2DE9A

Crystal structure of porcine pancreatic elastase complexed with tris after soaking a tris-free solution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase-1
publication title Tris(hydroxymethyl)aminomethane induces conformational change and crystal-packing contraction of porcine pancreatic elastase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2de9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2de9A01
4F49A 1C2HA 1IQMA 3BIUH 2FODA 1HAHH 2FTLE 1VCQA 1ZLRA 1GBAA 3FP6E 3RXJA 4IC5A 5EOKA 2TIOA 2FLRH 3G01A 2TGPZ 3RXVA 3SU0A 1W0ZU 5JB8S 1TBZH 3ZZAA 1O2JA 1OPHB 4IBLH 8KME2 1SFIA 1A3BH 1C5TA 2WUCA 3RM0H 5JPMH 3BN9A 1G3CA 2A5IA 3Q76A 1ZOMA 5JDUB 2FWWA 2OUAA 1SB1H 4H6TA 5E2OA 1SGFG 4MNYA 1AB9C 1H1BA 3PO1C 4RSPA 1P03A 1J14A 1MAXA 1O5GH 4UONA 4AFUA 1IQLA 1ELBA 1NRRH 1NT1A 2ZDLA 3N7OA 1SLXB 3BG8A 3AVZA 1D6RA 1Y5BT 3DD2H 2UUFB 2VIWA 2Y81A 1EJAA 2JH0D 2XBVA 3SU5A 3SU2A 3SUGA 4JZFH 3DFLA 5TJXA 1Q2WA 3ITIA 1GMHF 2R2WU 1GL1A 3TH2H 2BQWB 5EPYA 3STJA 2Z9IA 1NY22 4Z0KA 2EA3A 1ZHRA 1AQ7A 2BY7X 1KXBA 1NRSH 2F83A 3LC5A 3P17H 4MG3A 1FIZA 1GBTA 4UFEH 5C2ZA 3NPSA 1BTHH 2A7CA 2QYIA 2FXRA 1GWAA 3LGYA 2A4OA 1RFNA 2PGQB 1UVTH 2QY0B 1KXCA 1BRBE 1T8NA 2CXVA 2VWLA 2QN5T 1NRPH 1G3EA 2BD8A 1CHGA 2GDEH 2A5KA 3FP7E 4CH2B 2BQ7B 1PQ5A 1UK3A 4GUXA 2Y5HA 2FIRH 2ZDVH 4AFSA 3VEQB 2YNBA 4Y11E 4ABGA 1C4Y2 1AKSA 1AHTH 1GJ5H 3GCOA 1TX8A 1W13U 2G51A 1C5OH 3D65E 2V3HH 8LPRA 4HI3A 2AIPA 1YPMH 2J92A 2YNAA 3LH1A 1OXGA 2HVXA 2RG3A 4JK6A 5A8XA 1W11U 2BQ6B 1EAWA 4INHA 3M7TA 5IYTA 1UK4A 3SI3H 1O3EA 2HRVA 4NSVA 1BRAA 5DP6A 1IQKA 3MI4A 3RXMA 3A7XA 9LPRA 1HBTH 1XUJA 3AAUA 2FOGA 5CMXH 4KTSA 1FZZA 1GJ4H 2B8OH 1K1LA 3JZ1B 2G81E 1L0ZA 5HM2A 1BIOA 1HAOH 1OWEA 4NWKA 1U6QA 5DP9A 1JMOH 3ZZCA 2PKSC 3BTEE 1O35A 3RXCA 3ZVCA 3SNAA 2Z3CA 1HRTH 4FVBA 1ANBA 1SGPE 4WY3A 4UD9H 4ABAA 1ZPBA 4KKDA 5GPIB 4JMYA 2EI8A 3HK3B 2SGAA 3M36A 1A0HB 4NGAH 1JRTA 1QY6A 1BZXE 4ABFA 3EE0B 3DA9B 1NN6A 2SFAA 4A1XA 5LPEA 2JKHA 4K5ZA 2G4UA 1GI1A 2OTVA 1C1VH 4TPIZ 5EW2H 7GCHF 2A4RA 3A7TA 3U8RH 3LDXH 1O2YA 3FFGA 2W5EA 4R0IA 1IHTH 2HPPH 5JBAS 1P2IA 4IW4E 2OC1A 2FOFA 2VIDA 2VGCB 4HZHA 2H1UA 3ZYDA 1TE0A 5FXLA 2Q6GA 2H9EH 4XDEA 3M7QA 5TCCA 1NRQH 1GBJA 1GMHG 3SOSA 4ABHA 2ODYB 1ESBA 4D9QA 1CT4E 2TGDA 1AZ8A 1IQJA 2A0QB 3E1XB 4AYVB 1SL3A 3ZZ7A 1YPJH 1KY9A 4I8KA 1W2KH 4DURA 4I33A 1V2OT 3UQOA 1AUTC 3RXSA 1QA0A 4X2VA 5SGAE 4THNH 1JXPA 5FPSA 5F8ZA 1G3DA 5BRRE 4NFFA 3SO3A 4MPXA 4DJZB 1N6XA 3V0XA 3KQCA 3OU0A 3URDA 1P02A 1C2DA 4B74A 5FHTA 1DLEA 1O2RA 1V2WT 2AMDA 1WCZA 1J8AA 2C93B 3OSYA 3E90B 1BTPA 4AGKA 3HKJB 1Y5AT 2SGFE 3EDXB 4ABIA 2XCFA 3F1SB 2BY8X 1O3GA 1EXFA 1L1GA 1V2UT 2R0LA 2IN2A 1SLWB 2BDAA 2F9VA 1YC0A 2J2UA 3BTQE 3NCLA 1JIRA 1O34A 1GI5A 1TA6A 1S0QA 4WMFA 1C1TA 2BY6X 1INCA 3KQBA 5F8XA 1YP9A 4LZ1H 3BEFB 3VB5A 3TH4H 4NA8A 3T26A 1VZQH 2FYQA 1TMTH 3E0NB 3URCA 1GGDB 1FY8E 4NFEA 3SGQE 2FOBA 4F4OC 3SN8A 3V7TA 3BTGE 1N1LA 1DFPA 1OP8A 4CRDA 4AOQA 2A7JA 1G36A 1CSOE 5AF9H 1HB0B 1FIWA 1HAVA 1O3FA 1YYY1 2F9OA 1FQ3A 1T32A 1ESAA 2GCTC 2Z6BD 1F5RA 4ISHH 4MPVA 5L30H 1PPBH 1TBRH 3SJIA 3RU4E 4U30A 2P3TB 2H5CA 5F8TA 1ELGA 2GX4A 2Q6FA 1XKAC 3A82A 4MLFB 2GV6A 3C1KA 3P8FA 4YOJA 4DIIH 4AGJA 3AASA 5C5OA 3MHWU 3K65B 5EODA 3SU4A 3MO6A 2VWMA 3HGNA 2PHBA 1SOZA 1UTNA 1WTGH 4X8TH 1AMHA 3A8CA 1P2QA 2W7UA 2W26A 2BX4A 1A5HA 5FX5A 1UTOA 4FUGA 1LKAA 3A89A 7GCHG 3GY3A 4X6OA 3KL6A 4E7NA 4MTBA 1QBVH 4WF8A 2BDHA 3M35A 3R0FA 5E0GA 4CRCA 2RCEA 1EP6A 5EU8A 1TB6H 2QV1A 1PQ8A 4JYTA 1YPHC 2F9NA 1V3XA 2I6QA 2FTMA 2K1QA 4OS5A 2ZG0H 2UUJB 1CGIE 4ZKRU 2RDLA 2CHAB 4KTUA 1TYNA 3JZ2B 2BLWA 3BV9B 4Q2KA 1GHAG 3MO3A 3A88A 1LTOA 1S84A 1ZMNA 1W10U 1GBMA 3QN7A 2ZA5A 1SR5C 5FBIA 1E36B 1T8OA 1C2MA 3PLKA 1O2QA 4X6MA 5AFZH 3QK1A 4VGCB 3ZZ5A 2GGVB 1ZHMA 4YZUA 3RLWH 1GI6A 4ZHLU 4X8UH 1FXYA 4IMZA 1A5GH 4TWYA 1LPGB 1O2GH 1V2KT 1C5WB 1SPJA 1BA8B 3SQHE 2ZQ2A 5T3HA 4OS4A 1PPFE 2WINI 1HIAA 4B2BA 3TGKE 3LGIA 3W95A 1O32A 4OS6A 3A8DA 1UVSH 2VGCC 2HALA 3BTTE 4YT6H 1TFXA 1AU8A 2FEQH 2R3UA 1GJBB 2G5VA 2ZHQH 2ULLA 2AGIX 1QRWA 1TGNA 1WV7H 2P16A 1MTNB 5G4BA 3VXFH 3ZYEA 5T6DA 4X8VH 3ESTA 4IGDA 5J4QA 1AVGH 1QR3E 5FAHA 2BDCA 2Y6TA 2ZU5A 2SGEE 4E7RG 1Y3YA 2JH5D 1GMDF 1O38A 2QA9E 2G55A 2QAAA 1J15A 4R8TB 1DSUA 2ZGCA 1GI9B 1GHBF 3M7UA 3EGKH 4MNXA 1IQNA 4FXGH 3PMHB 6CHAB 2O9QA 4JK5A 1Q3XA 2VIQA 4AORA 2BDGA 5GJ4B 2XC5A 3BTFE 2GV7A 2VINA 3ATWA 3ZZ3A 1QL7A 3SU3A 3OY6U 1SVPA 1FUJA 4I8JA 4ISIH 1AD8H 1EB2A 3T25A 3ODDA 1HV7A 2F91A 1VITF 3K6ZA 3P95A 1TWXB 3MNBA 1HAPH 3BG4B 3TGJE 3ZZ6A 2Q1JA 1CA0B 5HYOA 1P2OA 3VB6A 3UNSA 1WOFA 2QCYA 4RKOB 4QT8C 3H5CB 3ZZ4A 2BLQA 1GGDC 2IJOB 4YM9A 2XBXA 2EI7A 2GT7A 3VB7A 1EATA 2BD4A 1C2IA 4CRAA 1EJNA 2PW8H 3QGJA 4J2YB 3RM2H 1QURH 3MFJA 2Z9GA 1HYLA 4MNVA 2WPIS 1HAXB 2H6MA 1XVOA 3MMGA 2A32A 1MD8A 1Q31A 3U8OH 4WMEA 2BXUH 1QFKH 2OD3B 3GCTF 1WUNH 2CN0H 3Q00A 4KGAA 5GXPA 1YPGH 1ZSJA 3GCHB 5CE1A 1RTFB 1ELAA 3AAVA 3M5NA 1SLUB 1J17T 3MYWA 2CF9H 3NZIA 1TNKA 1W8BH 2DE8A 4H42U 2C3SA 2R2MB 3ZZ8A 4ZKSU 3SUDA 3TIUA 2ZZUH 5C1UA 4U2WA 3GYLB 1EAUA 2OC7A 1ANCA 1F0TA 3M3VA 2BVSH 1FN6A 1BB0B 1OX1A 2CHAC 3B23B 3BEIB 2A5AA 3SBKA 1TNJA 3QWCH 1H9LB 1Z7KA 3EAJA 3RXAA 2VH6A 1BUIA 3A87A 3RXBA 1LPZB 1QNJA 1RJXB 5I25A 1LVYA 1BJVA 4FUBA 1TBQH 3RXOA 3SV2H 3SQEE 1DVAH 1LHEH 2BMGB 1GBFA 2ZF0H 1AKSB 1LMWB 1O3CA 4I8HA 3RXIA 1FNIA 2JETB 4AFZA 1CBWB 2D26C 2FPZA 4I31A 1GHBG 4VGCC 1C5VA 2ZFTA 1CGHA 1GMCF 2BD7A 1WAYB 1QBOA 3CS7A 2PGBB 3O8RA 2BY9X 1S81A 1GI2A 1L2EA 2GZ9A 4FU9A 2NWNA 3F68H 4H4FA 1GBHA 1V2LT 5FPYA 1GCDA 3BTDE 3GDSA 3PV4A 1MU6B 1LKBA 3A7WA 1SHYA 2SNVA 3ZVBA 2J9NA 3A8BA 4H6SB 5FX6A 1TPAE 1BTXA 3RMNH 1YCPK 1CT0E 2ANWA 2ZHDA 4MNWA 1BTZA 4CHAB 1QL8A 5DK1A 1MTNC 1GPZA 1UK2A 4X0WU 1TLDA 1GJ6A 2GD4B 5DP5A 5LGOA 1DICA 1GDQA 3RDZA 1PPHE 2P8OB 4ZHMU 2F9PA 3S7HB 2RA0A 1CE5A 2H5DA 1NESE 2XC4A 3ZVFA 7KMEH 2YOLA 1AZZA 4LZ4B 1BBRE 3GDUA 1G2LA 5EXNA 5FBEA 1LHCH 3GISB 3F9FA 4ZHAA 4WXVA 3VB4A 2WPKS 1JIMA 1O2NA 4AB8A 2XWBI 4A1TA 4WJG2 6CHAC 3LJJA 3SJOA 4MPWA 5EQQA 3Q3XA 3MNCA 4YLUA 3M5MA 3UWJH 2OQUA 1OOKB 5PTPA 1LHFH 1V2NT 3GCTG 2PWXA 5C3NA 1T8LA 1TONA 1C5SA 1Y3WA 2BD9A 4JZEH 5DPAA 1AVXA 1ZGVA 4I32A 2WYJA 2HNTC 1MBMA 2OC8A 3UWIA 4GHQA 3SJKA 4Y0ZE 1S6HA 3BG4C 3GDVA 4O03A 1CA0C 4U32A 3DHKH 1CT2E 1XXDA 3TGIE 1DITH 4FUHA 2ODPA 3FZDA 2A4QA 2QF3A 1C5MD 3PTBA 5JBBS 6LPRA 1D3DB 2Z7FE 5EW1H 4GPGA 1GI0A 3RXKA 1ELVA 1WSSH 1AGJA 2ZCHP 1XUKA 4Q80A 1O3NA 1GI3A 4D7FA 4TPYA 1A0LA 3LONA 3PROA 1QRZA 1HCGA 1TRYA 1SGQE 2ZU3A 3P8OA 1L1JA 1QA7A 2CF8H 1DPOA 4YT7H 2ZQ1A 5AVDA 3P8NA 4BAQB 1D3PB 1T4VH 2XCNA 1E35B 2V35A 1GMCG 1P3CA 1ELEE 1ZTKA 4XBDA 2ANKH 1O3KA 3ATKA 2FOCA 1SMFE 2Y5GA 4NIYA 1S6FA 5A8YA 3GCHC 4ISLA 2PV9B 1NFWA 2WV5A 1ETRH 4UFGH 1G37A 1O36A 1BMMH 1SBWA 3A81A 1ID5H 2R0KA 2FDAA 1DWBH 4X2YA 2SGDE 1T31A 4OS1A 1GHWH 4ZKOU 4BTTB 1RIWC 2ZTZA 4TY7A 1D3QB 3UPEA 4Z6AH 1Y3UA 2NU1E 1H8DH 3T2NA 3LT3A 3IITA 1O2PA 2D2DA 1TQ0B 2PR3A 1HAVB 1OWDA 1EAIA 4X1SU 4FUIA 2R9PA 3LGVA 3FP8E 1OYQA 1CU1A 4TY6A 4UDWH 4KTCA 2W7SA 1P05A 3GY2A 2BLVA 1ZRKA 3KCGH 2G52A 4CH8B 4INLA 1O2XA 3S9BA 5A0CA 2G5NA 3SJ9A 1S0RA 2JETC 1F0RA 1NROH 2SNWA 5A8ZA 1CBWC 3TH3H 1FY3A 2ODQA 4X2XA 2AYWA 1ZPCA 3F6UH 1E37B 1YPLH 1G9IE 5JBCS 1ZSLA 1FV9A 2PLXA 7ESTE 2ZDKA 1FY5A 4PROA 4DGJA 1P01A 1IQIA 3KIDU 1X7AC 2O8TA 1BBRK 2JH6D 3FZZA 3QUMP 1TGSZ 1HDTH 1O2UA 1O2TA 3O8BA 1XXFA 1GCTB 1O5EH 2ANMH 5DP7A 3ZVDA 1TNIA 4TYDA 3SV7A 4CHAC 3PWCA 1OP2A 4A92A 1G3BA 1A5IA 3LPRA 1BOQA 1O5AB 4JYUH 1O3DA 5FCKA 3MH5A 2A45B 3QZQA 1OSSA 3SGBE 1FI8A 1BRUP 3A85A 2P8OC 4I8GA 1ZYOA 1RRKA 1KDQA 2RA3A 4AX9H 1J9CH 1Y59T 4JZIA 4BAMB 2BX3A 1T8MA 4FUFA 4FUCA 1Z6EA 1UCYH 1C9TA 1ZSKA 3ZZDA 1ETSH 2OQ5A 4A7IB 1RS0A 4YESB 2BOHB 3HKIB 4DIHH 1FONA 1OS8A 3NKKA 1UTLM 2BDYA 1HIAB 4Y76A 2ZFSA 5C67A 1DS2E 4B2CA 1ELFA 3BTHE 1EPTA 1MTWA 2VNTA 4ESTE 1W12U 1SQOA 2C4FH 4ISOA 5J4SA 1SOTA 3RMLH 1A7SA 5ESBA 4Q7YA 1TAWA 2VWOA 1O3AA 1MQ6A 1O3HA 1UTMA 1YCPH 1YKTA 3M61U 1LQDB 2ZP0H 1EZQA 3FVFB 4O9VA 1SGRE 1WTHD 1TNLA 1V2MT 2BTCE 1LDTT 1P0SH 1C2KA 1HNEE 1YPEH 2FMJA 1GBIA 3K9XB 1BTWA 5HMAA 2OC0A 1QB9A 3MWIU 2ZU1A 4O97A 4A5TS 2AH4X 2B0FA 2A4GA 1O2HA 1FN8A 1DX5M 1LHDH 1FAKH 1O2LA 4ABJA 3QDZB 3ZVAA 1GG6B 3A7ZA 1DUAA 1EUFA 2PSXA 1SC8U 1YGCH 4NIXA 3UREA 3RXEA 3EQ0H 5C1XA 2BDBA 1DUEA 4LXBH 4CR5A 2AERH 5EG4A 4Y6DA 3RXLA 3K2UA 1FJSA 3NWUA 2EC9H 4X6NA 5EQRA 3RU4D 2ZGBH 1QB6A 1PPEE 2V3OH 1MCVA 3HPTB 2ZFPH 3ZZ9A 1SI5H 2O8LA 1EKBB 3U8TH 4DW2U 5JBTA 4NIVA 1SG8B 2B5TB 1V2ST 3H7OA 1C4V2 2HOBA 2QXIA 3UNRA 4BAHB 4ZXYH 4ZMAH 1D4PB 3E6PH 4OS2A 1N8OB 4BAOB 1ESTA 5EXLA 2XNIA 1C2GA 3MU4A 1O3IA 4I8LA 4AB9A 4NIWA 1GBLA 1THRH 2ZCLP 5A0BA 4Y8ZA 1XUHA 2PFEA 3E91A 3M5OA 1O2WA 1O5FH 1C1SA 1XM1A 1GDUA 1QRXA 4NZQA 1RXPA 1UO6A 6ESTA 2J4IA 3LGUA 1SQTA 3RMOH 1GJ7B 2VIOA 1ANDA 1G32B 3EA9A 1NC6A 2UWPA 1CO7E 1GBKA 1P9UA 1UJ1A 3O8DA 3UOPA 4Y7AA 1O2VA 4D76A 3O8CA 1DANH 5F03A 5JYIA 1SGTA 1HJ9A 5CHAB 1AIXH 1V2PT 2ZGXH 2AMPA 1OWIA 3BTKE 1TIOA 1VGCB 1KTTB 4NSYA 3UTUH 1A46H 1GCTC 1DY9A 1MKXK 1O31A 2P3FH 1ARBA 2WV4A 2ZO3H 1GJCB 3GY7A 2VIVA 4B73A 1KXDA 1CA8B 3LGWA 1AFEH 2FOHA 1TRMA 2BLOA 3Q77A 2A2XH 1ZJDA 2GKVE 1F0SA 1L4ZA 2FOEA 1K1OA 4K60A 1PQ7A 1HFDA 3FAOA 1A61H 1P2JA 1FLEE 1DM4B 1QHRB 1UTKA 1G2MA 1S83A 1HJ8A 1GVZA 3QLPH 3RLYH 2HNTE 1ACBE 2C8YB 2Y7ZA 1MAYA 8ESTE 3BTME 2OLGA 2C90B 4DT7B 1CGJE 1DWEH 1ELDE 2BHGA 5GWZA 3PTNA 3UFAA 5A0AE 1OWKA 4K1EA 3SW2B 1VJAU 1C2FA 3SV6A 5DO4H 1DY8A 4Q7ZA 3GY5A 1BBRH 1GVLA 4K2YA 2QXJA 1FAXA 4ABDA 1HPGA 3L3TA 3RXHA 4J1YA 1C5YB 2TRMA 1MQ5A 1JRSA 4UEHH 3T28A 5GIBA 3C27B 2CV3A 3EYDA 1NFYA 2FI5E 4CRBA 1TA2A 1P57B 3DFJA 1H9IE 3HATH 3KN2A 4GLYA 2A31A 3A83A 3PWBA 1P2NA 3CP7A 1YM0A 1MD7A 2AS9A 4INKA 2QC2A 2TGTA 4MQAA 3D49H 3NK8A 4OS7A 1DSTA 1P06A 2V6NA 3EA8A 2NU2E 1ARCA 1P04A 2W3IA 1GBBA 1GG6C 1IOEA 5TCAA 1ZGIA 4YTAA 1TMUH 2A7HA 2NU0E 4NA9H 3T5FH 1SLVB 1C1OA 1UVUH 2PTCE 1TPOA 2D8WA 3M37A 4X1QU 3Q3YA 3LC3A 3E8LA 3SV9A 2NU3E 3PMBB 4D8NA 1LPKB 4Y10E 1B0EA 3RXGA 1HXFH 1AWFH 1YPKH 2B7DH 2F9UA 2FESH 2FI4E 1N6YA 2ASUB 3MNXA 2Z9JA 3PMJA 5T6FA 1EASA 1HLTH 1THPB 3P6ZB 5EPNA 2PKAA 5ETXA 3SHCH 1S85A 1TOMH 2A1DB 5I46H 1F2SE 3P92A 1ZJKA 5GCHF 1BRCE 2VB0A 2FOMB 4AFQA 1DT2A 4JZDH 1O2SA 3D62A 1TMBH 2ZGHA 1QGFA 5HM9A 1MZAA 1LO6A 3SNBA 4DVAU 1BCUH 4X1NU 4GAWA 1FPCH 1QTFA 3RP2A 4ZAEA 1K1NA 2P59A 1GMDG 2VJ1A 4WWYA 5FPTA 4BOHA 4BTUB 1PJPA 4IC6A 3TJVA 3S0NA 4WH6A 4AZ2B 1P2MA 2BZAA 2J94A 4NG9H 1TALA 3TK6A 1C5RA 1C1PA 2KAIA 4HTCH 1S82A 1W7GH 1ZTLA 2HWLB 3OYPA 3TLOA 3TVJB 2DUCA 5EXMA 3KNXA 2BVRH 4GSOA 1OP0A 1MBQA 3WY8A 5L6NH 4ISNA 4K1SA 1ABIH 2GDDA 4KP0A 1WBGB 1NPMA 3A84A 1SSXA 3GCNA 4BAKB 1H4WA 3PB1E 4Y8XA 4AYYB 2GT8A 5ESTE 1VITG 2ZFRH 3MH4A 2VIPA 4JYVH 2FO9A 3OTJE 4ZUHA 1K1MA 2AGEX 3ATIA 5K7RA 2ILNA 5LPFA 1G30B 1VGCC 1OKXA 5B6OA 2OP9A 4MDSA 1ETTH 1HGTH 1IQHA 4E06H 2F3CE 3E16B 3CENA 1XMNB 2BDIA 3ZZBA 1AVWA 2IOTA 5EGMA 2ZPSA 3UNQA 5AHGH 4XFQA 1J16A 4X8SH 3SU6A 1KLTA 4FU8A 1K28D 1B5GH 4FVDA 1LHGH 3U9AH 4AN7A 2QIQA 4ASHA 1SFQB 4IN1A 5DP8A 1P10A 1O33A 2BD3A 1ORFA 1L1NA 1VITH 1W14U 4DOQA 1BT7A 1A0JA 3ZV9A 5T6GA 2C8ZB 3ZVGA 2ZTXA 4JCNA 3UOUA 1C1MA 1VJ9U 3LGTA 1MUEB 1NFUA 2R3YA 2ZIQH 3ODFA 1JWTA 1KLIH 5F6MA 5BPEA 3RXPA 4U01A 4B2AA 1LVOA 3QX5H 3TNSA 1ANEA 4HGCA 1JOUB 4NWLA 1SGNE 4B76A 2AIQA 5K0HA 2CGAA 2B9LA 5GDSH 3LIWA 1SHHB 4FUDA 2ZKSA 4NCYA 3SHAH 2ZDAH 1MKXH 1BQYA 3ATLA 3LJOA 5GCHG 2VH0A 2HGTH 4FUJA 1GHXH 2HNTF 2W3KA 2AMQA 4WH8A 1W0YH 2G8TA 1DXPA 4MPUA 1GDNA 1W7XH 4ZXXH 1Z8RA 1ZRBA 1K22H 1KDQB 4CBOA 1AWHB 1F7ZA 3E3TA 4LK4A 1TPSA 2GCTB 3QTVH 2OXSA 1HXEH 1YPHE 5DKMA 3V3MA 4BXSA 4Y8YA 3GY4A 3KQEA 2C8XB 4XBBA 3QGNB 2P94A 3SUEA 3A8AA 5E2PA 1EZSC 1EZXC 3TK5A 1C5NH 1IQGA 1O3BA 3BTWE 2XXLA 2BZ6H 1Z6JH 1GI8B 1LVBA 3LH3A 1T4UH 1C1UH 3RXRA 3KHVA 1E0FD 4X1RU 1EPTB 4DG4A 1GJAB 3OY5U 3TJUA 3FANA 4SGAE 4AG1A 5LPRA 1Y5UT 1ZMJA 4GCHF 1TX6A 1ZTJA 2Y5FA 3SGAE 1VCPA 1C5QA 1PPGE 1QCPA 2Q6DA 1O3JA 1DXWA 4FUEA 1BHXF 2LNCA 1P2KA 2PTNA 3M5LA 1H9HE 1P8VC 3SV8A 3S9CA 4DCDA 2UUKB 2ZPQA 4YO9A 1O37A 2QF0A 2BD5A 2XBYA 1AY6H 2FLBH 3GYMA 5C1YA 3VXEH 1MCTA 3RXFA 1V2QT 3PLPA 2XRCA 1HJAB 1SGDE 4TWWA 2BB4A 2VVCA 1TGCA 1P9SA 2VWNA 2FP7B 1K1IA 2NU4E 1B7XB 2HLCA 3P70B 4Y0YE 1RTKA 2ZU2A 1O2ZA 3TK9A 1EX3A 1Z8GA 4ZKNU 1SGYE 4Y71A 3VB3A 2BD2A 1PQAA 1C2LA 1SGIB 3PLBA 4X2WA 1Z8JB 4CRGA 4BTIB 1YBWA 2C8WB 3I77A 4K69A 2ZDNA 1GBEA 2XYAA 2TGAA 3T29A 1Z1JA 1EQ9A 3MO9A 3EA7A 2J38A 3MU1A 1EJMA 2VU8E 3A7VA 1PPZA 3U1IB 1D6WA 1GL0E 1QJ6B 3VGCB 1IAUA 2ZI2H 3D23A 1QJ1B 1BMNH 2ZTYA 3BEUA 3PYHA 4X1PU 1CVWH 1QQ4A 2XWAA 1CHOF 1V6DA 1AFQB 1O3LA 3RXDA 5FCRA 3SNDA 1GHVH 1TNGA 1W3CA 5HGGA 3RXTA 2UUYA 1GHAF 1ZR0A 4K1TA 1IHSH 2ZDMA 2LPRA 1C4U2 1QB1A 3BIVH 2ZEBA 3L33A 1Z1IA 1UMAH 3R3GB 5DP4A 4M7GA 3KQDA 3W94A 4CBNA 1XVMA 8GCHF 1V2JT 2TBSA 1PFXC 1ZMLA 1NM6A 1AE5A 1YLDA 1PYTD 1O3PB 2G4TA 1O5CB 4XSKU 4K8YA 1AE8H 1O39A 1K1PA 2UWLA 5A09A 1WQVH 2Y7XA 3SI4H 2UWOA 4KELA 3STIA 3ZVEA 1MMJN 2BOKA 3H7TA 2GMTB 1FDPA 1GBCA 3TJOA 1C2EA 1KXAA 2PUQH 3S69A 1RD3B 2GTBA 3QZRA 3F9HA 4IN2A 3ATMA 2VVUA 4WVPE 1THSH 1A4WH 3A86A 2FX4A 4CR9A 3CS0A 4LOYH 2Y82A 1QQUA 1C5PA 5E0JA 2ZU4A 1QJ7B 1BMLA 2XW9A 3V13A 4XE4A 1XUIA 5HXFA 2H2ZA 1F5KU 4GCHG 3P8GA 1DLKB 2OBQA 1IQEA 1MU8B 2QGRA 1E34B 5DP3A 4OGXA 1MKWK 2FS8A 3GOVB 2F9BH 2FI3E 1L4DA 1NO9H 2Z3DA 3KEEA 3UR9A 4D9RA 1Y3VA 1HAZB 1TPPA 3QO6A 2WPLS 7LPRA 4ZH8A 1F0UA 1WYKA 2ZHEH 3LKWA 3RC5A 1OWHA 2BYAX 1XUGA 2GZ8A 1O5DH 2SGPE 1HAGE 3SORA 2AEIH 1F92A 3PM3A 2VVVA 3VPKA 1C1WH 1RGQA 1E38B 4ZROA 1FY4A 2H9TH 3S7KB 3MH6A 4IS5A 4GVUA 1BJUA 1GVKB 2ZHWH 1GHZA 5E0HA 2ZNKH 1C1QA 1EOJA 1PPCE 1SQAA 1AI8H 1AN1E 1EPTC 3AW0A 4A1VA 1D3TB 1C5LH 2XTTB 3MU0A 2GCHF 2O8WA 4BANB 3MNSA 2ALVA 2AGGX 1SGEE 2O8UA 4FU7A 1C1NA 3NXPA 4E05H 4K3JA 3HK6B 2SGQE 4YLQH 3U98H 3T62A 3V12A 1O2IA 1Z8IB 2FS9A 3F9GA 3UQVA 3F9EA 1YLCA 4Y79A 1CHOG 4RKJB 1DWDH 3TU7H 2AFQB 4WMDA 1VCWA 1GJ8B 2P3UB 1A3EH 1K9OE 2IPHA 1NRNH 3SNEA 2BXTH 2ALPA 3NUMA 1AUJA 2Z9LA 1JBUH 5LH8A 1HJAC 3ZV8A 1XKBC 3MU5A 4HFPB 1B0FA 1GJ9B 1KSNA 1TQ7B 3GICB 1K2I1 2WPJS 4UE7H 8GCHG 2Z94A 6GCHF 1O5BB 2Z3EA 3RU4T 3RC4A 1DE7H 1XX9A 4ABEA 2WYGA 4UFDH 2WUBA 2ZC9H 1MZDA 2ZWLH 1CQQA 1BDAA 3ELAH 1O2KA 1A1RA 1VR1H 2BVXH 3IWMA 2WPHS 1TGBA 2QXGA 4YOGA 3MU8A 2PKAB 1EP5A 3OX7U 1BMAA 2A2QH 1Y8TA 1C5ZB 3VGCC 1HUTH 1KIGH 2PUXB 3IG6B 3SNCA 2V0BA 3VFEA 3M3SA 4Q7XA 1KLJH 3DT0H 1GI4A 2OBOA 1SGFA 1AFQC 5C5NA 1OWJA 1BTUA 1GBDA 1UCYE 2STBE 1V2RT 4DY7B 4SGBE 1YF4A 1YCPM 1MTVA 3MTYA 1UTPA 1O3MA 3B8JA 1V2VT 4CREA 9ESTA 1KYNA 1EB1H 1P3EA 2FYRA 1AB9B 1QIXB 4B1TA 2KAIB 1GHYH 3PO1B 2STAE 2HPQH 3UY9A 1NZQH 1A2CH 1O3OA 4UFFH 3B9FH 2PSYA 1H8IH 2CMYA 3RC6A 2P95A 1WQSA 3PMAB 3DUXH 1HAYB 3Q3KA 4OGYA 4O3TA 1TOCB 4MVNA 5AFYH 2GMTC 1IQFA 1WU1A 3LOXA 1UHBB 3A80A 2BY5X 4RN6A 3RXQA 1PYTC 1RTLA 3MOCA 4X6PA 2J34A 5IDKA 1NU9A 1DWCH 2EEKA 2GZ7A 4O3UA 3SZNA 4BXWA 3GY8A 2H9HA 4YOIA 1EZUC 2TPIZ 1NTPA 1C2JA 2GCHG 4IMQA 5H4IB 1M9UA 1FMGA 1DDJA 2ZFQH 2FM2A 2XC0A 1NFXA 2ZHFH 3AW1A 1LVMA 2BM2A 1C1RA 1MTSA 1P09A 1SGCA 1TX7A 1ELCA 5A2MH 3RXUA 2DE9A 4A6LA 2QXHA 2ZECA 4CRFA 1DOJA 4ABBA 2OINA 1ZZZA 1ABJH 2ZFFH 3RMMH 3E0PB 3GY6A 5DJ7A 1XUFA 1UTJA 2I6SA 3MH7A 3TITA 2Y80A 5L2YH 1NS3A 4Y7BA 1HAIH 5DGJA 4JZ1A 5E8EH 3UR6A 3RUOA 5ABWA 2FX6A 6GCHG 4D7GA 1Z71A 3SUFA 1UTQA 3L6PA 3TPIZ 3UIRA 2OCVB 1O2OA 1C9PA 1QL9A 1F5LA 1UVOA 1O30A 1ELTA 1LCYA 1GI7B 2J95A 1TNHA 1NU7B 3U69H 1GJDB 1BHXB 1LQEA 2ZPRA 1P11E 1K21H 2WPMS 1OYTH 2GP9B 3K6YA 1BTYA 5DG6A 3U1JB 3ENSB 3T27A 3TNTA 2CJIA 3I78A 1KXEA 1N8OC 2ZCKP 3QTOH 1ZPZA 1V2TT 1EAXA 3A7YA 2EI6A 3M3TA 1EOLA 1BITA 2PKSB 4I7YH 2FOAA 1FY1A 4XBCA 4K8BA 1MH0A 1RIWB 1ZHPA 1KTSB 1C5UA 1TABE 2D1JA 1TRNA 1MKWH 1P12E 5JB9S 2XBWA 2G00A 3LU9B 1C5XB 1K1JA 2Z9KA 1Y3XA 4B75A 3SJ8A 3HGPA 2O8MA 3BF6H 3KGPA 1D9IA 4B71A 4WXIA 4XOJA 1TGTA 2THFB 1KXFA 2GVFA 1S5SA 1UVPA 5EQSA 2P93A 3SU1A 4AG2A 2ESTE 4NA7A 1UCYK 3S9AA 1O0DH 5L2ZH 1UHBA 4GHTA 2ZGJA 4NZLA 3KF2A 4BNRA 3UUZA 5C20A 2M5TA 3BSQA 1FPHH 2FZZA 1MTUA 5CHAC 3TJNA 1AO5A 2ANYA 1O2MA 1QBNA 3I29A 1T7CA
chains in the Genus database with same CATH superfamily
4F49A 1C2HA 1IQMA 3BIUH 2FODA 1HAHH 2FTLE 1VCQA 1ZLRA 1GBAA 3FP6E 3RXJA 4IC5A 5EOKA 2TIOA 2FLRH 3G01A 2TGPZ 3RXVA 3SU0A 1W0ZU 5JB8S 1TBZH 3ZZAA 1O2JA 1OPHB 1SQRA 4IBLH 8KME2 1SFIA 1A3BH 1C5TA 2WUCA 4XD7D 3RM0H 5JPMH 3BN9A 1G3CA 2A5IA 3Q76A 4P02A 1ZOMA 5JDUB 2FWWA 2OUAA 1SB1H 4H6TA 5E2OA 1SGFG 4MNYA 1AB9C 1H1BA 3PO1C 4RSPA 1P03A 1J14A 1MAXA 1O5GH 4UONA 4AFUA 1IQLA 1ELBA 1NRRH 1NT1A 2ZDLA 3N7OA 1SLXB 3BG8A 3AVZA 1D6RA 1Y5BT 3DD2H 2UUFB 2VIWA 2Y81A 1EJAA 2JH0D 2XBVA 3SU5A 3SU2A 3SUGA 4JZFH 3DFLA 5TJXA 1Q2WA 3ITIA 1GMHF 2R2WU 1GL1A 3TH2H 2BQWB 5EPYA 3STJA 2Z9IA 1NY22 4Z0KA 2EA3A 1ZHRA 1AQ7A 2BY7X 1KXBA 1NRSH 2F83A 3LC5A 3P17H 4MG3A 1FIZA 1GBTA 4UFEH 5C2ZA 3NPSA 1BTHH 2K0QA 3NRLA 2A7CA 2QYIA 2FXRA 1GWAA 3LGYA 2A4OA 1RFNA 2PGQB 1UVTH 2QY0B 1KXCA 1BRBE 1T8NA 2CXVA 2VWLA 2QN5T 1NRPH 1G3EA 2BD8A 1CHGA 2GDEH 2A5KA 3FP7E 4CH2B 2BQ7B 1PQ5A 1UK3A 4GUXA 2Y5HA 2FIRH 2ZDVH 4AFSA 3VEQB 2YNBA 4Y11E 4ABGA 1C4Y2 1AKSA 1AHTH 1GJ5H 3GCOA 1TX8A 1W13U 2G51A 1C5OH 3D65E 2V3HH 8LPRA 4HI3A 2AIPA 1YPMH 2J92A 2YNAA 3LH1A 1OXGA 2HVXA 2RG3A 4JK6A 5A8XA 1W11U 2BQ6B 1EAWA 4INHA 3M7TA 5IYTA 1UK4A 3SI3H 1O3EA 2HRVA 4NSVA 1BRAA 5DP6A 1IQKA 3MI4A 3RXMA 3A7XA 2VBCA 9LPRA 1HBTH 1XUJA 3AAUA 2FOGA 5CMXH 4KTSA 1FZZA 1GJ4H 2B8OH 1K1LA 3JZ1B 2G81E 1L0ZA 5HM2A 1BIOA 1HAOH 1OWEA 4NWKA 5DN6D 1U6QA 5DP9A 1JMOH 3ZZCA 2PKSC 3BTEE 1O35A 3RXCA 3ZVCA 3SNAA 2Z3CA 1HRTH 1NBME 4FVBA 1ANBA 1SGPE 4WY3A 4UD9H 2YMSC 4ABAA 1ZPBA 4KKDA 5GPIB 4JMYA 2EI8A 3HK3B 2SGAA 3M36A 1A0HB 4NGAH 1JRTA 1QY6A 1BZXE 4ABFA 3SZEA 3EE0B 3DA9B 1NN6A 2SFAA 4A1XA 5LPEA 2JKHA 4K5ZA 2J98A 2G4UA 1GI1A 2OTVA 1C1VH 4TPIZ 5EW2H 7GCHF 2A4RA 3A7TA 3U8RH 3LDXH 1O2YA 3FFGA 2W5EA 4R0IA 1IHTH 2HPPH 5JBAS 1P2IA 4IW4E 2OC1A 2FOFA 2VIDA 2VGCB 4HZHA 2H1UA 3ZYDA 1TE0A 5FXLA 2Q6GA 2H9EH 4XDEA 3M7QA 5TCCA 1NRQH 1GBJA 1GMHG 3SOSA 4ABHA 2ODYB 1ESBA 4D9QA 1CT4E 2TGDA 1AZ8A 1IQJA 2A0QB 3E1XB 4AYVB 1SL3A 3ZZ7A 1YPJH 1KY9A 4I8KA 1W2KH 4DURA 4I33A 1V2OT 3UQOA 1AUTC 3RXSA 1QA0A 4X2VA 5SGAE 4THNH 1JXPA 5FPSA 5F8ZA 1G3DA 5BRRE 4NFFA 3SO3A 4MPXA 3DSPA 4DJZB 1N6XA 3V0XA 3KQCA 3OU0A 3URDA 1P02A 1C2DA 4B74A 5FHTA 1DLEA 1O2RA 1V2WT 2AMDA 1WCZA 1J8AA 2V3MA 2C93B 3OSYA 3E90B 1BTPA 4AGKA 3HKJB 5C0TA 1Y5AT 2SGFE 3EDXB 4ABIA 2XCFA 3F1SB 2BY8X 1O3GA 1EXFA 1L1GA 2WHXA 1V2UT 2R0LA 2IN2A 1SLWB 2BDAA 2F9VA 1YC0A 2J2UA 3BTQE 3NCLA 1JIRA 1O34A 1GI5A 1TA6A 1S0QA 1KMHB 4WMFA 1C1TA 2BY6X 4YXWD 1INCA 3KQBA 5F8XA 1YP9A 3CNRA 4XRNA 4LZ1H 1MABB 3BEFB 3VB5A 3TH4H 5KGOA 4NA8A 2KCAA 3T26A 5HKKD 1VZQH 2FYQA 2XOKD 1TMTH 3E0NB 3URCA 1GGDB 1FY8E 4NFEA 3SGQE 2FOBA 4F4OC 3SN8A 3V7TA 3BTGE 1N1LA 1DFPA 1OP8A 4CRDA 4AOQA 2A7JA 1G36A 1CSOE 2WPDD 5AF9H 1HB0B 1FIWA 1HAVA 1O3FA 1H8HD 1YYY1 2F9OA 1FQ3A 1T32A 1ESAA 2GCTC 2Z6BD 1F5RA 4ISHH 4MPVA 5L30H 1PPBH 1TBRH 3SJIA 3RU4E 4U30A 2P3TB 2H5CA 5F8TA 1ELGA 2GX4A 2Q6FA 1XKAC 3A82A 4MLFB 2GV6A 3C1KA 3P8FA 4YOJA 4DIIH 4AGJA 3AASA 5C5OA 3MHWU 3K65B 3PRDA 5EODA 3SU4A 3MO6A 2VWMA 3HGNA 2PHBA 1SOZA 1UTNA 1WTGH 4X8TH 1AMHA 3A8CA 1P2QA 2W7UA 2W26A 2BX4A 1A5HA 5FX5A 3GS9A 1UTOA 4FUGA 1LKAA 3A89A 7GCHG 3GY3A 4X6OA 3KL6A 4E7NA 4MTBA 3AK5A 1QBVH 4WF8A 2BDHA 3KYGA 3M35A 3R0FA 5E0GA 4CRCA 2RCEA 1EP6A 5EU8A 1TB6H 2QV1A 1PQ8A 4JYTA 2XNDD 1YPHC 2F9NA 1V3XA 2I6QA 2FTMA 2K1QA 4OS5A 2ZG0H 2UUJB 1CGIE 4ZKRU 2RDLA 2CHAB 4KTUA 1TYNA 3JZ2B 2BLWA 3BV9B 4Q2KA 1GHAG 3MO3A 3A88A 1LTOA 1S84A 1ZMNA 2OK5A 1W10U 1GBMA 3QN7A 2ZA5A 1SR5C 5FBIA 1E36B 1T8OA 1C2MA 3PLKA 4P00A 3N7DA 1O2QA 4X6MA 5AFZH 3QK1A 4VGCB 3ZZ5A 2GGVB 1ZHMA 4FETA 4YZUA 3RLWH 1GI6A 4ZHLU 4X8UH 1FXYA 4IMZA 1A5GH 4TWYA 1LPGB 5EJLA 1O2GH 1V2KT 1C5WB 1SPJA 1BA8B 3SQHE 2ZQ2A 5T3HA 4OS4A 1PPFE 2RFKC 2WINI 1HIAA 4B2BA 3TGKE 3LGIA 3W95A 1O32A 4OS6A 1S6LA 3A8DA 1UVSH 2VGCC 2HALA 3BTTE 4YT6H 1TFXA 1AU8A 2FEQH 2R3UA 1GJBB 2G5VA 2ZHQH 5KECA 2ULLA 2AGIX 1QRWA 1TGNA 1WV7H 2P16A 1MTNB 5G4BA 3VXFH 3ZYEA 5T6DA 4X8VH 3ESTA 4IGDA 5J4QA 1AVGH 2CK3D 1QR3E 5FAHA 2BDCA 2Y6TA 2ZU5A 2SGEE 4E7RG 5EJ1A 2EY4C 1Y3YA 2JH5D 1GMDF 1O38A 2QA9E 2G55A 2QAAA 1J15A 4R8TB 1DSUA 2ZGCA 1GI9B 1GHBF 3M7UA 3EGKH 4MNXA 1IQNA 4FXGH 3PMHB 6CHAB 2O9QA 4JK5A 1Q3XA 2VIQA 4AORA 2BDGA 5GJ4B 2XC5A 3BTFE 2GV7A 2VINA 3ATWA 3ZZ3A 1QL7A 3PV5A 2JJ2D 3SU3A 3OY6U 1SVPA 1FUJA 4I8JA 4ISIH 1AD8H 1EB2A 3T25A 3ODDA 1HV7A 2F91A 4B6EA 1VITF 3K6ZA 3P95A 1TWXB 3MNBA 1HAPH 3BG4B 3TGJE 3ZZ6A 2Q1JA 1CA0B 1VKYA 5HYOA 1P2OA 3VB6A 3UNSA 4TSFD 1WOFA 2QCYA 4RKOB 4QT8C 3H5CB 3ZZ4A 2BLQA 1YY3A 1GGDC 2IJOB 4YM9A 2XBXA 2EI7A 2GT7A 3VB7A 1EATA 2BD4A 1C2IA 4CRAA 1EJNA 2PW8H 3QGJA 4J2YB 3RM2H 1QURH 3MFJA 2Z9GA 1HYLA 1E79D 4MNVA 2WPIS 1HAXB 2H6MA 1XVOA 3MMGA 2A32A 1MD8A 2W6ID 1Q31A 3U8OH 2K8IA 4WMEA 5C17A 2BXUH 1QFKH 2OD3B 3GCTF 1WUNH 2CN0H 3Q00A 4KGAA 5GXPA 1YPGH 1ZSJA 3GCHB 5CE1A 1RTFB 1ELAA 3AAVA 3M5NA 2WSSD 1SLUB 1J17T 1COWD 3MYWA 2CF9H 3NZIA 1TNKA 1W8BH 2DE8A 4H42U 2C3SA 2R2MB 3ZZ8A 4ZKSU 3SUDA 3TIUA 2ZZUH 5C1UA 4U2WA 3GYLB 1EAUA 2OC7A 1ANCA 3H09A 1F0TA 3M3VA 2BVSH 1FN6A 1BB0B 1OX1A 2CHAC 3B23B 3BEIB 2A5AA 3SBKA 1TNJA 3QWCH 1H9LB 1Z7KA 3EAJA 3RXAA 2VH6A 1BUIA 3A87A 3RXBA 1LPZB 1QNJA 1RJXB 5I25A 3WWFA 3OAAD 1LVYA 1BJVA 4FUBA 1TBQH 3RXOA 3SV2H 3SQEE 1DVAH 1LHEH 2BMGB 1GBFA 2ZF0H 1AKSB 1LMWB 1O3CA 4I8HA 3RXIA 1FNIA 2JETB 4AFZA 2KCYA 1CBWB 3N99A 2D26C 2FPZA 4I31A 1GHBG 4VGCC 1C5VA 2ZFTA 2PP6A 1CGHA 1GMCF 2BD7A 1WAYB 2HLDD 1QBOA 3CS7A 2PGBB 3O8RA 2BY9X 1S81A 1GI2A 1L2EA 2GZ9A 4FU9A 1W0JD 2NWNA 1E1QD 2KCPA 3F68H 4H4FA 1GBHA 1V2LT 5FPYA 1GCDA 3BTDE 3GDSA 3PV4A 1MU6B 1LKBA 3A7WA 3F0OA 1SHYA 2SNVA 3ZVBA 2J9NA 3A8BA 4H6SB 5FX6A 1TPAE 1BTXA 3RMNH 1YCPK 1CT0E 2ANWA 2ZHDA 4MNWA 1BTZA 4CHAB 3F2GA 1QL8A 5DK1A 1MTNC 1GPZA 1UK2A 4X0WU 1TLDA 1GJ6A 2GD4B 5DP5A 5LGOA 1DICA 1GDQA 3RDZA 1PPHE 2P8OB 4ZHMU 2F9PA 3S7HB 2RA0A 1CE5A 2QF5A 2H5DA 1NESE 2XC4A 3ZVFA 7KMEH 2YOLA 1AZZA 4LZ4B 1BBRE 3GDUA 1G2LA 5EXNA 5FBEA 1LHCH 3GISB 3F9FA 4ZHAA 4WXVA 3VB4A 2J98B 5EJZA 2WPKS 1JIMA 1O2NA 4AB8A 2XWBI 4A1TA 4WJG2 6CHAC 3LJJA 3SJOA 4MPWA 5EQQA 3Q3XA 3MNCA 4YLUA 3M5MA 3UWJH 2OQUA 1OOKB 5PTPA 1LHFH 1V2NT 3GCTG 2PWXA 5C3NA 1E1RD 1T8LA 1TONA 1C5SA 1Y3WA 2BD9A 4JZEH 3KYFA 5DPAA 1AVXA 1ZGVA 4I32A 2WYJA 2HNTC 1MBMA 2OC8A 3UWIA 4GHQA 3SJKA 4Y0ZE 1S6HA 3BG4C 3GDVA 4O03A 1CA0C 4U32A 3DHKH 1CT2E 1XXDA 3TGIE 1DITH 4FUHA 2ODPA 3FZDA 2A4QA 2QF3A 1C5MD 3PTBA 5JBBS 6LPRA 1D3DB 2Z7FE 5EW1H 4GPGA 1GI0A 3RXKA 3PRBA 1ELVA 1WSSH 1AGJA 2ZCHP 1XUKA 4Q80A 1O3NA 1GI3A 4D7FA 4TPYA 1A0LA 3LONA 3PROA 1QRZA 1HCGA 1TRYA 1SGQE 2ZU3A 3P8OA 1L1JA 1WDIA 1QA7A 2CF8H 1DPOA 4YT7H 2ZQ1A 5AVDA 5C94A 3P8NA 2KR7A 4BAQB 1D3PB 1T4VH 2XCNA 1E35B 2V35A 1GMCG 1P3CA 1ELEE 1ZTKA 4XBDA 2ANKH 1O3KA 3ATKA 2FOCA 1SMFE 2Y5GA 4NIYA 1S6FA 5A8YA 3GCHC 4ISLA 2PV9B 1NFWA 2WV5A 1ETRH 4UFGH 1G37A 1O36A 3FO8D 1BMMH 1SBWA 3A81A 1ID5H 2R0KA 2FDAA 1DWBH 4X2YA 2SGDE 1T31A 4OS1A 1GHWH 4ZKOU 4BTTB 1RIWC 2ZTZA 4TY7A 1D3QB 3UPEA 4Z6AH 1Y3UA 1FX0B 2NU1E 1H8DH 3T2NA 3LT3A 3IITA 1O2PA 2D2DA 1TQ0B 2PR3A 1HAVB 1OWDA 1EAIA 4X1SU 4FUIA 2R9PA 3LGVA 3FP8E 1OYQA 1CU1A 4TY6A 4UDWH 4KTCA 2W7SA 1P05A 3GY2A 2BLVA 1ZRKA 3KCGH 2G52A 1NBMD 4INLA 4CH8B 1O2XA 3S9BA 5A0CA 2G5NA 3SJ9A 1S0RA 2JETC 1F0RA 1NROH 2SNWA 5A8ZA 1CBWC 3TH3H 1WXRA 1FY3A 2ODQA 4X2XA 2AYWA 1ZPCA 3F6UH 1E37B 1YPLH 1G9IE 5JBCS 1ZSLA 1FV9A 2AHME 2PLXA 7ESTE 2ZDKA 1FY5A 4PROA 4DGJA 1P01A 1IQIA 3KIDU 4RI0A 1X7AC 2O8TA 1BBRK 2JH6D 3FZZA 3QUMP 1TGSZ 1HDTH 1O2UA 3DSGA 1O2TA 3O8BA 1XXFA 1GCTB 1O5EH 2ANMH 5DP7A 3ZVDA 1TNIA 4TYDA 3SV7A 4CHAC 3PWCA 1OP2A 4A92A 1G3BA 1A5IA 3FOAA 1BOQA 3LPRA 1O5AB 4JYUH 4RT1A 1O3DA 5FCKA 3MH5A 2A45B 3QZQA 1OSSA 3SGBE 1FI8A 1BRUP 3A85A 2P8OC 4I8GA 1ZYOA 1RRKA 1KDQA 5B6LA 2RA3A 4AX9H 1J9CH 1Y59T 4JZIA 4BAMB 2BX3A 2WZQA 1T8MA 4FUFA 4FUCA 1Z6EA 1UCYH 1C9TA 1ZSKA 3ZZDA 1ETSH 2OQ5A 4A7IB 1RS0A 2IPQX 4YESB 2BOHB 3HKIB 4DIHH 1FONA 5F53A 1OS8A 4DT4A 3NKKA 2EQNA 1UTLM 2BDYA 1HIAB 4Y76A 2ZFSA 5C67A 1DS2E 4B2CA 1ELFA 3BTHE 1EPTA 1MTWA 2VNTA 4ESTE 1W12U 1SQOA 2C4FH 4ISOA 5J4SA 1SOTA 3RMLH 4B6FA 1A7SA 5ESBA 4Q7YA 1TAWA 2VWOA 1O3AA 1MQ6A 1O3HA 1UTMA 1YCPH 1YKTA 3M61U 1LQDB 2ZP0H 3FKSD 1EZQA 3FVFB 4O9VA 1SGRE 1WTHD 1TNLA 1V2MT 2BTCE 1LDTT 1P0SH 1C2KA 1HNEE 1YPEH 2FMJA 3F3BA 1GBIA 3K9XB 1BTWA 5HMAA 2OC0A 1QB9A 3MWIU 2ZU1A 4O97A 4A5TS 2AH4X 2B0FA 3OEHD 2A4GA 1O2HA 1FN8A 1DX5M 1LHDH 1OHHD 1FAKH 1O2LA 4ABJA 3QDZB 3ZVAA 1GG6B 3A7ZA 1DUAA 1EUFA 2PSXA 4M9FA 1SC8U 1YGCH 4NIXA 3UREA 3RXEA 3EQ0H 5C1XA 2BDBA 1DUEA 4LXBH 4CR5A 2AERH 5EG4A 4Y6DA 3RXLA 3K2UA 4ASUD 1FJSA 2LELA 3NWUA 2EC9H 4X6NA 5EQRA 3RU4D 2ZGBH 1QB6A 1PPEE 2V3OH 1MCVA 3HPTB 2ZFPH 3ZZ9A 1SI5H 2O8LA 1EKBB 3U8TH 4DW2U 5JBTA 4NIVA 1SG8B 2B5TB 1V2ST 3H7OA 1C4V2 2HOBA 2QXIA 3UNRA 4BAHB 4ZXYH 4ZMAH 1D4PB 3E6PH 4OS2A 1N8OB 4BAOB 1ESTA 5EXLA 2XNIA 5KEDA 1C2GA 3MU4A 1O3IA 5HIYA 4I8LA 4AB9A 4NIWA 1GBLA 1THRH 2ZCLP 5A0BA 4Y8ZA 1EFRD 1XUHA 2PFEA 3E91A 3M5OA 1O2WA 1O5FH 4F48B 1C1SA 1XM1A 1GDUA 1QRXA 4NZQA 1RXPA 1UO6A 6ESTA 2J4IA 3LGUA 1SQTA 4TT3D 1GJ7B 3RMOH 2VIOA 1ANDA 1G32B 3EA9A 1NC6A 2UWPA 1CO7E 1GBKA 1P9UA 1UJ1A 3O8DA 3UOPA 4Y7AA 1O2VA 2W6JD 3WWBA 4D76A 5CDFE 3O8CA 1DANH 5F03A 5JYIA 4ZCNA 1SGTA 4Q63A 1HJ9A 5CHAB 1AIXH 1V2PT 2ZGXH 2AMPA 1OWIA 3BTKE 1TIOA 1VGCB 1KTTB 4NSYA 3UTUH 5FL7D 1A46H 1GCTC 1DY9A 1MKXK 1O31A 2P3FH 1ARBA 2WV4A 2ZO3H 1GJCB 3GY7A 2VIVA 4B73A 3F0PA 2J97A 2KZ4A 1KXDA 1CA8B 3LGWA 1AFEH 2FOHA 1TRMA 2BLOA 3Q77A 2A2XH 1ZJDA 2GKVE 1F0SA 1L4ZA 2FOEA 1K1OA 4K60A 4Z1MD 1PQ7A 1HFDA 3FAOA 1A61H 1P2JA 1FLEE 1DM4B 1QHRB 1UTKA 1G2MA 1S83A 2HVYB 1HJ8A 1GVZA 3QLPH 3RLYH 2HNTE 1ACBE 2C8YB 2Y7ZA 1MAYA 8ESTE 3BTME 2OLGA 2C90B 4DT7B 1CGJE 1DWEH 1ELDE 2BHGA 5GWZA 3PTNA 3UFAA 5A0AE 1OWKA 4K1EA 3SW2B 1VJAU 1C2FA 3SV6A 5DO4H 1DY8A 4Q7ZA 3GY5A 1BBRH 1GVLA 4K2YA 2QXJA 1FAXA 3OTPA 4ABDA 1HPGA 3L3TA 3RXHA 4J1YA 1C5YB 2TRMA 1MQ5A 1JRSA 3SYJA 3FN8A 2L74A 4UEHH 2WV9A 3WW7A 3T28A 5GIBA 3C27B 2CV3A 3EYDA 1NFYA 2FI5E 4CRBA 1TA2A 1P57B 3DFJA 1H9IE 3HATH 3KN2A 4GLYA 2A31A 3A83A 2J5UA 3PWBA 1P2NA 3CP7A 1YM0A 1MD7A 2AS9A 4INKA 2QC2A 2TGTA 4MQAA 3MQKC 3D49H 3NK8A 4OS7A 1DSTA 1P06A 2V6NA 3EA8A 2NU2E 1ARCA 1P04A 2W3IA 1GBBA 1GG6C 1IOEA 5TCAA 1ZGIA 4YTAA 1TMUH 2A7HA 2NU0E 4NA9H 1QZ8A 1SLVB 1C1OA 1UVUH 2PTCE 3T5FH 1TPOA 2D8WA 3M37A 4X1QU 3Q3YA 3LC3A 3E8LA 3SV9A 2NU3E 3PMBB 4D8NA 1LPKB 4Y10E 1B0EA 3RXGA 1HXFH 1AWFH 1YPKH 2B7DH 2F9UA 2FESH 2FI4E 1N6YA 2ASUB 3MNXA 2Z9JA 3PMJA 5GNDA 5T6FA 1EASA 1HLTH 1THPB 3P6ZB 5EPNA 2PKAA 5ETXA 3SHCH 1S85A 1TOMH 2A1DB 5I46H 1F2SE 3P92A 1ZJKA 5GCHF 1BRCE 2VB0A 2FOMB 4AFQA 1DT2A 4JZDH 1O2SA 3D62A 1TMBH 2ZGHA 2KM0A 1QGFA 5HM9A 1MZAA 1LO6A 3SNBA 4DVAU 1BCUH 4X1NU 4GAWA 1FPCH 1QTFA 3RP2A 3N7EA 4ZAEA 1K1NA 2P59A 1GMDG 2VJ1A 4WWYA 5FPTA 4BOHA 4BTUB 1PJPA 4IC6A 3TJVA 3S0NA 4WH6A 4AZ2B 1P2MA 2BZAA 2J94A 4NG9H 1TALA 3TK6A 1C5RA 1C1PA 2KAIA 4HTCH 1S82A 5DSFA 1W7GH 1ZTLA 2HWLB 3OYPA 3TLOA 3TVJB 2DUCA 5EXMA 3KNXA 2BVRH 4GSOA 1OP0A 1MBQA 3WY8A 5L6NH 4ISNA 4K1SA 1ABIH 2GDDA 4KP0A 1WBGB 1NPMA 3A84A 1SSXA 3GCNA 4BAKB 1H4WA 3PB1E 4Y8XA 4AYYB 2GT8A 5ESTE 1VITG 2ZFRH 3MH4A 2VIPA 4JYVH 2FO9A 3OTJE 4ZUHA 1K1MA 2AGEX 3ATIA 5K7RA 2QF4A 2ILNA 5LPFA 1G30B 1VGCC 1OKXA 5B6OA 2OP9A 4MDSA 1ETTH 1HGTH 1IQHA 4E06H 2F3CE 3E16B 3CENA 2M2AA 1XMNB 2BDIA 3ZZBA 1AVWA 2IOTA 5EGMA 2ZPSA 3UNQA 5AHGH 4XFQA 1J16A 4X8SH 3SU6A 1KLTA 4FU8A 1K28D 1B5GH 4FVDA 1LHGH 3U9AH 4AN7A 2QIQA 4ASHA 1SFQB 4IN1A 5DP8A 1P10A 1O33A 2BD3A 1ORFA 1L1NA 1VITH 1W14U 3DSOA 4DOQA 1BT7A 1A0JA 3ZV9A 5T6GA 2C8ZB 3ZVGA 2ZTXA 4JCNA 3UOUA 1C1MA 1VJ9U 3LGTA 1MUEB 1NFUA 2R3YA 2ZIQH 3ODFA 1JWTA 1KLIH 5F6MA 5BPEA 3DCLA 3RXPA 4U01A 4B2AA 1LVOA 3QX5H 3TNSA 1ANEA 4HGCA 1JOUB 4NWLA 1SGNE 4B76A 2AIQA 5K0HA 2IJD1 2CGAA 2B9LA 5GDSH 3LIWA 1SHHB 4FUDA 2ZKSA 4NCYA 3SHAH 2ZDAH 1MKXH 1BQYA 3ATLA 3LJOA 5GCHG 2VH0A 2HGTH 4FUJA 1GHXH 2HNTF 2W3KA 2AMQA 4WH8A 1W0YH 2G8TA 1DXPA 4MPUA 1GDNA 4ACAA 1W7XH 4ZXXH 1Z8RA 1ZRBA 1K22H 1KDQB 4CBOA 2KFWA 1AWHB 1F7ZA 3E3TA 4LK4A 1TPSA 2GCTB 3QTVH 2OXSA 1HXEH 1YPHE 5DKMA 3V3MA 4BXSA 4Y8YA 3GY4A 3KQEA 2C8XB 4XBBA 3QGNB 4HG6A 2P94A 3SUEA 3A8AA 3OFND 5E2PA 1EZSC 1EZXC 3TK5A 1C5NH 1IQGA 1O3BA 4Q4LA 3KQ5A 3BTWE 2XXLA 2BZ6H 1Z6JH 1GI8B 1LVBA 3LH3A 1T4UH 4I86A 1C1UH 3RXRA 3KHVA 1E0FD 4X1RU 1EPTB 4DG4A 1GJAB 3OY5U 3TJUA 3FANA 4SGAE 4AG1A 5LPRA 1Y5UT 1ZMJA 4GCHF 1TX6A 1ZTJA 2Y5FA 3SGAE 1VCPA 5T1VA 1C5QA 1PPGE 1QCPA 2Q6DA 1O3JA 1DXWA 4FUEA 1BHXF 1P2KA 2LNCA 2PTNA 3M5LA 1H8ED 1H9HE 1P8VC 1YLNA 3SV8A 3S9CA 4DCDA 2UUKB 2ZPQA 4YO9A 1O37A 1SKYE 2QF0A 2BD5A 2XBYA 1AY6H 2FLBH 3GYMA 5C1YA 3VXEH 1MCTA 3RXFA 1V2QT 3PLPA 2XRCA 1HJAB 1SGDE 4TWWA 2BB4A 2VVCA 1TGCA 1P9SA 2VWNA 2FP7B 1K1IA 2NU4E 1B7XB 2HLCA 3P70B 4Y0YE 1RTKA 2ZU2A 1O2ZA 3TK9A 1EX3A 1Z8GA 4ZKNU 1SGYE 4Y71A 3VB3A 2BD2A 1PQAA 3PV2A 1C2LA 1SGIB 3PLBA 4FOUC 1Z8JB 4X2WA 4CRGA 4BTIB 1YBWA 2C8WB 3I77A 4K69A 2ZDNA 1GBEA 2XYAA 2TGAA 3T29A 4ACBA 1Z1JA 1EQ9A 3MO9A 3EA7A 2J38A 3MU1A 1EJMA 2VU8E 3A7VA 1PPZA 3U1IB 4AC9A 1D6WA 1GL0E 1QJ6B 3VGCB 1IAUA 2ZI2H 3D23A 1QJ1B 1BMNH 2ZTYA 3BEUA 3PYHA 4X1PU 1CVWH 1QQ4A 2XWAA 1CHOF 1V6DA 1AFQB 1O3LA 5IK2D 3RXDA 5FCRA 3SNDA 1GHVH 1TNGA 1W3CA 5HGGA 3RXTA 2UUYA 1GHAF 1ZR0A 4K1TA 1IHSH 2ZDMA 2LPRA 1C4U2 1QB1A 3BIVH 2ZEBA 3L33A 1Z1IA 1UMAH 3R3GB 5DP4A 4M7GA 3KQDA 3W94A 2F4LA 4CBNA 1XVMA 8GCHF 1V2JT 2TBSA 1PFXC 1ZMLA 1NM6A 1AE5A 1YLDA 1PYTD 1O3PB 2G4TA 1O5CB 4XSKU 4K8YA 1AE8H 1O39A 1K1PA 2UWLA 5A09A 1WQVH 2LP6A 2Y7XA 2RDEA 3SI4H 2UWOA 4KELA 3STIA 3ZVEA 1MMJN 2BOKA 3H7TA 2GMTB 1FDPA 1GBCA 3TJOA 1C2EA 1KXAA 2PUQH 3S69A 1RD3B 2GTBA 3QZRA 3F9HA 4IN2A 3ATMA 2VVUA 4WVPE 1THSH 1A4WH 3A86A 2FX4A 4CR9A 3CS0A 4LOYH 2Y82A 1QQUA 1C5PA 5E0JA 2ZU4A 1QJ7B 1BMLA 2XW9A 3V13A 4XE4A 1XUIA 5HXFA 2H2ZA 2V7QD 1F5KU 4GCHG 3P8GA 1DLKB 2OBQA 1IQEA 1MU8B 2QGRA 1E34B 5DP3A 4OGXA 1MKWK 2FS8A 3GOVB 2F9BH 2FI3E 1L4DA 3VG8A 1YWUA 1NO9H 2Z3DA 3KEEA 3UR9A 4D9RA 1Y3VA 1HAZB 1TPPA 3QO6A 2WPLS 7LPRA 4ZH8A 1F0UA 1WYKA 2ZHEH 3LKWA 3RC5A 1OWHA 2BYAX 1XUGA 2GZ8A 1O5DH 2SGPE 5HIZA 1HAGE 3SORA 2AEIH 1F92A 3PM3A 2VVVA 3VPKA 1C1WH 1RGQA 5CHBA 1E38B 4ZROA 1FY4A 2H9TH 3S7KB 3MH6A 4IS5A 4GVUA 1BJUA 1GVKB 2ZHWH 1GHZA 5E0HA 2ZNKH 1C1QA 1EOJA 1PPCE 1SQAA 1AI8H 3OE7D 1AN1E 1EPTC 3AW0A 4A1VA 1D3TB 1C5LH 2XTTB 3MU0A 2GCHF 2O8WA 4BANB 3MNSA 2ALVA 2AGGX 1SGEE 2O8UA 4FU7A 1C1NA 3NXPA 4E05H 1UW7A 4K3JA 3HK6B 2SGQE 4YLQH 3U98H 2KX4A 3T62A 1O2IA 3V12A 1Z8IB 2FS9A 3F9GA 2JJ1D 3UQVA 3F9EA 1YLCA 4Y79A 1CHOG 4RKJB 1DWDH 3TU7H 2AFQB 4WMDA 2F43B 1VCWA 1GJ8B 2P3UB 1A3EH 1K9OE 2IPHA 1NRNH 3SNEA 2BXTH 2ALPA 3NUMA 1AUJA 2Z9LA 1JBUH 5LH8A 1HJAC 3ZV8A 1XKBC 3MU5A 4HFPB 1B0FA 1GJ9B 1KSNA 1TQ7B 3GICB 1K2I1 2WPJS 4UE7H 8GCHG 2JIZD 2Z94A 6GCHF 1O5BB 2Z3EA 3RU4T 3RC4A 1DE7H 3OEED 1XX9A 4ABEA 2WYGA 3F2FA 4UFDH 2WUBA 3U28C 2ZC9H 1MZDA 2ZWLH 1CQQA 1BDAA 3ELAH 1O2KA 3ZIAD 1A1RA 1VR1H 2BVXH 3IWMA 2WPHS 1TGBA 2QXGA 4YOGA 3MU8A 2PKAB 1EP5A 3OX7U 1BMAA 2A2QH 1Y8TA 1C5ZB 3VGCC 1HUTH 1KIGH 2PUXB 3IG6B 3SNCA 2V0BA 3VFEA 3M3SA 4Q7XA 4F55A 1KLJH 3DT0H 1GI4A 2OBOA 1SGFA 1AFQC 5C5NA 1OWJA 3EE7A 1BTUA 1GBDA 1UCYE 2STBE 1V2RT 4DY7B 4SGBE 1YF4A 1YCPM 1MTVA 3MTYA 1UTPA 1O3MA 3B8JA 1V2VT 4CREA 9ESTA 5C0UA 1KYNA 1EB1H 1P3EA 2FYRA 1AB9B 1QIXB 3F2HA 4B1TA 2KAIB 1GHYH 3PO1B 2STAE 2HPQH 2KCOA 3UY9A 1NZQH 3W1EA 1A2CH 1O3OA 4UFFH 3B9FH 2PSYA 1H8IH 2CMYA 3RC6A 2P95A 1WQSA 3PMAB 3DUXH 1HAYB 3Q3KA 4OGYA 4O3TA 1TOCB 4MVNA 2JDID 5AFYH 2GMTC 1IQFA 1WU1A 3LOXA 1UHBB 3A80A 2BY5X 4RN6A 3RXQA 1PYTC 1RTLA 3MOCA 4X6PA 2J34A 5IDKA 1NU9A 1DWCH 2EEKA 2GZ7A 4O3UA 3SZNA 4BXWA 3UAIC 3GY8A 2H9HA 4YOIA 1EZUC 2TPIZ 1NTPA 1C2JA 2GCHG 4IMQA 5H4IB 1M9UA 1K0HA 1FMGA 1DDJA 2ZFQH 2FM2A 2XC0A 1NFXA 2ZHFH 3AW1A 1LVMA 2BM2A 1C1RA 1MTSA 1P09A 1SGCA 1TX7A 1ELCA 5A2MH 3RXUA 1W0KD 2DE9A 4A6LA 2QXHA 2ZECA 4CRFA 1DOJA 4ABBA 2OINA 1ZZZA 1ABJH 2ZFFH 3RMMH 3E0PB 3GY6A 5DJ7A 3UB0A 1XUFA 1UTJA 2I6SA 3MH7A 3TITA 2Y80A 5L2YH 1NS3A 4Y7BA 5EIYA 1HAIH 5DGJA 4JZ1A 5E8EH 3UR6A 3RUOA 4OM9A 5ABWA 2FX6A 6GCHG 4D7GA 2QE7D 1Z71A 3SUFA 1UTQA 3L6PA 3TPIZ 3UIRA 2OCVB 1O2OA 1C9PA 1QL9A 1F5LA 1UVOA 1O30A 1ELTA 1LCYA 1GI7B 2J95A 1TNHA 1NU7B 3U69H 1GJDB 1BHXB 1LQEA 2ZPRA 1P11E 1K21H 2WPMS 1OYTH 1BMFD 2GP9B 3K6YA 1BTYA 5DG6A 3U1JB 3ENSB 3T27A 3TNTA 2CJIA 3I78A 1KXEA 1N8OC 2ZCKP 3QTOH 2YMSD 1ZPZA 1V2TT 1EAXA 3A7YA 2EI6A 3M3TA 1EOLA 1BITA 2PKSB 4I7YH 2FOAA 1FY1A 4XBCA 4K8BA 1MH0A 1RIWB 1ZHPA 1KTSB 1C5UA 1TABE 2D1JA 1TRNA 1MKWH 1P12E 5JB9S 2L6OA 2XBWA 2YMSB 2G00A 3LU9B 1C5XB 1K1JA 2Z9KA 1Y3XA 4B75A 3SJ8A 3HGPA 2O8MA 3BF6H 3KGPA 1D9IA 4B71A 4WXIA 4XOJA 1TGTA 2THFB 1KXFA 2GVFA 1S5SA 1UVPA 4RT0A 5EQSA 2P93A 3SU1A 4AG2A 2ESTE 4NA7A 1UCYK 3S9AA 1O0DH 5L2ZH 1UHBA 4GHTA 2GJGA 2ZGJA 4NZLA 3KF2A 4BNRA 3UUZA 5C20A 2M5TA 3BSQA 1FPHH 2FZZA 1MTUA 5CHAC 3TJNA 1AO5A 2ANYA 1O2MA 1QBNA 3I29A 1T7CA
chains in the Genus database with same CATH topology
4F49A 1C2HA 1IQMA 3BIUH 2FODA 1HAHH 2FTLE 1VCQA 1ZLRA 1GBAA 3FP6E 3RXJA 4IC5A 5EOKA 2TIOA 2FLRH 3G01A 2TGPZ 3RXVA 3SU0A 1W0ZU 5JB8S 1TBZH 3ZZAA 1O2JA 1OPHB 4IBLH 8KME2 1SFIA 1A3BH 1C5TA 2WUCA 3RM0H 5JPMH 3BN9A 1G3CA 2A5IA 3Q76A 1ZOMA 5JDUB 2FWWA 2OUAA 1SB1H 4H6TA 5E2OA 1SGFG 4MNYA 1AB9C 1H1BA 3PO1C 4RSPA 1P03A 1J14A 1MAXA 1O5GH 4UONA 4AFUA 1IQLA 1ELBA 1NRRH 1NT1A 2ZDLA 3N7OA 1SLXB 3BG8A 3AVZA 1D6RA 1Y5BT 3DD2H 2UUFB 2VIWA 2Y81A 1EJAA 2JH0D 2XBVA 3SU5A 3SU2A 3SUGA 4JZFH 3DFLA 5TJXA 1Q2WA 3ITIA 1GMHF 2R2WU 1GL1A 3TH2H 2BQWB 5EPYA 3STJA 2Z9IA 1NY22 4Z0KA 2EA3A 1ZHRA 1AQ7A 2BY7X 1KXBA 1NRSH 2F83A 3LC5A 3P17H 4MG3A 1FIZA 1GBTA 4UFEH 5C2ZA 3NPSA 1BTHH 2A7CA 2QYIA 2FXRA 1GWAA 3LGYA 2A4OA 1RFNA 2PGQB 1UVTH 2QY0B 1KXCA 1BRBE 1T8NA 2CXVA 2VWLA 2QN5T 1NRPH 1G3EA 2BD8A 1CHGA 2GDEH 2A5KA 3FP7E 4CH2B 2BQ7B 1PQ5A 1UK3A 4GUXA 2Y5HA 2FIRH 2ZDVH 4AFSA 3VEQB 2YNBA 4Y11E 4ABGA 1C4Y2 1AKSA 1AHTH 1GJ5H 3GCOA 1TX8A 1W13U 2G51A 1C5OH 3D65E 2V3HH 8LPRA 4HI3A 2AIPA 1YPMH 2J92A 2YNAA 3LH1A 1OXGA 2HVXA 2RG3A 4JK6A 5A8XA 1W11U 2BQ6B 1EAWA 4INHA 3M7TA 5IYTA 1UK4A 3SI3H 1O3EA 2HRVA 4NSVA 1BRAA 5DP6A 1IQKA 3MI4A 3RXMA 3A7XA 9LPRA 1HBTH 1XUJA 3AAUA 2FOGA 5CMXH 4KTSA 1FZZA 1GJ4H 2B8OH 1K1LA 3JZ1B 2G81E 1L0ZA 5HM2A 1BIOA 1HAOH 1OWEA 4NWKA 1U6QA 5DP9A 1JMOH 3ZZCA 2PKSC 3BTEE 1O35A 3RXCA 3ZVCA 3SNAA 2Z3CA 1HRTH 4FVBA 1ANBA 1SGPE 4WY3A 4UD9H 4ABAA 1ZPBA 4KKDA 5GPIB 4JMYA 2EI8A 3HK3B 2SGAA 3M36A 1A0HB 4NGAH 1JRTA 1QY6A 1BZXE 4ABFA 3EE0B 3DA9B 1NN6A 2SFAA 4A1XA 5LPEA 2JKHA 4K5ZA 2G4UA 1GI1A 2OTVA 1C1VH 4TPIZ 5EW2H 7GCHF 2A4RA 3A7TA 3U8RH 3LDXH 1O2YA 3FFGA 2W5EA 4R0IA 1IHTH 2HPPH 5JBAS 1P2IA 4IW4E 2OC1A 2FOFA 2VIDA 2VGCB 4HZHA 2H1UA 3ZYDA 1TE0A 5FXLA 2Q6GA 2H9EH 4XDEA 3M7QA 5TCCA 1NRQH 1GBJA 1GMHG 3SOSA 4ABHA 2ODYB 1ESBA 4D9QA 1CT4E 2TGDA 1AZ8A 1IQJA 2A0QB 3E1XB 4AYVB 1SL3A 3ZZ7A 1YPJH 1KY9A 4I8KA 1W2KH 4DURA 4I33A 1V2OT 3UQOA 1AUTC 3RXSA 1QA0A 4X2VA 5SGAE 4THNH 1JXPA 5FPSA 5F8ZA 1G3DA 5BRRE 4NFFA 3SO3A 4MPXA 4DJZB 1N6XA 3V0XA 3KQCA 3OU0A 3URDA 1P02A 1C2DA 4B74A 5FHTA 1DLEA 1O2RA 1V2WT 2AMDA 1WCZA 1J8AA 2C93B 3OSYA 3E90B 1BTPA 4AGKA 3HKJB 1Y5AT 2SGFE 3EDXB 4ABIA 2XCFA 3F1SB 2BY8X 1O3GA 1EXFA 1L1GA 1V2UT 2R0LA 2IN2A 1SLWB 2BDAA 2F9VA 1YC0A 2J2UA 3BTQE 3NCLA 1JIRA 1O34A 1GI5A 1TA6A 1S0QA 4WMFA 1C1TA 2BY6X 1INCA 3KQBA 5F8XA 1YP9A 4LZ1H 3BEFB 3VB5A 3TH4H 4NA8A 3T26A 1VZQH 2FYQA 1TMTH 3E0NB 3URCA 1GGDB 1FY8E 4NFEA 3SGQE 2FOBA 4F4OC 3SN8A 3V7TA 3BTGE 1N1LA 1DFPA 1OP8A 4CRDA 4AOQA 2A7JA 1G36A 1CSOE 5AF9H 1HB0B 1FIWA 1HAVA 1O3FA 1YYY1 2F9OA 1FQ3A 1T32A 1ESAA 2GCTC 2Z6BD 1F5RA 4ISHH 4MPVA 5L30H 1PPBH 1TBRH 3SJIA 3RU4E 4U30A 2P3TB 2H5CA 5F8TA 1ELGA 2GX4A 2Q6FA 1XKAC 3A82A 4MLFB 2GV6A 3C1KA 3P8FA 4YOJA 4DIIH 4AGJA 3AASA 5C5OA 3MHWU 3K65B 5EODA 3SU4A 3MO6A 2VWMA 3HGNA 2PHBA 1SOZA 1UTNA 1WTGH 4X8TH 1AMHA 3A8CA 1P2QA 2W7UA 2W26A 2BX4A 1A5HA 5FX5A 1UTOA 4FUGA 1LKAA 3A89A 7GCHG 3GY3A 4X6OA 3KL6A 4E7NA 4MTBA 1QBVH 4WF8A 2BDHA 3M35A 3R0FA 5E0GA 4CRCA 2RCEA 1EP6A 5EU8A 1TB6H 2QV1A 1PQ8A 4JYTA 1YPHC 2F9NA 1V3XA 2I6QA 2FTMA 2K1QA 4OS5A 2ZG0H 2UUJB 1CGIE 4ZKRU 2RDLA 2CHAB 4KTUA 1TYNA 3JZ2B 2BLWA 3BV9B 4Q2KA 1GHAG 3MO3A 3A88A 1LTOA 1S84A 1ZMNA 1W10U 1GBMA 3QN7A 2ZA5A 1SR5C 5FBIA 1E36B 1T8OA 1C2MA 3PLKA 1O2QA 4X6MA 5AFZH 3QK1A 4VGCB 3ZZ5A 2GGVB 1ZHMA 4YZUA 3RLWH 1GI6A 4ZHLU 4X8UH 1FXYA 4IMZA 1A5GH 4TWYA 1LPGB 1O2GH 1V2KT 1C5WB 1SPJA 1BA8B 3SQHE 2ZQ2A 5T3HA 4OS4A 1PPFE 2WINI 1HIAA 4B2BA 3TGKE 3LGIA 3W95A 1O32A 4OS6A 3A8DA 1UVSH 2VGCC 2HALA 3BTTE 4YT6H 1TFXA 1AU8A 2FEQH 2R3UA 1GJBB 2G5VA 2ZHQH 2ULLA 2AGIX 1QRWA 1TGNA 1WV7H 2P16A 1MTNB 5G4BA 3VXFH 3ZYEA 5T6DA 4X8VH 3ESTA 4IGDA 5J4QA 1AVGH 1QR3E 5FAHA 2BDCA 2Y6TA 2ZU5A 2SGEE 4E7RG 1Y3YA 2JH5D 1GMDF 1O38A 2QA9E 2G55A 2QAAA 1J15A 4R8TB 1DSUA 2ZGCA 1GI9B 1GHBF 3M7UA 3EGKH 4MNXA 1IQNA 4FXGH 3PMHB 6CHAB 2O9QA 4JK5A 1Q3XA 2VIQA 4AORA 2BDGA 5GJ4B 2XC5A 3BTFE 2GV7A 2VINA 3ATWA 3ZZ3A 1QL7A 3SU3A 3OY6U 1SVPA 1FUJA 4I8JA 4ISIH 1AD8H 1EB2A 3T25A 3ODDA 1HV7A 2F91A 1VITF 3K6ZA 3P95A 1TWXB 3MNBA 1HAPH 3BG4B 3TGJE 3ZZ6A 2Q1JA 1CA0B 5HYOA 1P2OA 3VB6A 3UNSA 1WOFA 2QCYA 4RKOB 4QT8C 3H5CB 3ZZ4A 2BLQA 1GGDC 2IJOB 4YM9A 2XBXA 2EI7A 2GT7A 3VB7A 1EATA 2BD4A 1C2IA 4CRAA 1EJNA 2PW8H 3QGJA 4J2YB 3RM2H 1QURH 3MFJA 2Z9GA 1HYLA 4MNVA 2WPIS 1HAXB 2H6MA 1XVOA 3MMGA 2A32A 1MD8A 1Q31A 3U8OH 4WMEA 2BXUH 1QFKH 2OD3B 3GCTF 1WUNH 2CN0H 3Q00A 4KGAA 5GXPA 1YPGH 1ZSJA 3GCHB 5CE1A 1RTFB 1ELAA 3AAVA 3M5NA 1SLUB 1J17T 3MYWA 2CF9H 3NZIA 1TNKA 1W8BH 2DE8A 4H42U 2C3SA 2R2MB 3ZZ8A 4ZKSU 3SUDA 3TIUA 2ZZUH 5C1UA 4U2WA 3GYLB 1EAUA 2OC7A 1ANCA 1F0TA 3M3VA 2BVSH 1FN6A 1BB0B 1OX1A 2CHAC 3B23B 3BEIB 2A5AA 3SBKA 1TNJA 3QWCH 1H9LB 1Z7KA 3EAJA 3RXAA 2VH6A 1BUIA 3A87A 3RXBA 1LPZB 1QNJA 1RJXB 5I25A 1LVYA 1BJVA 4FUBA 1TBQH 3RXOA 3SV2H 3SQEE 1DVAH 1LHEH 2BMGB 1GBFA 2ZF0H 1AKSB 1LMWB 1O3CA 4I8HA 3RXIA 1FNIA 2JETB 4AFZA 1CBWB 2D26C 2FPZA 4I31A 1GHBG 4VGCC 1C5VA 2ZFTA 1CGHA 1GMCF 2BD7A 1WAYB 1QBOA 3CS7A 2PGBB 3O8RA 2BY9X 1S81A 1GI2A 1L2EA 2GZ9A 4FU9A 2NWNA 3F68H 4H4FA 1GBHA 1V2LT 5FPYA 1GCDA 3BTDE 3GDSA 3PV4A 1MU6B 1LKBA 3A7WA 1SHYA 2SNVA 3ZVBA 2J9NA 3A8BA 4H6SB 5FX6A 1TPAE 1BTXA 3RMNH 1YCPK 1CT0E 2ANWA 2ZHDA 4MNWA 1BTZA 4CHAB 1QL8A 5DK1A 1MTNC 1GPZA 1UK2A 4X0WU 1TLDA 1GJ6A 2GD4B 5DP5A 5LGOA 1DICA 1GDQA 3RDZA 1PPHE 2P8OB 4ZHMU 2F9PA 3S7HB 2RA0A 1CE5A 2H5DA 1NESE 2XC4A 3ZVFA 7KMEH 2YOLA 1AZZA 4LZ4B 1BBRE 3GDUA 1G2LA 5EXNA 5FBEA 1LHCH 3GISB 3F9FA 4ZHAA 4WXVA 3VB4A 2WPKS 1JIMA 1O2NA 4AB8A 2XWBI 4A1TA 4WJG2 6CHAC 3LJJA 3SJOA 4MPWA 5EQQA 3Q3XA 3MNCA 4YLUA 3M5MA 3UWJH 2OQUA 1OOKB 5PTPA 1LHFH 1V2NT 3GCTG 2PWXA 5C3NA 1T8LA 1TONA 1C5SA 1Y3WA 2BD9A 4JZEH 5DPAA 1AVXA 1ZGVA 4I32A 2WYJA 2HNTC 1MBMA 2OC8A 3UWIA 4GHQA 3SJKA 4Y0ZE 1S6HA 3BG4C 3GDVA 4O03A 1CA0C 4U32A 3DHKH 1CT2E 1XXDA 3TGIE 1DITH 4FUHA 2ODPA 3FZDA 2A4QA 2QF3A 1C5MD 3PTBA 5JBBS 6LPRA 1D3DB 2Z7FE 5EW1H 4GPGA 1GI0A 3RXKA 1ELVA 1WSSH 1AGJA 2ZCHP 1XUKA 4Q80A 1O3NA 1GI3A 4D7FA 4TPYA 1A0LA 3LONA 3PROA 1QRZA 1HCGA 1TRYA 1SGQE 2ZU3A 3P8OA 1L1JA 1QA7A 2CF8H 1DPOA 4YT7H 2ZQ1A 5AVDA 3P8NA 4BAQB 1D3PB 1T4VH 2XCNA 1E35B 2V35A 1GMCG 1P3CA 1ELEE 1ZTKA 4XBDA 2ANKH 1O3KA 3ATKA 2FOCA 1SMFE 2Y5GA 4NIYA 1S6FA 5A8YA 3GCHC 4ISLA 2PV9B 1NFWA 2WV5A 1ETRH 4UFGH 1G37A 1O36A 1BMMH 1SBWA 3A81A 1ID5H 2R0KA 2FDAA 1DWBH 4X2YA 2SGDE 1T31A 4OS1A 1GHWH 4ZKOU 4BTTB 1RIWC 2ZTZA 4TY7A 1D3QB 3UPEA 4Z6AH 1Y3UA 2NU1E 1H8DH 3T2NA 3LT3A 3IITA 1O2PA 2D2DA 1TQ0B 2PR3A 1HAVB 1OWDA 1EAIA 4X1SU 4FUIA 2R9PA 3LGVA 3FP8E 1OYQA 1CU1A 4TY6A 4UDWH 4KTCA 2W7SA 1P05A 3GY2A 2BLVA 1ZRKA 3KCGH 2G52A 4CH8B 4INLA 1O2XA 3S9BA 5A0CA 2G5NA 3SJ9A 1S0RA 2JETC 1F0RA 1NROH 2SNWA 5A8ZA 1CBWC 3TH3H 1FY3A 2ODQA 4X2XA 2AYWA 1ZPCA 3F6UH 1E37B 1YPLH 1G9IE 5JBCS 1ZSLA 1FV9A 2PLXA 7ESTE 2ZDKA 1FY5A 4PROA 4DGJA 1P01A 1IQIA 3KIDU 1X7AC 2O8TA 1BBRK 2JH6D 3FZZA 3QUMP 1TGSZ 1HDTH 1O2UA 1O2TA 3O8BA 1XXFA 1GCTB 1O5EH 2ANMH 5DP7A 3ZVDA 1TNIA 4TYDA 3SV7A 4CHAC 3PWCA 1OP2A 4A92A 1G3BA 1A5IA 3LPRA 1BOQA 1O5AB 4JYUH 1O3DA 5FCKA 3MH5A 2A45B 3QZQA 1OSSA 3SGBE 1FI8A 1BRUP 3A85A 2P8OC 4I8GA 1ZYOA 1RRKA 1KDQA 2RA3A 4AX9H 1J9CH 1Y59T 4JZIA 4BAMB 2BX3A 1T8MA 4FUFA 4FUCA 1Z6EA 1UCYH 1C9TA 1ZSKA 3ZZDA 1ETSH 2OQ5A 4A7IB 1RS0A 4YESB 2BOHB 3HKIB 4DIHH 1FONA 1OS8A 3NKKA 1UTLM 2BDYA 1HIAB 4Y76A 2ZFSA 5C67A 1DS2E 4B2CA 1ELFA 3BTHE 1EPTA 1MTWA 2VNTA 4ESTE 1W12U 1SQOA 2C4FH 4ISOA 5J4SA 1SOTA 3RMLH 1A7SA 5ESBA 4Q7YA 1TAWA 2VWOA 1O3AA 1MQ6A 1O3HA 1UTMA 1YCPH 1YKTA 3M61U 1LQDB 2ZP0H 1EZQA 3FVFB 4O9VA 1SGRE 1WTHD 1TNLA 1V2MT 2BTCE 1LDTT 1P0SH 1C2KA 1HNEE 1YPEH 2FMJA 1GBIA 3K9XB 1BTWA 5HMAA 2OC0A 1QB9A 3MWIU 2ZU1A 4O97A 4A5TS 2AH4X 2B0FA 2A4GA 1O2HA 1FN8A 1DX5M 1LHDH 1FAKH 1O2LA 4ABJA 3QDZB 3ZVAA 1GG6B 3A7ZA 1DUAA 1EUFA 2PSXA 1SC8U 1YGCH 4NIXA 3UREA 3RXEA 3EQ0H 5C1XA 2BDBA 1DUEA 4LXBH 4CR5A 2AERH 5EG4A 4Y6DA 3RXLA 3K2UA 1FJSA 3NWUA 2EC9H 4X6NA 5EQRA 3RU4D 2ZGBH 1QB6A 1PPEE 2V3OH 1MCVA 3HPTB 2ZFPH 3ZZ9A