3UR9A

1.65a resolution structure of norwalk virus protease containing a covalently bound dipeptidyl inhibitor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
175
structure length
164
Chain Sequence
HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like protease
publication title Broad-Spectrum Antivirals against 3C or 3C-Like Proteases of Picornaviruses, Noroviruses, and Coronaviruses.
pubmed doi rcsb
source organism Norovirus
total genus 37
structure length 164
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur9A01
1UTKA 5FPYA 2BB4A 3LT3A 3A81A 1F92A 1P3CA 1AQ7A 2UWOA 1AWFH 3KCGH 2ZGBH 5GJ4B 1LHFH 1FY4A 4ESTE 4TYDA 2NWNA 1NESE 5J4QA 1HDTH 2BD4A 3S7HB 2PUXB 2STAE 1ZR0A 3BG4C 4X2XA 1GI0A 2F91A 5EOKA 4ABJA 4Y79A 3RXBA 2VB0A 4ZKSU 3T25A 2Z3EA 2C8XB 3SQEE 2QC2A 3SV9A 2SFAA 1OYQA 1SGNE 3KNXA 2TGTA 2XBVA 3NUMA 2FX4A 1GMCG 3MO6A 1TABE 1W3CA 1EOJA 2OC1A 3ENSB 3BIVH 3T2NA 3SOSA 1HIAB 1RIWB 3EE0B 1NU7B 1VCWA 1BMAA 3QGJA 3DD2H 1WTGH 1O2JA 2XRCA 3HGNA 1AZ8A 4IW4E 3RXRA 1QJ6B 4DJZB 3LGIA 1TMBH 2VWOA 1YCPM 4E05H 1QQUA 2SNWA 1O38A 1C9TA 2Z6BD 1H9LB 2FOAA 1GBCA 3SQHE 3VB5A 2WUBA 3QZRA 3GYLB 1K1NA 3RXFA 2FYQA 4JYTA 2VU8E 5EW1H 3K6ZA 1SLUB 3TK6A 1BTWA 1P9UA 3MI4A 3TITA 1ELEE 5HM2A 1V2UT 1NT1A 3R0FA 2C4FH 2JETB 1Z6JH 3U8TH 6GCHG 1OOKB 2GTBA 1OXGA 2ZTYA 1DXWA 4K69A 4UFDH 3ESTA 3QUMP 1UK3A 2BZ6H 5CE1A 2FOCA 1UTNA 3EDXB 2OTVA 4RKJB 1EZQA 5CMXH 3A8BA 1GVKB 5LPRA 4O3TA 3M35A 5SGAE 2GZ8A 1LVBA 2J4IA 2VIPA 1Y5AT 1AKSB 5E2OA 2PKSB 4YT7H 1HAZB 4NCYA 1O3BA 4NIWA 2OQUA 4ABEA 3SNAA 1UMAH 1O3GA 5T6DA 2R2MB 2AIQA 5FBEA 1RXPA 3NWUA 3F9HA 3LIWA 4CRBA 2QF3A 4OS5A 1IQNA 1ZJDA 1NRRH 1UO6A 3V3MA 2A2QH 2B5TB 1Y3UA 1BCUH 3UTUH 2BDIA 1HV7A 2FESH 3LGVA 1G2LA 2XNIA 1LPGB 3SU3A 2G5NA 4CHAC 4B75A 2EEKA 1PYTC 2ZG0H 1GHWH 3BTGE 1MCTA 2NU1E 2BY5X 2BTCE 5EU8A 1RFNA 5A8YA 1GI1A 1YGCH 1H9HE 3SU6A 4M7GA 4YO9A 5L30H 3RU4E 2HALA 5FX5A 1UCYH 1L4ZA 1SQAA 1KLIH 1BT7A 4U2WA 3VXEH 1FY3A 1O2VA 1FXYA 3ZVGA 1EJAA 4VGCB 2J95A 4Y11E 4YESB 2ZPRA 1NROH 1K28D 3SBKA 1LCYA 3SV8A 2FO9A 1BDAA 4KGAA 1O2YA 3BTDE 4Y71A 1VCQA 2AGIX 4XFQA 1A1RA 2ZPSA 3T28A 1ZHPA 2ZNKH 1XKBC 1FN6A 3GCTG 1L1NA 1T8MA 3PV4A 3DT0H 1EZXC 1D6WA 1N1LA 2OCVB 1UTJA 3T5FH 1DUAA 2J9NA 3MYWA 3V7TA 4YZUA 1SL3A 2ZC9H 1GCDA 4LZ4B 1GDQA 5GDSH 1ZOMA 3H7TA 1AVXA 2OXSA 1GMDG 1ETSH 1MQ6A 1PPBH 3SUGA 1ZSLA 1GJ7B 4AYYB 2SGDE 3RXHA 3SGBE 5EODA 1ZLRA 2CGAA 3UR6A 3IG6B 4E06H 2Q6DA 1EUFA 1YPHE 2A2XH 1AI8H 1BTPA 1G3CA 1WOFA 1G3BA 2WPKS 2F9VA 3S69A 4IS5A 3ZZ3A 5H4IB 1QTFA 2GDDA 3NPSA 4IBLH 1N6YA 3FP7E 5A0BA 1YF4A 1GHXH 3BG4B 4FUFA 5I25A 4GLYA 3NCLA 1QRWA 3HGPA 3M36A 2Q1JA 1AUJA 4O3UA 4IMQA 4A1VA 1ARCA 1EZSC 3M3VA 1NFUA 1PPEE 1EQ9A 2F9NA 1YP9A 1C5TA 4WH8A 2A4QA 5E2PA 1JRSA 1N8OC 4GSOA 1GI9B 1HYLA 4XBDA 4JZIA 1RS0A 1QFKH 3GDUA 4FUJA 1QR3E 2PTCE 1SFQB 1G36A 7GCHF 2R9PA 1F0SA 2PSYA 4XE4A 1BHXF 2VGCC 1UVOA 3RXPA 2FYRA 1GBEA 4H6SB 1Q2WA 2FMJA 4X6NA 2NU3E 3VPKA 2QCYA 2OP9A 2FODA 1QB6A 1CT4E 1KXDA 1EP5A 5AVDA 1FAKH 3BEFB 5AFZH 1QBVH 3PTBA 1KYNA 3LC3A 2AGGX 3MMGA 1W7XH 4ASHA 1P11E 2ZDKA 4K8BA 3BTWE 1O2MA 3BTEE 4MNYA 3E16B 5C1UA 3U9AH 3ZVBA 5DP5A 1MTSA 5EG4A 4MPXA 1NFYA 4BTTB 2VH6A 5EQQA 3ATLA 1MUEB 3RMOH 3PO1C 5AFYH 3I77A 2A5AA 5C67A 1J14A 4JZEH 9ESTA 2BQWB 3RMNH 1YLDA 5EXNA 1QB1A 4WMDA 1JIMA 2D1JA 5F8XA 2O8MA 1UVPA 3ZZ6A 1T4UH 2FTLE 1G37A 3ZYDA 2BXUH 1H4WA 4Q2KA 3GCHC 2R0LA 3CP7A 4NIXA 4LOYH 1Z1JA 2G52A 3VFEA 4MPVA 2H9HA 2VINA 3SZNA 1K21H 1WU1A 2FXRA 1BA8B 3UREA 4K60A 5EQSA 5C20A 1VZQH 2PFEA 4NA7A 2FS8A 3E3TA 1KY9A 2ALVA 1CBWC 1QCPA 3P17H 4AG2A 4X1NU 4CHAB 2BLOA 3NK8A 1E0FD 4ZROA 4JZDH 4XDEA 1ELVA 5JB9S 3GY8A 3RLWH 4B73A 2SGPE 4ABBA 3SJ9A 3BG8A 1S0QA 1AHTH 1H9IE 4KTSA 3F9EA 3L3TA 3AASA 1SFIA 2CV3A 2B7DH 1TBRH 3KF2A 2BOKA 1F0TA 1HAVA 1PYTD 2ODYB 1CQQA 2BM2A 3QDZB 3F68H 1IQFA 2GZ7A 2H5DA 1DXPA 1NZQH 1UK2A 4A7IB 4SGBE 3S9BA 4IMZA 1O3OA 2IJOB 4AZ2B 1K1PA 1S84A 1HUTH 1PQAA 2BY8X 2ZHWH 2RDLA 1O36A 2RA0A 4ZMAH 1SGFG 3RP2A 2A5KA 1HAHH 3UQVA 2FP7B 1UTPA 2QAAA 1Y5UT 4AFUA 1O2ZA 1ABIH 3RC4A 1A5HA 1QBNA 1MU6B 2VJ1A 1O2LA 2CHAC 3LGYA 1RIWC 3DA9B 1O39A 3OTJE 5DP7A 1FIWA 3U1IB 1YPLH 3M5MA 2FOBA 2ODPA 3PYHA 1SGFA 1V2OT 1KXCA 1T31A 4A1TA 3SU5A 1G3EA 4YOIA 1MD7A 4MLFB 1G2MA 3PMJA 2OUAA 3SO3A 3A86A 3OU0A 3UNQA 2HNTC 2ZGXH 5L6NH 1FNIA 4ABIA 4BNRA 2A4GA 2IOTA 4MNWA 3Q3KA 4A92A 9LPRA 3EGKH 4JMYA 1XVOA 3E1XB 3NXPA 1ZTJA 1V2JT 2G4TA 1XVMA 3M37A 1T8OA 4DW2U 2GV7A 5JPMH 1MTWA 1YPMH 5TJXA 3SJ8A 1C2EA 3ZZ9A 4BANB 2H6MA 1GJDB 1KSNA 2D26C 1V2VT 2OQ5A 5HM9A 2QIQA 1P10A 1N8OB 2UUJB 1IQKA 2QGRA 2WPIS 2OBQA 2Z9KA 3GOVB 4FUEA 1BB0B 1EKBB 2VVUA 2W7SA 3ZZ5A 1C5YB 3E0PB 1HAPH 1C2DA 2G4UA 5GCHF 4NIYA 5BPEA 5EPNA 2VGCB 3TH4H 1SI5H 3O8DA 1EOLA 1JIRA 1C1UH 2QXHA 1C2MA 1VJAU 2Z9JA 1O3KA 4FU8A 3ZVEA 3QTOH 1GI4A 3ZZAA 1F5LA 1FY1A 1XUFA 2FZZA 4J1YA 1O2GH 1E36B 1KXEA 4BAHB 1O35A 2YNAA 4FU9A 2ALPA 2BD3A 2GCHF 1C1QA 4X8UH 3STIA 4NGAH 1SPJA 3VGCC 2ZDAH 1GBBA 3RXTA 4FUCA 4F49A 3TK5A 1CSOE 1CGJE 1O3IA 4AB9A 1YPEH 1TFXA 3PO1B 2F9PA 1O30A 1A7SA 3T62A 1UTQA 2HWLB 1ANBA 4BAOB 3B9FH 1C5MD 2QN5T 1M9UA 3KQDA 4NA8A 1YLCA 3GCHB 5JB8S 1A5IA 4H6TA 1ZRBA 3MHWU 2QV1A 3O8CA 2BQ6B 4OGXA 1ELAA 3E0NB 3KQEA 4MG3A 2A4RA 3EA8A 2Y5FA 1K1MA 1ESAA 3A8CA 2PHBA 1QJ7B 1OKXA 1VR1H 1CBWB 1B0FA 3LH3A 1MKWK 2R3UA 5DP8A 1Z8GA 1Y3VA 1TOMH 2XBXA 1DS2E 1C1OA 1E35B 2ZQ1A 3DFJA 2G5VA 3UFAA 1GHAF 1HAVB 2WV5A 1H8IH 1B5GH 1S82A 4I8HA 2G8TA 1AWHB 1UTMA 1TX6A 3ZZ4A 2A32A 4B71A 1CGHA 2I6SA 3EQ0H 1C5ZB 1BMLA 4ISHH 4O97A 2ZGHA 2CMYA 1HJAC 3A85A 1DE7H 1KDQA 1MBMA 3TJVA 1WAYB 5E0GA 1SLVB 4F4OC 4X6OA 1IQMA 2BQ7B 3ZVFA 1AE5A 4MNVA 4FUDA 1TNJA 2C8YB 1GI6A 3QK1A 1P03A 3GY6A 1AE8H 1TMUH 1WCZA 2C93B 1C5NH 4D7GA 5C5NA 3BEUA 4IN2A 4Y8XA 3Q77A 5F8ZA 5G4BA 1XX9A 1GJ4H 1LVOA 8GCHF 1OP0A 2JH0D 1OP2A 1CHOG 4BXWA 2ZI2H 2ZQ2A 4NIVA 2ZIQH 1O2IA 2CHAB 1KXAA 1W0ZU 2PTNA 2UUFB 1P2NA 4X6PA 1ZYOA 3GY5A 1EJMA 3SNEA 1C5PA 4TPIZ 1HFDA 2ILNA 3N7OA 4B2BA 3RMLH 2AYWA 3S9CA 4J2YB 1P12E 1QRXA 1V2WT 5FBIA 1DWCH 3M3SA 1D3PB 1BRCE 1TE0A 2GD4B 3RXGA 1P3EA 2THFB 2FOHA 1ID5H 1WV7H 1LPKB 5EQRA 1PPGE 1K1JA 4WXVA 1J9CH 1BTYA 2HRVA 1GHBF 1KTTB 1EAIA 3GCNA 1P2IA 2IPHA 3STJA 1GJBB 1NRNH 2FIRH 1GI5A 1TIOA 4GCHG 2QXJA 2SNVA 3BEIB 2VWNA 4X8TH 1YCPK 5DJ7A 2J92A 1AFEH 2XWBI 1ZHMA 2BX3A 1DWDH 1LHEH 1BTXA 1DLEA 2J38A 1FZZA 4NSVA 1TNLA 3SNBA 4GAWA 1DY8A 1NO9H 1AD8H 3DHKH 1O3FA 1FJSA 4R8TB 4NZLA 2VIQA 5DP3A 1EX3A 1C1MA 1V2PT 2SGEE 1P05A 1BMNH 1SOZA 2FTMA 1IQJA 1BBRE 4E7NA 2FOEA 2SGQE 5C2ZA 2OC0A 1ZTLA 1E37B 2Y7ZA 1JBUH 1ZGVA 3KHVA 2P94A 3RUOA 3Q3XA 2ZFTA 1HAIH 5F6MA 1MKXH 3DUXH 4K8YA 4TWWA 4Y7AA 3P8NA 2A0QB 3M5LA 1FMGA 4GHTA 1QJ1B 1GBFA 4YLUA 2BOHB 2H1UA 2BDYA 1CU1A 4UEHH 1GBLA 2XBYA 1GG6C 1O5EH 1CHGA 1O3DA 2FLRH 3VGCB 3AAVA 1ZPZA 3M3TA 4U32A 4ABGA 1T8LA 1P8VC 3PLKA 2BD5A 1L2EA 4AN7A 4H42U 2VWMA 2VH0A 1WYKA 1KIGH 2ZFPH 3ZVAA 1E34B 4B2AA 2CF9H 2ZF0H 1DFPA 2A7JA 3TPIZ 4AFSA 4CR9A 3TGJE 3KGPA 4B1TA 1UTOA 3A89A 3BTFE 3DFLA 1TX8A 4AGKA 4AOQA 1A0LA 3BIUH 3BTME 2PKAA 3SUDA 1BZXE 1T7CA 3D23A 1K1IA 3BSQA 1BQYA 3F9GA 1C5OH 3PROA 4K3JA 3LH1A 4KTUA 5EW2H 1TA6A 1XM1A 3VXFH 1PPZA 2ZFQH 1LTOA 1UVUH 2ZHQH 4DOQA 4MTBA 1KDQB 5HMAA 2P93A 3D65E 2ZEBA 3L33A 1W13U 3LONA 2CF8H 5DP6A 3MWIU 2PSXA 5E8EH 2P95A 1Q31A 5TCCA 1TBQH 1S83A 1JXPA 5C1YA 1SLWB 3BV9B 3MO3A 1GBHA 3A7WA 1Z8IB 1GDNA 1O5AB 4FVDA 4YT6H 1HXFH 1EASA 2PGQB 1O2PA 3CS7A 1HJAB 1GPZA 2AH4X 1GMHF 1TNKA 3M5OA 1O5CB 3RC5A 1L1GA 1O2QA 3P8OA 4ZKRU 2XCFA 1FUJA 1TMTH 4WMFA 1GJ8B 3P8FA 1INCA 1LHDH 2AFQB 2W26A 1P2KA 1O37A 5JBAS 5HXFA 3C1KA 1GBMA 2ODQA 1GJ5H 5ESBA 3UIRA 3ZZ8A 3BF6H 3V12A 5LH8A 4KKDA 1GI8B 2UUKB 1FLEE 2PW8H 4JK5A 3RXDA 1QQ4A 1AVWA 4NA9H 1CGIE 3IWMA 4FUGA 2Y7XA 4Y7BA 4BTUB 2FI5E 1UK4A 1XUHA 1HAYB 4WXIA 4D9RA 2HPPH 1NM6A 3D62A 2ZGJA 4CBNA 3M7UA 1AY6H 1C2FA 4D7FA 4MDSA 2RG3A 2BDCA 4AORA 4RSPA 3A84A 1QNJA 1W2KH 3QO6A 1LVYA 2P16A 4I8KA 1D3DB 3GY7A 1SMFE 5CHAC 1XUJA 3MU4A 2GDEH 3BN9A 2WYJA 2C8ZB 2H9EH 1O3HA 2K1QA 1Z71A 1A2CH 1F5KU 1HGTH 1V2TT 2KAIA 1BIOA 1SHYA 2G51A 4I8GA 2FM2A 2GX4A 5C1XA 1O2UA 1NC6A 2WPLS 2NU0E 5AHGH 1CA8B 1GHYH 3EA9A 7LPRA 1C5XB 1ZMNA 2ANYA 3RXMA 2W3IA 2BD7A 1THPB 3TVJB 1W12U 2Z9LA 5DKMA 1PPHE 1QA7A 1QY6A 4Z0KA 1T8NA 3ZVDA 1RJXB 1QB9A 1Y3WA 3LOXA 1GJ6A 1A3BH 1ELTA 4UONA 1LQDB 1DT2A 1TQ0B 4GPGA 5PTPA 1VITF 1OPHB 1HAOH 4X1QU 1TNGA 5E0JA 3SGQE 4CRDA 4D8NA 1DANH 1UCYE 4AFZA 5JBTA 3SV2H 2O8WA 2ESTE 4UD9H 1NFXA 2EC9H 1EJNA 3TJOA 4Y76A 1C5QA 8ESTE 1EB2A 3MO9A 2XW9A 1CE5A 1KXBA 1HJ8A 1TOCB 5FX6A 2ZWLH 3RXOA 3WY8A 4BTIB 1J15A 1HCGA 4YTAA 2JH6D 2H2ZA 2CJIA 2F9OA 3ATMA 3FANA 2NU4E 1MAXA 1MCVA 2AIPA 7GCHG 5JYIA 1FDPA 2ANKH 5A0CA 1P2MA 4ZKNU 5LGOA 4BXSA 4B2CA 2J34A 1GG6B 2UWLA 1O2TA 1TYNA 4THNH 1ELCA 1Y3YA 2BY6X 5F8TA 1GBJA 2FOFA 3QWCH 1P2QA 1TGTA 1TPOA 2XWAA 2HLCA 1DWBH 4ISNA 1O32A 1VCPA 1Z8RA 4MNXA 1KTSB 2PUQH 1UJ1A 3UQOA 1OWJA 3M7QA 1O5BB 1SG8B 1FI8A 1C4U2 1P04A 2PKAB 4AG1A 3EYDA 4A1XA 4FVBA 2YOLA 1O3JA 1WQSA 1DX5M 3KN2A 1DITH 4X2VA 5K7RA 2ZHDA 3E90B 2G55A 3ZVCA 2SGFE 1EAUA 5FPSA 4XBBA 1AUTC 2WV4A 1CA0C 2W5EA 2BHGA 2BDGA 4CRAA 1V2LT 2ZU4A 1BJUA 4DURA 5GWZA 4GVUA 3QX5H 1SGQE 4K1SA 1O5GH 1ETTH 3QGNB 3ZZ7A 3UOUA 1W14U 1O2SA 2ZECA 1C1SA 3QTVH 1BUIA 1LMWB 2BVRH 2Z9IA 2ZDMA 1OS8A 1PPCE 1O2RA 1O2HA 1V2RT 2A7CA 1MTNC 1O2OA 1QL8A 1FIZA 4UE7H 3RM2H 3SV7A 1GHZA 2ZDLA 1MU8B 3E91A 4TY6A 4KP0A 4CH2B 3ITIA 1CT0E 3RU4T 2ZDNA 3FZZA 5FCKA 1O3CA 1SOTA 5F03A 1J16A 1P06A 4DGJA 1FQ3A 2D2DA 1Q3XA 1OWDA 2XC0A 3SU0A 1ZTKA 1P2OA 4NSYA 4ISLA 1SBWA 5DK1A 5LPEA 1ZSJA 1GJAB 2WINI 3JZ2B 1SB1H 1D4PB 2FI4E 3NKKA 1E38B 2RCEA 4UFFH 3U98H 1F5RA 3ODFA 1BRBE 2ZFSA 1NRQH 1GBKA 1ZSKA 3HK6B 4Y0ZE 1C2GA 4ISOA 2ZDVH 2EI7A 1IQHA 1O2KA 1V2MT 3LC5A 2OC8A 1ZRKA 2BX4A 4U30A 3MNBA 3HKJB 2VVVA 5L2ZH 5FAHA 2XC4A 2STBE 1SLXB 2ANWA 1HNEE 4Z6AH 2KAIB 4ABAA 1YPJH 2TGDA 1RTLA 1Y3XA 3U8RH 2GCTC 3SW2B 4X0WU 1NS3A 5T3HA 4XSKU 2M5TA 5CHAB 1GDUA 4CH8B 1UTLM 1NRPH 1V3XA 4GHQA 2BVXH 2AGEX 2Z7FE 4CREA 2TIOA 1C2HA 1SGIB 3A7ZA 1C5LH 5FHTA 4ZHAA 1C1WH 2EI6A 2AERH 3QZQA 5EGMA 2BY9X 3SJOA 3KL6A 5DP4A 5DO4H 3P95A 1A4WH 2HNTE 4UFEH 1UHBA 1UVTH 2Y6TA 5DP9A 4JK6A 3RMMH 3U8OH 4Q80A 3MH6A 1GGDC 1HB0B 1WQVH 1B7XB 1O3AA 3RLYH 8KME2 1DSTA 2VVCA 2VIWA 4ISIH 1J8AA 3AAUA 1PQ8A 1TALA 3LGWA 3O8RA 1TNIA 3KEEA 4MPWA 5A0AE 1GI7B 1SC8U 3MU5A 1TA2A 5L2YH 2GT8A 1UVSH 1OYTH 1AB9C 1C1NA 2WYGA 1S6FA 3UR9A 2W7UA 3VB3A 2ZP0H 1LDTT 2OINA 1EAXA 1IOEA 2WPMS 2ZTZA 5ESTE 3LGUA 2BZAA 4OS6A 3SJIA 2ZPQA 5I46H 1W11U 2HVXA 1GMCF 4CRGA 5C3NA 1ETRH 1C1PA 1ELBA 1YPKH 4X8SH 4MQAA 2VIVA 2P8OC 3Q00A 5GCHG 4OS4A 1SQTA 1O3NA 3VB6A 3RXJA 4OS7A 1EXFA 4FU7A 3MTYA 1VJ9U 3RXCA 4K2YA 1BHXB 3OYPA 3F9FA 2LNCA 4A6LA 1IQGA 3V0XA 2BY7X 5JDUB 1AZZA 1TGSZ 3HKIB 1TPSA 2QXGA 3TNSA 1K22H 3T29A 3URDA 3G01A 2CXVA 3SNCA 2TGPZ 6GCHF 2VIOA 1RTFB 1GHVH 1SHHB 2BD9A 2ASUB 2PV9B 3ELAH 4FXGH 6CHAC 2ANMH 1CO7E 2ZCKP 1CA0B 1L0ZA 2FLBH 1ZZZA 1OWEA 3VB7A 2W3KA 3FFGA 1A5GH 4Q7XA 1QBOA 4INHA 1BJVA 1ACBE 4HTCH 5HYOA 1Z1IA 3MNSA 4CR5A 1D3QB 1FONA 1CT2E 1YKTA 4TWYA 3GYMA 4H4FA 3SU2A 1B0EA 1AFQC 1XMNB 3LKWA 2QY0B 3SNDA 3OY5U 4O03A 3RXLA 4BAQB 4TPYA 1MTNB 1P09A 1CVWH 2ZKSA 3ATKA 4INKA 1T4VH 1TLDA 2OLGA 3A88A 2XXLA 3KQBA 1DPOA 1OSSA 2A1DB 3B23B 1H8DH 1GL0E 2ZHFH 1SQOA 3H5CB 3S0NA 1BOQA 1EATA 2BDAA 4CRFA 1C1VH 4ZUHA 4DY7B 2LPRA 2BXTH 3ODDA 1QRZA 1QL7A 1QURH 4D9QA 3I78A 1GHAG 1ORFA 3TIUA 1MZAA 2Z9GA 3ATWA 2F9BH 1MH0A 3SHAH 3W95A 1V6DA 3B8JA 5A8ZA 2R3YA 3GDSA 1S5SA 2A31A 1SGPE 3LJOA 3T27A 2HPQH 2BD2A 4Y10E 1GVZA 1AIXH 1P57B 5HGGA 1S85A 2QXIA 1TRYA 1O2WA 3RC6A 3PLBA 3RXQA 3ZZDA 3HK3B 4ABDA 4IN1A 5J4SA 2O9QA 3AW1A 1ZPCA 2B8OH 4XBCA 4BAMB 1GCTC 1DSUA 1TWXB 1GI2A 4ZH8A 1C5UA 1TRNA 2ZFFH 3OX7U 2GCTB 1DDJA 1C5SA 1PQ5A 3MFJA 3VEQB 5A2MH 4K1EA 3TLOA 2B0FA 3GCTF 3K2UA 1UHBB 1X7AC 1O5FH 1FY8E 3I29A 8GCHG 3QN7A 1O3LA 1OWHA 2ZO3H 5IYTA 4AGJA 1FN8A 1JMOH 1ZHRA 1O3EA 2A5IA 3R3GB 2R0KA 3P70B 5FPTA 1EPTC 1QGFA 2VIDA 3F1SB 4X1RU 3RDZA 3ZZCA 2G00A 4I32A 4B74A 3TU7H 4RKOB 1FPCH 1GMDF 1ELFA 1P01A 1K1OA 1O3MA 4LZ1H 1GGDB 2UUYA 3BTQE 4HI3A 4HFPB 2BDHA 4Y6DA 5A09A 4FUHA 2EA3A 1GL1A 4BOHA 3LPRA 2AMPA 1GHBG 2ZA5A 4DT7B 1EPTA 4I31A 2HOBA 3UNSA 2AEIH 1C2LA 1C4V2 2AS9A 1D9IA 1Z8JB 3SUFA 3KIDU 2I6QA 2AMQA 1G9IE 1WBGB 4WMEA 1BTUA 1HJ9A 1YPHC 1JWTA 1MZDA 1AB9B 1YBWA 4OS2A 3FZDA 1DWEH 2O8UA 3S9AA 4NFFA 2YNBA 1C2KA 3LDXH 4JZ1A 2ULLA 3Q76A 3OSYA 1TQ7B 4OGYA 3RXEA 4INLA 4Y8YA 5GPIB 1IQLA 3RXKA 3UNRA 4NG9H 2DUCA 2P3FH 2ZU5A 2C3SA 2P8OB 2ZU2A 2J2UA 3MU8A 3L6PA 3UPEA 1SGEE 1HAXB 1IQEA 1RD3B 2GGVB 5EXLA 3SU1A 3TNTA 1RGQA 1Z7KA 1XUKA 1TBZH 3EAJA 1ELDE 1BTHH 1F0RA 1GBIA 3CS0A 1GBAA 3FP6E 2Y5GA 1O33A 1FPHH 1XXFA 3FVFB 4ZXXH 5T6FA 2GV6A 3URCA 1C5WB 4TY7A 1TX7A 3SHCH 3RM0H 4YOJA 1LPZB 4ABHA 3GISB 1D6RA 1NN6A 1ANCA 1TB6H 4BAKB 1PPFE 2UWPA 2A4OA 2RA3A 1MMJN 4GUXA 2Y5HA 2PLXA 3TH2H 1N6XA 6CHAB 2BMGB 2P59A 1JOUB 1AGJA 3LJJA 3K65B 3TK9A 4KELA 3V13A 2Y80A 2BLWA 1PFXC 3FAOA 3MU0A 2FWWA 2GVFA 2WPJS 4JCNA 1F0UA 1MKWH 5EPYA 2VWLA 3BTHE 5BRRE 2OC7A 2V3OH 2BLVA 3U69H 2EI8A 5E0HA 2TBSA 3A7VA 2A45B 4AFQA 4X2YA 1ANEA 8LPRA 1AFQB 4DVAU 4B76A 4ZAEA 4YLQH 2BDBA 1IQIA 3ATIA 1TPPA 1EP6A 1A3EH 1EZUC 2Q6GA 4DIIH 1MTVA 1ABJH 1NU9A 1XUIA 3PMBB 4YM9A 1K2I1 1S81A 4CBOA 2HGTH 2VNTA 2Y82A 1NTPA 3AVZA 4CRCA 6LPRA 4ZHLU 5C5OA 1FY5A 1A61H 1IAUA 1BBRK 2PR3A 1IHTH 1FV9A 1V2NT 2C90B 1QA0A 2F83A 3W94A 1KLJH 4D76A 1AMHA 1Z6EA 1O0DH 1ANDA 4ZHMU 2ZCLP 1A0HB 1W10U 3ZZBA 2GP9B 1P02A 4WF8A 1GMHG 3GY2A 2FOMB 4LXBH 4X8VH 3MU1A 3UWJH 3SI4H 5EXMA 3MNCA 1VGCC 1GCTB 4DIHH 3TJUA 1OWKA 1VITH 1EAWA 3MH7A 4MVNA 5ABWA 1LQEA 1ZMJA 1AU8A 2SGAA 1SGYE 3NZIA 4Q7YA 1C1TA 2Z94A 1V2QT 3TH3H 2JH5D 5ETXA 1DLKB 4WVPE 3UWIA 2P3UB 2XYAA 3LU9B 3U1JB 2Z3DA 1OX1A 1IHSH 2ZZUH 1MD8A 2V35A 3RXUA 2FEQH 2OD3B 3K9XB 5T6GA 4WY3A 3VB4A 4NZQA 4AX9H 1G30B 1W0YH 2BVSH 1SSXA 2Z3CA 1NPMA 1K9OE 3RU4D 2PGBB 3PWCA 4X2WA 1A0JA 1GJCB 1TGCA 1OP8A 3SJKA 1THSH 1SGTA 2O8TA 2QA9E 7KMEH 5JBCS 3GY3A 2FDAA 3SI3H 1S6HA 1GJ9B 3RXVA 1EPTB 1YCPH 3FP8E 4I33A 4UDWH 1LKBA 3BTTE 4HGCA 1P9SA 4YOGA 2FPZA 3M5NA 1QIXB 2D8WA 2A7HA 2HNTF 2Y81A 3TJNA 1SGRE 1TGNA 4X6MA 1SR5C 4K5ZA 4X1SU 3SORA 1Y59T 3AW0A 1KLTA 5JBBS 1D3TB 1XUGA 1LKAA 1YC0A 2H5CA 2GMTC 2ZGCA 2V6NA 4NWLA 4NWKA 3H7OA 4U01A 1KXFA 1G32B 5FXLA 1T32A 3D49H 4IGDA 1SGCA 1NFWA 1NY22 1ESBA 3UY9A 3S7KB 1C2IA 1VITG 4Y0YE 1HPGA 4JYUH 3T26A 1O2NA 4Y8ZA 1V2KT 4I8LA 1ARBA 1MAYA 3MNXA 3O8BA 2CN0H 1A46H 3RXSA 2GKVE 4X1PU 1THRH 2FOGA 1C5VA 1TONA 2F9UA 1BRUP 1K1LA 3E6PH 1LHCH 2XBWA 1O2XA 1PQ7A 2QYIA 4OS1A 3A80A 1BITA 1YPGH 3C27B 4SGAE 2IN2A 2R2WU 1Y8TA 2TPIZ 4I8JA 3E8LA 1V2ST 3CENA 1YM0A 1QL9A 3PWBA 4A5TS 5FCRA 3GICB 1Y5BT 4JZFH 3PM3A 5DGJA 2ZCHP 1BTZA 2G81E 4NFEA 2C8WB 3F6UH 2DE9A 1C5RA 3ZV9A 1TRMA 4KTCA 3A82A 1HIAA 1HAGE 2J94A 5K0HA 1DICA 4UFGH 3PB1E 1MKXK 2AMDA 1TGBA 2FS9A 2XCNA 2JETC 2JKHA 5LPFA 1WSSH 2ZHEH 4WWYA 2F3CE 1BRAA 3A8AA 3PMHB 1AO5A 3BTKE 2ZTXA 4MPUA 2TRMA 3M7TA 3IITA 4E7RG 1DOJA 1O5DH 1RTKA 1TAWA 1LHGH 4Q7ZA 4RN6A 1ZJKA 1U6QA 6ESTA 2H9TH 4ZXYH 3A8DA 3QLPH 3Q3YA 2NU2E 1UCYK 1C2JA 2PKSC 4WH6A 1QHRB 3K6YA 3P8GA 1WUNH 2O8LA 1SGDE 4DCDA 1AN1E 1P2JA 1O34A 2BLQA 3M61U 2B9LA 1C4Y2 3ZV8A 2P3TB 1F2SE 4JYVH 3GCOA 2XC5A 3EA7A 1GBDA 3HPTB 1XXDA 1AKSA 3ZYEA 4IC6A 2ZU3A 3A7YA 3HATH 1O3PB 1C1RA 2FI3E 4I7YH 2WUCA 3SGAE 4IC5A 1J17T 2GZ9A 1FAXA 1HRTH 5DG6A 1O31A 3SN8A 1MTUA 3PTNA 1SVPA 1VGCB 3PMAB 3GDVA 3TGKE 1F7ZA 2BD8A 5A8XA 3GY4A 2TGAA 1P0SH 1W8BH 1XKAC 1G3DA 4O9VA 4K1TA 2V0BA 1S0RA 1L4DA 4HZHA 5GXPA 1ELGA 3A83A 3UOPA 1GI3A 4FUIA 2PWXA 2FX6A 4ZKOU 4AYVB 2WPHS 1LO6A 1BBRH 1YYY1 4PROA 1ZGIA 1CHOF 1DM4B 1ZPBA 3TGIE 2Q6FA 4VGCC 3A7XA 1GVLA 7ESTE 3UUZA 3MH5A 3RXIA 4FUBA 3KQCA 4XOJA 4R0IA 4AB8A 4ABFA 1ZMLA 5AF9H 1OWIA 1BMMH 5DPAA 4WJG2 3SUEA 1WTHD 1DY9A 1W7GH 3JZ1B 1HBTH 5IDKA 1PJPA 1DUEA 5TCAA 4DG4A 1JRTA 1L1JA 1EB1H 1LVMA 3PLPA 3P92A 1C9PA 1MQ5A 2GT7A 1DVAH 1TPAE 1MBQA 5GIBA 1NRSH 4QT8C 4LK4A 3SU4A 2GMTB 3A7TA 1H1BA 3RXAA 3SV6A 1GBTA 1TNHA 1HLTH 2GCHG 3MOCA 2ZFRH 3LGTA 3OY6U 1RRKA 1AVGH 1ESTA 2BYAX 2OBOA 2XTTB 4GCHF 2QF0A 3MH4A 5B6OA 3P6ZB 1GWAA 3A87A 2DE8A 2ZU1A 2V3HH 1HXEH
chains in the Genus database with same CATH superfamily
1UTKA 5FPYA 2BB4A 3LT3A 3A81A 1F92A 1P3CA 1AQ7A 2UWOA 1AWFH 3KCGH 2ZGBH 5GJ4B 1LHFH 1FY4A 4ESTE 4TYDA 3UB0A 2NWNA 1NESE 5J4QA 1HDTH 2BD4A 3S7HB 1QZ8A 2PUXB 2STAE 1ZR0A 3BG4C 4X2XA 1GI0A 2F91A 5EOKA 4ABJA 4Y79A 3RXBA 2VB0A 4ZKSU 3T25A 2Z3EA 2C8XB 3SQEE 2EQNA 2QC2A 3SV9A 2SFAA 1OYQA 1SGNE 3KNXA 2L74A 2TGTA 2XBVA 3NUMA 2FX4A 1GMCG 3MO6A 5CDFE 1TABE 1W3CA 1EOJA 2KCYA 2OC1A 3ENSB 3BIVH 3T2NA 3SOSA 1HIAB 1RIWB 3EE0B 1NU7B 1VCWA 1BMAA 3QGJA 3DD2H 1WTGH 1O2JA 2XRCA 3HGNA 1AZ8A 4IW4E 3RXRA 1QJ6B 4DJZB 3LGIA 1TMBH 2VWOA 1YCPM 4E05H 1QQUA 2SNWA 1O38A 1C9TA 2Z6BD 1H9LB 2FOAA 1GBCA 3SQHE 3VB5A 2WUBA 3QZRA 2J5UA 3GYLB 1BMFD 1K1NA 2FYQA 3RXFA 4JYTA 2VU8E 5EW1H 3K6ZA 1SLUB 3TK6A 1BTWA 1P9UA 3MI4A 3TITA 1ELEE 5HM2A 1V2UT 1NT1A 3R0FA 2C4FH 2JETB 1E79D 1Z6JH 3U8TH 6GCHG 1OOKB 2GTBA 1OXGA 2ZTYA 1DXWA 4K69A 4UFDH 3ESTA 3QUMP 1UK3A 2BZ6H 5CE1A 2FOCA 1UTNA 3EDXB 2OTVA 4RKJB 1EZQA 5CMXH 3A8BA 1GVKB 5LPRA 4O3TA 3M35A 5SGAE 4TSFD 2GZ8A 1LVBA 2J4IA 2VIPA 2IPQX 1Y5AT 1AKSB 5E2OA 2PKSB 4YT7H 1HAZB 4NCYA 1O3BA 4NIWA 2OQUA 4ABEA 3SNAA 1UMAH 1O3GA 5T6DA 2R2MB 2AIQA 5FBEA 1RXPA 3NWUA 3F9HA 3LIWA 4CRBA 2QF3A 4OS5A 1IQNA 1ZJDA 1NRRH 5DN6D 1UO6A 3V3MA 2A2QH 2B5TB 5C0UA 1Y3UA 4FOUC 1BCUH 3UTUH 2BDIA 1HV7A 2FESH 3LGVA 1G2LA 2XNIA 1LPGB 3SU3A 2G5NA 4CHAC 4B75A 2EEKA 1PYTC 2ZG0H 1GHWH 3BTGE 4DT4A 1MCTA 2NU1E 2BY5X 2BTCE 5EU8A 1RFNA 5A8YA 1GI1A 1YGCH 1H9HE 3SU6A 4M7GA 4YO9A 5L30H 3RU4E 2HALA 5FX5A 1UCYH 1L4ZA 1SQAA 1KLIH 5EJLA 1BT7A 4U2WA 3VXEH 1FY3A 1O2VA 1UW7A 1FXYA 5EJZA 3ZVGA 1EJAA 4VGCB 2J95A 1COWD 4Y11E 4YESB 2ZPRA 1NROH 1K28D 3SBKA 1LCYA 3SV8A 2FO9A 1BDAA 4KGAA 1O2YA 3BTDE 4Y71A 1VCQA 2AGIX 4XFQA 1A1RA 2ZPSA 3T28A 1ZHPA 2ZNKH 1XKBC 1FN6A 3GCTG 1L1NA 1T8MA 2QE7D 3PV4A 3DT0H 2K0QA 1EZXC 1D6WA 1N1LA 2OCVB 1UTJA 3T5FH 1DUAA 2J98A 2J9NA 3MYWA 3V7TA 2RDEA 4YZUA 1SL3A 2ZC9H 1GCDA 4LZ4B 1GDQA 5GDSH 1ZOMA 3H7TA 1AVXA 2OXSA 1GMDG 1ETSH 1MQ6A 1PPBH 3SUGA 1ZSLA 1GJ7B 4AYYB 2SGDE 3RXHA 3SGBE 5EODA 1ZLRA 2CGAA 3UR6A 3IG6B 4E06H 2Q6DA 1EUFA 1YPHE 2A2XH 1AI8H 1BTPA 1G3CA 1WOFA 1G3BA 2WPKS 2F9VA 3S69A 4IS5A 3ZZ3A 5H4IB 1QTFA 2GDDA 3NPSA 4IBLH 1N6YA 3FP7E 5A0BA 1YF4A 1GHXH 3BG4B 4FUFA 5I25A 4GLYA 3NCLA 1QRWA 3HGPA 3M36A 2Q1JA 1AUJA 4O3UA 4IMQA 4A1VA 1ARCA 1EZSC 3M3VA 1NFUA 1PPEE 1EQ9A 2F9NA 1YP9A 1C5TA 4WH8A 2WPDD 2A4QA 5E2PA 1JRSA 1N8OC 4GSOA 1GI9B 1HYLA 4XBDA 3WWBA 4JZIA 2V3MA 1RS0A 1QFKH 3GDUA 4FUJA 1QR3E 2PTCE 1SFQB 1G36A 7GCHF 2R9PA 3KQ5A 1F0SA 2PSYA 4XE4A 1BHXF 2VGCC 3DSPA 1UVOA 3RXPA 4F48B 2FYRA 1GBEA 4H6SB 3MQKC 1Q2WA 2FMJA 4X6NA 3KYFA 2NU3E 3VPKA 2QCYA 2OP9A 2FODA 1QB6A 1CT4E 1KXDA 1EP5A 5AVDA 1FAKH 3BEFB 5AFZH 1QBVH 3PTBA 1KYNA 3LC3A 2AGGX 3MMGA 1W7XH 4ASHA 1P11E 1WDIA 2ZDKA 4K8BA 3BTWE 1O2MA 3BTEE 4MNYA 3E16B 5C1UA 3U9AH 3ZVBA 5DP5A 1MTSA 5EG4A 4MPXA 1NFYA 4BTTB 2VH6A 5EQQA 5HIYA 3ATLA 1MUEB 3RMOH 3PO1C 5AFYH 3I77A 2A5AA 5C67A 1J14A 4JZEH 9ESTA 2BQWB 3RMNH 1YLDA 5EXNA 1QB1A 4WMDA 1JIMA 2D1JA 5F8XA 1UVPA 2O8MA 3ZZ6A 1T4UH 2FTLE 1G37A 3ZYDA 2BXUH 1H4WA 4Q2KA 3GCHC 5KEDA 2R0LA 3CP7A 4NIXA 4LOYH 1Z1JA 2G52A 3VFEA 4MPVA 2H9HA 2VINA 3SZNA 1K21H 1FX0B 1WU1A 2FXRA 1BA8B 3UREA 4K60A 5EQSA 5C20A 1VZQH 2PFEA 4NA7A 2FS8A 3E3TA 1KY9A 2ALVA 1CBWC 1QCPA 3P17H 4AG2A 4X1NU 4CHAB 2BLOA 3NK8A 1E0FD 4ZROA 4JZDH 4XDEA 3KYGA 1ELVA 5JB9S 3PV5A 3PV2A 3GY8A 3RLWH 4B73A 2SGPE 3N7DA 4ABBA 3SJ9A 3BG8A 1E1RD 1S0QA 1AHTH 1H9IE 4KTSA 3F9EA 3L3TA 3AASA 1SFIA 2CV3A 2B7DH 1TBRH 3KF2A 2BOKA 1F0TA 1HAVA 1PYTD 2ODYB 1CQQA 2BM2A 3QDZB 3N99A 3F68H 1IQFA 2GZ7A 5C94A 2H5DA 1DXPA 1NZQH 1UK2A 4A7IB 4SGBE 3S9BA 4IMZA 1O3OA 2IJOB 4AZ2B 1K1PA 1S84A 1HUTH 2J98B 1PQAA 2BY8X 2ZHWH 2RDLA 1O36A 2RA0A 4ZMAH 1SGFG 3RP2A 2KCAA 2A5KA 1HAHH 3UQVA 2FP7B 4B6EA 1UTPA 2QAAA 1Y5UT 4AFUA 1O2ZA 4YXWD 1ABIH 3RC4A 1A5HA 1QBNA 1MU6B 2VJ1A 1O2LA 2CHAC 3LGYA 1RIWC 3DA9B 1O39A 1SKYE 3OTJE 1FIWA 5DP7A 1YPLH 3U1IB 3M5MA 2FOBA 2ODPA 3PYHA 1SGFA 1V2OT 1KXCA 1T31A 4A1TA 3SU5A 1G3EA 4YOIA 1MD7A 4MLFB 1G2MA 3PMJA 2OUAA 3SO3A 3A86A 3OU0A 3UNQA 2HNTC 2ZGXH 5L6NH 1FNIA 4ABIA 4BNRA 2A4GA 2IOTA 4MNWA 3Q3KA 4A92A 9LPRA 3EGKH 4JMYA 1XVOA 3E1XB 3NXPA 1ZTJA 1V2JT 2G4TA 3ZIAD 1XVMA 3M37A 1T8OA 4DW2U 2GV7A 5JPMH 1MTWA 1YPMH 5TJXA 3SJ8A 1C2EA 3ZZ9A 4BANB 2H6MA 1GJDB 1KSNA 2D26C 1V2VT 2OQ5A 5HM9A 2QIQA 1P10A 1N8OB 2UUJB 1IQKA 2QGRA 2WPIS 2OBQA 2Z9KA 3GOVB 4FUEA 1BB0B 1EKBB 2VVUA 2W7SA 3ZZ5A 1C5YB 3E0PB 2W6JD 1HAPH 1C2DA 2G4UA 5GCHF 4NIYA 5BPEA 5EPNA 2VGCB 3TH4H 1SI5H 3O8DA 1EOLA 1JIRA 1C1UH 2QXHA 1C2MA 1VJAU 2Z9JA 1O3KA 4FU8A 3ZVEA 3QTOH 1GI4A 3ZZAA 1F5LA 1FY1A 1XUFA 2FZZA 4FETA 4J1YA 1O2GH 1E36B 1KXEA 4BAHB 1O35A 2YNAA 4FU9A 2YMSC 2ALPA 2BD3A 2GCHF 1C1QA 4X8UH 3STIA 4Q63A 4NGAH 1SPJA 3VGCC 2ZDAH 1GBBA 3RXTA 4FUCA 4F49A 3TK5A 1CSOE 1CGJE 1O3IA 4AB9A 1YPEH 1TFXA 3PO1B 2QF5A 5F53A 2F9PA 1O30A 1A7SA 3T62A 1UTQA 2HWLB 1ANBA 4BAOB 3B9FH 1C5MD 2QN5T 1M9UA 3KQDA 4NA8A 1YLCA 3GCHB 5JB8S 3NRLA 1A5IA 4H6TA 1ZRBA 3MHWU 2QV1A 3O8CA 2BQ6B 2KZ4A 4OGXA 1ELAA 3E0NB 3KQEA 4MG3A 2A4RA 3EA8A 2Y5FA 1K1MA 1ESAA 3A8CA 2PHBA 1QJ7B 1OKXA 1VR1H 1CBWB 1B0FA 3LH3A 4RT0A 1MKWK 2R3UA 5DP8A 1Z8GA 1Y3VA 1TOMH 2XBXA 1DS2E 1C1OA 1E35B 2ZQ1A 3DFJA 3F0OA 2G5VA 3UFAA 1GHAF 1HAVB 2WV5A 1H8IH 1B5GH 1S82A 4I8HA 2G8TA 1AWHB 1UTMA 1TX6A 3ZZ4A 2A32A 4B71A 1CGHA 2I6SA 3EQ0H 1C5ZB 1BMLA 4ISHH 4O97A 2ZGHA 2CMYA 1HJAC 3A85A 1DE7H 1KDQA 1MBMA 3TJVA 1WAYB 5E0GA 1SLVB 4F4OC 4X6OA 1IQMA 2BQ7B 3ZVFA 1AE5A 4MNVA 4FUDA 1TNJA 2C8YB 1GI6A 3QK1A 2LP6A 1P03A 3GY6A 1AE8H 1TMUH 1WCZA 2C93B 1C5NH 3OAAD 4D7GA 5C5NA 3BEUA 4IN2A 4Y8XA 3Q77A 5F8ZA 5G4BA 3AK5A 1XX9A 1EFRD 1GJ4H 1LVOA 5CHBA 8GCHF 1OP0A 2JH0D 1OP2A 5EIYA 1CHOG 4BXWA 2ZI2H 2ZQ2A 4NIVA 2ZIQH 1O2IA 2CHAB 1KXAA 1W0ZU 2PTNA 2UUFB 1P2NA 2J97A 4X6PA 1ZYOA 3GY5A 1EJMA 3SNEA 1C5PA 4TPIZ 1HFDA 2ILNA 3N7OA 2XNDD 4B2BA 3RMLH 2AYWA 3S9CA 4J2YB 1P12E 1QRXA 5KECA 1V2WT 5FBIA 1DWCH 3M3SA 1D3PB 1BRCE 1TE0A 2GD4B 3RXGA 1P3EA 2THFB 2FOHA 1ID5H 1WV7H 1LPKB 5EQRA 1PPGE 1K1JA 4WXVA 1J9CH 1BTYA 2HRVA 1GHBF 2HVYB 1KTTB 1EAIA 3GCNA 1P2IA 2IPHA 3STJA 1GJBB 1NRNH 2FIRH 1GI5A 1TIOA 4GCHG 2QXJA 2SNVA 3BEIB 2VWNA 4X8TH 1YCPK 5DJ7A 2J92A 1AFEH 2XWBI 1ZHMA 2BX3A 1DWDH 1LHEH 3WWFA 1BTXA 1DLEA 1S6LA 2J38A 1FZZA 4NSVA 1TNLA 3SNBA 4GAWA 1DY8A 1NO9H 1AD8H 3DHKH 1O3FA 1FJSA 4R8TB 4NZLA 2VIQA 5DP3A 4XRNA 1EX3A 1C1MA 1V2PT 1YLNA 2SGEE 1P05A 1BMNH 1SOZA 2FTMA 1IQJA 1BBRE 4E7NA 2FOEA 2SGQE 5C2ZA 2OC0A 1ZTLA 1E37B 2Y7ZA 1JBUH 1ZGVA 3KHVA 2P94A 3RUOA 3Q3XA 2ZFTA 1HAIH 5F6MA 1MKXH 3DUXH 4K8YA 4TWWA 4Y7AA 3P8NA 2A0QB 4P02A 3M5LA 1FMGA 4GHTA 1QJ1B 1GBFA 4YLUA 2BOHB 2XOKD 2H1UA 2YMSB 2AHME 2BDYA 1CU1A 4UEHH 1GBLA 2XBYA 1GG6C 1O5EH 1CHGA 1O3DA 2FLRH 3VGCB 3AAVA 1ZPZA 3M3TA 4U32A 4ABGA 3OEED 1T8LA 1P8VC 3PLKA 2BD5A 1L2EA 4AN7A 4H42U 2VWMA 2VH0A 1WYKA 1KIGH 2ZFPH 3ZVAA 1E34B 4B2AA 2RFKC 2CF9H 2ZF0H 1DFPA 2A7JA 3TPIZ 4AFSA 4CR9A 3TGJE 3KGPA 4B1TA 1UTOA 3A89A 3BTFE 3DFLA 4ZCNA 1TX8A 4AGKA 4AOQA 1A0LA 3BIUH 3BTME 5KGOA 2PKAA 3SUDA 1BZXE 1YY3A 1T7CA 3D23A 1K1IA 3BSQA 1BQYA 3F9GA 1C5OH 3PROA 4K3JA 3LH1A 4KTUA 5EW2H 1TA6A 1XM1A 3VXFH 1PPZA 2ZFQH 4F55A 1LTOA 1UVUH 2ZHQH 4DOQA 4MTBA 1KDQB 5HMAA 2P93A 3D65E 2ZEBA 3L33A 1W13U 3LONA 2CF8H 5DP6A 3MWIU 2PSXA 5E8EH 2P95A 1Q31A 5TCCA 1TBQH 1S83A 1JXPA 5C1YA 1SLWB 3BV9B 3MO3A 1GBHA 3A7WA 1Z8IB 1GDNA 1O5AB 4FVDA 4YT6H 1HXFH 1EASA 2PGQB 1O2PA 3CS7A 1HJAB 1GPZA 2AH4X 1GMHF 1TNKA 3M5OA 1O5CB 3RC5A 1L1GA 1O2QA 3P8OA 4ZKRU 2XCFA 1FUJA 1TMTH 4WMFA 1GJ8B 3P8FA 1INCA 1LHDH 2AFQB 2W26A 1P2KA 1O37A 5JBAS 5HXFA 3C1KA 1GBMA 2ODQA 1GJ5H 5ESBA 3UIRA 3ZZ8A 3BF6H 3V12A 5LH8A 4KKDA 1GI8B 2UUKB 1FLEE 2PW8H 4JK5A 3RXDA 1QQ4A 1AVWA 4NA9H 1CGIE 3IWMA 4FUGA 2Y7XA 4Y7BA 4BTUB 2FI5E 1UK4A 1XUHA 1HAYB 4WXIA 4D9RA 2HPPH 1NM6A 3D62A 2ZGJA 4CBNA 3M7UA 1AY6H 1C2FA 4D7FA 4MDSA 2RG3A 2BDCA 4AORA 4RSPA 3A84A 1QNJA 1W2KH 3QO6A 1LVYA 2P16A 4I8KA 1D3DB 3GY7A 1SMFE 5CHAC 1XUJA 3MU4A 2GDEH 3BN9A 2WYJA 2C8ZB 2H9EH 1O3HA 2K1QA 1Z71A 1A2CH 1F5KU 1HGTH 2F4LA 1V2TT 2KAIA 1BIOA 1SHYA 2G51A 4I8GA 2FM2A 2GX4A 5C1XA 3PRDA 1O2UA 1NC6A 2WPLS 2NU0E 4I86A 5AHGH 1CA8B 1GHYH 3EA9A 7LPRA 1C5XB 1ZMNA 2ANYA 3DSOA 3RXMA 2W3IA 2BD7A 1THPB 3TVJB 1W12U 2Z9LA 5DKMA 1PPHE 1QA7A 1QY6A 4Z0KA 1T8NA 3ZVDA 1RJXB 1QB9A 1Y3WA 3LOXA 1GJ6A 1A3BH 1ELTA 4UONA 1LQDB 1DT2A 1TQ0B 4GPGA 5PTPA 1VITF 1OPHB 1HAOH 4X1QU 1TNGA 5E0JA 3SGQE 4CRDA 4D8NA 1DANH 1UCYE 4AFZA 5JBTA 3SV2H 3UAIC 2O8WA 2ESTE 4UD9H 1NFXA 2EC9H 1EJNA 3TJOA 3CNRA 4Y76A 1C5QA 8ESTE 1EB2A 3MO9A 2XW9A 1CE5A 1KXBA 1HJ8A 1TOCB 5FX6A 2ZWLH 3RXOA 3WY8A 4BTIB 1J15A 1HCGA 4YTAA 2JH6D 2H2ZA 2CJIA 2F9OA 3ATMA 3FANA 2NU4E 3OE7D 1MAXA 1MCVA 2AIPA 7GCHG 5JYIA 1FDPA 2ANKH 5A0CA 1P2MA 4ZKNU 5LGOA 4BXSA 3F3BA 4B2CA 2J34A 1GG6B 2UWLA 1O2TA 1TYNA 4THNH 1ELCA 1Y3YA 5GNDA 2BY6X 5F8TA 1GBJA 2FOFA 3QWCH 1P2QA 1TGTA 1TPOA 2XWAA 2HLCA 1DWBH 4ISNA 1O32A 1VCPA 1Z8RA 4MNXA 1KTSB 2PUQH 1UJ1A 3UQOA 1OWJA 3M7QA 1O5BB 1SG8B 3WW7A 1FI8A 1C4U2 1P04A 2PKAB 4AG1A 3EYDA 4A1XA 4FVBA 2YOLA 1O3JA 1WQSA 1DX5M 3KN2A 1DITH 4X2VA 5K7RA 2M2AA 2ZHDA 3E90B 2G55A 3ZVCA 2SGFE 2QF4A 1EAUA 5FPSA 4XBBA 1AUTC 2WV4A 1CA0C 2W5EA 2BHGA 2BDGA 4CRAA 1V2LT 2ZU4A 1BJUA 4DURA 5GWZA 4GVUA 3QX5H 1SGQE 4K1SA 1O5GH 1ETTH 3QGNB 3ZZ7A 3UOUA 1W14U 1O2SA 2ZECA 1C1SA 3QTVH 1BUIA 1LMWB 2BVRH 2Z9IA 2ZDMA 1OS8A 1PPCE 1O2RA 1O2HA 1V2RT 2A7CA 1MTNC 1O2OA 1QL8A 1FIZA 4UE7H 3RM2H 3SV7A 1GHZA 2ZDLA 1MU8B 3E91A 4TY6A 4KP0A 4CH2B 3ITIA 1CT0E 3RU4T 2ZDNA 3FZZA 5FCKA 3FN8A 1O3CA 1SOTA 5F03A 1J16A 1E1QD 1P06A 4DGJA 1FQ3A 2D2DA 1Q3XA 1OWDA 2XC0A 3SU0A 1ZTKA 1P2OA 4NSYA 4ISLA 1SBWA 5DK1A 5LPEA 1ZSJA 3SZEA 1GJAB 2WINI 3JZ2B 1SB1H 1D4PB 2FI4E 3NKKA 1E38B 2RCEA 4UFFH 3U98H 1F5RA 3ODFA 1BRBE 2ZFSA 1NRQH 1GBKA 1ZSKA 3HK6B 4Y0ZE 1C2GA 4ISOA 2ZDVH 2EI7A 1IQHA 1O2KA 1V2MT 3LC5A 2OC8A 1ZRKA 2BX4A 4U30A 3MNBA 3HKJB 2VVVA 5L2ZH 1NBME 5FAHA 2XC4A 2STBE 1H8HD 1SLXB 2ANWA 1HNEE 4Z6AH 2KAIB 4ABAA 1YPJH 2TGDA 1RTLA 1Y3XA 3U8RH 2GCTC 3SW2B 1YWUA 4X0WU 1NS3A 5T3HA 4XSKU 2M5TA 5CHAB 1GDUA 4CH8B 1UTLM 1NRPH 1V3XA 4GHQA 2BVXH 2AGEX 2Z7FE 4CREA 2TIOA 1C2HA 1OHHD 2KCOA 1SGIB 3A7ZA 1C5LH 5FHTA 4ZHAA 1C1WH 2EI6A 2AERH 2WSSD 3QZQA 5EGMA 2BY9X 3SJOA 3KL6A 5DP4A 5DO4H 3P95A 1A4WH 2HNTE 4UFEH 1UHBA 1UVTH 2Y6TA 5DP9A 4JK6A 3RMMH 3U8OH 4Q80A 3MH6A 1GGDC 1HB0B 3H09A 1WQVH 1B7XB 1O3AA 2JJ2D 3RLYH 8KME2 1DSTA 2VVCA 2VIWA 4ISIH 1J8AA 3AAUA 1PQ8A 1TALA 3LGWA 3O8RA 1TNIA 3KEEA 4MPWA 5A0AE 1GI7B 1SC8U 2CK3D 3MU5A 2KM0A 1TA2A 5L2YH 2GT8A 1UVSH 1OYTH 1AB9C 4B6FA 1C1NA 2WYGA 1S6FA 3UR9A 2W7UA 3VB3A 2ZP0H 1LDTT 2OINA 1EAXA 1IOEA 2WPMS 2ZTZA 5ESTE 3LGUA 2BZAA 4OS6A 3SJIA 2ZPQA 5I46H 4M9FA 1W11U 2WZQA 2HVXA 1GMCF 4CRGA 5C3NA 1ETRH 1C1PA 1ELBA 3GS9A 1YPKH 4X8SH 4MQAA 2VIVA 2P8OC 3Q00A 5GCHG 4OS4A 1SQTA 1O3NA 3VB6A 3RXJA 4OS7A 1EXFA 4FU7A 3MTYA 1VJ9U 3RXCA 4K2YA 1BHXB 3OYPA 3F9FA 2LNCA 4AC9A 4A6LA 1IQGA 3V0XA 2BY7X 5JDUB 1AZZA 1TGSZ 3HKIB 3FO8D 1TPSA 2QXGA 3TNSA 1K22H 3T29A 3URDA 3G01A 2CXVA 3SNCA 2TGPZ 6GCHF 2VIOA 1RTFB 3FOAA 1GHVH 1SHHB 2BD9A 2ASUB 2PV9B 3ELAH 2KX4A 4FXGH 6CHAC 2ANMH 1CO7E 3F2GA 3SYJA 2ZCKP 1CA0B 1L0ZA 2FLBH 2JDID 1ZZZA 1OWEA 3VB7A 2W3KA 3FFGA 1A5GH 4Q7XA 1QBOA 4INHA 1BJVA 1ACBE 4HTCH 5HYOA 1Z1IA 3MNSA 4CR5A 1D3QB 1FONA 1CT2E 1YKTA 4TWYA 3GYMA 4H4FA 3SU2A 1B0EA 1AFQC 1XMNB 4Z1MD 3LKWA 2QY0B 3SNDA 3OY5U 4O03A 3RXLA 4BAQB 1W0JD 4TPYA 1MTNB 1P09A 1NBMD 1CVWH 2ZKSA 3ATKA 4INKA 1T4VH 1TLDA 2OLGA 3A88A 2XXLA 3KQBA 1DPOA 1OSSA 2A1DB 3B23B 1H8DH 1GL0E 2ZHFH 1SQOA 3H5CB 2WHXA 2GJGA 1BOQA 3S0NA 1EATA 4ASUD 2BDAA 4CRFA 1C1VH 4ZUHA 4DY7B 2LPRA 2BXTH 3ODDA 1QRZA 1QL7A 1QURH 4D9QA 3I78A 1GHAG 1ORFA 3TIUA 1MZAA 2Z9GA 3ATWA 2F9BH 1MH0A 1W0KD 3SHAH 3W95A 3OTPA 1V6DA 3B8JA 4P00A 5A8ZA 2R3YA 3GDSA 1S5SA 2A31A 1SGPE 3LJOA 3T27A 2HPQH 3EE7A 2BD2A 4Y10E 1GVZA 1AIXH 1P57B 5HGGA 1S85A 2QXIA 1TRYA 1O2WA 3RC6A 3PLBA 3RXQA 3ZZDA 3HK3B 4ABDA 4IN1A 5J4SA 5EJ1A 2O9QA 3AW1A 1ZPCA 2B8OH 4XBCA 4BAMB 1GCTC 2KCPA 1DSUA 1TWXB 1GI2A 4ZH8A 1C5UA 1TRNA 2ZFFH 3OX7U 2GCTB 1DDJA 1C5SA 3F2HA 1PQ5A 3MFJA 3VEQB 5A2MH 4K1EA 3TLOA 2KFWA 2B0FA 3GCTF 3K2UA 1UHBB 1X7AC 1O5FH 1FY8E 3I29A 8GCHG 3QN7A 1O3LA 1OWHA 2ZO3H 5IYTA 4AGJA 1FN8A 1JMOH 1ZHRA 1O3EA 2A5IA 3F0PA 3R3GB 2R0KA 3P70B 5FPTA 1EPTC 1QGFA 2VIDA 3F1SB 4X1RU 3RDZA 3ZZCA 2G00A 4I32A 4B74A 3TU7H 4RKOB 1FPCH 1GMDF 1ELFA 1P01A 1K1OA 1O3MA 4LZ1H 1GGDB 2UUYA 3BTQE 4HI3A 4HFPB 2BDHA 4Y6DA 5A09A 4FUHA 2EA3A 2V7QD 1GL1A 4BOHA 3LPRA 2AMPA 1GHBG 2ZA5A 4DT7B 1EPTA 4I31A 2HOBA 3UNSA 2AEIH 2YMSD 1C2LA 1C4V2 5T1VA 2AS9A 1D9IA 1Z8JB 3SUFA 3KIDU 2I6QA 2AMQA 1G9IE 1WBGB 4WMEA 1BTUA 1HJ9A 1YPHC 1JWTA 1MZDA 1AB9B 1YBWA 4OS2A 3FZDA 1DWEH 2O8UA 3S9AA 4NFFA 2YNBA 1C2KA 3LDXH 4JZ1A 2ULLA 3Q76A 1VKYA 3OSYA 1TQ7B 4OGYA 3RXEA 4INLA 4Y8YA 5GPIB 1IQLA 3RXKA 3UNRA 4NG9H 2DUCA 2P3FH 2ZU5A 2C3SA 2P8OB 2ZU2A 2J2UA 3MU8A 3L6PA 3UPEA 1SGEE 1HAXB 1IQEA 1RD3B 2GGVB 5EXLA 3SU1A 3TNTA 1RGQA 1Z7KA 1XUKA 1TBZH 3EAJA 1ELDE 1BTHH 1F0RA 1GBIA 3CS0A 1GBAA 3FP6E 2Y5GA 1O33A 1FPHH 1XXFA 5HKKD 3FVFB 4ZXXH 5T6FA 2GV6A 3URCA 1C5WB 4TY7A 1TX7A 3SHCH 3RM0H 2F43B 4YOJA 1LPZB 4ABHA 3GISB 1D6RA 1NN6A 1ANCA 1TB6H 4BAKB 1PPFE 2UWPA 2A4OA 2RA3A 1MMJN 4GUXA 2Y5HA 2PLXA 3TH2H 1N6XA 6CHAB 2BMGB 2P59A 1JOUB 1AGJA 3LJJA 3K65B 3TK9A 4KELA 3V13A 2Y80A 2BLWA 1PFXC 3FAOA 3MU0A 3VG8A 2JIZD 2FWWA 2GVFA 2WPJS 4JCNA 1F0UA 1MKWH 5EPYA 2VWLA 3BTHE 5BRRE 5IK2D 5DSFA 2OC7A 2V3OH 2BLVA 3U69H 2EI8A 5E0HA 2TBSA 3A7VA 2A45B 4AFQA 4X2YA 1ANEA 8LPRA 1AFQB 4DVAU 4B76A 4ZAEA 4YLQH 2BDBA 1IQIA 3ATIA 1TPPA 1EP6A 1A3EH 1EZUC 2Q6GA 4DIIH 1MTVA 1ABJH 1NU9A 1XUIA 3PMBB 4YM9A 1K2I1 1S81A 4CBOA 2HGTH 2VNTA 2Y82A 1NTPA 3AVZA 4CRCA 6LPRA 3OFND 4ZHLU 5C5OA 1FY5A 3U28C 1A61H 1IAUA 5C17A 1BBRK 2PR3A 1IHTH 4Q4LA 1FV9A 1V2NT 2C90B 2HLDD 1QA0A 2F83A 3W94A 1KLJH 4D76A 1AMHA 1Z6EA 1O0DH 1ANDA 4ZHMU 2ZCLP 1A0HB 1W10U 3ZZBA 2GP9B 1P02A 4WF8A 1GMHG 3GY2A 2FOMB 4LXBH 4X8VH 3MU1A 3UWJH 3SI4H 1KMHB 5EXMA 3MNCA 1VGCC 1GCTB 4DIHH 3TJUA 1OWKA 1VITH 1EAWA 3MH7A 4MVNA 5ABWA 1LQEA 2IJD1 1ZMJA 1AU8A 2SGAA 1SGYE 3NZIA 4Q7YA 1C1TA 2Z94A 1V2QT 3TH3H 2JH5D 5ETXA 1DLKB 4WVPE 3UWIA 2P3UB 2XYAA 3LU9B 3U1JB 2Z3DA 1OX1A 1IHSH 2ZZUH 1MD8A 2V35A 3RXUA 2FEQH 2OD3B 3K9XB 5T6GA 4WY3A 3VB4A 4NZQA 4AX9H 1G30B 1W0YH 2BVSH 1SSXA 1H8ED 2Z3CA 1NPMA 1K9OE 3RU4D 2PGBB 3PWCA 4X2WA 1A0JA 1GJCB 1TGCA 1OP8A 3SJKA 1THSH 1SGTA 2O8TA 2QA9E 7KMEH 5JBCS 3GY3A 2FDAA 3SI3H 1S6HA 1GJ9B 3RXVA 1EPTB 5C0TA 1YCPH 3FP8E 4I33A 4UDWH 1LKBA 3BTTE 4HGCA 1P9SA 4YOGA 2FPZA 3M5NA 4RT1A 1QIXB 2D8WA 2A7HA 2HNTF 2Y81A 1MABB 3TJNA 1SGRE 1TGNA 4X6MA 1SR5C 4K5ZA 4X1SU 3SORA 1Y59T 3AW0A 1KLTA 5JBBS 1D3TB 1XUGA 1LKAA 1YC0A 2H5CA 2GMTC 2ZGCA 2V6NA 4NWLA 4NWKA 3H7OA 4U01A 1KXFA 1G32B 5FXLA 1T32A 3D49H 4IGDA 1SGCA 1NFWA 1NY22 1ESBA 2OK5A 3PRBA 3UY9A 3S7KB 1C2IA 1VITG 4Y0YE 1HPGA 4JYUH 3T26A 1O2NA 4Y8ZA 1V2KT 4I8LA 1ARBA 1MAYA 3MNXA 3O8BA 2CN0H 4RI0A 1A46H 3RXSA 2GKVE 4X1PU 1THRH 2FOGA 1C5VA 1TONA 2F9UA 1BRUP 1K1LA 3E6PH 1LHCH 2XBWA 1O2XA 1PQ7A 4TT3D 2VBCA 2QYIA 4OS1A 3A80A 1BITA 3DCLA 1YPGH 3C27B 4SGAE 2IN2A 2R2WU 1Y8TA 2TPIZ 4I8JA 3E8LA 5B6LA 1V2ST 3CENA 1YM0A 1QL9A 3PWBA 4A5TS 5FCRA 3GICB 1Y5BT 4JZFH 3PM3A 5DGJA 2ZCHP 1BTZA 2G81E 4NFEA 4HG6A 2C8WB 3F6UH 2L6OA 5FL7D 2DE9A 1C5RA 3ZV9A 1TRMA 4KTCA 3A82A 1HIAA 1HAGE 2J94A 5K0HA 1DICA 4UFGH 3PB1E 1MKXK 2AMDA 1TGBA 2FS9A 2XCNA 2JETC 2JKHA 5LPFA 1WSSH 2ZHEH 3OEHD 4WWYA 2F3CE 1BRAA 3DSGA 3A8AA 3PMHB 1AO5A 3BTKE 2ZTXA 4MPUA 2TRMA 3M7TA 3IITA 4E7RG 3FKSD 1DOJA 3N7EA 1O5DH 1RTKA 2EY4C 1TAWA 1LHGH 4Q7ZA 4RN6A 1ZJKA 1U6QA 6ESTA 2H9TH 4ZXYH 3A8DA 3QLPH 3Q3YA 2NU2E 1UCYK 1C2JA 2PKSC 4WH6A 1QHRB 3K6YA 2K8IA 3P8GA 1WUNH 2O8LA 1SGDE 4DCDA 1AN1E 1P2JA 1O34A 2BLQA 3M61U 2B9LA 1C4Y2 3ZV8A 2P3TB 1F2SE 4JYVH 3GCOA 4OM9A 2XC5A 3EA7A 1GBDA 3HPTB 1XXDA 1AKSA 3ZYEA 4IC6A 2ZU3A 3A7YA 3HATH 1O3PB 1C1RA 2KR7A 2FI3E 4I7YH 2WUCA 2W6ID 4IC5A 3SGAE 1J17T 2GZ9A 1FAXA 1HRTH 5DG6A 1O31A 3SN8A 1MTUA 3PTNA 1SVPA 1VGCB 5HIZA 3PMAB 3GDVA 3TGKE 1F7ZA 2BD8A 3W1EA 2LELA 5A8XA 3GY4A 2TGAA 1P0SH 1W8BH 1XKAC 1G3DA 4O9VA 1K0HA 4K1TA 2V0BA 1S0RA 1L4DA 4HZHA 2JJ1D 5GXPA 1ELGA 3A83A 3UOPA 1GI3A 4FUIA 2PWXA 2FX6A 4ZKOU 4AYVB 2WPHS 1SQRA 1LO6A 1BBRH 3F2FA 1YYY1 4PROA 1ZGIA 1CHOF 1DM4B 1ZPBA 3TGIE 2Q6FA 4VGCC 3A7XA 1GVLA 7ESTE 3UUZA 3MH5A 3RXIA 4FUBA 3KQCA 1WXRA 4XOJA 4R0IA 4AB8A 4ABFA 1ZMLA 5AF9H 1OWIA 1BMMH 5DPAA 4WJG2 3SUEA 1WTHD 1DY9A 1W7GH 3JZ1B 1HBTH 5IDKA 1PJPA 1DUEA 5TCAA 2PP6A 4DG4A 1JRTA 1L1JA 1EB1H 1LVMA 3PLPA 3P92A 1C9PA 1MQ5A 2GT7A 1DVAH 1TPAE 1MBQA 5GIBA 1NRSH 4QT8C 4XD7D 4LK4A 3SU4A 2GMTB 3A7TA 1H1BA 3RXAA 4ACBA 3SV6A 1GBTA 4ACAA 1TNHA 1HLTH 2GCHG 3MOCA 2ZFRH 3LGTA 3OY6U 1RRKA 1AVGH 1ESTA 2BYAX 2OBOA 2WV9A 2XTTB 4GCHF 2QF0A 3MH4A 5B6OA 3P6ZB 1GWAA 3A87A 2DE8A 2ZU1A 2V3HH 1HXEH
chains in the Genus database with same CATH topology
1UTKA 5FPYA 2BB4A 3LT3A 3A81A 1F92A 1P3CA 1AQ7A 2UWOA 1AWFH 3KCGH 2ZGBH 5GJ4B 1LHFH 1FY4A 4ESTE 4TYDA 2NWNA 1NESE 5J4QA 1HDTH 2BD4A 3S7HB 2PUXB 2STAE 1ZR0A 3BG4C 4X2XA 1GI0A 2F91A 5EOKA 4ABJA 4Y79A 3RXBA 2VB0A 4ZKSU 3T25A 2Z3EA 2C8XB 3SQEE 2QC2A 3SV9A 2SFAA 1OYQA 1SGNE 3KNXA 2TGTA 2XBVA 3NUMA 2FX4A 1GMCG 3MO6A 1TABE 1W3CA 1EOJA 2OC1A 3ENSB 3BIVH 3T2NA 3SOSA 1HIAB 1RIWB 3EE0B 1NU7B 1VCWA 1BMAA 3QGJA 3DD2H 1WTGH 1O2JA 2XRCA 3HGNA 1AZ8A 4IW4E 3RXRA 1QJ6B 4DJZB 3LGIA 1TMBH 2VWOA 1YCPM 4E05H 1QQUA 2SNWA 1O38A 1C9TA 2Z6BD 1H9LB 2FOAA 1GBCA 3SQHE 3VB5A 2WUBA 3QZRA 3GYLB 1K1NA 3RXFA 2FYQA 4JYTA 2VU8E 5EW1H 3K6ZA 1SLUB 3TK6A 1BTWA 1P9UA 3MI4A 3TITA 1ELEE 5HM2A 1V2UT 1NT1A 3R0FA 2C4FH 2JETB 1Z6JH 3U8TH 6GCHG 1OOKB 2GTBA 1OXGA 2ZTYA 1DXWA 4K69A 4UFDH 3ESTA 3QUMP 1UK3A 2BZ6H 5CE1A 2FOCA 1UTNA 3EDXB 2OTVA 4RKJB 1EZQA 5CMXH 3A8BA 1GVKB 5LPRA 4O3TA 3M35A 5SGAE 2GZ8A 1LVBA 2J4IA 2VIPA 1Y5AT 1AKSB 5E2OA 2PKSB 4YT7H 1HAZB 4NCYA 1O3BA 4NIWA 2OQUA 4ABEA 3SNAA 1UMAH 1O3GA 5T6DA 2R2MB 2AIQA 5FBEA 1RXPA 3NWUA 3F9HA 3LIWA 4CRBA 2QF3A 4OS5A 1IQNA 1ZJDA 1NRRH 1UO6A 3V3MA 2A2QH 2B5TB 1Y3UA 1BCUH 3UTUH 2BDIA 1HV7A 2FESH 3LGVA 1G2LA 2XNIA 1LPGB 3SU3A 2G5NA 4CHAC 4B75A 2EEKA 1PYTC 2ZG0H 1GHWH 3BTGE 1MCTA 2NU1E 2BY5X 2BTCE 5EU8A 1RFNA 5A8YA 1GI1A 1YGCH 1H9HE 3SU6A 4M7GA 4YO9A 5L30H 3RU4E 2HALA 5FX5A 1UCYH 1L4ZA 1SQAA 1KLIH 1BT7A 4U2WA 3VXEH 1FY3A 1O2VA 1FXYA 3ZVGA 1EJAA 4VGCB 2J95A 4Y11E 4YESB 2ZPRA 1NROH 1K28D 3SBKA 1LCYA 3SV8A 2FO9A 1BDAA 4KGAA 1O2YA 3BTDE 4Y71A 1VCQA 2AGIX 4XFQA 1A1RA 2ZPSA 3T28A 1ZHPA 2ZNKH 1XKBC 1FN6A 3GCTG 1L1NA 1T8MA 3PV4A 3DT0H 1EZXC 1D6WA 1N1LA 2OCVB 1UTJA 3T5FH 1DUAA 2J9NA 3MYWA 3V7TA 4YZUA 1SL3A 2ZC9H 1GCDA 4LZ4B 1GDQA 5GDSH 1ZOMA 3H7TA 1AVXA 2OXSA 1GMDG 1ETSH 1MQ6A 1PPBH 3SUGA 1ZSLA 1GJ7B 4AYYB 2SGDE 3RXHA 3SGBE 5EODA 1ZLRA 2CGAA 3UR6A 3IG6B 4E06H 2Q6DA 1EUFA 1YPHE 2A2XH 1AI8H 1BTPA 1G3CA 1WOFA 1G3BA 2WPKS 2F9VA 3S69A 4IS5A 3ZZ3A 5H4IB 1QTFA 2GDDA 3NPSA 4IBLH 1N6YA 3FP7E 5A0BA 1YF4A 1GHXH 3BG4B 4FUFA 5I25A 4GLYA 3NCLA 1QRWA 3HGPA 3M36A 2Q1JA 1AUJA 4O3UA 4IMQA 4A1VA 1ARCA 1EZSC 3M3VA 1NFUA 1PPEE 1EQ9A 2F9NA 1YP9A 1C5TA 4WH8A 2A4QA 5E2PA 1JRSA 1N8OC 4GSOA 1GI9B 1HYLA 4XBDA 4JZIA 1RS0A 1QFKH 3GDUA 4FUJA 1QR3E 2PTCE 1SFQB 1G36A 7GCHF 2R9PA 1F0SA 2PSYA 4XE4A 1BHXF 2VGCC 1UVOA 3RXPA 2FYRA 1GBEA 4H6SB 1Q2WA 2FMJA 4X6NA 2NU3E 3VPKA 2QCYA 2OP9A 2FODA 1QB6A 1CT4E 1KXDA 1EP5A 5AVDA 1FAKH 3BEFB 5AFZH 1QBVH 3PTBA 1KYNA 3LC3A 2AGGX 3MMGA 1W7XH 4ASHA 1P11E 2ZDKA 4K8BA 3BTWE 1O2MA 3BTEE 4MNYA 3E16B 5C1UA 3U9AH 3ZVBA 5DP5A 1MTSA 5EG4A 4MPXA 1NFYA 4BTTB 2VH6A 5EQQA 3ATLA 1MUEB 3RMOH 3PO1C 5AFYH 3I77A 2A5AA 5C67A 1J14A 4JZEH 9ESTA 2BQWB 3RMNH 1YLDA 5EXNA 1QB1A 4WMDA 1JIMA 2D1JA 5F8XA 2O8MA 1UVPA 3ZZ6A 1T4UH 2FTLE 1G37A 3ZYDA 2BXUH 1H4WA 4Q2KA 3GCHC 2R0LA 3CP7A 4NIXA 4LOYH 1Z1JA 2G52A 3VFEA 4MPVA 2H9HA 2VINA 3SZNA 1K21H 1WU1A 2FXRA 1BA8B 3UREA 4K60A 5EQSA 5C20A 1VZQH 2PFEA 4NA7A 2FS8A 3E3TA 1KY9A 2ALVA 1CBWC 1QCPA 3P17H 4AG2A 4X1NU 4CHAB 2BLOA 3NK8A 1E0FD 4ZROA 4JZDH 4XDEA 1ELVA 5JB9S 3GY8A 3RLWH 4B73A 2SGPE 4ABBA 3SJ9A 3BG8A 1S0QA 1AHTH 1H9IE 4KTSA 3F9EA 3L3TA 3AASA 1SFIA 2CV3A 2B7DH 1TBRH 3KF2A 2BOKA 1F0TA 1HAVA 1PYTD 2ODYB 1CQQA 2BM2A 3QDZB 3F68H 1IQFA 2GZ7A 2H5DA 1DXPA 1NZQH 1UK2A 4A7IB 4SGBE 3S9BA 4IMZA 1O3OA 2IJOB 4AZ2B 1K1PA 1S84A 1HUTH 1PQAA 2BY8X 2ZHWH 2RDLA 1O36A 2RA0A 4ZMAH 1SGFG 3RP2A 2A5KA 1HAHH 3UQVA 2FP7B 1UTPA 2QAAA 1Y5UT 4AFUA 1O2ZA 1ABIH 3RC4A 1A5HA 1QBNA 1MU6B 2VJ1A 1O2LA 2CHAC 3LGYA 1RIWC 3DA9B 1O39A 3OTJE 5DP7A 1FIWA 3U1IB 1YPLH 3M5MA 2FOBA 2ODPA 3PYHA 1SGFA 1V2OT 1KXCA 1T31A 4A1TA 3SU5A 1G3EA 4YOIA 1MD7A 4MLFB 1G2MA 3PMJA 2OUAA 3SO3A 3A86A 3OU0A 3UNQA 2HNTC 2ZGXH 5L6NH 1FNIA 4ABIA 4BNRA 2A4GA 2IOTA 4MNWA 3Q3KA 4A92A 9LPRA 3EGKH 4JMYA 1XVOA 3E1XB 3NXPA 1ZTJA 1V2JT 2G4TA 1XVMA 3M37A 1T8OA 4DW2U 2GV7A 5JPMH 1MTWA 1YPMH 5TJXA 3SJ8A 1C2EA 3ZZ9A 4BANB 2H6MA 1GJDB 1KSNA 2D26C 1V2VT 2OQ5A 5HM9A 2QIQA 1P10A 1N8OB 2UUJB 1IQKA 2QGRA 2WPIS 2OBQA 2Z9KA 3GOVB 4FUEA 1BB0B 1EKBB 2VVUA 2W7SA 3ZZ5A 1C5YB 3E0PB 1HAPH 1C2DA 2G4UA 5GCHF 4NIYA 5BPEA 5EPNA 2VGCB 3TH4H 1SI5H 3O8DA 1EOLA 1JIRA 1C1UH 2QXHA 1C2MA 1VJAU 2Z9JA 1O3KA 4FU8A 3ZVEA 3QTOH 1GI4A 3ZZAA 1F5LA 1FY1A 1XUFA 2FZZA 4J1YA 1O2GH 1E36B 1KXEA 4BAHB 1O35A 2YNAA 4FU9A 2ALPA 2BD3A 2GCHF 1C1QA 4X8UH 3STIA 4NGAH 1SPJA 3VGCC 2ZDAH 1GBBA 3RXTA 4FUCA 4F49A 3TK5A 1CSOE 1CGJE 1O3IA 4AB9A 1YPEH 1TFXA 3PO1B 2F9PA 1O30A 1A7SA 3T62A 1UTQA 2HWLB 1ANBA 4BAOB 3B9FH 1C5MD 2QN5T 1M9UA 3KQDA 4NA8A 1YLCA 3GCHB 5JB8S 1A5IA 4H6TA 1ZRBA 3MHWU 2QV1A 3O8CA 2BQ6B 4OGXA 1ELAA 3E0NB 3KQEA 4MG3A 2A4RA 3EA8A 2Y5FA 1K1MA 1ESAA 3A8CA 2PHBA 1QJ7B 1OKXA 1VR1H 1CBWB 1B0FA 3LH3A 1MKWK 2R3UA 5DP8A 1Z8GA 1Y3VA 1TOMH 2XBXA 1DS2E 1C1OA 1E35B 2ZQ1A 3DFJA 2G5VA 3UFAA 1GHAF 1HAVB 2WV5A 1H8IH 1B5GH 1S82A 4I8HA 2G8TA 1AWHB 1UTMA 1TX6A 3ZZ4A 2A32A 4B71A 1CGHA 2I6SA 3EQ0H 1C5ZB 1BMLA 4ISHH 4O97A 2ZGHA 2CMYA 1HJAC 3A85A 1DE7H 1KDQA 1MBMA 3TJVA 1WAYB 5E0GA 1SLVB 4F4OC 4X6OA 1IQMA 2BQ7B 3ZVFA 1AE5A 4MNVA 4FUDA 1TNJA 2C8YB 1GI6A 3QK1A 1P03A 3GY6A 1AE8H 1TMUH 1WCZA 2C93B 1C5NH 4D7GA 5C5NA 3BEUA 4IN2A 4Y8XA 3Q77A 5F8ZA 5G4BA 1XX9A 1GJ4H 1LVOA 8GCHF 1OP0A 2JH0D 1OP2A 1CHOG 4BXWA 2ZI2H 2ZQ2A 4NIVA 2ZIQH 1O2IA 2CHAB 1KXAA 1W0ZU 2PTNA 2UUFB 1P2NA 4X6PA 1ZYOA 3GY5A 1EJMA 3SNEA 1C5PA 4TPIZ 1HFDA 2ILNA 3N7OA 4B2BA 3RMLH 2AYWA 3S9CA 4J2YB 1P12E 1QRXA 1V2WT 5FBIA 1DWCH 3M3SA 1D3PB 1BRCE 1TE0A 2GD4B 3RXGA 1P3EA 2THFB 2FOHA 1ID5H 1WV7H 1LPKB 5EQRA 1PPGE 1K1JA 4WXVA 1J9CH 1BTYA 2HRVA 1GHBF 1KTTB 1EAIA 3GCNA 1P2IA 2IPHA 3STJA 1GJBB 1NRNH 2FIRH 1GI5A 1TIOA 4GCHG 2QXJA 2SNVA 3BEIB 2VWNA 4X8TH 1YCPK 5DJ7A 2J92A 1AFEH 2XWBI 1ZHMA 2BX3A 1DWDH 1LHEH 1BTXA 1DLEA 2J38A 1FZZA 4NSVA 1TNLA 3SNBA 4GAWA 1DY8A 1NO9H 1AD8H 3DHKH 1O3FA 1FJSA 4R8TB 4NZLA 2VIQA 5DP3A 1EX3A 1C1MA 1V2PT 2SGEE 1P05A 1BMNH 1SOZA 2FTMA 1IQJA 1BBRE 4E7NA 2FOEA 2SGQE 5C2ZA 2OC0A 1ZTLA 1E37B 2Y7ZA 1JBUH 1ZGVA 3KHVA 2P94A 3RUOA 3Q3XA 2ZFTA 1HAIH 5F6MA 1MKXH 3DUXH 4K8YA 4TWWA 4Y7AA 3P8NA 2A0QB 3M5LA 1FMGA 4GHTA 1QJ1B 1GBFA 4YLUA 2BOHB 2H1UA 2BDYA 1CU1A 4UEHH 1GBLA 2XBYA 1GG6C 1O5EH 1CHGA 1O3DA 2FLRH 3VGCB 3AAVA 1ZPZA 3M3TA 4U32A 4ABGA 1T8LA 1P8VC 3PLKA 2BD5A 1L2EA 4AN7A 4H42U 2VWMA 2VH0A 1WYKA 1KIGH 2ZFPH 3ZVAA 1E34B 4B2AA 2CF9H 2ZF0H 1DFPA 2A7JA 3TPIZ 4AFSA 4CR9A 3TGJE 3KGPA 4B1TA 1UTOA 3A89A 3BTFE 3DFLA 1TX8A 4AGKA 4AOQA 1A0LA 3BIUH 3BTME 2PKAA 3SUDA 1BZXE 1T7CA 3D23A 1K1IA 3BSQA 1BQYA 3F9GA 1C5OH 3PROA 4K3JA 3LH1A 4KTUA 5EW2H 1TA6A 1XM1A 3VXFH 1PPZA 2ZFQH 1LTOA 1UVUH 2ZHQH 4DOQA 4MTBA 1KDQB 5HMAA 2P93A 3D65E 2ZEBA 3L33A 1W13U 3LONA 2CF8H 5DP6A 3MWIU 2PSXA 5E8EH 2P95A 1Q31A 5TCCA 1TBQH 1S83A 1JXPA 5C1YA 1SLWB 3BV9B 3MO3A 1GBHA 3A7WA 1Z8IB 1GDNA 1O5AB 4FVDA 4YT6H 1HXFH 1EASA 2PGQB 1O2PA 3CS7A 1HJAB 1GPZA 2AH4X 1GMHF 1TNKA 3M5OA 1O5CB 3RC5A 1L1GA 1O2QA 3P8OA 4ZKRU 2XCFA 1FUJA 1TMTH 4WMFA 1GJ8B 3P8FA 1INCA 1LHDH 2AFQB 2W26A 1P2KA 1O37A 5JBAS 5HXFA 3C1KA 1GBMA 2ODQA 1GJ5H 5ESBA 3UIRA 3ZZ8A 3BF6H 3V12A 5LH8A 4KKDA 1GI8B 2UUKB 1FLEE 2PW8H 4JK5A 3RXDA 1QQ4A 1AVWA 4NA9H 1CGIE 3IWMA 4FUGA 2Y7XA 4Y7BA 4BTUB 2FI5E 1UK4A 1XUHA 1HAYB 4WXIA 4D9RA 2HPPH 1NM6A 3D62A 2ZGJA 4CBNA 3M7UA 1AY6H 1C2FA 4D7FA 4MDSA 2RG3A 2BDCA 4AORA 4RSPA 3A84A 1QNJA 1W2KH 3QO6A 1LVYA 2P16A 4I8KA 1D3DB 3GY7A 1SMFE 5CHAC 1XUJA 3MU4A 2GDEH 3BN9A 2WYJA 2C8ZB 2H9EH 1O3HA 2K1QA 1Z71A 1A2CH 1F5KU 1HGTH 1V2TT 2KAIA 1BIOA 1SHYA 2G51A 4I8GA 2FM2A 2GX4A 5C1XA 1O2UA 1NC6A 2WPLS 2NU0E 5AHGH 1CA8B 1GHYH 3EA9A 7LPRA 1C5XB 1ZMNA 2ANYA 3RXMA 2W3IA 2BD7A 1THPB 3TVJB 1W12U 2Z9LA 5DKMA 1PPHE 1QA7A 1QY6A 4Z0KA 1T8NA 3ZVDA 1RJXB 1QB9A 1Y3WA 3LOXA 1GJ6A 1A3BH 1ELTA 4UONA 1LQDB 1DT2A 1TQ0B 4GPGA 5PTPA 1VITF 1OPHB 1HAOH 4X1QU 1TNGA 5E0JA 3SGQE 4CRDA 4D8NA 1DANH 1UCYE 4AFZA 5JBTA 3SV2H 2O8WA 2ESTE 4UD9H 1NFXA 2EC9H 1EJNA 3TJOA 4Y76A 1C5QA 8ESTE 1EB2A 3MO9A 2XW9A 1CE5A 1KXBA 1HJ8A 1TOCB 5FX6A