4A 1C4Y2 2KAIB 2F9PA 4YLQH 4A6LA 2QA9E 4MPXA 1SVPA 1Z8IB 4X1NU 1O3PB 1O3LA 3BEIB 4K69A 4H6SB 4NA9H 1G36A 3QTVH 4TPIZ 1HJ9A 1NRNH 2G00A 4YZUA 4BOHA 2G51A 2V3HH 3NXPA 4GSOA 1FLEE 2TGPZ 3Q76A 4M7GA 3N7OA 4ZHLU 1P0SH 1ELTA 1FN8A 1RRKA 4XFQA 1B7XB 3M37A 1LO6A 2QYIA 5C3NA 1CT4E 2R3YA 4FUFA 2Z6BD 4NG9H 3C1KA 3QO6A 3KCGH 4ISIH 1KLIH 4AFUA 2ZDMA 1CT2E 3TU7H 1UCYH 2V3OH 5DP9A 1Y3UA 5DP4A 1SGDE 1SGFG 1P2MA 1OSSA 1XMNB 4CRDA 3RXKA 2DE8A 5L6NH 3RMLH 5CHAB 1GI9B 1DSUA 1C5TA 2V6NA 4I8HA 1TGSZ 5HM9A 1A1RA 2ZGCA 1SI5H 1RTFB 2SGPE 4I33A 1GL1A 2GCHF 2FTLE 2A0QB 3LGIA 3FZDA 3T5FH 1EZUC 2OC1A 1RJXB 2BZAA 4FVDA 1DWDH 1G2LA 1LVYA 1K1PA 2G5VA 4O97A 4WVPE 1MTVA 1A0JA 1DY9A 1EKBB 4U01A 3E3TA 3K2UA 1HGTH 3GCHC 2PTCE 1C5OH 2Y6TA 1THPB 3HK3B 1BOQA 1ABIH 2ZQ2A 1BBRK 3UIRA 2CXVA 1MTNC 2BLQA 2GZ8A 2XYAA 3MO9A 3BG4B 1KLTA 4LZ4B 2HPQH 5FPYA 3DT0H 1JOUB 1NS3A 3BEFB 1KXCA 1P02A 4WH6A 2C4FH 1GJAB 5EGMA 3NCLA 3RM0H 3RXJA 1QL8A 3F1SB 1ZHPA 2TGTA 5TCAA 3H7TA 3T29A 1ID5H 1TMTH 2JETC 3HGPA 1CO7E 1GJCB 2ANWA 2YOLA 5ESTE 4BNRA 2IOTA 2THFB 5A8ZA 1G3DA 2O8TA 3MO3A 1QJ7B 1A2CH 3MYWA 2WINI 4FUCA 4OGXA 5E0GA 1MH0A 2VIQA 3QZQA 3UTUH 1VJ9U 1SHHB 4CRFA 2SGEE 3PMAB 3TJNA 4JYUH 3TJUA 4RKJB 2AGEX 3GY8A 3TGJE 2B7DH 4YLUA 1UTJA 1F92A 4O03A 4AB9A 1OOKB 1JIRA 1LMWB 2ZC9H 1X7AC 1LTOA 2ZQ1A 2V35A 2ZNKH 3KNXA 1C1NA 3P92A 1RIWC 5L2ZH 1ZZZA 4UONA 4IC5A 3P8OA 3BEUA 2ZGHA 3L6PA 2Z9LA 3ZZ3A 4X6PA 5FBIA 4DJZB 4IBLH 2G8TA 2JH0D 5EPNA 1V2PT 1UTNA 1LHCH 2WPLS 1ELAA 3RXPA 3W95A 4OS6A 2BLOA 3LGTA 1TQ0B 1BJVA 4CBOA 1VITG 1GMCF 3E6PH 1HV7A 2FIRH 1QIXB 1S6FA 1ETRH 3SHAH 4A1TA 2R9PA 4HGCA 1CHOF 2BX3A 4TWWA 2AEIH 2BDYA 1KDQA 4K60A 3NPSA 1O5AB 4Y8XA 4ABIA 7ESTE 1VCPA 5TJXA 4CH2B 4ZMAH 5HGGA 3ZVDA 3E0PB 1ORFA 3BTHE 1T8NA 4ZHMU 1CE5A 1ZYOA 2QV1A 1GDQA 4TWYA 4RKOB 3SU6A 5PTPA 1O2IA 2RA3A 4KTCA 1TRNA 3UQOA 2BOKA 2ZFSA 2B0FA 3GY7A 4INLA 1HNEE 5HMAA 1HUTH 2ANYA 3TGIE 1TGBA 2ZDAH 3TK9A 4CH8B 1XUFA 2H5CA 1LPGB 1V2MT 2ZDLA 4GHQA 1V2OT 4JMYA 3BTQE 3AASA 1E37B 3VB6A 2FS9A 4ZKOU 3QK1A 1YGCH 2PKAA 4CR5A 1AI8H 1GMDF 1LPZB 1GHXH 3ELAH 1BBRH 1KXFA 3A84A 4X2XA 1ETSH 4XBDA 1KIGH 2PTNA 4XDEA 3QDZB 1WTGH 1GVLA 3ENSB 1FQ3A 1C1SA 3ZVEA 1C2HA 4NA8A 2QY0B 3BN9A 4NFFA 3B23B 1OXGA 1SFIA 1IQLA 1C1MA 1G3CA 5T3HA 1O2XA 1AKSB 5EOKA 1XUGA 2HVXA 4NA7A 3VFEA 4AYVB 1NROH 4I8JA 1EATA 1C5MD 1NRQH 1UJ1A 1JRTA 1BT7A 2NU4E 1IHSH 4BAMB 1WU1A 2RCEA 3V12A 1NZQH 5DPAA 2SGDE 2FX4A 1SLVB 3BTME 3DHKH 1TX8A 2YNBA 5JB9S 4AFQA 1C1VH 3DD2H 5ESBA 4TY7A 2BQWB 3BTTE 2FWWA 3KHVA 1ZJDA 2ODYB 2ZFTA 1GGDB 1P03A 1WQSA 1ZGIA 3TIUA 1DM4B 1EZXC 1KXEA 2G55A 1O3JA 1G30B 1CSOE 3BTGE 1SL3A 2A5KA 5H4IB 1CBWB 2HGTH 4DCDA 2PR3A 3A87A 5BRRE 4WMEA 5DP7A 1XXDA 4Y7BA 3GYMA 1K22H
chains in the Genus database with same CATH superfamily
1P8VC 1VR1H 2FOHA 2SGQE 1Z6JH 3SI4H 1L0ZA 2VJ1A 1VJAU 2DE9A 3OAAD 1SGCA 1DS2E 2F3CE 1SBWA 3PTBA 4H42U 1K0HA 1S85A 4TYDA 3PLPA 2CF8H 2ZZUH 2HNTF 3DA9B 1GI5A 3KIDU 1HJAB 3ZVFA 3EE7A 4HI3A 1TBRH 1OPHB 4XOJA 1UMAH 3R0FA 3GOVB 1C5VA 5EQSA 2P93A 2LP6A 2XW9A 1C2IA 1GBHA 2XTTB 1GHBG 1PPFE 3KF2A 2QN5T 4R8TB 1NO9H 1Z8JB 4X2WA 1O30A 1WTHD 2A7HA 1O5GH 5T6GA 3RXBA 2QC2A 2XC5A 1HXEH 3SNEA 2ESTE 3ZZ7A 1WQVH 4D8NA 6LPRA 3MH6A 4U2WA 4ZKSU 1KYNA 3RLWH 1D3QB 1D9IA 3S69A 4OS2A 3PMBB 5KGOA 5EXLA 3MH7A 5E2OA 1BTXA 5AHGH 5ABWA 1P9UA 2FOMB 2BD4A 1GBFA 1O5FH 4AC9A 4B2BA 1VCWA 5C17A 2AGGX 1TYNA 1A0LA 1FPHH 2Y5HA 2KX4A 4XBBA 3PROA 1T32A 1W0YH 2KCPA 2BZ6H 1XX9A 1C1QA 3PV2A 1H9IE 3FP7E 1ZOMA 3SW2B 1OYQA 1EZQA 3TPIZ 3GCNA 5I25A 4K1EA 2VWNA 4B75A 3DFLA 3GY6A 2D1JA 3K6YA 4Y6DA 5EIYA 1TOMH 3T62A 1C1OA 7KMEH 3EA7A 2GV7A 4I32A 1UHBB 1CA0B 2R0LA 4ABHA 4DOQA 2YMSC 3LOXA 2XWBI 1B0EA 1O3BA 1EPTB 1WYKA 2GCHG 4NSVA 4I8LA 4AB8A 3KEEA 2ZU4A 2WV9A 4ZXYH 3T2NA 2H5DA 4O3UA 1AIXH 1E35B 1SG8B 1DANH 1UTMA 1G3EA 4I8KA 1GDNA 1HXFH 1TIOA 2ZHFH 5ETXA 3KGPA 1G3BA 3OSYA 2Q6GA 1M9UA 4ISOA 4JK6A 4Z0KA 3K65B 1DXWA 3V13A 2GGVB 1BRAA 1PYTD 3U1JB 2D2DA 1W0KD 1GBJA 3B9FH 2M2AA 5F8TA 3T25A 2ZFPH 1QNJA 3KL6A 4NCYA 2BDHA 1HRTH 1O3OA 2IJD1 1SQTA 1SLXB 1GPZA 5K0HA 2VWOA 3M36A 1GI4A 1P12E 3GDUA 1O2NA 3RXDA 2Z7FE 3QUMP 1TGNA 2QAAA 2BOHB 2QIQA 4UFGH 1MTWA 2QE7D 3TH2H 2OCVB 1FONA 2HVYB 1IQJA 1W0ZU 1GVZA 4LK4A 1Y3YA 3A86A 2BXTH 7GCHF 3S9BA 3NK8A 2P3UB 1ELGA 1FY8E 1GCTB 2GZ7A 3ZZDA 1C5NH 4K5ZA 1P09A 8ESTE 1YLNA 1XM1A 3GY5A 1UVOA 4A7IB 4YOJA 1QA7A 5DKMA 1B0FA 5E0JA 3PLKA 1S0RA 2BQ7B 2FTMA 1LCYA 2VNTA 4Q7YA 1GI2A 1AMHA 1GBKA 4RT1A 4BTUB 2FOAA 5LGOA 1MAYA 2W5EA 1Z1IA 2VWLA 5F6MA 1MZDA 3RXHA 1HLTH 1SGPE 1TRMA 1FMGA 3F0OA 1YBWA 1LVMA 2PV9B 1OHHD 1O3HA 3FZZA 3ZZAA 5L30H 4VGCC 1GBMA 2ZWLH 1F0SA 1QFKH 4X1QU 4X6NA 1MABB 1GMCG 1NC6A 1Z7KA 4ZCNA 1ZMNA 1F5KU 2BQ6B 5T6DA 1BZXE 1O2JA 2GJGA 1CHOG 5A0BA 9ESTA 2JIZD 1IQFA 3T28A 2C93B 2FS8A 3TNSA 3RMMH 3DSOA 1O39A 1O3FA 1OWKA 2XC4A 2BVRH 3MMGA 1DE7H 1LKBA 1HB0B 2ZA5A 3SJ8A 1ANEA 3SV6A 7LPRA 5JYIA 1O2UA 1P10A 4X1PU 2OXSA 3MO6A 4B6FA 3MI4A 2F91A 2ILNA 1FNIA 4UE7H 3EAJA 4FUEA 1EP6A 5JPMH 2SGAA 2W3KA 1TNJA 1OP0A 4K8YA 3SV2H 1FY3A 3M3TA 1P11E 4ABAA 4DW2U 1W2KH 1K1OA 1EAXA 3ODDA 3NZIA 1LDTT 5E2PA 3MU1A 3OYPA 1GBCA 2ZU3A 1O2ZA 3UQVA 3UPEA 3PWBA 1GVKB 3O8RA 5C20A 1F0UA 2CV3A 1MD7A 4IMQA 4BAQB 4YM9A 1A5HA 1C5YB 1ZMLA 5A2MH 4SGAE 2OD3B 3A89A 5J4SA 1CVWH 1GBBA 2UWPA 3P8NA 2PKSB 4U32A 2UWOA 1OS8A 1F7ZA 2VVVA 2WHXA 2ZDKA 3PMJA 3SBKA 1PPHE 2VVUA 4PROA 2AMDA 1AD8H 3RXRA 2BD2A 1AB9B 1YP9A 1N6YA 1EJMA 3RU4T 2BD9A 1DITH 3RC4A 1S84A 1ARCA 2STAE 2BLWA 1FY4A 3UOPA 4E06H 2JKHA 2ZHDA 3UNRA 1NPMA 3SI3H 1GL0E 4BXSA 1TNIA 4M9FA 3ATKA 2ZFQH 3M3SA 4CRGA 1HAGE 4CREA 4KP0A 5KEDA 2FP7B 4MPWA 2Y7ZA 3SJIA 1MMJN 1BMNH 1TONA 2ZHQH 4XSKU 1GHVH 1S82A 5GCHF 1ZGVA 1A61H 4NWKA 3UAIC 1ZRBA 1A0HB 1EB1H 1AE5A 1IOEA 1C1RA 2NWNA 3S0NA 2HOBA 3IG6B 1FN6A 1P57B 5EQQA 4RSPA 2ZPQA 1UVSH 2Z3DA 3D65E 4FUHA 2AFQB 4CRCA 3S7HB 1V2TT 3UB0A 5JBCS 4WY3A 4UDWH 1BCUH 1GI8B 3BV9B 2CHAB 1G37A 1NESE 1GHWH 1CQQA 1NFWA 2AERH 4JYVH 1T7CA 3LT3A 3BTKE 1GHAF 2FOFA 1MKWK 2ZU2A 1SLUB 2FZZA 1O2HA 2TGAA 1FY1A 4FU8A 3EE0B 2ZGXH 5AF9H 8KME2 2ZECA 3VB4A 2ZO3H 4ABDA 1EQ9A 1TAWA 2AHME 1XKAC 2Z94A 4I8GA 4DGJA 1BTHH 1DUEA 1QR3E 3GCHB 4B71A 4ABBA 2F9NA 1G32B 3A85A 2Z9KA 3LGWA 4F48B 3T26A 1O34A 1TBQH 4DT7B 1HJ8A 1MKXK 3F2FA 2HWLB 5C1UA 1NT1A 3ZZ8A 1W10U 2ZI2H 3M5NA 3VGCC 2G81E 4Z1MD 1ELVA 1W0JD 2GCTB 3SZEA 3M5MA 1P2OA 4D7GA 1NTPA 1FJSA 1C1WH 4SGBE 3MNBA 4F55A 1QBNA 1HAHH 3O8DA 2BHGA 1FIWA 1UCYE 1UK2A 2Y5FA 3UNSA 1BTUA 1P2JA 3LH3A 1TE0A 1INCA 1HPGA 4XD7D 2XBYA 3N7EA 1O2TA 3LDXH 3CENA 2ZCKP 1SMFE 1ELCA 5C1YA 1F0RA 2RG3A 4X8TH 1AFEH 5JDUB 5JBAS 2QF3A 4D9RA 1YC0A 3SZNA 5I46H 1KXBA 2NU2E 5GPIB 5LPEA 2D8WA 3C27B 4WXVA 4YOIA 3SV8A 2P95A 1QCPA 1ZHRA 1BMAA 3JZ1B 4A1VA 4H4FA 3U69H 3TK6A 1C5UA 1QL7A 3SGBE 2CJIA 1BB0B 3S7KB 1NFYA 3P95A 1QB9A 2RFKC 1THSH 3V3MA 4XRNA 4WMDA 2OC0A 4ASUD 5GJ4B 3P8FA 4X8VH 1V2KT 4Y0ZE 2EY4C 3NWUA 4ZKRU 2C8YB 1DY8A 3ZZCA 1IQIA 4AORA 4BTIB 1MBMA 3UNQA 1EOJA 1SKYE 5FCRA 3SO3A 5LPRA 1AVXA 3PV5A 1E34B 1W3CA 4FVBA 3GDSA 6CHAB 1ANDA 3QTOH 4X6OA 5EQRA 2VB0A 3S9AA 4A5TS 1SFQB 5F8ZA 2ZHEH 3NUMA 1EZSC 9LPRA 1SR5C 4NFEA 1A3BH 1O2KA 1J9CH 7GCHG 1QJ6B 1UVTH 2QXIA 1HAXB 1ZSKA 3SUGA 1BMMH 1TNHA 4MG3A 3SU0A 3OY5U 1GJDB 1MUEB 2FYRA 1KLJH 1J16A 3MNSA 1PPGE 4KELA 2JJ2D 5EW1H 1MKWH 2A2XH 5FCKA 5DO4H 1E1QD 2Q1JA 1N1LA 3VB5A 2K8IA 4JZ1A 5FX5A 1EP5A 1ZPBA 4ISNA 1QURH 3SORA 1MCVA 2UWLA 1GBLA 1D3DB 4INKA 4FUBA 5G4BA 3GCOA 3F2HA 4B74A 6ESTA 2ZP0H 4FUIA 1D6RA 1BMLA 1SGEE 2WPKS 1MQ6A 1O3EA 1V2LT 2A7CA 3VB3A 2BM2A 2ZGBH 1TPPA 1GHYH 3ZIAD 4RN6A 3R3GB 1L1NA 3QGNB 3DFJA 1HAZB 1YPHC 2ZGJA 1RTLA 2GDDA 3PTNA 2ZTYA 4IC6A 1CU1A 4A1XA 1O2YA 1O2MA 1P3EA 4I31A 4ZH8A 1RFNA 1AU8A 2WPHS 1OWDA 1O32A 1TNLA 1MU6B 5DG6A 5AFZH 1Y5AT 2C8XB 1C5LH 1TNGA 2P59A 3HKJB 3ITIA 3M7QA 5A09A 4Y11E 1TX6A 2BDIA 1UW7A 1QHRB 1P2QA 4ACAA 5C94A 2XC0A 5IYTA 1GBTA 1GJ4H 2ZCLP 2GKVE 1K1NA 1PYTC 4ZXXH 4Q2KA 2PW8H 1TOCB 2HALA 3IITA 1DOJA 1HYLA 1A3EH 1GJ8B 3OU0A 3PM3A 3RDZA 1F5LA 2A5IA 2BB4A 3FVFB 1QQ4A 2A7JA 2FI5E 4B2AA 1O3GA 1BBRE 2PFEA 2P3FH 4HZHA 1GGDC 3M5OA 2GMTC 3SYJA 3SUFA 1LHGH 5LPFA 1SQOA 2H9EH 2GTBA 3W1EA 2JH6D 3FFGA 3OFND 1VCQA 3M7TA 4D76A 1SHYA 3SQHE 1MCTA 2ZFFH 1TGTA 1V3XA 1AO5A 1L1JA 2J97A 3MNXA 2H2ZA 3LC5A 2V7QD 1BA8B 2CN0H 3TH4H 3LKWA 1HCGA 1O3DA 3SU3A 1TQ7B 1YY3A 1CHGA 3GDVA 2A2QH 3VEQB 1ELDE 2J2UA 2ZTZA 4BTTB 3A7YA 2XXLA 5FHTA 4WXIA 1H8DH 3GICB 1J15A 2OBQA 3MH5A 4UD9H 1GI3A 3W94A 1AVGH 3PWCA 3AAVA 1GCDA 5GDSH 2R2MB 5FL7D 2ZF0H 1Y3XA 1K28D 1P9SA 1A46H 2RDLA 4JK5A 3RXLA 5EU8A 4AYYB 2EI6A 3D62A 5J4QA 1P06A 3LC3A 3SU2A 3LH1A 3HGNA 1NU9A 5GNDA 4DURA 2P94A 2J9NA 2WSSD 1UK3A 3RXFA 2EC9H 2A4QA 1AY6H 4INHA 2VIWA 2TPIZ 1O33A 2QXJA 1OWHA 1AZ8A 3UR6A 2P8OC 1W14U 5GCHG 1PFXC 1MTUA 4NZLA 2Y5GA 1SSXA 1ANBA 1HAVA 1C5XB 1YF4A 5CHBA 1J14A 1A4WH 2FLRH 2J92A 1PQAA 5CE1A 3ODFA 3GYLB 2KR7A 4AGKA 2VGCB 1V6DA 2O8WA 1KDQB 1K1IA 2YMSB 5A0CA 1MQ5A 2QXGA 1MU8B 5DGJA 3RXCA 2BDBA 2ODPA 3RXOA 5FAHA 1GHAG 2WV5A 5DP3A 2B5TB 5GXPA 1ESBA 2XBVA 2DUCA 1C5RA 1JMOH 1EAIA 2OP9A 5DP6A 5L2YH 1GBAA 1P04A 1AUTC 1GBDA 1EJNA 2UUFB 1IHTH 4NZQA 3I78A 2BVSH 1ZHMA 2ZIQH 4DVAU 1E38B 1O5DH 2ZU1A 1S83A 2J95A 2WPJS 3T27A 4FOUC 2KAIA 3EQ0H 1FPCH 1YPLH 3M35A 3TH3H 2A5AA 1TNKA 8GCHF 3LJOA 2EI7A 3DSGA 1W12U 5JBBS 4OS1A 2PKAB 1VGCC 3M7UA 1GJBB 3LU9B 3AAUA 3TJOA 1O2PA 2HRVA 1QB1A 2VINA 2A32A 3F9HA 4YESB 4Z6AH 1H4WA 1FAXA 3MU8A 3TVJB 1ARBA 1QJ1B 1O3MA 4ZKNU 4UFFH 3U98H 1SOZA 5EXMA 3STIA 3QX5H 3FP8E 2OQUA 3M61U 3HK6B 1GJ7B 1AFQC 1ZTLA 2PGQB 2EI8A 3RXAA 2OK5A 5EPYA 2TGDA 5C1XA 1NFXA 2OTVA 3KQBA 4TY6A 4WWYA 2IJOB 4YO9A 3RU4E 5FPTA 5TCCA 2FOBA 4FXGH 1O3NA 1JRSA 1RD3B 5C2ZA 2IN2A 1OWJA 1QGFA 5LH8A 2QGRA 1P2IA 4Y0YE 1IQMA 4ISLA 3ZV8A 1D6WA 3BIVH 1ACBE 3A8BA 3ZV9A 2CMYA 2GD4B 1OP2A 1UTOA 1XUJA 1C2DA 3TITA 3LPRA 2BDGA 3PO1C 1CA8B 4F4OC 1TMBH 2HLCA 4KTSA 1GWAA 1EFRD 4VGCB 2BY7X 1GG6B 2K1QA 1EOLA 1HIAA 2PUQH 2ODQA 5C5NA 3U1IB 2SNVA 3SJKA 1L2EA 1NRRH 1QA0A 1QY6A 1AWHB 1UCYK 2LELA 2BVXH 1C4U2 1SGIB 2HNTE 2KZ4A 4CHAB 1C5ZB 1OP8A 1EASA 1QRXA 4TT3D 4B6EA 1O2RA 1C2LA 4R0IA 2BY6X 1K2I1 2ZKSA 3OTJE 1TX7A 1P01A 1V2UT 2H1UA 5E0HA 3EGKH 4RI0A 3E1XB 5JB8S 1ZPCA 1TFXA 2ULLA 2BYAX 3SOSA 4BANB 4FUDA 2M5TA 2FI4E 2A4GA 2FX6A 3ZYDA 2BD5A 2EQNA 2ALVA 2QF4A 3RXQA 1T4UH 3LGVA 1GMDG 3SNCA 1QB6A 1SGFA 1F2SE 2BMGB 3URCA 1UTLM 1O36A 2FI3E 1A7SA 3LGUA 1RGQA 5HM2A 1YCPM 3MU4A 1DICA 1N8OB 1YPJH 4NIYA 4K1SA 2RA0A 3ZVGA 2OUAA 4BAHB 1TPAE 1P3CA 1Y5BT 3FOAA 1QBVH 4CBNA 1C9PA 1Z1JA 3A8CA 2Q6DA 3UREA 2BD8A 2ZHWH 2WYGA 2J98A 2Y82A 1DXPA 4YOGA 1NBMD 1O2VA 1DWEH 2SFAA 2FMJA 1K1MA 3MU5A 5FPSA 1TPOA 1K1JA 1LPKB 3MH4A 5C5OA 1BQYA 1N6XA 4D7FA 1J8AA 1BTZA 1V2QT 3ZYEA 1DFPA 2PKSC 1V2ST 4E7NA 4NIWA 3RXUA 3HATH 3UWJH 4F49A 2I6SA 4P02A 3RM2H 3SNAA 4ABGA 1LHFH 1XKBC 1SGTA 1PPZA 3OEED 4X6MA 2WYJA 1ELFA 1Z6EA 3SN8A 4BAOB 1SB1H 1C5PA 1YM0A 2GZ9A 3Q3YA 4X8SH 2TRMA 1O2GH 2W26A 3CS0A 3PRDA 1O0DH 1T4VH 1KTTB 2XRCA 1NY22 3SNDA 1O2LA 1BDAA 4CRBA 3LJJA 2C90B 2J38A 2LNCA 1EJAA 1TBZH 1HAOH 3ATIA 1GJ9B 1E79D 3GY4A 2ZDNA 3RMNH 3SQEE 1C5WB 1PJPA 4MPVA 1K21H 2WPMS 1GDUA 1L1GA 3KQEA 4J1YA 3E90B 1C1TA 1AKSA 4K3JA 3G01A 1SQRA 1LVOA 2BTCE 2KCAA 2TIOA 3A82A 4MQAA 3UFAA 3F68H 2CF9H 5CHAC 2C8ZB 1DWCH 3Q3XA 1BUIA 1RXPA 3P17H 3SGAE 1SGQE 2F9UA 1O5BB 2CHAC 4MPUA 1C2JA 3GY2A 4K2YA 3GISB 1O3AA 1TB6H 1DUAA 5GIBA 3ZZ5A 1BITA 3UOUA 1XVOA 3FP6E 4ABFA 1G2MA 1TABE 4KGAA 1S6HA 2PUXB 3BTDE 4OS5A 1MTNB 2O8LA 1MAXA 1JWTA 1IQNA 2SNWA 2GP9B 2WV4A 4X2YA 2H6MA 3A8AA 2AYWA 4AG1A 1LVBA 4FUJA 3VGCB 3V0XA 3HPTB 4A92A 2BDAA 2IPHA 2OINA 1DSTA 1NU7B 1K1LA 3MHWU 3BG4C 4NIVA 2ZTXA 5DP8A 3E8LA 2WUCA 2C8WB 4MVNA 1LQDB 2Y7XA 1PPBH 5EW2H 1TA6A 6GCHF 5DP7A 2FM2A 2JETB 1P2NA 1FUJA 1HIAB 2GCTC 3AW0A 4AOQA 1E36B 1GJ5H 1KTSB 1ZMJA 3ESTA 1OX1A 2OC8A 4MNYA 3RC6A 4NGAH 3O8BA 1TALA 2FEQH 1NN6A 1J17T 4P00A 2AS9A 4ACBA 2OQ5A 2ZPSA 1ANCA 5DSFA 3M5LA 3M3VA 3OX7U 1W8BH 2H9TH 4LXBH 1XVMA 3RC5A 4GLYA 3VXEH 1O3IA 1Z8GA 3D23A 2VU8E 1P2KA 2BDCA 4HFPB 2F83A 1HDTH 1TGCA 1P05A 2R2WU 5T6FA 1KSNA 3P70B 3MU0A 2GV6A 1RIWB 3GY3A 5EJZA 1LQEA 1MD8A 1ELEE 1BRBE 1EB2A 4JZEH 3BTEE 8GCHG 1W7GH 4KKDA 3F6UH 2AMPA 2FDAA 4NWLA 3QGJA 4AGJA 1NM6A 1O38A 2BD7A 1O31A 4UFEH 3ZVBA 1D4PB 1UO6A 3ZVAA 4GHTA 2QXHA 2HNTC 3KQ5A 3SUDA 3P8GA 3TGKE 2W7UA 1O5EH 2XCNA 5HYOA 1TRYA 2Z3EA 3MNCA 4AX9H 2V0BA 3E91A 3FAOA 4FU9A 1GMHF 1C5SA 2NU3E 3A7XA 3WW7A 2AIPA 4AG2A 1UHBA 6CHAC 1A5GH 1EX3A 1NBME 3L3TA 1MZAA 2FXRA 1D3TB 3TJVA 3URDA 1O37A 4GVUA 1EPTA 1ESAA 1QTFA 4LOYH 4IS5A 5AFYH 3VPKA 1FDPA 1YYY1 4GCHF 4XBCA 2PLXA 3SV7A 3TK5A 1XUKA 5F03A 1YLDA 2VWMA 2VVCA 4B76A 1AZZA 1MTSA 2P3TB 1TWXB 2AGIX 4Y79A 4ZUHA 1ZR0A 1FX0B 2R0KA 3LGYA 2PWXA 1Y59T 1IQKA 2G4TA 4B2CA 1MKXH 5FBEA 1O2SA 2O8UA 5F53A 2O8MA 4MDSA 3RXMA 1PPEE 1C1PA 1RTKA 2ZEBA 3QZRA 1ESTA 2PP6A 3D49H 2KCYA 4X0WU 4DIHH 3F0PA 5AVDA 1WXRA 3KQCA 1ZTKA 3H5CB 1O2WA 1DT2A 3GCTF 2BXUH 5A8YA 2VIVA 4YT6H 2AIQA 1ZPZA 2PHBA 5HKKD 3RU4D 3DSPA 4YTAA 3QLPH 1V2VT 3O8CA 2EEKA 3CNRA 3RXSA 4NIXA 2F9OA 2ZPRA 4IN2A 4GPGA 1W7XH 4JZDH 2P16A 1EAUA 2B8OH 2F43B 3ZZBA 4MNXA 1QL9A 1WUNH 1NFUA 1YCPK 1YLCA 1V2WT 3ZVCA 3Q00A 3EDXB 3AVZA 1AUJA 1JIMA 1OWEA 5EJLA 2A4RA 1EAWA 2F9BH 1Y8TA 4UEHH 3FANA 2FPZA 2RDEA 1BTPA 1KXAA 1DLEA 1BIOA 4WH8A 2FYQA 1HAPH 3UY9A 2GMTB 4DT4A 1Y3WA 1CBWC 2GT7A 3K6ZA 3JZ2B 2F4LA 3SJ9A 2GDEH 2FOGA 1T8OA 1AE8H 3A7TA 3GS9A 4JCNA 4Y8YA 2I6QA 1H8IH 3U8OH 1C2MA 2AH4X 3KYFA 1C9TA 5JBTA 3A80A 3RP2A 4IMZA 2V3MA 1QRZA 1QZ8A 3AW1A 3A8DA 2A1DB 1AQ7A 5A8XA 2Z3CA 4ZAEA 2XNDD 1O2QA 4D9QA 1S81A 4WMFA 1B5GH 1G9IE 4Y7AA 1K9OE 1DX5M 4MNWA 1DPOA 1H9LB 1OKXA 1HJAC 3EA9A 2Z9IA 3SJOA 5DJ7A 4ZROA 3ATWA 1IQGA 5SGAE 3OTPA 3E0NB 1PQ5A 4OS4A 3KQDA 5EODA 2ZG0H 2TBSA 1HFDA 4LZ1H 1UTQA 2BD3A 1XUIA 1FXYA 1FZZA 1ZJKA 3DCLA 4GUXA 3RLYH 2WUBA 3PLBA 2A4OA 3A7VA 1O3CA 1Y3VA 1JXPA 3ZZ4A 1UVUH 1C2EA 2BY8X 3F9FA 4X1SU 3A88A 1S0QA 2A45B 4DY7B 4FUGA 1HAYB 3VB7A 4FETA 2OLGA 2P8OB 2R3UA 2W6ID 1BRUP 3SUEA 2VIPA 1XUHA 1GBIA 3BIUH 4ABJA 1ZSJA 5FX6A 1U6QA 3S9CA 2FLBH 1ZRKA 1L4DA 3H7OA 1SGRE 5IK2D 2OC7A 2FOEA 1V2JT 1GI7B 1T8LA 4X8UH 5BPEA 2H9HA 3HKIB 2FOCA 2W3IA 1CA0C 1Z71A 2VIDA 1KY9A 4NSYA 4YT7H 1FV9A 1Q3XA 2VGCC 3A7ZA 3KN2A 2QF0A 5KECA 3SU1A 1AWFH 3CS7A 2XWAA 4MLFB 1EPTC 1TPSA 1SGYE 2D26C 3EYDA 2JH5D 1WAYB 3B8JA 4OGYA 2G52A 1SOTA 1ZTJA 4DG4A 3SNBA 1O5CB 3ATLA 1SLWB 1YPGH 3MTYA 5T1VA 4ASHA 5EG4A 1H1BA 1YCPH 3PMHB 1XXFA 5EXNA 2A31A 1SGNE 4B73A 2JJ1D 3E16B 2Y80A 1OWIA 2FO9A 2J34A 5DP5A 3RXGA 4Y10E 3WY8A 3UR9A 2FESH 3I29A 3RXVA 5HXFA 4Y76A 5DK1A 1Q31A 4U30A 1FI8A 2Q6FA 4Y8ZA 1S6LA 3U8TH 4WF8A 3UUZA 1VGCB 1GI1A 3STJA 3EA8A 2NU0E 1S5SA 4ISHH 1AN1E 1CGJE 2FODA 2PSXA 1Q2WA 1FAKH 1T8MA 1O35A 4GAWA 1YPMH 4WJG2 1C5QA 6GCHG 3V7TA 4J2YB 5CMXH 1W11U 4K1TA 1BHXB 4Q7XA 2XBWA 2BY9X 3BTFE 1VITF 2VH6A 4JYTA 3PB1E 3VXFH 2XBXA 2VBCA 1WOFA 3BG8A 4TPYA 1V2NT 1GBEA 4IN1A 2F9VA 3SU5A 1V2RT 1CGHA 1VZQH 1AFQB 3A83A 2C3SA 2K0QA 4Y71A 3RMOH 1TA2A 1YPKH 3MOCA 3LIWA 2AMQA 1WBGB 2ANMH 5CDFE 1THRH 1JBUH 1FY5A 1VKYA 2ZU5A 3PV4A 3FN8A 1Y5UT 2GX4A 4FU7A 1QBOA 4CRAA 1GCTC 2ZCHP 4AN7A 1WV7H 3RUOA 3U9AH 4Q80A 3RXTA 3ATMA 1HAIH 2BLVA 3QN7A 4ESTE 1SQAA 1GI6A 4X2VA 2WZQA 4JZFH 1AVWA 1BTYA 1UK4A 3BSQA 3P6ZB 1C2FA 2G5NA 3TLOA 1GJ6A 1KXDA 4Q7ZA 2SGFE 3A81A 2ZDVH 1UTPA 3PO1B 1H9HE 3F9GA 1DLKB 4KTUA 2NU1E 4X1RU 1D3PB 1E0FD 1IAUA 3FKSD 4OS7A 1A5IA 2LPRA 2Y81A 1O2OA 3ZZ9A 1YWUA 3NKKA 3Q3KA 8LPRA 2Z9JA 1CGIE 4ZHAA 3QWCH 1DVAH 4JZIA 3PYHA 1L4ZA 2EA3A 1GG6C 1C1UH 1GMHG 1C2GA 1C4V2 1GI0A 1RS0A 1YPEH 2KFWA 3ZZ6A 4IGDA 3U28C 4YXWD 1SC8U 2GT8A 2QF5A 3MFJA 1AGJA 1IQEA 4CR9A 1UTKA 2HPPH 5C67A 4THNH 1DWBH 2ALPA 2VIOA 3CP7A 4CHAC 1IQHA 1LHDH 1WSSH 4I7YH 1PQ7A 3Q77A 3L33A 3DUXH 4GCHG 2J4IA 2VH0A 4ABEA 3RXEA 2XCFA 3I77A 4BAKB 2YMSD 4E05H 3BTWE 2G4UA 4O3TA 1AHTH 2UUKB 2WPDD 3RXIA 3WWFA 2L6OA 5IDKA 5E8EH 4QT8C 1EXFA 1DDJA 1CT0E 1BMFD 1SPJA 4B1TA 1BTWA 2YNAA 5B6OA 5F8XA 3N99A 2PGBB 4AZ2B 2CGAA 2ASUB 2B9LA 4AFSA 2UUJB 5GWZA 2BY5X 3F9EA 3H09A 4MTBA 3SHCH 2XNIA 2ANKH 2Z9GA 4UFDH 3MWIU 1F5RA 4E7RG 2WPIS 1BRCE 2W6JD 1QRWA 4AFZA 3SGQE 2PSYA 1TMUH 4RT0A 3OY6U 4MNVA 1HBTH 2GVFA 1ZLRA 3IWMA 4K8BA 2O9QA 1HAVB 3SV9A 1LKAA 1VITH 2STBE 3OE7D 1ELBA 1N8OC 1C2KA 2OBOA 1W13U 3GCTG 1OYTH 1ETTH 3F3BA 3SU4A 5K7RA 3LONA 2W7SA 1PPCE 3MQKC 1QQUA 4HTCH 4DIIH 1F0TA 1UVPA 3U8RH 1Z8RA 1LHEH 4Q63A 1FIZA 1ZSLA 3NRLA 1YKTA 5FXLA 1WCZA 3BF6H 3TNTA 1NRSH 1T31A 1PQ8A 2J94A 3K9XB 3UWIA 2QCYA 1TLDA 5A0AE 1BHXF 4BXWA 4H6TA 1EUFA 1GHBF 1MBQA 4O9VA 1NRPH 4IW4E 1ABJH 1YPHE 1AB9C 1BJUA 2UUYA 1GHZA 2ZFRH 1O3KA 3A7WA 2BX4A 4XE4A 1C4Y2 2KAIB 2F9PA 4YLQH 4A6LA 5C0TA 2QA9E 4MPXA 1SVPA 3OEHD 1Z8IB 4X1NU 1O3PB 1O3LA 3BEIB 4K69A 4H6SB 4NA9H 1G36A 3QTVH 4TPIZ 5HIYA 1HJ9A 1NRNH 2G00A 4YZUA 4BOHA 2G51A 2V3HH 3NXPA 4GSOA 1FLEE 2TGPZ 3Q76A 2CK3D 3N7OA 4M7GA 4ZHLU 1P0SH 1ELTA 1FN8A 1RRKA 4XFQA 3WWBA 1B7XB 3M37A 1LO6A 2QYIA 5C3NA 1CT4E 2R3YA 4FUFA 2Z6BD 4NG9H 3C1KA 3QO6A 3FO8D 3KCGH 4ISIH 1KLIH 4AFUA 2ZDMA 1CT2E 3TU7H 5DN6D 4TSFD 1UCYH 2V3OH 5DP9A 1Y3UA 3VG8A 5DP4A 1SGDE 1SGFG 1P2MA 1OSSA 1XMNB 4CRDA 3RXKA 2DE8A 5L6NH 3RMLH 5CHAB 1GI9B 1DSUA 4I86A 1C5TA 2V6NA 4I8HA 1TGSZ 5HM9A 1A1RA 2ZGCA 1SI5H 1RTFB 2SGPE 4I33A 1GL1A 2GCHF 2FTLE 2A0QB 2JDID 5HIZA 3LGIA 3FZDA 3T5FH 1EZUC 2OC1A 1RJXB 2BZAA 4FVDA 1DWDH 1G2LA 2KM0A 1LVYA 1K1PA 2G5VA 4O97A 4WVPE 1MTVA 1A0JA 1DY9A 1EKBB 4U01A 3E3TA 3K2UA 1HGTH 3GCHC 2PTCE 1C5OH 2Y6TA 1THPB 3HK3B 1BOQA 1ABIH 2ZQ2A 1BBRK 3UIRA 2CXVA 1MTNC 2XOKD 2BLQA 2GZ8A 2XYAA 3MO9A 3BG4B 1KLTA 4LZ4B 2HPQH 5FPYA 2L74A 3DT0H 1JOUB 1NS3A 3BEFB 1KXCA 1P02A 4WH6A 2C4FH 1GJAB 5EGMA 3NCLA 3RM0H 3RXJA 1QL8A 3F1SB 1ZHPA 2TGTA 5TCAA 3H7TA 3T29A 1ID5H 1TMTH 2JETC 3HGPA 4OM9A 1CO7E 1GJCB 2ANWA 2YOLA 5ESTE 4BNRA 2IOTA 2THFB 5A8ZA 1G3DA 2O8TA 3MO3A 1QJ7B 1A2CH 3MYWA 2WINI 4FUCA 4OGXA 5E0GA 1MH0A 2VIQA 3QZQA 3UTUH 1VJ9U 1SHHB 4CRFA 2SGEE 3PMAB 3TJNA 4JYUH 3TJUA 4RKJB 2AGEX 3GY8A 3TGJE 4HG6A 5B6LA 2KCOA 2B7DH 4YLUA 1UTJA 1F92A 4O03A 4AB9A 1OOKB 1JIRA 1LMWB 2ZC9H 1X7AC 1LTOA 2ZQ1A 2V35A 2ZNKH 3KNXA 1C1NA 3P92A 1RIWC 5L2ZH 1E1RD 3KYGA 1ZZZA 4UONA 4IC5A 3P8OA 3BEUA 2ZGHA 3L6PA 2Z9LA 3ZZ3A 4X6PA 5FBIA 4DJZB 4IBLH 2G8TA 2JH0D 5EPNA 1V2PT 1UTNA 1LHCH 2WPLS 1ELAA 3RXPA 3W95A 4OS6A 5C0UA 2BLOA 3LGTA 1TQ0B 1BJVA 4CBOA 1VITG 1GMCF 3E6PH 1HV7A 2FIRH 1QIXB 2J98B 1S6FA 1ETRH 3SHAH 4A1TA 2R9PA 4HGCA 1CHOF 2BX3A 4TWWA 2AEIH 2BDYA 1KDQA 4K60A 3NPSA 1O5AB 4Y8XA 4ABIA 7ESTE 1VCPA 5TJXA 4CH2B 4ZMAH 5HGGA 3ZVDA 3E0PB 1ORFA 3BTHE 1T8NA 4ZHMU 1CE5A 1ZYOA 2QV1A 1GDQA 4TWYA 1KMHB 4RKOB 3SU6A 5PTPA 1O2IA 4Q4LA 3N7DA 2RA3A 4KTCA 1TRNA 3UQOA 2BOKA 2ZFSA 2B0FA 1WDIA 3GY7A 4INLA 1HNEE 5HMAA 1HUTH 2ANYA 3PRBA 3TGIE 1TGBA 2IPQX 2ZDAH 3TK9A 4CH8B 1XUFA 2H5CA 1LPGB 1V2MT 2ZDLA 4GHQA 1V2OT 4JMYA 3BTQE 2J5UA 3AASA 1E37B 3VB6A 2FS9A 4ZKOU 3QK1A 1YGCH 2PKAA 4CR5A 1AI8H 1GMDF 1LPZB 1GHXH 3ELAH 1BBRH 1KXFA 3A84A 4X2XA 1ETSH 4XBDA 1KIGH 2PTNA 4XDEA 3QDZB 1WTGH 1GVLA 3ENSB 1FQ3A 1C1SA 3ZVEA 1C2HA 4NA8A 2QY0B 3BN9A 4NFFA 3B23B 1OXGA 1SFIA 1IQLA 1C1MA 1G3CA 5T3HA 1O2XA 1AKSB 5EOKA 1XUGA 2HVXA 4NA7A 3VFEA 4AYVB 1NROH 4I8JA 1EATA 1C5MD 1NRQH 1UJ1A 1JRTA 1BT7A 2NU4E 1IHSH 4BAMB 1WU1A 2RCEA 3V12A 1NZQH 5DPAA 2SGDE 2FX4A 1SLVB 3BTME 3DHKH 1TX8A 2YNBA 5JB9S 5EJ1A 1H8HD 4AFQA 1C1VH 3DD2H 5ESBA 4TY7A 3AK5A 2BQWB 3BTTE 1COWD 3F2GA 2FWWA 3KHVA 1ZJDA 2ODYB 2ZFTA 1GGDB 1P03A 1H8ED 1WQSA 1ZGIA 3TIUA 1DM4B 1EZXC 1KXEA 2G55A 1O3JA 1G30B 1CSOE 3BTGE 1SL3A 2A5KA 5H4IB 1CBWB 2HGTH 4DCDA 2PR3A 3A87A 5BRRE 4WMEA 2HLDD 1XXDA 4Y7BA 3GYMA 1K22H
chains in the Genus database with same CATH topology
1P8VC 1VR1H 2FOHA 2SGQE 1Z6JH 3SI4H 1L0ZA 2VJ1A 1VJAU 2DE9A 1SGCA 1DS2E 2F3CE 1SBWA 3PTBA 4H42U 1S85A 4TYDA 3PLPA 2CF8H 2ZZUH 2HNTF 3DA9B 1GI5A 3KIDU 1HJAB 3ZVFA 4HI3A 1TBRH 1OPHB 4XOJA 1UMAH 3R0FA 3GOVB 1C5VA 5EQSA 2P93A 2XW9A 1C2IA 1GBHA 2XTTB 1GHBG 1PPFE 3KF2A 2QN5T 4R8TB 1NO9H 1Z8JB 4X2WA 1O30A 1WTHD 2A7HA 1O5GH 5T6GA 3RXBA 2QC2A 2XC5A 1HXEH 3SNEA 2ESTE 3ZZ7A 1WQVH 4D8NA 6LPRA 3MH6A 4U2WA 4ZKSU 1KYNA 3RLWH 1D3QB 1D9IA 3S69A 4OS2A 3PMBB 5EXLA 3MH7A 5E2OA 1BTXA 5AHGH 5ABWA 1P9UA 2FOMB 2BD4A 1GBFA 1O5FH 4B2BA 1VCWA 2AGGX 1TYNA 1A0LA 1FPHH 2Y5HA 4XBBA 3PROA 1T32A 1W0YH 2BZ6H 1XX9A 1C1QA 1H9IE 3FP7E 1ZOMA 3SW2B 1OYQA 1EZQA 3TPIZ 3GCNA 5I25A 4K1EA 2VWNA 4B75A 3DFLA 3GY6A 2D1JA 3K6YA 4Y6DA 1TOMH 3T62A 1C1OA 7KMEH 3EA7A 2GV7A 4I32A 1UHBB 1CA0B 2R0LA 4ABHA 4DOQA 3LOXA 2XWBI 1B0EA 1O3BA 1EPTB 1WYKA 2GCHG 4NSVA 4I8LA 4AB8A 3KEEA 2ZU4A 4ZXYH 3T2NA 2H5DA 4O3UA 1AIXH 1E35B 1SG8B 1DANH 1UTMA 1G3EA 4I8KA 1GDNA 1HXFH 1TIOA 2ZHFH 5ETXA 3KGPA 1G3BA 3OSYA 2Q6GA 1M9UA 4ISOA 4JK6A 4Z0KA 3K65B 1DXWA 3V13A 2GGVB 1BRAA 1PYTD 3U1JB 2D2DA 1GBJA 3B9FH 5F8TA 3T25A 2ZFPH 1QNJA 3KL6A 4NCYA 2BDHA 1HRTH 1O3OA 1SQTA 1SLXB 1GPZA 5K0HA 2VWOA 3M36A 1GI4A 1P12E 3GDUA 1O2NA 3RXDA 2Z7FE 3QUMP 1TGNA 2QAAA 2BOHB 2QIQA 4UFGH 1MTWA 3TH2H 2OCVB 1FONA 1IQJA 1W0ZU 1GVZA 4LK4A 1Y3YA 3A86A 2BXTH 7GCHF 3S9BA 3NK8A 2P3UB 1ELGA 1FY8E 1GCTB 2GZ7A 3ZZDA 1C5NH 4K5ZA 1P09A 8ESTE 1XM1A 3GY5A 1UVOA 4A7IB 4YOJA 1QA7A 5DKMA 1B0FA 5E0JA 3PLKA 1S0RA 2BQ7B 2FTMA 1LCYA 2VNTA 4Q7YA 1GI2A 1AMHA 1GBKA 4BTUB 2FOAA 5LGOA 1MAYA 2W5EA 1Z1IA 2VWLA 5F6MA 1MZDA 3RXHA 1HLTH 1SGPE 1TRMA 1FMGA 1YBWA 1LVMA 2PV9B 1O3HA 3FZZA 3ZZAA 5L30H 4VGCC 1GBMA 2ZWLH 1F0SA 1QFKH 4X1QU 4X6NA 1NC6A 1GMCG 1Z7KA 1ZMNA 1F5KU 2BQ6B 5T6DA 1BZXE 1O2JA 1CHOG 5A0BA 9ESTA 1IQFA 3T28A 2C93B 2FS8A 3TNSA 3RMMH 1O39A 1O3FA 1OWKA 2XC4A 2BVRH 3MMGA 1DE7H 1LKBA 1HB0B 2ZA5A 3SJ8A 1ANEA 3SV6A 7LPRA 5JYIA 1O2UA 1P10A 4X1PU 2OXSA 3MO6A 3MI4A 2F91A 2ILNA 1FNIA 4UE7H 3EAJA 4FUEA 1EP6A 5JPMH 2SGAA 2W3KA 1TNJA 1OP0A 4K8YA 3SV2H 1FY3A 3M3TA 1P11E 4ABAA 4DW2U 1W2KH 1K1OA 1EAXA 3ODDA 3NZIA 1LDTT 5E2PA 3MU1A 3OYPA 1GBCA 2ZU3A 1O2ZA 3UQVA 3UPEA 3PWBA 1GVKB 3O8RA 5C20A 1F0UA 2CV3A 1MD7A 4IMQA 4BAQB 4YM9A 1A5HA 1C5YB 1ZMLA 5A2MH 4SGAE 2OD3B 3A89A 5J4SA 1CVWH 1GBBA 2UWPA 3P8NA 2PKSB 4U32A 2UWOA 1OS8A 1F7ZA 2VVVA 3PMJA 2ZDKA 3SBKA 1PPHE 2VVUA 4PROA 2AMDA 1AD8H 3RXRA 2BD2A 1AB9B 1YP9A 1N6YA 1EJMA 3RU4T 2BD9A 1DITH 3RC4A 1S84A 1ARCA 2STAE 2BLWA 1FY4A 3UOPA 4E06H 2JKHA 2ZHDA 3UNRA 1NPMA 3SI3H 1GL0E 4BXSA 1TNIA 3ATKA 2ZFQH 3M3SA 4CRGA 1HAGE 4CREA 4KP0A 2FP7B 4MPWA 2Y7ZA 3SJIA 1MMJN 1BMNH 1TONA 2ZHQH 4XSKU 1GHVH 1S82A 5GCHF 1ZGVA 1A61H 4NWKA 1ZRBA 1A0HB 1EB1H 1AE5A 1IOEA 1C1RA 2NWNA 3S0NA 2HOBA 3IG6B 1FN6A 1P57B 5EQQA 4RSPA 2ZPQA 1UVSH 2Z3DA 3D65E 4FUHA 2AFQB 4CRCA 3S7HB 1V2TT 5JBCS 4WY3A 4UDWH 1BCUH 1GI8B 3BV9B 2CHAB 1G37A 1NESE 1GHWH 1CQQA 1NFWA 2AERH 4JYVH 1T7CA 3LT3A 3BTKE 1GHAF 2FOFA 1MKWK 2ZU2A 1SLUB 2FZZA 1O2HA 2TGAA 1FY1A 4FU8A 3EE0B 2ZGXH 5AF9H 8KME2 2ZECA 3VB4A 2ZO3H 4ABDA 1EQ9A 1TAWA 1XKAC 2Z94A 4I8GA 4DGJA 1BTHH 1DUEA 1QR3E 3GCHB 4B71A 4ABBA 2F9NA 1G32B 3A85A 2Z9KA 3LGWA 3T26A 1O34A 1TBQH 4DT7B 1HJ8A 1MKXK 2HWLB 5C1UA 1NT1A 3ZZ8A 1W10U 2ZI2H 3M5NA 3VGCC 2G81E 1ELVA 2GCTB 3M5MA 1P2OA 4D7GA 1NTPA 1FJSA 1C1WH 4SGBE 3MNBA 1QBNA 1HAHH 3O8DA 2BHGA 1FIWA 1UCYE 1UK2A 2Y5FA 3UNSA 1BTUA 1P2JA 3LH3A 1TE0A 1INCA 1HPGA 2XBYA 1O2TA 3LDXH 3CENA 2ZCKP 1SMFE 1ELCA 5C1YA 1F0RA 2RG3A 4X8TH 1AFEH 5JDUB 5JBAS 2QF3A 4D9RA 1YC0A 3SZNA 5I46H 1KXBA 2NU2E 5GPIB 5LPEA 2D8WA 3C27B 4WXVA 4YOIA 3SV8A 2P95A 1QCPA 1ZHRA 1BMAA 3JZ1B 4A1VA 4H4FA 3U69H 3TK6A 1C5UA 1QL7A 3SGBE 2CJIA 1BB0B 3S7KB 1NFYA 3P95A 1QB9A 1THSH 3V3MA 4WMDA 2OC0A 5GJ4B 3P8FA 4X8VH 1V2KT 4Y0ZE 3NWUA 4ZKRU 2C8YB 1DY8A 3ZZCA 1IQIA 4AORA 4BTIB 1MBMA 3UNQA 1EOJA 5FCRA 3SO3A 5LPRA 1AVXA 1E34B 1W3CA 4FVBA 3GDSA 6CHAB 1ANDA 3QTOH 4X6OA 5EQRA 2VB0A 3S9AA 4A5TS 1SFQB 5F8ZA 2ZHEH 3NUMA 1EZSC 9LPRA 1SR5C 4NFEA 1A3BH 1O2KA 1J9CH 7GCHG 1QJ6B 1UVTH 2QXIA 1HAXB 1ZSKA 3SUGA 1BMMH 1TNHA 4MG3A 3SU0A 3OY5U 1GJDB 1MUEB 2FYRA 1KLJH 1J16A 3MNSA 1PPGE 4KELA 5EW1H 1MKWH 2A2XH 5FCKA 5DO4H 2Q1JA 1N1LA 3VB5A 4JZ1A 5FX5A 1EP5A 1ZPBA 4ISNA 1QURH 3SORA 1MCVA 2UWLA 1GBLA 1D3DB 4INKA 4FUBA 5G4BA 3GCOA 4B74A 6ESTA 2ZP0H 4FUIA 1D6RA 1BMLA 1SGEE 2WPKS 1MQ6A 1O3EA 1V2LT 2A7CA 3VB3A 2BM2A 2ZGBH 1TPPA 1GHYH 4RN6A 3R3GB 1L1NA 3QGNB 3DFJA 1HAZB 1YPHC 2ZGJA 1RTLA 2GDDA 3PTNA 2ZTYA 4IC6A 1CU1A 4A1XA 1O2YA 1O2MA 1P3EA 4I31A 4ZH8A 1RFNA 1AU8A 2WPHS 1OWDA 1O32A 1TNLA 1MU6B 5DG6A 5AFZH 1Y5AT 2C8XB 1C5LH 1TNGA 2P59A 3HKJB 3ITIA 3M7QA 5A09A 4Y11E 1TX6A 2BDIA 1QHRB 1P2QA 2XC0A 5IYTA 1GBTA 1GJ4H 2ZCLP 2GKVE 1K1NA 1PYTC 4ZXXH 4Q2KA 2PW8H 1TOCB 2HALA 3IITA 1DOJA 1HYLA 1A3EH 1GJ8B 3OU0A 3PM3A 3RDZA 1F5LA 2A5IA 2BB4A 3FVFB 1QQ4A 2A7JA 2FI5E 4B2AA 1O3GA 1BBRE 2PFEA 2P3FH 4HZHA 1GGDC 3M5OA 2GMTC 3SUFA 1LHGH 5LPFA 1SQOA 2H9EH 2GTBA 2JH6D 3FFGA 1VCQA 3M7TA 4D76A 1SHYA 3SQHE 1MCTA 2ZFFH 1TGTA 1V3XA 1AO5A 1L1JA 3MNXA 2H2ZA 3LC5A 1BA8B 2CN0H 3TH4H 3LKWA 1HCGA 1O3DA 3SU3A 1TQ7B 1CHGA 3GDVA 2A2QH 3VEQB 1ELDE 2J2UA 2ZTZA 4BTTB 3A7YA 2XXLA 5FHTA 4WXIA 1H8DH 3GICB 1J15A 2OBQA 3MH5A 4UD9H 1GI3A 3W94A 1AVGH 3PWCA 3AAVA 1GCDA 5GDSH 2R2MB 2ZF0H 1Y3XA 1K28D 1P9SA 1A46H 2RDLA 4JK5A 3RXLA 5EU8A 4AYYB 2EI6A 3D62A 5J4QA 1P06A 3LC3A 3SU2A 3LH1A 3HGNA 1NU9A 4DURA 2P94A 2J9NA 1UK3A 3RXFA 2EC9H 2A4QA 1AY6H 4INHA 2VIWA 2TPIZ 1O33A 2QXJA 1OWHA 1AZ8A 3UR6A 2P8OC 1W14U 5GCHG 1PFXC 1MTUA 4NZLA 2Y5GA 1SSXA 1ANBA 1HAVA 1C5XB 1YF4A 1J14A 1A4WH 2FLRH 2J92A 1PQAA 5CE1A 3ODFA 3GYLB 4AGKA 2VGCB 1V6DA 2O8WA 1KDQB 1K1IA 5A0CA 1MQ5A 2QXGA 1MU8B 5DGJA 3RXCA 2BDBA 2ODPA 3RXOA 5FAHA 1GHAG 2WV5A 5DP3A 2B5TB 5GXPA 1ESBA 2XBVA 2DUCA 1C5RA 1JMOH 1EAIA 2OP9A 5DP6A 5L2YH 1GBAA 1P04A 1AUTC 1GBDA 1EJNA 2UUFB 1IHTH 4NZQA 3I78A 2BVSH 1ZHMA 2ZIQH 4DVAU 1E38B 1O5DH 2ZU1A 1S83A 2J95A 2WPJS 3T27A 2KAIA 3EQ0H 1FPCH 1YPLH 3M35A 3TH3H 2A5AA 1TNKA 8GCHF 3LJOA 2EI7A 1W12U 5JBBS 4OS1A 2PKAB 1VGCC 3M7UA 1GJBB 3LU9B 3AAUA 3TJOA 1O2PA 2HRVA 1QB1A 2VINA 2A32A 3F9HA 4YESB 4Z6AH 1H4WA 1FAXA 3MU8A 3TVJB 1ARBA 1QJ1B 1O3MA 4ZKNU 4UFFH 3U98H 1SOZA 5EXMA 3STIA 3QX5H 3FP8E 2OQUA 3M61U 3HK6B 1GJ7B 1AFQC 1ZTLA 2PGQB 2EI8A 3RXAA 5EPYA 2TGDA 5C1XA 1NFXA 2OTVA 3KQBA 4TY6A 4WWYA 2IJOB 4YO9A 3RU4E 5FPTA 5TCCA 2FOBA 4FXGH 1O3NA 1JRSA 1RD3B 5C2ZA 2IN2A 1OWJA 1QGFA 5LH8A 2QGRA 1P2IA 4Y0YE 1IQMA 4ISLA 3ZV8A 1D6WA 3BIVH 1ACBE 3A8BA 3ZV9A 2CMYA 2GD4B 1OP2A 1UTOA 1XUJA 1C2DA 3TITA 3LPRA 2BDGA 3PO1C 1CA8B 4F4OC 1TMBH 2HLCA 4KTSA 1GWAA 4VGCB 2BY7X 1GG6B 2K1QA 1EOLA 1HIAA 2PUQH 2ODQA 5C5NA 3U1IB 2SNVA 3SJKA 1L2EA 1NRRH 1QA0A 1QY6A 1AWHB 1UCYK 2BVXH 1C4U2 1SGIB 2HNTE 4CHAB 1C5ZB 1OP8A 1EASA 1QRXA 1O2RA 1C2LA 4R0IA 2BY6X 1K2I1 2ZKSA 3OTJE 1TX7A 1P01A 1V2UT 2H1UA 5E0HA 3EGKH 3E1XB 5JB8S 1ZPCA 1TFXA 2ULLA 2BYAX 3SOSA 4BANB 4FUDA 2M5TA 2FI4E 2A4GA 2FX6A 3ZYDA 2BD5A 2ALVA 3RXQA 1T4UH 3LGVA 1GMDG 3SNCA 1QB6A 1SGFA 1F2SE 2BMGB 3URCA 1UTLM 1O36A 2FI3E 1A7SA 3LGUA 1RGQA 5HM2A 1YCPM 3MU4A 1DICA 1N8OB 1YPJH 4NIYA 4K1SA 2RA0A 3ZVGA 2OUAA 4BAHB 1TPAE 1P3CA 1Y5BT 1QBVH 4CBNA 1C9PA 1Z1JA 3A8CA 2Q6DA 3UREA 2BD8A 2ZHWH 2WYGA 2Y82A 1DXPA 4YOGA 1O2VA 1DWEH 2SFAA 2FMJA 1K1MA 3MU5A 5FPSA 1TPOA 1K1JA 1LPKB 3MH4A 5C5OA 1BQYA 1N6XA 4D7FA 1J8AA 1BTZA 1V2QT 3ZYEA 1DFPA 2PKSC 1V2ST 4E7NA 4NIWA 3RXUA 3HATH 3UWJH 4F49A 2I6SA 3RM2H 3SNAA 4ABGA 1LHFH 1XKBC 1SGTA 1PPZA 4X6MA 2WYJA 1ELFA 1Z6EA 3SN8A 4BAOB 1SB1H 1C5PA 1YM0A 2GZ9A 3Q3YA 4X8SH 2TRMA 1O2GH 2W26A 3CS0A 1O0DH 1T4VH 1KTTB 2XRCA 1NY22 3SNDA 1O2LA 1BDAA 4CRBA 3LJJA 2C90B 2J38A 2LNCA 1EJAA 1TBZH 1HAOH 3ATIA 1GJ9B 3GY4A 2ZDNA 3RMNH 3SQEE 1C5WB 1PJPA 4MPVA 1K21H 2WPMS 1GDUA 1L1GA 3KQEA 4J1YA 3E90B 1C1TA 1AKSA 4K3JA 3G01A 1LVOA 2BTCE 2TIOA 3A82A 4MQAA 3UFAA 3F68H 2CF9H 5CHAC 2C8ZB 1DWCH 3Q3XA 1BUIA 1RXPA 3P17H 3SGAE 1SGQE 2F9UA 1O5BB 2CHAC 4MPUA 1C2JA 3GY2A