2DE9A

Crystal structure of porcine pancreatic elastase complexed with tris after soaking a tris-free solution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tris(hydroxymethyl)aminomethane induces conformational change and crystal-packing contraction of porcine pancreatic elastase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Elastase-1
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2de9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2de9A01
1C5TA 1O3DA 4MVNA 3PTBA 2ANYA 1SMFE 5J4SA 4A6LA 3ITIA 1ELGA 1SGDE 2H6MA 2BD8A 3SQHE 4SGBE 1HJAC 1LQDB 1JRTA 1O2QA 2O8UA 2QGRA 4B73A 5DGJA 2WV4A 2BTCE 2BDCA 1C5UA 2ZO3H 4FUBA 3ELAH 1Z8RA 3BTGE 3OU0A 4WXIA 1GCTB 3ZZ9A 9LPRA 1FONA 1AFQB 4XSKU 3EDXB 1TNJA 1VITH 2OC1A 1NFYA 4ABFA 2OBQA 3TGIE 1WQVH 1WU1A 1HAGE 4GHTA 2FS9A 9ESTA 3SU3A 3U1JB 1YPKH 2A31A 5JBCS 1Y5AT 2FTLE 2XNIA 3E8LA 1MU6B 3PLPA 3RXMA 3GY3A 1VCPA 2QC2A 4A7IB 3GYMA 4JZ1A 3S7HB 2KAIB 4IBLH 1GBIA 4WMDA 1ESBA 5FBIA 1O35A 2ODQA 1HAVA 2F3CE 1Q3XA 2FLBH 4OS6A 3LGTA 2C8YB 2FYRA 1N8OB 2V0BA 1KXAA 1PPEE 4GAWA 2F91A 1FMGA 5E8EH 4MNVA 1F5RA 2SFAA 2A4RA 2XWBI 3GOVB 2GV7A 4JK6A 1DE7H 4ABBA 1F2SE 5T6DA 2BB4A 4BTTB 5LH8A 2TGPZ 1KYNA 3PLKA 4O9VA 1TNKA 1O38A 1C2LA 1JXPA 1O3CA 3R3GB 1V2JT 1F0TA 1ELAA 2G5VA 3GY7A 1PQ8A 4A5TS 5GCHF 5GDSH 3NUMA 1KXBA 1GHAG 1O3IA 3QTOH 1ELFA 1BBRE 1QNJA 1DLEA 3M3TA 1C1NA 1W11U 1EP5A 2A7CA 2FI5E 2BD5A 4XBDA 1P8VC 3AAUA 4UEHH 3AW1A 2B5TB 8GCHG 2JETC 1ESAA 1VZQH 2V3HH 1GMCF 3SGQE 2F9VA 3GISB 2PV9B 3DD2H 2GDEH 1SBWA 1GG6B 1DM4B 2ZTZA 2BY5X 2FZZA 1T8MA 1S5SA 4MNXA 4ISNA 2VH0A 4BAOB 3UQOA 1NM6A 1D3PB 1LO6A 1TQ7B 1ZMJA 2P95A 3PYHA 1GDQA 3A8DA 3HKJB 3SUFA 1C9PA 1EUFA 1V2KT 2XRCA 1A61H 2WYJA 2OC7A 1TX8A 4WMFA 1L4ZA 1OWDA 4UE7H 1O2IA 1ZJKA 2FX4A 1YPGH 3ZZ3A 3SJ9A 1ANEA 2XBWA 2GCTB 3A81A 1BRUP 3UNRA 2WPIS 4AYYB 3RXPA 1GL0E 4U32A 2ZGJA 1O3MA 1AY6H 2VIQA 3LIWA 1Z1JA 3SV7A 1MQ6A 2STBE 3EGKH 4I32A 1VCWA 1ZLRA 4JCNA 1KLJH 2C90B 3RXJA 2PR3A 3P6ZB 1HLTH 1FY4A 4NZQA 5EGMA 1BOQA 3GY4A 4BAMB 3TJUA 3ZVEA 1P06A 4Y7AA 1O3KA 2G51A 4UFFH 1BTPA 1XUKA 3TGKE 3QO6A 3SU4A 1HAHH 3D65E 1TQ0B 2GCHG 5CHAC 2XC4A 1TONA 4XBCA 2ZDLA 1P9SA 3ZVAA 2H9EH 4O03A 1P02A 2EI8A 4FUHA 2J38A 1F0UA 4ABIA 3TH2H 1TRYA 1J8AA 3PTNA 2ZZUH 5AFZH 2XBYA 1O2PA 1ZSKA 5C5OA 1PYTD 2BY7X 2HWLB 2ZDKA 1O2WA 1GI4A 1NO9H 1RTFB 4Q7ZA 1DVAH 1G2MA 1GI3A 3VXEH 1OX1A 1QB9A 2Z3EA 1GBFA 2D2DA 1GHZA 2P59A 1MMJN 4Q7YA 2H5DA 3KQBA 1FY1A 3D62A 1LQEA 1YCPH 2A4GA 3KQCA 1YKTA 1IOEA 2AGGX 3RXLA 2ZFPH 3AW0A 3B9FH 1L1JA 3LT3A 3TLOA 3MU5A 3OY6U 1HIAB 1BTYA 3SN8A 4D7FA 4X2WA 2Z94A 2FPZA 3MWIU 4X6MA 1O3AA 4I7YH 1O2HA 2AIQA 1AVXA 1GHBG 5EW1H 1EAWA 1ELCA 3GDSA 3LGUA 5HMAA 1CA0B 1XKBC 2RDLA 1FUJA 5C2ZA 1O2YA 1CHOF 1WAYB 1FIZA 4KKDA 4AFUA 4XE4A 4YT7H 1AWHB 2ZPSA 2AS9A 1WCZA 2ZU3A 1GJDB 3BEFB 2D26C 1GI2A 1A2CH 3GDVA 1K1PA 1YPMH 4ZAEA 1GJ4H 3N7OA 1FY8E 2XBVA 1Z8GA 1LKAA 3LOXA 2V3OH 4ASHA 4ZKRU 5FPSA 1W13U 4FVDA 3RC4A 3MOCA 1WV7H 2OC0A 1LVBA 1XXFA 4OS1A 1FZZA 2P93A 4D9RA 1SG8B 2CGAA 2ZG0H 4OGYA 5FCRA 2CMYA 2ILNA 3MH6A 1BTWA 3BTWE 3NZIA 4AB9A 1EB1H 4GCHF 1HJAB 1QQ4A 2ZQ2A 1WSSH 3QTVH 3AAVA 3A7XA 2F9PA 1F92A 1AFEH 1UHBB 2A45B 2GX4A 3SU5A 1GBDA 2VWNA 1E38B 1GHXH 1P2MA 1TX6A 3MH5A 2HGTH 1C5LH 3SORA 4YESB 5GIBA 4DT7B 3A7YA 1SGNE 1XUJA 7ESTE 1JBUH 4CRDA 1BRCE 2ANKH 1OP8A 3UQVA 1HGTH 2F9OA 3E1XB 1AIXH 1SL3A 5L2ZH 1CT0E 1EOLA 1O2UA 1SHYA 3SHAH 3L33A 2G55A 3RMNH 3MU4A 2C8WB 4KTSA 2J94A 1AKSB 5TCCA 3RXEA 4CRCA 4FU9A 2GT8A 1BT7A 2BQ6B 1P04A 3F68H 2QYIA 1GBHA 5A8ZA 3NK8A 1MTWA 1O2XA 1RGQA 3F9GA 4K8YA 1GGDC 1VITG 2GD4B 3SJIA 1LHDH 5K0HA 2QA9E 2NU4E 3QGJA 5FPTA 1P01A 4GPGA 3U9AH 3ZVBA 4CH2B 3RU4E 4Y8XA 1SC8U 1ZTJA 1C1WH 3MMGA 2PFEA 1DXPA 3NKKA 1Y59T 1EAUA 3LGYA 3A85A 1YC0A 2ZHFH 1YYY1 2VVCA 4AGKA 4ESTE 2UWLA 1Y3XA 2VIPA 2I6SA 1PQ5A 3CENA 1GJBB 2H9TH 3SNDA 1C2KA 2P16A 4QT8C 1HBTH 3MU1A 4H4FA 2W3KA 1H4WA 1IQGA 1ABIH 1V2ST 1P2KA 1C5RA 4NSYA 4K8BA 4UFDH 1GI8B 3VXFH 1A3BH 5DP6A 3ZZBA 1C1MA 2YNBA 1Q2WA 1K1OA 1ACBE 1CU1A 1D3DB 1MKWH 1KXFA 1T8LA 3VGCB 2BOHB 2BLQA 1EKBB 1O3BA 2XCFA 2DE8A 1IQLA 1CA0C 1TA2A 4GCHG 1O5EH 4GSOA 3Q00A 1Z8IB 2FXRA 1QJ7B 3T26A 1EPTC 2JH0D 4MPVA 1AWFH 4M7GA 2FOAA 1S82A 5E0GA 4FUEA 1ZHRA 1VITF 2ZDVH 2CN0H 4MG3A 1TPOA 2Z3CA 1ZTLA 2GDDA 4Q7XA 1TB6H 2OC8A 2F83A 2ZEBA 3LH3A 3UR9A 1BIOA 3OX7U 2GV6A 4K1TA 1QRXA 3ZZ4A 3QWCH 1ELDE 1HV7A 2HNTC 1QB6A 3RXQA 1C5OH 2GZ7A 3E0PB 1TPSA 2VIOA 2PKSC 1C5VA 4A1TA 1UK4A 3BTKE 5EPNA 1B0FA 2TBSA 1E0FD 5JBAS 2BXUH 1KTSB 2HPPH 2J92A 2O9QA 3H5CB 3RXDA 2SNVA 4ZUHA 3ODDA 4INHA 1NT1A 3OSYA 3MHWU 4X6PA 3P8GA 3FAOA 1O2GH 1MBMA 3RLYH 1AU8A 1CT4E 2YNAA 3IITA 5EU8A 2ZPRA 5EG4A 4ZXYH 3M3SA 2RA3A 3ATKA 5TJXA 4FUGA 3RXKA 1TOMH 3U8RH 1MZAA 2W7SA 1ZPBA 2OQ5A 2ZU1A 5C5NA 1O30A 3VFEA 1Z1IA 1V2NT 3VPKA 4YT6H 1TBRH 3SUDA 1A1RA 4NIYA 5IYTA 4CRBA 1L0ZA 2AGEX 3TNTA 1DXWA 1BB0B 1EOJA 2ODPA 1S0RA 8LPRA 1D9IA 2BHGA 2OTVA 1GI5A 1GI1A 1EAIA 1G3DA 5JBTA 4K5ZA 3SBKA 1C4Y2 1V2QT 3BG8A 1NTPA 3T27A 1HB0B 4WH6A 1CE5A 2PTCE 1XMNB 2ZPQA 2SGAA 4B71A 5F6MA 5DP9A 1O3GA 5T6GA 1AVGH 1ZTKA 3T2NA 1D4PB 3BSQA 2Y81A 3NXPA 3PO1C 1EQ9A 3RDZA 3EQ0H 2AMDA 3VB6A 2ZCLP 2UUKB 1NRPH 3QZQA 5FPYA 3A7VA 2HRVA 4JK5A 4K60A 1U6QA 5DP8A 5AHGH 1RIWB 1K1NA 5JDUB 1QL8A 1DX5M 2AFQB 2IPHA 1Y5BT 4CRGA 1LHCH 3RXOA 1PPGE 1YPLH 1GMHF 4DW2U 3KQEA 1GJ5H 1LVMA 2PSXA 2GCHF 2GT7A 2FX6A 1ELBA 2FS8A 1P2JA 4ISHH 5PTPA 4AGJA 4WJG2 2G52A 2UUJB 1PPZA 4YZUA 3ZVCA 1DWBH 3M36A 3RXUA 1H8IH 3MNBA 3HGNA 4DY7B 1BDAA 2BZAA 3FP7E 5AVDA 5FAHA 1PFXC 3MNXA 1EXFA 3WY8A 1OPHB 1IQJA 2FOHA 3Q3XA 1NRSH 3K2UA 1GBAA 2J2UA 4X0WU 5SGAE 1EPTA 3Q3YA 1HAYB 4ZKSU 2BVSH 3HK3B 2VU8E 1C1SA 1GI6A 3FANA 3DFLA 3BTME 3VGCC 1X7AC 1WOFA 2PKAB 1HAOH 3LJJA 4DIIH 1B7XB 3G01A 1EASA 1GBMA 1OOKB 1TGBA 4ABHA 1OXGA 1GHAF 4ZMAH 1V2OT 5HGGA 2Y5FA 3A86A 4LK4A 3ZZCA 4B76A 3SV9A 1O2VA 1NZQH 6CHAC 4NIWA 1GVLA 1IQIA 1W8BH 4J2YB 1FIWA 3LGVA 1DPOA 2JH5D 2BM2A 2FIRH 4BAKB 1J14A 1GBEA 2ZFSA 1C1OA 1WTHD 2Y6TA 3B8JA 1P10A 3RXSA 3D23A 1C1VH 1SLUB 2F9UA 1TNHA 1P03A 4CH8B 2NU3E 2V6NA 1NU7B 2PGQB 1AHTH 1QHRB 5JB9S 1P9UA 2ZCHP 2ZDMA 1LHEH 4VGCC 1AO5A 1GG6C 3PLBA 4D8NA 2FOCA 3EE0B 2QXGA 1C1UH 3ZZ7A 1AB9B 3S9CA 2Z9IA 1C5MD 2GMTB 3UTUH 2ZHWH 1GGDB 1ID5H 4O3TA 1ZZZA 5ESBA 3SNBA 2G5NA 5CE1A 3MO9A 3B23B 4D7GA 4X2YA 2XC0A 1IQFA 1TPPA 5C20A 1P3EA 1YP9A 1HYLA 4Q80A 2NU1E 2IJOB 3HATH 3UOUA 3I29A 2A5KA 1SFQB 4Y71A 2G4UA 1HAIH 2XWAA 1O3HA 1MBQA 2ZGBH 3A8BA 3TJOA 4HTCH 1UTLM 2PTNA 3MYWA 2FOEA 5L6NH 1GBCA 5I25A 3EA7A 1BMNH 4GHQA 2CHAC 1FPCH 3MU0A 3TVJB 4DOQA 3V7TA 1W3CA 1QJ6B 1ETTH 3UPEA 1AUJA 1BUIA 2BDIA 1HCGA 1L1NA 1ZGIA 1YCPK 1H9HE 3PMAB 3KIDU 1HRTH 5T6FA 2CF9H 1QTFA 1SOZA 3ESTA 3TIUA 1NESE 4X1PU 1IAUA 4ZHLU 4E7RG 2PUXB 1DUEA 2EEKA 1FI8A 5F8ZA 2FWWA 1KIGH 3EA8A 1AE8H 3O8CA 4ISOA 4XFQA 4AFQA 1THPB 1T31A 1AZZA 1BHXB 3SHCH 3ZZ5A 1UVPA 4YLQH 4WMEA 2D1JA 4AX9H 1YLDA 4H6SB 3SW2B 6ESTA 4ZKNU 5FX6A 3C27B 1ZYOA 4IMQA 1ANDA 3KEEA 2BY9X 1A0HB 2ZGXH 3KNXA 1TFXA 5T3HA 1BTUA 2ZFFH 5EQRA 3RP2A 2B8OH 3V3MA 5C3NA 1C9TA 4ISLA 4NA8A 1NY22 4DIHH 1O3LA 1HAZB 1NRRH 3GY6A 1HDTH 4NWKA 1BQYA 3GY8A 1NROH 4GLYA 1LVYA 3BEIB 3LGWA 2IN2A 3QLPH 2P3TB 2CHAB 1MKXK 1C2HA 4XDEA 3U8TH 2A5AA 3QDZB 3P92A 1UTJA 4UFGH 1BBRK 1BJVA 2UUFB 3A88A 2BXTH 4MPWA 4IGDA 1ZSJA 1P3CA 1XM1A 2PKAA 1AKSA 1T8NA 1QQUA 1ZPCA 5JB8S 4I8KA 1O3OA 3QK1A 1C5QA 3K65B 1NFXA 3E91A 1SPJA 1D3TB 3BTEE 4MPXA 1OWJA 2W5EA 4B2AA 4B75A 3Q76A 1HIAA 1LKBA 4U30A 1AB9C 1NU9A 3LJOA 1A4WH 1G3EA 1YPHE 2ZTYA 3RC5A 3U98H 4IN2A 1SQTA 3QZRA 3MI4A 2OP9A 1YCPM 2Z9JA 2BOKA 1GI9B 2SGEE 1IQHA 4RN6A 4NA7A 1HJ8A 3PWBA 3SI3H 4CBOA 1DSUA 2WPKS 3TH3H 3HGPA 1T32A 1OP0A 1K22H 1UCYE 5GPIB 1QIXB 1CQQA 1HAVB 3PO1B 1O3EA 1MAYA 1YM0A 1FAXA 3TNSA 1SHHB 1T8OA 2PGBB 2FTMA 5DJ7A 4HI3A 4OGXA 3UY9A 3ATIA 3T29A 1UTQA 3STJA 3BV9B 3PB1E 1H1BA 1QFKH 1GCTC 4FUIA 2ZFRH 4AORA 4AB8A 3UR6A 2P94A 3TPIZ 4INKA 1O2OA 3LH1A 2AEIH 4Y8ZA 2HLCA 1S6HA 2H5CA 1UHBA 5ABWA 4Y8YA 3DUXH 3PROA 2H9HA 1FXYA 1G36A 1V2UT 3O8RA 3ZV9A 5EPYA 1Q31A 2VWMA 1PQAA 3RMOH 4TYDA 5LPEA 2R2WU 3M5NA 3SNAA 2KAIA 1LHGH 1MKWK 2QN5T 5FX5A 2CV3A 2PWXA 3BG4C 1DY8A 1AUTC 2RCEA 3M7QA 4WH8A 2HNTE 2BY6X 2BDBA 4XOJA 1WBGB 2SGFE 1D6RA 3KHVA 2FEQH 1ARCA 1MUEB 2QAAA 1M9UA 3BF6H 4KP0A 4ZHMU 2EI6A 1BMLA 3MO6A 1A0LA 1GPZA 2XBXA 1S83A 1O5FH 1FNIA 4NSVA 1BTHH 1V2LT 1AD8H 1SB1H 1V3XA 2PW8H 5FCKA 4BXWA 1QJ1B 4CRFA 5A09A 1GHVH 1GVZA 1HJ9A 3MNSA 3FFGA 4LZ4B 1AVWA 4ABEA 3GCNA 2TPIZ 3BG4B 1KDQA 1SGFG 3QX5H 1QGFA 1KTTB 4JZIA 8GCHF 1ORFA 4B1TA 1O2RA 5DP3A 1Y3WA 3E16B 1BMAA 1GJ8B 2BD9A 1C1QA 3AASA 3SUEA 5EODA 2R9PA 1DY9A 2PSYA 3RM2H 3GCHC 2B9LA 4K1SA 2Q6DA 1QBOA 1ZR0A 4E7NA 1T4UH 2D8WA 4FU7A 1F7ZA 4WXVA 3RU4T 1JRSA 1SGRE 3I77A 2AIPA 2G8TA 1EZQA 1JWTA 2Z3DA 3EYDA 3LPRA 2J34A 1S84A 1WQSA 3A8CA 1EJAA 3LKWA 1JIRA 4OS2A 4CRAA 1O3JA 1O2TA 2FMJA 1MD8A 3GCHB 1J9CH 1OP2A 1UVUH 1AE5A 1S6FA 1OYQA 2HNTF 2J4IA 1ZMNA 1AZ8A 2CXVA 4B2BA 1TGNA 1BZXE 1A0JA 4R8TB 3PMBB 5C67A 1GMDG 3U8OH 4UFEH 3GCTF 2BMGB 3ZZ6A 1CO7E 3SU1A 2ZWLH 1ARBA 3OTJE 1O0DH 1PPBH 2ULLA 2BD2A 1Z71A 2VWLA 1NRQH 3ZVGA 1GBKA 1XUIA 4Y7BA 3VB4A 3A80A 2TGDA 1INCA 1UJ1A 1DLKB 3QN7A 1G37A 4FXGH 3TK6A 2OQUA 4XBBA 3ZYEA 2A2XH 1ZHMA 3S9BA 4Y0YE 7GCHG 1RD3B 3SGAE 3GICB 5K7RA 1SLXB 1THSH 3A82A 3KQDA 3OY5U 5H4IB 2XTTB 1A5GH 2ZI2H 3K6ZA 1TGTA 5A2MH 4H42U 1XVOA 4AG2A 2A2QH 5L30H 1MCTA 3LC5A 1ABJH 1W0ZU 4LOYH 3TK5A 3I78A 3H7OA 1CGHA 3A83A 2GTBA 3RLWH 2HVXA 1YBWA 1AMHA 2LPRA 4KGAA 3EAJA 4F49A 4ZHAA 2VJ1A 1L4DA 3C1KA 1TE0A 4MQAA 1AN1E 2W26A 1PJPA 2OINA 3TJVA 2ZIQH 2BLOA 5DK1A 1CHGA 1KXCA 2ZDAH 4X8UH 2Y80A 3URCA 4B74A 1OWIA 3AVZA 4AFSA 1EPTB 2WUCA 2DUCA 2SGPE 1CBWB 5C1XA 2ZC9H 4K69A 1LCYA 3BTFE 1EP6A 1MU8B 2LNCA 4E06H 1TRMA 4CR5A 1N6YA 3GCOA 4O3UA 4NWLA 3SNCA 3SOSA 3V13A 3RXAA 3SU2A 2A32A 3IG6B 1HXEH 3RXBA 1HAXB 4R0IA 2Z9GA 4UONA 5L2YH 4E05H 1V2VT 3K6YA 1O5AB 3SJKA 5A8YA 4MNWA 1CSOE 1DICA 2AERH 2Y82A 3MFJA 2WUBA 1P09A 4I33A 2C93B 2PKSB 2EC9H 3S69A 1H9LB 5EQSA 1OWEA 2FESH 2FODA 3ZVDA 2XXLA 1BA8B 1C2EA 4MLFB 4IN1A 4SGAE 4X8SH 3RC6A 3F1SB 2RA0A 2ZCKP 1HAPH 1Z7KA 3PWCA 4I31A 3O8BA 1BHXF 4YOIA 1TALA 1T7CA 3RM0H 1QRZA 1W0YH 4ZXXH 1O2LA 2QV1A 3R0FA 4HFPB 1KSNA 2UWPA 3M5LA 2ZQ1A 3BTTE 4NZLA 7LPRA 4ZROA 2BVXH 5DP7A 1YF4A 2Q1JA 1DT2A 1IQMA 1L2EA 1OS8A 2OUAA 2HPQH 1AFQC 4OS4A 1ZSLA 1UTOA 1GJ7B 3CS0A 4UD9H 1QRWA 2K1QA 4TPYA 3SQEE 5B6OA 3DT0H 4ABDA 3O8DA 3ATWA 1O5CB 1FLEE 6CHAB 1E37B 1O2ZA 3RXHA 6GCHF 1DSTA 3V12A 4X2XA 2R3YA 1K1JA 1BRBE 3SZNA 2WYGA 2UWOA 3SU6A 1O5GH 3LGIA 1G3BA 1MH0A 3LC3A 1KY9A 1K21H 1MCVA 3MH7A 1O2SA 1SGYE 2BYAX 2CF8H 4X1SU 4YM9A 2R3UA 3DFJA 3L6PA 1MQ5A 3NWUA 3RXFA 4AG1A 1GMCG 2I6QA 3BIUH 1YPEH 3VEQB 1C2IA 4LZ1H 2ESTE 1F0RA 3UREA 2ZP0H 4BTUB 1P2OA 1G9IE 1CGJE 2A0QB 1ZGVA 2O8MA 3KN2A 2Y5GA 1UO6A 4DGJA 3GY2A 4Y0ZE 3KGPA 4GVUA 4PROA 2VGCB 2AYWA 3HKIB 8ESTE 4H6TA 2OCVB 3F9HA 2FI3E 4K2YA 1GBTA 2JETB 5FXLA 3SV6A 2RG3A 2SGDE 1IQKA 1TYNA 5ESTE 2BLVA 1QB1A 2BZ6H 2ZHQH 1TBZH 3TH4H 4DURA 4BAHB 4NFFA 2W7UA 3BTDE 1RRKA 1XUHA 1V2PT 2OLGA 1T4VH 4AFZA 3ZZAA 4ZKOU 3T28A 3U1IB 1FV9A 2GGVB 1GDUA 4FUDA 1C5NH 5A8XA 1EJMA 1TPAE 2BDAA 2A4QA 1P05A 3A7ZA 1HXFH 1A5HA 4LXBH 3KF2A 3F6UH 5EOKA 3M35A 2THFB 1EATA 4RKJB 5G4BA 2QY0B 2EI7A 4JZEH 1GHWH 4YTAA 5HXFA 3S7KB 1G3CA 2XCNA 4IC6A 1FY5A 2ODYB 1SOTA 2ZA5A 3W94A 3CS7A 4NIXA 5ETXA 1OYTH 1FAKH 1DOJA 2ZHDA 4HGCA 5LGOA 2P3FH 1P57B 1W7XH 2VVUA 1C2JA 3E6PH 1K28D 1C5XB 3TGJE 1RJXB 1HUTH 3SI4H 5LPFA 1UK3A 3PMHB 5IDKA 3E0NB 3P95A 2ZFQH 1K9OE 3RMMH 1G32B 3VB7A 5GXPA 3Q3KA 1V2WT 4Y10E 4NCYA 3HK6B 3M7UA 1KXEA 5JYIA 3M5MA 1GWAA 4HZHA 2GZ9A 1RTLA 1ELVA 1BJUA 2TIOA 3P8OA 1RTKA 4YO9A 4YLUA 1YPJH 4MPUA 3P8FA 3UNQA 4A1VA 3RXVA 3W95A 1MAXA 1GHBF 1FPHH 2WPLS 5BRRE 5I46H 1C5ZB 1MTNC 4THNH 4B2CA 7KMEH 1SI5H 3Q77A 1CT2E 4U01A 4X6OA 3A87A 3ODFA 1S81A 1V2TT 1D6WA 4I8GA 1D3QB 5E0JA 3P8NA 4TPIZ 3SNEA 1TMBH 1OSSA 4INLA 1DITH 2C4FH 2G81E 5HM2A 1SGPE 4CREA 2ZF0H 1RXPA 1TGSZ 1W7GH 2BD3A 2P8OB 3VB5A 4D76A 4K3JA 5AFYH 2UUYA 1EAXA 2VNTA 1NPMA 1SGIB 2ZGCA 3L3TA 1OKXA 1C5SA 1YGCH 1ZPZA 2NWNA 2WV5A 2Z6BD 3FP6E 5A0AE 4TY7A 1G30B 1GVKB 1KLIH 1PYTC 2BD7A 2H1UA 1P12E 1Z6EA 5JPMH 1QA7A 1YPHC 1OWHA 1FY3A 2QF3A 3MU8A 3D49H 1O3FA 1GHYH 2A5IA 4O97A 1NFUA 2Y7XA 1O2MA 1P2IA 3UWIA 1K1IA 1SQOA 1QA0A 1PPFE 5LPRA 2AGIX 4AN7A 1LPKB 7GCHF 3S9AA 2AMQA 2QXIA 3U69H 1O5BB 2ZNKH 5TCAA 1SFIA 1GDNA 1LTOA 1ANCA 1N6XA 1TX7A 1Z8JB 1UTNA 4IS5A 2Q6GA 3QUMP 1QBNA 2BDHA 1SGEE 1CVWH 1TAWA 1HPGA 1IHSH 4Y11E 1ZRBA 2J95A 5FHTA 4JZFH 1EZXC 1FN8A 2ZU4A 1TGCA 3FP8E 2NU2E 1UCYH 3UNSA 5E2OA 4AZ2B 1W14U 4FUJA 1PQ7A 1O31A 3M5OA 4BANB 2FM2A 6GCHG 1NRNH 3NCLA 3UWJH 2PHBA 4BOHA 5GJ4B 1J17T 5F8TA 1QL7A 3UFAA 1BTZA 1UCYK 2FP7B 3M61U 3T5FH 2M5TA 1N8OC 4Y79A 3PM3A 1AGJA 3M7TA 1Y3UA 3QGNB 1LHFH 4CBNA 1C1RA 2FOGA 3LU9B 4NGAH 1GJCB 2Z9LA 5EXMA 1IHTH 3MTYA 4JYUH 4YOGA 2V35A 3M3VA 1ZHPA 1P2QA 2O8LA 1YLCA 2O8TA 3ZZDA 1TRNA 2B7DH 1E36B 3RUOA 1DFPA 1RS0A 4I8JA 3A7TA 2A1DB 3UOPA 1H9IE 5GWZA 1A3EH 2PLXA 2HOBA 1QCPA 2VIDA 3JZ1B 5GCHG 1KDQB 1NS3A 1XX9A 2Y7ZA 4J1YA 1C2GA 3KL6A 3RXCA 3OYPA 1C2FA 3FVFB 1TOCB 1NN6A 1P0SH 2ALVA 3P17H 4WVPE 5C1YA 2ZTXA 2GZ8A 2SGQE 2C8XB 3RMLH 4ABAA 1FDPA 1VGCC 1SGTA 1JIMA 2CJIA 3PMJA 3BTHE 1C5YB 4ZH8A 2ZU2A 2QCYA 1LVOA 1GJAB 1UVOA 1QURH 4AOQA 8KME2 4NA9H 1C5PA 1LPZB 2EA3A 5DP5A 1UTKA 1FQ3A 3PV4A 5CMXH 2VIVA 5HM9A 2W3IA 3STIA 3T62A 3A89A 1ZMLA 4FVBA 1F0SA 3NPSA 4TWYA 2OBOA 3TU7H 2R2MB 1TWXB 1Y3VA 3SV8A 2WPHS 4Y76A 1SR5C 2BD4A 1EB2A 1C1PA 1O3NA 2XW9A 1GBLA 2P8OC 1UK2A 3ATMA 1SLWB 1SGQE 2OXSA 4FUFA 1CHOG 4NG9H 3TITA 3E3TA 1ZRKA 1A46H 1UVSH 1ESTA 2VINA 5E0HA 4IW4E 4CHAC 1NC6A 4BNRA 1BRAA 2FOFA 1KLTA 3HPTB 1O39A 1FJSA 2ZHEH 1QBVH 2FYQA 1O3PB 4X6NA 4TY6A 3F9EA 4OS5A 3BTQE 2FOMB 4JYTA 1GMHG 3GDUA 3RU4D 3DHKH 1GBBA 2XYAA 1O2NA 2F9BH 2Q6FA 2XC5A 1XXDA 2O8WA 3BEUA 1F5LA 1SQAA 4BAQB 4JYVH 1HFDA 5BPEA 2VGCC 2FLRH 3TJNA 1TBQH 4GUXA 5A0CA 1UVTH 2BQWB 4I8HA 4Q2KA 3SJOA 1GCDA 1SGCA 1LMWB 1GL1A 1BTXA 3K9XB 1QY6A 3ZZ8A 4KELA 3FZZA 1E34B 3A8AA 1ZJDA 1P11E 4CR9A 1W2KH 5DP4A 1GI7B 5C1UA 3ATLA 2BLWA 4RKOB 2R0KA 1N1LA 1Y8TA 4YOJA 4I8LA 1V2RT 1XKAC 2NU0E 2GKVE 3RXGA 4RSPA 1SVPA 2PUQH 4FU8A 3M37A 2IOTA 4A1XA 1ETRH 4WF8A 1B5GH 2GVFA 4DJZB 3IWMA 2G00A 1O5DH 1MD7A 1O34A 2ANWA 1W12U 2AMPA 2ZGHA 3CP7A 2ASUB 3TK9A 2HALA 1DS2E 3GCTG 1EX3A 2FO9A 3LONA 1TNGA 1S0QA 3RXIA 3ENSB 1XUFA 3GY5A 2GCTC 3JZ2B 1CGIE 2WINI 1GMDF 4WY3A 1O36A 2VIWA 3BIVH 4MNYA 1W10U 2G4TA 1BCUH 1E35B 4BXSA 2VVVA 3S0NA 2ZU5A 1SLVB 4NFEA 1JOUB 4IMZA 5DPAA 5EQQA 2P3UB 3MNCA 1K2I1 1QR3E 5DKMA 2GP9B 3V0XA 2VWOA 3SV2H 3BN9A 4ISIH 1BITA 2TRMA 1F5KU 1JMOH 1EZSC 3P70B 2C8ZB 1MTUA 3H7TA 1UTMA 1S85A 1WYKA 3E90B 4DG4A 4KTUA 1MTNB 1C4V2 1LPGB 5EXLA 4BTIB 2QXHA 1O33A 1VR1H 5JBBS 1THRH 1B0EA 1GBJA 1RIWC 1J15A 2BDGA 2R0LA 4X1NU 4JZDH 6LPRA 5CHAB 1Y5UT 2A4OA 1UMAH 2BQ7B 1C5WB 5EXNA 1J16A 2VH6A 1VCQA 1TIOA 2QIQA 2QF0A 1ELEE 2TGAA 3DA9B 5F03A 3VB3A 1V6DA 1K1LA 1NFWA 2BDYA 2ZFTA 1L1GA 3SUGA 1MTSA 2WPMS 4D9QA 4TWWA 3RXRA 2YOLA 1HNEE 4Z6AH 1GI0A 2BX3A 3URDA 1ANBA 1O37A 1QL9A 1XUGA 4DVAU 1O2KA 1TLDA 1C2DA 1C4U2 1DWCH 1MZDA 5E2PA 1IQEA 1PPHE 1VJ9U 2TGTA 2J9NA 4IC5A 3SU0A 2VB0A 1ELTA 2SNWA 1XVMA 1DANH 2AH4X 3LDXH 4K1EA 2Z7FE 1H8DH 5A0BA 1ZOMA 1EJNA 1DDJA 3RXTA 3MH4A 4ABGA 1MKXH 1TABE 4X8TH 5F8XA 1Y3YA 5DG6A 4WWYA 4A92A 1BMMH 1C2MA 2ALPA 3EA9A 3GYLB 2B0FA 1WTGH 1TNIA 4X8VH 1CA8B 2QXJA 2DE9A 4FUCA 4MTBA 2GMTC 1TMTH 1BBRH 2JH6D 2C3SA 1KXDA 3SJ8A 4KTCA 2Y5HA 2ZKSA 1WUNH 3ZVFA 2ZECA 1C1TA 1PPCE 1VGCB 4VGCB 3FZDA 1P2NA 4MDSA 5AF9H 4Y6DA 1LDTT 1K1MA 4Z0KA 3A84A 5FBEA 1UTPA 3MO3A 2Z9KA 3SGBE 3ZV8A 2A7HA 2ANMH 4X2VA 1MTVA 3A7WA 1FN6A 1V2MT 1IQNA 5J4QA 2FI4E 2ZDNA 4JMYA 1ETSH 1TA6A 4UDWH 2F9NA 3KCGH 3UUZA 2JKHA 1DUAA 2BY8X 4AYVB 5HYOA 4OS7A 2FDAA 2WPJS 2BX4A 4X1QU 1A5IA 1A7SA 1G2LA 3SO3A 1AI8H 4ABJA 3ZYDA 3T25A 4NIVA 1SGFA 4DCDA 1SSXA 1GJ6A 2FOBA 1O32A 1VJAU 2A7JA 4CHAB 3UIRA 1EZUC 1RFNA 1GJ9B 2OD3B 3F9FA 1TNLA 2BVRH 1DWEH 1AQ7A 1TMUH 1Z6JH 1CBWC 1O2JA 4U2WA 5EW2H 2H2ZA 1OWKA 2STAE 5DO4H 1DWDH 4X1RU 4F4OC
chains in the Genus database with same CATH superfamily
1C5TA 1O3DA 4MVNA 3PTBA 2ANYA 1SMFE 5J4SA 4A6LA 3ITIA 1ELGA 1SGDE 2F43B 2H6MA 2BD8A 3SQHE 4SGBE 1HJAC 1LQDB 1JRTA 1O2QA 2O8UA 2QGRA 1S6LA 4B73A 5DGJA 2WV4A 2BTCE 4XD7D 2BDCA 1C5UA 2ZO3H 4FUBA 3ELAH 1Z8RA 3BTGE 3OU0A 4WXIA 3N7DA 1GCTB 3ZZ9A 1WDIA 9LPRA 1FONA 1AFQB 4XSKU 3EDXB 1TNJA 1VITH 2OC1A 1NFYA 3PRBA 4ABFA 2OBQA 3TGIE 1WQVH 1WU1A 2JJ1D 1HAGE 4GHTA 5EJLA 2FS9A 9ESTA 3SU3A 3U1JB 1YPKH 2A31A 5JBCS 1Y5AT 1YLNA 2FTLE 2IPQX 2XNIA 3E8LA 3PRDA 1MU6B 3PLPA 3RXMA 3GY3A 1VCPA 2QC2A 4A7IB 3GYMA 4JZ1A 3S7HB 2KAIB 4IBLH 2J98B 1GBIA 4WMDA 1ESBA 4Q4LA 5FBIA 1O35A 2ODQA 1HAVA 2F3CE 1Q3XA 2FLBH 4OS6A 2WSSD 3LGTA 2C8YB 2FYRA 1N8OB 2V0BA 1KXAA 1PPEE 4GAWA 2F91A 1FMGA 5E8EH 4MNVA 1F5RA 2SFAA 2A4RA 2XWBI 3GOVB 2GV7A 4JK6A 1DE7H 4ABBA 1F2SE 4DT4A 5T6DA 2BB4A 4BTTB 5LH8A 2TGPZ 1KYNA 3PLKA 4O9VA 1TNKA 1O38A 1C2LA 1JXPA 1O3CA 3R3GB 1V2JT 1F0TA 1ELAA 2G5VA 3GY7A 1PQ8A 4A5TS 5GCHF 2J5UA 5GDSH 3NUMA 1KXBA 1GHAG 1O3IA 3QTOH 1ELFA 3DCLA 3F0OA 1BBRE 1QNJA 1DLEA 3M3TA 1C1NA 1W11U 1EP5A 2A7CA 2FI5E 2BD5A 4XBDA 1P8VC 3AAUA 4UEHH 3AW1A 2B5TB 8GCHG 2JETC 1ESAA 1VZQH 2V3HH 1GMCF 3SGQE 2F9VA 3GISB 2PV9B 3DD2H 2GDEH 1SBWA 1GG6B 1DM4B 2ZTZA 2BY5X 2FZZA 1T8MA 1S5SA 2WV9A 4MNXA 4ISNA 2VH0A 4BAOB 3UQOA 1NM6A 1D3PB 1LO6A 1TQ7B 1ZMJA 2P95A 3PYHA 1GDQA 3A8DA 3HKJB 3SUFA 1C9PA 1EUFA 1V2KT 2XRCA 1A61H 2WYJA 2OC7A 1TX8A 4WMFA 1L4ZA 1OWDA 4UE7H 1O2IA 1ZJKA 2FX4A 1YPGH 5KGOA 3ZZ3A 3SJ9A 1ANEA 2XBWA 2GCTB 3A81A 1BRUP 3UNRA 2WPIS 4AYYB 3RXPA 1GL0E 4U32A 2ZGJA 1O3MA 1AY6H 2VIQA 3LIWA 1Z1JA 3SV7A 1MQ6A 5EJ1A 2STBE 3GS9A 3EGKH 4I32A 1VCWA 1ZLRA 4JCNA 1EFRD 1KLJH 2C90B 3RXJA 2PR3A 3P6ZB 1HLTH 1FY4A 5HIZA 4NZQA 5EGMA 1BOQA 3GY4A 4BAMB 3TJUA 3ZVEA 1P06A 4Y7AA 1O3KA 2G51A 4UFFH 1BTPA 1XUKA 3TGKE 1YWUA 3QO6A 3SU4A 1HAHH 3D65E 1TQ0B 2GCHG 5CHAC 2XC4A 1TONA 4XBCA 2ZDLA 1P9SA 3ZVAA 2H9EH 4O03A 1P02A 2EI8A 1UW7A 4FUHA 2J38A 1F0UA 4ABIA 3TH2H 1TRYA 1J8AA 3PTNA 2ZZUH 5AFZH 2XBYA 1O2PA 1ZSKA 5C5OA 1PYTD 2BY7X 2HWLB 2ZDKA 1O2WA 1GI4A 1NO9H 1RTFB 4Q7ZA 5IK2D 1DVAH 1G2MA 1GI3A 3VXEH 1OX1A 1QB9A 2Z3EA 2QF4A 1GBFA 2D2DA 1GHZA 2P59A 1MMJN 4Q7YA 2H5DA 3KQBA 1FY1A 3D62A 5C94A 1LQEA 1YCPH 2A4GA 3KQCA 1YKTA 1IOEA 2AGGX 3RXLA 5KECA 2ZFPH 3AW0A 3B9FH 1L1JA 3LT3A 3TLOA 3MU5A 3OY6U 1HIAB 1BTYA 3SN8A 4D7FA 4X2WA 2Z94A 2FPZA 3MWIU 4X6MA 1O3AA 4I7YH 1O2HA 2AIQA 1AVXA 1GHBG 5EW1H 1EAWA 1ELCA 2K8IA 3GDSA 3LGUA 5HMAA 1CA0B 1XKBC 2RDLA 1FUJA 5C2ZA 1O2YA 1CHOF 1WAYB 1FIZA 4KKDA 4AFUA 4XE4A 4YT7H 1AWHB 2ZPSA 2AS9A 1WCZA 2ZU3A 3UAIC 1GJDB 3BEFB 2D26C 1GI2A 1A2CH 3GDVA 1K1PA 1YPMH 3OFND 4ZAEA 1GJ4H 3N7OA 1FY8E 2XBVA 1Z8GA 1LKAA 3LOXA 2V3OH 4ASHA 4ZKRU 5FPSA 1W13U 4FVDA 3RC4A 3MOCA 1WV7H 2OC0A 1LVBA 1XXFA 4OS1A 1FZZA 2P93A 4D9RA 1SG8B 2CGAA 2ZG0H 4OGYA 5FCRA 2CMYA 2ILNA 3MH6A 1BTWA 3BTWE 3NZIA 4AB9A 1EB1H 4GCHF 1HJAB 1QQ4A 2ZQ2A 1WSSH 3QTVH 3AAVA 3A7XA 2F9PA 1F92A 1AFEH 1UHBB 2A45B 2GX4A 3SU5A 1GBDA 1E38B 2VWNA 1GHXH 1P2MA 1TX6A 3MH5A 2HGTH 1C5LH 3SORA 4YESB 5GIBA 4DT7B 3A7YA 2AHME 1SGNE 1XUJA 7ESTE 1JBUH 4CRDA 1BRCE 3WW7A 2ANKH 1OP8A 3UQVA 1HGTH 2F9OA 3E1XB 1AIXH 1SL3A 5L2ZH 1CT0E 1EOLA 1O2UA 3PV2A 2CK3D 1SHYA 3SHAH 3L33A 2G55A 3RMNH 3MU4A 2C8WB 4KTSA 2J94A 1AKSB 5TCCA 3RXEA 4CRCA 4FU9A 2GT8A 1BT7A 2BQ6B 1P04A 3F68H 2QYIA 1GBHA 5A8ZA 3NK8A 1MTWA 1O2XA 1RGQA 3F9GA 4K8YA 1GGDC 1VITG 2GD4B 3SJIA 1LHDH 5K0HA 2KCPA 2QA9E 2NU4E 3QGJA 5FPTA 1P01A 4GPGA 3U9AH 3ZVBA 4CH2B 3RU4E 4Y8XA 1SC8U 1ZTJA 1C1WH 3MMGA 2PFEA 1DXPA 3F2HA 3NKKA 1Y59T 1EAUA 3LGYA 3A85A 1YC0A 2ZHFH 1YYY1 2VVCA 4AGKA 4ESTE 2UWLA 4B6FA 1Y3XA 2VIPA 2KZ4A 2I6SA 1PQ5A 2K0QA 3CENA 1GJBB 2H9TH 3SNDA 1C2KA 2P16A 4QT8C 1HBTH 5F53A 3MU1A 5CDFE 4H4FA 2W3KA 1H4WA 1IQGA 1ABIH 1V2ST 1P2KA 1C5RA 4NSYA 4K8BA 4UFDH 1GI8B 3VXFH 1A3BH 5DP6A 3ZZBA 1C1MA 5C0UA 2YNBA 1VKYA 1Q2WA 1K1OA 1ACBE 1CU1A 1D3DB 1MKWH 1KXFA 1T8LA 3VGCB 2BOHB 2BLQA 1EKBB 1O3BA 2XCFA 2DE8A 1IQLA 1CA0C 1TA2A 4GCHG 1O5EH 4GSOA 3Q00A 1Z8IB 2FXRA 1QJ7B 5DSFA 3T26A 1EPTC 2JH0D 4MPVA 1AWFH 4M7GA 2FOAA 1S82A 5E0GA 4FUEA 1ZHRA 1VITF 2ZDVH 3W1EA 2CN0H 4MG3A 1TPOA 2Z3CA 1ZTLA 2GDDA 4Q7XA 1TB6H 2HVYB 2OC8A 2F83A 2ZEBA 3LH3A 3UR9A 1BIOA 3OX7U 2GV6A 4K1TA 1QRXA 3ZZ4A 3QWCH 1ELDE 1HV7A 2M2AA 2HNTC 1QB6A 3RXQA 2F4LA 1C5OH 1SQRA 2GZ7A 3E0PB 1TPSA 2VIOA 2PKSC 1C5VA 4Z1MD 4A1TA 1UK4A 3BTKE 5EPNA 1B0FA 2TBSA 3SZEA 1E0FD 2W6ID 2BXUH 5JBAS 1KTSB 2HPPH 2J92A 2O9QA 3H5CB 3RXDA 2SNVA 4ZUHA 3ODDA 4INHA 1NT1A 3OSYA 3MHWU 4X6PA 3P8GA 3FAOA 1O2GH 1MBMA 3WWBA 3RLYH 1AU8A 1CT4E 2YNAA 3IITA 5EU8A 2ZPRA 5EG4A 4ZXYH 3M3SA 2RA3A 3ATKA 5T1VA 5TJXA 4FUGA 3RXKA 1TOMH 3U8RH 1MZAA 2W7SA 1ZPBA 2KCAA 2OQ5A 2ZU1A 5C5NA 1O30A 3VFEA 1Z1IA 1V2NT 3VPKA 4YT6H 1TBRH 3SUDA 1A1RA 2IJD1 4NIYA 5IYTA 4CRBA 1L0ZA 2AGEX 3TNTA 1DXWA 1BB0B 1EOJA 2ODPA 1S0RA 4RT0A 1D9IA 8LPRA 2BHGA 2OTVA 1GI5A 1GI1A 2PP6A 1EAIA 1G3DA 5JBTA 4K5ZA 3SBKA 1C4Y2 1V2QT 3BG8A 1NTPA 2XNDD 3T27A 1WXRA 1HB0B 4WH6A 1CE5A 2PTCE 1XMNB 2ZPQA 2GJGA 2SGAA 4B71A 5DP9A 5F6MA 1O3GA 5T6GA 1AVGH 1ZTKA 3T2NA 1D4PB 3BSQA 2Y81A 3NXPA 3PO1C 1EQ9A 3RDZA 3EQ0H 2AMDA 3VB6A 2ZCLP 2UUKB 1NRPH 3QZQA 5FPYA 3A7VA 3N7EA 2HRVA 4JK5A 4K60A 1U6QA 5DP8A 5AHGH 1RIWB 1K1NA 5JDUB 1QL8A 1DX5M 2AFQB 2IPHA 1Y5BT 4CRGA 1LHCH 3RXOA 2XOKD 1PPGE 1YPLH 1GMHF 4DW2U 3KQEA 1GJ5H 1LVMA 2PSXA 2GCHF 2KCOA 2GT7A 2FX6A 1ELBA 2FS8A 1P2JA 4ISHH 5PTPA 4AGJA 4WJG2 2G52A 2UUJB 1PPZA 4YZUA 3ZVCA 1DWBH 3M36A 3RXUA 1H8IH 3MNBA 3HGNA 4DY7B 1BDAA 2BZAA 3FP7E 5AVDA 5FAHA 1PFXC 3MNXA 1EXFA 3WY8A 1OPHB 1IQJA 2FOHA 3Q3XA 5DN6D 1NRSH 3K2UA 1GBAA 2J2UA 4X0WU 5SGAE 3UB0A 1EPTA 3Q3YA 1HAYB 2KX4A 4ZKSU 2BVSH 3HK3B 2VU8E 1C1SA 1GI6A 3FANA 3DFLA 3BTME 3VGCC 1X7AC 1WOFA 2PKAB 1HAOH 3LJJA 4DIIH 1B7XB 3G01A 1EASA 1GBMA 1OOKB 3KQ5A 1TGBA 4ABHA 3AK5A 1OXGA 1GHAF 4ZMAH 1V2OT 5HGGA 2Y5FA 3A86A 4LK4A 3ZZCA 4B76A 3SV9A 1O2VA 1NZQH 6CHAC 4NIWA 1GVLA 1IQIA 1W8BH 4J2YB 1FIWA 3LGVA 1DPOA 2JH5D 2BM2A 2FIRH 4BAKB 1J14A 1GBEA 2ZFSA 1C1OA 1WTHD 2Y6TA 3B8JA 1P10A 3RXSA 3D23A 1C1VH 2OK5A 1SLUB 2F9UA 1TNHA 1P03A 4CH8B 2NU3E 2V6NA 1NU7B 2PGQB 5EIYA 1AHTH 1QHRB 5JB9S 1P9UA 2ZCHP 2ZDMA 1LHEH 4VGCC 2J98A 1AO5A 1GG6C 3PLBA 4D8NA 4Q63A 3MQKC 2L6OA 2FOCA 3EE0B 2QXGA 1C1UH 3ZZ7A 1AB9B 3S9CA 2Z9IA 1C5MD 2GMTB 3UTUH 2ZHWH 1GGDB 1ID5H 4O3TA 1ZZZA 5ESBA 3SNBA 2QF5A 2G5NA 5CE1A 3MO9A 3B23B 4D7GA 4X2YA 2XC0A 1IQFA 1K0HA 2WPDD 1TPPA 5C20A 4RI0A 1P3EA 1YP9A 1HYLA 4Q80A 2NU1E 2IJOB 3HATH 3UOUA 3I29A 2A5KA 1SFQB 4Y71A 2G4UA 1HAIH 2XWAA 1O3HA 1MBQA 2ZGBH 3A8BA 3TJOA 4HTCH 1UTLM 2PTNA 3MYWA 2FOEA 5L6NH 1GBCA 5I25A 3EA7A 1BMNH 4GHQA 2CHAC 1FPCH 3DSPA 3MU0A 3TVJB 4DOQA 3OEED 3V7TA 1W3CA 1QJ6B 1ETTH 3UPEA 1AUJA 1BUIA 2BDIA 1HCGA 1L1NA 1ZGIA 1YCPK 1H9HE 3PMAB 3KIDU 1HRTH 5T6FA 2CF9H 1QTFA 3N99A 1SOZA 3ESTA 3TIUA 1NESE 4X1PU 1IAUA 4I86A 4ZHLU 4E7RG 2PUXB 1DUEA 2EEKA 1FI8A 3VG8A 5F8ZA 2FWWA 5C17A 1KIGH 3EA8A 2JIZD 3FOAA 1AE8H 3O8CA 4ISOA 4XFQA 4AFQA 1THPB 1T31A 1AZZA 1BHXB 3SHCH 3ZZ5A 1UVPA 4YLQH 4WMEA 2D1JA 4AX9H 1YLDA 4H6SB 3SW2B 6ESTA 4ZKNU 5FX6A 3C27B 1ZYOA 4IMQA 1ANDA 3KEEA 2BY9X 1A0HB 2ZGXH 3KNXA 1TFXA 5T3HA 1BTUA 2ZFFH 5EQRA 3RP2A 2B8OH 3V3MA 5C3NA 1C9TA 4ISLA 4NA8A 1NY22 4DIHH 1O3LA 1HAZB 1NRRH 3GY6A 1HDTH 4NWKA 1BQYA 3GY8A 1NROH 1NBMD 4GLYA 1LVYA 3BEIB 3LGWA 3OTPA 2IN2A 3QLPH 2P3TB 2CHAB 1MKXK 1C2HA 4XDEA 3U8TH 2A5AA 3QDZB 3P92A 1UTJA 4RT1A 4XRNA 4FOUC 4UFGH 1BBRK 1BJVA 2UUFB 3A88A 2BXTH 4MPWA 4IGDA 1ZSJA 1P3CA 1XM1A 2PKAA 1AKSA 1T8NA 1QQUA 1ZPCA 5JB8S 4I8KA 1O3OA 3QK1A 1C5QA 3K65B 1NFXA 3E91A 1SPJA 1D3TB 3BTEE 4MPXA 2V7QD 1OWJA 2W5EA 4B2AA 4B75A 3Q76A 1HIAA 1LKBA 4U30A 1AB9C 1NU9A 3LJOA 1A4WH 1G3EA 1YPHE 2ZTYA 4FETA 3RC5A 3U98H 4IN2A 1SQTA 3QZRA 3MI4A 2OP9A 1YCPM 2Z9JA 2BOKA 3U28C 1GI9B 2SGEE 1IQHA 4RN6A 4NA7A 1HJ8A 3PWBA 3SI3H 4CBOA 1DSUA 2WPKS 3TH3H 3HGPA 1T32A 1OP0A 5HKKD 1K22H 1UCYE 5GPIB 1QIXB 1CQQA 1HAVB 3PO1B 1O3EA 1MAYA 1YM0A 1FAXA 3TNSA 1SHHB 1T8OA 2PGBB 2FTMA 5DJ7A 4HI3A 4OGXA 3UY9A 3ATIA 3T29A 1UTQA 1OHHD 3STJA 3BV9B 3PB1E 1H1BA 1QFKH 1GCTC 4FUIA 2YMSD 2ZFRH 4AORA 4AB8A 3UR6A 2P94A 3TPIZ 4INKA 1O2OA 4M9FA 3LH1A 2AEIH 4Y8ZA 2HLCA 1S6HA 2H5CA 3KYFA 1UHBA 5ABWA 4Y8YA 3DUXH 3PROA 2H9HA 1FXYA 1G36A 1V2UT 3O8RA 3ZV9A 5EPYA 1Q31A 2VWMA 1PQAA 3RMOH 4TYDA 5LPEA 2R2WU 3M5NA 3SNAA 2KAIA 1LHGH 1MKWK 2QN5T 2EY4C 5FX5A 2CV3A 2PWXA 3BG4C 1DY8A 1MABB 1AUTC 2RCEA 3M7QA 4WH8A 2HNTE 2BY6X 2BDBA 4XOJA 2V3MA 1WBGB 2SGFE 1D6RA 3KHVA 2FEQH 1ARCA 1MUEB 2QAAA 1M9UA 3BF6H 4KP0A 4ZHMU 2EI6A 1BMLA 3MO6A 1A0LA 1GPZA 2XBXA 1S83A 3SYJA 1O5FH 1FNIA 4NSVA 1E79D 1BTHH 1V2LT 1AD8H 1SB1H 1V3XA 2PW8H 5FCKA 4BXWA 1QJ1B 4P02A 4CRFA 5A09A 1GHVH 4TT3D 1GVZA 1HJ9A 3MNSA 3FFGA 4LZ4B 1AVWA 4ABEA 3GCNA 2TPIZ 3BG4B 1KDQA 5KEDA 1SGFG 3QX5H 1QGFA 1KTTB 4JZIA 8GCHF 1ORFA 4B1TA 1O2RA 5DP3A 1Y3WA 3E16B 1BMAA 1GJ8B 2BD9A 1C1QA 3AASA 3SUEA 5EODA 2R9PA 1DY9A 2PSYA 3RM2H 3GCHC 2B9LA 4K1SA 2Q6DA 1QBOA 1ZR0A 4E7NA 1T4UH 2D8WA 4FU7A 1F7ZA 4WXVA 3RU4T 1JRSA 1SGRE 3I77A 2AIPA 2G8TA 1EZQA 1JWTA 2Z3DA 3EYDA 3LPRA 2J34A 1S84A 1WQSA 3A8CA 1EJAA 3LKWA 1JIRA 4OS2A 4CRAA 1O3JA 1O2TA 1H8HD 2FMJA 1MD8A 3GCHB 1J9CH 1OP2A 1UVUH 1AE5A 1S6FA 1OYQA 2HNTF 2J4IA 1ZMNA 1AZ8A 2CXVA 4B2BA 1TGNA 1BZXE 1A0JA 4R8TB 3PMBB 5C67A 1GMDG 3U8OH 4UFEH 3GCTF 2BMGB 3ZIAD 3ZZ6A 2VBCA 1CO7E 3SU1A 2ZWLH 1ARBA 3OTJE 1O0DH 1PPBH 2ULLA 2BD2A 1Z71A 2VWLA 1NRQH 3ZVGA 1GBKA 1XUIA 4Y7BA 3VB4A 3A80A 2TGDA 1INCA 1UJ1A 1DLKB 3QN7A 1G37A 4FXGH 3TK6A 2OQUA 4XBBA 3ZYEA 4YXWD 2A2XH 1ZHMA 3S9BA 4Y0YE 7GCHG 1RD3B 3SGAE 3GICB 5K7RA 1SLXB 1E1QD 1THSH 3A82A 3KQDA 3OY5U 5H4IB 1YY3A 2XTTB 1A5GH 2ZI2H 3K6ZA 1TGTA 1FX0B 5A2MH 4H42U 1XVOA 4AG2A 2A2QH 5L30H 3OEHD 1MCTA 3LC5A 1ABJH 1W0ZU 4LOYH 3F2GA 3TK5A 3I78A 3H7OA 1CGHA 3A83A 2GTBA 3RLWH 5GNDA 2HVXA 1YBWA 1AMHA 2LPRA 4KGAA 3EAJA 4F49A 5CHBA 4ZHAA 2VJ1A 1L4DA 3C1KA 1TE0A 4MQAA 1AN1E 2W26A 1PJPA 2OINA 3TJVA 2ZIQH 2BLOA 5DK1A 1KMHB 1CHGA 1KXCA 2ZDAH 4X8UH 2Y80A 3URCA 4B74A 1OWIA 3AVZA 4AFSA 1EPTB 2WUCA 2DUCA 2SGPE 1CBWB 5C1XA 2ZC9H 4K69A 1LCYA 3BTFE 1EP6A 1MU8B 2LNCA 4E06H 1TRMA 4CR5A 1N6YA 3GCOA 4O3UA 4NWLA 3SNCA 3SOSA 3V13A 3RXAA 3SU2A 2A32A 3IG6B 1HXEH 3RXBA 1HAXB 4R0IA 2Z9GA 4UONA 5L2YH 4E05H 1BMFD 1V2VT 3K6YA 1O5AB 3SJKA 5A8YA 4MNWA 1CSOE 1DICA 2AERH 2Y82A 3MFJA 2WUBA 1P09A 4I33A 2C93B 2PKSB 2EC9H 3S69A 1H9LB 5EQSA 1OWEA 2FESH 2FODA 3ZVDA 2XXLA 1BA8B 1C2EA 4MLFB 4IN1A 4SGAE 4X8SH 3RC6A 3F1SB 2RA0A 2ZCKP 1HAPH 1Z7KA 3PWCA 4I31A 3O8BA 1BHXF 4YOIA 1TALA 2JDID 1T7CA 3RM0H 1QRZA 1W0YH 4ZXXH 1O2LA 2QV1A 3R0FA 4HFPB 1KSNA 2UWPA 3M5LA 2ZQ1A 3BTTE 4NZLA 7LPRA 4ZROA 2BVXH 2EQNA 5DP7A 1YF4A 2Q1JA 1DT2A 1IQMA 1L2EA 1OS8A 2YMSB 2OUAA 2HPQH 1AFQC 4OS4A 1ZSLA 1UTOA 1GJ7B 3CS0A 4UD9H 1QRWA 2K1QA 4TPYA 3SQEE 5B6OA 3DT0H 4ABDA 3O8DA 3ATWA 1O5CB 1FLEE 6CHAB 1E37B 1O2ZA 3RXHA 4ACAA 6GCHF 1DSTA 3V12A 4B6EA 4X2XA 2R3YA 1K1JA 1BRBE 3SZNA 2WYGA 2UWOA 4ASUD 3SU6A 1O5GH 3LGIA 1G3BA 1MH0A 3LC3A 1KY9A 1K21H 1MCVA 3MH7A 4TSFD 1O2SA 1SGYE 2BYAX 2CF8H 4X1SU 4YM9A 2R3UA 3DFJA 3L6PA 1MQ5A 3NWUA 3RXFA 4AG1A 1GMCG 2I6QA 3BIUH 1YPEH 3VEQB 1C2IA 4LZ1H 4OM9A 2ESTE 1F0RA 3UREA 2ZP0H 4BTUB 1P2OA 1G9IE 1CGJE 2A0QB 1ZGVA 2O8MA 3KN2A 2Y5GA 1UO6A 4ZCNA 4DGJA 3GY2A 4Y0ZE 3KGPA 4GVUA 4PROA 2VGCB 2AYWA 3HKIB 5C0TA 8ESTE 4H6TA 2OCVB 3F9HA 2FI3E 4K2YA 1GBTA 2JETB 5FXLA 3SV6A 2LELA 2RG3A 2SGDE 2YMSC 4AC9A 1IQKA 1TYNA 5ESTE 2BLVA 1QB1A 2BZ6H 2ZHQH 1TBZH 5HIYA 3TH4H 4DURA 4BAHB 4NFFA 2HLDD 2W7UA 3BTDE 1RRKA 1XUHA 1V2PT 2OLGA 3NRLA 1T4VH 2KFWA 4AFZA 3ZZAA 4ZKOU 3T28A 3U1IB 1FV9A 2GGVB 1GDUA 4FUDA 1C5NH 5A8XA 2RFKC 1EJMA 1TPAE 2BDAA 2A4QA 1P05A 3A7ZA 1HXFH 4ACBA 3CNRA 1A5HA 4LXBH 3KF2A 3F6UH 5EOKA 5FL7D 3M35A 2THFB 1EATA 4RKJB 5G4BA 4P00A 2QY0B 2EI7A 4JZEH 1GHWH 2J97A 4YTAA 5HXFA 3DSOA 3S7KB 1G3CA 2XCNA 4IC6A 1FY5A 2ODYB 1SOTA 2ZA5A 3W94A 3CS7A 4NIXA 5ETXA 3F0PA 1OYTH 1FAKH 1DOJA 2ZHDA 4HGCA 5LGOA 2P3FH 1P57B 1W7XH 2VVUA 1C2JA 3E6PH 2KM0A 1K28D 1C5XB 3TGJE 1RJXB 1HUTH 3SI4H 5LPFA 1UK3A 3PMHB 5IDKA 3E0NB 3P95A 2ZFQH 1K9OE 3RMMH 1G32B 3VB7A 5GXPA 3Q3KA 1V2WT 4Y10E 2KR7A 3HK6B 4NCYA 3M7UA 1KXEA 5JYIA 3M5MA 3FKSD 1GWAA 4HZHA 2GZ9A 1RTLA 1ELVA 1BJUA 2TIOA 2WZQA 3P8OA 1RTKA 4YO9A 4YLUA 1YPJH 4MPUA 3P8FA 3UNQA 4A1VA 3RXVA 3OE7D 3W95A 1MAXA 3H09A 1GHBF 1FPHH 2WPLS 5BRRE 5I46H 5B6LA 1C5ZB 1MTNC 4THNH 4B2CA 7KMEH 1SI5H 3Q77A 1CT2E 4U01A 4X6OA 3A87A 3ODFA 1S81A 1V2TT 1D6WA 4I8GA 1D3QB 5E0JA 3P8NA 4TPIZ 4F48B 3SNEA 1TMBH 1W0KD 1OSSA 4INLA 1DITH 2C4FH 2G81E 5HM2A 1SGPE 4CREA 2ZF0H 1RXPA 1TGSZ 1W7GH 2BD3A 2P8OB 3VB5A 4D76A 4K3JA 5AFYH 2UUYA 1EAXA 2VNTA 1NPMA 1SGIB 2ZGCA 3L3TA 1OKXA 1C5SA 1YGCH 1ZPZA 2NWNA 2WV5A 2Z6BD 3FP6E 5A0AE 4TY7A 1G30B 1GVKB 1KLIH 1PYTC 2BD7A 2H1UA 1P12E 1Z6EA 5JPMH 1QA7A 1YPHC 1OWHA 1FY3A 2QF3A 3MU8A 3D49H 1O3FA 1GHYH 2A5IA 4O97A 1NFUA 2Y7XA 1O2MA 1P2IA 3UWIA 1K1IA 1SQOA 1QA0A 4HG6A 1PPFE 1H8ED 5LPRA 2AGIX 4AN7A 1LPKB 7GCHF 3S9AA 2AMQA 2QXIA 3U69H 1O5BB 2ZNKH 5TCAA 1SFIA 1GDNA 1LTOA 1ANCA 1N6XA 1TX7A 1Z8JB 1UTNA 4IS5A 2Q6GA 3QUMP 1QBNA 2BDHA 1SGEE 2WHXA 1CVWH 1TAWA 1HPGA 1IHSH 4Y11E 1ZRBA 2J95A 5FHTA 4JZFH 1EZXC 1FN8A 2ZU4A 1TGCA 3FP8E 2NU2E 1UCYH 3UNSA 5E2OA 4AZ2B 1W14U 4FUJA 1E1RD 1PQ7A 1O31A 3M5OA 4BANB 2FM2A 6GCHG 1NRNH 3NCLA 3UWJH 2PHBA 4BOHA 5GJ4B 1J17T 5F8TA 1QL7A 3UFAA 1COWD 1BTZA 1UCYK 2FP7B 3M61U 3T5FH 2M5TA 1N8OC 4Y79A 3PM3A 1AGJA 3M7TA 1Y3UA 3QGNB 1LHFH 3F2FA 4CBNA 1C1RA 2FOGA 3LU9B 4NGAH 1GJCB 2Z9LA 5EXMA 1IHTH 3MTYA 4JYUH 4YOGA 2V35A 3M3VA 1ZHPA 1P2QA 2O8LA 1YLCA 2O8TA 3ZZDA 1TRNA 2B7DH 1E36B 3RUOA 1DFPA 1RS0A 4I8JA 3A7TA 2A1DB 3F3BA 3UOPA 1H9IE 5GWZA 1A3EH 2PLXA 2HOBA 1QCPA 2VIDA 3JZ1B 5GCHG 1KDQB 1NS3A 3FN8A 3OAAD 1XX9A 2Y7ZA 4J1YA 1C2GA 3KL6A 3RXCA 3OYPA 1C2FA 3FVFB 1TOCB 1NN6A 1P0SH 2ALVA 3P17H 4WVPE 5C1YA 2ZTXA 2GZ8A 2SGQE 2C8XB 3RMLH 4ABAA 1FDPA 1VGCC 1SGTA 1JIMA 2CJIA 3PMJA 3BTHE 1C5YB 4ZH8A 2ZU2A 2QCYA 1LVOA 1GJAB 1UVOA 1QURH 4AOQA 8KME2 4NA9H 1C5PA 1LPZB 2EA3A 5DP5A 1UTKA 1FQ3A 3PV4A 5CMXH 2VIVA 5HM9A 2W3IA 3STIA 3T62A 3A89A 1ZMLA 4FVBA 1F0SA 3NPSA 4TWYA 2OBOA 3TU7H 2R2MB 1TWXB 1Y3VA 3SV8A 2WPHS 4Y76A 1SR5C 2BD4A 1EB2A 1C1PA 1O3NA 2XW9A 1GBLA 2P8OC 1UK2A 3ATMA 1SLWB 1SGQE 2OXSA 4FUFA 1CHOG 4NG9H 3TITA 3E3TA 1ZRKA 1A46H 1UVSH 1ESTA 2VINA 5E0HA 4IW4E 1SKYE 4CHAC 1NC6A 4BNRA 1BRAA 2FOFA 1KLTA 3HPTB 1O39A 1FJSA 2ZHEH 1QBVH 3PV5A 2FYQA 1O3PB 4X6NA 4TY6A 3F9EA 4OS5A 3BTQE 2FOMB 4JYTA 1GMHG 5EJZA 3GDUA 3RU4D 3DHKH 1GBBA 4F55A 2XYAA 1O2NA 2F9BH 2Q6FA 2XC5A 1XXDA 2O8WA 3BEUA 1F5LA 1SQAA 4BAQB 4JYVH 1HFDA 5BPEA 2VGCC 2FLRH 3TJNA 1TBQH 4GUXA 5A0CA 1UVTH 2QE7D 2BQWB 4I8HA 4Q2KA 3SJOA 3KYGA 1GCDA 1SGCA 1LMWB 1GL1A 1BTXA 1NBME 3K9XB 1QY6A 3ZZ8A 4KELA 3FZZA 1E34B 3A8AA 1ZJDA 1P11E 4CR9A 1W2KH 5DP4A 1GI7B 5C1UA 3ATLA 2BLWA 4RKOB 2R0KA 1N1LA 1Y8TA 4YOJA 4I8LA 1V2RT 1XKAC 2NU0E 2L74A 2GKVE 3FO8D 3RXGA 4RSPA 1SVPA 2PUQH 4FU8A 3M37A 2IOTA 4A1XA 1ETRH 4WF8A 1B5GH 2GVFA 4DJZB 3IWMA 2G00A 1O5DH 1MD7A 1O34A 2ANWA 1W12U 2AMPA 2ZGHA 3CP7A 2ASUB 3TK9A 2HALA 1DS2E 3GCTG 1EX3A 2FO9A 3LONA 1TNGA 3DSGA 1S0QA 2KCYA 3RXIA 3ENSB 1XUFA 3GY5A 2GCTC 3JZ2B 1CGIE 1W0JD 2WINI 2LP6A 1GMDF 4WY3A 1O36A 2VIWA 3BIVH 4MNYA 1W10U 2G4TA 1BCUH 1E35B 4BXSA 2VVVA 3S0NA 2ZU5A 1SLVB 4NFEA 1JOUB 4IMZA 5DPAA 2JJ2D 5EQQA 2P3UB 3MNCA 1K2I1 1QR3E 5DKMA 2GP9B 1QZ8A 3V0XA 2VWOA 3SV2H 3BN9A 4ISIH 1BITA 2TRMA 1F5KU 1JMOH 1EZSC 3P70B 2C8ZB 1MTUA 3H7TA 1UTMA 1S85A 1WYKA 3E90B 4DG4A 4KTUA 1MTNB 1C4V2 1LPGB 5EXLA 4BTIB 2QXHA 1O33A 1VR1H 5JBBS 1THRH 1B0EA 1GBJA 1RIWC 1J15A 2BDGA 2R0LA 4X1NU 4JZDH 6LPRA 5CHAB 1Y5UT 2A4OA 1UMAH 2BQ7B 1C5WB 5EXNA 1J16A 2VH6A 1VCQA 1TIOA 2QIQA 2QF0A 1ELEE 2TGAA 3DA9B 5F03A 3VB3A 1V6DA 1K1LA 1NFWA 2BDYA 2ZFTA 1L1GA 3SUGA 1MTSA 2WPMS 4D9QA 4TWWA 3RXRA 2YOLA 1HNEE 4Z6AH 1GI0A 2BX3A 3URDA 1ANBA 1O37A 1QL9A 1XUGA 4DVAU 1O2KA 1TLDA 1C2DA 1C4U2 1DWCH 1MZDA 5E2PA 1IQEA 1PPHE 1VJ9U 2TGTA 2J9NA 4IC5A 3SU0A 2VB0A 1ELTA 2SNWA 1XVMA 1DANH 2AH4X 3LDXH 4K1EA 2Z7FE 1H8DH 5A0BA 1ZOMA 1EJNA 1DDJA 3RXTA 3MH4A 4ABGA 1MKXH 1TABE 4X8TH 5F8XA 1Y3YA 5DG6A 4WWYA 4A92A 1BMMH 1C2MA 2ALPA 3EA9A 3GYLB 2B0FA 1WTGH 1TNIA 4X8VH 1CA8B 2QXJA 2DE9A 4FUCA 4MTBA 2GMTC 1TMTH 3EE7A 1BBRH 2JH6D 2C3SA 1KXDA 3SJ8A 3WWFA 4KTCA 2Y5HA 2ZKSA 2RDEA 1WUNH 3ZVFA 2ZECA 1C1TA 1PPCE 1VGCB 4VGCB 3FZDA 1P2NA 4MDSA 5AF9H 4Y6DA 1LDTT 1K1MA 4Z0KA 3A84A 5FBEA 1UTPA 3MO3A 2Z9KA 3SGBE 2W6JD 3ZV8A 2A7HA 2ANMH 4X2VA 1MTVA 3A7WA 1FN6A 1V2MT 1IQNA 5J4QA 2FI4E 2ZDNA 4JMYA 1ETSH 1TA6A 4UDWH 2F9NA 3KCGH 3UUZA 2JKHA 1DUAA 2BY8X 4AYVB 5HYOA 4OS7A 2FDAA 2WPJS 2BX4A 4X1QU 1A5IA 1A7SA 1G2LA 3SO3A 1AI8H 4ABJA 3ZYDA 3T25A 4NIVA 1SGFA 4DCDA 1SSXA 1GJ6A 2FOBA 1O32A 1VJAU 2A7JA 4CHAB 3UIRA 1EZUC 1RFNA 1GJ9B 2OD3B 3F9FA 1TNLA 2BVRH 1DWEH 1AQ7A 1TMUH 1Z6JH 1CBWC 1O2JA 4U2WA 5EW2H 2H2ZA 1OWKA 2STAE 5DO4H 1DWDH 4X1RU 4F4OC
chains in the Genus database with same CATH topology
1C5TA 1O3DA 4MVNA 3PTBA 2ANYA 1SMFE 5J4SA 4A6LA 3ITIA 1ELGA 1SGDE 2H6MA 2BD8A 3SQHE 4SGBE 1HJAC 1LQDB 1JRTA 1O2QA 2O8UA 2QGRA 4B73A 5DGJA 2WV4A 2BTCE 2BDCA 1C5UA 2ZO3H 4FUBA 3ELAH 1Z8RA 3BTGE 3OU0A 4WXIA 1GCTB 3ZZ9A 9LPRA 1FONA 1AFQB 4XSKU 3EDXB 1TNJA 1VITH 2OC1A 1NFYA 4ABFA 2OBQA 3TGIE 1WQVH 1WU1A 1HAGE 4GHTA 2FS9A 9ESTA 3SU3A 3U1JB 1YPKH 2A31A 5JBCS 1Y5AT 2FTLE 2XNIA 3E8LA 1MU6B 3PLPA 3RXMA 3GY3A 1VCPA 2QC2A 4A7IB 3GYMA 4JZ1A 3S7HB 2KAIB 4IBLH 1GBIA 4WMDA 1ESBA 5FBIA 1O35A 2ODQA 1HAVA 2F3CE 1Q3XA 2FLBH 4OS6A 3LGTA 2C8YB 2FYRA 1N8OB 2V0BA 1KXAA 1PPEE 4GAWA 2F91A 1FMGA 5E8EH 4MNVA 1F5RA 2SFAA 2A4RA 2XWBI 3GOVB 2GV7A 4JK6A 1DE7H 4ABBA 1F2SE 5T6DA 2BB4A 4BTTB 5LH8A 2TGPZ 1KYNA 3PLKA 4O9VA 1TNKA 1O38A 1C2LA 1JXPA 1O3CA 3R3GB 1V2JT 1F0TA 1ELAA 2G5VA 3GY7A 1PQ8A 4A5TS 5GCHF 5GDSH 3NUMA 1KXBA 1GHAG 1O3IA 3QTOH 1ELFA 1BBRE 1QNJA 1DLEA 3M3TA 1C1NA 1W11U 1EP5A 2A7CA 2FI5E 2BD5A 4XBDA 1P8VC 3AAUA 4UEHH 3AW1A 2B5TB 8GCHG 2JETC 1ESAA 1VZQH 2V3HH 1GMCF 3SGQE 2F9VA 3GISB 2PV9B 3DD2H 2GDEH 1SBWA 1GG6B 1DM4B 2ZTZA 2BY5X 2FZZA 1T8MA 1S5SA 4MNXA 4ISNA 2VH0A 4BAOB 3UQOA 1NM6A 1D3PB 1LO6A 1TQ7B 1ZMJA 2P95A 3PYHA 1GDQA 3A8DA 3HKJB 3SUFA 1C9PA 1EUFA 1V2KT 2XRCA 1A61H 2WYJA 2OC7A 1TX8A 4WMFA 1L4ZA 1OWDA 4UE7H 1O2IA 1ZJKA 2FX4A 1YPGH 3ZZ3A 3SJ9A 1ANEA 2XBWA 2GCTB 3A81A 1BRUP 3UNRA 2WPIS 4AYYB 3RXPA 1GL0E 4U32A 2ZGJA 1O3MA 1AY6H 2VIQA 3LIWA 1Z1JA 3SV7A 1MQ6A 2STBE 3EGKH 4I32A 1VCWA 1ZLRA 4JCNA 1KLJH 2C90B 3RXJA 2PR3A 3P6ZB 1HLTH 1FY4A 4NZQA 5EGMA 1BOQA 3GY4A 4BAMB 3TJUA 3ZVEA 1P06A 4Y7AA 1O3KA 2G51A 4UFFH 1BTPA 1XUKA 3TGKE 3QO6A 3SU4A 1HAHH 3D65E 1TQ0B 2GCHG 5CHAC 2XC4A 1TONA 4XBCA 2ZDLA 1P9SA 3ZVAA 2H9EH 4O03A 1P02A 2EI8A 4FUHA 2J38A 1F0UA 4ABIA 3TH2H 1TRYA 1J8AA 3PTNA 2ZZUH 5AFZH 2XBYA 1O2PA 1ZSKA 5C5OA 1PYTD 2BY7X 2HWLB 2ZDKA 1O2WA 1GI4A 1NO9H 1RTFB 4Q7ZA 1DVAH 1G2MA 1GI3A 3VXEH 1OX1A 1QB9A 2Z3EA 1GBFA 2D2DA 1GHZA 2P59A 1MMJN 4Q7YA 2H5DA 3KQBA 1FY1A 3D62A 1LQEA 1YCPH 2A4GA 3KQCA 1YKTA 1IOEA 2AGGX 3RXLA 2ZFPH 3AW0A 3B9FH 1L1JA 3LT3A 3TLOA 3MU5A 3OY6U 1HIAB 1BTYA 3SN8A 4D7FA 4X2WA 2Z94A 2FPZA 3MWIU 4X6MA 1O3AA 4I7YH 1O2HA 2AIQA 1AVXA 1GHBG 5EW1H 1EAWA 1ELCA 3GDSA 3LGUA 5HMAA 1CA0B 1XKBC 2RDLA 1FUJA 5C2ZA 1O2YA 1CHOF 1WAYB 1FIZA 4KKDA 4AFUA 4XE4A 4YT7H 1AWHB 2ZPSA 2AS9A 1WCZA 2ZU3A 1GJDB 3BEFB 2D26C 1GI2A 1A2CH 3GDVA 1K1PA 1YPMH 4ZAEA 1GJ4H 3N7OA 1FY8E 2XBVA 1Z8GA 1LKAA 3LOXA 2V3OH 4ASHA 4ZKRU 5FPSA 1W13U 4FVDA 3RC4A 3MOCA 1WV7H 2OC0A 1LVBA 1XXFA 4OS1A 1FZZA 2P93A 4D9RA 1SG8B 2CGAA 2ZG0H 4OGYA 5FCRA 2CMYA 2ILNA 3MH6A 1BTWA 3BTWE 3NZIA 4AB9A 1EB1H 4GCHF 1HJAB 1QQ4A 2ZQ2A 1WSSH 3QTVH 3AAVA 3A7XA 2F9PA 1F92A 1AFEH 1UHBB 2A45B 2GX4A 3SU5A 1GBDA 2VWNA 1E38B 1GHXH 1P2MA 1TX6A 3MH5A 2HGTH 1C5LH 3SORA 4YESB 5GIBA 4DT7B 3A7YA 1SGNE 1XUJA 7ESTE 1JBUH 4CRDA 1BRCE 2ANKH 1OP8A 3UQVA 1HGTH 2F9OA 3E1XB 1AIXH 1SL3A 5L2ZH 1CT0E 1EOLA 1O2UA 1SHYA 3SHAH 3L33A 2G55A 3RMNH 3MU4A 2C8WB 4KTSA 2J94A 1AKSB 5TCCA 3RXEA 4CRCA 4FU9A 2GT8A 1BT7A 2BQ6B 1P04A 3F68H 2QYIA 1GBHA 5A8ZA 3NK8A 1MTWA 1O2XA 1RGQA 3F9GA 4K8YA 1GGDC 1VITG 2GD4B 3SJIA 1LHDH 5K0HA 2QA9E 2NU4E 3QGJA 5FPTA 1P01A 4GPGA 3U9AH 3ZVBA 4CH2B 3RU4E 4Y8XA 1SC8U 1ZTJA 1C1WH 3MMGA 2PFEA 1DXPA 3NKKA 1Y59T 1EAUA 3LGYA 3A85A 1YC0A 2ZHFH 1YYY1 2VVCA 4AGKA 4ESTE 2UWLA 1Y3XA 2VIPA 2I6SA 1PQ5A 3CENA 1GJBB 2H9TH 3SNDA 1C2KA 2P16A 4QT8C 1HBTH 3MU1A 4H4FA 2W3KA 1H4WA 1IQGA 1ABIH 1V2ST 1P2KA 1C5RA 4NSYA 4K8BA 4UFDH 1GI8B 3VXFH 1A3BH 5DP6A 3ZZBA 1C1MA 2YNBA 1Q2WA 1K1OA 1ACBE 1CU1A 1D3DB 1MKWH 1KXFA 1T8LA 3VGCB 2BOHB 2BLQA 1EKBB 1O3BA 2XCFA 2DE8A 1IQLA 1CA0C 1TA2A 4GCHG 1O5EH 4GSOA 3Q00A 1Z8IB 2FXRA 1QJ7B 3T26A 1EPTC 2JH0D 4MPVA 1AWFH 4M7GA 2FOAA 1S82A 5E0GA 4FUEA 1ZHRA 1VITF 2ZDVH 2CN0H 4MG3A 1TPOA 2Z3CA 1ZTLA 2GDDA 4Q7XA 1TB6H 2OC8A 2F83A 2ZEBA 3LH3A 3UR9A 1BIOA 3OX7U 2GV6A 4K1TA 1QRXA 3ZZ4A 3QWCH 1ELDE 1HV7A 2HNTC 1QB6A 3RXQA 1C5OH 2GZ7A 3E0PB 1TPSA 2VIOA 2PKSC 1C5VA 4A1TA 1UK4A 3BTKE 5EPNA 1B0FA 2TBSA 1E0FD 5JBAS 2BXUH 1KTSB 2HPPH 2J92A 2O9QA 3H5CB 3RXDA 2SNVA 4ZUHA 3ODDA 4INHA 1NT1A 3OSYA 3MHWU 4X6PA 3P8GA 3FAOA 1O2GH 1MBMA 3RLYH 1AU8A 1CT4E 2YNAA 3IITA 5EU8A 2ZPRA 5EG4A 4ZXYH 3M3SA 2RA3A 3ATKA 5TJXA 4FUGA 3RXKA 1TOMH 3U8RH 1MZAA 2W7SA 1ZPBA 2OQ5A 2ZU1A 5C5NA 1O30A 3VFEA 1Z1IA 1V2NT 3VPKA 4YT6H 1TBRH 3SUDA 1A1RA 4NIYA 5IYTA 4CRBA 1L0ZA 2AGEX 3TNTA 1DXWA 1BB0B 1EOJA 2ODPA 1S0RA 8LPRA 1D9IA 2BHGA 2OTVA 1GI5A 1GI1A 1EAIA 1G3DA 5JBTA 4K5ZA 3SBKA 1C4Y2 1V2QT 3BG8A 1NTPA 3T27A 1HB0B 4WH6A 1CE5A 2PTCE 1XMNB 2ZPQA 2SGAA 4B71A 5F6MA 5DP9A 1O3GA 5T6GA 1AVGH 1ZTKA 3T2NA 1D4PB 3BSQA 2Y81A 3NXPA 3PO1C 1EQ9A 3RDZA 3EQ0H 2AMDA 3VB6A 2ZCLP 2UUKB 1NRPH 3QZQA 5FPYA 3A7VA 2HRVA 4JK5A 4K60A 1U6QA 5DP8A 5AHGH 1RIWB 1K1NA 5JDUB 1QL8A 1DX5M 2AFQB 2IPHA 1Y5BT 4CRGA 1LHCH 3RXOA 1PPGE 1YPLH 1GMHF 4DW2U 3KQEA 1GJ5H 1LVMA 2PSXA 2GCHF 2GT7A 2FX6A 1ELBA 2FS8A 1P2JA 4ISHH 5PTPA 4AGJA 4WJG2 2G52A 2UUJB 1PPZA 4YZUA 3ZVCA 1DWBH 3M36A 3RXUA 1H8IH 3MNBA 3HGNA 4DY7B 1BDAA 2BZAA 3FP7E 5AVDA 5FAHA 1PFXC 3MNXA 1EXFA 3WY8A 1OPHB 1IQJA 2FOHA 3Q3XA 1NRSH 3K2UA 1GBAA 2J2UA 4X0WU 5SGAE 1EPTA 3Q3YA 1HAYB 4ZKSU 2BVSH 3HK3B 2VU8E 1C1SA 1GI6A 3FANA 3DFLA 3BTME 3VGCC 1X7AC 1WOFA 2PKAB 1HAOH 3LJJA 4DIIH 1B7XB 3G01A 1EASA 1GBMA 1OOKB 1TGBA 4ABHA 1OXGA 1GHAF 4ZMAH 1V2OT 5HGGA 2Y5FA 3A86A 4LK4A 3ZZCA 4B76A 3SV9A 1O2VA 1NZQH 6CHAC 4NIWA 1GVLA 1IQIA 1W8BH 4J2YB 1FIWA 3LGVA 1DPOA 2JH5D 2BM2A 2FIRH 4BAKB 1J14A 1GBEA 2ZFSA 1C1OA 1WTHD 2Y6TA 3B8JA 1P10A 3RXSA 3D23A 1C1VH 1SLUB 2F9UA 1TNHA 1P03A 4CH8B 2NU3E 2V6NA 1NU7B 2PGQB 1AHTH 1QHRB 5JB9S 1P9UA 2ZCHP 2ZDMA 1LHEH 4VGCC 1AO5A 1GG6C 3PLBA 4D8NA 2FOCA 3EE0B 2QXGA 1C1UH 3ZZ7A 1AB9B 3S9CA 2Z9IA 1C5MD 2GMTB 3UTUH 2ZHWH 1GGDB 1ID5H 4O3TA 1ZZZA 5ESBA 3SNBA 2G5NA 5CE1A 3MO9A 3B23B 4D7GA 4X2YA 2XC0A 1IQFA 1TPPA 5C20A 1P3EA 1YP9A 1HYLA 4Q80A 2NU1E 2IJOB 3HATH 3UOUA 3I29A 2A5KA 1SFQB 4Y71A 2G4UA 1HAIH 2XWAA 1O3HA 1MBQA 2ZGBH 3A8BA 3TJOA 4HTCH 1UTLM 2PTNA 3MYWA 2FOEA 5L6NH 1GBCA 5I25A 3EA7A 1BMNH 4GHQA 2CHAC 1FPCH 3MU0A 3TVJB 4DOQA 3V7TA 1W3CA 1QJ6B 1ETTH 3UPEA 1AUJA 1BUIA 2BDIA 1HCGA 1L1NA 1ZGIA 1YCPK 1H9HE 3PMAB 3KIDU 1HRTH 5T6FA 2CF9H 1QTFA 1SOZA 3ESTA 3TIUA 1NESE 4X1PU 1IAUA 4ZHLU 4E7RG 2PUXB 1DUEA 2EEKA 1FI8A 5F8ZA 2FWWA 1KIGH 3EA8A 1AE8H 3O8CA 4ISOA 4XFQA 4AFQA 1THPB 1T31A 1AZZA 1BHXB 3SHCH 3ZZ5A 1UVPA 4YLQH 4WMEA 2D1JA 4AX9H 1YLDA 4H6SB 3SW2B 6ESTA 4ZKNU 5FX6A 3C27B 1ZYOA 4IMQA 1ANDA 3KEEA 2BY9X 1A0HB 2ZGXH 3KNXA 1TFXA 5T3HA 1BTUA 2ZFFH 5EQRA 3RP2A 2B8OH 3V3MA 5C3NA 1C9TA 4ISLA 4NA8A 1NY22 4DIHH 1O3LA 1HAZB 1NRRH 3GY6A 1HDTH 4NWKA 1BQYA 3GY8A 1NROH 4GLYA 1LVYA 3BEIB 3LGWA 2IN2A 3QLPH 2P3TB 2CHAB 1MKXK 1C2HA 4XDEA 3U8TH 2A5AA 3QDZB 3P92A 1UTJA 4UFGH 1BBRK 1BJVA 2UUFB 3A88A 2BXTH 4MPWA 4IGDA 1ZSJA 1P3CA 1XM1A 2PKAA 1AKSA 1T8NA 1QQUA 1ZPCA 5JB8S 4I8KA 1O3OA 3QK1A 1C5QA 3K65B 1NFXA 3E91A 1SPJA 1D3TB 3BTEE 4MPXA 1OWJA 2W5EA 4B2AA 4B75A 3Q76A 1HIAA 1LKBA 4U30A 1AB9C 1NU9A 3LJOA 1A4WH 1G3EA 1YPHE 2ZTYA 3RC5A 3U98H 4IN2A 1SQTA 3QZRA 3MI4A 2OP9A 1YCPM 2Z9JA 2BOKA 1GI9B 2SGEE 1IQHA 4RN6A 4NA7A 1HJ8A 3PWBA 3SI3H 4CBOA 1DSUA 2WPKS 3TH3H 3HGPA 1T32A 1OP0A 1K22H 1UCYE 5GPIB 1QIXB 1CQQA 1HAVB 3PO1B 1O3EA 1MAYA 1YM0A 1FAXA 3TNSA 1SHHB 1T8OA 2PGBB 2FTMA 5DJ7A 4HI3A 4OGXA 3UY9A 3ATIA 3T29A 1UTQA 3STJA 3BV9B 3PB1E 1H1BA 1QFKH 1GCTC 4FUIA 2ZFRH 4AORA 4AB8A 3UR6A 2P94A 3TPIZ 4INKA 1O2OA 3LH1A 2AEIH 4Y8ZA 2HLCA 1S6HA 2H5CA 1UHBA 5ABWA 4Y8YA 3DUXH 3PROA 2H9HA 1FXYA 1G36A 1V2UT 3O8RA 3ZV9A 5EPYA 1Q31A 2VWMA 1PQAA 3RMOH 4TYDA 5LPEA 2R2WU 3M5NA 3SNAA 2KAIA 1LHGH 1MKWK 2QN5T 5FX5A 2CV3A 2PWXA 3BG4C 1DY8A 1AUTC 2RCEA 3M7QA 4WH8A 2HNTE 2BY6X 2BDBA 4XOJA 1WBGB 2SGFE 1D6RA 3KHVA 2FEQH 1ARCA 1MUEB 2QAAA 1M9UA 3BF6H 4KP0A 4ZHMU 2EI6A 1BMLA 3MO6A 1A0LA 1GPZA 2XBXA 1S83A 1O5FH 1FNIA 4NSVA 1BTHH 1V2LT 1AD8H 1SB1H 1V3XA 2PW8H 5FCKA 4BXWA 1QJ1B 4CRFA 5A09A 1GHVH 1GVZA 1HJ9A 3MNSA 3FFGA 4LZ4B 1AVWA 4ABEA 3GCNA 2TPIZ