3UR9A

1.65a resolution structure of norwalk virus protease containing a covalently bound dipeptidyl inhibitor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
175
structure length
164
Chain Sequence
HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broad-Spectrum Antivirals against 3C or 3C-Like Proteases of Picornaviruses, Noroviruses, and Coronaviruses.
pubmed doi rcsb
source organism Norovirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like protease
total genus 37
structure length 164
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur9A01
1MTVA 5FBIA 1CHGA 2BY6X 1IQJA 3HKIB 2R2MB 1SLWB 1NFXA 3RXAA 1P2JA 2FX4A 4KGAA 1SQTA 4JZEH 1GHXH 1GJ9B 4XBCA 4A5TS 3E0NB 3RMNH 3P8FA 3TPIZ 4GVUA 1VZQH 1K1JA 2C8XB 1VCPA 3E6PH 3Q00A 2BDAA 1D3PB 2ZFRH 4ZAEA 3ATKA 3ZVBA 1O33A 2ZHFH 2A32A 1TAWA 1P10A 1INCA 1LPZB 3URDA 4BTTB 1FJSA 3MTYA 3GYLB 2UWPA 1FY3A 2OBOA 3LJJA 4ABJA 4CRAA 6GCHG 1H8IH 5IYTA 3ATLA 1EAXA 3AASA 1NZQH 3URCA 1B0EA 1KXEA 1ESTA 3MU0A 2FTMA 3M35A 2WV4A 3UIRA 1NU7B 1Z8RA 1RTLA 2BQWB 1FQ3A 1CGJE 1DFPA 4QT8C 1TGTA 1C1OA 5TJXA 2B7DH 1QFKH 1EUFA 2F9OA 3GCNA 1UTLM 1HIAA 1J9CH 4KTUA 1S0RA 1TYNA 1HAHH 2F9VA 1C1VH 2VIWA 4U01A 4Z0KA 3KN2A 1ZHMA 2BQ7B 4KTSA 3RXIA 2RA3A 1OWEA 1SC8U 1JXPA 3LKWA 3Q3KA 2P3UB 2ANWA 1A5HA 4K1TA 3NCLA 4GHQA 3RXFA 1FIZA 5CMXH 2F9UA 4FUBA 4FUCA 2QF0A 1TGSZ 1ZMNA 2J34A 4O3UA 1O2MA 1HDTH 1KXFA 2Y80A 1LVYA 1SHHB 2P95A 1AIXH 1SGEE 2FI4E 3GCHC 4Y8ZA 1T8OA 1MQ6A 3QZRA 3SORA 1TX7A 2BZAA 1QA0A 3MU1A 1GCDA 3BTHE 4UFDH 4HGCA 1O2TA 3QGNB 4AGJA 1BOQA 5PTPA 2GDEH 2PWXA 4ZMAH 5DP6A 3LGVA 3EQ0H 3SGQE 2BY7X 1ZRKA 3TGKE 2G4TA 2O8WA 5JDUB 3UWJH 1RIWB 3A82A 4JK5A 4YT6H 5FBEA 1HB0B 4WXIA 1TOMH 2PTNA 2VB0A 2B5TB 5G4BA 1C5QA 1OOKB 1K28D 4X1SU 1RTFB 5DP8A 1CBWC 2A45B 1P3EA 2V0BA 3A8BA 3RM0H 3RMOH 2WPJS 1MAYA 1ZHPA 1FUJA 1GI4A 5FHTA 3A8CA 1QRXA 2C93B 4Y76A 2VIOA 2Q1JA 1ANBA 3CENA 1BA8B 4XE4A 1P2IA 4BNRA 2PR3A 3PLKA 1WYKA 2XNIA 3ZYDA 4ISNA 1QBOA 2J4IA 2O9QA 2GTBA 3D65E 3F9EA 3GOVB 4I8HA 4MLFB 1FPCH 3VXEH 1L2EA 1O2HA 1HAZB 1C1TA 1GMDF 2R0KA 2PFEA 5DP9A 3P8GA 1WAYB 1AKSB 4FU7A 3SV8A 1ARCA 3HGPA 3A7TA 1G3BA 1EJNA 4H6TA 1V2NT 2VJ1A 1AZ8A 2BDIA 1XUKA 1NFYA 2QC2A 1GDNA 3MU4A 1C5NH 1ANEA 3PTBA 4WMEA 4I8KA 4OS5A 4KKDA 1P9SA 1SGTA 1A4WH 4GSOA 2NU4E 1BTWA 3SJ9A 4D9RA 3A89A 1V2UT 4ESTE 2P16A 3QWCH 2AIPA 2XW9A 1V2PT 2Z94A 4JYUH 1W12U 2J9NA 4YZUA 1V2WT 3ZZCA 7KMEH 1UJ1A 1GJAB 2ANYA 3QN7A 2QY0B 1KXBA 3RXDA 3A86A 5C1UA 4E06H 2ZGJA 3NXPA 2FPZA 5FCRA 4U32A 5JBBS 1NC6A 4X8SH 4H4FA 3GICB 1AMHA 2F3CE 1A46H 2IN2A 1ZMLA 3S69A 5EPYA 5FAHA 4UFGH 2A7HA 3R0FA 2FI5E 1E34B 1D3TB 1GI2A 2FZZA 1IQIA 2D2DA 1LTOA 5E0HA 4THNH 1D3DB 1K1MA 3NPSA 1O3KA 4ZXYH 3LPRA 1SGDE 2ANMH 3A7ZA 2UWLA 3LH3A 3AW0A 3BEIB 4D7GA 1C5YB 1P05A 3ZVDA 1GJ7B 1GDQA 4WMDA 1DSUA 3BEFB 2HNTC 3GCHB 1J15A 3SU4A 1UVUH 2K1QA 2OINA 2BY8X 3TJOA 3TNTA 4Y8YA 3PLBA 2ZHDA 1C4U2 4FUDA 5C1YA 1HAGE 2XC4A 1UVOA 2DE9A 1EQ9A 2FEQH 3BN9A 5I25A 2GX4A 1O3NA 4BTUB 2FX6A 4FXGH 1IQHA 1WTHD 3E3TA 2G4UA 1C2DA 1BZXE 1WQSA 3RLYH 1GJ4H 4JMYA 1P2OA 3NWUA 1HAYB 4Y7BA 1MKXH 2ODYB 5FX5A 1HFDA 3KGPA 3M3TA 5C3NA 4GUXA 2FWWA 5E0JA 1NFWA 3STIA 1C1WH 5DGJA 3SNCA 3Q3XA 5K7RA 3IITA 4NA9H 3BG4C 2V3HH 1S82A 2VH6A 3UOUA 3M7QA 1V2LT 1CA0B 4NSVA 4BOHA 4I8JA 1GI1A 1H8DH 1Z71A 1O3OA 4I32A 1O5BB 4MNWA 1BTHH 1SMFE 3MI4A 2NU2E 2BXTH 2AEIH 1ZMJA 1E0FD 4AB8A 4AFZA 2GCHG 1V2KT 1AU8A 4K60A 3K2UA 1YPMH 4K8YA 2GV6A 4R0IA 1O5EH 3BTME 1GI3A 4O9VA 2LPRA 3VGCB 5LPFA 2G81E 1G37A 5JYIA 3ZVFA 4I8GA 3LGWA 2ZDAH 5A0BA 3M3SA 2C3SA 2FLRH 1T4VH 2BVSH 1Z6JH 3GCTF 3M5MA 4FVBA 2QAAA 3ZYEA 3QUMP 4DGJA 2P8OC 1ZTJA 6ESTA 2PKSC 3LGTA 2H1UA 2BTCE 1OP2A 5L6NH 1KY9A 1AQ7A 4NGAH 1GL0E 4Y6DA 1DUEA 1A61H 4UONA 1HAVB 1FN6A 5T6FA 1XUHA 2TGTA 1ZHRA 6GCHF 1GDUA 3MHWU 1DUAA 4ZXXH 3RXSA 3MH4A 1D3QB 2BLVA 1GBEA 1TBRH 3SQEE 1D9IA 1PPZA 2J92A 2ZC9H 4UD9H 3E1XB 3A7YA 1C2FA 3BIUH 3TJVA 4B2BA 2VWMA 2RA0A 1ELVA 1UVPA 1P2KA 1F7ZA 3CS7A 1VITG 1TABE 4ZKSU 5CE1A 3R3GB 1L0ZA 2EEKA 1WCZA 2B8OH 3VFEA 3BV9B 2TPIZ 1BJUA 2ZP0H 1DSTA 3MH7A 2ZPRA 2G52A 2UUFB 4FUHA 8ESTE 1C1RA 4XSKU 4YOIA 4TY6A 1TRYA 4Q7ZA 1HNEE 3RMMH 2Q6DA 1HJ8A 1RJXB 1AD8H 1AUTC 1O2RA 3GY6A 4CREA 1SPJA 3BTEE 5C20A 3VB5A 2FODA 1NRRH 3RXCA 2BD4A 2BQ6B 1C2EA 4AG2A 1BMNH 3FP6E 1FY8E 3E16B 3EGKH 3QDZB 7ESTE 1C1MA 2JH6D 3VEQB 3STJA 2WV5A 1F5RA 4X1PU 1LQDB 5DP5A 3A7VA 2R3UA 1O2ZA 3FP7E 1C1UH 1DWEH 2TBSA 1FN8A 4BXSA 1GMHF 4GAWA 1BTPA 3SUFA 7LPRA 1TGCA 2XTTB 2M5TA 3A8AA 1BHXF 1BT7A 1RTKA 1E38B 3SW2B 2H5DA 4A6LA 1V3XA 1Y8TA 3U8TH 4AFSA 3BEUA 5ESBA 1TX8A 3RXQA 3S9AA 4H42U 3KHVA 4WF8A 1O37A 2ZZUH 1QQ4A 2QF3A 1C5XB 3U9AH 2SGDE 1CA0C 4MPWA 1O3HA 1TQ0B 5EQRA 1PFXC 1CT2E 2A0QB 1UTJA 3EE0B 4WH8A 1BMLA 3ZZ4A 1L4DA 1G2MA 4DJZB 2GVFA 4TY7A 3MO9A 5HM9A 1GVKB 1SFIA 3TU7H 2XRCA 3BTFE 1GHAF 4YOJA 1P2QA 4GHTA 4IC5A 2Z3CA 4Q7YA 1TQ7B 1J17T 4KELA 1C2HA 4CHAB 1DWCH 1GBMA 4TPIZ 5EOKA 4AOQA 4OS4A 1O3IA 1WOFA 4YLQH 1TNIA 1Z8IB 2FYRA 1FAKH 2THFB 1N6XA 2A5AA 4AX9H 3TK6A 3H5CB 3IG6B 1DPOA 1G36A 1Y3YA 1YCPK 1XXFA 1PQAA 4ZUHA 5T3HA 2VVVA 1SHYA 1C5PA 5B6OA 1MMJN 2FOHA 1T8LA 1IQNA 1HUTH 1NRQH 1VCWA 1FXYA 1TGBA 2VIPA 4Y7AA 3SHCH 1HBTH 2AMDA 3SU3A 3M36A 1O2LA 1LO6A 2FOEA 4IN2A 1SGYE 4D7FA 1ZZZA 3B8JA 2FLBH 1AFEH 2FIRH 2PGQB 1GVLA 2ZGCA 1O3BA 2BYAX 3P6ZB 4K5ZA 1EASA 2UUKB 1QJ1B 1Y59T 4Q7XA 3ZZ6A 1YCPM 1UK3A 2PTCE 2A7JA 1GHWH 2WYGA 4LZ4B 3C1KA 4ABDA 2A1DB 1E37B 1G3CA 4X6PA 1THRH 4D8NA 4OS1A 5H4IB 2QGRA 3K9XB 1P12E 1EJMA 1PPBH 2YNBA 1QJ7B 1IHSH 5AF9H 2BLOA 1NT1A 2ZIQH 1WBGB 1DS2E 4NA8A 2IJOB 4MDSA 3FANA 3GY2A 3O8BA 1PYTD 3PM3A 1OP8A 2FOAA 2OBQA 2VVCA 3ATWA 3RU4E 3SNDA 1FNIA 1FI8A 2JETB 3RU4T 3FAOA 3TH3H 2BLQA 1SGQE 1L1NA 1F5KU 1T8NA 4D9QA 1ELBA 3L33A 1LKAA 1O2VA 1TONA 2CJIA 1ACBE 4MNYA 2QXGA 4FU9A 2BVRH 4MQAA 1Q31A 5C5NA 1TMTH 8GCHG 4ABBA 5BRRE 2BB4A 1GJ6A 5LPEA 1GBFA 1ZPBA 2GZ9A 2H9EH 4B71A 2BZ6H 3QTVH 1AHTH 3T26A 1HLTH 1C5SA 2CGAA 1JRTA 4KP0A 1BMMH 2A7CA 4Y8XA 2ZDNA 1YBWA 2Y5HA 3EA9A 4MTBA 4ABAA 1C5MD 1CBWB 2ZDVH 1C5OH 1H4WA 1NO9H 1SVPA 1TPSA 2Y6TA 1YP9A 2YOLA 1GI5A 2A5KA 1TB6H 2BD9A 1DICA 1K1OA 3U8OH 2O8MA 4MPUA 4JCNA 1C5WB 3OY5U 2HPQH 1QB9A 4A1VA 1O3AA 1IQFA 3U1IB 1MBQA 2FDAA 2NU3E 1CA8B 4IMQA 1T31A 3W95A 1SG8B 5C67A 3BTDE 4LOYH 1RD3B 1NRPH 2R9PA 1U6QA 1W11U 1XX9A 4D76A 5DKMA 5ESTE 4X2WA 4X6OA 3SJKA 4MPXA 2SGQE 1CGHA 1IQLA 3RC5A 2PW8H 1ZSKA 1YC0A 5A8XA 1QHRB 1Z8JB 3N7OA 2BVXH 2VIVA 2JH5D 1ZSLA 1SI5H 2EI6A 3F6UH 4NIYA 1VITH 1XM1A 2W5EA 3RXTA 1OKXA 2Y5FA 2J94A 1MKWH 1MZDA 2ODQA 3MNBA 1C1NA 5TCCA 3MMGA 1MTUA 4NIWA 2BX4A 2A2QH 2ZU2A 3ZZDA 4NSYA 3CP7A 1AFQC 1D6WA 1DT2A 4FUJA 1GBTA 3H7OA 3I77A 1O2NA 2ZA5A 5EQQA 5BPEA 2ZWLH 1MCTA 3LU9B 2ZDLA 2ZPQA 1UMAH 4ABFA 1GI8B 1K2I1 1PQ5A 1JMOH 1LPKB 2GZ7A 1AI8H 1K21H 2ZI2H 3VB7A 1O2KA 2TGDA 4MG3A 1GBHA 1ZR0A 1H9IE 1HJAB 2XBWA 3RXEA 3M5NA 1C5UA 1K1PA 3U8RH 1SGNE 4B75A 2OP9A 4CH8B 1EPTA 2BHGA 3VGCC 1TMBH 2BM2A 7GCHF 2Z9IA 3RXHA 4WJG2 1HV7A 1QL9A 1ETTH 3PTNA 1MKWK 1S6HA 3C27B 1A3EH 2NWNA 6LPRA 2ZQ1A 1S6FA 1YPEH 3SGBE 4B73A 1G2LA 2AMQA 4ZHLU 4BANB 2ZFQH 3BG8A 1L1JA 4I33A 4ISLA 4YM9A 3OU0A 3UPEA 4CRBA 4HZHA 1EAUA 1SGCA 3LT3A 3F9HA 4X1RU 1S85A 3UOPA 3KNXA 3SQHE 1GPZA 1JBUH 1ABIH 3DA9B 3KL6A 1GI0A 3UUZA 1A3BH 3ESTA 4CBOA 1VCQA 1DLEA 2GD4B 4AORA 5GDSH 2ZFTA 4YT7H 1TLDA 1W8BH 3SBKA 5JBAS 3SNBA 2P59A 1GHZA 1W0ZU 3S9CA 2FS8A 3A84A 2GDDA 2XBYA 4I8LA 1F0TA 4MVNA 1P01A 3GDSA 3EAJA 4FUFA 2AGEX 4UDWH 1SQAA 2Y82A 2WPIS 1E36B 1MTWA 3SU1A 3BTWE 1YLCA 2ZU3A 4WY3A 2ZCHP 2QXHA 1C9TA 2QIQA 4U2WA 5C5OA 3ATIA 2F83A 1SQOA 3TNSA 5IDKA 3FZZA 3T28A 3RXUA 2UUJB 1SR5C 3MNCA 2ALVA 3ZZ5A 4KTCA 4CRFA 1ZRBA 3L6PA 2VWOA 3PYHA 1XUFA 2ZQ2A 2XBXA 1GJDB 1V2RT 2ZTYA 1O5AB 4I7YH 4CBNA 1DWBH 1P8VC 4A1XA 4AZ2B 1LVMA 4LXBH 5EG4A 1VJAU 1HJ9A 2R0LA 1PYTC 3A81A 2VU8E 2I6QA 3DFLA 1P9UA 2FOCA 3MO3A 1C1PA 1VR1H 1ELDE 1MTNC 3UFAA 1WQVH 1GHAG 5T6DA 1P2MA 2G5NA 1O2QA 4VGCC 2Z9GA 1TMUH 2P94A 1YF4A 2UUYA 3MNXA 1MD7A 2VH0A 1FIWA 3TH4H 2JKHA 5FPTA 4CRCA 3GCOA 1ZJKA 1PQ8A 3FZDA 1KYNA 5DO4H 4A7IB 2HVXA 3A80A 1X7AC 4K1SA 3ZVEA 3U1JB 4XFQA 1VJ9U 1Z6EA 3LJOA 1TGNA 1V2TT 2ZF0H 4ASHA 1O3LA 3PB1E 3OYPA 1ABJH 3TIUA 1H1BA 1JOUB 4H6SB 1S5SA 2VGCC 3UWIA 2FOMB 3GYMA 1LCYA 1A5IA 2BD8A 3M61U 2G55A 2TRMA 2ZTZA 3SUGA 1TFXA 4CRGA 4CHAC 1SL3A 1SOZA 3I29A 1AGJA 1GBDA 2BLWA 1GBJA 4FUGA 5F8ZA 3UQVA 1GJ5H 1MCVA 2ALPA 2BDBA 1ZPZA 3P8NA 5L2ZH 3P17H 1QURH 1AWHB 2I6SA 1T32A 2OTVA 3LOXA 1QL8A 4HI3A 1GJ8B 4U30A 1QR3E 2A4QA 5FPSA 1GGDC 1O2UA 2QXIA 5I46H 3UY9A 1RGQA 2AIQA 1EP6A 3BG4B 2FO9A 1CSOE 1MAXA 1NU9A 1HGTH 1C5TA 1FAXA 3O8RA 2CXVA 4AFQA 3QLPH 3ENSB 2G00A 3FFGA 1NFUA 1V2OT 2OCVB 3RXLA 1XMNB 1BUIA 1W13U 1GI7B 3UQOA 5FCKA 1FY5A 1KDQB 1HAXB 3FVFB 5AHGH 5FX6A 1NROH 1O3GA 4AYVB 1Z1IA 3V13A 3O8DA 1GHBF 1SB1H 2SGEE 4BAQB 2WINI 3SV9A 1F2SE 1IAUA 2PKAA 1NTPA 1C5VA 1OS8A 3P92A 5HXFA 1BITA 3MWIU 5A0AE 1AKSA 5E8EH 8LPRA 3RXOA 2EA3A 4BXWA 4RKJB 1HAVA 2OQ5A 2WYJA 3PMBB 2CV3A 4O97A 1SGPE 1FONA 1EB2A 2Z9KA 1O3FA 1P09A 1TA6A 4ZKRU 4B74A 4O03A 2ZGBH 1O32A 1UTKA 5A2MH 3T29A 1WU1A 1F0RA 2BD3A 3A83A 5JB8S 1J16A 2IPHA 2OD3B 1NM6A 3GCTG 1EB1H 3MU8A 3HK6B 3ITIA 1O5DH 2ILNA 3SJOA 3ZV9A 1TX6A 1RRKA 1HRTH 1W0YH 3PO1C 3TGIE 4INLA 4K1EA 4I31A 3SV7A 1WTGH 2RCEA 3RXBA 1ELFA 2WPLS 2J95A 2A4OA 2OC8A 2XC0A 2XYAA 1EZUC 1BMAA 1QRZA 2PHBA 1SSXA 2ZFPH 3QO6A 2ESTE 2FI3E 3V3MA 3SU0A 1O2WA 4MNXA 2Z3DA 2GP9B 1E35B 1EX3A 2PSXA 3AVZA 5GJ4B 2FM2A 1NN6A 1PPEE 5F03A 2ZECA 4ZROA 4K3JA 1BDAA 1RXPA 3TLOA 1L4ZA 4NZLA 1KTSB 1ZJDA 4ISHH 1K1NA 1Z8GA 2Y7ZA 1LHGH 5CHAC 3UNQA 2FOFA 2STAE 1ELTA 2RDLA 1UTMA 4B2AA 1B7XB 1ZTKA 1L1GA 1AO5A 3MFJA 5EXMA 2FP7B 1SBWA 4X2XA 5DP4A 4BAHB 1QNJA 1Z7KA 2QN5T 1C1QA 4ZH8A 1N8OC 1OPHB 3P70B 5JB9S 4RN6A 1BBRH 4WMFA 1AN1E 2V6NA 1SGRE 4AB9A 2HPPH 1TBQH 1GGDB 4JYTA 1MZAA 1C9PA 1EKBB 2F9NA 3M5LA 1CHOG 3SU2A 2BD7A 1C4V2 4ABGA 1D6RA 3RXMA 1SGFG 3EA7A 3P8OA 4BAKB 4DCDA 3HK3B 1AB9B 2ANKH 1GMCG 2P8OB 1BCUH 2FTLE 1O39A 1AY6H 3H7TA 2JETC 4YESB 2Z9JA 1IHTH 3SOSA 3I78A 1EOJA 3PLPA 1O2YA 2OC7A 4WWYA 1VGCB 1UTNA 2ZU4A 2KAIB 1AE8H 1UVTH 4JYVH 2ZHQH 2Y7XA 3V12A 2W3IA 2D8WA 1W2KH 4CR9A 1NY22 2GCTC 3AAUA 3ZZ9A 1TA2A 4ZHMU 1GG6B 5E2PA 1YPJH 3KIDU 2AS9A 2ZTXA 1G9IE 3RXVA 1W14U 1O3PB 1TNKA 3NK8A 1BB0B 2QCYA 1O3DA 1O2IA 1BBRE 2ZFSA 2A5IA 3BSQA 4BAMB 2BOHB 3BIVH 3K6YA 3KCGH 2ZU5A 2D26C 4J1YA 5JBTA 1O5CB 1M9UA 3RUOA 5F6MA 2H9HA 2Q6GA 1MH0A 3LC5A 1YPKH 1ESAA 5A0CA 2PV9B 5J4QA 4K69A 5DK1A 2ZU1A 1QIXB 2BD2A 2HALA 3Q77A 1DX5M 1G32B 1AB9C 2HNTE 1D4PB 2ZGXH 2SNWA 1PPHE 1LHCH 1VITF 4XDEA 1ELGA 1Z1JA 1AZZA 4SGBE 5ABWA 2HOBA 2LNCA 2BY5X 5EXLA 4FUIA 3K65B 1ZTLA 4ZKNU 2DE8A 3K6ZA 1VGCC 5LH8A 3KQDA 3ZZ7A 1DANH 3LGYA 9LPRA 1ID5H 1EATA 1S81A 2NU0E 4Q2KA 4CH2B 3LGUA 3RXRA 4A1TA 1DY8A 5FPYA 2SFAA 3QX5H 4IS5A 3RC4A 1ZYOA 3V7TA 1H9LB 1LQEA 1TIOA 1A7SA 5CHAB 3S0NA 1SOTA 3D62A 4FU8A 3AAVA 1AFQB 1MU6B 1THSH 2D1JA 4NIXA 4TWYA 4Y11E 1P3CA 3VB6A 3RMLH 1A1RA 3VB4A 3M3VA 1ZGIA 1O34A 3ZV8A 1TNLA 1SLUB 2XXLA 4XOJA 1THPB 1W10U 1CT0E 1HCGA 4BTIB 3SU5A 1MQ5A 1KXAA 3FP8E 2PKAB 1A2CH 3OY6U 5E2OA 2CHAB 1EJAA 1C2GA 1MUEB 4IMZA 1GI9B 4MNVA 3Q3YA 4YOGA 2EC9H 2OUAA 5F8TA 1XVMA 1KDQA 1Y3XA 1YLDA 2RG3A 1F0SA 1FV9A 2C8WB 1C4Y2 1GVZA 1O2OA 3MYWA 1NS3A 2CF8H 4SGAE 2EI7A 1BBRK 2NU1E 3MH6A 3QK1A 3L3TA 1C5LH 1V2JT 2ZHWH 5F8XA 4DVAU 1BIOA 3A7XA 4AN7A 4E7RG 2GT8A 2C8ZB 2ZEBA 1SLVB 1DXWA 3GY8A 3LGIA 1SLXB 2FOBA 2BDYA 2W7UA 1QQUA 1LPGB 2GV7A 2P93A 1AWFH 3PWCA 4IW4E 5HMAA 2PSYA 1K1IA 2SGAA 1MU8B 2GZ8A 4JK6A 4OGXA 5HM2A 1V2QT 1BRUP 2ZO3H 3HKJB 1O3CA 3RP2A 2QXJA 2TGAA 8GCHF 2ASUB 3QTOH 3O8CA 3F1SB 2AH4X 3ZZAA 3PROA 2BOKA 2KAIA 1C1SA 1O30A 3BTKE 3GISB 1ORFA 4X6MA 1ANCA 3PWBA 2XCNA 1BJVA 3GDUA 5JBCS 4NFFA 1ANDA 2O8UA 1T8MA 1GG6C 1AUJA 2BXUH 3SI3H 1J14A 2A31A 4F49A 2OC0A 1NPMA 3DHKH 3SU6A 1EAWA 2G51A 3RU4D 2WPKS 1BRCE 1TOCB 4B76A 1V6DA 1HAOH 4DW2U 4J2YB 1XKAC 1HXEH 5L30H 5AFZH 1ZLRA 1A0JA 1XUIA 3A87A 5ETXA 2G5VA 5E0GA 1DOJA 3ELAH 5EW1H 4RSPA 3GY7A 2W26A 2V3OH 1QTFA 2B0FA 5DG6A 1P57B 3KQEA 2XBVA 2FESH 3TK5A 1ARBA 1EAIA 1LVOA 1KLJH 2AFQB 4K2YA 4AG1A 4A92A 1UVSH 3UREA 4UFEH 1AE5A 2HGTH 3SNAA 2AGIX 1HXFH 1YGCH 1O2SA 1T4UH 1O3EA 1XXDA 3DUXH 3E91A 3CS0A 1O35A 2WUBA 2ZDMA 4BAOB 1OXGA 4ISOA 3T62A 1AVGH 8KME2 1KLIH 1C2KA 1TBZH 3SGAE 1P02A 1S84A 2WUCA 3JZ2B 3SUDA 2Y5GA 4X6NA 2OC1A 1BTXA 3OSYA 1O2PA 1UK4A 1RS0A 1GBLA 1JWTA 1HAPH 4IN1A 1ELEE 1TRMA 3UR6A 3A88A 2GMTB 1G3EA 1DXPA 1XVOA 4TWWA 4Y10E 1GBCA 1WV7H 2Z7FE 3GDVA 4ISIH 2F91A 3ZVCA 1DITH 5HYOA 5AVDA 3BTGE 1TPPA 1GI6A 1EZXC 3BF6H 1O3JA 3EYDA 4FVDA 1GCTB 2FOGA 2QA9E 3BTTE 1LDTT 5EXNA 1GBBA 1B0FA 3RXPA 2AMPA 3RDZA 5TCAA 4JZDH 5GCHG 1Y5BT 1KXDA 1DWDH 5A09A 2PUQH 4WVPE 1KSNA 4HTCH 1YPGH 1HAIH 3ODDA 1UHBA 1LHDH 1EXFA 3JZ1B 1CQQA 4DIIH 3TJUA 5AFYH 2ZPSA 2XCFA 3SNEA 1OWKA 1GWAA 3F9GA 1PQ7A 4XBBA 1BRAA 2AYWA 1P04A 3RXKA 1O3MA 2BDGA 6CHAC 1TPOA 3U69H 5GXPA 4FUEA 3VPKA 3E90B 2C8YB 2EI8A 1BTYA 1LVBA 4NWLA 3SJ8A 3HATH 2DUCA 3M5OA 1HIAB 1OWJA 4TYDA 2PKSB 3HPTB 4ZHAA 4JZFH 3SN8A 4X1QU 1NESE 2TIOA 3TK9A 2VINA 3KQBA 3LIWA 3RXJA 1YM0A 1RIWC 3B9FH 1O2XA 1CU1A 3ATMA 3T27A 2WPHS 5SGAE 4UE7H 3ODFA 4LK4A 4WH6A 1FDPA 1QA7A 4OS2A 2GMTC 2OQUA 3PV4A 1CGIE 2VIQA 3MH5A 1EOLA 2JH0D 2XC5A 1UCYK 5EU8A 2WPMS 5DP7A 1TNGA 5T6GA 2BX3A 1A0HB 5K0HA 1FY1A 1KXCA 7GCHG 4TPYA 1B5GH 3GY3A 5EPNA 2PUXB 3OTJE 1TNJA 1TALA 1TWXB 5EW2H 1YCPH 2O8LA 2J2UA 1ELAA 4RKOB 5HGGA 3LONA 1TNHA 4VGCB 4NA7A 3NKKA 1V2MT 5DPAA 5C2ZA 1ETSH 3MNSA 1XUGA 4IGDA 3A8DA 3D23A 2FYQA 4JZ1A 1DM4B 3T2NA 1O2JA 3TH2H 1ETRH 4Y79A 1K1LA 3DFJA 1QJ6B 1Q2WA 4X1NU 1BTUA 4K8BA 2A4RA 1OSSA 2GCTB 1S0QA 1SFQB 1PJPA 3Q76A 3SZNA 1TPAE 1UCYE 1P03A 2H9TH 2VGCB 2W7SA 1C2IA 3UTUH 3E8LA 4INKA 4UFFH 3EDXB 1GHVH 3ZZ3A 3OX7U 1IOEA 4DURA 1PPFE 5J4SA 3PMJA 2R2WU 3A85A 4OGYA 1OWIA 4GPGA 1AVXA 1OYTH 2BD5A 4XBDA 2A4GA 3RLWH 2GKVE 1YKTA 3P95A 2ZKSA 4UEHH 2W3KA 4F4OC 2FS9A 2XWAA 2G8TA 1YPHE 3ZZ8A 1ZSJA 1XUJA 3F68H 2BY9X 3KQCA 4YTAA 3RC6A 1O5GH 4DG4A 5FXLA 1F92A 1H9HE 3ZVGA 4LZ1H 2ZDKA 1QRWA 3TJNA 1GJCB 1KTTB 2XWBI 1C2LA 3D49H 3IWMA 2O8TA 5GCHF 1PPCE 5LGOA 1F0UA 2PGBB 1BTZA 1DDJA 2ZGHA 1SGFA 6CHAB 1O38A 1NRSH 4AYYB 4X2VA 1BRBE 1FLEE 1IQKA 1K22H 4DY7B 1GCTC 1TRNA 3S7HB 1GBKA 2VVUA 1A0LA 1IQEA 1GBAA 3KF2A 1RFNA 2H5CA 1S83A 5LPRA 1W7XH 1DY9A 1A5GH 1GMHG 5DP3A 4DT7B 1G30B 3G01A 1LHFH 2Z9LA 4Q80A 4DOQA 1EZSC 2IOTA 1ESBA 4B1TA 1UTOA 2QYIA 2ZNKH 1MTNB 2R3YA 3VXFH 3NUMA 2ZG0H 1EPTC 2GT7A 1C2MA 3UNSA 4AGKA 1CHOF 4INHA 1MBMA 1YPHC 3NZIA 1Y3UA 1GHYH 1WUNH 1W3CA 2QV1A 3T25A 2C4FH 2C90B 2CHAC 3RXGA 3SV6A 1UTQA 2SGFE 3LH1A 4Y0YE 1DVAH 2OXSA 1O2GH 1O5FH 3W94A 1QGFA 4NCYA 1EZQA 2HWLB 4X0WU 1OP0A 4B2CA 5L2YH 2HNTF 3GY4A 3PMHB 2FMJA 2UWOA 2CMYA 1P06A 3B23B 1JIMA 3LDXH 4GLYA 1ELCA 2CF9H 1LHEH 2ZCLP 4IBLH 1IQGA 2BDCA 4MPVA 5EGMA 4E05H 2BMGB 5A8ZA 1FMGA 3SI4H 1QBVH 3VB3A 1C2JA 4CRDA 2VWLA 1Y3WA 3GY5A 1OX1A 1UCYH 1LMWB 1N6YA 2GGVB 4NZQA 2YNAA 2FXRA 4E7NA 1JRSA 4HFPB 2P3FH 1DLKB 1W7GH 4ABHA 1V2VT 1CO7E 3ZVAA 1EPTB 4YLUA 1OYQA 2H2ZA 3QGJA 4X2YA 1YYY1 1LKBA 3S9BA 3UNRA 4ZKOU 1HPGA 3MO6A 1V2ST 2BDHA 1NRNH 2ZHEH 1MTSA 5EQSA 1CE5A 4Y0ZE 5GWZA 3UR9A 1N1LA 2V35A 2Q6FA 1P2NA 2ULLA 4X8UH 3DT0H 3A7WA 4NIVA 1SGIB 1T7CA 1Y3VA 1QCPA 3ZZBA 4OS6A 3TITA 1JIRA 1MD8A 4JZIA 2ZCKP 2AGGX 1YPLH 1CVWH 2SGPE 3BTQE 3S7KB 3TVJB 2STBE 1FY4A 1GMCF 4M7GA 1UHBB 4Z6AH 1Q3XA 2J38A 4X8TH 2H6MA 4YO9A 4CR5A 4GCHF 5A8YA 3MOCA 5C1XA 2ODPA 1BHXB 1ZOMA 1AVWA 2F9PA 3U98H 3HGNA 1OWDA 1FZZA 1PPGE 2ZFFH 1QBNA 4O3TA 3EA8A 2GCHF 1G3DA 1GHBG 1UTPA 4IC6A 2Z3EA 3M7TA 1WSSH 1QY6A 3QZQA 3DD2H 5GPIB 2OLGA 3SV2H 1GMDG 3SO3A 1TE0A 2B9LA 2Z6BD 3TGJE 1KIGH 4Y71A 1J8AA 1GBIA 3SJIA 1ZGVA 3V0XA 1O36A 1P11E 2Y81A 5GIBA 3PO1B 1Y5AT 4WXVA 1QL7A 4ABIA 3SUEA 1P0SH 5EODA 1QB1A 2PLXA 2SNVA 3MU5A 1DE7H 2VWNA 2TGPZ 1XKBC 1KLTA 3M7UA 1FPHH 1C5ZB 3RM2H 3WY8A 3KEEA 4NWKA 1IQMA 3PMAB 4NG9H 1ZPCA 1BQYA 2AERH 3LC3A 1QB6A 3AW1A 2F9BH 2CN0H 1Y5UT 2HRVA 1C5RA 5JPMH 9ESTA 2VNTA 1HJAC 3M37A 3E0PB 1F5LA 1MKXK 1O31A 4DIHH 1UK2A 4AFUA 3SHAH 1UO6A 2VIDA 4ABEA 4X8VH 1OWHA 4GCHG 4NFEA 1HYLA 1GJBB 1GL1A 2HLCA 1K9OE 4PROA 3F9FA 3T5FH 1CT4E 1N8OB 4R8TB 1EP5A 2P3TB 5DJ7A 4OS7A 2A2XH 1O0DH
chains in the Genus database with same CATH superfamily
1MTVA 5FBIA 1CHGA 2BY6X 1IQJA 3HKIB 2R2MB 1SLWB 1NFXA 3RXAA 1P2JA 2FX4A 4KGAA 1SQTA 4JZEH 1GHXH 1GJ9B 4XBCA 4A5TS 3E0NB 3RMNH 3P8FA 3TPIZ 4GVUA 1VZQH 1K1JA 2C8XB 1VCPA 3E6PH 3Q00A 2BDAA 1D3PB 2ZFRH 4ZAEA 3ATKA 3ZVBA 1O33A 2ZHFH 2A32A 1TAWA 1P10A 1INCA 1LPZB 3URDA 4BTTB 1FJSA 3MTYA 3GYLB 2UWPA 1FY3A 2OBOA 3LJJA 4ABJA 4CRAA 6GCHG 1H8IH 5IYTA 3ATLA 1BMFD 1EAXA 3AASA 1NZQH 3URCA 1B0EA 1KXEA 1ESTA 3MU0A 2FTMA 3M35A 2WV4A 3UIRA 1NU7B 1Z8RA 1RTLA 2BQWB 1FQ3A 1CGJE 1DFPA 4QT8C 1TGTA 1C1OA 5TJXA 2B7DH 1QFKH 1EUFA 2F9OA 3GCNA 2QE7D 1UTLM 1HIAA 1J9CH 4KTUA 1S0RA 1TYNA 1HAHH 2F9VA 1C1VH 2VIWA 4U01A 4Z0KA 3KN2A 1ZHMA 2BQ7B 4KTSA 3RXIA 2RA3A 1OWEA 1SC8U 1JXPA 3LKWA 3Q3KA 2P3UB 2ANWA 1A5HA 4K1TA 3NCLA 4GHQA 3RXFA 1FIZA 5CMXH 2F9UA 4FUBA 4FUCA 2QF0A 1TGSZ 1ZMNA 2J34A 4O3UA 1O2MA 1HDTH 1KXFA 2Y80A 1LVYA 1SHHB 2P95A 1AIXH 1SGEE 2FI4E 3GCHC 4Y8ZA 1T8OA 1MQ6A 3QZRA 3SORA 1TX7A 2BZAA 1QA0A 3MU1A 1GCDA 3BTHE 3FN8A 4UFDH 4HGCA 1O2TA 3QGNB 4AGJA 1BOQA 5PTPA 2GDEH 2PWXA 4ZMAH 5DP6A 3LGVA 3CNRA 3EQ0H 3SGQE 2BY7X 1ZRKA 3TGKE 2G4TA 2O8WA 5JDUB 3UWJH 1RIWB 3A82A 4JK5A 4YT6H 5FBEA 1HB0B 4WXIA 1TOMH 2PTNA 2VB0A 2B5TB 5G4BA 1C5QA 1OOKB 3F2FA 1K28D 4X1SU 1RTFB 5DP8A 1CBWC 2A45B 1P3EA 2V0BA 3A8BA 3RM0H 3RMOH 2WPJS 1MAYA 1ZHPA 1FUJA 1GI4A 5FHTA 3A8CA 1QRXA 2C93B 4Y76A 2VBCA 2VIOA 2Q1JA 1ANBA 3CENA 1BA8B 4XE4A 3FO8D 1P2IA 4BNRA 2PR3A 3PLKA 1WYKA 2XNIA 3ZYDA 4ISNA 1QBOA 2J4IA 2O9QA 2GTBA 3D65E 3F9EA 3GOVB 4I8HA 4MLFB 1FPCH 3VXEH 1L2EA 1O2HA 1HAZB 1C1TA 1GMDF 2R0KA 2PFEA 4OM9A 5DP9A 3P8GA 1WAYB 1AKSB 4FU7A 3SV8A 1ARCA 3HGPA 3A7TA 1G3BA 1EJNA 4H6TA 1V2NT 2VJ1A 1AZ8A 2BDIA 1XUKA 1NFYA 2QC2A 3PRBA 1GDNA 3MU4A 1C5NH 1ANEA 3PTBA 4WMEA 4I8KA 4OS5A 4KKDA 1P9SA 1SGTA 1A4WH 4GSOA 2NU4E 1BTWA 3SJ9A 4D9RA 3A89A 1V2UT 4ESTE 2P16A 3QWCH 2AIPA 2XW9A 1V2PT 5GNDA 2Z94A 4JYUH 1W12U 2J9NA 4YZUA 1V2WT 3ZZCA 7KMEH 1UJ1A 1GJAB 2ANYA 3QN7A 2QY0B 1KXBA 3RXDA 3A86A 5C1UA 4E06H 2ZGJA 3NXPA 2FPZA 5FCRA 4U32A 5JBBS 1NC6A 4X8SH 4H4FA 3GICB 1AMHA 2F3CE 1A46H 2IN2A 1ZMLA 3S69A 5EPYA 5FAHA 4UFGH 2A7HA 3R0FA 2FI5E 1E34B 1D3TB 1GI2A 2FZZA 1IQIA 2D2DA 1LTOA 5E0HA 4THNH 2V3MA 1D3DB 1K1MA 3NPSA 1O3KA 4ZXYH 3LPRA 1SGDE 2ANMH 3A7ZA 3PV2A 2UWLA 3LH3A 3AW0A 3BEIB 4D7GA 1C5YB 1P05A 3ZVDA 1GJ7B 1GDQA 4WMDA 1DSUA 3BEFB 2HNTC 3GCHB 3WWFA 1J15A 3SU4A 1UVUH 2K1QA 2OINA 2BY8X 3TJOA 3TNTA 4Y8YA 3PLBA 2ZHDA 1C4U2 4FUDA 5C1YA 1HAGE 1UVOA 2DE9A 2XC4A 1EQ9A 2FEQH 3BN9A 4AC9A 5I25A 2GX4A 3N99A 1O3NA 4BTUB 2FX6A 4FXGH 1IQHA 1WTHD 5HIYA 3E3TA 2EQNA 2G4UA 1C2DA 1BZXE 1WQSA 3RLYH 1GJ4H 4JMYA 1P2OA 3NWUA 3DCLA 1HAYB 4Y7BA 1MKXH 2ODYB 5FX5A 1HFDA 3KGPA 1E79D 3M3TA 5C3NA 4GUXA 2FWWA 5E0JA 1NFWA 3STIA 1C1WH 2OK5A 5DGJA 2K8IA 3Q3XA 3SNCA 5K7RA 3IITA 4NA9H 3BG4C 2V3HH 1S82A 2VH6A 3UOUA 3M7QA 1V2LT 1CA0B 4NSVA 4BOHA 4I8JA 5T1VA 1GI1A 1H8DH 1Z71A 1O3OA 4I32A 1O5BB 4MNWA 1BTHH 1SMFE 3MI4A 2NU2E 2BXTH 2AEIH 3F3BA 1ZMJA 1E0FD 4AB8A 4AFZA 2GCHG 1V2KT 1AU8A 4K60A 3K2UA 1YPMH 4K8YA 2GV6A 4R0IA 1O5EH 3BTME 1KMHB 1GI3A 4O9VA 2LPRA 3VGCB 3F2HA 5LPFA 2G81E 1G37A 5JYIA 3ZVFA 4I8GA 3LGWA 2ZDAH 5A0BA 3M3SA 2C3SA 2FLRH 5C17A 1T4VH 2BVSH 1Z6JH 3GCTF 3M5MA 4FVBA 1W0JD 2QAAA 3ZYEA 3QUMP 4DGJA 2P8OC 1ZTJA 6ESTA 2PKSC 3LGTA 2H1UA 2BTCE 1OP2A 5L6NH 4Q63A 5B6LA 1KY9A 1OHHD 1AQ7A 4NGAH 1GL0E 4Y6DA 1DUEA 1A61H 4UONA 1HAVB 1FN6A 5T6FA 1XUHA 2TGTA 1ZHRA 5KEDA 6GCHF 1GDUA 3MHWU 1DUAA 4ZXXH 3RXSA 3MH4A 1D3QB 2BLVA 1GBEA 4ASUD 1TBRH 3SQEE 1D9IA 1PPZA 2J92A 2ZC9H 4UD9H 3E1XB 3A7YA 1C2FA 3BIUH 3TJVA 4B2BA 2VWMA 2RA0A 1ELVA 1UVPA 1P2KA 1F7ZA 3CS7A 1VITG 1TABE 1NBME 4ZKSU 5CE1A 3R3GB 1L0ZA 2EEKA 1WCZA 2B8OH 3VFEA 3BV9B 2TPIZ 1BJUA 2ZP0H 1DSTA 3MH7A 2ZPRA 2G52A 2UUFB 4FUHA 8ESTE 1C1RA 4XSKU 4YOIA 4TY6A 1TRYA 4Q7ZA 1HNEE 3RMMH 2Q6DA 1HJ8A 1RJXB 3W1EA 1AD8H 1AUTC 1O2RA 3GY6A 4CREA 1SPJA 3BTEE 5C20A 3VB5A 2FODA 1NRRH 3RXCA 2BD4A 2BQ6B 1C2EA 4AG2A 1BMNH 3FP6E 1FY8E 1YY3A 3E16B 3EGKH 3QDZB 4RT0A 7ESTE 1C1MA 2JH6D 3VEQB 3STJA 2WV5A 1F5RA 2WZQA 4X1PU 1LQDB 5DP5A 3A7VA 2R3UA 1O2ZA 3FP7E 1C1UH 1DWEH 2TBSA 1FN8A 4BXSA 1GMHF 4GAWA 1BTPA 3SUFA 7LPRA 1TGCA 2XTTB 2M5TA 3A8AA 1BHXF 3F0PA 1BT7A 1RTKA 1E38B 3SW2B 2H5DA 4A6LA 1V3XA 1Y8TA 3U8TH 4AFSA 3BEUA 5ESBA 1TX8A 3RXQA 3S9AA 4H42U 3KHVA 4WF8A 1O37A 2ZZUH 1QQ4A 2QF3A 1EFRD 1C5XB 3U9AH 2SGDE 1CA0C 4MPWA 1O3HA 1TQ0B 5EQRA 1PFXC 1CT2E 2A0QB 1UTJA 3EE0B 4WH8A 1BMLA 3ZZ4A 1L4DA 1G2MA 4FETA 4DJZB 2GVFA 4TY7A 3MO9A 5HM9A 1GVKB 1SFIA 3TU7H 2XRCA 3BTFE 1GHAF 4YOJA 1P2QA 4GHTA 4IC5A 2Z3CA 4Q7YA 1TQ7B 1J17T 3N7EA 4KELA 1C2HA 4P00A 2K0QA 4CHAB 1DWCH 1GBMA 4TPIZ 5EOKA 4AOQA 4OS4A 1O3IA 1WOFA 4YLQH 1TNIA 1Z8IB 2FYRA 1FAKH 2THFB 1N6XA 2A5AA 4AX9H 3TK6A 3H5CB 3IG6B 1DPOA 1G36A 1Y3YA 1YCPK 1XXFA 1PQAA 4ZUHA 5T3HA 2VVVA 1SHYA 1C5PA 5B6OA 1MMJN 2FOHA 1T8LA 1IQNA 1HUTH 1NRQH 1VCWA 1FXYA 2KCPA 1TGBA 2VIPA 4Y7AA 5C0UA 3SHCH 1HBTH 2AMDA 3SU3A 3M36A 1O2LA 1LO6A 2FOEA 4IN2A 1SGYE 4D7FA 1ZZZA 3B8JA 2FLBH 1AFEH 2FIRH 2PGQB 1GVLA 2ZGCA 1O3BA 2BYAX 3P6ZB 4K5ZA 1EASA 2UUKB 1QJ1B 1Y59T 4Q7XA 3ZZ6A 1YCPM 1UK3A 2PTCE 2A7JA 1GHWH 2WYGA 4LZ4B 3C1KA 4ABDA 2A1DB 1E37B 1G3CA 4X6PA 1THRH 4D8NA 4OS1A 5H4IB 2QGRA 3K9XB 1P12E 1EJMA 1PPBH 2YNBA 2KCOA 1QJ7B 1IHSH 5AF9H 2BLOA 1NT1A 2JIZD 2ZIQH 1WBGB 1DS2E 4NA8A 2IJOB 4MDSA 3FANA 3GY2A 3O8BA 1PYTD 3PM3A 1OP8A 2FOAA 2OBQA 2VVCA 3ATWA 3RU4E 3SNDA 1FNIA 1FI8A 2JETB 3RU4T 3FAOA 3TH3H 2BLQA 1SGQE 1L1NA 1F5KU 1T8NA 4D9QA 1ELBA 3L33A 1LKAA 1O2VA 1TONA 2CJIA 1ACBE 4MNYA 2QXGA 4FU9A 2BVRH 4MQAA 1Q31A 5C5NA 1TMTH 8GCHG 4ABBA 5BRRE 2BB4A 1GJ6A 5LPEA 3WW7A 1GBFA 1ZPBA 2H9EH 2GZ9A 4B71A 2BZ6H 3QTVH 1AHTH 3T26A 1HLTH 4P02A 1C5SA 2CGAA 1JRTA 4KP0A 1BMMH 2A7CA 4Y8XA 2ZDNA 1YBWA 2Y5HA 3EA9A 4MTBA 5C94A 4ABAA 1C5MD 1CBWB 2ZDVH 1C5OH 1H4WA 1NO9H 1SVPA 1TPSA 2Y6TA 1YP9A 2YOLA 1GI5A 2A5KA 1TB6H 2BD9A 1DICA 1K1OA 3U8OH 2O8MA 4MPUA 4JCNA 1C5WB 3OY5U 2HPQH 1QB9A 4A1VA 1O3AA 1IQFA 3U1IB 1MBQA 2FDAA 2NU3E 1CA8B 4IMQA 4XD7D 1T31A 3W95A 1SG8B 5C67A 3BTDE 4LOYH 1RD3B 1NRPH 2PP6A 2R9PA 1U6QA 1W11U 1XX9A 4D76A 5DKMA 5ESTE 4X2WA 4X6OA 3SJKA 4MPXA 2SGQE 1CGHA 1IQLA 3RC5A 2PW8H 1ZSKA 1YC0A 5A8XA 1QHRB 1Z8JB 3N7OA 2BVXH 2VIVA 2JH5D 2W6JD 1ZSLA 1SI5H 2EI6A 3F6UH 4NIYA 1VITH 1XM1A 3GS9A 2W5EA 3RXTA 1OKXA 2Y5FA 2J94A 1MKWH 1MZDA 2ODQA 3MNBA 1C1NA 5TCCA 3MMGA 1MTUA 4NIWA 3KQ5A 2BX4A 2A2QH 2ZU2A 3ZZDA 4NSYA 3CP7A 1AFQC 3UB0A 1D6WA 1DT2A 4FUJA 1GBTA 3H7OA 3I77A 1O2NA 1YLNA 2ZA5A 5EQQA 5BPEA 2ZWLH 2JJ1D 1MCTA 3FKSD 3LU9B 2ZDLA 2ZPQA 1UMAH 4ABFA 2KCYA 3PV5A 1GI8B 1K2I1 1PQ5A 1JMOH 1LPKB 2GZ7A 1AI8H 1K21H 2ZI2H 3VB7A 1O2KA 2TGDA 4MG3A 1GBHA 1ZR0A 1H9IE 1HJAB 2XBWA 3RXEA 3M5NA 1C5UA 1K1PA 3U8RH 1SGNE 4B75A 2OP9A 4CH8B 1EPTA 2BHGA 3VGCC 1TMBH 2BM2A 7GCHF 2Z9IA 3RXHA 4WJG2 1HV7A 1QL9A 1ETTH 3PTNA 1MKWK 1S6HA 3C27B 1A3EH 2NWNA 6LPRA 3MQKC 2ZQ1A 1S6FA 1YPEH 3SGBE 4B73A 1G2LA 2AMQA 4ZHLU 4BANB 2ZFQH 3BG8A 1L1JA 4I33A 4ISLA 4YM9A 3OU0A 3UPEA 4CRBA 4HZHA 1EAUA 1SGCA 3LT3A 3F9HA 4X1RU 1S85A 3UOPA 3KNXA 3SQHE 1GPZA 1JBUH 3F2GA 1ABIH 3DA9B 3KL6A 1GI0A 3UUZA 1A3BH 3ESTA 4CBOA 1VCQA 1DLEA 4ZCNA 2GD4B 4AORA 5GDSH 2ZFTA 4YT7H 1TLDA 1W8BH 3SBKA 5JBAS 3SNBA 2P59A 1GHZA 1W0ZU 3S9CA 2FS8A 3A84A 2GDDA 2XBYA 4I8LA 1F0TA 4MVNA 1P01A 3GDSA 3EAJA 4FUFA 2AGEX 4UDWH 1SQAA 2Y82A 2WPIS 1E36B 1MTWA 3SU1A 3BTWE 1YLCA 2ZU3A 4WY3A 2ZCHP 2QXHA 1C9TA 2QIQA 4U2WA 5C5OA 3ATIA 2F83A 1SQOA 3TNSA 5IDKA 3KYFA 3FZZA 3T28A 1QZ8A 3RXUA 2UUJB 1SR5C 3MNCA 1FX0B 2ALVA 5EJZA 3ZZ5A 4KTCA 4CRFA 1ZRBA 3L6PA 2VWOA 3PYHA 1XUFA 2ZQ2A 2XBXA 1GJDB 1V2RT 2ZTYA 1O5AB 4I7YH 4CBNA 1DWBH 1P8VC 2WHXA 4A1XA 4AZ2B 1LVMA 4LXBH 5EG4A 2RDEA 1VJAU 1HJ9A 2KZ4A 2R0LA 1PYTC 3A81A 2VU8E 2I6QA 3DFLA 1P9UA 2FOCA 3MO3A 1C1PA 1VR1H 1ELDE 1MTNC 3UFAA 1WQVH 1GHAG 5T6DA 1P2MA 2G5NA 1O2QA 4VGCC 2Z9GA 1TMUH 2P94A 1YF4A 2UUYA 3MNXA 1MD7A 2VH0A 1FIWA 3TH4H 2JKHA 5FPTA 4CRCA 3GCOA 1ZJKA 1PQ8A 3FZDA 1KYNA 5DO4H 4A7IB 2HVXA 3A80A 3KYGA 1X7AC 4K1SA 3ZVEA 3U1JB 4XFQA 1VJ9U 1Z6EA 3LJOA 1TGNA 1V2TT 2ZF0H 4ASHA 1O3LA 3PB1E 3NRLA 3OYPA 1ABJH 3TIUA 1H1BA 1JOUB 4H6SB 1S5SA 2VGCC 3UWIA 2FOMB 1WDIA 3GYMA 1LCYA 1A5IA 2BD8A 3M61U 2G55A 2TRMA 2ZTZA 3SUGA 1TFXA 4CRGA 4TSFD 4CHAC 1SL3A 1SOZA 3I29A 1AGJA 1GBDA 2BLWA 1GBJA 4FUGA 5F8ZA 3OAAD 3UQVA 1GJ5H 1MCVA 2ALPA 2BDBA 1ZPZA 3P8NA 5L2ZH 3P17H 1QURH 1AWHB 2I6SA 1T32A 2OTVA 3LOXA 1QL8A 4HI3A 1GJ8B 4U30A 1QR3E 2A4QA 4F55A 5FPSA 1GGDC 1O2UA 2QXIA 5I46H 3UY9A 1RGQA 2AIQA 1EP6A 3BG4B 2FO9A 1CSOE 1MAXA 1NU9A 1HGTH 1C5TA 1FAXA 3O8RA 2CXVA 4AFQA 3QLPH 3ENSB 2G00A 3FFGA 3WWBA 1NFUA 1V2OT 2OCVB 3RXLA 1XMNB 1BUIA 1W13U 1GI7B 3UQOA 5FCKA 1FY5A 1KDQB 1HAXB 3FVFB 5AHGH 5F53A 5FX6A 1NROH 1O3GA 4Q4LA 4AYVB 1Z1IA 3V13A 3O8DA 1GHBF 1SB1H 2SGEE 4BAQB 2WINI 3SV9A 2YMSC 1F2SE 3FOAA 1IAUA 2PKAA 1NTPA 1C5VA 1OS8A 3P92A 5HXFA 1BITA 3MWIU 5A0AE 1AKSA 5E8EH 4XRNA 8LPRA 3RXOA 2EA3A 4BXWA 4RKJB 1HAVA 2OQ5A 2WYJA 3PMBB 5KGOA 2J98A 2CV3A 4O97A 1SGPE 1FONA 1EB2A 2Z9KA 1O3FA 1P09A 1TA6A 4ZKRU 4B74A 4O03A 2ZGBH 2KCAA 1O32A 1UTKA 5A2MH 3T29A 1WU1A 1F0RA 2BD3A 3A83A 5JB8S 1J16A 2IPHA 2OD3B 1K0HA 1NM6A 3GCTG 1EB1H 3MU8A 3HK6B 3ITIA 1O5DH 2ILNA 3SJOA 3ZV9A 1WXRA 1TX6A 1RRKA 1HRTH 1W0YH 3PO1C 3TGIE 4INLA 4K1EA 4I31A 3SV7A 1WTGH 2RCEA 3RXBA 1ELFA 2WPLS 2J95A 2A4OA 2OC8A 2XC0A 2XYAA 1EZUC 1BMAA 1QRZA 2PHBA 1SSXA 2ZFPH 3QO6A 2ESTE 2FI3E 3V3MA 3SU0A 1O2WA 4MNXA 1YWUA 2Z3DA 3SYJA 2GP9B 1E35B 1EX3A 2PSXA 3AVZA 5GJ4B 2FM2A 1NN6A 1PPEE 5F03A 2ZECA 4ZROA 4K3JA 1BDAA 1RXPA 3TLOA 1L4ZA 4NZLA 1KTSB 1ZJDA 2YMSB 4ISHH 1K1NA 1Z8GA 2Y7ZA 1LHGH 5CHAC 3UNQA 2FOFA 2STAE 1ELTA 2RDLA 1UTMA 4B2AA 1B7XB 1ZTKA 1L1GA 1AO5A 3MFJA 5EXMA 2FP7B 1SBWA 4X2XA 5DP4A 4BAHB 1QNJA 2HLDD 1Z7KA 2QN5T 1C1QA 4ZH8A 2HVYB 1N8OC 1OPHB 3P70B 4RI0A 5JB9S 4RN6A 1BBRH 4WMFA 1AN1E 2V6NA 1SGRE 4AB9A 2HPPH 1TBQH 1GGDB 4JYTA 1MZAA 1C9PA 4RT1A 1EKBB 2F9NA 3M5LA 1CHOG 3SU2A 2BD7A 3OFND 1C4V2 4ABGA 1D6RA 3RXMA 1SGFG 3EA7A 3P8OA 2L6OA 4BAKB 4DCDA 2QF5A 1AB9B 3HK3B 2ANKH 1GMCG 2P8OB 1BCUH 2FTLE 1O39A 1AY6H 3H7TA 2JETC 3OEED 4YESB 2Z9JA 1IHTH 3SOSA 3I78A 1EOJA 1H8ED 1O2YA 2OC7A 3PLPA 1VGCB 4WWYA 1UTNA 2ZU4A 2KAIB 1AE8H 1UVTH 4JYVH 2ZHQH 2Y7XA 3V12A 2XOKD 2W3IA 2D8WA 2IJD1 1NBMD 1W2KH 4CR9A 1NY22 2GCTC 3AAUA 3ZZ9A 1TA2A 4ZHMU 1GG6B 5E2PA 1YPJH 3KIDU 2AS9A 2ZTXA 1G9IE 3RXVA 1W14U 1O3PB 1TNKA 3NK8A 2W6ID 1BB0B 2QCYA 1O3DA 3ZIAD 1O2IA 1BBRE 1SKYE 2ZFSA 2V7QD 2A5IA 3BSQA 4BAMB 2BOHB 3BIVH 3K6YA 3KCGH 2ZU5A 2D26C 4J1YA 3N7DA 5JBTA 1O5CB 1M9UA 3RUOA 5F6MA 2H9HA 2Q6GA 3VG8A 1MH0A 3LC5A 1YPKH 1ESAA 5A0CA 2PV9B 5J4QA 4K69A 5DK1A 2ZU1A 1QIXB 2BD2A 2HALA 3Q77A 1DX5M 1G32B 1AB9C 2HNTE 1D4PB 2ZGXH 2SNWA 2YMSD 2QF4A 3DSGA 1PPHE 1LHCH 1VITF 4XDEA 1ELGA 1Z1JA 1AZZA 4SGBE 5ABWA 2HOBA 2LNCA 1E1QD 2BY5X 5EXLA 4FUIA 3K65B 1ZTLA 4ZKNU 2DE8A 2WPDD 3K6ZA 1VGCC 5LH8A 3KQDA 3ZZ7A 1DANH 3LGYA 9LPRA 1ID5H 1EATA 1S81A 2JDID 2NU0E 4Q2KA 3PRDA 3LGUA 3RXRA 4CH2B 4A1TA 1DY8A 5CHBA 5FPYA 2SFAA 3QX5H 2XNDD 4IS5A 3RC4A 1ZYOA 3V7TA 1H9LB 1LQEA 1TIOA 1A7SA 5CHAB 3S0NA 1SOTA 3D62A 4FU8A 4ACAA 3AAVA 1AFQB 1MU6B 1THSH 2D1JA 2LP6A 4NIXA 4TWYA 4Y11E 1P3CA 5EIYA 3VB6A 3RMLH 1A1RA 3VB4A 3M3VA 1ZGIA 1O34A 3ZV8A 1TNLA 1SLUB 2XXLA 4XOJA 1THPB 1W10U 3OEHD 1CT0E 1HCGA 4BTIB 3SU5A 1MQ5A 1KXAA 3FP8E 2PKAB 1A2CH 3OY6U 5E2OA 2CHAB 1EJAA 1C2GA 1MUEB 4IMZA 1GI9B 4MNVA 3Q3YA 4YOGA 2EC9H 2OUAA 1S6LA 5F8TA 1XVMA 1KDQA 1Y3XA 1YLDA 2RG3A 1F0SA 1FV9A 2C8WB 1C4Y2 1GVZA 1O2OA 3MYWA 1NS3A 2CF8H 4SGAE 2EI7A 1BBRK 2NU1E 3MH6A 3QK1A 3L3TA 1C5LH 1V2JT 2ZHWH 5F8XA 4DVAU 1BIOA 3A7XA 4AN7A 2WV9A 4E7RG 2GT8A 2C8ZB 2J97A 2GJGA 2ZEBA 3F0OA 1SLVB 1DXWA 3GY8A 3LGIA 1SLXB 2FOBA 2BDYA 2W7UA 1QQUA 1LPGB 2GV7A 2P93A 1AWFH 3PWCA 4IW4E 5HMAA 2PSYA 1K1IA 2SGAA 1MU8B 2GZ8A 4JK6A 4OGXA 5HM2A 1V2QT 1BRUP 2ZO3H 3HKJB 1O3CA 3RP2A 2QXJA 2TGAA 8GCHF 2ASUB 3QTOH 3O8CA 2L74A 3F1SB 2AH4X 5FL7D 3ZZAA 3PROA 2BOKA 2KAIA 1C1SA 1O30A 3BTKE 4B6FA 3GISB 1ORFA 4X6MA 1ANCA 3PWBA 2XCNA 1BJVA 3GDUA 5JBCS 4NFFA 1ANDA 2O8UA 1T8MA 1GG6C 1AUJA 2BXUH 3SI3H 1J14A 1SQRA 2A31A 4F49A 2OC0A 1NPMA 3DHKH 3SU6A 1EAWA 2G51A 3RU4D 2WPKS 1BRCE 1TOCB 4B76A 1V6DA 1HAOH 4DW2U 4J2YB 1XKAC 1HXEH 5L30H 5AFZH 1ZLRA 1A0JA 1XUIA 3A87A 5ETXA 2G5VA 5E0GA 1DOJA 3ELAH 5EW1H 4RSPA 3GY7A 2W26A 2KX4A 1QTFA 2B0FA 2V3OH 5DG6A 1P57B 3KQEA 2XBVA 2FESH 3UAIC 3TK5A 1ARBA 1EAIA 1LVOA 1KLJH 2AFQB 4K2YA 4AG1A 4A92A 1UVSH 3UREA 4UFEH 1AE5A 2HGTH 3SNAA 2AGIX 1HXFH 1YGCH 1O2SA 1T4UH 1O3EA 1XXDA 4DT4A 3DUXH 3E91A 3CS0A 1O35A 2WUBA 2ZDMA 4BAOB 1OXGA 4ISOA 3T62A 1AVGH 8KME2 1KLIH 1C2KA 1TBZH 3SGAE 1P02A 1S84A 2WUCA 3JZ2B 3SUDA 2Y5GA 4X6NA 2OC1A 1BTXA 3OSYA 1O2PA 1UK4A 1RS0A 1GBLA 1JWTA 1HAPH 4IN1A 1ELEE 1TRMA 3UR6A 3A88A 2GMTB 1G3EA 1DXPA 1XVOA 4TWWA 4Y10E 5KECA 1GBCA 1WV7H 2Z7FE 3GDVA 4ISIH 2F91A 3ZVCA 1DITH 5HYOA 5AVDA 3BTGE 1TPPA 1GI6A 1EZXC 3BF6H 1O3JA 3EYDA 4FVDA 1GCTB 2FOGA 2QA9E 3BTTE 1LDTT 5EXNA 1GBBA 1B0FA 3RXPA 2AMPA 3EE7A 5TCAA 3RDZA 4JZDH 4M9FA 1Y5BT 5GCHG 1KXDA 1DWDH 5A09A 2PUQH 4WVPE 1KSNA 2IPQX 2J98B 4HTCH 1YPGH 1HAIH 3ODDA 1UHBA 1LHDH 1EXFA 3JZ1B 1CQQA 4DIIH 3TJUA 5AFYH 2ZPSA 2XCFA 3SNEA 1OWKA 1GWAA 3F9GA 1PQ7A 4XBBA 1BRAA 2AYWA 3U28C 1P04A 3RXKA 1O3MA 2BDGA 6CHAC 1TPOA 3U69H 5GXPA 4FUEA 3VPKA 3E90B 2C8YB 2EI8A 1BTYA 1LVBA 4NWLA 3SJ8A 3HATH 2DUCA 3M5OA 1HIAB 1OWJA 4TYDA 2PKSB 3HPTB 4ZHAA 4JZFH 3SN8A 4X1QU 3OTPA 1NESE 2TIOA 3TK9A 2VINA 3KQBA 3LIWA 3RXJA 1YM0A 1RIWC 3B9FH 5IK2D 1O2XA 1CU1A 3ATMA 3T27A 2WPHS 5SGAE 4UE7H 3ODFA 4LK4A 4WH6A 1FDPA 1QA7A 4OS2A 2GMTC 2OQUA 3PV4A 1CGIE 2VIQA 3MH5A 1EOLA 2JH0D 2XC5A 1UCYK 5EU8A 2WPMS 5DP7A 1TNGA 5T6GA 2BX3A 1A0HB 5K0HA 1FY1A 1KXCA 7GCHG 2RFKC 4TPYA 1B5GH 3GY3A 5EPNA 2PUXB 3OTJE 1TNJA 1TALA 1TWXB 5EW2H 1YCPH 2O8LA 2J2UA 1ELAA 1H8HD 4RKOB 5HGGA 3LONA 4Z1MD 1TNHA 4VGCB 4NA7A 3NKKA 1V2MT 5DPAA 2CK3D 5C2ZA 1ETSH 3MNSA 1XUGA 4IGDA 3A8DA 3D23A 2FYQA 4JZ1A 1DM4B 3T2NA 1O2JA 3TH2H 1ETRH 4Y79A 1K1LA 3DFJA 1QJ6B 1Q2WA 4X1NU 1BTUA 4K8BA 2A4RA 1OSSA 2GCTB 1S0QA 1SFQB 1PJPA 3Q76A 3SZNA 1TPAE 1UCYE 1P03A 2H9TH 1MABB 2VGCB 2W7SA 1C2IA 3UTUH 3E8LA 3DSPA 4INKA 4UFFH 3EDXB 1GHVH 3ZZ3A 3OX7U 1IOEA 4DURA 1PPFE 2F4LA 5J4SA 3PMJA 2R2WU 3A85A 4OGYA 1OWIA 4GPGA 1AVXA 1OYTH 4HG6A 2BD5A 4XBDA 2A4GA 3RLWH 2GKVE 1YKTA 3P95A 2ZKSA 4UEHH 2W3KA 4F4OC 2FS9A 2KFWA 2XWAA 2G8TA 1YPHE 3ZZ8A 1ZSJA 1XUJA 3F68H 2BY9X 3KQCA 4YTAA 3RC6A 1O5GH 4DG4A 2J5UA 5FXLA 1F92A 1H9HE 3ZVGA 4LZ1H 3OE7D 2KR7A 2ZDKA 1QRWA 3TJNA 1GJCB 1KTTB 2XWBI 1C2LA 3D49H 3IWMA 2O8TA 5GCHF 1PPCE 5LGOA 1F0UA 2AHME 1BTZA 1DDJA 2PGBB 2ZGHA 1SGFA 3H09A 6CHAB 1O38A 4F48B 1NRSH 4AYYB 4X2VA 1BRBE 5DSFA 1FLEE 1IQKA 1K22H 4DY7B 1GCTC 1TRNA 3S7HB 1GBKA 2VVUA 1A0LA 1IQEA 1GBAA 3KF2A 1RFNA 2H5CA 1S83A 5LPRA 1W7XH 1DY9A 1A5GH 2KM0A 1GMHG 5DP3A 4DT7B 1G30B 3G01A 1LHFH 2Z9LA 4Q80A 4DOQA 1EZSC 2IOTA 1ESBA 4B1TA 1UTOA 2QYIA 2ZNKH 1MTNB 2R3YA 3VXFH 2F43B 3NUMA 2ZG0H 1EPTC 2GT7A 1C2MA 3UNSA 4AGKA 1CHOF 4INHA 1MBMA 1YPHC 3NZIA 1Y3UA 1GHYH 1WUNH 1W3CA 2QV1A 3T25A 2C4FH 1W0KD 2C90B 2CHAC 3RXGA 3SV6A 1UTQA 2SGFE 3LH1A 4Y0YE 1DVAH 4TT3D 2OXSA 1O2GH 1O5FH 3W94A 1QGFA 4NCYA 1EZQA 2HWLB 4X0WU 1OP0A 4B2CA 5L2YH 2HNTF 3GY4A 3PMHB 2FMJA 2UWOA 2CMYA 1P06A 5HKKD 3B23B 1JIMA 3LDXH 4GLYA 1ELCA 2EY4C 2CF9H 1LHEH 2ZCLP 4ACBA 4IBLH 1IQGA 1COWD 2BDCA 4MPVA 5EGMA 4E05H 2BMGB 5A8ZA 1FMGA 3SI4H 1QBVH 5DN6D 3VB3A 1C2JA 4CRDA 2VWLA 1Y3WA 3GY5A 1OX1A 1UCYH 1LMWB 1N6YA 2GGVB 4NZQA 2YNAA 2LELA 2FXRA 4E7NA 1JRSA 4HFPB 2P3FH 1DLKB 1W7GH 4ABHA 3AK5A 1V2VT 1CO7E 3ZVAA 1EPTB 4YLUA 1OYQA 2H2ZA 3QGJA 4X2YA 1YYY1 1LKBA 3S9BA 3UNRA 4ZKOU 1HPGA 3MO6A 1V2ST 2BDHA 1NRNH 2JJ2D 2ZHEH 1MTSA 5EQSA 1CE5A 1E1RD 4Y0ZE 5GWZA 3UR9A 1N1LA 2V35A 2Q6FA 1P2NA 2ULLA 4X8UH 3DT0H 3A7WA 4NIVA 1SGIB 1T7CA 1Y3VA 1QCPA 3ZZBA 4OS6A 3TITA 1JIRA 1MD8A 4JZIA 2ZCKP 2AGGX 1YPLH 1CVWH 2SGPE 3BTQE 3S7KB 3TVJB 2STBE 1FY4A 1GMCF 4M7GA 1UHBB 5HIZA 4Z6AH 1Q3XA 1UW7A 2J38A 4X8TH 2H6MA 4YO9A 4CR5A 4GCHF 5A8YA 5C0TA 3MOCA 5C1XA 2ODPA 1BHXB 1ZOMA 1AVWA 2F9PA 3U98H 3HGNA 1OWDA 1FZZA 1PPGE 2ZFFH 1QBNA 4O3TA 3EA8A 2GCHF 1G3DA 1GHBG 1UTPA 4IC6A 2Z3EA 3M7TA 1WSSH 1QY6A 4YXWD 3QZQA 3DD2H 5GPIB 2OLGA 3SV2H 5CDFE 1GMDG 4FOUC 3SO3A 3SZEA 1TE0A 2B9LA 2Z6BD 3TGJE 1KIGH 2WSSD 4Y71A 1J8AA 1GBIA 3SJIA 1ZGVA 3V0XA 1O36A 1P11E 2Y81A 2M2AA 5GIBA 3PO1B 1Y5AT 4WXVA 1QL7A 4ABIA 3SUEA 1P0SH 4I86A 5EODA 1QB1A 2PLXA 2SNVA 5EJ1A 3MU5A 1DE7H 2VWNA 2TGPZ 3DSOA 1XKBC 1KLTA 3M7UA 1FPHH 1C5ZB 5EJLA 3RM2H 3WY8A 3KEEA 4NWKA 1IQMA 4B6EA 3PMAB 4NG9H 1ZPCA 1BQYA 2AERH 3LC3A 1QB6A 3AW1A 1VKYA 2F9BH 2CN0H 1Y5UT 2HRVA 1C5RA 5JPMH 9ESTA 2VNTA 1HJAC 3M37A 3E0PB 1F5LA 1MKXK 1O31A 4DIHH 1UK2A 4AFUA 3SHAH 1UO6A 2VIDA 4ABEA 4X8VH 1OWHA 4GCHG 4NFEA 1HYLA 1GJBB 1GL1A 2HLCA 1K9OE 4PROA 3F9FA 3T5FH 1CT4E 1N8OB 4R8TB 1EP5A 2P3TB 5DJ7A 4OS7A 2A2XH 1O0DH
chains in the Genus database with same CATH topology
1MTVA 5FBIA 1CHGA 2BY6X 1IQJA 3HKIB 2R2MB 1SLWB 1NFXA 3RXAA 1P2JA 2FX4A 4KGAA 1SQTA 4JZEH 1GHXH 1GJ9B 4XBCA 4A5TS 3E0NB 3RMNH 3P8FA 3TPIZ 4GVUA 1VZQH 1K1JA 2C8XB 1VCPA 3E6PH 3Q00A 2BDAA 1D3PB 2ZFRH 4ZAEA 3ATKA 3ZVBA 1O33A 2ZHFH 2A32A 1TAWA 1P10A 1INCA 1LPZB 3URDA 4BTTB 1FJSA 3MTYA 3GYLB 2UWPA 1FY3A 2OBOA 3LJJA 4ABJA 4CRAA 6GCHG 1H8IH 5IYTA 3ATLA 1EAXA 3AASA 1NZQH 3URCA 1B0EA 1KXEA 1ESTA 3MU0A 2FTMA 3M35A 2WV4A 3UIRA 1NU7B 1Z8RA 1RTLA 2BQWB 1FQ3A 1CGJE 1DFPA 4QT8C 1TGTA 1C1OA 5TJXA 2B7DH 1QFKH 1EUFA 2F9OA 3GCNA 1UTLM 1HIAA 1J9CH 4KTUA 1S0RA 1TYNA 1HAHH 2F9VA 1C1VH 2VIWA 4U01A 4Z0KA 3KN2A 1ZHMA 2BQ7B 4KTSA 3RXIA 2RA3A 1OWEA 1SC8U 1JXPA 3LKWA 3Q3KA 2P3UB 2ANWA 1A5HA 4K1TA 3NCLA 4GHQA 3RXFA 1FIZA 5CMXH 2F9UA 4FUBA 4FUCA 2QF0A 1TGSZ 1ZMNA 2J34A 4O3UA 1O2MA 1HDTH 1KXFA 2Y80A 1LVYA 1SHHB 2P95A 1AIXH 1SGEE 2FI4E 3GCHC 4Y8ZA 1T8OA 1MQ6A 3QZRA 3SORA 1TX7A 2BZAA 1QA0A 3MU1A 1GCDA 3BTHE 4UFDH 4HGCA 1O2TA 3QGNB 4AGJA 1BOQA 5PTPA 2GDEH 2PWXA 4ZMAH 5DP6A 3LGVA 3EQ0H 3SGQE 2BY7X 1ZRKA 3TGKE 2G4TA 2O8WA 5JDUB 3UWJH 1RIWB 3A82A 4JK5A 4YT6H 5FBEA 1HB0B 4WXIA 1TOMH 2PTNA 2VB0A 2B5TB 5G4BA 1C5QA 1OOKB 1K28D 4X1SU 1RTFB 5DP8A 1CBWC 2A45B 1P3EA 2V0BA 3A8BA 3RM0H 3RMOH 2WPJS 1MAYA 1ZHPA 1FUJA 1GI4A 5FHTA 3A8CA 1QRXA 2C93B 4Y76A 2VIOA 2Q1JA 1ANBA 3CENA 1BA8B 4XE4A 1P2IA 4BNRA 2PR3A 3PLKA 1WYKA 2XNIA 3ZYDA 4ISNA 1QBOA 2J4IA 2O9QA 2GTBA 3D65E 3F9EA 3GOVB 4I8HA 4MLFB 1FPCH 3VXEH 1L2EA 1O2HA 1HAZB 1C1TA 1GMDF 2R0KA 2PFEA 5DP9A 3P8GA 1WAYB 1AKSB 4FU7A 3SV8A 1ARCA 3HGPA 3A7TA 1G3BA 1EJNA 4H6TA 1V2NT 2VJ1A 1AZ8A 2BDIA 1XUKA 1NFYA 2QC2A 1GDNA 3MU4A 1C5NH 1ANEA 3PTBA 4WMEA 4I8KA 4OS5A 4KKDA 1P9SA 1SGTA 1A4WH 4GSOA 2NU4E 1BTWA 3SJ9A 4D9RA 3A89A 1V2UT 4ESTE 2P16A 3QWCH 2AIPA 2XW9A 1V2PT 2Z94A 4JYUH 1W12U 2J9NA 4YZUA 1V2WT 3ZZCA 7KMEH 1UJ1A 1GJAB 2ANYA 3QN7A 2QY0B 1KXBA 3RXDA 3A86A 5C1UA 4E06H 2ZGJA 3NXPA 2FPZA 5FCRA 4U32A 5JBBS 1NC6A 4X8SH 4H4FA 3GICB 1AMHA 2F3CE 1A46H 2IN2A 1ZMLA 3S69A 5EPYA 5FAHA 4UFGH 2A7HA 3R0FA 2FI5E 1E34B 1D3TB 1GI2A 2FZZA 1IQIA 2D2DA 1LTOA 5E0HA 4THNH 1D3DB 1K1MA 3NPSA 1O3KA 4ZXYH 3LPRA 1SGDE 2ANMH 3A7ZA 2UWLA 3LH3A 3AW0A 3BEIB 4D7GA 1C5YB 1P05A 3ZVDA 1GJ7B 1GDQA 4WMDA 1DSUA 3BEFB 2HNTC 3GCHB 1J15A 3SU4A 1UVUH 2K1QA 2OINA 2BY8X 3TJOA 3TNTA 4Y8YA 3PLBA 2ZHDA 1C4U2 4FUDA 5C1YA 1HAGE 2XC4A 1UVOA 2DE9A 1EQ9A 2FEQH 3BN9A 5I25A 2GX4A 1O3NA 4BTUB 2FX6A 4FXGH 1IQHA 1WTHD 3E3TA 2G4UA 1C2DA 1BZXE 1WQSA 3RLYH 1GJ4H 4JMYA 1P2OA 3NWUA 1HAYB 4Y7BA 1MKXH 2ODYB 5FX5A 1HFDA 3KGPA 3M3TA 5C3NA 4GUXA 2FWWA 5E0JA 1NFWA 3STIA 1C1WH 5DGJA 3SNCA 3Q3XA 5K7RA 3IITA 4NA9H 3BG4C 2V3HH 1S82A 2VH6A 3UOUA 3M7QA 1V2LT 1CA0B 4NSVA 4BOHA 4I8JA 1GI1A 1H8DH 1Z71A 1O3OA 4I32A 1O5BB 4MNWA 1BTHH 1SMFE 3MI4A 2NU2E 2BXTH 2AEIH 1ZMJA 1E0FD 4AB8A 4AFZA 2GCHG 1V2KT 1AU8A 4K60A 3K2UA 1YPMH 4K8YA 2GV6A 4R0IA 1O5EH 3BTME 1GI3A 4O9VA 2LPRA 3VGCB 5LPFA 2G81E 1G37A 5JYIA 3ZVFA 4I8GA 3LGWA 2ZDAH 5A0BA 3M3SA 2C3SA 2FLRH 1T4VH 2BVSH 1Z6JH 3GCTF 3M5MA 4FVBA 2QAAA 3ZYEA 3QUMP 4DGJA 2P8OC 1ZTJA 6ESTA 2PKSC 3LGTA 2H1UA 2BTCE 1OP2A 5L6NH 1KY9A 1AQ7A 4NGAH 1GL0E 4Y6DA 1DUEA 1A61H 4UONA 1HAVB 1FN6A 5T6FA 1XUHA 2TGTA 1ZHRA 6GCHF 1GDUA 3MHWU 1DUAA 4ZXXH 3RXSA 3MH4A 1D3QB 2BLVA 1GBEA 1TBRH 3SQEE 1D9IA 1PPZA 2J92A 2ZC9H 4UD9H 3E1XB 3A7YA 1C2FA 3BIUH 3TJVA 4B2BA 2VWMA 2RA0A 1ELVA 1UVPA 1P2KA 1F7ZA 3CS7A 1VITG 1TABE 4ZKSU 5CE1A 3R3GB 1L0ZA 2EEKA 1WCZA 2B8OH 3VFEA 3BV9B 2TPIZ 1BJUA 2ZP0H 1DSTA 3MH7A 2ZPRA 2G52A 2UUFB 4FUHA 8ESTE 1C1RA 4XSKU 4YOIA 4TY6A 1TRYA 4Q7ZA 1HNEE 3RMMH 2Q6DA 1HJ8A 1RJXB 1AD8H 1AUTC 1O2RA 3GY6A 4CREA 1SPJA 3BTEE 5C20A 3VB5A 2FODA 1NRRH 3RXCA 2BD4A 2BQ6B 1C2EA 4AG2A 1BMNH 3FP6E 1FY8E 3E16B 3EGKH 3QDZB 7ESTE 1C1MA 2JH6D 3VEQB 3STJA 2WV5A 1F5RA 4X1PU 1LQDB 5DP5A 3A7VA 2R3UA 1O2ZA 3FP7E 1C1UH 1DWEH 2TBSA 1FN8A 4BXSA 1GMHF 4GAWA 1BTPA 3SUFA 7LPRA 1TGCA 2XTTB 2M5TA 3A8AA 1BHXF 1BT7A 1RTKA 1E38B 3SW2B 2H5DA 4A6LA 1V3XA 1Y8TA 3U8TH 4AFSA 3BEUA 5ESBA 1TX8A 3RXQA 3S9AA 4H42U 3KHVA 4WF8A 1O37A 2ZZUH 1QQ4A 2QF3A 1C5XB 3U9AH 2SGDE 1CA0C 4MPWA 1O3HA 1TQ0B 5EQRA 1PFXC 1CT2E 2A0QB 1UTJA 3EE0B 4WH8A 1BMLA 3ZZ4A 1L4DA 1G2MA 4DJZB 2GVFA 4TY7A 3MO9A 5HM9A 1GVKB 1SFIA 3TU7H 2XRCA 3BTFE 1GHAF 4YOJA 1P2QA 4GHTA 4IC5A 2Z3CA 4Q7YA 1TQ7B 1J17T 4KELA 1C2HA 4CHAB 1DWCH 1GBMA 4TPIZ 5EOKA 4AOQA 4OS4A 1O3IA 1WOFA 4YLQH 1TNIA 1Z8IB 2FYRA 1FAKH 2THFB 1N6XA 2A5AA 4AX9H 3TK6A 3H5CB 3IG6B 1DPOA 1G36A 1Y3YA 1YCPK 1XXFA 1PQAA 4ZUHA 5T3HA 2VVVA 1SHYA 1C5PA 5B6OA 1MMJN 2FOHA 1T8LA 1IQNA 1HUTH 1NRQH 1VCWA 1FXYA 1TGBA 2VIPA 4Y7AA 3SHCH 1HBTH 2AMDA 3SU3A 3M36A 1O2LA 1LO6A 2FOEA 4IN2A 1SGYE 4D7FA 1ZZZA 3B8JA 2FLBH 1AFEH 2FIRH 2PGQB 1GVLA 2ZGCA 1O3BA 2BYAX 3P6ZB 4K5ZA 1EASA 2UUKB 1QJ1B 1Y59T 4Q7XA 3ZZ6A 1YCPM 1UK3A 2PTCE 2A7JA 1GHWH 2WYGA 4LZ4B 3C1KA 4ABDA 2A1DB 1E37B 1G3CA 4X6PA 1THRH 4D8NA 4OS1A 5H4IB 2QGRA 3K9XB 1P12E 1EJMA 1PPBH 2YNBA 1QJ7B 1IHSH 5AF9H 2BLOA 1NT1A 2ZIQH 1WBGB 1DS2E 4NA8A 2IJOB 4MDSA 3FANA 3GY2A 3O8BA 1PYTD 3PM3A 1OP8A 2FOAA 2OBQA 2VVCA 3ATWA 3RU4E 3SNDA 1FNIA 1FI8A 2JETB 3RU4T 3FAOA 3TH3H 2BLQA 1SGQE 1L1NA 1F5KU 1T8NA 4D9QA 1ELBA 3L33A 1LKAA 1O2VA 1TONA 2CJIA 1ACBE 4MNYA 2QXGA 4FU9A 2BVRH 4MQAA 1Q31A 5C5NA 1TMTH 8GCHG 4ABBA 5BRRE 2BB4A 1GJ6A 5LPEA 1GBFA 1ZPBA 2GZ9A 2H9EH 4B71A 2BZ6H 3QTVH 1AHTH 3T26A 1HLTH 1C5SA 2CGAA 1JRTA 4KP0A 1BMMH 2A7CA 4Y8XA 2ZDNA 1YBWA 2Y5HA 3EA9A 4MTBA 4ABAA 1C5MD 1CBWB 2ZDVH 1C5OH 1H4WA 1NO9H 1SVPA 1TPSA 2Y6TA 1YP9A 2YOLA 1GI5A 2A5KA 1TB6H 2BD9A 1DICA 1K1OA 3U8OH 2O8MA 4MPUA 4JCNA 1C5WB 3OY5U 2HPQH 1QB9A 4A1VA 1O3AA 1IQFA 3U1IB 1MBQA 2FDAA 2NU3E 1CA8B 4IMQA 1T31A 3W95A 1SG8B 5C67A 3BTDE 4LOYH 1RD3B 1NRPH 2R9PA 1U6QA 1W11U 1XX9A 4D76A 5DKMA 5ESTE 4X2WA 4X6OA 3SJKA 4MPXA 2SGQE 1CGHA 1IQLA 3RC5A 2PW8H 1ZSKA 1YC0A 5A8XA 1QHRB 1Z8JB 3N7OA 2BVXH 2VIVA 2JH5D 1ZSLA 1SI5H 2EI6A 3F6UH 4NIYA 1VITH 1XM1A 2W5EA 3RXTA 1OKXA 2Y5FA 2J94A 1MKWH 1MZDA 2ODQA 3MNBA 1C1NA 5TCCA 3MMGA 1MTUA 4NIWA 2BX4A 2A2QH 2ZU2A 3ZZDA 4NSYA 3CP7A 1AFQC 1D6WA 1DT2A 4FUJA 1GBTA 3H7OA 3I77A 1O2NA 2ZA5A 5EQQA 5BPEA 2ZWLH 1MCTA 3LU9B 2ZDLA 2ZPQA 1UMAH 4ABFA 1GI8B 1K2I1 1PQ5A 1JMOH 1LPKB 2GZ7A 1AI8H 1K21H 2ZI2H 3VB7A 1O2KA 2TGDA 4MG3A 1GBHA 1ZR0A 1H9IE 1HJAB 2XBWA 3RXEA 3M5NA 1C5UA 1K1PA 3U8RH 1SGNE 4B75A 2OP9A 4CH8B 1EPTA 2BHGA 3VGCC 1TMBH 2BM2A 7GCHF 2Z9IA 3RXHA 4WJG2 1HV7A 1QL9A 1ETTH 3PTNA 1MKWK 1S6HA 3C27B 1A3EH 2NWNA 6LPRA 2ZQ1A 1S6FA 1YPEH 3SGBE 4B73A 1G2LA 2AMQA 4ZHLU 4BANB 2ZFQH 3BG8A 1L1JA 4I33A 4ISLA 4YM9A 3OU0A 3UPEA 4CRBA 4HZHA 1EAUA 1SGCA 3LT3A 3F9HA 4X1RU 1S85A 3UOPA 3KNXA 3SQHE 1GPZA 1JBUH 1ABIH 3DA9B 3KL6A 1GI0A 3UUZA 1A3BH 3ESTA 4CBOA 1VCQA 1DLEA 2GD4B 4AORA 5GDSH 2ZFTA 4YT7H 1TLDA 1W8BH 3SBKA 5JBAS 3SNBA 2P59A 1GHZA 1W0ZU 3S9CA 2FS8A 3A84A 2GDDA 2XBYA 4I8LA 1F0TA 4MVNA 1P01A 3GDSA 3EAJA 4FUFA 2AGEX 4UDWH 1SQAA 2Y82A 2WPIS 1E36B 1MTWA 3SU1A 3BTWE 1YLCA 2ZU3A 4WY3A 2ZCHP 2QXHA 1C9TA 2QIQA 4U2WA 5C5OA 3ATIA 2F83A 1SQOA 3TNSA 5IDKA 3FZZA 3T28A 3RXUA 2UUJB 1SR5C 3MNCA 2ALVA 3ZZ5A 4KTCA 4CRFA 1ZRBA 3L6PA 2VWOA 3PYHA 1XUFA 2ZQ2A 2XBXA 1GJDB 1V2RT 2ZTYA 1O5AB 4I7YH 4CBNA 1DWBH 1P8VC 4A1XA 4AZ2B 1LVMA 4LXBH 5EG4A 1VJAU 1HJ9A 2R0LA 1PYTC 3A81A 2VU8E 2I6QA 3DFLA 1P9UA 2FOCA 3MO3A 1C1PA 1VR1H 1ELDE 1MTNC 3UFAA 1WQVH 1GHAG 5T6DA 1P2MA 2G5NA 1O2QA 4VGCC 2Z9GA 1TMUH 2P94A 1YF4A 2UUYA 3MNXA 1MD7A 2VH0A 1FIWA 3TH4H 2JKHA 5FPTA 4CRCA 3GCOA 1ZJKA 1PQ8A 3FZDA 1KYNA 5DO4H 4A7IB 2HVXA 3A80A 1X7AC 4K1SA 3ZVEA 3U1JB 4XFQA 1VJ9U 1Z6EA 3LJOA 1TGNA 1V2TT 2ZF0H 4ASHA 1O3LA 3PB1E 3OYPA 1ABJH 3TIUA 1H1BA 1JOUB 4H6SB 1S5SA 2VGCC 3UWIA 2FOMB 3GYMA 1LCYA 1A5IA 2BD8A 3M61U 2G55A 2TRMA 2ZTZA 3SUGA 1TFXA 4CRGA 4CHAC 1SL3A 1SOZA 3I29A 1AGJA 1GBDA 2BLWA 1GBJA 4FUGA 5F8ZA 3UQVA 1GJ5H 1MCVA 2ALPA 2BDBA 1ZPZA 3P8NA 5L2ZH 3P17H 1QURH 1AWHB 2I6SA 1T32A 2OTVA 3LOXA 1QL8A 4HI3A 1GJ8B 4U30A 1QR3E 2A4QA 5FPSA 1GGDC 1O2UA 2QXIA 5I46H 3UY9A 1RGQA 2AIQA 1EP6A 3BG4B 2FO9A 1CSOE 1MAXA 1NU9