2DE9A

Crystal structure of porcine pancreatic elastase complexed with tris after soaking a tris-free solution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tris(hydroxymethyl)aminomethane induces conformational change and crystal-packing contraction of porcine pancreatic elastase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Elastase-1
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2de9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2de9A01
8LPRA 1IOEA 4NA8A 2QF3A 5JBTA 2ZNKH 1C2JA 4D76A 1KXFA 1E34B 2AMPA 2QC2A 1G32B 5DKMA 3RXOA 1RJXB 1MZDA 2FTLE 8KME2 1TPAE 4E7RG 5GJ4B 1P03A 3M35A 1GJCB 1HIAB 1HIAA 2UWLA 3RXKA 2A0QB 3V13A 3MU0A 1BITA 1HAYB 5FCRA 4X1NU 4YOGA 1O2MA 3RMLH 3GCNA 4BNRA 4DURA 2FO9A 1GDUA 1O2VA 3GCTF 3ZVCA 1THPB 1NRPH 2BMGB 1YLCA 3SHAH 3Q3YA 2ALPA 3WY8A 2WPLS 5DP4A 2BM2A 1SB1H 2SGEE 1HAVA 3KNXA 1V2MT 7KMEH 1CT0E 4AFSA 2WV4A 4B76A 2ZTZA 2BXUH 3RU4E 1TYNA 2IOTA 1GJ8B 1JBUH 2FOCA 2FX4A 3SUEA 5ESBA 3TLOA 4X1RU 3FANA 3H7OA 1P2KA 1BZXE 1LVOA 2BDBA 3GDVA 3S9AA 1J16A 5FAHA 1Z8RA 1FY4A 3ZVDA 5L6NH 5LGOA 5AFZH 1GMHF 4F4OC 3VB3A 3BG4C 1AU8A 1T8MA 6GCHG 2XC5A 3EA9A 4DIIH 3OSYA 1T8LA 1C1SA 4HFPB 1GI9B 4IBLH 2GTBA 2C8WB 1GBHA 1GJ6A 1P04A 2RCEA 3RXPA 3T26A 1EJAA 1Y5BT 5DO4H 4I8KA 2ZEBA 2O8LA 3GY8A 1P9SA 1LCYA 3RDZA 1TGCA 3P8NA 2FMJA 4A1VA 1YKTA 3F1SB 4CREA 5E2PA 1LVMA 1P2IA 1MH0A 2H1UA 1GBTA 1OP0A 2H5CA 2ZFTA 3PROA 4TY7A 2XBXA 1C5LH 4CRGA 2P16A 1H8IH 1GDQA 2JH5D 4YZUA 3ZYEA 1ZGIA 1O3KA 2ZI2H 1ZTLA 1BJVA 4Z0KA 3QTVH 3GISB 1WYKA 4BOHA 4WXIA 1SGFA 4TWYA 3B23B 4UFFH 3A8CA 7ESTE 1WAYB 1PPZA 4ZKOU 1DSUA 3M37A 3SQHE 1GBDA 1OYQA 3UREA 1QB1A 5A0BA 2ZFPH 1ZPBA 4X8TH 2BD3A 4A1XA 1FQ3A 4A6LA 1C5QA 1FDPA 4NZLA 4OS2A 3A88A 7GCHF 1OWDA 1MU6B 3A84A 2PSXA 5EQSA 1ZMJA 4SGBE 2EA3A 5T6FA 5EPNA 4GCHF 2HPQH 1J14A 3VB5A 1V6DA 4ZHAA 4Y71A 1BTHH 3PTBA 2WPIS 1NU7B 1OSSA 4TYDA 1VCQA 3KF2A 2BY8X 1RXPA 1ANDA 4MVNA 5F8ZA 1MQ5A 2RDLA 3UFAA 4I8HA 1JIMA 3RXLA 1H9LB 4X6MA 1NRNH 2ZO3H 3M7TA 3GY5A 1K1JA 1DE7H 4UFDH 3RXMA 3PLPA 2BY7X 1GCTB 2R3YA 1AZZA 1DDJA 3SNDA 1GJ9B 3LGVA 2R0LA 2GMTC 1ZTJA 1KLTA 1ELCA 1MAXA 4AFQA 3EGKH 1O3PB 2ZECA 1C4Y2 2A5IA 1DUAA 1YYY1 3D62A 1C1RA 1L1NA 1EJMA 1FUJA 1PPHE 2BDCA 1FN8A 1B0EA 3TNSA 1V2VT 2WUCA 2B7DH 1GVKB 1CHOG 1HB0B 2F83A 3RM0H 1S0RA 1RD3B 2SGFE 2TBSA 1BHXB 1C5OH 4B75A 3RLWH 1TMUH 5FXLA 3FP8E 3EAJA 4MPVA 1O38A 1AUJA 3SNCA 2FLRH 1SPJA 1UTKA 2ZF0H 3MNXA 4Z6AH 1O2OA 3E6PH 1RFNA 3SO3A 5AF9H 1C1OA 1SGNE 1NRSH 3E90B 3R3GB 5E8EH 2P59A 2AYWA 3DT0H 3QZRA 1NY22 4BTIB 1LMWB 2M5TA 4A1TA 1C2HA 2Z9KA 1AVWA 2PGBB 5DP9A 2Z94A 2ZU1A 1CA0B 1C2DA 4RN6A 3LGWA 2ZHDA 2CJIA 2FP7B 1ELVA 2AH4X 4H6TA 1S6HA 4ZAEA 3VEQB 1AUTC 4ZROA 4GLYA 1TX8A 1C1MA 2ZZUH 1T4VH 2G4TA 3Q3XA 1QIXB 1AVXA 3U8RH 1SGCA 1SGFG 1WTHD 4R8TB 4ZKNU 1XUJA 2ODYB 1KIGH 5JDUB 1D6WA 4JZEH 1FY8E 2YOLA 5C5NA 1O36A 4UEHH 2FM2A 2Y5FA 1O3MA 3GY7A 4DVAU 3SI4H 1BCUH 3I29A 3G01A 2AIPA 1Z6JH 1O2KA 4ABIA 3B9FH 4WH8A 1K2I1 2EC9H 1P10A 5GWZA 2B5TB 1GJBB 2PFEA 1HJAB 4YTAA 4BAQB 1KXBA 2NU4E 2HALA 2BZ6H 4X1QU 3QWCH 5EQQA 1EAUA 1O5AB 3BEIB 1RS0A 3M3VA 2B0FA 4Y7BA 2DE9A 4AX9H 2PUXB 3SHCH 5E0JA 2ZDMA 1UCYE 3UNRA 3RC6A 3ZZBA 4K5ZA 5F8XA 1FMGA 2WINI 1Q31A 4U01A 1UK3A 1Q2WA 3RXCA 1VITF 1C2MA 1Z6EA 1NU9A 3RMOH 4X8UH 1CGHA 2ASUB 3ZZAA 3SU4A 1ZOMA 2D1JA 3BEUA 2Y7XA 3UNSA 2EI8A 2ZIQH 3M3TA 5BRRE 2QN5T 4WVPE 1ZHPA 3T29A 1C2KA 4TPYA 1VR1H 2BQ7B 2NU3E 1MKXH 1GI1A 2ANMH 1FIZA 3S69A 3V3MA 1UVTH 4X6PA 3EYDA 3S0NA 1ZMLA 1Y8TA 1HPGA 1THSH 2NU0E 3ZZ9A 1BBRK 1FIWA 1T7CA 1WTGH 2OINA 3K65B 1RIWB 1O2NA 3ZZ6A 4UD9H 4UDWH 1BBRH 1JXPA 1O2XA 5CHAB 2GMTB 1PPCE 1G3BA 1UTNA 4H4FA 1TLDA 2ZFSA 1HLTH 1CVWH 5EOKA 2WPKS 1W7GH 2AIQA 3PMHB 4XBDA 4Y79A 2FS8A 2GZ9A 3GCHB 1EZQA 2TGPZ 1HAPH 3GDUA 4Y0YE 4AYVB 4OS7A 3ENSB 4HGCA 1EOLA 4U2WA 1O30A 1QL9A 2ZP0H 3Q3KA 1C9PA 3T62A 1HYLA 1C1NA 2ZTXA 3BTDE 1QY6A 1ARCA 4DJZB 1SFQB 1Y3YA 4IC6A 4X1PU 1C9TA 1ZJDA 2GVFA 2ZU4A 3M7UA 1K1OA 4OS1A 4IC5A 3KL6A 1TQ0B 3A87A 1P06A 3SJKA 4ISLA 2HWLB 1P57B 3E0NB 1TOMH 1VITH 1HJAC 2BVXH 1V2ST 1O5DH 3M3SA 1C2FA 3FZDA 2OCVB 2XW9A 1DM4B 1SGRE 2FTMA 3RXJA 2GDEH 2PGQB 3K9XB 2THFB 1KXDA 4X8SH 1GBKA 1F5LA 2Y80A 2ZGHA 2ZGXH 1UHBA 3RXFA 4Q7YA 1ELAA 5TCCA 3SW2B 5ETXA 1SGDE 3KQDA 1ETRH 1QQ4A 1TPSA 2A1DB 1O3NA 3C27B 4D8NA 1QBNA 4DG4A 3UOUA 1O3HA 1C5SA 1PPBH 1XUHA 1WUNH 2ANKH 2GZ7A 4WY3A 3ATWA 4K1EA 1EQ9A 3SGBE 4THNH 4FUFA 1DY9A 3BTWE 3PWBA 4BTTB 2FOEA 4MNYA 4CBNA 3VGCC 1T8OA 1O35A 4X6OA 1TBZH 2A4RA 2A7HA 4YLQH 1XUGA 2HNTE 4OS6A 4LK4A 1OP8A 1O3JA 2IPHA 3A83A 4I32A 1LHGH 1SSXA 4DCDA 1GMDG 1UJ1A 3BTME 2BXTH 1DWEH 4KTSA 2R9PA 4IN2A 4CHAB 4UFGH 5DK1A 4Q80A 1Y5UT 3NPSA 1IQNA 4E05H 1TMBH 1MKWH 3LT3A 1UCYK 1P2NA 4KTUA 2QXHA 1K1IA 2BB4A 1G3EA 1MCTA 3A7VA 1QNJA 1OWKA 4CH8B 3L3TA 1AFEH 1PPFE 1QQUA 5C1XA 1C2EA 1N8OB 3A7ZA 1NFWA 4H6SB 4ABGA 3PMAB 1A5IA 2BLVA 2XCFA 2A31A 1ZR0A 4BTUB 2BD8A 4ABDA 1F92A 2D2DA 3FVFB 4Q7XA 2SNVA 5C67A 2C8XB 1WU1A 2ZHFH 1W12U 2BVRH 1XVMA 1C1PA 1YC0A 1NESE 1O3DA 4O03A 4FUDA 3TGKE 3GY3A 1W7XH 3GY4A 3TPIZ 1TONA 2K1QA 4D9QA 3PO1B 1ELEE 1W11U 1Y3VA 2Z3EA 2GCTB 3DFLA 2G4UA 1A3BH 2YNBA 3ZVAA 1O3AA 3E0PB 1A5GH 1FONA 1V2KT 1KLIH 4CH2B 1LPKB 1O2JA 4E06H 3A80A 4ZHMU 1DITH 1QRWA 3MH6A 4Y8YA 3RP2A 1G36A 2GV6A 1N6YA 1K28D 1XUKA 3UTUH 2A5AA 3TJVA 5JB8S 1ANCA 3L6PA 2BD4A 3VXFH 4MPUA 1GL0E 4O9VA 4WJG2 1AD8H 4O97A 1LKBA 4WMEA 5AVDA 1O2SA 1O0DH 1GHAG 2BD9A 5LPRA 2STBE 2BTCE 1IQLA 4QT8C 3D23A 5TCAA 2H6MA 1SGYE 1TGSZ 4FVBA 3RC5A 4AORA 1IAUA 1OWJA 3BIVH 1TAWA 2G55A 1EXFA 3TVJB 1SQTA 3GY6A 1YPLH 1Y5AT 1C5YB 1K21H 1TRNA 1DS2E 1AVGH 1GGDC 1ZSLA 2BQWB 1A1RA 1K9OE 4WF8A 1IHTH 4JZIA 1CA8B 1V2TT 1CGIE 1CSOE 1O3IA 2I6QA 3SZNA 1AWHB 3VB7A 1TQ7B 2VVUA 3OX7U 1SI5H 1A3EH 5EU8A 3SBKA 3SQEE 3S7KB 4B1TA 4INHA 4B2BA 3A89A 8ESTE 1GI0A 5IDKA 3ZVFA 2FI5E 4WMDA 1GBMA 3MO3A 1RIWC 5GXPA 4DIHH 1HXEH 2Y6TA 4NG9H 1SOTA 2A45B 4UONA 2JETB 3QN7A 1EUFA 2TIOA 1E38B 3E1XB 4IMQA 3JZ1B 1SLWB 1T32A 4ZHLU 1MQ6A 1VGCB 1XX9A 5GPIB 2GCHF 5JBAS 1GVZA 5HXFA 1V2PT 2H9EH 1ZSKA 2P93A 3PTNA 5E0HA 1KDQA 3SU5A 1VCWA 4NA7A 5DP6A 1BMMH 4U30A 1KY9A 4GPGA 2ZDKA 1TNGA 1IQGA 1CQQA 4O3UA 5FPYA 1UVPA 5AHGH 1W3CA 1ESTA 1QJ6B 2EI6A 1LQEA 1RTFB 1TBQH 1W2KH 5HM2A 2GP9B 5HYOA 2J9NA 1TPPA 3NZIA 5A8ZA 1TWXB 2EEKA 3U9AH 1OX1A 2SGAA 2G00A 4ZKSU 3RXGA 1TA2A 4ZKRU 2C4FH 3RU4T 3IITA 3EQ0H 1L4ZA 2FOMB 1EAWA 1EP5A 3RXSA 5PTPA 1AKSB 1GHAF 3GYMA 1P01A 1AB9B 2WV5A 4ISOA 5B6OA 4K1SA 1B0FA 1F5KU 1FAKH 3AW1A 4B73A 1KSNA 5FPTA 3SU6A 3RXIA 4GHTA 1L2EA 3LGIA 3A85A 3SU2A 4GVUA 2XTTB 1QURH 4NWKA 3QZQA 1EAIA 1QGFA 3BG8A 4K1TA 2Z9LA 4IN1A 1C5XB 4XOJA 1QJ7B 2ZGCA 1TX6A 1NRRH 4HTCH 3OU0A 2HLCA 1NTPA 1G37A 3F68H 4MQAA 4BAKB 1A0JA 1HDTH 1ELBA 1BTPA 1GMCG 1SGTA 3R0FA 3PLKA 1QTFA 3UUZA 4AN7A 1GHYH 3TK9A 3UIRA 1OYTH 2O9QA 5JPMH 3V0XA 1ZLRA 1BMAA 2QXGA 3KGPA 1OWIA 2GDDA 2ZPRA 2D8WA 2ZGJA 2BLWA 3MNSA 4DGJA 4ISIH 4I8GA 2Q6GA 1CE5A 5DP7A 2C8ZB 4J1YA 2Z3DA 2ZDAH 1D3DB 1KLJH 4JZ1A 4NIYA 3MO6A 5HM9A 4OGXA 4K60A 1YPJH 3I78A 3LDXH 1AN1E 4Y6DA 1SGEE 3P8GA 4B74A 1BTXA 1PYTC 3ZVBA 4BANB 3S9BA 1FNIA 1OPHB 2Y5HA 5EPYA 4ZH8A 3SU1A 4MPWA 4INKA 2FEQH 2OBQA 3UNQA 2PKAA 3PM3A 1PQ5A 5CHAC 2BD5A 3QDZB 2VVCA 1TE0A 2BDIA 2VB0A 1Y59T 2FODA 4FUBA 1KYNA 1SHYA 4K69A 4MNWA 7GCHG 1W0YH 2XXLA 3HKJB 4B71A 1B7XB 2GV7A 4H42U 1S6FA 1LVBA 3E3TA 1PFXC 1V2UT 1ELFA 1KXCA 1QL7A 2ZHWH 3IWMA 4Y8XA 3RXEA 3VFEA 1KXAA 3GDSA 2FOHA 1V2NT 3F9GA 1O33A 1H4WA 3D65E 2O8MA 5DP5A 1XUIA 1G2LA 3MU4A 4ABJA 4CHAC 1WCZA 3LH3A 4ISNA 1KDQB 1GDNA 1GL1A 3LKWA 2B8OH 4TY6A 2V35A 3MU5A 4AFUA 1OXGA 1TNJA 2BHGA 2AMDA 2PTNA 1BTUA 1XXFA 3FZZA 2C8YB 4GHQA 1P8VC 4TWWA 1C5ZB 2GCHG 2R2WU 5T6GA 2HNTF 1PYTD 6CHAC 3DA9B 2F9VA 1HAGE 1XMNB 3TJUA 2BOHB 3MYWA 2PKAB 1HUTH 1UO6A 1SQOA 1GBCA 1C1TA 1V2RT 3QX5H 4KTCA 2FDAA 1TGNA 3LPRA 1TALA 3P92A 1O2PA 1ZTKA 2W7SA 2YNAA 3ELAH 3A8BA 4RSPA 4VGCB 5DGJA 3SGAE 1D6RA 3T25A 1NFYA 4ESTE 3A7XA 1EZXC 1YPGH 2SGQE 4ZXXH 1SFIA 3MI4A 1EZUC 1SHHB 1O2YA 3P6ZB 4NGAH 1E35B 3NWUA 8GCHF 1C5UA 2FXRA 3BTTE 3MH7A 1O5FH 3RXAA 3RC4A 1YPMH 4BAOB 3O8RA 2AFQB 3P95A 2V6NA 4CR5A 1DFPA 1GBEA 3ZZDA 2J4IA 2F91A 2VIPA 2Y5GA 1AY6H 1SGQE 5C1YA 4YESB 1MBMA 4ABFA 1MMJN 1EP6A 1DWCH 3SV7A 3SNBA 1ZGVA 3AVZA 1O2TA 2O8WA 1S5SA 2G81E 2KAIA 3JZ2B 3SI3H 1L1GA 1P02A 1WSSH 4D7GA 1WBGB 3S7HB 3HGPA 2IJOB 1HAVB 3C1KA 2SFAA 1GCDA 1K1PA 1EOJA 4XE4A 1HAOH 3Q76A 2OUAA 2FX6A 4I8LA 1BJUA 1GPZA 2STAE 1YPKH 2VJ1A 3A8DA 2W5EA 5A2MH 1PQAA 1DXWA 3U1JB 3ZZ8A 1A2CH 1CT2E 1ABJH 3K6YA 1TPOA 1TRYA 1C1QA 2F3CE 3T5FH 1BIOA 2IN2A 2AEIH 1C2LA 2J95A 4MG3A 1AWFH 3VB6A 1NROH 2FLBH 1DICA 1W13U 1DOJA 1Y3WA 1ZJKA 3MNCA 4Y8ZA 1CHGA 1QCPA 2RG3A 4FUEA 3ZZ3A 3STJA 1GBFA 1GG6B 1LQDB 1SOZA 1HAXB 4X2XA 1LHCH 1BTZA 1BTWA 5K7RA 1HAZB 1SG8B 1KTTB 5A09A 1CGJE 3FP7E 3NUMA 2OC0A 4A7IB 1ZRKA 2VIVA 1G3CA 2NU1E 1NFXA 3MTYA 1C5VA 2V0BA 4ABEA 3RXHA 2ZC9H 4JK6A 4ZUHA 3LGUA 1O2HA 4IS5A 1QR3E 1TNLA 3M36A 5DPAA 1P2QA 4X0WU 1YPEH 2FOGA 1MTNC 4GUXA 5HGGA 2QCYA 4OGYA 1AHTH 1W0ZU 2CF9H 1MUEB 2WPMS 2HOBA 2QXJA 3QGJA 1RTKA 3TH4H 1HNEE 3SJ9A 1A61H 1D3QB 3RXTA 1EJNA 2W7UA 2BDGA 2GX4A 4WH6A 3UPEA 2W3IA 3MU8A 3O8CA 1HGTH 1OOKB 4U32A 2OC7A 2ZU2A 2G8TA 3SU0A 4YM9A 1J8AA 3F9FA 3A86A 1GJ4H 3EA7A 1QFKH 2F9UA 2FOBA 1TABE 2QA9E 2HNTC 5FCKA 3KCGH 1YBWA 4DOQA 4GSOA 1O2RA 5GIBA 1ZMNA 2R2MB 3VPKA 4AYYB 1DANH 2ALVA 3ITIA 4AOQA 2WPJS 1GHXH 4JYTA 1ZRBA 2H9HA 4FUIA 1EZSC 4NIXA 2G51A 3T28A 1HCGA 5A0CA 1GHWH 1EKBB 2J94A 2UUJB 3W95A 1UTJA 1NS3A 2C90B 1NZQH 1U6QA 2Q6FA 3BG4B 3V12A 1YP9A 1MKWK 1GHVH 1BHXF 3F9EA 1ORFA 4K3JA 3PV4A 2GD4B 2ZCHP 3UY9A 1J15A 2CN0H 1AIXH 3MHWU 2P3TB 1GJ7B 1WV7H 2W26A 3ZV8A 3RXBA 3KIDU 1GI5A 3SUDA 5L30H 3SJOA 1SL3A 8GCHG 2VINA 1D3TB 1JOUB 3DFJA 4X2VA 1YCPK 4I33A 1O2GH 2WYJA 3LGTA 1NFUA 3U8OH 4X8VH 4CRDA 1AE8H 1D9IA 3M5NA 1KXEA 2UUYA 3OYPA 1ABIH 2ZHEH 5K0HA 2CGAA 1B5GH 3E16B 3AAUA 2BZAA 3I77A 2P8OB 2NU2E 2RA3A 1TRMA 1EPTA 1W8BH 2VWOA 1HFDA 3A7YA 3MFJA 3RLYH 1H8DH 3ODFA 2HGTH 1YF4A 3LJJA 2PV9B 1P3EA 1P12E 2A7JA 5EGMA 4ZXYH 1C1WH 1AZ8A 2CF8H 1FY3A 4CRAA 3SUGA 1IQFA 1IQEA 3BTEE 1CO7E 5DP3A 3T2NA 3URCA 4Y0ZE 1LHFH 3U1IB 2B9LA 3UWJH 1EAXA 5H4IB 1VCPA 4NFEA 4FXGH 5GCHF 1TA6A 1NRQH 4I7YH 2QF0A 1P2OA 3TNTA 4YT6H 5J4SA 5JB9S 1QRXA 3KEEA 4JZFH 5EXLA 3CENA 4HI3A 3TK5A 3SORA 2TRMA 1WQVH 3MWIU 4X2WA 1AQ7A 4CRCA 2OXSA 2FS9A 1IHSH 2RA0A 3GYLB 3RUOA 2V3OH 3GOVB 3LOXA 4Y10E 3MNBA 3HATH 2QYIA 3ZVGA 1Y3UA 3UR9A 3P70B 1V2JT 1C2IA 1QA0A 5A8YA 1AGJA 3CS0A 4UE7H 1C1VH 1XUFA 2Y81A 5DP8A 1O37A 2UUKB 1H1BA 1MD7A 1P2MA 1V2LT 5EODA 4JCNA 2FOFA 2FYRA 3AW0A 1O3CA 2Z3CA 2BQ6B 1PQ7A 5EG4A 1VJ9U 5L2YH 1IQHA 3BF6H 2G5NA 2XRCA 4OS5A 1P2JA 2OBOA 1IQKA 1GI6A 3SV6A 1YPHE 2QIQA 6GCHF 5J4QA 1O34A 4JYUH 4AZ2B 1IQMA 3ATKA 2ZFRH 1C5RA 2OC1A 1FY5A 5FBIA 1GBJA 2TGTA 2FPZA 2PWXA 3TJNA 4NFFA 3A82A 2JH0D 4Y76A 5FHTA 3TU7H 1DWBH 2GT8A 3DUXH 1OP2A 4KKDA 1P0SH 3M5LA 1GBIA 2XYAA 1O5EH 1FXYA 2ZPQA 3RXUA 4B2CA 1G30B 5T6DA 1V2OT 1O31A 2ZG0H 1YCPM 1S83A 4ASHA 3TGIE 2ZPSA 2BYAX 3CP7A 1PPGE 2PUQH 1UTLM 2OD3B 4UFEH 2VWMA 4LZ4B 2OTVA 2VIQA 3ZVEA 3T27A 2AGIX 1ELDE 4AB8A 5SGAE 1GHBF 1FZZA 1XXDA 2DUCA 1NO9H 2VWLA 2BD2A 2P94A 2TGDA 3ZZCA 1BMLA 3PO1C 2AERH 3RU4D 1LDTT 1P11E 1P05A 1DLKB 1C5PA 5F8TA 3N7OA 1K1LA 3TH3H 3ZYDA 4XSKU 4GCHG 2W3KA 1F0SA 2FESH 1SQAA 4WXVA 1UTOA 3BTGE 2D26C 1GI2A 2PR3A 4AGKA 1INCA 2NWNA 4FUCA 1SLUB 4NSVA 1SGPE 1TNHA 1UVUH 4ISHH 1LPZB 3U69H 3LIWA 4FU7A 3QLPH 4AG2A 3MOCA 1A7SA 1UMAH 3QK1A 2A4OA 5C5OA 3V7TA 1A46H 1O2ZA 2ZCKP 2BOKA 2Z9GA 1F0UA 3EDXB 2P95A 4KGAA 1HV7A 2G52A 4LXBH 1S82A 2ZQ1A 1S85A 3BN9A 2ZQ2A 1FI8A 4XFQA 3H7TA 1YLDA 3O8BA 2CHAC 4ABBA 3PMBB 1GJDB 4ABHA 4HZHA 3F6UH 2LNCA 4SGAE 2ESTE 1D3PB 3VGCB 2I6SA 1BRUP 4YOIA 4RKOB 1O5CB 5C20A 4FU8A 4IGDA 4X2YA 4DW2U 3QO6A 1O3BA 4YOJA 1Z8IB 2FWWA 1ETTH 1ZPZA 5G4BA 1GI8B 4BXWA 4ZMAH 7LPRA 1FAXA 2EI7A 3U8TH 2GT7A 2FIRH 5LH8A 1QHRB 4MDSA 1THRH 2QGRA 1BDAA 3ESTA 1FPCH 4MPXA 4AFZA 5DJ7A 1HXFH 3U98H 4MLFB 2JETC 3TH2H 3PB1E 1HRTH 2R3UA 2PKSB 3HK6B 1MD8A 5ABWA 1TOCB 2ZDVH 1QA7A 2SNWA 3GCOA 4A5TS 4K2YA 1WOFA 1FN6A 1UK4A 2JKHA 2Y7ZA 1VJAU 2WPHS 1GHZA 1O39A 2VVVA 4CRBA 3NCLA 3LONA 3FAOA 1ANBA 3B8JA 3KQEA 5E2OA 1O2QA 1MKXK 1A0LA 3TJOA 5DG6A 3TK6A 2XWBI 5F6MA 1S84A 1DY8A 1O2WA 3NXPA 2CHAB 1WQSA 2VH6A 1DLEA 4YT7H 4IMZA 3M7QA 1MZAA 1ZHRA 4WWYA 1X7AC 1HAIH 3HKIB 1DUEA 2R0KA 4INLA 1V2QT 2BY9X 2FI4E 3NK8A 1C5MD 1ZZZA 2ZFFH 1C5WB 4TPIZ 3K6ZA 1MTSA 4F49A 1CHOF 4YLUA 2OLGA 1FPHH 3SV9A 4DY7B 1P3CA 2WYGA 1UVSH 2FOAA 1LPGB 3UR6A 4R0IA 4NWLA 3BV9B 3DD2H 4D9RA 1ELGA 2V3HH 4MNVA 4PROA 5TJXA 2PTCE 3PMJA 4BAHB 3VB4A 1UTPA 1NM6A 3UOPA 1DSTA 3LH1A 2QAAA 5C2ZA 1DT2A 2CMYA 3MMGA 1GVLA 1TGTA 5EQRA 3SN8A 1AB9C 2XWAA 1EX3A 1GHBG 2ZHQH 1JIRA 1YGCH 1GCTC 2BLOA 4NA9H 3HPTB 1BOQA 3MU1A 1D4PB 1W14U 2XBWA 2BX3A 1FJSA 2SGPE 1E0FD 1T8NA 2A32A 1H9HE 1QB9A 1CT4E 1GJ5H 4NZQA 3KQBA 2O8TA 3BTFE 3SOSA 3URDA 4LOYH 1DXPA 1L4DA 1PJPA 2AS9A 3P8FA 1RTLA 1LVYA 1ZYOA 1QRZA 1SLXB 4KP0A 2J34A 5LPFA 1DVAH 4XDEA 5AFYH 2PHBA 1O32A 3H5CB 1O3EA 4X1SU 4A92A 1F5RA 3TITA 1BBRE 1QL8A 6ESTA 2DE8A 3CS7A 1G9IE 3UQVA 3GCHC 3LGYA 1A4WH 2TPIZ 5JBCS 1GMHG 1O2IA 3BTQE 1JMOH 3KN2A 4CRFA 4YO9A 2ZDLA 2OQ5A 1CU1A 9ESTA 1MAYA 2UUFB 5FBEA 1LO6A 4LZ1H 1GWAA 4Y7AA 1AO5A 1VGCC 2Q1JA 3AAVA 3RMNH 4XBBA 1MBQA 1TNIA 2XC4A 4X6NA 2GCTC 2BDAA 2VU8E 2Z7FE 5CE1A 4BXSA 1EPTC 5BPEA 1K1NA 1EASA 3RXDA 1BRCE 2VIWA 4Q2KA 5JYIA 4MNXA 3L33A 2CXVA 1F0TA 1OS8A 2TGAA 2Y82A 4JK5A 3RXRA 4FU9A 1YCPH 1DWDH 2OQUA 1SC8U 2H9TH 4ABAA 2ZKSA 1EB2A 2AGGX 2OC8A 1UCYH 4FUHA 6CHAB 3KHVA 1BMNH 1F2SE 1GI3A 2A2QH 1GGDB 3BTKE 1BQYA 3OY6U 1ANEA 1TMTH 2J2UA 4E7NA 1BUIA 2ULLA 1XKBC 1G3DA 4AB9A 1DPOA 1UVOA 1HJ9A 1F0RA 1BB0B 1KTSB 1ZSJA 1HAHH 1N8OC 1NT1A 1C4V2 3QTOH 2XCNA 1BT7A 2GKVE 5I25A 4MTBA 5EW1H 5IYTA 3LU9B 2VH0A 4JZDH 5GCHG 4CR9A 1OWHA 2C3SA 3GY2A 1QB6A 2UWPA 3M61U 1SMFE 3QUMP 1O3LA 2FYQA 1ZPCA 1HJ8A 3F9HA 1PPEE 2GGVB 3EA8A 1JRTA 1NN6A 2WUBA 1O5BB 1PQ8A 1C5TA 1OKXA 1ESBA 2HVXA 2F9BH 3PWCA 4OS4A 1SBWA 1K1MA 2H2ZA 2J38A 2BY5X 1EB1H 2J92A 2BLQA 2OP9A 2P3FH 2ZA5A 3EE0B 1GI7B 2G5VA 2KAIB 2UWOA 2QY0B 1T31A 2ANYA 2VIOA 1L1JA 3A7TA 3TIUA 3S9CA 1AMHA 5F03A 5JBBS 1L0ZA 2ANWA 3MH4A 2ZU3A 3QGNB 9LPRA 2BX4A 2ODPA 3ZZ4A 5A8XA 1SR5C 1P09A 1UTMA 5EW2H 3BIUH 3STIA 1GMCF 1P9UA 3RM2H 3E8LA 1EATA 1HBTH 1S0QA 1C1UH 1Z8JB 3MO9A 1ESAA 3ZV9A 1CA0C 3ODDA 3ATIA 3SGQE 2VNTA 2BD7A 4AGJA 4NIWA 3PLBA 2A4GA 2ZTYA 2PSYA 3KQCA 4NCYA 3LC5A 3SUFA 3SU3A 1AE5A 3OY5U 2Z9JA 3K2UA 1M9UA 4GAWA 1AFQC 3RXQA 4B2AA 1ELTA 1XKAC 2QXIA 4NIVA 3FFGA 5T3HA 3A7WA 1BRBE 2XBYA 2SGDE 1AI8H 1CBWC 4DT7B 1AFQB 2XC0A 3SV2H 3UQOA 3AASA 3FP6E 3RXVA 1IQIA 3GICB 1GG6C 1TFXA 1XM1A 2VGCC 1O3GA 2P3UB 3ZZ7A 1QBVH 3DHKH 5HMAA 4K8BA 1N6XA 1O2UA 3SNEA 3P17H 3Q77A 1TNKA 2A2XH 1Z8GA 1DX5M 2O8UA 3A8AA 4M7GA 1LHDH 1Z1IA 3W94A 2GZ8A 1OWEA 1YPHC 4RKJB 1O5GH 4JYVH 1RGQA 4FUGA 1Y3XA 5I46H 3BSQA 3A81A 2Q6DA 2JH6D 2AGEX 3P8OA 3OTJE 1FLEE 2A7CA 4FVDA 1GBBA 3HK3B 3LJOA 1QBOA 5FX5A 2BDHA 3Q00A 1GI4A 3MH5A 2BVSH 1O3FA 2F9OA 1F7ZA 3ZZ5A 1UHBB 2PW8H 3IG6B 1UTQA 2FZZA 2HRVA 1O3OA 3PYHA 2P8OC 1MTNB 3VXEH 4CBOA 5EXNA 1TGBA 5C3NA 3SJIA 2FI3E 2VIDA 4I31A 1MCVA 1Z1JA 1E36B 1MU8B 3RMMH 1BRAA 1BTYA 3M5MA 3NKKA 1GMDF 1LKAA 2BDYA 1UK2A 1IQJA 2ILNA 2Z6BD 5E0GA 6LPRA 3D49H 1CBWB 1FY1A 5FPSA 2BY6X 1VITG 1SVPA 1J17T 3HGNA 5EXMA 2F9NA 1ID5H 4I8JA 2VGCB 3TGJE 2ZCLP 1C4U2 1GJAB 2XNIA 1ACBE 2F9PA 4KELA 3SJ8A 1W10U 4D7FA 2ZDNA 1YM0A 3SV8A 2VWNA 3E91A 2ZWLH 1ZHMA 5A0AE 3LC3A 1V2WT 1Z71A 2C93B 1J9CH 5GDSH 4JMYA 2XBVA 2A4QA 1QJ1B 3BEFB 1N1LA 1Q3XA 2ODQA 4VGCC 1ARBA 2QV1A 1FV9A 1AKSA 1H9IE 1MTWA 2PKSC 5ESTE 1SGIB 4Y11E 2ZGBH 4FUJA 4Q7ZA 5L2ZH 4K8YA 1NC6A 1E37B 1EPTB 1A0HB 1VZQH 2ZU5A 2H5DA 3ATMA 4NSYA 2Z9IA 4AG1A 1V3XA 5LPEA 1TIOA 1XVOA 1Z7KA 3UWIA 1A5HA 1TBRH 1TB6H 1C5NH 1SLVB 1MTUA 1O2LA 5CMXH 1G2MA 1K22H 2ZFQH 1MTVA 1LHEH 1JRSA 3SNAA 3ATLA 2HPPH 5C1UA 1GBLA 2A5KA 2PLXA 4BAMB 1BA8B 1C2GA 4XBCA 1GBAA 3O8DA 3M5OA 1JWTA 1TX7A 4J2YB 3GCTG 1NPMA 3BTHE 4WMFA 1ETSH 4IW4E 2AMQA 1LTOA 4O3TA 5FX6A 1S81A 2LPRA 1RRKA 1T4UH 2CV3A
chains in the Genus database with same CATH superfamily
8LPRA 1IOEA 3KQ5A 4NA8A 2QF3A 5JBTA 2ZNKH 1C2JA 4D76A 1KXFA 1E34B 2AMPA 2QC2A 1G32B 5DKMA 3RXOA 1RJXB 1MZDA 2FTLE 8KME2 1TPAE 4E7RG 5EIYA 5GJ4B 1P03A 3M35A 1GJCB 1HIAB 1HIAA 5C17A 2XOKD 2UWLA 3KYGA 4RT1A 3RXKA 2A0QB 3V13A 3MU0A 1BITA 5CDFE 1HAYB 5FCRA 4X1NU 4YOGA 1O2MA 3F2FA 3RMLH 3F3BA 3GCNA 4BNRA 4DURA 2FO9A 1GDUA 1O2VA 3GCTF 3ZVCA 1THPB 1NRPH 2BMGB 1YLCA 3SHAH 3Q3YA 2ALPA 3WY8A 2WPLS 5DP4A 2BM2A 1SB1H 2SGEE 1HAVA 3KNXA 1V2MT 7KMEH 1CT0E 4AFSA 2WV4A 4RT0A 4B76A 2ZTZA 2BXUH 3RU4E 1TYNA 2IOTA 1GJ8B 2QE7D 1JBUH 2FOCA 2FX4A 3SUEA 5ESBA 3TLOA 4X1RU 3FANA 5FL7D 3H7OA 1P2KA 1BZXE 1LVOA 2BDBA 3GDVA 3S9AA 1J16A 5FAHA 1Z8RA 1FY4A 3ZVDA 5L6NH 5LGOA 5AFZH 4AC9A 1GMHF 4F4OC 3VB3A 3BG4C 1AU8A 1T8MA 6GCHG 2XC5A 3EA9A 4DIIH 3OSYA 1T8LA 1C1SA 4HFPB 1GI9B 4IBLH 2GTBA 2C8WB 1GBHA 1GJ6A 1P04A 2RCEA 3RXPA 3T26A 1EJAA 1Y5BT 5DO4H 1K0HA 4I8KA 2ZEBA 2O8LA 3GY8A 1P9SA 1LCYA 3RDZA 1TGCA 3P8NA 2FMJA 4A1VA 1YKTA 3F1SB 4CREA 5E2PA 1LVMA 1P2IA 1MH0A 2H1UA 1GBTA 1OP0A 2H5CA 2ZFTA 3PROA 2QF4A 4TY7A 2XBXA 1C5LH 4CRGA 2P16A 1H8IH 1GDQA 2JH5D 5EJ1A 4YZUA 3ZYEA 1ZGIA 1O3KA 2ZI2H 1ZTLA 1BJVA 4Z0KA 3QTVH 3GISB 1WYKA 4BOHA 4WXIA 1SGFA 4TWYA 3B23B 4UFFH 3A8CA 7ESTE 1WAYB 1PPZA 4ZKOU 1DSUA 3M37A 3SQHE 2KZ4A 1GBDA 1OYQA 1VKYA 3UREA 1QB1A 5A0BA 2ZFPH 1ZPBA 4X8TH 2BD3A 4A1XA 1FQ3A 4A6LA 1C5QA 1OHHD 1FDPA 4NZLA 4OS2A 3A88A 7GCHF 1OWDA 2OK5A 1MU6B 3A84A 2PSXA 5EQSA 1ZMJA 4SGBE 2EA3A 5T6FA 5EPNA 4GCHF 2HPQH 1J14A 3VB5A 1V6DA 4ZHAA 4Y71A 1BTHH 3PTBA 2WPIS 1NU7B 1OSSA 4TYDA 1VCQA 3KF2A 2BY8X 1RXPA 1ANDA 4MVNA 5F8ZA 1MQ5A 2RDLA 3UFAA 4I8HA 1JIMA 3RXLA 1H9LB 4X6MA 1NRNH 5KEDA 2ZO3H 3M7TA 3GY5A 1K1JA 1DE7H 4UFDH 3RXMA 3PLPA 2BY7X 1GCTB 2R3YA 1AZZA 1DDJA 3SNDA 2RDEA 1GJ9B 3LGVA 2R0LA 2GMTC 1ZTJA 1KLTA 1ELCA 1MAXA 4AFQA 3EGKH 1O3PB 2ZECA 1C4Y2 2A5IA 1DUAA 1YYY1 3D62A 1C1RA 1L1NA 1EJMA 1FUJA 1PPHE 2BDCA 1FN8A 1B0EA 3TNSA 1V2VT 2WUCA 2B7DH 1GVKB 1CHOG 1HB0B 2F83A 3RM0H 2F4LA 1S0RA 1RD3B 2SGFE 2TBSA 1BHXB 1C5OH 4B75A 3RLWH 1TMUH 5FXLA 3FP8E 3EAJA 3OFND 4MPVA 1O38A 1AUJA 3SNCA 2FLRH 1SPJA 1UTKA 2ZF0H 3MNXA 4Z6AH 1O2OA 3E6PH 1RFNA 3SO3A 5AF9H 1C1OA 1SGNE 1BMFD 1NRSH 3E90B 3R3GB 5E8EH 2P59A 2AYWA 3DT0H 3QZRA 1NY22 2KCOA 4BTIB 1LMWB 2M5TA 4A1TA 1C2HA 2Z9KA 1AVWA 2PGBB 5DP9A 2Z94A 2ZU1A 1CA0B 1C2DA 4RN6A 3LGWA 2ZHDA 2CJIA 2FP7B 1ELVA 2AH4X 4H6TA 1S6HA 4ZAEA 3VEQB 1AUTC 4ZROA 4GLYA 1TX8A 1C1MA 2ZZUH 1T4VH 2G4TA 3Q3XA 1QIXB 1AVXA 3U8RH 1SGCA 1SGFG 1WTHD 4R8TB 4ZKNU 1XUJA 2ODYB 1KIGH 5JDUB 1D6WA 4JZEH 1FY8E 2YOLA 5C5NA 1O36A 4UEHH 2FM2A 2Y5FA 1O3MA 3GY7A 4DVAU 3SI4H 1BCUH 3I29A 3G01A 2AIPA 1Z6JH 1O2KA 4ABIA 3B9FH 3EE7A 5EJLA 4WH8A 1K2I1 2EC9H 1P10A 5GWZA 2B5TB 1GJBB 2PFEA 1HJAB 4YTAA 4BAQB 1KXBA 2NU4E 2HALA 2BZ6H 4X1QU 3QWCH 5EQQA 1EAUA 1O5AB 3BEIB 1RS0A 3M3VA 2B0FA 4Y7BA 2DE9A 3PV2A 4AX9H 2PUXB 3SHCH 5E0JA 2ZDMA 1UCYE 3UNRA 3RC6A 3ZZBA 2LP6A 3ZIAD 4K5ZA 5F8XA 1FMGA 2WINI 1Q31A 4U01A 1UK3A 1Q2WA 3RXCA 1VITF 1C2MA 1Z6EA 1NU9A 3RMOH 4X8UH 1CGHA 2ASUB 2WHXA 3ZZAA 3SU4A 1ZOMA 2D1JA 3BEUA 2Y7XA 3UNSA 2EI8A 2ZIQH 3M3TA 5BRRE 2QN5T 4WVPE 1ZHPA 3T29A 1C2KA 2KFWA 4TPYA 1VR1H 2BQ7B 2NU3E 3F0OA 1MKXH 1GI1A 2ANMH 1FIZA 3S69A 3V3MA 1UVTH 4X6PA 3EYDA 3S0NA 1ZMLA 1Y8TA 1HPGA 1THSH 2NU0E 3ZZ9A 1BBRK 1FIWA 1T7CA 1WTGH 2OINA 3K65B 1RIWB 1O2NA 3ZZ6A 4UD9H 4UDWH 1BBRH 3VG8A 1JXPA 1O2XA 5CHAB 2GMTB 1PPCE 1G3BA 1UTNA 4H4FA 1TLDA 2ZFSA 1HLTH 1CVWH 5EOKA 2WPKS 1W7GH 2AIQA 3PMHB 4XBDA 4Y79A 2FS8A 2GZ9A 3GCHB 1EZQA 2TGPZ 3FN8A 1HAPH 3GDUA 4Y0YE 4AYVB 4OS7A 3ENSB 4HGCA 1EOLA 4U2WA 1O30A 1QL9A 2ZP0H 3Q3KA 1C9PA 3T62A 1HYLA 1C1NA 2ZTXA 3BTDE 1QY6A 1ARCA 4DJZB 1SFQB 1Y3YA 4IC6A 4X1PU 1C9TA 1ZJDA 2GVFA 2ZU4A 3M7UA 1K1OA 4OS1A 4IC5A 3KL6A 1TQ0B 3A87A 1P06A 3SJKA 4ISLA 2HWLB 1P57B 3E0NB 1TOMH 1VITH 1HJAC 2BVXH 1V2ST 1O5DH 3M3SA 1C2FA 3FZDA 2OCVB 2XW9A 1DM4B 1SGRE 2FTMA 3RXJA 2GDEH 2PGQB 5B6LA 3K9XB 2THFB 1KXDA 4X8SH 1GBKA 1F5LA 2Y80A 2ZGHA 2ZGXH 1UHBA 3RXFA 4Q7YA 1ELAA 5TCCA 3SW2B 5ETXA 1SGDE 3KQDA 1ETRH 1QQ4A 1TPSA 2A1DB 1O3NA 3C27B 4D8NA 1COWD 1QBNA 4DG4A 3UOUA 1O3HA 1C5SA 1PPBH 1XUHA 1WUNH 2ANKH 2GZ7A 4WY3A 3ATWA 4K1EA 4FOUC 1EQ9A 5HIYA 4THNH 3SGBE 4FUFA 1DY9A 3BTWE 3PWBA 4BTTB 2FOEA 4MNYA 4CBNA 3VGCC 1T8OA 1O35A 4X6OA 1TBZH 2A4RA 2A7HA 4YLQH 1XUGA 2HNTE 4OS6A 4LK4A 1OP8A 1O3JA 2IPHA 3A83A 4I32A 1LHGH 1SSXA 4DCDA 1GMDG 1UJ1A 3BTME 2BXTH 1DWEH 4KTSA 2R9PA 4IN2A 4RI0A 4CHAB 4UFGH 5DK1A 4Q80A 1Y5UT 3NPSA 4B6EA 1IQNA 4E05H 1TMBH 1MKWH 3LT3A 3FO8D 2L6OA 1UCYK 1P2NA 4KTUA 2QXHA 1K1IA 4TSFD 2BB4A 1H8HD 1G3EA 1MCTA 3A7VA 1QNJA 1OWKA 4CH8B 3L3TA 1AFEH 1PPFE 1QQUA 5C1XA 1C2EA 1N8OB 3A7ZA 1NFWA 4H6SB 4ABGA 3PMAB 1A5IA 2BLVA 2XCFA 2A31A 1ZR0A 4BTUB 2BD8A 4ABDA 1F92A 2D2DA 3FVFB 4Q7XA 2SNVA 4DT4A 3NRLA 5C67A 2C8XB 1WU1A 1SQRA 2ZHFH 1W12U 2BVRH 1XVMA 1C1PA 3KYFA 1YC0A 1NESE 1O3DA 4O03A 4FUDA 3TGKE 3GY3A 1W7XH 3GY4A 3TPIZ 1TONA 2K1QA 4D9QA 3PO1B 4F55A 1ELEE 1W11U 1Y3VA 2Z3EA 2GCTB 3DFLA 2G4UA 1A3BH 2YNBA 3ZVAA 1O3AA 3E0PB 1A5GH 1FONA 1V2KT 1KLIH 4CH2B 1LPKB 1O2JA 3CNRA 4E06H 3A80A 4ZHMU 1DITH 1QRWA 3MH6A 4Y8YA 3RP2A 1G36A 2GV6A 3DSOA 1N6YA 1K28D 1XUKA 3UTUH 2A5AA 3TJVA 5JB8S 1ANCA 3L6PA 2BD4A 3VXFH 4MPUA 1GL0E 4O9VA 4WJG2 1AD8H 4O97A 1LKBA 4WMEA 5AVDA 1O2SA 1O0DH 1GHAG 2BD9A 5LPRA 2STBE 2BTCE 5KGOA 1IQLA 4QT8C 3D23A 5TCAA 2EQNA 2H6MA 1SGYE 1TGSZ 4FVBA 3RC5A 4AORA 1IAUA 1OWJA 3BIVH 1TAWA 2G55A 1EXFA 3TVJB 1SQTA 3GY6A 1YPLH 1Y5AT 1C5YB 1K21H 1TRNA 1DS2E 1AVGH 1GGDC 1ZSLA 2BQWB 1A1RA 1K9OE 4WF8A 1IHTH 2JDID 4JZIA 1CA8B 1V2TT 3AK5A 3UB0A 1CGIE 1CSOE 1O3IA 2I6QA 3SZNA 1AWHB 3VB7A 1TQ7B 4ZCNA 2VVUA 3OX7U 1SI5H 1A3EH 5EU8A 3SBKA 3SQEE 3S7KB 4B1TA 4INHA 4B6FA 3OEHD 4B2BA 3A89A 2KCYA 8ESTE 1GI0A 5IDKA 2J98B 2K0QA 3ZVFA 2FI5E 4WMDA 1GBMA 3MO3A 1RIWC 5GXPA 4DIHH 1HXEH 2Y6TA 4NG9H 1SOTA 2A45B 4UONA 2JETB 3QN7A 1EUFA 2TIOA 1E38B 3E1XB 2HLDD 4IMQA 3JZ1B 5HKKD 1SLWB 1T32A 4ZHLU 1MQ6A 1VGCB 1XX9A 5GPIB 2GCHF 5JBAS 1GVZA 5HXFA 1V2PT 2H9EH 1ZSKA 2P93A 3PTNA 5E0HA 1KDQA 4Z1MD 3PRDA 3SU5A 1VCWA 4NA7A 5DP6A 1BMMH 4U30A 1KY9A 4GPGA 2ZDKA 1TNGA 1IQGA 1CQQA 1UW7A 4O3UA 5FPYA 1UVPA 5AHGH 1W3CA 1ESTA 1QJ6B 2EI6A 1LQEA 1RTFB 1TBQH 1W2KH 5HM2A 2GP9B 5HYOA 2J9NA 3PV5A 1TPPA 3NZIA 5A8ZA 1TWXB 2EEKA 3U9AH 1OX1A 2SGAA 2G00A 4ZKSU 3RXGA 4ACBA 3OAAD 1TA2A 2KCAA 4ZKRU 2C4FH 3RU4T 3IITA 3EQ0H 1L4ZA 2FOMB 1EAWA 1EP5A 3RXSA 5F53A 5PTPA 1AKSB 1GHAF 3GYMA 1P01A 1AB9B 2WV5A 4ISOA 5B6OA 3F0PA 4K1SA 1B0FA 1F5KU 1FAKH 3AW1A 4B73A 1KSNA 1NBMD 1NBME 3OEED 4XD7D 5FPTA 3SU6A 3RXIA 4GHTA 1L2EA 3LGIA 3A85A 3SU2A 4GVUA 2XTTB 1QURH 4NWKA 3QZQA 1EAIA 1QGFA 3BG8A 4K1TA 2Z9LA 4IN1A 1C5XB 4XOJA 1QJ7B 2ZGCA 1TX6A 1NRRH 4HTCH 3OU0A 2HLCA 1NTPA 1G37A 3F68H 4MQAA 4BAKB 1A0JA 1HDTH 1ELBA 1BTPA 1GMCG 1SGTA 3R0FA 3PLKA 1QTFA 3UUZA 4AN7A 5DN6D 1GHYH 3TK9A 3UIRA 1OYTH 2O9QA 5JPMH 3V0XA 1ZLRA 1BMAA 2QXGA 3KGPA 1OWIA 2GDDA 2ZPRA 2D8WA 2ZGJA 2BLWA 3MNSA 4DGJA 4ISIH 3FOAA 4I8GA 2Q6GA 1CE5A 5DP7A 2C8ZB 4J1YA 2Z3DA 2ZDAH 1D3DB 1KLJH 4JZ1A 4NIYA 3MO6A 5HM9A 4OGXA 4K60A 1YPJH 3I78A 3LDXH 1AN1E 4Y6DA 2KM0A 1SGEE 3P8GA 4B74A 1BTXA 1PYTC 3ZVBA 4BANB 3S9BA 1FNIA 1OPHB 2Y5HA 5EPYA 4ZH8A 3SU1A 4MPWA 4INKA 2FEQH 2OBQA 3UNQA 2PKAA 3PM3A 1PQ5A 5CHAC 2BD5A 3QDZB 2VVCA 1TE0A 2BDIA 2VB0A 1Y59T 2FODA 4FUBA 1KYNA 1SHYA 4K69A 4MNWA 7GCHG 1W0YH 2XXLA 3HKJB 4B71A 1B7XB 2GV7A 4H42U 1S6FA 1LVBA 3E3TA 1PFXC 1V2UT 1ELFA 1KXCA 1QL7A 2ZHWH 3IWMA 4Y8XA 3RXEA 2WZQA 3VFEA 1KXAA 2HVYB 3GDSA 2FOHA 1V2NT 3F9GA 3F2GA 1O33A 1H4WA 4I86A 3D65E 2O8MA 5DP5A 3OE7D 1XUIA 1G2LA 3MU4A 4ABJA 4CHAC 1WCZA 3LH3A 4ISNA 1KDQB 1GDNA 1GL1A 3LKWA 2B8OH 4TY6A 2V35A 3MU5A 4AFUA 1OXGA 1TNJA 2BHGA 2AMDA 2PTNA 1BTUA 1XXFA 3FZZA 2C8YB 4GHQA 1P8VC 4TWWA 1C5ZB 2GCHG 2R2WU 3SYJA 5T6GA 2HNTF 1PYTD 6CHAC 3DA9B 2F9VA 1HAGE 1XMNB 3TJUA 2BOHB 2W6JD 3MYWA 2PKAB 1YY3A 1HUTH 1UO6A 1SQOA 1GBCA 1C1TA 1V2RT 3QX5H 4KTCA 2FDAA 1TGNA 3LPRA 1TALA 3P92A 1O2PA 1ZTKA 2F43B 2W7SA 3WW7A 2YNAA 3ELAH 3A8BA 4RSPA 4VGCB 5DGJA 3SGAE 4XRNA 1D6RA 3T25A 1NFYA 4ESTE 3A7XA 1EZXC 1YPGH 2SGQE 4ZXXH 1SFIA 3MI4A 1EZUC 1SHHB 1O2YA 3P6ZB 4NGAH 1E35B 3NWUA 1H8ED 8GCHF 1C5UA 2FXRA 3BTTE 3MH7A 1O5FH 3RXAA 3RC4A 1YPMH 4BAOB 3O8RA 3WWFA 2AFQB 3P95A 2V6NA 4CR5A 1DFPA 1GBEA 1E1QD 3ZZDA 2J4IA 2F91A 2VIPA 2Y5GA 1AY6H 1SGQE 5C1YA 4YESB 1MBMA 4ABFA 1MMJN 1EP6A 1DWCH 3SV7A 3SNBA 1QZ8A 1ZGVA 3AVZA 1O2TA 2O8WA 1S5SA 2G81E 2KAIA 3JZ2B 3SI3H 1L1GA 1P02A 1WSSH 3FKSD 4D7GA 1WBGB 3S7HB 3HGPA 2IJOB 1HAVB 3C1KA 2SFAA 1GCDA 1K1PA 1EOJA 4XE4A 1HAOH 3Q76A 2OUAA 2JJ1D 2FX6A 4I8LA 1BJUA 1GPZA 5C0TA 2STAE 1YPKH 2VJ1A 3A8DA 2W5EA 2AHME 5A2MH 1PQAA 1DXWA 3U1JB 3ZZ8A 1A2CH 1CT2E 1ABJH 3K6YA 1TPOA 1TRYA 1C1QA 2F3CE 3T5FH 1BIOA 2IN2A 2AEIH 1C2LA 2J95A 4MG3A 1AWFH 3VB6A 1NROH 2FLBH 1DICA 1W13U 1DOJA 1Y3WA 1ZJKA 2L74A 3MNCA 4Y8ZA 1CHGA 4TT3D 1QCPA 2RG3A 4FUEA 3ZZ3A 3STJA 1GBFA 1GG6B 1LQDB 1SOZA 1HAXB 4X2XA 1LHCH 1BTZA 1BTWA 5K7RA 1HAZB 1SG8B 3OTPA 1KTTB 5A09A 1YWUA 1CGJE 3FP7E 3NUMA 2OC0A 4A7IB 1ZRKA 2VIVA 1G3CA 2NU1E 1NFXA 3MTYA 1C5VA 2V0BA 4ABEA 3RXHA 2ZC9H 4JK6A 4ZUHA 3LGUA 1O2HA 2YMSD 4IS5A 1QR3E 1TNLA 3M36A 5DPAA 1P2QA 4X0WU 1YPEH 2FOGA 1MTNC 4GUXA 5HGGA 2QCYA 4OGYA 1AHTH 1W0ZU 2CF9H 2KCPA 1MUEB 2WPMS 2HOBA 2QXJA 3QGJA 1RTKA 3TH4H 1HNEE 3SJ9A 1A61H 1D3QB 3RXTA 1EJNA 2W7UA 2BDGA 2GX4A 2J5UA 4WH6A 3UPEA 2W3IA 3MU8A 3O8CA 1HGTH 1OOKB 4U32A 2OC7A 2ZU2A 2G8TA 2KR7A 3SU0A 4YM9A 1J8AA 3F9FA 3A86A 4YXWD 1GJ4H 3EA7A 1QFKH 2F9UA 2FOBA 1TABE 2QA9E 2HNTC 5FCKA 3KCGH 1YBWA 4DOQA 4GSOA 1O2RA 5GIBA 1ZMNA 2R2MB 3VPKA 4AYYB 1DANH 2ALVA 3ITIA 4AOQA 2WPJS 1GHXH 4JYTA 1ZRBA 3N7DA 2H9HA 4FUIA 1EZSC 4NIXA 2G51A 3T28A 1HCGA 4P02A 5A0CA 1GHWH 1EKBB 2J94A 2UUJB 3W95A 1UTJA 1NS3A 2C90B 1NZQH 1U6QA 2Q6FA 3BG4B 3V12A 1YP9A 1MKWK 1GHVH 1BHXF 2IPQX 3F9EA 1ORFA 4K3JA 3W1EA 3PV4A 2GD4B 2ZCHP 3UY9A 1J15A 2CN0H 2YMSC 1AIXH 4ACAA 2M2AA 3MHWU 2P3TB 1GJ7B 1WV7H 2W26A 3ZV8A 3RXBA 3KIDU 1GI5A 3SUDA 5L30H 3SJOA 1SL3A 8GCHG 2VINA 1D3TB 1JOUB 4FETA 3DFJA 4X2VA 1YCPK 4I33A 1O2GH 2WYJA 3LGTA 1NFUA 3U8OH 4X8VH 4CRDA 1AE8H 1D9IA 3M5NA 1KXEA 2UUYA 3OYPA 1ABIH 2ZHEH 5K0HA 2CGAA 1B5GH 3E16B 3AAUA 2BZAA 3I77A 2P8OB 2NU2E 2RA3A 1TRMA 1EPTA 1W8BH 2VWOA 1HFDA 3A7YA 3MFJA 3RLYH 1H8DH 3ODFA 2HGTH 1YF4A 3LJJA 2PV9B 3GS9A 1P3EA 1P12E 2A7JA 5EGMA 3DSPA 4ZXYH 1C1WH 1AZ8A 2CF8H 1FY3A 4CRAA 3SUGA 1IQFA 1IQEA 3BTEE 1CO7E 5DP3A 3T2NA 3URCA 4Y0ZE 1LHFH 3U1IB 2B9LA 2WSSD 3UWJH 1EAXA 5H4IB 1VCPA 4NFEA 4FXGH 5GCHF 1TA6A 1NRQH 4I7YH 2QF0A 1P2OA 3TNTA 4YT6H 5J4SA 5JB9S 1QRXA 3KEEA 4JZFH 5EXLA 3CENA 4HI3A 3TK5A 3SORA 2TRMA 1WQVH 3MWIU 4X2WA 1E79D 1AQ7A 4CRCA 2OXSA 2FS9A 1IHSH 2RA0A 3GYLB 3RUOA 2V3OH 3GOVB 3LOXA 4Y10E 3MNBA 3HATH 2QYIA 3ZVGA 1Y3UA 3UR9A 3P70B 5DSFA 1V2JT 1C2IA 1QA0A 5A8YA 1AGJA 3CS0A 4UE7H 1C1VH 2XNDD 1XUFA 2Y81A 5DP8A 1O37A 2UUKB 1H1BA 1MD7A 1P2MA 1V2LT 5EODA 4JCNA 2FOFA 2FYRA 3AW0A 1O3CA 2Z3CA 2BQ6B 1PQ7A 5EG4A 1VJ9U 5L2YH 1IQHA 3BF6H 2G5NA 2XRCA 4ASUD 4OS5A 5IK2D 1P2JA 2OBOA 1IQKA 2LELA 1GI6A 2KX4A 1YPHE 3SV6A 2QIQA 5GNDA 2RFKC 6GCHF 5J4QA 1O34A 4JYUH 4AZ2B 1IQMA 3ATKA 2ZFRH 1C5RA 2OC1A 1FY5A 5FBIA 1GBJA 2TGTA 2FPZA 2PWXA 3TJNA 4NFFA 3A82A 2JH0D 4Y76A 5FHTA 3TU7H 1DWBH 2GT8A 3DUXH 1OP2A 4KKDA 1P0SH 3M5LA 1GBIA 1O5EH 1FXYA 2XYAA 2ZPQA 3RXUA 4B2CA 1G30B 5T6DA 1V2OT 1O31A 2ZG0H 1YCPM 1S83A 2IJD1 4ASHA 3TGIE 2ZPSA 2BYAX 3CP7A 1PPGE 3DSGA 2PUQH 1UTLM 2OD3B 4UFEH 2VWMA 2W6ID 4LZ4B 2OTVA 2VIQA 3ZVEA 3T27A 2AGIX 5T1VA 1ELDE 4AB8A 5SGAE 1GHBF 1FZZA 1XXDA 2DUCA 1NO9H 2CK3D 2VWLA 2BD2A 2P94A 2TGDA 3ZZCA 1BMLA 2J97A 3PO1C 2AERH 3RU4D 1LDTT 1P11E 1P05A 1DLKB 1C5PA 5F8TA 3N7OA 1K1LA 3TH3H 3ZYDA 4F48B 4XSKU 4GCHG 2W3KA 1F0SA 2FESH 1SQAA 4WXVA 1UTOA 3BTGE 2D26C 1GI2A 2PR3A 4AGKA 1INCA 2NWNA 4FUCA 1SLUB 4NSVA 1SGPE 1TNHA 1UVUH 4ISHH 1LPZB 3U69H 2QF5A 3LIWA 4FU7A 3QLPH 4AG2A 3MOCA 1A7SA 1UMAH 3QK1A 2A4OA 5C5OA 3V7TA 1A46H 1O2ZA 2ZCKP 2BOKA 2Z9GA 1F0UA 1S6LA 3EDXB 2P95A 4KGAA 1HV7A 2G52A 4LXBH 1S82A 2EY4C 2ZQ1A 1S85A 3BN9A 2ZQ2A 1FI8A 4XFQA 3H7TA 1YLDA 3O8BA 2CHAC 4ABBA 3PMBB 1GJDB 4ABHA 4HZHA 3F6UH 2LNCA 4SGAE 2ESTE 1D3PB 3VGCB 2I6SA 1BRUP 4YOIA 4RKOB 1FX0B 1O5CB 5C20A 4FU8A 2V3MA 4IGDA 4X2YA 4DW2U 3QO6A 1O3BA 4P00A 2PP6A 4YOJA 2V7QD 1Z8IB 2FWWA 2VBCA 1ETTH 1ZPZA 5G4BA 1GI8B 4BXWA 4ZMAH 7LPRA 1FAXA 2EI7A 3U8TH 2GT7A 2FIRH 5LH8A 1QHRB 4MDSA 1THRH 2QGRA 1BDAA 3ESTA 1FPCH 4MPXA 4AFZA 5DJ7A 1HXFH 5HIZA 4Q4LA 3U98H 4MLFB 2JETC 3TH2H 1W0KD 3PB1E 1HRTH 2R3UA 2PKSB 2J98A 3HK6B 1MD8A 5ABWA 1TOCB 2ZDVH 1QA7A 2SNWA 3PRBA 3GCOA 4A5TS 4K2YA 4OM9A 1WOFA 1FN6A 1UK4A 2JKHA 2Y7ZA 1VJAU 2WPHS 1GHZA 1O39A 2VVVA 4CRBA 3NCLA 2JIZD 3LONA 3FAOA 1ANBA 3B8JA 3KQEA 5E2OA 1O2QA 1MKXK 1A0LA 3TJOA 5DG6A 3TK6A 2XWBI 5F6MA 1S84A 1DY8A 1O2WA 3NXPA 2CHAB 1WQSA 2VH6A 1DLEA 4YT7H 4IMZA 3M7QA 1MZAA 1ZHRA 4WWYA 1X7AC 1HAIH 3HKIB 1DUEA 2R0KA 4INLA 1V2QT 2BY9X 2FI4E 1WXRA 3NK8A 1C5MD 1ZZZA 2ZFFH 1C5WB 4TPIZ 3K6ZA 1MTSA 1EFRD 1CHOF 4F49A 4YLUA 2OLGA 1FPHH 3SV9A 2K8IA 4DY7B 1P3CA 2WYGA 1UVSH 2FOAA 1LPGB 3U28C 3UR6A 4R0IA 4NWLA 3BV9B 3DD2H 4D9RA 1ELGA 2V3HH 4MNVA 4PROA 5TJXA 2PTCE 3PMJA 4BAHB 3VB4A 1UTPA 1NM6A 3UOPA 1DSTA 3LH1A 2QAAA 5C2ZA 1DT2A 2CMYA 3MMGA 1GVLA 1TGTA 5EQRA 3SN8A 1AB9C 2XWAA 1EX3A 1GHBG 2ZHQH 1JIRA 1YGCH 1GCTC 2BLOA 4NA9H 3HPTB 1BOQA 3MU1A 1D4PB 1W14U 2XBWA 2BX3A 1FJSA 2SGPE 1E0FD 1T8NA 2A32A 1H9HE 1QB9A 1CT4E 1GJ5H 1WDIA 4NZQA 4Q63A 3KQBA 2O8TA 3BTFE 3SOSA 3URDA 4LOYH 1DXPA 1L4DA 1PJPA 2AS9A 3P8FA 1RTLA 1LVYA 1ZYOA 1QRZA 1SLXB 4KP0A 2J34A 5LPFA 1DVAH 4XDEA 5AFYH 2PHBA 1O32A 3H5CB 1O3EA 4X1SU 4A92A 1F5RA 3TITA 1BBRE 1QL8A 6ESTA 2DE8A 4M9FA 3CS7A 1G9IE 3UQVA 3GCHC 3LGYA 1A4WH 2TPIZ 5JBCS 1GMHG 1O2IA 3BTQE 1JMOH 3KN2A 4CRFA 4YO9A 2ZDLA 2OQ5A 1CU1A 9ESTA 1MAYA 2UUFB 5FBEA 1LO6A 4LZ1H 1GWAA 4Y7AA 1AO5A 1VGCC 2Q1JA 3AAVA 3RMNH 4XBBA 1MBQA 1TNIA 2XC4A 4X6NA 2GCTC 2BDAA 2VU8E 2Z7FE 5CE1A 4BXSA 1EPTC 5BPEA 1K1NA 1EASA 3RXDA 1BRCE 2VIWA 4Q2KA 5JYIA 4MNXA 3L33A 2CXVA 1F0TA 1OS8A 2TGAA 2Y82A 4JK5A 3RXRA 3WWBA 4FU9A 1YCPH 1DWDH 2OQUA 1SC8U 2H9TH 4ABAA 2ZKSA 1EB2A 2AGGX 2OC8A 1UCYH 4FUHA 6CHAB 3KHVA 1BMNH 1F2SE 1GI3A 2A2QH 1GGDB 3BTKE 1BQYA 3OY6U 1ANEA 1TMTH 2J2UA 4E7NA 1BUIA 2ULLA 1XKBC 1G3DA 5CHBA 4AB9A 1DPOA 1UVOA 1HJ9A 1F0RA 1BB0B 1KTSB 1ZSJA 1HAHH 1N8OC 1NT1A 1C4V2 3QTOH 2XCNA 1BT7A 2GKVE 5I25A 4MTBA 5EW1H 5IYTA 3LU9B 2VH0A 4JZDH 5GCHG 4CR9A 1OWHA 2C3SA 3GY2A 1QB6A 2UWPA 3M61U 1SMFE 3QUMP 1O3LA 2FYQA 1ZPCA 1HJ8A 3F9HA 1PPEE 2GGVB 3EA8A 1JRTA 1NN6A 1O5BB 2WUBA 1PQ8A 1C5TA 3SZEA 1OKXA 1ESBA 2HVXA 2F9BH 3PWCA 4OS4A 1SBWA 1K1MA 2H2ZA 2J38A 2BY5X 1EB1H 2J92A 2BLQA 2OP9A 2P3FH 2ZA5A 3EE0B 1GI7B 2G5VA 2KAIB 2UWOA 2QY0B 1T31A 2ANYA 2VIOA 1L1JA 3A7TA 3TIUA 3S9CA 1AMHA 5F03A 5JBBS 1L0ZA 2ANWA 3MH4A 2ZU3A 3QGNB 9LPRA 2BX4A 2ODPA 3ZZ4A 5A8XA 1SR5C 1P09A 1UTMA 5EW2H 3BIUH 3STIA 1GMCF 1P9UA 3RM2H 3E8LA 1EATA 1HBTH 1S0QA 1C1UH 1Z8JB 3MO9A 1ESAA 3ZV9A 1CA0C 3ODDA 3ATIA 3SGQE 2VNTA 2BD7A 4AGJA 3DCLA 4NIWA 1W0JD 2A4GA 3PLBA 2ZTYA 2PSYA 3KQCA 3N99A 4NCYA 3LC5A 3SUFA 3N7EA 5EJZA 3SU3A 1AE5A 3OY5U 2Z9JA 3K2UA 1M9UA 4GAWA 1AFQC 3RXQA 4B2AA 1ELTA 1XKAC 2QXIA 4NIVA 3FFGA 5T3HA 2JJ2D 3A7WA 1BRBE 2XBYA 2SGDE 1AI8H 1CBWC 4DT7B 1AFQB 2XC0A 3SV2H 3UQOA 3AASA 3FP6E 3RXVA 1IQIA 3GICB 1GG6C 1TFXA 1XM1A 2VGCC 1O3GA 2P3UB 3ZZ7A 1QBVH 3DHKH 5HMAA 4K8BA 1N6XA 1O2UA 3SNEA 3P17H 3Q77A 1TNKA 2A2XH 1Z8GA 1DX5M 2O8UA 3A8AA 4M7GA 1LHDH 1Z1IA 3W94A 2GZ8A 1OWEA 1YPHC 4RKJB 1O5GH 4JYVH 1RGQA 4FUGA 1Y3XA 5I46H 3BSQA 3A81A 2Q6DA 2JH6D 2AGEX 3P8OA 3OTJE 1FLEE 2A7CA 4FVDA 1GBBA 3HK3B 3LJOA 1QBOA 5KECA 5FX5A 2BDHA 3Q00A 1GI4A 3MH5A 2BVSH 1O3FA 2F9OA 4HG6A 1F7ZA 3ZZ5A 1UHBB 2PW8H 3IG6B 1UTQA 2FZZA 2HRVA 1E1RD 3UAIC 1O3OA 3PYHA 2P8OC 1MTNB 3VXEH 4CBOA 2YMSB 5EXNA 1TGBA 5C3NA 3SJIA 2FI3E 2VIDA 4I31A 1MCVA 1Z1JA 1E36B 1MU8B 3RMMH 1BRAA 1BTYA 2WV9A 3M5MA 3NKKA 1GMDF 1LKAA 2BDYA 1UK2A 1IQJA 2ILNA 2Z6BD 2GJGA 5E0GA 5C0UA 3D49H 5C94A 6LPRA 1CBWB 1FY1A 5FPSA 2BY6X 1VITG 1SVPA 1J17T 3HGNA 5EXMA 2F9NA 1ID5H 4I8JA 2VGCB 3TGJE 2ZCLP 1C4U2 1GJAB 2XNIA 1ACBE 2F9PA 4KELA 3SJ8A 1W10U 4D7FA 2ZDNA 1YM0A 3SV8A 2VWNA 3E91A 2ZWLH 1ZHMA 5A0AE 3LC3A 1V2WT 1Z71A 2C93B 1J9CH 5GDSH 4JMYA 2XBVA 2A4QA 1QJ1B 3BEFB 1N1LA 1Q3XA 2ODQA 3MQKC 4VGCC 1SKYE 1ARBA 2QV1A 1FV9A 1AKSA 1H9IE 1MTWA 2PKSC 5ESTE 1SGIB 4Y11E 2ZGBH 4FUJA 4Q7ZA 5L2ZH 4K8YA 1NC6A 1E37B 1EPTB 1A0HB 1VZQH 2ZU5A 2H5DA 3H09A 3ATMA 4NSYA 2Z9IA 4AG1A 1V3XA 5LPEA 1YLNA 1TIOA 1XVOA 1Z7KA 3UWIA 1A5HA 1TBRH 1KMHB 3F2HA 1TB6H 1MABB 1C5NH 1SLVB 1MTUA 1O2LA 5CMXH 1G2MA 1K22H 2ZFQH 1MTVA 1LHEH 1JRSA 3SNAA 3ATLA 2HPPH 5C1UA 1GBLA 2A5KA 2PLXA 4BAMB 1BA8B 1C2GA 4XBCA 1GBAA 3O8DA 3M5OA 1JWTA 1TX7A 4J2YB 3GCTG 2WPDD 1NPMA 3BTHE 4WMFA 1ETSH 4IW4E 2AMQA 1LTOA 4O3TA 5FX6A 1S81A 2LPRA 1RRKA 1T4UH 2CV3A
chains in the Genus database with same CATH topology
8LPRA 1IOEA 4NA8A 2QF3A 5JBTA 2ZNKH 1C2JA 4D76A 1KXFA 1E34B 2AMPA 2QC2A 1G32B 5DKMA 3RXOA 1RJXB 1MZDA 2FTLE 8KME2 1TPAE 4E7RG 5GJ4B 1P03A 3M35A 1GJCB 1HIAB 1HIAA 2UWLA 3RXKA 2A0QB 3V13A 3MU0A 1BITA 1HAYB 5FCRA 4X1NU 4YOGA 1O2MA 3RMLH 3GCNA 4BNRA 4DURA 2FO9A 1GDUA 1O2VA 3GCTF 3ZVCA 1THPB 1NRPH 2BMGB 1YLCA 3SHAH 3Q3YA 2ALPA 3WY8A 2WPLS 5DP4A 2BM2A 1SB1H 2SGEE 1HAVA 3KNXA 1V2MT 7KMEH 1CT0E 4AFSA 2WV4A 4B76A 2ZTZA 2BXUH 3RU4E 1TYNA 2IOTA 1GJ8B 1JBUH 2FOCA 2FX4A 3SUEA 5ESBA 3TLOA 4X1RU 3FANA 3H7OA 1P2KA 1BZXE 1LVOA 2BDBA 3GDVA 3S9AA 1J16A 5FAHA 1Z8RA 1FY4A 3ZVDA 5L6NH 5LGOA 5AFZH 1GMHF 4F4OC 3VB3A 3BG4C 1AU8A 1T8MA 6GCHG 2XC5A 3EA9A 4DIIH 3OSYA 1T8LA 1C1SA 4HFPB 1GI9B 4IBLH 2GTBA 2C8WB 1GBHA 1GJ6A 1P04A 2RCEA 3RXPA 3T26A 1EJAA 1Y5BT 5DO4H 4I8KA 2ZEBA 2O8LA 3GY8A 1P9SA 1LCYA 3RDZA 1TGCA 3P8NA 2FMJA 4A1VA 1YKTA 3F1SB 4CREA 5E2PA 1LVMA 1P2IA 1MH0A 2H1UA 1GBTA 1OP0A 2H5CA 2ZFTA 3PROA 4TY7A 2XBXA 1C5LH 4CRGA 2P16A 1H8IH 1GDQA 2JH5D 4YZUA 3ZYEA 1ZGIA 1O3KA 2ZI2H 1ZTLA 1BJVA 4Z0KA 3QTVH 3GISB 1WYKA 4BOHA 4WXIA 1SGFA 4TWYA 3B23B 4UFFH 3A8CA 7ESTE 1WAYB 1PPZA 4ZKOU 1DSUA 3M37A 3SQHE 1GBDA 1OYQA 3UREA 1QB1A 5A0BA 2ZFPH 1ZPBA 4X8TH 2BD3A 4A1XA 1FQ3A 4A6LA 1C5QA 1FDPA 4NZLA 4OS2A 3A88A 7GCHF 1OWDA 1MU6B 3A84A 2PSXA 5EQSA 1ZMJA 4SGBE 2EA3A 5T6FA 5EPNA 4GCHF 2HPQH 1J14A 3VB5A 1V6DA 4ZHAA 4Y71A 1BTHH 3PTBA 2WPIS 1NU7B 1OSSA 4TYDA 1VCQA 3KF2A 2BY8X 1RXPA 1ANDA 4MVNA 5F8ZA 1MQ5A 2RDLA 3UFAA 4I8HA 1JIMA 3RXLA 1H9LB 4X6MA 1NRNH 2ZO3H 3M7TA 3GY5A 1K1JA 1DE7H 4UFDH 3RXMA 3PLPA 2BY7X 1GCTB 2R3YA 1AZZA 1DDJA 3SNDA 1GJ9B 3LGVA 2R0LA 2GMTC 1ZTJA 1KLTA 1ELCA 1MAXA 4AFQA 3EGKH 1O3PB 2ZECA 1C4Y2 2A5IA 1DUAA 1YYY1 3D62A 1C1RA 1L1NA 1EJMA 1FUJA 1PPHE 2BDCA 1FN8A 1B0EA 3TNSA 1V2VT 2WUCA 2B7DH 1GVKB 1CHOG 1HB0B 2F83A 3RM0H 1S0RA 1RD3B 2SGFE 2TBSA 1BHXB 1C5OH 4B75A 3RLWH 1TMUH 5FXLA 3FP8E 3EAJA 4MPVA 1O38A 1AUJA 3SNCA 2FLRH 1SPJA 1UTKA 2ZF0H 3MNXA 4Z6AH 1O2OA 3E6PH 1RFNA 3SO3A 5AF9H 1C1OA 1SGNE 1NRSH 3E90B 3R3GB 5E8EH 2P59A 2AYWA 3DT0H 3QZRA 1NY22 4BTIB 1LMWB 2M5TA 4A1TA 1C2HA 2Z9KA 1AVWA 2PGBB 5DP9A 2Z94A 2ZU1A 1CA0B 1C2DA 4RN6A 3LGWA 2ZHDA 2CJIA 2FP7B 1ELVA 2AH4X 4H6TA 1S6HA 4ZAEA 3VEQB 1AUTC 4ZROA 4GLYA 1TX8A 1C1MA 2ZZUH 1T4VH 2G4TA 3Q3XA 1QIXB 1AVXA 3U8RH 1SGCA 1SGFG 1WTHD 4R8TB 4ZKNU 1XUJA 2ODYB 1KIGH 5JDUB 1D6WA 4JZEH 1FY8E 2YOLA 5C5NA 1O36A 4UEHH 2FM2A 2Y5FA 1O3MA 3GY7A 4DVAU 3SI4H 1BCUH 3I29A 3G01A 2AIPA 1Z6JH 1O2KA 4ABIA 3B9FH 4WH8A 1K2I1 2EC9H 1P10A 5GWZA 2B5TB 1GJBB 2PFEA 1HJAB 4YTAA 4BAQB 1KXBA 2NU4E 2HALA 2BZ6H 4X1QU 3QWCH 5EQQA 1EAUA 1O5AB 3BEIB 1RS0A 3M3VA 2B0FA 4Y7BA 2DE9A 4AX9H 2PUXB 3SHCH 5E0JA 2ZDMA 1UCYE 3UNRA 3RC6A 3ZZBA 4K5ZA 5F8XA 1FMGA 2WINI 1Q31A 4U01A 1UK3A 1Q2WA 3RXCA 1VITF 1C2MA 1Z6EA 1NU9A 3RMOH 4X8UH 1CGHA 2ASUB 3ZZAA 3SU4A 1ZOMA 2D1JA 3BEUA 2Y7XA 3UNSA 2EI8A 2ZIQH 3M3TA 5BRRE 2QN5T 4WVPE 1ZHPA 3T29A 1C2KA 4TPYA 1VR1H 2BQ7B 2NU3E 1MKXH 1GI1A 2ANMH 1FIZA 3S69A 3V3MA 1UVTH 4X6PA 3EYDA 3S0NA 1ZMLA 1Y8TA 1HPGA 1THSH 2NU0E 3ZZ9A 1BBRK 1FIWA 1T7CA 1WTGH 2OINA 3K65B 1RIWB 1O2NA 3ZZ6A 4UD9H 4UDWH 1BBRH 1JXPA 1O2XA 5CHAB 2GMTB 1PPCE 1G3BA 1UTNA 4H4FA 1TLDA 2ZFSA 1HLTH 1CVWH 5EOKA 2WPKS 1W7GH 2AIQA 3PMHB 4XBDA 4Y79A 2FS8A 2GZ9A 3GCHB 1EZQA 2TGPZ 1HAPH 3GDUA 4Y0YE 4AYVB 4OS7A 3ENSB 4HGCA 1EOLA 4U2WA 1O30A 1QL9A 2ZP0H 3Q3KA 1C9PA 3T62A 1HYLA 1C1NA 2ZTXA 3BTDE 1QY6A 1ARCA 4DJZB 1SFQB 1Y3YA 4IC6A 4X1PU 1C9TA 1ZJDA 2GVFA 2ZU4A 3M7UA 1K1OA 4OS1A 4IC5A 3KL6A 1TQ0B 3A87A 1P06A 3SJKA 4ISLA 2HWLB 1P57B 3E0NB 1TOMH 1VITH 1HJAC 2BVXH 1V2ST 1O5DH 3M3SA 1C2FA 3FZDA 2OCVB 2XW9A 1DM4B 1SGRE 2FTMA 3RXJA 2GDEH 2PGQB 3K9XB 2THFB 1KXDA 4X8SH 1GBKA 1F5LA 2Y80A 2ZGHA 2ZGXH 1UHBA 3RXFA 4Q7YA 1ELAA 5TCCA 3SW2B 5ETXA 1SGDE 3KQDA 1ETRH 1QQ4A 1TPSA 2A1DB 1O3NA 3C27B 4D8NA 1QBNA 4DG4A 3UOUA 1O3HA 1C5SA 1PPBH 1XUHA 1WUNH 2ANKH 2GZ7A 4WY3A 3ATWA 4K1EA 1EQ9A 3SGBE 4THNH 4FUFA 1DY9A 3BTWE 3PWBA 4BTTB 2FOEA 4MNYA 4CBNA 3VGCC 1T8OA 1O35A 4X6OA 1TBZH 2A4RA 2A7HA 4YLQH 1XUGA 2HNTE 4OS6A 4LK4A 1OP8A 1O3JA 2IPHA 3A83A 4I32A 1LHGH 1SSXA 4DCDA 1GMDG 1UJ1A 3BTME 2BXTH 1DWEH 4KTSA 2R9PA 4IN2A 4CHAB 4UFGH 5DK1A 4Q80A 1Y5UT 3NPSA 1IQNA 4E05H 1TMBH 1MKWH 3LT3A 1UCYK 1P2NA 4KTUA 2QXHA 1K1IA 2BB4A 1G3EA 1MCTA 3A7VA 1QNJA 1OWKA 4CH8B 3L3TA 1AFEH 1PPFE 1QQUA 5C1XA 1C2EA 1N8OB 3A7ZA 1NFWA 4H6SB 4ABGA 3PMAB 1A5IA 2BLVA 2XCFA 2A31A 1ZR0A 4BTUB 2BD8A 4ABDA 1F92A 2D2DA 3FVFB 4Q7XA 2SNVA 5C67A 2C8XB 1WU1A 2ZHFH 1W12U 2BVRH 1XVMA 1C1PA 1YC0A 1NESE 1O3DA 4O03A 4FUDA 3TGKE 3GY3A 1W7XH 3GY4A 3TPIZ 1TONA 2K1QA 4D9QA 3PO1B 1ELEE 1W11U 1Y3VA 2Z3EA 2GCTB 3DFLA 2G4UA 1A3BH 2YNBA 3ZVAA 1O3AA 3E0PB 1A5GH 1FONA 1V2KT 1KLIH 4CH2B 1LPKB 1O2JA 4E06H 3A80A 4ZHMU 1DITH 1QRWA 3MH6A 4Y8YA 3RP2A 1G36A 2GV6A 1N6YA 1K28D 1XUKA 3UTUH 2A5AA 3TJVA 5JB8S 1ANCA 3L6PA 2BD4A 3VXFH 4MPUA 1GL0E 4O9VA 4WJG2 1AD8H 4O97A 1LKBA 4WMEA 5AVDA 1O2SA 1O0DH 1GHAG 2BD9A 5LPRA 2STBE 2BTCE 1IQLA 4QT8C 3D23A 5TCAA 2H6MA 1SGYE 1TGSZ 4FVBA 3RC5A 4AORA 1IAUA 1OWJA 3BIVH 1TAWA 2G55A 1EXFA 3TVJB 1SQTA 3GY6A 1YPLH 1Y5AT 1C5YB 1K21H 1TRNA 1DS2E 1AVGH 1GGDC 1ZSLA 2BQWB 1A1RA 1K9OE 4WF8A 1IHTH 4JZIA 1CA8B 1V2TT 1CGIE 1CSOE 1O3IA 2I6QA 3SZNA 1AWHB 3VB7A 1TQ7B 2VVUA 3OX7U 1SI5H 1A3EH 5EU8A 3SBKA 3SQEE 3S7KB 4B1TA 4INHA 4B2BA 3A89A 8ESTE 1GI0A 5IDKA 3ZVFA 2FI5E 4WMDA 1GBMA 3MO3A 1RIWC 5GXPA 4DIHH 1HXEH 2Y6TA 4NG9H 1SOTA 2A45B 4UONA 2JETB 3QN7A 1EUFA 2TIOA 1E38B 3E1XB 4IMQA 3JZ1B 1SLWB 1T32A 4ZHLU 1MQ6A 1VGCB 1XX9A 5GPIB 2GCHF 5JBAS 1GVZA 5HXFA 1V2PT 2H9EH 1ZSKA 2P93A 3PTNA 5E0HA 1KDQA 3SU5A 1VCWA 4NA7A 5DP6A 1BMMH 4U30A 1KY9A 4GPGA 2ZDKA 1TNGA 1IQGA 1CQQA 4O3UA 5FPYA 1UVPA 5AHGH 1W3CA 1ESTA 1QJ6B 2EI6A 1LQEA 1RTFB 1TBQH 1W2KH 5HM2A 2GP9B 5HYOA 2J9NA 1TPPA 3NZIA 5A8ZA 1TWXB 2EEKA 3U9AH 1OX1A 2SGAA 2G00A 4ZKSU 3RXGA 1TA2A 4ZKRU 2C4FH 3RU4T 3IITA 3EQ0H 1L4ZA 2FOMB 1EAWA 1EP5A 3RXSA 5PTPA 1AKSB 1GHAF 3GYMA 1P01A 1AB9B 2WV5A 4ISOA 5B6OA 4K1SA 1B0FA 1F5KU 1FAKH 3AW1A 4B73A 1KSNA 5FPTA 3SU6A 3RXIA 4GHTA 1L2EA 3LGIA 3A85A 3SU2A 4GVUA 2XTTB 1QURH 4NWKA 3QZQA 1EAIA 1QGFA 3BG8A 4K1TA 2Z9LA 4IN1A 1C5XB 4XOJA 1QJ7B 2ZGCA 1TX6A 1NRRH 4HTCH 3OU0A 2HLCA 1NTPA 1G37A 3F68H 4MQAA 4BAKB 1A0JA 1HDTH 1ELBA 1BTPA 1GMCG 1SGTA 3R0FA 3PLKA 1QTFA 3UUZA 4AN7A 1GHYH 3TK9A 3UIRA 1OYTH 2O9QA 5JPMH 3V0XA 1ZLRA 1BMAA 2QXGA 3KGPA 1OWIA 2GDDA 2ZPRA 2D8WA 2ZGJA 2BLWA 3MNSA 4DGJA 4ISIH 4I8GA 2Q6GA 1CE5A 5DP7A 2C8ZB 4J1YA 2Z3DA 2ZDAH 1D3DB 1KLJH 4JZ1A 4NIYA 3MO6A 5HM9A 4OGXA 4K60A 1YPJH 3I78A 3LDXH 1AN1E 4Y6DA 1SGEE 3P8GA 4B74A 1BTXA 1PYTC 3ZVBA 4BANB 3S9BA 1FNIA 1OPHB 2Y5HA 5EPYA 4ZH8A 3SU1A 4MPWA 4INKA 2FEQH 2OBQA 3UNQA 2PKAA 3PM3A 1PQ5A 5CHAC 2BD5A 3QDZB 2VVCA 1TE0A 2BDIA 2VB0A 1Y59T 2FODA 4FUBA 1KYNA 1SHYA 4K69A 4MNWA 7GCHG 1W0YH 2XXLA 3HKJB 4B71A 1B7XB 2GV7A 4H42U 1S6FA 1LVBA 3E3TA 1PFXC 1V2UT 1ELFA 1KXCA 1QL7A 2ZHWH 3IWMA 4Y8XA 3RXEA 3VFEA 1KXAA 3GDSA 2FOHA 1V2NT 3F9GA 1O33A 1H4WA 3D65E 2O8MA 5DP5A 1XUIA 1G2LA 3MU4A 4ABJA 4CHAC 1WCZA 3LH3A 4ISNA 1KDQB 1GDNA 1GL1A 3LKWA 2B8OH 4TY6A 2V35A 3MU5A 4AFUA 1OXGA 1TNJA 2BHGA 2AMDA 2PTNA 1BTUA 1XXFA 3FZZA 2C8YB 4GHQA 1P8VC 4TWWA 1C5ZB 2GCHG 2R2WU 5T6GA 2HNTF 1PYTD 6CHAC 3DA9B 2F9VA 1HAGE 1XMNB 3TJUA 2BOHB 3MYWA 2PKAB 1HUTH 1UO6A 1SQOA 1GBCA 1C1TA 1V2RT 3QX5H 4KTCA 2FDAA 1TGNA 3LPRA 1TALA 3P92A 1O2PA 1ZTKA 2W7SA 2YNAA 3ELAH 3A8BA 4RSPA 4VGCB 5DGJA 3SGAE 1D6RA 3T25A 1NFYA 4ESTE 3A7XA 1EZXC 1YPGH 2SGQE 4ZXXH 1SFIA 3MI4A 1EZUC 1SHHB 1O2YA 3P6ZB 4NGAH 1E35B 3NWUA 8GCHF 1C5UA 2FXRA 3BTTE 3MH7A 1O5FH 3RXAA 3RC4A 1YPMH 4BAOB 3O8RA 2AFQB 3P95A 2V6NA 4CR5A 1DFPA 1GBEA 3ZZDA 2J4IA 2F91A 2VIPA 2Y5GA 1AY6H 1SGQE 5C1YA 4YESB 1MBMA 4ABFA 1MMJN 1EP6A 1DWCH 3SV7A 3SNBA 1ZGVA 3AVZA 1O2TA 2O8WA 1S5SA 2G81E 2KAIA 3JZ2B 3SI3H 1L1GA 1P02A 1WSSH 4D7GA 1WBGB 3S7HB 3HGPA 2IJOB 1HAVB 3C1KA 2SFAA 1GCDA 1K1PA 1EOJA 4XE4A 1HAOH 3Q76A 2OUAA 2FX6A 4I8LA 1BJUA 1GPZA 2STAE 1YPKH 2VJ1A 3A8DA 2W5EA 5A2MH 1PQAA 1DXWA