2DE9A

Crystal structure of porcine pancreatic elastase complexed with tris after soaking a tris-free solution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase-1
publication title Tris(hydroxymethyl)aminomethane induces conformational change and crystal-packing contraction of porcine pancreatic elastase.
pubmed doi rcsb
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2de9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2de9A01
1BJUA 3K6YA 4JYTA 4AX9H 2O8TA 1C5NH 1ZSLA 1HAHH 1B5GH 2XCNA 3GDUA 4E7NA 2TBSA 4CBOA 1BTHH 4H6SB 4I8KA 3SV6A 2OINA 5F8TA 1G2MA 1KIGH 2STAE 5FPSA 5A09A 1G3CA 2GT8A 2CF9H 4I32A 3ZYDA 2K1QA 1A4WH 2VIWA 1RIWB 3MU8A 2Y7XA 1TB6H 1UTQA 1Z1IA 3CS7A 1O5FH 3VB7A 5DG6A 4ZKRU 3MO6A 1E35B 2GMTB 1GMDG 1P05A 2FI4E 4BTTB 4Q7XA 1ID5H 4UD9H 1KXFA 4GVUA 1UVUH 1G3BA 1T31A 4AB8A 2C8ZB 1CT0E 3A8BA 1ETTH 1C1SA 2BY8X 2G81E 3S7KB 2OTVA 3NK8A 4ABJA 1QIXB 2G4TA 1DWCH 1D3QB 1GMCF 4IW4E 1QNJA 1LPZB 4OS2A 1EXFA 1PYTD 3QDZB 1OWKA 1TBQH 1O30A 5A0AE 2GCTB 1P9SA 4NIVA 3NKKA 2PKAB 1GBTA 1C2DA 2M5TA 1MQ6A 1GBAA 3EGKH 3RU4T 5A2MH 3A7ZA 3E91A 1YPLH 1Z8IB 2HNTE 1ESTA 2GZ9A 5J4QA 2J92A 1W12U 2AIPA 2H5DA 4F4OC 1GJ9B 3A84A 3RP2A 2PW8H 3M7TA 2DUCA 3CS0A 2FI5E 2Z3DA 3KIDU 4HI3A 1O2SA 5IYTA 3L33A 1TX7A 1O5GH 2AERH 1GI5A 3NWUA 2QA9E 2GV6A 7ESTE 3ZZCA 2F9VA 1C4U2 5GJ4B 4MPXA 1G36A 1O3CA 1OXGA 5I46H 2Q6GA 1O36A 1DLKB 1YPHE 1ZGVA 1TMUH 1ZSJA 1LVBA 3SU5A 4MDSA 2HLCA 4WWYA 3MH4A 1C1QA 1D3TB 2ZTYA 3ZZ8A 4GLYA 3ZV8A 1H4WA 1TGTA 4U30A 4Y79A 4PROA 2WUBA 1DVAH 1OWEA 1TONA 3ZV9A 2HVXA 4A1TA 3UREA 1SVPA 3WY8A 1SG8B 2OXSA 1C1VH 3M7UA 2I6QA 4A92A 1LO6A 3TJUA 4WJG2 1ELAA 1TA6A 4AFUA 1W11U 1BMMH 4NZQA 3A88A 1HJAC 5T6FA 3O8RA 3B9FH 1TNLA 1VGCC 1IQNA 1P2QA 1GI3A 1XX9A 1MH0A 1O2MA 1TMTH 4ISHH 2NU1E 3SGAE 1O3EA 1O2ZA 2BY6X 2TRMA 1F5RA 5FPYA 1V2WT 4Z6AH 1BQYA 2F9UA 1RXPA 1GHAF 4MNYA 1SGCA 3NXPA 2FX4A 3PLPA 5L2YH 1KTSB 2ZU1A 1DUAA 3FAOA 8KME2 1JWTA 3DT0H 4NGAH 2ZDNA 2Y5HA 4IN1A 3PMAB 2BD5A 3QUMP 3SHAH 1O5BB 1GHVH 1TGBA 5DK1A 1Z6JH 3ZZ9A 4JZIA 1VCWA 2H9HA 3Q3KA 3U9AH 2P16A 2SNWA 2AH4X 3QGJA 1FXYA 1GCTC 3RXCA 3S9AA 1XUJA 1SLVB 2SGPE 5GIBA 1J8AA 4SGBE 1V2NT 1EASA 2Y80A 1O3FA 1O37A 2BOHB 3R3GB 1QA0A 3BIUH 1CQQA 2VGCC 1DM4B 2A7JA 4YESB 2WUCA 5DP4A 1YPMH 2FEQH 2WPLS 4FVBA 2ZQ2A 1HJAB 3LC5A 1G32B 1H9IE 1K1MA 1VGCB 2FI3E 1T8MA 4CRDA 5JDUB 1ZTLA 1LHCH 2YNBA 1YGCH 2BDHA 1S83A 1SQTA 4ZROA 3RXEA 4ISIH 5AFZH 4O03A 1QB1A 2A4GA 9LPRA 1T32A 1H9HE 2GDDA 4DG4A 2VU8E 1SGNE 1NT1A 2XBXA 4D7GA 1ABIH 3FFGA 4IN2A 1V2ST 4X6MA 2ZU3A 2EI6A 1HAVA 1FNIA 4DIHH 1YLCA 2SGEE 4BAMB 4CHAC 2XBWA 1W0YH 3P95A 1HGTH 2VINA 4Q80A 4IMZA 2ZDMA 3ATWA 1O2WA 1VZQH 1N6YA 3SBKA 4Y8XA 1O31A 4GUXA 1UCYH 5F6MA 1PFXC 1O35A 2QV1A 2FO9A 1GCTB 2UUYA 1Y59T 4U32A 2RDLA 3PMJA 3P70B 4ZKNU 3GYLB 1TPOA 1DX5M 2W7UA 6CHAC 2XXLA 1Z8GA 5AF9H 1LVMA 2HALA 3E8LA 5JYIA 3SW2B 2PWXA 2VGCB 4HFPB 1LHGH 1W3CA 4IMQA 3T26A 4ABBA 4OS5A 3LGYA 1C9PA 4I7YH 2PR3A 5GCHF 1NRRH 2VJ1A 2WYGA 4FUJA 3QWCH 4TWYA 3D65E 2EA3A 1K22H 4XOJA 1VITH 3ZZ4A 3MU0A 1C5ZB 2PSYA 1BT7A 2H9EH 5FXLA 3HATH 2O8UA 1OP0A 2BX3A 2R9PA 3RXBA 1C5LH 2ZTZA 1BHXF 3PTBA 2ZFTA 3BTME 1IQKA 2ZHFH 1ZJDA 5DPAA 5TJXA 2RA0A 5A8YA 1TNJA 1GBLA 2ZDKA 1SGIB 2NU0E 2FTLE 2BD2A 2SFAA 2VWOA 3A8CA 4DIIH 2VVVA 2PUQH 1BTPA 3SO3A 1TRMA 1TLDA 1LHEH 1XUFA 1PPGE 4INKA 1O2JA 1T8OA 4CHAB 3LOXA 3T28A 1UTJA 5C1XA 3ZVBA 1SGEE 3TJOA 1DS2E 1C5RA 1O3KA 3SJ9A 3PWCA 1WUNH 1O2RA 3Q77A 2QXGA 3B23B 4I8LA 1P2MA 1TX8A 4RSPA 3TU7H 1EQ9A 3HKIB 2GX4A 4IGDA 1KTTB 2BX4A 3ZVGA 2FDAA 4CRAA 6CHAB 1QQ4A 2J38A 1IQGA 4Y10E 1J17T 1GHXH 1OP8A 1HXFH 1FJSA 4MG3A 1TBZH 3GYMA 3RXJA 1OKXA 1J14A 1P09A 3LH3A 3V7TA 1AWHB 1ZYOA 1A3BH 2WINI 4YLQH 1TMBH 1GDNA 2QXJA 2B8OH 1L1JA 1ORFA 2ZO3H 5DJ7A 4FVDA 1TPSA 1CGJE 3M3TA 4XSKU 1TNKA 2A7HA 1KDQA 3HKJB 5DP5A 4MTBA 1GJ6A 5TCCA 1MTUA 2QN5T 3ZZBA 4I31A 3PLBA 3KGPA 1ZJKA 1LMWB 2PKSC 2GTBA 1BA8B 1ELTA 2ZGBH 1SLXB 1HIAA 1GBMA 1BIOA 2F83A 3SQHE 1GBIA 5GCHG 1ANCA 1ABJH 3VB3A 3LKWA 2A0QB 3BTQE 1C5SA 1RTFB 2H1UA 1YBWA 5HYOA 1YPHC 1C2LA 3K9XB 4DOQA 2FODA 2TGAA 4GHQA 3SU0A 1LKBA 1P06A 1THPB 4I8GA 3RDZA 1AUTC 2LPRA 2OBQA 1FUJA 1KXCA 3HGNA 4MLFB 1VCQA 1NTPA 3LGVA 1ZZZA 4ISOA 4Y6DA 1QL7A 1EZQA 2Z94A 4DGJA 5DKMA 3BF6H 2ZEBA 3GY6A 1UCYE 1AY6H 1NESE 2FLBH 5C3NA 4XBDA 3QK1A 3SN8A 3KEEA 3PWBA 1QBVH 1K1JA 1HBTH 2OC0A 4YOGA 2Z9JA 4X1NU 1ZHMA 1O3HA 1ARCA 1GHZA 1MUEB 2F9NA 2FM2A 4OGXA 2ANYA 2AMPA 3OY6U 1AHTH 1JRSA 1K2I1 3MNSA 5HGGA 4H42U 2PKSB 4MQAA 1HYLA 2NWNA 3GDVA 3TK6A 3I78A 1C2MA 4FU8A 1H9LB 3RM2H 3FP7E 3M5OA 4Y76A 1L1NA 4ISNA 2HPPH 1ZLRA 1IAUA 2R2MB 5AHGH 3SNEA 1O2LA 5DGJA 3ODDA 1AZ8A 1TPPA 1UTKA 2FXRA 4AGJA 1MU6B 1HAZB 1PQ8A 4J1YA 1UK2A 2XNIA 2BVRH 1MKWH 1Y8TA 4JCNA 4BOHA 4CH2B 3HK6B 3NZIA 1L4ZA 3BEIB 1OP2A 2TGPZ 2QXHA 1LTOA 3PO1C 5L2ZH 3TGKE 4AFZA 1ZMJA 3KCGH 1B7XB 4ZUHA 4X8UH 2PTNA 2PTCE 1QJ7B 4WH6A 4E7RG 1SI5H 2ZF0H 1C4Y2 3A7VA 5L6NH 3SU2A 3AASA 5T6DA 1O3DA 1Z8JB 2CHAC 5LPRA 5EXNA 1GL0E 1MMJN 2J9NA 4YT7H 2VIPA 3N7OA 2GDEH 4JYUH 2PSXA 3QX5H 1HAYB 4DURA 3VEQB 4FXGH 5DP8A 1GBBA 2P94A 3E0PB 3U8TH 3FP6E 2A5KA 4IBLH 3KN2A 2F91A 2NU2E 2ZCLP 1RFNA 2SGAA 5A8XA 1SQOA 1W8BH 1S81A 1SGRE 3IITA 1C5UA 1NO9H 1N1LA 1TNHA 1QFKH 2XTTB 1HJ9A 3RC6A 1TNGA 1AGJA 1IQEA 1O34A 5DP9A 4Y11E 5C2ZA 1F0UA 2XC5A 4O9VA 2ODPA 4THNH 3URCA 5I25A 1SGYE 3U1IB 5K0HA 3U1JB 3QZRA 3QTVH 1UTLM 3CP7A 3E16B 2D8WA 1RJXB 1PYTC 2XCFA 3GY5A 1GBKA 5C1UA 2J95A 1GWAA 4B76A 3PO1B 1C2GA 1GPZA 1JXPA 2FP7B 2OC1A 1ZPBA 1TWXB 1CT2E 3RUOA 3P17H 1NRQH 4DJZB 1V6DA 1QJ6B 3C27B 2ZG0H 2FZZA 4Y0YE 3BEUA 2AGEX 1OWIA 5EW2H 2CHAB 1O3NA 1MCTA 4X2WA 4BAHB 2BTCE 1CO7E 3FZDA 1ZMLA 3RXGA 3EE0B 1WAYB 2XC4A 2FYRA 1SHHB 2Q6FA 4FUDA 3TJNA 2BZ6H 2RCEA 2PUXB 4INLA 1IOEA 3MH5A 1INCA 1BUIA 3GY3A 1ACBE 2BXTH 3SUEA 1TRNA 5DO4H 1Y5UT 3B8JA 1C4V2 3QZQA 4K5ZA 1O2PA 3GY8A 3AAUA 3SU6A 2C3SA 2G55A 4WF8A 2D2DA 2PLXA 4FUIA 3TJVA 5C5OA 1OWHA 3UOUA 4CRBA 4IC6A 1EJMA 1O2QA 2UUJB 1QA7A 2OD3B 2VVCA 3VB5A 5EPYA 1EAIA 1YKTA 1O32A 1RTKA 2BQ7B 2ZIQH 2AFQB 3S0NA 4RN6A 3FVFB 2DE9A 2BB4A 3A83A 3R0FA 1TE0A 1D6RA 4ZHAA 4K8BA 4X8VH 3MH6A 4B1TA 3SNAA 1Y3XA 4ABEA 1YC0A 3RMOH 2AMQA 1UK4A 2Y82A 3LT3A 3GCNA 3BTGE 1SB1H 1F0SA 1SLUB 3BG4C 1GDQA 2O8WA 1S82A 2FYQA 4ASHA 4D9RA 1PPEE 1T8LA 3SJOA 1HCGA 1YM0A 4BTIB 1UTPA 4JZFH 3RMMH 1QL8A 2A7CA 4O3TA 4X2XA 1TX6A 1VJAU 1TOCB 4ZHLU 4AFSA 1FAXA 1GMHF 4UFEH 3UFAA 1NROH 2VVUA 2EEKA 1HXEH 4XFQA 3QN7A 3RMLH 2I6SA 3D49H 3RXSA 2WV5A 2G00A 7LPRA 1O2IA 3GCHC 1H8IH 5LGOA 4Y8YA 1EX3A 2QF3A 1CGIE 2ZFPH 4MNVA 1F92A 2VB0A 3RC4A 4BXSA 1FPHH 2HRVA 1SL3A 5F8ZA 1V2KT 3D23A 1T4UH 1GBCA 1FY1A 1L4DA 2YNAA 1F0TA 3F9GA 2WPHS 1CA0C 3RU4E 3DFLA 4ABFA 4AN7A 1AIXH 3H5CB 1BMAA 1MBQA 1XKAC 1O3OA 2ZHDA 1QHRB 4HZHA 1DXPA 5JPMH 2Z9KA 3RXTA 4RKOB 1O38A 3ZZ5A 1CHOF 2XRCA 2XBVA 1E34B 1KXBA 3BG4B 3S7HB 2ZU4A 5GWZA 1DY8A 2AMDA 4B2AA 4NSYA 1UTOA 3MMGA 4NA9H 4YOJA 1GI9B 3QTOH 1W13U 1WQSA 5HM9A 2CMYA 3LH1A 2SGQE 5HMAA 3SJIA 3SORA 1FZZA 1WV7H 3V0XA 4FU7A 4XBBA 2CN0H 3RXIA 2AYWA 1AKSA 1BBRE 3ZVCA 2V3HH 1ANDA 3DFJA 2BOKA 1FMGA 4UFFH 2Q1JA 1YPJH 1W10U 4U2WA 3GCHB 4E06H 1ZGIA 1E38B 5EU8A 1GI2A 2SGDE 1C5MD 3Q3YA 1HDTH 2B0FA 5C67A 1Z6EA 1QBNA 2WPIS 3BTDE 1VJ9U 1SLWB 1SHYA 2Y7ZA 3K2UA 3LJJA 5EW1H 2CV3A 3A81A 5H4IB 1PJPA 2P3TB 1MBMA 3UPEA 3OYPA 1CA0B 1ZSKA 3RXOA 1GMHG 1EPTA 4UE7H 2A5AA 1UHBA 4IC5A 4NCYA 4WMDA 2TGTA 1TGNA 1FIWA 1A5HA 3SNCA 1MQ5A 2F9OA 1BMLA 4FU9A 5GDSH 4ZXYH 1K1OA 2UUFB 2ZCKP 3ATIA 4D8NA 1GI4A 3EQ0H 2Z9LA 2XBYA 1HV7A 4AFQA 1K1NA 2CJIA 2BXUH 1BITA 3RXVA 1ESBA 4B2CA 5A0CA 5JBAS 2ZPRA 1BZXE 1YP9A 2ZU2A 4K8YA 3ATMA 2OQ5A 3CENA 3PYHA 1P3EA 3ZZ7A 2A4QA 3IG6B 3MTYA 2BY5X 1GBHA 1P2OA 4JYVH 4BXWA 1P9UA 3V3MA 2HGTH 1CHOG 1WSSH 3STIA 1UCYK 1DWDH 3STJA 2ANKH 1EAWA 1NY22 1V3XA 2ZI2H 2OQUA 1ETRH 3RXKA 1LCYA 1FLEE 1VR1H 1MZAA 4TPYA 1MTNC 3MO3A 1GG6C 1KSNA 1GHYH 3PB1E 1MTWA 4K3JA 2ZQ1A 5EOKA 1MKXK 3PMHB 1HB0B 1O2OA 2FX6A 1MAXA 5JBBS 1O2XA 1HJ8A 1TYNA 1XKBC 2P3FH 2NU4E 4BAKB 1UTMA 2ZPSA 3LU9B 2O8LA 3PLKA 1AUJA 3HPTB 1QRWA 3P8NA 1A0HB 1GHWH 4R8TB 1BRCE 5FCRA 3UTUH 1AI8H 2QXIA 2W26A 1O2VA 1A3EH 2VWMA 1H1BA 1MCVA 1UJ1A 5FX5A 1CA8B 3NCLA 1UMAH 3OY5U 3M61U 1UVTH 1GJ5H 3A7TA 1BHXB 1HRTH 3RLWH 2FS8A 2OBOA 3MWIU 1BRAA 3LONA 3MNBA 3A82A 5F8XA 3HK3B 1OYTH 1LQEA 2SGFE 4JK6A 3SV8A 1C1OA 3C1KA 4D9QA 1A61H 2R2WU 4K1SA 2GT7A 1HAVB 1HAGE 4NFFA 3BN9A 1QBOA 3HGPA 2QF0A 3M35A 1WTHD 1S85A 1NRPH 2ASUB 2ZDLA 1L1GA 1Y3WA 2GZ8A 2R3UA 1D3PB 4UFDH 4NFEA 3BTFE 1IQIA 3M7QA 1B0FA 1SGPE 1JIMA 1MTNB 1GG6B 1O2GH 2BVSH 4YZUA 5K7RA 1ZR0A 1AU8A 1NN6A 1NFUA 2GV7A 2ZA5A 3SUFA 5EQQA 1JMOH 2BDYA 4AGKA 4BANB 4ZKSU 1Y3UA 2W7SA 4X1PU 3M5MA 1S0RA 1N8OC 3RXDA 1FY3A 3TK9A 1XUIA 1DWBH 1E36B 1D9IA 1NPMA 2GGVB 1SGFG 1SQAA 1IHTH 3UWIA 1CGHA 3SU4A 2TGDA 5AVDA 2ANWA 2JH6D 4FUFA 1PPZA 2HWLB 1D6WA 4Q7YA 1TABE 2IN2A 1TQ0B 1NFYA 3BTKE 4TY6A 3DHKH 4LZ4B 1S0QA 2H5CA 1G2LA 1QQUA 1BB0B 4OGYA 5JB8S 5PTPA 3Q3XA 3TNTA 4KP0A 3F9EA 1XXFA 3ESTA 2FIRH 3U69H 4DT7B 3FANA 3GCOA 1C2EA 2BDIA 4B71A 2G51A 4K69A 2SNVA 3VXFH 1S6FA 1YCPM 4DVAU 5JBTA 2B5TB 2FESH 1BRBE 2YOLA 4ZMAH 1F0RA 1G30B 5LH8A 2D26C 1Q31A 4OS6A 4OS7A 4DY7B 1P2KA 2H6MA 3PROA 1C5YB 2XC0A 4GCHF 1C2HA 2KAIA 3VXEH 3ZVEA 5CMXH 1N8OB 4DW2U 2BMGB 2CF8H 1J16A 3RXUA 2BM2A 4NWLA 2FOEA 2W5EA 2AIQA 1O2YA 1FIZA 2HOBA 5SGAE 1J15A 3SGQE 1TFXA 2Z3EA 1EAUA 1FAKH 2FWWA 2VNTA 3LC3A 3ELAH 4Y8ZA 4CREA 1BTUA 2JH0D 1YCPK 1KDQB 3MU5A 3W94A 3SU1A 3UIRA 4RKJB 2ZGXH 4F49A 3GDSA 1PQAA 1OWDA 1L2EA 1WQVH 1C9TA 3EYDA 4K2YA 3V13A 1V2TT 5ETXA 5C1YA 3SUGA 3RXPA 5T3HA 1YYY1 1C5XB 1CBWC 1JIRA 1HIAB 1O0DH 2F9BH 2FOFA 2QAAA 2QIQA 2WPKS 2ZP0H 1NRNH 3SGBE 4ESTE 1K28D 1SMFE 1FN6A 3DD2H 3UQVA 3KQDA 8ESTE 1QCPA 4HGCA 1AFEH 1EKBB 1WTGH 1QURH 4ISLA 5C5NA 1GI8B 1BCUH 3FP8E 2KAIB 3RC5A 1OOKB 1GJ8B 1P2JA 3S69A 2B7DH 3RXQA 3GCTG 1A5GH 2J94A 1C1UH 2Y5GA 1Y3YA 1TA2A 2A2XH 4GPGA 1SBWA 1A0LA 2XW9A 2PGBB 4NG9H 3TPIZ 1V2RT 1C1MA 5HXFA 4UEHH 5TCAA 2GCHF 1O2TA 2HNTF 1TNIA 1V2JT 2GP9B 2J4IA 4J2YB 4ZKOU 2P3UB 2P93A 5EQSA 1O3GA 2PV9B 4WVPE 4JZDH 4BAOB 3EDXB 2VWNA 2F3CE 3A86A 4NIYA 1SGQE 2G4UA 3QGNB 4OS4A 1O2HA 3KHVA 1V2MT 1E0FD 4CRGA 2ZNKH 1TBRH 3MO9A 1ELEE 4GCHG 2ZHWH 3LGUA 1CU1A 1W0ZU 3VFEA 4X1RU 4ABAA 2VWLA 4YO9A 3W95A 3ZZ3A 1HAIH 5EODA 5JB9S 2WPJS 1CBWB 1M9UA 3E1XB 3SUDA 1O2UA 2H2ZA 3BV9B 3RU4D 1DOJA 3MI4A 3E6PH 1LKAA 4VGCC 1K1LA 1SGTA 1G3EA 5E0JA 1THSH 1W7GH 2GZ7A 1GI1A 2ZGJA 3TH4H 3GY2A 1GJDB 1HAOH 2Z9GA 1UVSH 5FAHA 2FS9A 1CVWH 3UY9A 4CR9A 1N6XA 3ZVDA 1T4VH 2IOTA 1PQ5A 5CHAC 2ZCHP 1P10A 3OSYA 3BTHE 2DE8A 7KMEH 1P2IA 1LDTT 1DWEH 1BBRK 3E0NB 1THRH 4NSVA 2PGQB 4KELA 3UNSA 4A7IB 4Q2KA 4AB9A 2FOMB 1QB9A 4WXIA 1WBGB 1DITH 1DPOA 3O8BA 1HPGA 1P01A 1ARBA 1GBEA 4X6OA 4CRCA 3AVZA 4ZH8A 4B74A 1EB2A 5A8ZA 1EB1H 1V2UT 3QO6A 3KQEA 4B75A 5C20A 2FTMA 1Z71A 3PTNA 2UWPA 1TRYA 3S9CA 3SZNA 2GCHG 1ELFA 5LPEA 4KGAA 3I77A 2BQ6B 1A46H 3GICB 4AYVB 1VCPA 1FY5A 1NZQH 1C1PA 4VGCB 1AO5A 3M5NA 5EPNA 1MZDA 1O2KA 3A87A 1LHFH 2PKAA 3OU0A 2ZTXA 1BMNH 2AGIX 1GI7B 2Z7FE 8LPRA 5FBEA 1ZHRA 3U8RH 2FOAA 2BDBA 1GVKB 1BTWA 5CHAB 1W14U 3RMNH 1PPHE 1TGSZ 2ZFQH 1AFQC 1P12E 2R0KA 1KLTA 4YLUA 4AOQA 1JOUB 1RS0A 4K1EA 2BVXH 1SOTA 1YLDA 1O5DH 4AYYB 5EXLA 2QCYA 5BPEA 3A89A 1GGDC 1AWFH 3TGJE 5T6GA 1C2FA 4ABDA 1NM6A 5ABWA 1C5TA 4FUBA 2VIOA 1GJ7B 2ZDAH 3ITIA 2FOCA 3PV4A 1KY9A 4AORA 5DP3A 1KLIH 4Y0ZE 2Y5FA 4LZ1H 1EJAA 1TOMH 2R0LA 3PMBB 4TY7A 5ESBA 1OYQA 1LHDH 5F03A 1ZRKA 4UONA 1LVOA 1ZTJA 1IQFA 2TIOA 1JRTA 1DSUA 2BZAA 1EZXC 1A2CH 1G3DA 1EOJA 1S5SA 2BD4A 1YPKH 1CSOE 3F1SB 2Y6TA 2ZHEH 1MAYA 3UNQA 1DT2A 2V0BA 3BEFB 2V6NA 3L3TA 4K1TA 3UOPA 3ZVFA 2J34A 3RXMA 3GY4A 1AFQB 3MYWA 4LXBH 1SSXA 1GVZA 2C8XB 1SFIA 4CRFA 2Z6BD 1RD3B 3SV9A 2ALVA 2ILNA 3MU1A 1GGDB 1Q2WA 2BY9X 2ESTE 4MNXA 1WU1A 4ZXXH 2VIVA 3H7TA 3K6ZA 1EZUC 1GVLA 2BDCA 2BY7X 3DUXH 3ZZ6A 1MTSA 2BD7A 2STBE 1V2QT 3A8DA 2TPIZ 4IS5A 1EZSC 1O5CB 1SC8U 2XWAA 2FMJA 2GVFA 3KF2A 3A80A 1GI0A 1A7SA 3SI3H 1SGDE 3TITA 4ABGA 1RGQA 1GJBB 1UVOA 3I29A 2THFB 1NS3A 2V35A 1IQMA 1BTYA 2CGAA 1BTZA 1FDPA 5G4BA 5E0GA 3UNRA 4TWWA 1XXDA 3SJ8A 1LQDB 2EI7A 3M37A 3TH2H 1OX1A 1SGFA 2ZZUH 1FI8A 2ANMH 3RXRA 1EOLA 4GAWA 3LGTA 3LDXH 5BRRE 3TGIE 3GISB 1A5IA 3RXHA 2ALPA 1GMCG 3MFJA 2ZPQA 1FY8E 4K60A 1NU7B 1O3BA 4TPIZ 1EPTC 5GPIB 3TK5A 4A6LA 5FHTA 2BD9A 5IDKA 3MH7A 3A7XA 1DY9A 3MOCA 4FUCA 3SU3A 3U8OH 1RTLA 1XUHA 2JKHA 1J9CH 4H6TA 3BSQA 2G52A 1PQ7A 4Y7BA 3FZZA 2RG3A 3LGWA 1ZPZA 4HTCH 2C8YB 1BJVA 4WH8A 4MPWA 4AZ2B 2AEIH 1C5QA 3UR9A 1F7ZA 2W3IA 3Q00A 4MPUA 3KQCA 1KXAA 3SOSA 1MD7A 1GDUA 1V2LT 1EJNA 2ZDVH 5E2PA 4WY3A 1ELBA 2BD8A 2OUAA 1FONA 1P03A 4BTUB 2JH5D 1AKSB 1EP6A 3TIUA 2BD3A 3AAVA 1P04A 2VH0A 2ZU5A 1GHBF 3TNSA 3VPKA 8GCHF 4KTCA 3VGCC 3UR6A 1ELDE 3RM0H 2A4OA 3BIVH 1P3CA 1A0JA 1D4PB 2LNCA 3RLYH 2BQWB 4Q7ZA 4R0IA 2BYAX 1C5VA 1C2KA 3ENSB 3VB4A 2BHGA 1K9OE 1S84A 3EAJA 5FX6A 4CH8B 2PFEA 3QLPH 3D62A 3NUMA 3O8DA 2A1DB 2EC9H 4O3UA 2A2QH 3ZYEA 4NIXA 1F2SE 2AS9A 1F5LA 1EPTB 1KYNA 1QJ1B 1UHBB 3JZ2B 2P8OC 3KL6A 3SI4H 1QRZA 2B9LA 3BG8A 1HUTH 4CR5A 2BLWA 3T5FH 5GXPA 1AMHA 1KXEA 2Y81A 3T29A 4A1VA 9ESTA 1P57B 1Z1JA 4YTAA 2D1JA 2VIDA 1AQ7A 2O8MA 1DLEA 2QGRA 2ZHQH 2A32A 4WMFA 1GCDA 1ZHPA 3URDA 4SGAE 6LPRA 5EGMA 1BRUP 1RRKA 3E90B 1KXDA 3T2NA 2OC8A 2C90B 4X2VA 1TALA 4JK5A 4X0WU 1K1PA 2A45B 1T8NA 3UQOA 1VITF 2ZWLH 1OSSA 4Y71A 1ZRBA 4LOYH 1YPEH 1G37A 5E0HA 3F6UH 3A7WA 1GHAG 3VGCB 1EATA 2WV4A 4FUEA 1G9IE 1XUGA 1FN8A 1OPHB 1MKXH 3U98H 1AZZA 3ZZDA 1O3MA 1C1RA 1Y3VA 1LPGB 3KQBA 5DP7A 7GCHF 2UUKB 1NRSH 2FOBA 1H8DH 3SV2H 2EI8A 4I8JA 1BOQA 1TAWA 4X2YA 1B0EA 4WMEA 2WYJA 1ZOMA 2ZGCA 3RXLA 1ZPCA 1HNEE 1GBDA 5DP6A 2OP9A 1U6QA 2P8OB 4D76A 1DE7H 1GHBG 8GCHG 1PPCE 4ZAEA 2XYAA 2ZECA 2V3OH 4X8SH 4XDEA 4ZHMU 2FOHA 1A1RA 1ETSH 3T62A 1ELCA 3AW1A 2QYIA 3A7YA 1CE5A 3TH3H 2VIQA 1HAXB 1IQJA 1Y5BT 1FPCH 1C1TA 1NFWA 3P8GA 3P6ZB 4O97A 3SV7A 2UWOA 1ESAA 1XM1A 1V2VT 1XMNB 3T27A 2FLRH 4ABHA 2ZKSA 1DICA 3GCTF 1ELGA 3TVJB 1P8VC 1X7AC 2PHBA 1E37B 4JZ1A 3ATKA 3NPSA 5CE1A 4H4FA 1AE5A 1EP5A 1WOFA 3SJKA 1L0ZA 1T7CA 1WCZA 5FBIA 4D7FA 3IWMA 1EUFA 1W2KH 1BDAA 1LPKB 1OS8A 2BDGA 4CBNA 1SR5C 3E3TA 5HM2A 2O9QA 1P11E 4MPVA 1HLTH 2OC7A 3O8CA 1MTVA 4M7GA 2XWBI 2Q6DA 4NA8A 1MU8B 1KLJH 1VITG 3ATLA 2HNTC 2ZC9H 1CT4E 5E8EH 4KKDA 3G01A 1P2NA 4DCDA 1O3LA 4MNWA 1ANEA 3P92A 4BAQB 3RXFA 1P0SH 1Q3XA 4QT8C 3ZZAA 2G5NA 1F5KU 1SOZA 1NFXA 1SPJA 1GJ4H 3OX7U 3DA9B 3LIWA 6GCHF 3H7OA 3A85A 3LGIA 4U01A 3EA9A 4MVNA 4NA7A 4FUHA 4X8TH 2Z3CA 1K1IA 7GCHG 1NU9A 1MD8A 2A5IA 2UWLA 4AG1A 5LPFA 1TGCA 3LJOA 2BDAA 4UDWH 1QRXA 5ESTE 2CXVA 3ZVAA 4INHA 3MHWU 5L30H 1HAPH 3ODFA 5E2OA 4X1QU 2ZFSA 4UFGH 1QGFA 3T25A 1DANH 4Z0KA 3EA7A 3MNXA 2J2UA 3LPRA 4FUGA 2W3KA 2IJOB 1OWJA 1W7XH 1O2NA 3S9BA 1DXWA 4X1SU 2H9TH 2P59A 3GY7A 1AVWA 2A4RA 5J4SA 4NIWA 3SNBA 3P8OA 1MKWK 4KTSA 1D3DB 1DDJA 3F9HA 1K21H 1FQ3A 4TYDA 2C93B 4I8HA 2JETC 5EG4A 4A1XA 5FCKA 1GBJA 1YCPH 3BTWE 4YT6H 1C2JA 1AE8H 2F9PA 4KTUA 2R3YA 2ULLA 3A8AA 1S6HA 1CHGA 4YM9A 3UWJH 4A5TS 2QC2A 2BLQA 2G5VA 2QY0B 1V2OT 1FV9A 1YF4A 1QTFA 1TPAE 2OCVB 4ABIA 3M3VA 3EA8A 1ZMNA 2WPMS 2BLVA 3VB6A 1GJCB 5EQRA 4X6NA 2A31A 1IQLA 1SFQB 3GOVB 3SNDA 1TIOA 2G8TA 3M36A 2AGGX 2VH6A 2HPQH 3UUZA 3RXAA 2BLOA 3AW0A 5AFYH 3SQEE 1NC6A 1GBFA 1DFPA 4B2BA 1AN1E 2Z9IA 2RA3A 3OTJE 1C5WB 5EXMA 5B6OA 1AB9C 2C4FH 1HFDA 1UVPA 3BTEE 2ODYB 1O39A 4X6PA 1C2IA 5JBCS 1GMDF 1UK3A 1P02A 6GCHG 1Z8RA 1QR3E 4XBCA 1UTNA 2P95A 1QY6A 3K65B 2IPHA 2ZFFH 3L6PA 1IHSH 4B73A 1TQ7B 2ODQA 3M5LA 1C1WH 1GL1A 4I33A 3M3SA 4E05H 1JBUH 2NU3E 1V2PT 2JETB 4JZEH 1Y5AT 1Z7KA 1C5OH 2GD4B 1YPGH 1AD8H 1UO6A 1FY4A 4WXVA 3MU4A 1RIWC 1GJAB 1BTXA 3PM3A 1IQHA 2GMTC 1QL9A 2OLGA 6ESTA 1LVYA 4GHTA 4JMYA 1XVOA 1ANBA 4OS1A 4YOIA 3V12A 2C8WB 3SHCH 1DUEA 3F68H 1AVGH 1AVXA 4NWKA 1EAXA 4Y7AA 1O3IA 1O3AA 1PPFE 2GKVE 2FPZA 4GSOA 3JZ1B 3Q76A 2ZFRH 1ELVA 3F9FA 3KNXA 4LK4A 1PPBH 2ZGHA 1C1NA 3MNCA 1O33A 3BTTE 3P8FA 4BNRA 4AG2A 1AB9B 1O5AB 1XUKA 5A0BA 1O3PB 1QB6A 1XVMA 1O3JA 5FPTA 1DSTA 1ZTKA 4NZLA 1C5PA 2GCTC 4XE4A 2FOGA 3TLOA 1O5EH 1GI6A 1WYKA 1BBRH
chains in the Genus database with same CATH superfamily
1BJUA 4F48B 3K6YA 4JYTA 4AX9H 2O8TA 1C5NH 2EY4C 1ZSLA 1HAHH 1B5GH 2XCNA 3GDUA 4E7NA 4YXWD 2TBSA 4CBOA 1BTHH 4H6SB 4I8KA 3SV6A 2OINA 5F8TA 1G2MA 1KIGH 2STAE 5FPSA 5A09A 1G3CA 2GT8A 2CF9H 4I32A 3ZYDA 2K1QA 1A4WH 2VIWA 3N7EA 1RIWB 3MU8A 2Y7XA 1TB6H 1UTQA 1Z1IA 3CS7A 1O5FH 4ACAA 3VB7A 5DG6A 4ZKRU 3MO6A 1E35B 2GMTB 1GMDG 1P05A 2FI4E 2AHME 4BTTB 4Q7XA 1ID5H 4UD9H 1KXFA 4GVUA 1UVUH 1G3BA 1T31A 4AB8A 2C8ZB 1CT0E 3A8BA 1ETTH 1C1SA 2BY8X 2G81E 3S7KB 2OTVA 3NK8A 3OFND 4ABJA 1QIXB 2G4TA 1DWCH 1D3QB 1GMCF 4IW4E 1QNJA 1LPZB 4OS2A 1EXFA 1PYTD 3QDZB 1OWKA 1TBQH 1O30A 5A0AE 2GCTB 1P9SA 4NIVA 3NKKA 2PKAB 1GBTA 1C2DA 2M5TA 1MQ6A 1GBAA 3EGKH 3RU4T 2JDID 3A7ZA 3E91A 1YPLH 1Z8IB 2HNTE 5A2MH 1ESTA 2GZ9A 5J4QA 2J92A 1W12U 2AIPA 2H5DA 4F4OC 1GJ9B 3A84A 3RP2A 2PW8H 3M7TA 2DUCA 3CS0A 2FI5E 2Z3DA 3KIDU 4HI3A 1O2SA 5IYTA 3L33A 1TX7A 1O5GH 2AERH 1GI5A 3NWUA 2QA9E 2GV6A 7ESTE 3ZZCA 2F9VA 5CDFE 3NRLA 1C4U2 5GJ4B 4MPXA 1G36A 1O3CA 1OXGA 5I46H 2Q6GA 1O36A 1DLKB 1YPHE 1ZGVA 1TMUH 1ZSJA 1LVBA 3DSOA 3SU5A 1E1QD 4MDSA 2HLCA 4WWYA 3MH4A 1C1QA 1D3TB 2ZTYA 3ZZ8A 4GLYA 3ZV8A 1H4WA 1TGTA 4U30A 4Y79A 4PROA 2WUBA 4AC9A 1DVAH 1OWEA 1TONA 3ZV9A 2HVXA 4A1TA 3UREA 1SVPA 3WY8A 1SG8B 2OXSA 1C1VH 3M7UA 2I6QA 4A92A 1LO6A 3TJUA 4WJG2 1ELAA 1TA6A 4AFUA 1W11U 1BMMH 4NZQA 3A88A 1HJAC 5T6FA 3O8RA 3B9FH 1TNLA 1VGCC 1IQNA 1P2QA 1GI3A 1XX9A 1MH0A 2JIZD 1O2MA 1TMTH 4ISHH 2NU1E 3SGAE 1O3EA 4ZCNA 1O2ZA 2BY6X 2TRMA 1F5RA 5FPYA 1V2WT 4Z6AH 1BQYA 2F9UA 4M9FA 1RXPA 1GHAF 4MNYA 1SGCA 3NXPA 2FX4A 3PLPA 5L2YH 1KTSB 2ZU1A 1DUAA 3FAOA 8KME2 1JWTA 3DT0H 4NGAH 2ZDNA 2Y5HA 4IN1A 3PMAB 2BD5A 3QUMP 3SHAH 1O5BB 1GHVH 1TGBA 5DK1A 1Z6JH 3ZZ9A 5T1VA 4JZIA 1VCWA 2H9HA 3Q3KA 3U9AH 2P16A 2SNWA 2AH4X 3QGJA 1FXYA 1GCTC 2OK5A 3RXCA 3S9AA 1XUJA 5KECA 1SLVB 2SGPE 5GIBA 1J8AA 4SGBE 1V2NT 1EASA 2Y80A 1O3FA 1O37A 2BOHB 3R3GB 1QA0A 3BIUH 1CQQA 2VGCC 1DM4B 2A7JA 4YESB 2WUCA 5DP4A 1YPMH 2FEQH 2WPLS 4FVBA 2ZQ2A 1HJAB 3LC5A 1G32B 1H9IE 1K1MA 1VGCB 2FI3E 1T8MA 4CRDA 5JDUB 1ZTLA 1LHCH 2YNBA 1YGCH 2BDHA 1S83A 1SQTA 4ZROA 3RXEA 4ISIH 5AFZH 4O03A 1QB1A 2A4GA 9LPRA 1T32A 1H9HE 2GDDA 4DG4A 2VU8E 1SGNE 1NT1A 2XBXA 4D7GA 1ABIH 3FFGA 3PV5A 4IN2A 1V2ST 4X6MA 1H8ED 2ZU3A 2EI6A 1HAVA 1FNIA 4DIHH 1YLCA 2SGEE 4BAMB 4CHAC 2XBWA 1W0YH 3P95A 1HGTH 2VINA 4Q80A 4IMZA 3F0PA 3FOAA 2ZDMA 3ATWA 1O2WA 1VZQH 1N6YA 3SBKA 4Y8XA 1O31A 4GUXA 1UCYH 5F6MA 1PFXC 1O35A 2QV1A 1BMFD 1GCTB 2FO9A 1Y59T 2UUYA 2XNDD 4U32A 2RDLA 3PMJA 3P70B 4ZKNU 4P02A 3GYLB 1TPOA 1DX5M 4Z1MD 2W7UA 6CHAC 2XXLA 1Z8GA 5AF9H 1LVMA 2HALA 3E8LA 5JYIA 3SW2B 2PWXA 2VGCB 3OE7D 4HFPB 1LHGH 1W3CA 4IMQA 3T26A 4ABBA 4OS5A 3LGYA 1C9PA 2YMSD 4I7YH 2PR3A 5GCHF 1NRRH 2VJ1A 2WYGA 4FUJA 1H8HD 3QWCH 4TWYA 3D65E 2EA3A 1K22H 4XOJA 1VITH 3ZZ4A 3MU0A 1C5ZB 2PSYA 1BT7A 2H9EH 5FXLA 3HATH 2O8UA 1OP0A 2BX3A 2R9PA 3RXBA 1C5LH 2ZTZA 1BHXF 3F3BA 3PTBA 2ZFTA 3BTME 1IQKA 2ZHFH 1ZJDA 5DPAA 5TJXA 2RA0A 5A8YA 1TNJA 1GBLA 2ZDKA 1SGIB 2NU0E 2FTLE 2BD2A 2SFAA 2VWOA 3A8CA 4DIIH 2VVVA 2PUQH 1BTPA 4Q63A 3SO3A 1TRMA 1TLDA 1LHEH 1XUFA 1PPGE 4INKA 1O2JA 1T8OA 4CHAB 3LOXA 3T28A 1UTJA 5C1XA 2J97A 3ZVBA 1SGEE 3TJOA 1DS2E 1C5RA 1O3KA 3SJ9A 3PWCA 1WUNH 1O2RA 3Q77A 2QXGA 3B23B 4I8LA 1P2MA 1TX8A 4RSPA 3TU7H 1EQ9A 3HKIB 2GX4A 4IGDA 5EJ1A 1KTTB 2BX4A 3DSGA 3ZVGA 2FDAA 4CRAA 6CHAB 1QQ4A 2J38A 1IQGA 4Y10E 1J17T 1GHXH 1OP8A 1OHHD 1HXFH 1FJSA 4MG3A 1TBZH 3GYMA 3RXJA 1OKXA 1J14A 1P09A 3LH3A 2IJD1 3V7TA 1AWHB 1ZYOA 1A3BH 2WINI 4YLQH 1TMBH 1GDNA 2QXJA 2B8OH 1L1JA 1ORFA 2ZO3H 5DJ7A 4FVDA 1TPSA 1CGJE 3M3TA 4XSKU 1TNKA 2A7HA 3ZIAD 1KDQA 3HKJB 5DP5A 4MTBA 5EIYA 1GJ6A 5TCCA 1MTUA 2QN5T 3ZZBA 4I31A 3PLBA 3KGPA 1ZJKA 1LMWB 2PKSC 2GTBA 1BA8B 1ELTA 2JJ1D 2ZGBH 1SLXB 1HIAA 1GBMA 1BIOA 2F83A 3SQHE 1GBIA 5GCHG 1ANCA 1ABJH 3VB3A 3LKWA 2A0QB 3BTQE 1C5SA 1RTFB 1FX0B 1YBWA 2H1UA 5HYOA 1YPHC 1C2LA 3K9XB 4DOQA 2FODA 2TGAA 4GHQA 3SU0A 1LKBA 1P06A 1THPB 3DCLA 4I8GA 3RDZA 1AUTC 2LPRA 2OBQA 1FUJA 1KXCA 3HGNA 4MLFB 1VCQA 1NTPA 3LGVA 1ZZZA 3F2FA 4ISOA 4Y6DA 1QL7A 1EZQA 2Z94A 2W6ID 4DGJA 5DKMA 3BF6H 2ZEBA 3GY6A 1UCYE 1AY6H 1NESE 2FLBH 5C3NA 4XBDA 3QK1A 3SN8A 3KEEA 3PWBA 1QBVH 1K1JA 1HBTH 2OC0A 4YOGA 2Z9JA 4X1NU 1ZHMA 1O3HA 1ARCA 1GHZA 1MUEB 2F9NA 2FM2A 4RT0A 4OGXA 2ANYA 2AMPA 3OY6U 1AHTH 1JRSA 1K2I1 3MNSA 5HGGA 4H42U 2PKSB 4MQAA 1HYLA 2NWNA 3GDVA 3TK6A 3I78A 1C2MA 3OAAD 4FU8A 1H9LB 3RM2H 3FP7E 3M5OA 4Y76A 1L1NA 4ISNA 2HPPH 1ZLRA 1IAUA 2R2MB 5AHGH 3SNEA 1O2LA 5DGJA 3ODDA 1AZ8A 1TPPA 1UTKA 2FXRA 4AGJA 1MU6B 2QF4A 1HAZB 1PQ8A 4J1YA 1UK2A 2XNIA 2BVRH 1MKWH 1Y8TA 4JCNA 4BOHA 4CH2B 3HK6B 3NZIA 1L4ZA 3BEIB 1OP2A 2TGPZ 2QXHA 1LTOA 3PO1C 3U28C 5L2ZH 3TGKE 4AFZA 1ZMJA 3KCGH 1B7XB 4ZUHA 4X8UH 2PTNA 2PTCE 2WPDD 1QJ7B 2QF5A 4WH6A 4E7RG 1SI5H 2ZF0H 1C4Y2 3A7VA 5L6NH 3SU2A 3AASA 5T6DA 1O3DA 1Z8JB 2CHAC 5LPRA 5EXNA 1GL0E 1MMJN 2J9NA 4YT7H 2VIPA 3N7OA 2GDEH 4JYUH 2PSXA 3QX5H 1HAYB 4DURA 3VEQB 4FXGH 5DP8A 1GBBA 2P94A 3E0PB 3U8TH 3FP6E 2A5KA 4IBLH 3KN2A 2F91A 2NU2E 2ZCLP 1RFNA 2SGAA 5A8XA 1SQOA 1W8BH 1S81A 1SGRE 3IITA 1C5UA 1NO9H 1N1LA 1TNHA 1QFKH 2XTTB 1HJ9A 3RC6A 1TNGA 1AGJA 1IQEA 1O34A 5DP9A 4Y11E 5C2ZA 1F0UA 2XC5A 4O9VA 2ODPA 4THNH 3URCA 3KYFA 5I25A 1SGYE 3U1IB 5K0HA 3U1JB 2KFWA 3QZRA 3QTVH 1UTLM 3CP7A 3E16B 2D8WA 1RJXB 1PYTC 2XCFA 3GY5A 1GBKA 5C1UA 2J95A 1GWAA 4B76A 3PO1B 1C2GA 1GPZA 1JXPA 2FP7B 3OTPA 2OC1A 1ZPBA 1S6LA 1TWXB 1CT2E 3RUOA 3P17H 2KZ4A 1NRQH 4DJZB 1V6DA 1QJ6B 5EJLA 3C27B 2ZG0H 2FZZA 4Y0YE 3BEUA 2AGEX 1E79D 1OWIA 5EW2H 2CHAB 1O3NA 1MCTA 4X2WA 4BAHB 2BTCE 1CO7E 3FZDA 1ZMLA 3PRBA 3RXGA 3EE0B 1WAYB 2XC4A 2FYRA 1SHHB 2Q6FA 4FUDA 3TJNA 2BZ6H 2RCEA 2L6OA 2PUXB 4INLA 1IOEA 3MH5A 1INCA 1BUIA 3GY3A 1ACBE 4FOUC 2BXTH 3SUEA 4F55A 1TRNA 5DO4H 1Y5UT 3B8JA 1C4V2 3QZQA 4K5ZA 1O2PA 3GY8A 3AAUA 3SU6A 2C3SA 2G55A 4WF8A 2D2DA 2PLXA 4FUIA 3EE7A 3TJVA 5C5OA 1OWHA 3UOUA 4CRBA 4IC6A 1EJMA 1O2QA 2UUJB 1QA7A 2OD3B 2VVCA 3VB5A 5EPYA 1EAIA 1YKTA 1O32A 1RTKA 2BQ7B 2ZIQH 2AFQB 3S0NA 4RN6A 3FVFB 2DE9A 2BB4A 3A83A 3R0FA 1TE0A 1D6RA 4ZHAA 4TSFD 4K8BA 4X8VH 3MH6A 4B1TA 3SNAA 1Y3XA 4ABEA 1YC0A 3RMOH 2AMQA 1UK4A 2Y82A 3LT3A 3GCNA 3BTGE 1SB1H 1F0SA 1SLUB 3BG4C 1GDQA 2O8WA 1S82A 2FYQA 4ASHA 4D9RA 1PPEE 1T8LA 3SJOA 1HCGA 1YM0A 3PV2A 4BTIB 1UTPA 4JZFH 3RMMH 1QL8A 1SKYE 2A7CA 4O3TA 4X2XA 1TX6A 1VJAU 1TOCB 4ZHLU 1W0JD 4AFSA 1FAXA 1GMHF 4UFEH 3UFAA 1NROH 2VVUA 2EEKA 1HXEH 4XFQA 3QN7A 3RMLH 2I6SA 3D49H 3RXSA 2WV5A 2G00A 7LPRA 1O2IA 3GCHC 1H8IH 4I86A 5LGOA 4Y8YA 1EX3A 2QF3A 1CGIE 2ZFPH 4MNVA 1F92A 2VB0A 3RC4A 4BXSA 1FPHH 2HRVA 1SL3A 5F8ZA 1V2KT 3D23A 1T4UH 1GBCA 1FY1A 1L4DA 2YNAA 1NBMD 1F0TA 3F9GA 2WPHS 1CA0C 2L74A 3DFLA 3DSPA 3RU4E 4ABFA 4TT3D 4AN7A 1AIXH 3H5CB 1BMAA 1MBQA 1XKAC 2KX4A 1O3OA 2ZHDA 1QHRB 4HZHA 1DXPA 5JPMH 2Z9KA 3RXTA 4RKOB 2J98A 1O38A 3ZZ5A 1CHOF 2XRCA 2XBVA 5IK2D 1E34B 1KXBA 3BG4B 3S7HB 2ZU4A 5GWZA 1DY8A 2AMDA 4B2AA 2KCPA 1UTOA 3MMGA 4NA9H 4NSYA 4YOJA 1GI9B 3QTOH 1W13U 1WQSA 5HM9A 2CMYA 3LH1A 2SGQE 5HMAA 3SJIA 3SORA 1FZZA 1WV7H 3V0XA 4FU7A 5HIYA 4XBBA 2CN0H 3RXIA 2AYWA 1AKSA 1BBRE 3ZVCA 2V3HH 1ANDA 3DFJA 4DT4A 2BOKA 1FMGA 4UFFH 2Q1JA 4Q4LA 1YPJH 1W10U 4U2WA 3GCHB 4E06H 1ZGIA 1E38B 5EU8A 1GI2A 2SGDE 1C5MD 3Q3YA 1HDTH 2B0FA 5C67A 1Z6EA 1QBNA 2WPIS 3BTDE 1VJ9U 1SLWB 3UB0A 1SHYA 2Y7ZA 3K2UA 3LJJA 5EW1H 2CV3A 3A81A 5H4IB 1PJPA 2P3TB 1MBMA 3UPEA 3OYPA 1CA0B 1ZSKA 3RXOA 1GMHG 1EPTA 4UE7H 2A5AA 1UHBA 4IC5A 4NCYA 4WMDA 2TGTA 1TGNA 1FIWA 5HIZA 1A5HA 3SNCA 1MQ5A 5KEDA 2F9OA 1BMLA 4FU9A 5GDSH 4ZXYH 1K1OA 2UUFB 2ZCKP 3ATIA 4D8NA 1GI4A 3EQ0H 2Z9LA 2XBYA 1HV7A 4AFQA 1K1NA 2CJIA 5B6LA 2BXUH 1BITA 3RXVA 1ESBA 4B2CA 5A0CA 5JBAS 2ZPRA 5EJZA 1BZXE 1YP9A 2ZU2A 4K8YA 3ATMA 2OQ5A 3CENA 3PYHA 1COWD 1P3EA 3ZZ7A 2A4QA 3IG6B 3MTYA 2BY5X 1GBHA 1P2OA 4JYVH 4BXWA 1P9UA 3V3MA 1SQRA 2HGTH 2WZQA 5KGOA 1CHOG 1WSSH 3STIA 1UCYK 1DWDH 3STJA 2WHXA 2ANKH 1EAWA 1NY22 1V3XA 2ZI2H 2OQUA 1ETRH 3RXKA 1LCYA 1FLEE 1VR1H 1MZAA 4TPYA 1MTNC 3MO3A 1GG6C 1KSNA 1GHYH 3PB1E 1MTWA 4K3JA 2KCYA 2ZQ1A 5EOKA 1MKXK 2V7QD 3PMHB 1HB0B 1O2OA 2FX6A 1MAXA 5JBBS 1O2XA 1HJ8A 1TYNA 1XKBC 2P3FH 2NU4E 4BAKB 1UTMA 2ZPSA 3LU9B 2O8LA 3PLKA 1AUJA 3HPTB 1QRWA 3P8NA 1A0HB 1GHWH 4R8TB 1BRCE 5FCRA 3UTUH 1AI8H 2QXIA 2W26A 1O2VA 1A3EH 2VWMA 1H1BA 1MCVA 1UJ1A 5FX5A 1CA8B 3NCLA 1UMAH 3OY5U 3M61U 1UVTH 1GJ5H 3A7TA 1BHXB 1HRTH 3RLWH 2FS8A 2OBOA 3MWIU 1BRAA 3LONA 3MNBA 3A82A 4XD7D 5F8XA 3HK3B 1OYTH 1LQEA 2SGFE 4JK6A 3SV8A 1C1OA 3C1KA 4D9QA 1A61H 2R2WU 4K1SA 2GT7A 1HAVB 1HAGE 4NFFA 3BN9A 1QBOA 3HGPA 2QF0A 3M35A 1WTHD 1S85A 1NRPH 2ASUB 2ZDLA 1L1GA 1Y3WA 2GZ8A 2R3UA 1D3PB 4UFDH 4NFEA 3BTFE 1IQIA 3M7QA 1B0FA 3N7DA 1SGPE 1JIMA 1MTNB 1GG6B 1O2GH 2BVSH 4YZUA 5K7RA 1ZR0A 1AU8A 1NN6A 3FN8A 1NFUA 2GV7A 2ZA5A 2KM0A 3SUFA 2F4LA 5EQQA 1JMOH 2BDYA 4AGKA 4BANB 4ZKSU 1Y3UA 2W7SA 4X1PU 3M5MA 1S0RA 1N8OC 3RXDA 1FY3A 3TK9A 1XUIA 1DWBH 1E36B 1D9IA 1NPMA 2GGVB 1WXRA 1SGFG 1SQAA 1IHTH 3UWIA 1CGHA 3SU4A 2TGDA 5AVDA 2ANWA 2JH6D 2HVYB 4FUFA 1PPZA 2HWLB 1D6WA 4Q7YA 1EFRD 1TABE 2IN2A 1TQ0B 1NFYA 3BTKE 4TY6A 4B6FA 3DHKH 4LZ4B 1S0QA 2H5CA 1G2LA 1QQUA 1BB0B 4OGYA 5JB8S 5PTPA 3Q3XA 3TNTA 4KP0A 3F9EA 1XXFA 3ESTA 1VKYA 2FIRH 3U69H 4DT7B 3FANA 3GCOA 1C2EA 2BDIA 4B71A 2G51A 4K69A 2SNVA 3VXFH 2F43B 1S6FA 1YCPM 4DVAU 2EQNA 5JBTA 2B5TB 2FESH 1BRBE 2YOLA 4ZMAH 1F0RA 1G30B 5LH8A 2D26C 1Q31A 4OS6A 4OS7A 4DY7B 1P2KA 2H6MA 3PROA 1C5YB 2XC0A 4GCHF 1C2HA 2KAIA 3VXEH 3ZVEA 5CMXH 5F53A 1N8OB 4DW2U 2BMGB 2CF8H 1J16A 3RXUA 2BM2A 4NWLA 2FOEA 2W5EA 2AIQA 1O2YA 1FIZA 2HOBA 5SGAE 1J15A 3SGQE 1TFXA 2Z3EA 1EAUA 1FAKH 2FWWA 2VNTA 3LC3A 3ELAH 4Y8ZA 5C0TA 4CREA 1BTUA 2JH0D 1YCPK 1KDQB 3MU5A 3W94A 3SU1A 3UIRA 4RKJB 2ZGXH 4F49A 3GDSA 1PQAA 1OWDA 1L2EA 1WQVH 1C9TA 3EYDA 4K2YA 2XOKD 3V13A 1V2TT 5ETXA 5C1YA 3SUGA 3RXPA 5T3HA 1YYY1 1C5XB 1CBWC 1JIRA 1HIAB 1O0DH 2F9BH 2FOFA 2QAAA 2QIQA 2WPKS 2ZP0H 1NRNH 3SGBE 4ESTE 1K28D 1SMFE 3KQ5A 1FN6A 3N99A 3DD2H 3UQVA 3KQDA 8ESTE 1QCPA 4HGCA 1AFEH 1EKBB 1E1RD 1WTGH 1QURH 4ISLA 5C5NA 1GI8B 1BCUH 3FP8E 2KAIB 3RC5A 1OOKB 1GJ8B 1P2JA 3S69A 2B7DH 3RXQA 3GCTG 1A5GH 2J94A 1C1UH 2Y5GA 1Y3YA 1TA2A 2A2XH 4GPGA 1SBWA 1A0LA 2XW9A 2M2AA 2PGBB 4NG9H 3TPIZ 1V2RT 1C1MA 2JJ2D 5HXFA 4UEHH 5TCAA 2GCHF 1O2TA 2HNTF 1TNIA 1V2JT 2GP9B 2J4IA 3F2GA 4J2YB 4ZKOU 2P3UB 2P93A 5EQSA 1O3GA 2PV9B 4WVPE 4JZDH 4BAOB 3EDXB 2VWNA 2F3CE 3A86A 4NIYA 1SGQE 2G4UA 3QGNB 4OS4A 1O2HA 3KHVA 1V2MT 1E0FD 4CRGA 2ZNKH 1TBRH 3MO9A 1ELEE 4GCHG 2ZHWH 3LGUA 3GS9A 1CU1A 1W0ZU 3VFEA 4X1RU 4ABAA 2VWLA 4YO9A 3W95A 3ZZ3A 1HAIH 5EODA 3FKSD 5JB9S 2WPJS 2KR7A 1CBWB 1M9UA 3E1XB 3SUDA 1O2UA 2H2ZA 3BV9B 3RU4D 5HKKD 1DOJA 3MI4A 3E6PH 1LKAA 4VGCC 1K1LA 1SGTA 1G3EA 5E0JA 3MQKC 1THSH 1W7GH 2GZ7A 1GI1A 2ZGJA 3TH4H 3GY2A 1GJDB 1HAOH 2Z9GA 1UVSH 5FAHA 2FS9A 1CVWH 3UY9A 4CR9A 1N6XA 3ZVDA 1T4VH 2IOTA 1PQ5A 5CHAC 2ZCHP 1P10A 3OSYA 3PRDA 3BTHE 2DE8A 7KMEH 1P2IA 1LDTT 1DWEH 1BBRK 3E0NB 1THRH 4NSVA 2PGQB 4KELA 3UNSA 4A7IB 4Q2KA 4AB9A 2FOMB 1QB9A 4WXIA 1WBGB 1DITH 1DPOA 3O8BA 2LP6A 5FL7D 1HPGA 1P01A 3SZEA 1ARBA 1GBEA 4X6OA 4CRCA 3AVZA 4ZH8A 4B74A 1EB2A 5A8ZA 1EB1H 1V2UT 3QO6A 3KQEA 4B75A 2WSSD 5C20A 2FTMA 1Z71A 3PTNA 2UWPA 1K0HA 1TRYA 3S9CA 3SZNA 2GCHG 1ELFA 5LPEA 4KGAA 3I77A 2BQ6B 1A46H 3GICB 4AYVB 1VCPA 1FY5A 1NZQH 1C1PA 4VGCB 1AO5A 3M5NA 5EPNA 1MZDA 1O2KA 3A87A 1LHFH 2PKAA 3OU0A 2ZTXA 1BMNH 3F0OA 2AGIX 1GI7B 2RFKC 2Z7FE 8LPRA 5FBEA 1ZHRA 3U8RH 2FOAA 2BDBA 1GVKB 1BTWA 5CHAB 1W14U 3RMNH 1PPHE 1TGSZ 2ZFQH 1AFQC 3OEED 1P12E 2R0KA 5C17A 2J5UA 1KLTA 4YLUA 4AOQA 1JOUB 1RS0A 4K1EA 2BVXH 1SOTA 3W1EA 1YLDA 1O5DH 4AYYB 5EXLA 2QCYA 5BPEA 3A89A 1GGDC 1AWFH 3TGJE 5T6GA 1C2FA 4ABDA 1NM6A 5ABWA 1C5TA 4FUBA 2VIOA 1GJ7B 2ZDAH 3ITIA 3CNRA 2FOCA 3PV4A 1KY9A 4AORA 5DP3A 1KLIH 4Y0ZE 2Y5FA 4LZ1H 1EJAA 4XRNA 1TOMH 2R0LA 3PMBB 4TY7A 5ESBA 1OYQA 1LHDH 5F03A 1ZRKA 4UONA 1LVOA 1ZTJA 1IQFA 2TIOA 1JRTA 1DSUA 2BZAA 1EZXC 1A2CH 1G3DA 1EOJA 1S5SA 2BD4A 1YPKH 1CSOE 3F1SB 2Y6TA 2ZHEH 1MAYA 3UNQA 1DT2A 2V0BA 3BEFB 4RT1A 2V6NA 3L3TA 4K1TA 3UOPA 3ZVFA 2J34A 3RXMA 3GY4A 1AFQB 3MYWA 4LXBH 1SSXA 1GVZA 2C8XB 1SFIA 4CRFA 2Z6BD 1RD3B 3SV9A 2ALVA 2ILNA 3MU1A 1GGDB 1Q2WA 2BY9X 2ESTE 4MNXA 1WU1A 4ZXXH 2VIVA 3H7TA 3K6ZA 1EZUC 1GVLA 2BDCA 4ACBA 2BY7X 3DUXH 3ZZ6A 1MTSA 2BD7A 2STBE 1V2QT 3A8DA 2TPIZ 4IS5A 1EZSC 1O5CB 1SC8U 2XWAA 2FMJA 2GVFA 3KF2A 3A80A 1GI0A 1A7SA 3SI3H 1SGDE 3TITA 4ABGA 1RGQA 1GJBB 1UVOA 3I29A 2THFB 1NS3A 2V35A 1IQMA 1BTYA 2K0QA 2CGAA 1BTZA 1FDPA 5G4BA 5E0GA 3UNRA 4TWWA 1XXDA 3SJ8A 1LQDB 2EI7A 3M37A 3TH2H 1OX1A 1SGFA 2ZZUH 1FI8A 2ANMH 3RXRA 2GJGA 1EOLA 4GAWA 3LGTA 3LDXH 5BRRE 3TGIE 3GISB 1A5IA 3RXHA 2ALPA 1GMCG 3MFJA 2ZPQA 1FY8E 4K60A 1NU7B 1O3BA 4TPIZ 1EPTC 3KYGA 5GPIB 3TK5A 4A6LA 5FHTA 2BD9A 2W6JD 5IDKA 2KCAA 3MH7A 3A7XA 1DY9A 3MOCA 4FUCA 3SU3A 3U8OH 1RTLA 1XUHA 2JKHA 1J9CH 4H6TA 2J98B 3BSQA 2G52A 1PQ7A 4Y7BA 3FZZA 2RG3A 3LGWA 1ZPZA 4HTCH 2C8YB 1BJVA 4WH8A 4MPWA 4AZ2B 2AEIH 1C5QA 3UR9A 1F7ZA 2W3IA 3Q00A 4MPUA 3KQCA 2YMSC 1KXAA 3SOSA 4ASUD 1MD7A 1GDUA 1V2LT 1EJNA 2ZDVH 5E2PA 4WY3A 1ELBA 2BD8A 2OUAA 1YLNA 1FONA 1P03A 4BTUB 2JH5D 1AKSB 1EP6A 3TIUA 2BD3A 3AAVA 1P04A 2VH0A 2ZU5A 1KMHB 1GHBF 3TNSA 3VPKA 8GCHF 4KTCA 3VGCC 3UR6A 2K8IA 1ELDE 3RM0H 2A4OA 3BIVH 1P3CA 1A0JA 1D4PB 2LNCA 3RLYH 1MABB 2BQWB 4Q7ZA 4R0IA 2BYAX 1C5VA 1C2KA 3ENSB 3VB4A 2BHGA 1K9OE 1S84A 3EAJA 5FX6A 4CH8B 2PFEA 3QLPH 3D62A 3NUMA 3O8DA 2A1DB 2EC9H 4O3UA 2A2QH 3ZYEA 4NIXA 1F2SE 2AS9A 1F5LA 1EPTB 2PP6A 1KYNA 1QJ1B 1UHBB 3JZ2B 2P8OC 3KL6A 3SI4H 1QRZA 2B9LA 3BG8A 1HUTH 4CR5A 2BLWA 3T5FH 5GXPA 1AMHA 1KXEA 2Y81A 3T29A 4A1VA 9ESTA 1P57B 1Z1JA 4YTAA 2D1JA 2VIDA 1AQ7A 2O8MA 1DLEA 2QGRA 2ZHQH 2A32A 4WMFA 1GCDA 1ZHPA 3URDA 4SGAE 6LPRA 5EGMA 2YMSB 1BRUP 1RRKA 3WWBA 3E90B 1KXDA 3T2NA 2OC8A 2C90B 4X2VA 2CK3D 1TALA 4JK5A 4X0WU 1K1PA 2A45B 1T8NA 3UQOA 1VITF 2ZWLH 1OSSA 4Y71A 1ZRBA 4LOYH 1YPEH 1G37A 5E0HA 3F6UH 3A7WA 1GHAG 3VGCB 1EATA 2WV4A 4FUEA 1G9IE 1XUGA 1FN8A 1OPHB 1MKXH 3U98H 1AZZA 3ZZDA 1O3MA 1C1RA 1Y3VA 1LPGB 3KQBA 5DP7A 7GCHF 2UUKB 1NRSH 2FOBA 1H8DH 3SV2H 2EI8A 4I8JA 1BOQA 1TAWA 4X2YA 1B0EA 4WMEA 2WYJA 1ZOMA 2ZGCA 3RXLA 1NBME 1ZPCA 2IPQX 1HNEE 1GBDA 4HG6A 5DP6A 2OP9A 3F2HA 1U6QA 2P8OB 4D76A 1DE7H 1GHBG 8GCHG 1WDIA 1PPCE 4ZAEA 2XYAA 2ZECA 2V3OH 4X8SH 4XDEA 4ZHMU 2FOHA 1A1RA 1ETSH 3T62A 4P00A 1ELCA 3AW1A 2QYIA 3A7YA 1CE5A 3TH3H 2VIQA 1HAXB 4OM9A 1IQJA 1Y5BT 1FPCH 1C1TA 1NFWA 3P8GA 3P6ZB 4O97A 3SV7A 1YY3A 2UWOA 1ESAA 3OEHD 1XM1A 1V2VT 1XMNB 3T27A 2FLRH 4ABHA 2ZKSA 1DICA 3GCTF 1ELGA 3TVJB 1P8VC 1X7AC 2PHBA 5DN6D 1E37B 4JZ1A 2HLDD 3ATKA 3NPSA 5CE1A 4H4FA 1AE5A 1EP5A 1WOFA 3SJKA 1L0ZA 1T7CA 1WCZA 5FBIA 4D7FA 3IWMA 1EUFA 1W2KH 1BDAA 1LPKB 1OS8A 2BDGA 5C94A 4CBNA 1SR5C 3E3TA 5HM2A 2O9QA 1P11E 4MPVA 1HLTH 2OC7A 3O8CA 1MTVA 4M7GA 2XWBI 2Q6DA 4NA8A 3SYJA 1MU8B 1KLJH 1VITG 3ATLA 2HNTC 2ZC9H 1CT4E 5E8EH 4KKDA 3G01A 1P2NA 4DCDA 1O3LA 4MNWA 1ANEA 3P92A 2WV9A 4BAQB 3RXFA 1P0SH 1Q3XA 4QT8C 3ZZAA 2G5NA 1F5KU 1SOZA 1NFXA 1SPJA 1QZ8A 1GJ4H 3OX7U 3DA9B 3LIWA 6GCHF 3H7OA 3A85A 2KCOA 3LGIA 4U01A 3EA9A 4MVNA 4NA7A 4FUHA 4X8TH 2Z3CA 1K1IA 7GCHG 1NU9A 1MD8A 2A5IA 2UWLA 4AG1A 5LPFA 1TGCA 3LJOA 2BDAA 3H09A 4UDWH 1QRXA 1YWUA 5ESTE 2CXVA 3ZVAA 4INHA 3MHWU 5L30H 1HAPH 3ODFA 5E2OA 4X1QU 2ZFSA 4UFGH 4B6EA 1QGFA 3T25A 1DANH 4Z0KA 3EA7A 3MNXA 2QE7D 2J2UA 2RDEA 3LPRA 4FUGA 2W3KA 2IJOB 1OWJA 1W7XH 1O2NA 3WW7A 3S9BA 1DXWA 4X1SU 2V3MA 2H9TH 2P59A 3GY7A 1AVWA 2A4RA 5J4SA 4NIWA 3SNBA 3P8OA 5GNDA 1MKWK 4KTSA 1D3DB 1DDJA 3F9HA 1K21H 1FQ3A 4TYDA 2C93B 4I8HA 2JETC 5EG4A 4A1XA 5FCKA 1GBJA 1YCPH 3BTWE 4YT6H 1C2JA 1AE8H 2F9PA 4KTUA 2R3YA 2ULLA 3A8AA 1S6HA 3UAIC 1CHGA 4YM9A 4RI0A 3UWJH 4A5TS 2QC2A 2BLQA 2G5VA 2QY0B 1V2OT 1FV9A 1YF4A 1QTFA 1TPAE 2OCVB 2VBCA 4FETA 4ABIA 3M3VA 3EA8A 1ZMNA 3FO8D 2WPMS 2BLVA 3VB6A 1GJCB 5EQRA 4X6NA 2A31A 1IQLA 1SFQB 3GOVB 3SNDA 1TIOA 2G8TA 3M36A 2AGGX 2VH6A 2HPQH 3UUZA 3RXAA 2BLOA 3AW0A 5AFYH 3SQEE 1NC6A 1GBFA 1DFPA 4B2BA 1AN1E 2Z9IA 2RA3A 3OTJE 1C5WB 5EXMA 5B6OA 1AB9C 2C4FH 1UW7A 1HFDA 1UVPA 3BTEE 5C0UA 2ODYB 1O39A 4X6PA 5CHBA 1C2IA 5JBCS 1GMDF 1UK3A 1P02A 6GCHG 1Z8RA 3WWFA 1QR3E 4XBCA 1UTNA 2P95A 1QY6A 3K65B 2IPHA 2ZFFH 3L6PA 1IHSH 2LELA 4B73A 1TQ7B 2ODQA 3M5LA 1C1WH 1GL1A 4I33A 3M3SA 4E05H 1JBUH 2NU3E 1V2PT 2JETB 4JZEH 1Y5AT 1Z7KA 1C5OH 2GD4B 1YPGH 1W0KD 1AD8H 1UO6A 1FY4A 4WXVA 3MU4A 1RIWC 1GJAB 1BTXA 3PM3A 1IQHA 2GMTC 1QL9A 3VG8A 2OLGA 6ESTA 1LVYA 4GHTA 4JMYA 1XVOA 1ANBA 4OS1A 4YOIA 3V12A 2C8WB 3SHCH 1DUEA 3F68H 1AVGH 1AVXA 4NWKA 1EAXA 4Y7AA 1O3IA 1O3AA 1PPFE 2GKVE 2FPZA 4GSOA 3JZ1B 3Q76A 2ZFRH 1ELVA 3F9FA 3KNXA 4LK4A 1PPBH 2ZGHA 3AK5A 1C1NA 3MNCA 1O33A 3BTTE 3P8FA 4BNRA 4AG2A 1AB9B 1O5AB 1XUKA 5A0BA 1O3PB 1QB6A 1XVMA 1O3JA 5FPTA 1DSTA 1ZTKA 4NZLA 1C5PA 2GCTC 4XE4A 5DSFA 2FOGA 3TLOA 1O5EH 1GI6A 1WYKA 1BBRH
chains in the Genus database with same CATH topology
1BJUA 3K6YA 4JYTA 4AX9H 2O8TA 1C5NH 1ZSLA 1HAHH 1B5GH 2XCNA 3GDUA 4E7NA 2TBSA 4CBOA 1BTHH 4H6SB 4I8KA 3SV6A 2OINA 5F8TA 1G2MA 1KIGH 2STAE 5FPSA 5A09A 1G3CA 2GT8A 2CF9H 4I32A 3ZYDA 2K1QA 1A4WH 2VIWA 1RIWB 3MU8A 2Y7XA 1TB6H 1UTQA 1Z1IA 3CS7A 1O5FH 3VB7A 5DG6A 4ZKRU 3MO6A 1E35B 2GMTB 1GMDG 1P05A 2FI4E 4BTTB 4Q7XA 1ID5H 4UD9H 1KXFA 4GVUA 1UVUH 1G3BA 1T31A 4AB8A 2C8ZB 1CT0E 3A8BA 1ETTH 1C1SA 2BY8X 2G81E 3S7KB 2OTVA 3NK8A 4ABJA 1QIXB 2G4TA 1DWCH 1D3QB 1GMCF 4IW4E 1QNJA 1LPZB 4OS2A 1EXFA 1PYTD 3QDZB 1OWKA 1TBQH 1O30A 5A0AE 2GCTB 1P9SA 4NIVA 3NKKA 2PKAB 1GBTA 1C2DA 2M5TA 1MQ6A 1GBAA 3EGKH 3RU4T 5A2MH 3A7ZA 3E91A 1YPLH 1Z8IB 2HNTE 1ESTA 2GZ9A 5J4QA 2J92A 1W12U 2AIPA 2H5DA 4F4OC 1GJ9B 3A84A 3RP2A 2PW8H 3M7TA 2DUCA 3CS0A 2FI5E 2Z3DA 3KIDU 4HI3A 1O2SA 5IYTA 3L33A 1TX7A 1O5GH 2AERH 1GI5A 3NWUA 2QA9E 2GV6A 7ESTE 3ZZCA 2F9VA 1C4U2 5GJ4B 4MPXA 1G36A 1O3CA 1OXGA 5I46H 2Q6GA 1O36A 1DLKB 1YPHE 1ZGVA 1TMUH 1ZSJA 1LVBA 3SU5A 4MDSA 2HLCA 4WWYA 3MH4A 1C1QA 1D3TB 2ZTYA 3ZZ8A 4GLYA 3ZV8A 1H4WA 1TGTA 4U30A 4Y79A 4PROA 2WUBA 1DVAH 1OWEA 1TONA 3ZV9A 2HVXA 4A1TA 3UREA 1SVPA 3WY8A 1SG8B 2OXSA 1C1VH 3M7UA 2I6QA 4A92A 1LO6A 3TJUA 4WJG2 1ELAA 1TA6A 4AFUA 1W11U 1BMMH 4NZQA 3A88A 1HJAC 5T6FA 3O8RA 3B9FH 1TNLA 1VGCC 1IQNA 1P2QA 1GI3A 1XX9A 1MH0A 1O2MA 1TMTH 4ISHH 2NU1E 3SGAE 1O3EA 1O2ZA 2BY6X 2TRMA 1F5RA 5FPYA 1V2WT 4Z6AH 1BQYA 2F9UA 1RXPA 1GHAF 4MNYA 1SGCA 3NXPA 2FX4A 3PLPA 5L2YH 1KTSB 2ZU1A 1DUAA 3FAOA 8KME2 1JWTA 3DT0H 4NGAH 2ZDNA 2Y5HA 4IN1A 3PMAB 2BD5A 3QUMP 3SHAH 1O5BB 1GHVH 1TGBA 5DK1A 1Z6JH 3ZZ9A 4JZIA 1VCWA 2H9HA 3Q3KA 3U9AH 2P16A 2SNWA 2AH4X 3QGJA 1FXYA 1GCTC 3RXCA 3S9AA 1XUJA 1SLVB 2SGPE 5GIBA 1J8AA 4SGBE 1V2NT 1EASA 2Y80A 1O3FA 1O37A 2BOHB 3R3GB 1QA0A 3BIUH 1CQQA 2VGCC 1DM4B 2A7JA 4YESB 2WUCA 5DP4A 1YPMH 2FEQH 2WPLS 4FVBA 2ZQ2A 1HJAB 3LC5A 1G32B 1H9IE 1K1MA 1VGCB 2FI3E 1T8MA 4CRDA 5JDUB 1ZTLA 1LHCH 2YNBA 1YGCH 2BDHA 1S83A 1SQTA 4ZROA 3RXEA 4ISIH 5AFZH 4O03A 1QB1A 2A4GA 9LPRA 1T32A 1H9HE 2GDDA 4DG4A 2VU8E 1SGNE 1NT1A 2XBXA 4D7GA 1ABIH 3FFGA 4IN2A 1V2ST 4X6MA 2ZU3A 2EI6A 1HAVA 1FNIA 4DIHH 1YLCA 2SGEE 4BAMB 4CHAC 2XBWA 1W0YH 3P95A 1HGTH 2VINA 4Q80A 4IMZA 2ZDMA 3ATWA 1O2WA 1VZQH 1N6YA 3SBKA 4Y8XA 1O31A 4GUXA 1UCYH 5F6MA 1PFXC 1O35A 2QV1A 2FO9A 1GCTB 2UUYA 1Y59T 4U32A 2RDLA 3PMJA 3P70B 4ZKNU 3GYLB 1TPOA 1DX5M 2W7UA 6CHAC 2XXLA 1Z8GA 5AF9H 1LVMA 2HALA 3E8LA 5JYIA 3SW2B 2PWXA 2VGCB 4HFPB 1LHGH 1W3CA 4IMQA 3T26A 4ABBA 4OS5A 3LGYA 1C9PA 4I7YH 2PR3A 5GCHF 1NRRH 2VJ1A 2WYGA 4FUJA 3QWCH 4TWYA 3D65E 2EA3A 1K22H 4XOJA 1VITH 3ZZ4A 3MU0A 1C5ZB 2PSYA 1BT7A 2H9EH 5FXLA 3HATH 2O8UA 1OP0A 2BX3A 2R9PA 3RXBA 1C5LH 2ZTZA 1BHXF 3PTBA 2ZFTA 3BTME 1IQKA 2ZHFH 1ZJDA 5DPAA 5TJXA 2RA0A 5A8YA 1TNJA 1GBLA 2ZDKA 1SGIB 2NU0E 2FTLE 2BD2A 2SFAA 2VWOA 3A8CA 4DIIH 2VVVA 2PUQH 1BTPA 3SO3A 1TRMA 1TLDA 1LHEH 1XUFA 1PPGE 4INKA 1O2JA 1T8OA 4CHAB 3LOXA 3T28A 1UTJA 5C1XA 3ZVBA 1SGEE 3TJOA 1DS2E 1C5RA 1O3KA 3SJ9A 3PWCA 1WUNH 1O2RA 3Q77A 2QXGA 3B23B 4I8LA 1P2MA 1TX8A 4RSPA 3TU7H 1EQ9A 3HKIB 2GX4A 4IGDA 1KTTB 2BX4A 3ZVGA 2FDAA 4CRAA 6CHAB 1QQ4A 2J38A 1IQGA 4Y10E 1J17T 1GHXH 1OP8A 1HXFH 1FJSA 4MG3A 1TBZH 3GYMA 3RXJA 1OKXA 1J14A 1P09A 3LH3A 3V7TA 1AWHB 1ZYOA 1A3BH 2WINI 4YLQH 1TMBH 1GDNA 2QXJA 2B8OH 1L1JA 1ORFA 2ZO3H 5DJ7A 4FVDA 1TPSA 1CGJE 3M3TA 4XSKU 1TNKA 2A7HA 1KDQA 3HKJB 5DP5A 4MTBA 1GJ6A 5TCCA 1MTUA 2QN5T 3ZZBA 4I31A 3PLBA 3KGPA 1ZJKA 1LMWB 2PKSC 2GTBA 1BA8B 1ELTA 2ZGBH 1SLXB 1HIAA 1GBMA 1BIOA 2F83A 3SQHE 1GBIA 5GCHG 1ANCA 1ABJH 3VB3A 3LKWA 2A0QB 3BTQE 1C5SA 1RTFB 2H1UA 1YBWA 5HYOA 1YPHC 1C2LA 3K9XB 4DOQA 2FODA 2TGAA 4GHQA 3SU0A 1LKBA 1P06A 1THPB 4I8GA 3RDZA 1AUTC 2LPRA 2OBQA 1FUJA 1KXCA 3HGNA 4MLFB 1VCQA 1NTPA 3LGVA 1ZZZA 4ISOA 4Y6DA 1QL7A 1EZQA 2Z94A 4DGJA 5DKMA 3BF6H 2ZEBA 3GY6A 1UCYE 1AY6H 1NESE 2FLBH 5C3NA 4XBDA 3QK1A 3SN8A 3KEEA 3PWBA 1QBVH 1K1JA 1HBTH 2OC0A 4YOGA 2Z9JA 4X1NU 1ZHMA 1O3HA 1ARCA 1GHZA 1MUEB 2F9NA 2FM2A 4OGXA 2ANYA 2AMPA 3OY6U 1AHTH 1JRSA 1K2I1 3MNSA 5HGGA 4H42U 2PKSB 4MQAA 1HYLA 2NWNA 3GDVA 3TK6A 3I78A 1C2MA 4FU8A 1H9LB 3RM2H 3FP7E 3M5OA 4Y76A 1L1NA 4ISNA 2HPPH 1ZLRA 1IAUA 2R2MB 5AHGH 3SNEA 1O2LA 5DGJA 3ODDA 1AZ8A 1TPPA 1UTKA 2FXRA 4AGJA 1MU6B 1HAZB 1PQ8A 4J1YA 1UK2A 2XNIA 2BVRH 1MKWH 1Y8TA 4JCNA 4BOHA 4CH2B 3HK6B 3NZIA 1L4ZA 3BEIB 1OP2A 2TGPZ 2QXHA 1LTOA 3PO1C 5L2ZH 3TGKE 4AFZA 1ZMJA 3KCGH 1B7XB 4ZUHA 4X8UH 2PTNA 2PTCE 1QJ7B 4WH6A 4E7RG 1SI5H 2ZF0H 1C4Y2 3A7VA 5L6NH 3SU2A 3AASA 5T6DA 1O3DA 1Z8JB 2CHAC 5LPRA 5EXNA 1GL0E 1MMJN 2J9NA 4YT7H 2VIPA 3N7OA 2GDEH 4JYUH 2PSXA 3QX5H 1HAYB 4DURA 3VEQB 4FXGH 5DP8A 1GBBA 2P94A 3E0PB 3U8TH 3FP6E 2A5KA 4IBLH 3KN2A 2F91A 2NU2E 2ZCLP 1RFNA 2SGAA 5A8XA 1SQOA 1W8BH 1S81A 1SGRE 3IITA 1C5UA 1NO9H 1N1LA 1TNHA 1QFKH 2XTTB 1HJ9A 3RC6A 1TNGA 1AGJA 1IQEA 1O34A 5DP9A 4Y11E 5C2ZA 1F0UA 2XC5A 4O9VA 2ODPA 4THNH 3URCA 5I25A 1SGYE 3U1IB 5K0HA 3U1JB 3QZRA 3QTVH 1UTLM 3CP7A 3E16B 2D8WA 1RJXB 1PYTC 2XCFA 3GY5A 1GBKA 5C1UA 2J95A 1GWAA 4B76A 3PO1B 1C2GA 1GPZA 1JXPA 2FP7B 2OC1A 1ZPBA 1TWXB 1CT2E 3RUOA 3P17H 1NRQH 4DJZB 1V6DA 1QJ6B 3C27B 2ZG0H 2FZZA 4Y0YE 3BEUA 2AGEX 1OWIA 5EW2H 2CHAB 1O3NA 1MCTA 4X2WA 4BAHB 2BTCE 1CO7E 3FZDA 1ZMLA 3RXGA 3EE0B 1WAYB 2XC4A 2FYRA 1SHHB 2Q6FA 4FUDA 3TJNA 2BZ6H 2RCEA 2PUXB 4INLA 1IOEA 3MH5A 1INCA 1BUIA 3GY3A 1ACBE 2BXTH 3SUEA 1TRNA 5DO4H 1Y5UT 3B8JA 1C4V2 3QZQA 4K5ZA 1O2PA 3GY8A 3AAUA 3SU6A 2C3SA 2G55A 4WF8A 2D2DA 2PLXA 4FUIA 3TJVA 5C5OA 1OWHA 3UOUA 4CRBA 4IC6A 1EJMA 1O2QA 2UUJB 1QA7A 2OD3B 2VVCA 3VB5A 5EPYA 1EAIA 1YKTA 1O32A 1RTKA 2BQ7B 2ZIQH 2AFQB 3S0NA 4RN6A 3FVFB 2DE9A 2BB4A 3A83A 3R0FA 1TE0A 1D6RA 4ZHAA 4K8BA 4X8VH 3MH6A 4B1TA 3SNAA 1Y3XA 4ABEA 1YC0A 3RMOH 2AMQA 1UK4A 2Y82A 3LT3A 3GCNA 3BTGE 1SB1H 1F0SA 1SLUB 3BG4C 1GDQA 2O8WA 1S82A 2FYQA 4ASHA 4D9RA 1PPEE 1T8LA 3SJOA 1HCGA 1YM0A 4BTIB 1UTPA 4JZFH 3RMMH 1QL8A 2A7CA 4O3TA 4X2XA 1TX6A 1VJAU 1TOCB 4ZHLU 4AFSA 1FAXA 1GMHF 4UFEH 3UFAA 1NROH 2VVUA 2EEKA 1HXEH 4XFQA 3QN7A 3RMLH 2I6SA 3D49H 3RXSA 2WV5A 2G00A 7LPRA 1O2IA 3GCHC 1H8IH 5LGOA 4Y8YA 1EX3A 2QF3A 1CGIE 2ZFPH 4MNVA 1F92A 2VB0A 3RC4A 4BXSA 1FPHH 2HRVA 1SL3A 5F8ZA 1V2KT 3D23A 1T4UH 1GBCA 1FY1A 1L4DA 2YNAA 1F0TA 3F9GA 2WPHS 1CA0C 3RU4E 3DFLA 4ABFA 4AN7A 1AIXH 3H5CB 1BMAA 1MBQA 1XKAC 1O3OA 2ZHDA 1QHRB 4HZHA 1DXPA 5JPMH 2Z9KA 3RXTA 4RKOB 1O38A 3ZZ5A 1CHOF 2XRCA 2XBVA 1E34B 1KXBA 3BG4B 3S7HB 2ZU4A 5GWZA 1DY8A 2AMDA 4B2AA 4NSYA 1UTOA 3MMGA 4NA9H 4YOJA 1GI9B 3QTOH 1W13U 1WQSA 5HM9A 2CMYA 3LH1A 2SGQE 5HMAA 3SJIA 3SORA 1FZZA 1WV7H 3V0XA 4FU7A 4XBBA 2CN0H 3RXIA 2AYWA 1AKSA 1BBRE 3ZVCA 2V3HH 1ANDA 3DFJA 2BOKA 1FMGA 4UFFH 2Q1JA 1YPJH 1W10U 4U2WA 3GCHB 4E06H 1ZGIA 1E38B 5EU8A 1GI2A 2SGDE 1C5MD 3Q3YA 1HDTH 2B0FA 5C67A 1Z6EA 1QBNA 2WPIS 3BTDE 1VJ9U 1SLWB 1SHYA 2Y7ZA 3K2UA 3LJJA 5EW1H 2CV3A 3A81A 5H4IB 1PJPA 2P3TB 1MBMA 3UPEA 3OYPA 1CA0B 1ZSKA 3RXOA 1GMHG 1EPTA 4UE7H 2A5AA 1UHBA 4IC5A 4NCYA 4WMDA 2TGTA 1TGNA 1FIWA 1A5HA 3SNCA 1MQ5A 2F9OA 1BMLA 4FU9A 5GDSH 4ZXYH 1K1OA 2UUFB 2ZCKP 3ATIA 4D8NA 1GI4A 3EQ0H 2Z9LA 2XBYA 1HV7A 4AFQA 1K1NA 2CJIA 2BXUH 1BITA 3RXVA 1ESBA 4B2CA 5A0CA 5JBAS 2ZPRA 1BZXE 1YP9A 2ZU2A 4K8YA 3ATMA 2OQ5A 3CENA 3PYHA 1P3EA 3ZZ7A 2A4QA 3IG6B 3MTYA 2BY5X 1GBHA 1P2OA 4JYVH 4BXWA 1P9UA 3V3MA 2HGTH 1CHOG 1WSSH 3STIA 1UCYK 1DWDH 3STJA 2ANKH 1EAWA 1NY22 1V3XA 2ZI2H 2OQUA 1ETRH 3RXKA 1LCYA 1FLEE 1VR1H 1MZAA 4TPYA 1MTNC 3MO3A 1GG6C 1KSNA 1GHYH 3PB1E 1MTWA 4K3JA 2ZQ1A 5EOKA 1MKXK 3PMHB 1HB0B 1O2OA 2FX6A 1MAXA 5JBBS 1O2XA 1HJ8A 1TYNA 1XKBC 2P3FH 2NU4E 4BAKB 1UTMA 2ZPSA 3LU9B 2O8LA 3PLKA 1AUJA 3HPTB 1QRWA 3P8NA 1A0HB 1GHWH 4R8TB 1BRCE 5FCRA 3UTUH 1AI8H 2QXIA 2W26A 1O2VA 1A3EH 2VWMA 1H1BA 1MCVA 1UJ1A 5FX5A 1CA8B 3NCLA 1UMAH 3OY5U 3M61U 1UVTH 1GJ5H 3A7TA 1BHXB 1HRTH 3RLWH 2FS8A 2OBOA 3MWIU 1BRAA 3LONA 3MNBA 3A82A 5F8XA 3HK3B 1OYTH 1LQEA 2SGFE 4JK6A 3SV8A 1C1OA 3C1KA 4D9QA 1A61H 2R2WU 4K1SA 2GT7A 1HAVB 1HAGE 4NFFA 3BN9A 1QBOA 3HGPA 2QF0A 3M35A 1WTHD 1S85A 1NRPH 2ASUB 2ZDLA 1