2QXIA

High resolution structure of human kallikrein 7 in complex with suc-ala-ala-pro-phe-chloromethylketone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Kallikrein-7
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA02
1SPJA 1A5GH 1Z6JH 3SBKA 1H9IE 4E06H 3RMNH 1WUNH 1TPPA 3QWCH 1CA8B 1JIMA 1JMOH 4FU9A 1W12U 2BQ7B 1A4WH 1T4VH 2F91A 1PPGE 2OQUA 2GZ8A 2ZDLA 2ZU2A 1C5WB 5DP8A 3W95A 2ZDVH 3T25A 1Z8JB 3NPSA 3E0PB 1L0ZA 2D8WA 1BBRK 1TBQH 3SNCA 4WMEA 1MKWK 1ZPCA 2GZ9A 1W0YH 2TGTA 3MNBA 2FTMA 1QIXB 2W5EA 3F9HA 1SVPA 4FVDA 1UVOA 1ESTA 2BD9A 4DIHH 2PSYA 3VGCB 1INCA 2VIDA 1NROH 1MUEB 1Y3WA 2H5CA 1QTFA 3BN9A 4AG1A 2FEQH 5I25A 2BYAX 5DP9A 4X1SU 3TNTA 1NT1A 1SGTA 3F9EA 2CN0H 2ZDAH 4D76A 1OSSA 1MTWA 4TWYA 3S7KB 1MH0A 4I8HA 1C1RA 1O5BB 5EPNA 4ZKOU 1H9HE 1HAOH 3FP8E 2P16A 1QNJA 2JKHA 3P8FA 1PQ5A 5JBBS 2W7SA 1IQJA 1P9SA 2HOBA 5ESBA 3V13A 2XTTB 5T3HA 3UTUH 1UHBA 5GWZA 1PJPA 1C5TA 1O2YA 2AGGX 1DUEA 1FJSA 2ZEBA 1LVYA 1A46H 4GCHF 1C5QA 2FOCA 3FANA 5EQRA 1PYTD 4A7IB 2BD3A 1AMHA 1OPHB 1O3MA 1TPOA 4X2XA 1JXPA 3OSYA 1KLTA 2A5AA 2QYIA 2JH5D 1THSH 2QXJA 1YGCH 4IMZA 3RXVA 3W94A 3KHVA 1ESBA 3TLOA 1HIAB 3U98H 2OUAA 3ZZ8A 2VGCC 4NIXA 3TK5A 7LPRA 1P2NA 3P95A 2FPZA 1NPMA 1EAUA 1D9IA 3WY8A 1UTOA 1UCYE 3E90B 2W7UA 2ZKSA 1N8OB 1SQTA 2J92A 2D2DA 4UFGH 4Y8ZA 3VXEH 5J4SA 3U9AH 4CREA 2AS9A 6CHAB 2ZHQH 2VVVA 1ELCA 1BMMH 4MNVA 4WJG2 3A7VA 1S6FA 1S6HA 1H4WA 1DANH 1QRXA 1T7CA 1O3NA 3C27B 3EA9A 1TALA 1GJCB 2FWWA 4IW4E 3SI3H 1NFXA 4WXVA 4MVNA 4F4OC 3A82A 4DCDA 3TITA 3KQEA 2GX4A 4UD9H 1DE7H 1RIWB 1V3XA 2Z9KA 1T4UH 1UJ1A 2G4UA 1BDAA 2OTVA 2V0BA 1GBHA 5IDKA 2C8XB 2WYGA 1GPZA 3JZ2B 3EQ0H 3GCHC 4O9VA 4JZIA 3MI4A 4MQAA 4Y0YE 1OP0A 5C67A 2GGVB 4BAOB 2QIQA 1FIWA 1YPKH 4NFFA 2O8TA 2ZFSA 3ZVFA 4MPXA 3T28A 5DP4A 5HMAA 2CF8H 4NA9H 1YBWA 4RN6A 1DWEH 2CGAA 3M7QA 3A7TA 1GMCG 2F9UA 2AERH 2BM2A 1O2SA 3HGPA 2VH6A 1CHGA 1WV7H 1PQ8A 1QL8A 2IN2A 1BITA 1GI0A 3SJIA 2BDHA 2FOAA 3KCGH 3VGCC 3GY6A 2ZIQH 3BTKE 3CENA 4ABJA 4ZAEA 1FPHH 4Q7XA 1EASA 1QBOA 4JYVH 3VFEA 1C1QA 2EI8A 3EYDA 3LOXA 1RTFB 2C4FH 1IQNA 2ZCLP 5T6DA 1DWDH 1J16A 3D49H 3FVFB 1SL3A 3URCA 2B8OH 3S0NA 3N7OA 3BG4B 1ELTA 1NC6A 2FOHA 4YOJA 3EA7A 1GMHG 1HAPH 1ABIH 4A1TA 2RA3A 3B9FH 1DS2E 1UVTH 1KXDA 1UTMA 2PTNA 2ZU4A 3BIUH 1V2VT 1TGTA 1ZSKA 1B0FA 1GG6C 1ELVA 2CV3A 4CH2B 4AFUA 2FLBH 1MAYA 1O2PA 1P03A 4HTCH 4LOYH 2AMQA 3GOVB 4YOIA 1P12E 2ZO3H 3PO1B 3MH5A 1WQVH 1Z1JA 2XWBI 1TABE 3K6YA 2QAAA 4E7NA 3QTOH 1G2MA 3TJOA 1TGCA 4DG4A 1O37A 3MYWA 4RKOB 1HFDA 3GY4A 1P11E 4FUIA 5LPFA 1MAXA 1CT2E 1EAXA 1Y59T 1D3DB 4U01A 2SGEE 3MO3A 2ANKH 1A7SA 1AB9B 3TPIZ 2P3TB 4THNH 1DDJA 1NRPH 4BAHB 1LKBA 2FP7B 2XBWA 2GP9B 1P3EA 1UCYK 2FI5E 4IMQA 1ANCA 1TMTH 1G32B 2IPHA 1N8OC 2GT8A 2R9PA 3PWCA 2O8MA 3RU4E 2ZFQH 3DT0H 1BBRH 1GMCF 1MKWH 1P09A 2HWLB 3TIUA 4ABFA 2VJ1A 2IOTA 3RU4T 4X2VA 1HJ8A 4ABEA 6CHAC 4Y71A 4CHAB 2UUJB 1KTSB 4A92A 4A1VA 4RKJB 4INLA 4I32A 2R0LA 1C1MA 1XUGA 1QL7A 2AYWA 5HXFA 3UNRA 1O32A 3E3TA 1XVMA 3SQHE 5EGMA 1P04A 1V2NT 1K21H 2WPLS 1DWCH 5EXLA 1MU8B 1QL9A 1T32A 4AN7A 1RIWC 4BAMB 1TOCB 3RU4D 6GCHG 2UWPA 3URDA 3LT3A 3R0FA 1GBKA 2CHAB 4B2AA 1ZHRA 3TK9A 4BOHA 1PFXC 2ZPSA 3UUZA 1FDPA 3D23A 2J4IA 1Y5UT 2H2ZA 1A3EH 1GI8B 2BZ6H 3M5MA 3MU5A 1GHAG 5A09A 3U1JB 1DLKB 1WYKA 3GDVA 2H9HA 5C20A 5HM2A 1GHYH 2Z7FE 2F9OA 1F2SE 1C5SA 3LJOA 1O3HA 5LPEA 1ETSH 1Y3XA 4NA7A 1ETTH 3TGJE 1EJAA 4DJZB 4YT7H 2W26A 1QURH 1C5ZB 1W7XH 3RC5A 4NCYA 5CMXH 3E1XB 3UR9A 2O8UA 4JZ1A 1O2VA 2D1JA 1H1BA 2Z9JA 3ATLA 2VINA 4VGCB 1A3BH 1LO6A 1TX8A 3OY5U 4TYDA 1RTKA 1KYNA 1TNKA 2PV9B 1SGPE 1IAUA 4O97A 2G51A 5EW1H 2ESTE 3PTNA 1BTZA 1L4ZA 1LHDH 1AGJA 2VIVA 1KXCA 1H9LB 5DK1A 4Q2KA 2FOFA 2ZG0H 1SFQB 4CR9A 2BOHB 4JZEH 2J9NA 2FTLE 1EZUC 2C90B 1D3PB 3M3VA 3RXDA 4K2YA 1TOMH 1HJAC 1E37B 2A2XH 2SFAA 1C5YB 1S84A 4GSOA 1GCTB 5DG6A 3OY6U 4AZ2B 1O5AB 3GCNA 2H9EH 1GHXH 2ZGCA 1AE8H 3BSQA 3MOCA 4MNYA 3RXFA 2ZC9H 1FV9A 2R2WU 1LPGB 1VCQA 1DICA 1FQ3A 1BRUP 1SBWA 1P01A 1UO6A 2TGPZ 4Y8XA 2KAIA 3PMHB 2PGBB 1SQAA 5F8TA 3ZYDA 1P2MA 1MU6B 1LPKB 1CO7E 2GDDA 1CHOG 1PPHE 1P2QA 1TWXB 3TGKE 4XBCA 2BLVA 3RMOH 1GBTA 2FOMB 1TIOA 2ZHWH 2SGQE 4FUDA 1ID5H 1GHAF 1IQKA 2VWMA 1AB9C 2CF9H 4CRDA 1EATA 3E16B 2F9NA 3A87A 1GWAA 1KXAA 4ISNA 4I8KA 1G9IE 1EJMA 5JBAS 3LH1A 3BTFE 1TLDA 1QQ4A 3L3TA 2HRVA 3SHCH 1Z8IB 1GL0E 1HAVB 2QXHA 4UFEH 1FLEE 3RXBA 3SV8A 2G55A 2BD4A 2OXSA 1SG8B 2ZP0H 3R3GB 2ZNKH 4AFQA 3ZZ5A 2GCTB 4Y7AA 3SU6A 7GCHG 1UTJA 2ALVA 1J8AA 3BTWE 1P9UA 2BDBA 1YLCA 5L30H 1GBIA 2H9TH 3SO3A 1C4V2 1YPHE 1Z1IA 4AG2A 1BHXF 5T6GA 1AD8H 2AIQA 4GAWA 2OC8A 2Q1JA 4BTTB 3NZIA 2J38A 3GY3A 2FOGA 5BPEA 3M3SA 1LHCH 3VB3A 5FX5A 1O2IA 1YPJH 1IQEA 3E0NB 1P2JA 3MNXA 1FZZA 4B76A 1GI5A 2WINI 2B0FA 5HYOA 5E0HA 5K0HA 1FY5A 1SGRE 2P3FH 3BTEE 2QA9E 3ZV8A 3H5CB 3KF2A 1FY3A 3P92A 3RXLA 1DSUA 2QF0A 2OLGA 4D8NA 5J4QA 4IN1A 1O30A 1TBZH 3Q76A 1NZQH 2ANWA 3AASA 1OYTH 4WH6A 3RC6A 1FIZA 1GGDB 2VIPA 5TCCA 4CRFA 1Y3UA 1ZPBA 3UY9A 1EZXC 1GJ9B 1ZRKA 1QRWA 4KTCA 1GMDF 1KIGH 4YT6H 4ABHA 2BVSH 3FAOA 4ABAA 1YCPK 3BTME 1BMNH 1O35A 1SLWB 1LQDB 1SLXB 1O3FA 2C8ZB 1GJ6A 2HALA 1O2JA 2XRCA 1SHYA 4WMDA 3TVJB 3SV9A 1MQ6A 5F6MA 2FI3E 1K28D 4BTIB 4D7GA 3O8RA 1KTTB 1TGSZ 3H7OA 3KIDU 1TGBA 1NU7B 3ZZ9A 5FBIA 1BHXB 2HNTE 2JETB 3SV6A 2D26C 1O2NA 1GCTC 2HGTH 2Y82A 3GCHB 1AVWA 4KELA 2ZF0H 4XOJA 7GCHF 1DM4B 1ZMLA 4ZHLU 3UFAA 2G4TA 1SGNE 2BXTH 3BTDE 4X1PU 4YZUA 3ZZBA 1BCUH 3F68H 3SI4H 6ESTA 4KTSA 1XXDA 1O33A 3CP7A 2GT7A 1QB9A 1QB1A 1K22H 2AMDA 1BTYA 1A1RA 1JRTA 4ABIA 4CRCA 1K1JA 4RSPA 1W2KH 2Z3CA 4GUXA 1GHZA 3TJNA 1EAIA 1L2EA 3ENSB 1EP5A 4GPGA 1MBQA 4TY6A 3V12A 2LNCA 2OD3B 4NG9H 1TMUH 4LK4A 1O3PB 4FUBA 1AZ8A 2JH0D 4XE4A 1DX5M 3RLYH 3B23B 1SFIA 3BEIB 4ZXYH 1SQOA 2GDEH 3V7TA 4GLYA 3ATKA 5E2PA 1Q2WA 4BXWA 2SNVA 3LH3A 3ZVAA 5C1UA 3SUDA 2A0QB 2A4RA 1QBNA 1TFXA 2XBXA 1K2I1 4DW2U 4WH8A 1RRKA 1C1PA 2J34A 1O2TA 4CH8B 4ZMAH 2P95A 4B1TA 4CRGA 3BTHE 1K1PA 1UK2A 2EEKA 3KEEA 1XXFA 2EI6A 4K1EA 2QCYA 4X8SH 1O0DH 2BDYA 2XBYA 5K7RA 2GCTC 4BTUB 1GG6B 4FUHA 2CMYA 3RLWH 1OP2A 2XCFA 1A2CH 2AGIX 3T27A 1UK4A 4HZHA 2H6MA 1HCGA 3SORA 3VEQB 2P3UB 3RXEA 2C8YB 4PROA 5A8YA 3RXJA 5F8XA 2NU3E 1S0RA 2WPJS 2VWOA 1TPAE 4I31A 4AYVB 4FUGA 1AZZA 3TH2H 1NTPA 1C2GA 5TCAA 1ZLRA 3E8LA 3K9XB 4FUFA 5FCRA 1KXEA 1CE5A 2Z9LA 3TK6A 2BDCA 1GDQA 1V2UT 1IHSH 1X7AC 3M35A 2GKVE 3UPEA 5ETXA 5GXPA 4ZROA 2QXGA 1JRSA 1XUJA 8LPRA 1TA2A 3NCLA 2A5IA 1C5RA 4I8JA 1DFPA 1ANEA 5JB9S 1SOTA 2R3UA 4K1SA 4F49A 3B8JA 1O2ZA 3QZQA 1O3IA 3DUXH 2BTCE 1GGDC 1ZZZA 2VWNA 1Y8TA 1YYY1 5C1YA 3CS0A 4O3TA 3MO9A 1ZGIA 4DVAU 1WCZA 2XW9A 1E36B 4AFZA 1CGIE 1A61H 1JIRA 1GDUA 5EPYA 1O3OA 1OWIA 2GVFA 1O36A 1P02A 2ILNA 1Z8RA 1DT2A 6LPRA 4X1RU 2ZCHP 1BRBE 2JETC 1CGJE 7KMEH 4X0WU 3SGQE 4TWWA 1PPEE 4X6NA 3E91A 4ISHH 1LTOA 1C1UH 1SLUB 2ANYA 3JZ1B 1GI9B 1O5FH 3TJUA 3LJJA 1ACBE 1KLIH 4ZKNU 3A8CA 1O5CB 1MTUA 1N6XA 1UTPA 4NWLA 5GIBA 3UQVA 4A5TS 4MPVA 3VB4A 5EQSA 4YM9A 1G30B 5DP7A 1C1NA 1IQIA 1IQFA 3U8TH 2ZTXA 2XNIA 3VB6A 3SOSA 3TU7H 3P8GA 1V2LT 4ABGA 1BMLA 4R8TB 3S9BA 2UWLA 2ASUB 4XBDA 1J17T 2QXIA 2WV4A 1TA6A 1FPCH 3T29A 1ETRH 1ARCA 2UUYA 1L4DA 1TNJA 4WF8A 3EA8A 1LVOA 5FPSA 1XKBC 2OP9A 1TX7A 2FI4E 2BY8X 3U8OH 2G00A 1O2KA 4LZ4B 1F0RA 1FUJA 5A0AE 1XM1A 1GBAA 1DXWA 1RXPA 1G36A 3P70B 4ZKRU 2BLOA 1HV7A 4Q7ZA 2G8TA 2PSXA 1RD3B 1HIAA 1BTXA 1QHRB 3M5NA 5DO4H 2A4QA 2ZTZA 1KDQB 1QBVH 1V2PT 3LGUA 3HATH 3EGKH 2BY6X 1HJAB 2NWNA 1OX1A 1QA7A 3RXGA 1C2MA 1RJXB 1YCPH 2V35A 5AHGH 1G3EA 1V6DA 4X8TH 3Q00A 4YLUA 5E0JA 3EAJA 2B5TB 3I77A 1MZAA 2BD7A 3MNSA 1YF4A 2AGEX 1CBWC 3QX5H 2GZ7A 3ATWA 3TH4H 1O3JA 4ISOA 3ZZAA 2V6NA 3KQCA 4TPIZ 3STJA 3P6ZB 2BMGB 3RXIA 2GD4B 1EB2A 2M5TA 4JMYA 3SW2B 1LKAA 3E6PH 4FU8A 1YCPM 1CT0E 3BG8A 2Y5HA 3LIWA 1MD7A 4KKDA 1ZPZA 5DP3A 1GBCA 1SGEE 3OYPA 1FY4A 2Y81A 2RA0A 4I8LA 3SQEE 1C2KA 3RXSA 3PYHA 4NSVA 3PLBA 1BRCE 3MWIU 2WYJA 3RM2H 3HKIB 2R3YA 1GJAB 2ZECA 5HM9A 1O2OA 2P94A 2HPPH 3F6UH 3RMLH 4AFSA 1N1LA 3OTJE 3PB1E 1GBDA 3UNSA 1GDNA 1BT7A 3ESTA 4K60A 1V2TT 2VU8E 4Y79A 1ZTLA 3PM3A 5FCKA 3ELAH 4H6TA 2FOEA 2A2QH 1F5RA 2FZZA 1J15A 3MTYA 1BB0B 2F9PA 3RXMA 2B9LA 3UWIA 3GCOA 1UVPA 1O3EA 4BANB 1CA0B 1T8OA 5FAHA 4J2YB 1O3AA 1GHVH 1SGYE 1TE0A 1PPFE 3A85A 2WUCA 4Y76A 5C5NA 1Y5BT 1DUAA 5A2MH 3DFJA 1L1JA 1C9PA 1GJBB 4B71A 2OBQA 4B75A 1W13U 1F7ZA 1ZSLA 4IBLH 2XWAA 3LC3A 1GI4A 4Y8YA 2BOKA 1O2LA 1IQMA 1QJ6B 1FN8A 3FZZA 1O2QA 3RXQA 1AKSA 1FI8A 1UTKA 3VB7A 2LPRA 1P3CA 5FBEA 4Z0KA 4FVBA 5A8XA 1AWHB 1GI7B 2P59A 3QLPH 2UWOA 3T2NA 1LPZB 1DXPA 1HAXB 1OWHA 3A8AA 3KQBA 4INHA 3ZZCA 5GCHF 3S9CA 1O2HA 2Q6GA 3RM0H 4JYUH 4QT8C 3PTBA 1WOFA 1RFNA 1SLVB 2DUCA 2STBE 1HAHH 1O31A 2NU1E 4Y7BA 1S0QA 1UTQA 4MTBA 1MCTA 1AO5A 1RTLA 2BXUH 1VCWA 3ITIA 4OS4A 1C4Y2 4JK6A 3Q77A 3A84A 1EKBB 1GJDB 2ZQ1A 1F5KU 1OKXA 1VJAU 3MH6A 1K9OE 2PUQH 4AGKA 4GVUA 3PMAB 1QRZA 2BD8A 3NWUA 1IQHA 1PPZA 1OYQA 2RCEA 3FZDA 1A0JA 3ZVGA 1C9TA 2Y80A 1C2FA 1LVMA 1EOJA 2HPQH 1ARBA 3ZZ6A 4JZDH 1ELAA 1BA8B 1O2GH 3MFJA 1LDTT 1A0LA 2PKAB 1AU8A 1EPTB 1O3GA 4XBBA 4Y11E 1AWFH 1YPLH 1C2HA 2FXRA 2FS8A 1GVZA 3V0XA 4B2BA 5JPMH 2DE8A 2A5KA 3SUGA 2WV5A 1NU9A 2VNTA 4X2WA 1AHTH 2ZFRH 5PTPA 4BAKB 4IC5A 1ZJKA 1IOEA 3RXPA 2P8OB 1LQEA 1P05A 1PYTC 4NA8A 3GY8A 3NUMA 3P17H 3BEFB 5L2YH 1BQYA 1V2JT 3L33A 3K6ZA 3GY2A 1ZJDA 1CVWH 2FX6A 3GISB 3D65E 1GMDG 1SSXA 2Y7ZA 2SNWA 4K8YA 3ZZ7A 4DY7B 1WTHD 1GJ8B 2V3OH 4MDSA 1HBTH 4X2YA 2HLCA 2ZQ2A 1CSOE 5GPIB 2K1QA 4MPWA 2ZGHA 1DY8A 4I33A 1HJ9A 2PFEA 4XDEA 2NU0E 3SJ8A 5LPRA 3SJ9A 5JBTA 2ZPQA 1V2KT 1BBRE 4KTUA 4AGJA 2XC4A 1VITF 2FLRH 1GHBF 1Q3XA 2FESH 4IN2A 3MHWU 3AAVA 1NM6A 5EXMA 2Y7XA 2ZGXH 1LCYA 4OS6A 2OQ5A 1AIXH 1PQAA 5CHAB 2Q6DA 2O9QA 1XUHA 2J2UA 5E0GA 1W7GH 1G3CA 1CA0C 1O2MA 1XVOA 3QK1A 1A5HA 1FAKH 1ZGVA 2BVRH 3K65B 1ORFA 3SU4A 3VXFH 2FO9A 1C5PA 1K1IA 1C2DA 3NK8A 1JWTA 1LHFH 1F5LA 2Z9IA 3QUMP 1HNEE 5H4IB 2J95A 3I78A 1NRRH 1QB6A 4Q80A 1L1NA 2ZU5A 8KME2 4H42U 3RC4A 3FFGA 4BNRA 4CRBA 1UMAH 1AE5A 1P2OA 4OS2A 1FXYA 1C2EA 1SGCA 2GTBA 1YKTA 3M5LA 5A8ZA 1C1SA 1QY6A 4B73A 4CBNA 1DSTA 3QGJA 3BIVH 1DVAH 4K5ZA 3SN8A 1MBMA 4JYTA 1HDTH 1O2UA 2FS9A 1EP6A 3I29A 1T8MA 4I7YH 9ESTA 3S9AA 2GV7A 2BY5X 1HPGA 1ZR0A 3KNXA 3M5OA 1NRQH 4YO9A 1ZTKA 3IWMA 3AVZA 1P10A 2BDGA 1K1LA 1IQLA 5A0CA 1GJ7B 2XC0A 2C3SA 2FIRH 4NFEA 2XYAA 1FNIA 1OWJA 3GY7A 3PLPA 2BY7X 4ASHA 1GL1A 3IG6B 5L2ZH 1MTNC 5AFYH 2G52A 3RXRA 5AVDA 5F8ZA 1NRSH 2R2MB 5ABWA 1MD8A 4O3UA 4FUEA 3MU8A 1T8LA 1ZHMA 1V2RT 3IITA 3RXCA 1TGNA 1NY22 1XX9A 1P57B 5G4BA 1WTGH 4AB8A 1FONA 2YNAA 1GJ5H 4UEHH 3P8OA 1BZXE 1UCYH 1XMNB 5E8EH 3MH4A 3DFLA 1GBMA 4KP0A 5BRRE 1HRTH 3KGPA 1IHTH 3SU1A 3SZNA 3M7TA 4OGXA 4WMFA 1TRYA 1EAWA 4AYYB 4D9QA 3LC5A 1C1TA 4X8VH 5HGGA 3ZVCA 1EQ9A 1TMBH 1UHBB 1VR1H 1B0EA 1TQ0B 2WUBA 1QCPA 2G5NA 2W3KA 2AMPA 2TRMA 1XUIA 1EPTC 8GCHF 3Q3YA 2G81E 4NIVA 3SNDA 5EXNA 2BD5A 1YC0A 3HK3B 4AORA 1EJNA 3LGVA 1U6QA 3RXHA 3O8DA 2H5DA 1L1GA 3A80A 3CS7A 1QJ1B 1O38A 1WAYB 1EUFA 2P8OC 1EOLA 1O2RA 2ZGBH 4GHQA 3KN2A 2A7JA 3SU0A 1XUFA 2BB4A 1HAGE 1YPEH 5CE1A 1GVLA 2PHBA 2BX3A 1CQQA 1ZRBA 1GI1A 1HXEH 5I46H 2VIWA 3UIRA 2FDAA 1YP9A 3DD2H 3MH7A 2ODYB 4U30A 3SNBA 4ZXXH 2DE9A 1QR3E 1E34B 4X6PA 1OP8A 4XSKU 1GCDA 1SB1H 1D3QB 1W0ZU 2UUFB 1C2JA 1ZMNA 2VWLA 1TQ7B 2SGDE 1K1OA 2FMJA 2BDAA 3UREA 2CXVA 4ISLA 3SHAH 1CGHA 5C2ZA 2GV6A 1B5GH 5CHAC 2ZU1A 1C5XB 3A7YA 2VIOA 2NU2E 4X6MA 1ZHPA 5C5OA 1ELFA 4K1TA 1C1WH 1ABJH 4Y0ZE 3BTTE 1Z8GA 3A7WA 1CBWB 2NU4E 2ZFPH 1OWKA 2WPHS 2BVXH 1BMAA 3ODFA 1LMWB 1NFYA 1BTHH 1W8BH 2ZPRA 3ATMA 1Y3YA 4TPYA 2GCHF 3KL6A 1CU1A 1P8VC 2PWXA 9LPRA 3GDSA 4UONA 4MG3A 5EOKA 2B7DH 4NSYA 1BTWA 1W14U 2F9BH 3A81A 1UVUH 2FX4A 3PLKA 2A7CA 3MNCA 3GCTG 1F92A 1MZDA 2EI7A 2ZFFH 1TNHA 1C1OA 1W10U 4LXBH 2HNTF 5EU8A 4A6LA 1RGQA 3RDZA 4X8UH 1PQ7A 2TIOA 3A7XA 3ZVBA 2ZWLH 3VB5A 3LDXH 3BF6H 1N6YA 2GMTB 1FY8E 2SGAA 2ZHEH 3BV9B 1O5EH 2YNBA 1K1MA 5EODA 3ZV9A 1TPSA 2TBSA 4JZFH 3FP6E 1AUJA 3LGTA 3O8BA 3ZVEA 2OC1A 2EC9H 1UTLM 5B6OA 3QN7A 2TGAA 2QF3A 3U1IB 1D6RA 2V3HH 4JK5A 1BJUA 3ODDA 1IQGA 3P8NA 1MTVA 4HGCA 4H4FA 3M61U 3M3TA 1DOJA 1MKXK 2OC7A 1NRNH 2Z9GA 1UTNA 5FXLA 4LZ1H 2FYQA 3RXTA 4Y6DA 1LHGH 1KXBA 1C4U2 1ANBA 2IJOB 1J14A 1HUTH 1V2QT 1C2IA 3A88A 3TGIE 1YLDA 2BQ6B 4E7RG 2YOLA 2ZI2H 1QGFA 3SNAA 2QGRA 4NIWA 2XXLA 4CRAA 1SHHB 1V2ST 3ZYEA 3A86A 1RS0A 3A7ZA 4K69A 1Z71A 3STIA 3D62A 4R0IA 1P06A 2SGPE 1VITH 2PKSC 1ELEE 4MPUA 2BLWA 2ZCKP 4AOQA 5FX6A 2ZGJA 4JCNA 1LVBA 1HAIH 2O8WA 3SGBE 4DT7B 5C1XA 3GDUA 1TNLA 2VIQA 1YM0A 1BTUA 1XUKA 4WXIA 1OWDA 4CR5A 1H8IH 4WWYA 1KY9A 3PWBA 1ZYOA 3SU3A 1OWEA 2Q6FA 1WU1A 1W11U 3C1KA 3GCTF 5FPYA 1AFQB 2VVCA 1O2WA 2QC2A 1NS3A 1EZQA 1VZQH 5LGOA 1O39A 2ULLA 1O3BA 2F83A 4ZHAA 2XC5A 1YPGH 3UQOA 3RXUA 3BEUA 1QA0A 5E2OA 5DPAA 1GBLA 2BDIA 1WSSH 1EXFA 3DA9B 4BXSA 5TJXA 2ZDNA 4AB9A 5IYTA 1TNIA 1V2WT 2ODPA 2J94A 4YTAA 2ZFTA 1GI6A 4NIYA 1AKSB 1TB6H 4FU7A 1Y3VA 2QN5T 4X1QU 4ZKSU 3UR6A 4U2WA 3SV7A 1ELBA 1WBGB 5GCHG 4UDWH 3QTVH 1AUTC 1AVGH 2VH0A 1FMGA 1BRAA 4HI3A 1O3CA 1C5OH 4UFFH 5AF9H 1FY1A 2EA3A 4ABDA 1TRNA 1S5SA 1VGCB 5JB8S 3SGAE 5EW2H 1ELDE 1THPB 2BHGA 2O8LA 5F03A 3S7HB 3MU4A 1C1VH 1DITH 1XKAC 1P2IA 2W3IA 1VCPA 1YPHC 2TPIZ 4NZLA 1HYLA 1SGFG 4NZQA 1C5LH 3ZZ3A 1DPOA 3M37A 2GMTC 2HVXA 1G2LA 5DP6A 1HXFH 1O3KA 4OGYA 3S69A 2OBOA 1QJ7B 2BD2A 1GI3A 5EQQA 1D3TB 3BTQE 5JBCS 3F1SB 2ZU3A 1ELGA 2OC0A 1P2KA 1HB0B 4XFQA 3U69H 5L6NH 1TNGA 1PPCE 1BJVA 1GBJA 1VJ9U 3T26A 3QZRA 3SJKA 3QO6A 1KSNA 1HAZB 1DWBH 4B2CA 1HGTH 2OCVB 2BY9X 1OXGA 1MCVA 2F3CE 2A7HA 1ZMJA 2KAIB 1KDQA 1G3BA 4FXGH 1C5UA 1B7XB 3SU2A 1OOKB 3AAUA 3T5FH 3T62A 1GI2A 2I6QA 4BAQB 3TNSA 3RXAA 1O5GH 1SMFE 3AW0A 4ABBA 1AI8H 1JBUH 1JOUB 1GMHF 5DKMA 4MNXA 2TGDA 1SI5H 1VITG 1GHBG 4NWKA 4X6OA 2HNTC 3QGNB 4X1NU 4B74A 1G37A 2PUXB 1D6WA 1GVKB 2ANMH 1D4PB 1MTNB 1TYNA 1ZOMA 4ESTE 3GYMA 4H6SB 3SUFA 2A4GA 2ALPA 1WQSA 1SR5C 3VPKA 1HLTH 3ZVDA 1NESE 1AFQC 2AH4X 1GBBA 3F9GA 2ODQA 1CT4E 2I6SA 1TONA 5FPTA 3SUEA 2C8WB 1O3LA 4UFDH 3FP7E 4DIIH 4DGJA 1YPMH 3DHKH 3L6PA 1UK3A 4D7FA 4ZH8A 2F9VA 1QFKH 3KQDA 2FM2A 2OINA 3RXOA 1C5VA 1M9UA 2BQWB 2STAE 4M7GA 1G3DA 2BX4A 3LGYA 5FHTA 1S81A 2ZHDA 4KGAA 1Z6EA 1GBEA 4DURA 3RP2A 3TJVA 2A1DB 2Y5GA 1ZTJA 1W3CA 3BG4C 4ZHMU 1BUIA 3H7TA 3PROA 2H1UA 1EZSC 1F0UA 1MKXH 1MQ5A 3F9FA 3LKWA 2JH6D 1Q31A 1EX3A 1NFWA 3ZZDA 2Z3EA 2WPMS 4HFPB 1O2XA 1VGCC 2ZA5A 4SGBE 1C5NH 4SGAE 2UUKB 2A31A 3PO1C 3PMBB 1J9CH 3SJOA 1FAXA 2AEIH 3V3MA 3TH3H 1K1NA 2P93A 1T8NA 5T6FA 5A0BA 1ZSJA 3M36A 5DGJA 3PV4A 6GCHF 1SGQE 4IS5A 2XBVA 3ZZ4A 4OS5A 2G5VA 1O34A 2THFB 3LGWA 2CJIA 3MU0A 1UVSH 3Q3KA 2XCNA 4FUCA 1Z7KA 2Z3DA 1TRMA 1BOQA 1S85A 3HPTB 2R0KA 1A5IA 4INKA 3A89A 3A8DA 4IC6A 2AIPA 2C93B 2FODA 1BIOA 3PMJA 4AX9H 5AFZH 8GCHG 3QDZB 7ESTE 1V2MT 2A32A 3O8CA 1C2LA 3AW1A 1H8DH 3M7UA 4NGAH 1TBRH 1AFEH 5C3NA 3RUOA 2FOBA 2SGFE 4CHAC 4O03A 3BTGE 4OS7A 4Y10E 3UWJH 1V2OT 3GYLB 4ISIH 1DLEA 4K3JA 2VB0A 1THRH 1GJ4H 3RMMH 5LH8A 2PW8H 1KLJH 1BTPA 2ZHFH 3LU9B 4D9RA 1HAYB 2AFQB 3UNQA 4YOGA 3ATIA 1ANDA 5DP5A 3NKKA 2A45B 2ZTYA 1AQ7A 2PTCE 3EE0B 4WVPE 2A4OA 4YESB 4OS1A 1SC8U 1E38B 5SGAE 4YLQH 2Z94A 1AVXA 4UE7H 2VVUA 3SNEA 1Y5AT 1MMJN 1E35B 2CHAC 1ESAA 2ZDMA 4FUJA 8ESTE 2PKAA 4IGDA 3OU0A 1EPTA 5EG4A 3UOUA 1NO9H 3LGIA 2BZAA 4K8BA 1S83A 1O5DH 1C5MD 2PGQB 3A83A 1A0HB 5ESTE 2Y6TA 3UOPA 1GBFA 2QV1A 2ZZUH 3MMGA 4I8GA 4GHTA 1EB1H 1TAWA 4Q7YA 3SV2H 3K2UA 2VGCB 2PLXA 5GDSH 1DY9A 3U8RH 2RDLA 3OX7U 4U32A 3EDXB 1F0TA 3LPRA 1CHOF 1T31A 2RG3A 4J1YA 1NFUA 2ZDKA 3HKJB 2PR3A 2QY0B 3MO6A 2WPIS 4E05H 1E0FD 3G01A 4VGCC 5JDUB 4CBOA 1AY6H 1KXFA 1P0SH 2GCHG 5GJ4B 1HAVA 1PPBH 4A1XA 3GY5A 1SGDE 1SOZA 5DJ7A 3MU1A 1SGFA 4DOQA 1AN1E 3GICB 1GHWH 1LHEH 1NN6A 1OS8A 1TX6A 4MLFB 3SU5A 3A8BA 4ZUHA 2BLQA 3Q3XA 4GCHG 2Z6BD 4WY3A 3RXKA 1S82A 1O3DA 3NXPA 4TY7A 3LONA 3HGNA 2FYRA 2Y5FA 1MTSA 1QQUA 2WPKS 1FN6A 4MNWA 4Z6AH 1F0SA 2PKSB 1SGIB 3HK6B 5JYIA
chains in the Genus database with same CATH superfamily
1SPJA 3GS9A 1A5GH 1Z6JH 3SBKA 1H9IE 4E06H 3RMNH 1WUNH 2LELA 1TPPA 3QWCH 1CA8B 1JIMA 1JMOH 4FU9A 1W12U 2BQ7B 5KGOA 1A4WH 1T4VH 2F91A 1PPGE 2OQUA 2GZ8A 2ZDLA 2ZU2A 1C5WB 5DP8A 3W95A 2ZDVH 3T25A 1Z8JB 3NPSA 3E0PB 1L0ZA 2D8WA 1BBRK 1TBQH 3SNCA 4WMEA 1MKWK 1ZPCA 2GZ9A 1W0YH 2TGTA 3MNBA 2FTMA 1QIXB 2W5EA 3F9HA 1SVPA 4FVDA 1UVOA 1ESTA 2BD9A 4DIHH 2PSYA 3VGCB 1INCA 2VIDA 1NROH 1MUEB 1Y3WA 2H5CA 1QTFA 3BN9A 4AG1A 2FEQH 5I25A 2BYAX 5DP9A 4X1SU 3TNTA 1NT1A 1SGTA 3F9EA 2CN0H 2ZDAH 4D76A 1OSSA 1MTWA 5CHBA 4TWYA 3S7KB 1MH0A 3WWFA 4I8HA 3FOAA 1C1RA 1O5BB 5EPNA 4ZKOU 1H9HE 1HAOH 3FP8E 2P16A 1QNJA 2JKHA 3P8FA 1PQ5A 5JBBS 2W7SA 1IQJA 1P9SA 2HOBA 5ESBA 3V13A 3OE7D 2XTTB 5T3HA 2XOKD 4ACAA 3UTUH 1UHBA 5GWZA 1PJPA 1C5TA 1O2YA 2AGGX 1DUEA 1FJSA 2ZEBA 1LVYA 3SZEA 1A46H 4GCHF 1C5QA 2FOCA 3FANA 5EQRA 1PYTD 4A7IB 2BD3A 1W0JD 1AMHA 1OPHB 1O3MA 1TPOA 4X2XA 1JXPA 3OSYA 1KLTA 2A5AA 2QYIA 3PRDA 2JH5D 1THSH 2QXJA 1YGCH 4IMZA 3RXVA 3W94A 3KHVA 1ESBA 3TLOA 1HIAB 3U98H 2OUAA 3ZZ8A 5KEDA 2VGCC 4NIXA 3TK5A 7LPRA 1P2NA 3P95A 2FPZA 1NPMA 1EAUA 1D9IA 3WY8A 1UTOA 1UCYE 3E90B 2WHXA 2W7UA 2ZKSA 1N8OB 1SQTA 2J92A 2D2DA 4UFGH 4Y8ZA 3VXEH 5J4SA 3U9AH 2KM0A 4CREA 2AS9A 2WV9A 6CHAB 2ZHQH 2VVVA 1ELCA 1BMMH 4MNVA 4WJG2 3A7VA 1S6FA 1S6HA 1H4WA 3DSGA 1DANH 1QRXA 1T7CA 1O3NA 3C27B 2QF5A 3EA9A 1TALA 1GJCB 2FWWA 4IW4E 4TSFD 3SI3H 1NFXA 4WXVA 4MVNA 4F4OC 3A82A 4DCDA 3TITA 3KQEA 2GX4A 4UD9H 1DE7H 1RIWB 1V3XA 2Z9KA 1T4UH 1UJ1A 2G4UA 1BDAA 2OTVA 2V0BA 1GBHA 5IDKA 2C8XB 2WYGA 1GPZA 3JZ2B 3EQ0H 3GCHC 4O9VA 4JZIA 3MI4A 4MQAA 4Y0YE 1OP0A 5C67A 2GGVB 4BAOB 2QIQA 1FIWA 1YPKH 4NFFA 2O8TA 2ZFSA 3ZVFA 4MPXA 3T28A 5DP4A 5HMAA 2CF8H 5EJZA 4NA9H 1YBWA 4RN6A 1DWEH 2CGAA 5C0UA 3M7QA 3A7TA 1GMCG 2F9UA 2AERH 2BM2A 1O2SA 3HGPA 2VH6A 1CHGA 1WV7H 1PQ8A 1QL8A 2IN2A 1BITA 1GI0A 3SJIA 2BDHA 2FOAA 3KCGH 3DCLA 3VGCC 3GY6A 2ZIQH 3BTKE 3CENA 4ABJA 4ZAEA 4OM9A 1FPHH 4Q7XA 1EASA 1QBOA 4JYVH 3VFEA 1C1QA 2EI8A 3EYDA 3LOXA 1RTFB 2C4FH 1IQNA 2ZCLP 5T6DA 1DWDH 1J16A 3D49H 3FVFB 1SL3A 3N99A 3URCA 2B8OH 3S0NA 3N7OA 3BG4B 1ELTA 1NC6A 2FOHA 4YOJA 3EA7A 1GMHG 1HAPH 1ABIH 4RT1A 4A1TA 2RA3A 3B9FH 1E79D 1DS2E 1UVTH 1KXDA 1UTMA 2PTNA 2ZU4A 3BIUH 1V2VT 1TGTA 1ZSKA 1B0FA 1GG6C 1ELVA 2CV3A 4CH2B 4AFUA 2FLBH 1MAYA 1O2PA 1P03A 4HTCH 4LOYH 2AMQA 3GOVB 4YOIA 1P12E 2ZO3H 3PO1B 3MH5A 1WQVH 1Z1JA 2XWBI 1TABE 3K6YA 2QAAA 4E7NA 3QTOH 1G2MA 3TJOA 1TGCA 4DG4A 1O37A 3MYWA 4RKOB 1HFDA 3EE7A 3GY4A 1P11E 2JIZD 4FUIA 5LPFA 1MAXA 1CT2E 1EAXA 1Y59T 1D3DB 4U01A 2SGEE 3MO3A 2KCAA 2ANKH 1A7SA 1AB9B 3TPIZ 2P3TB 4THNH 1DDJA 1NRPH 4BAHB 1LKBA 2FP7B 2XBWA 2GP9B 1P3EA 1UCYK 2FI5E 4IMQA 1ANCA 1TMTH 1G32B 2IPHA 1N8OC 2GT8A 2KR7A 2R9PA 2O8MA 3PWCA 3RU4E 2ZFQH 3DT0H 1BBRH 1GMCF 1MKWH 1P09A 2HWLB 3TIUA 4ABFA 2VJ1A 2IOTA 3RU4T 4X2VA 1HJ8A 4ABEA 6CHAC 4Y71A 4CHAB 2UUJB 1KTSB 3NRLA 4A92A 4A1VA 4RKJB 1H8HD 4INLA 4I32A 2R0LA 1C1MA 1XUGA 1QL7A 2AYWA 5HXFA 3UNRA 1O32A 3E3TA 1XVMA 3SQHE 5EGMA 1P04A 1V2NT 1K21H 2WPLS 1DWCH 5EXLA 1MU8B 1QL9A 1T32A 4AN7A 1RIWC 4BAMB 1TOCB 3RU4D 6GCHG 2UWPA 3URDA 3LT3A 3R0FA 1GBKA 2CHAB 5KECA 4B2AA 1ZHRA 3TK9A 4BOHA 1PFXC 2ZPSA 3UUZA 1FDPA 3D23A 2J4IA 1Y5UT 2H2ZA 1A3EH 1GI8B 2BZ6H 3M5MA 3MU5A 1GHAG 5A09A 3U1JB 1DLKB 1WYKA 3GDVA 2H9HA 5C20A 5HM2A 1GHYH 2Z7FE 2F9OA 1F2SE 1C5SA 3LJOA 1O3HA 5LPEA 1ETSH 1Y3XA 4NA7A 1ETTH 3TGJE 1EJAA 4DJZB 4YT7H 2W26A 1QURH 1C5ZB 1W7XH 3RC5A 4NCYA 5CMXH 3E1XB 3UR9A 2O8UA 4JZ1A 1O2VA 2D1JA 1H1BA 2JDID 2Z9JA 3ATLA 2VINA 4VGCB 1A3BH 1LO6A 1TX8A 3OY5U 4TYDA 1RTKA 1KYNA 1TNKA 2PV9B 1SGPE 1IAUA 4O97A 2G51A 5EW1H 2ESTE 3PTNA 1BTZA 1L4ZA 1LHDH 1AGJA 2VIVA 1KXCA 1H9LB 5DK1A 4Q2KA 2FOFA 2ZG0H 1SFQB 4CR9A 2BOHB 4JZEH 2J9NA 2FTLE 1EZUC 2C90B 1D3PB 3M3VA 3RXDA 4K2YA 1TOMH 1HJAC 3OTPA 1E37B 2A2XH 2SFAA 1C5YB 1S84A 4GSOA 1GCTB 5DG6A 3KYGA 3OY6U 5T1VA 1O5AB 4AZ2B 2J98A 3GCNA 2H9EH 1GHXH 2ZGCA 1AE8H 3BSQA 3MOCA 4MNYA 3RXFA 2ZC9H 1FV9A 2R2WU 1LPGB 1VCQA 1DICA 1FQ3A 1BRUP 1SBWA 1P01A 1UO6A 2TGPZ 2HVYB 4Y8XA 2KAIA 3PMHB 2PGBB 1SQAA 5F8TA 3ZYDA 1YY3A 2YMSB 1P2MA 1MU6B 1LPKB 1CO7E 2GDDA 1CHOG 1PPHE 1P2QA 1TWXB 4FOUC 3TGKE 4XBCA 2BLVA 3RMOH 1GBTA 2FOMB 1TIOA 2ZHWH 2SGQE 4FUDA 1ID5H 1GHAF 1IQKA 2VWMA 1AB9C 2CF9H 4CRDA 1EATA 3E16B 2F9NA 3A87A 1GWAA 1KXAA 4ISNA 4I8KA 1G9IE 1EJMA 5JBAS 3LH1A 3SYJA 3BTFE 1TLDA 1W0KD 3VG8A 1QQ4A 3L3TA 2HRVA 3SHCH 1Z8IB 1GL0E 1HAVB 2QXHA 4UFEH 1FLEE 3RXBA 3SV8A 2G55A 2BD4A 2OXSA 1SG8B 2ZP0H 3R3GB 2ZNKH 4AFQA 3ZZ5A 2GCTB 4Y7AA 3SU6A 7GCHG 1UTJA 2ALVA 1J8AA 3BTWE 3DSPA 2KCYA 1P9UA 2BDBA 1YLCA 5L30H 1GBIA 2H9TH 3SO3A 1C4V2 1YPHE 1Z1IA 4AG2A 1BHXF 5T6GA 1AD8H 2AIQA 4GAWA 2OC8A 2Q1JA 4BTTB 3NZIA 2J38A 3GY3A 2FOGA 5BPEA 3M3SA 1LHCH 3VB3A 5FX5A 1O2IA 1YPJH 1IQEA 3E0NB 1P2JA 3MNXA 1FZZA 3N7EA 4B76A 1GI5A 2WINI 2B0FA 5HYOA 5E0HA 5K0HA 1FY5A 1SGRE 2P3FH 3BTEE 2QA9E 3ZV8A 3H5CB 3KF2A 1FY3A 3P92A 3RXLA 2L74A 1DSUA 2QF0A 2OLGA 4D8NA 5J4QA 4IN1A 1O30A 1TBZH 3Q76A 1NZQH 2ANWA 3AASA 1OYTH 4WH6A 3RC6A 1FIZA 1GGDB 2VIPA 5TCCA 4CRFA 1Y3UA 1ZPBA 3UY9A 1EZXC 1GJ9B 1ZRKA 1QRWA 3H09A 4KTCA 1GMDF 1KIGH 4YT6H 4ABHA 2BVSH 4I86A 3FAOA 4ABAA 1YCPK 3BTME 1BMNH 1O35A 2L6OA 1SLWB 1LQDB 1SLXB 1O3FA 2C8ZB 1GJ6A 2HALA 1YWUA 1O2JA 2XRCA 1SHYA 4WMDA 3TVJB 3SV9A 1MQ6A 5F6MA 2FI3E 1K28D 4BTIB 4D7GA 3O8RA 1KTTB 1TGSZ 3H7OA 3KIDU 1TGBA 4F48B 1NU7B 3ZZ9A 5FBIA 1BHXB 2HNTE 2JETB 3SV6A 2D26C 1O2NA 1GCTC 2HGTH 2Y82A 2EQNA 3GCHB 1AVWA 4KELA 2ZF0H 2QE7D 4XOJA 7GCHF 1DM4B 1ZMLA 4ZHLU 3UFAA 2G4TA 1SGNE 2BXTH 3BTDE 4X1PU 4YZUA 3ZZBA 1BCUH 3F68H 3SI4H 6ESTA 4KTSA 1XXDA 1O33A 3CP7A 2GT7A 2YMSC 1QB9A 1QB1A 1K22H 2AMDA 1BTYA 1A1RA 1JRTA 4ABIA 4CRCA 1K1JA 4RSPA 3UB0A 1W2KH 2Z3CA 4GUXA 1GHZA 3TJNA 1EAIA 1L2EA 3ENSB 1EP5A 4GPGA 1MBQA 4TY6A 3V12A 2LNCA 2OD3B 4NG9H 1TMUH 4LK4A 1O3PB 4FUBA 1AZ8A 2JH0D 4XE4A 1DX5M 3RLYH 3B23B 1SFIA 3BEIB 4ZXYH 1SQOA 2GDEH 3V7TA 4GLYA 3ATKA 5E2PA 1Q2WA 4BXWA 2SNVA 3LH3A 3FO8D 3ZVAA 5C1UA 3SUDA 2A0QB 2A4RA 1QBNA 1TFXA 2XBXA 1K2I1 4DW2U 4WH8A 1RRKA 1C1PA 2J34A 1O2TA 4CH8B 4XRNA 3AK5A 4ZMAH 2OK5A 2P95A 4B1TA 4CRGA 3BTHE 1K1PA 1UK2A 2EEKA 3KEEA 1XXFA 2EI6A 4K1EA 2QCYA 4X8SH 1O0DH 2BDYA 2XBYA 5K7RA 2WSSD 2GCTC 2KFWA 4BTUB 1GG6B 4FUHA 2CMYA 3RLWH 1OP2A 2XCFA 1A2CH 2AGIX 3T27A 1UK4A 4HZHA 2H6MA 1HCGA 3SORA 3VEQB 2P3UB 3RXEA 2C8YB 4PROA 5A8YA 3RXJA 5F8XA 2NU3E 1S0RA 2WPJS 5HKKD 2VWOA 1TPAE 4I31A 1BMFD 4AYVB 4FUGA 1AZZA 3TH2H 1NTPA 1C2GA 5TCAA 1ZLRA 3E8LA 3K9XB 4FUFA 5FCRA 1KXEA 1CE5A 2RDEA 2Z9LA 3TK6A 2BDCA 1GDQA 1V2UT 1IHSH 1X7AC 3M35A 2GKVE 3UPEA 5ETXA 5GXPA 4ZROA 4HG6A 2QXGA 1JRSA 1XUJA 8LPRA 1TA2A 3NCLA 2A5IA 1C5RA 4I8JA 1DFPA 1ANEA 5JB9S 1SOTA 2R3UA 4K1SA 4F49A 3B8JA 1O2ZA 3QZQA 1O3IA 3DUXH 2BTCE 1GGDC 1ZZZA 2VWNA 1Y8TA 1YYY1 5C1YA 3CS0A 4O3TA 2F4LA 2RFKC 3ZIAD 3MO9A 1ZGIA 4DVAU 1WCZA 2XW9A 1E36B 4AFZA 1CGIE 1A61H 1JIRA 1GDUA 3FKSD 5EPYA 1O3OA 1OWIA 2GVFA 1O36A 1P02A 2ILNA 1Z8RA 1DT2A 6LPRA 4X1RU 2VBCA 2ZCHP 1BRBE 2JETC 1CGJE 7KMEH 3F2FA 4X0WU 1K0HA 3SGQE 4TWWA 1PPEE 4X6NA 3E91A 4ISHH 1LTOA 1C1UH 1SLUB 2ANYA 3JZ1B 1GI9B 1O5FH 3TJUA 3LJJA 1ACBE 1KLIH 4ZKNU 3A8CA 1O5CB 1MTUA 2KCOA 1N6XA 1UTPA 4NWLA 5GIBA 3UQVA 4A5TS 4MPVA 3VB4A 5EQSA 4YM9A 1G30B 5DP7A 1C1NA 1IQIA 1IQFA 3U8TH 2ZTXA 2XNIA 3VB6A 3SOSA 3TU7H 3OFND 3P8GA 1V2LT 4ABGA 1BMLA 4R8TB 3S9BA 2UWLA 2ASUB 4XBDA 1J17T 2QXIA 2WV4A 1TA6A 1FPCH 3T29A 1ETRH 1ARCA 2UUYA 1L4DA 1TNJA 4WF8A 4RT0A 3EA8A 1LVOA 5FPSA 1XKBC 2OP9A 1TX7A 2FI4E 2BY8X 2WPDD 3U8OH 2G00A 1O2KA 4LZ4B 1F0RA 1FUJA 5A0AE 1XM1A 1GBAA 1DXWA 1RXPA 1G36A 3P70B 4ZKRU 2BLOA 1HV7A 4Q7ZA 2G8TA 2PSXA 1RD3B 1HIAA 1BTXA 1QHRB 3M5NA 5DO4H 2A4QA 2ZTZA 1KDQB 1QBVH 1V2PT 3LGUA 3HATH 3EGKH 2BY6X 1HJAB 2NWNA 1OX1A 1QA7A 3RXGA 1C2MA 1RJXB 1YCPH 2V35A 5AHGH 1G3EA 1V6DA 4X8TH 3Q00A 4YLUA 5E0JA 3EAJA 2B5TB 3FN8A 3I77A 1MZAA 2BD7A 3MNSA 4XD7D 1YF4A 2AGEX 2W6ID 1CBWC 3QX5H 2GZ7A 3ATWA 3TH4H 1O3JA 4ISOA 3ZZAA 2V6NA 3KQCA 4TPIZ 3STJA 3P6ZB 2BMGB 3RXIA 2GD4B 3U28C 1EB2A 2M5TA 4JMYA 3SW2B 1LKAA 3E6PH 4FU8A 1YCPM 1CT0E 3BG8A 2Y5HA 3LIWA 1MD7A 4KKDA 1ZPZA 5DP3A 1GBCA 1SGEE 3OYPA 1FY4A 2Y81A 2RA0A 4I8LA 3SQEE 1C2KA 3RXSA 3PYHA 4NSVA 3PLBA 1BRCE 3MWIU 2WYJA 3RM2H 3HKIB 2R3YA 1GJAB 2ZECA 5HM9A 1O2OA 2P94A 2HPPH 3F6UH 3RMLH 3WW7A 4AFSA 1N1LA 3OTJE 3PB1E 1GBDA 3UNSA 1GDNA 1OHHD 5B6LA 2EY4C 1BT7A 3ESTA 4K60A 1V2TT 2VU8E 4Y79A 1ZTLA 3PM3A 5FCKA 3ELAH 4H6TA 2FOEA 2A2QH 1F5RA 2FZZA 1J15A 2V7QD 1BB0B 2F9PA 3MTYA 3RXMA 2B9LA 3UWIA 3GCOA 1UVPA 1O3EA 4BANB 1CA0B 5GNDA 1T8OA 5FAHA 4J2YB 1O3AA 1GHVH 1SGYE 1TE0A 1PPFE 3A85A 2WUCA 4Y76A 5C5NA 1Y5BT 1DUAA 5A2MH 4RI0A 3DFJA 1L1JA 1C9PA 1GJBB 4B71A 2OBQA 4B75A 1W13U 1F7ZA 1ZSLA 4IBLH 2XWAA 3LC3A 1GI4A 4Y8YA 2BOKA 1O2LA 1IQMA 3OEHD 1QJ6B 1FN8A 3FZZA 1O2QA 3RXQA 1AKSA 1FI8A 1UTKA 3VB7A 2LPRA 1P3CA 5FBEA 4Z0KA 4FVBA 5A8XA 1AWHB 1GI7B 2P59A 3QLPH 2UWOA 3T2NA 1LPZB 1DXPA 1HAXB 1OWHA 3A8AA 3KQBA 4INHA 3ZZCA 5GCHF 3S9CA 1O2HA 2Q6GA 3RM0H 4JYUH 4QT8C 3PTBA 1WOFA 1RFNA 1SLVB 4Q4LA 2DUCA 2STBE 1HAHH 1O31A 2NU1E 4Y7BA 1S0QA 1UTQA 4MTBA 1MCTA 1AO5A 1RTLA 2BXUH 1VCWA 3ITIA 4OS4A 1C4Y2 4JK6A 3Q77A 3A84A 1EKBB 3N7DA 1GJDB 2ZQ1A 1F5KU 1OKXA 1VJAU 3MH6A 1K9OE 2PUQH 4AGKA 4GVUA 3PMAB 1QRZA 2BD8A 3NWUA 1IQHA 1NBME 1PPZA 1OYQA 2RCEA 3FZDA 1A0JA 3ZVGA 1C9TA 2Y80A 3CNRA 1C2FA 1LVMA 1EOJA 2HPQH 1ARBA 3ZZ6A 4JZDH 2IPQX 1ELAA 1BA8B 1O2GH 3MFJA 1LDTT 1A0LA 2PKAB 1AU8A 1EPTB 1O3GA 4XBBA 4Y11E 1AWFH 1YPLH 1C2HA 2FXRA 2FS8A 1GVZA 3V0XA 4B2BA 5JPMH 2DE8A 2A5KA 3SUGA 2WV5A 4FETA 1NU9A 1QZ8A 2VNTA 1NBMD 4X2WA 1AHTH 2ZFRH 1H8ED 5PTPA 4BAKB 4IC5A 1ZJKA 1IOEA 3RXPA 2P8OB 1LQEA 1P05A 1PYTC 4NA8A 3GY8A 3NUMA 3P17H 3BEFB 5L2YH 1BQYA 1V2JT 3L33A 3K6ZA 3GY2A 1ZJDA 1CVWH 2FX6A 3GISB 3D65E 1GMDG 1SSXA 2Y7ZA 2SNWA 4K8YA 3ZZ7A 4DY7B 1WTHD 1GJ8B 2V3OH 4MDSA 1HBTH 4X2YA 2HLCA 2ZQ2A 2HLDD 1CSOE 5GPIB 2K1QA 4MPWA 2ZGHA 1DY8A 4I33A 1HJ9A 2PFEA 3KYFA 4XDEA 2NU0E 3SJ8A 5LPRA 3SJ9A 5JBTA 2ZPQA 1V2KT 1BBRE 4KTUA 2M2AA 4AGJA 2XC4A 1VITF 2FLRH 1GHBF 1Q3XA 2FESH 4IN2A 3MHWU 3AAVA 1NM6A 5EXMA 2WZQA 2Y7XA 2ZGXH 1LCYA 4OS6A 4ZCNA 4B6FA 2OQ5A 1AIXH 1PQAA 5CHAB 2Q6DA 2O9QA 1XUHA 2J2UA 5E0GA 1W7GH 1G3CA 1CA0C 1O2MA 1XVOA 3QK1A 1A5HA 1FAKH 1ZGVA 2BVRH 1WDIA 3K65B 1ORFA 3SU4A 3VXFH 2FO9A 1C5PA 1K1IA 1E1QD 1C2DA 3NK8A 1JWTA 1LHFH 1F5LA 2Z9IA 3QUMP 1HNEE 5H4IB 2J95A 3I78A 3OAAD 1NRRH 1QB6A 4Q80A 1L1NA 2ZU5A 8KME2 4H42U 3RC4A 3FFGA 4BNRA 4CRBA 5DSFA 1UMAH 1AE5A 1P2OA 4OS2A 1FXYA 1C2EA 1SGCA 2V3MA 2GTBA 2KZ4A 1YKTA 3M5LA 4ASUD 5A8ZA 1C1SA 1QY6A 4B73A 4CBNA 1DSTA 3QGJA 3BIVH 1DVAH 4K5ZA 3SN8A 1MBMA 4JYTA 1HDTH 1O2UA 2FS9A 1EP6A 3I29A 1T8MA 4I7YH 9ESTA 3S9AA 2GV7A 2BY5X 1HPGA 1ZR0A 3KNXA 3M5OA 1NRQH 5F53A 4YO9A 1ZTKA 3IWMA 3AVZA 1P10A 2BDGA 1K1LA 1IQLA 5A0CA 5EJLA 1GJ7B 2XC0A 1MABB 2C3SA 2FIRH 4NFEA 2XYAA 1FNIA 1OWJA 3GY7A 3PLPA 2BY7X 4ASHA 1GL1A 3IG6B 5L2ZH 1MTNC 5AFYH 2G52A 3RXRA 5AVDA 5F8ZA 1NRSH 2R2MB 5ABWA 1MD8A 4O3UA 1SKYE 4FUEA 3MU8A 1T8LA 3DSOA 1ZHMA 1V2RT 3IITA 3RXCA 1TGNA 5EJ1A 1NY22 3KQ5A 1XX9A 1P57B 5G4BA 1WTGH 4AB8A 1FONA 2YNAA 1GJ5H 4UEHH 3P8OA 1BZXE 1UCYH 1XMNB 5E8EH 3MH4A 3DFLA 1GBMA 4KP0A 5BRRE 1HRTH 3KGPA 1IHTH 3SU1A 3SZNA 3M7TA 4OGXA 4WMFA 1TRYA 1EAWA 4AYYB 4D9QA 3LC5A 1C1TA 4X8VH 5HGGA 2K8IA 3ZVCA 1EQ9A 1TMBH 1UHBB 1VR1H 1B0EA 1TQ0B 2WUBA 1QCPA 4M9FA 2G5NA 2W3KA 2AMPA 2TRMA 1XUIA 1EPTC 8GCHF 3Q3YA 2G81E 4NIVA 3SNDA 5EXNA 2BD5A 1EFRD 1YC0A 3HK3B 4AORA 1EJNA 3LGVA 1U6QA 3RXHA 3O8DA 2H5DA 1L1GA 3A80A 3CS7A 1QJ1B 1O38A 1WAYB 1EUFA 2P8OC 1EOLA 1O2RA 2ZGBH 4GHQA 3KN2A 2A7JA 3SU0A 1XUFA 2BB4A 1HAGE 1YPEH 5CE1A 1GVLA 2PHBA 2BX3A 1CQQA 1ZRBA 1GI1A 1HXEH 5I46H 2VIWA 3UIRA 2FDAA 1YP9A 1KMHB 3DD2H 3MH7A 2ODYB 4U30A 3SNBA 3OEED 4ZXXH 2DE9A 1QR3E 1E34B 4X6PA 1OP8A 4XSKU 1GCDA 1SB1H 1D3QB 1W0ZU 2UUFB 1C2JA 1ZMNA 2VWLA 1TQ7B 2SGDE 1K1OA 2XNDD 2FMJA 2BDAA 4P00A 3UREA 2CXVA 4ISLA 3SHAH 1CGHA 5C2ZA 2GV6A 1B5GH 5CHAC 2ZU1A 1C5XB 3A7YA 2VIOA 2NU2E 4X6MA 1ZHPA 5C5OA 1ELFA 4K1TA 1C1WH 1ABJH 4Y0ZE 3BTTE 1Z8GA 3A7WA 1CBWB 2NU4E 2ZFPH 1OWKA 2WPHS 2BVXH 1BMAA 3ODFA 1LMWB 1NFYA 1BTHH 5HIYA 1W8BH 2ZPRA 3ATMA 1Y3YA 4TPYA 2GCHF 3KL6A 1CU1A 1P8VC 2PWXA 9LPRA 3GDSA 2IJD1 4UONA 4MG3A 5EOKA 2B7DH 4NSYA 1BTWA 1W14U 2F9BH 3A81A 1UVUH 2FX4A 5HIZA 3PLKA 2A7CA 3MNCA 3GCTG 1F92A 1MZDA 2EI7A 2ZFFH 1TNHA 1C1OA 1W10U 4LXBH 2HNTF 5EU8A 4A6LA 1RGQA 3RDZA 4X8UH 1PQ7A 2TIOA 3A7XA 3ZVBA 2ZWLH 3VB5A 3LDXH 3BF6H 1N6YA 2GMTB 1FY8E 2SGAA 2ZHEH 3BV9B 1O5EH 2YNBA 1K1MA 1WXRA 5EODA 3ZV9A 1TPSA 2TBSA 4JZFH 3FP6E 1AUJA 3LGTA 3O8BA 3ZVEA 2OC1A 2EC9H 1UTLM 5B6OA 3QN7A 2TGAA 2QF3A 3U1IB 1D6RA 2V3HH 4JK5A 1BJUA 3ODDA 1IQGA 3P8NA 5C94A 1MTVA 4HGCA 4H4FA 3M61U 3M3TA 1DOJA 1MKXK 2OC7A 1NRNH 2Z9GA 1UTNA 5FXLA 2QF4A 4LZ1H 2FYQA 3RXTA 4Y6DA 1LHGH 1KXBA 1C4U2 1ANBA 2IJOB 1J14A 1HUTH 1V2QT 1C2IA 3A88A 3TGIE 1YLDA 2BQ6B 4E7RG 2YOLA 2ZI2H 1QGFA 3SNAA 2QGRA 4NIWA 2LP6A 2XXLA 4CRAA 1SHHB 2CK3D 1V2ST 3ZYEA 3A86A 1RS0A 3A7ZA 4K69A 1Z71A 3STIA 3D62A 4R0IA 1P06A 2SGPE 1VITH 2PKSC 1ELEE 4MPUA 2BLWA 2ZCKP 4AOQA 5FX6A 2ZGJA 4JCNA 1LVBA 1HAIH 2O8WA 3SGBE 4DT7B 5C1XA 3GDUA 1TNLA 2VIQA 5C0TA 1YM0A 1BTUA 3F2GA 1XUKA 4WXIA 1OWDA 3F0PA 4CR5A 1H8IH 4WWYA 1KY9A 3PWBA 4YXWD 1ZYOA 3SU3A 1OWEA 2Q6FA 1WU1A 1W11U 3C1KA 3GCTF 5FPYA 1AFQB 2VVCA 1O2WA 2KX4A 2QC2A 1NS3A 1EZQA 1VZQH 4P02A 5LGOA 1O39A 2ULLA 1O3BA 2F83A 4ZHAA 2XC5A 1YPGH 3UQOA 3RXUA 3BEUA 1QA0A 5E2OA 5DPAA 1GBLA 2BDIA 1WSSH 1EXFA 3DA9B 4BXSA 5TJXA 2ZDNA 4AB9A 5IK2D 5IYTA 1TNIA 1V2WT 2ODPA 2J94A 4YTAA 2ZFTA 1GI6A 4NIYA 1AKSB 1TB6H 4FU7A 1Y3VA 2QN5T 4X1QU 4ZKSU 3UR6A 4U2WA 3SV7A 1ELBA 1YLNA 1WBGB 5GCHG 4UDWH 3QTVH 1AUTC 1AVGH 2VH0A 1FMGA 1BRAA 4HI3A 1O3CA 1C5OH 4UFFH 5AF9H 1FY1A 2EA3A 3F0OA 2JJ1D 4ABDA 1TRNA 1S5SA 1VGCB 5JB8S 3SGAE 5EW2H 1ELDE 1THPB 2BHGA 2O8LA 5F03A 3S7HB 3MU4A 1C1VH 1DITH 1XKAC 4ACBA 5CDFE 2YMSD 1P2IA 2W3IA 1VCPA 1YPHC 2TPIZ 4NZLA 1HYLA 2JJ2D 1SGFG 4NZQA 1C5LH 3ZZ3A 1DPOA 3M37A 2GMTC 2HVXA 1G2LA 5DP6A 1HXFH 4Q63A 1O3KA 4OGYA 3S69A 2OBOA 1QJ7B 3WWBA 2BD2A 1GI3A 5EQQA 1D3TB 3BTQE 5JBCS 3F1SB 2ZU3A 1ELGA 2OC0A 1P2KA 1HB0B 4XFQA 3U69H 5L6NH 1TNGA 2J98B 1PPCE 1BJVA 1GBJA 1VJ9U 3T26A 3W1EA 3QZRA 3SJKA 3QO6A 1KSNA 1HAZB 1DWBH 4B2CA 4DT4A 1HGTH 2KCPA 1SQRA 2OCVB 2BY9X 1OXGA 1MCVA 2F43B 2F3CE 1UW7A 2A7HA 1ZMJA 2KAIB 1KDQA 1G3BA 4FXGH 1C5UA 5C17A 1B7XB 3SU2A 1OOKB 3AAUA 3T5FH 3T62A 1GI2A 2I6QA 4BAQB 3TNSA 3RXAA 1O5GH 1SMFE 3AW0A 4ABBA 1AI8H 1JBUH 1JOUB 1GMHF 5FL7D 5DKMA 4MNXA 2TGDA 1SI5H 1VITG 1GHBG 4NWKA 4X6OA 2HNTC 3QGNB 4X1NU 4B74A 1G37A 2PUXB 1D6WA 1GVKB 2ANMH 1D4PB 1MTNB 1TYNA 1ZOMA 4ESTE 3GYMA 4H6SB 3SUFA 2A4GA 2PP6A 2ALPA 1WQSA 1SR5C 3VPKA 5EIYA 1HLTH 3ZVDA 1NESE 1AFQC 2AH4X 1GBBA 3F9GA 2ODQA 1CT4E 2I6SA 1TONA 5FPTA 3SUEA 2C8WB 1O3LA 4UFDH 3FP7E 4DIIH 4DGJA 1YPMH 3DHKH 3L6PA 1UK3A 4D7FA 4ZH8A 2F9VA 1QFKH 3KQDA 2FM2A 2OINA 3RXOA 1C5VA 1M9UA 2BQWB 2STAE 4M7GA 3F2HA 1G3DA 2BX4A 3LGYA 5FHTA 1S81A 2ZHDA 4KGAA 1Z6EA 1GBEA 4DURA 3RP2A 3TJVA 2A1DB 1VKYA 2Y5GA 1ZTJA 1W3CA 2AHME 3BG4C 4ZHMU 1BUIA 3H7TA 3PROA 2H1UA 1EZSC 1F0UA 1MKXH 1MQ5A 3F9FA 3LKWA 2JH6D 1Q31A 1EX3A 1NFWA 3ZZDA 2Z3EA 2WPMS 4HFPB 1O2XA 3PRBA 1VGCC 2ZA5A 4SGBE 4TT3D 1C5NH 4SGAE 2UUKB 2A31A 3PO1C 3PMBB 1J9CH 3SJOA 1FAXA 2AEIH 3V3MA 3TH3H 1K1NA 2P93A 1T8NA 5T6FA 5A0BA 1ZSJA 3M36A 5DGJA 3PV4A 6GCHF 1SGQE 4IS5A 2XBVA 3ZZ4A 4OS5A 2G5VA 1O34A 2THFB 3LGWA 2CJIA 3MU0A 1UVSH 3Q3KA 2XCNA 4FUCA 1Z7KA 2Z3DA 1TRMA 1BOQA 1S85A 3HPTB 2R0KA 1A5IA 4INKA 3A89A 3A8DA 4IC6A 2AIPA 2C93B 2FODA 1BIOA 3PMJA 4AX9H 5AFZH 8GCHG 3QDZB 7ESTE 1V2MT 2A32A 2K0QA 3O8CA 1C2LA 4B6EA 3AW1A 1H8DH 3M7UA 4NGAH 1TBRH 4AC9A 1AFEH 5C3NA 3RUOA 2FOBA 2SGFE 5DN6D 3MQKC 4CHAC 4O03A 3BTGE 4OS7A 4Y10E 3UWJH 1V2OT 3GYLB 4ISIH 1DLEA 2GJGA 4K3JA 2VB0A 1THRH 1GJ4H 3RMMH 5LH8A 2PW8H 1KLJH 1BTPA 2ZHFH 3LU9B 4D9RA 1HAYB 2AFQB 3UNQA 4YOGA 3ATIA 1ANDA 5DP5A 3F3BA 3NKKA 2A45B 2ZTYA 1AQ7A 2PTCE 3EE0B 4WVPE 2A4OA 4YESB 4OS1A 1SC8U 1E38B 5SGAE 4YLQH 2Z94A 1AVXA 3PV2A 4UE7H 2VVUA 3SNEA 1Y5AT 1MMJN 1E35B 1COWD 2CHAC 1ESAA 2ZDMA 4FUJA 8ESTE 2PKAA 4IGDA 3OU0A 1EPTA 5EG4A 3UOUA 1NO9H 3LGIA 2W6JD 2BZAA 2J97A 4K8BA 1S83A 1O5DH 1C5MD 2PGQB 3A83A 1A0HB 5ESTE 2Y6TA 3UOPA 1GBFA 2QV1A 2ZZUH 3MMGA 4I8GA 4GHTA 1EB1H 1TAWA 4Q7YA 3SV2H 1FX0B 3K2UA 2VGCB 2J5UA 1E1RD 2PLXA 5GDSH 3UAIC 1DY9A 3U8RH 2RDLA 3OX7U 4U32A 3EDXB 1F0TA 3LPRA 1CHOF 1T31A 2RG3A 4J1YA 1NFUA 2ZDKA 3HKJB 2PR3A 3PV5A 2QY0B 3MO6A 2WPIS 4E05H 1E0FD 3G01A 4VGCC 5JDUB 4CBOA 1AY6H 1KXFA 1P0SH 2GCHG 5GJ4B 4F55A 1HAVA 1PPBH 4A1XA 3GY5A 1SGDE 1SOZA 5DJ7A 3MU1A 1SGFA 4DOQA 1AN1E 3GICB 1GHWH 1LHEH 1NN6A 1OS8A 1TX6A 4MLFB 1S6LA 3SU5A 3A8BA 4ZUHA 2BLQA 3Q3XA 4GCHG 2Z6BD 4WY3A 3RXKA 1S82A 1O3DA 3NXPA 4Z1MD 4TY7A 3LONA 3HGNA 2FYRA 2Y5FA 1MTSA 1QQUA 2WPKS 1FN6A 4MNWA 4Z6AH 1F0SA 2PKSB 1SGIB 3HK6B 5JYIA
chains in the Genus database with same CATH topology
1SPJA 1A5GH 1Z6JH 3SBKA 1H9IE 4E06H 3RMNH 1WUNH 1TPPA 3QWCH 1CA8B 1JIMA 1JMOH 4FU9A 1W12U 2BQ7B 1A4WH 1T4VH 2F91A 1PPGE 2OQUA 2GZ8A 2ZDLA 2ZU2A 1C5WB 5DP8A 3W95A 2ZDVH 3T25A 1Z8JB 3NPSA 3E0PB 1L0ZA 2D8WA 1BBRK 1TBQH 3SNCA 4WMEA 1MKWK 1ZPCA 2GZ9A 1W0YH 2TGTA 3MNBA 2FTMA 1QIXB 2W5EA 3F9HA 1SVPA 4FVDA 1UVOA 1ESTA 2BD9A 4DIHH 2PSYA 3VGCB 1INCA 2VIDA 1NROH 1MUEB 1Y3WA 2H5CA 1QTFA 3BN9A 4AG1A 2FEQH 5I25A 2BYAX 5DP9A 4X1SU 3TNTA 1NT1A 1SGTA 3F9EA 2CN0H 2ZDAH 4D76A 1OSSA 1MTWA 4TWYA 3S7KB 1MH0A 4I8HA 1C1RA 1O5BB 5EPNA 4ZKOU 1H9HE 1HAOH 3FP8E 2P16A 1QNJA 2JKHA 3P8FA 1PQ5A 5JBBS 2W7SA 1IQJA 1P9SA 2HOBA 5ESBA 3V13A 2XTTB 5T3HA 3UTUH 1UHBA 5GWZA 1PJPA 1C5TA 1O2YA 2AGGX 1DUEA 1FJSA 2ZEBA 1LVYA 1A46H 4GCHF 1C5QA 2FOCA 3FANA 5EQRA 1PYTD 4A7IB 2BD3A 1AMHA 1OPHB 1O3MA 1TPOA 4X2XA 1JXPA 3OSYA 1KLTA 2A5AA 2QYIA 2JH5D 1THSH 2QXJA 1YGCH 4IMZA 3RXVA 3W94A 3KHVA 1ESBA 3TLOA 1HIAB 3U98H 2OUAA 3ZZ8A 2VGCC 4NIXA 3TK5A 7LPRA 1P2NA 3P95A 2FPZA 1NPMA 1EAUA 1D9IA 3WY8A 1UTOA 1UCYE 3E90B 2W7UA 2ZKSA 1N8OB 1SQTA 2J92A 2D2DA 4UFGH 4Y8ZA 3VXEH 5J4SA 3U9AH 4CREA 2AS9A 6CHAB 2ZHQH 2VVVA 1ELCA 1BMMH 4MNVA 4WJG2 3A7VA 1S6FA 1S6HA 1H4WA 1DANH 1QRXA 1T7CA 1O3NA 3C27B 3EA9A 1TALA 1GJCB 2FWWA 4IW4E 3SI3H 1NFXA 4WXVA 4MVNA 4F4OC 3A82A 4DCDA 3TITA 3KQEA 2GX4A 4UD9H 1DE7H 1RIWB 1V3XA 2Z9KA 1T4UH 1UJ1A 2G4UA 1BDAA 2OTVA 2V0BA 1GBHA 5IDKA 2C8XB 2WYGA 1GPZA 3JZ2B 3EQ0H 3GCHC 4O9VA 4JZIA 3MI4A 4MQAA 4Y0YE 1OP0A 5C67A 2GGVB 4BAOB 2QIQA 1FIWA 1YPKH 4NFFA 2O8TA 2ZFSA 3ZVFA 4MPXA 3T28A 5DP4A 5HMAA 2CF8H 4NA9H 1YBWA 4RN6A 1DWEH 2CGAA 3M7QA 3A7TA 1GMCG 2F9UA 2AERH 2BM2A 1O2SA 3HGPA 2VH6A 1CHGA 1WV7H 1PQ8A 1QL8A 2IN2A 1BITA 1GI0A 3SJIA 2BDHA 2FOAA 3KCGH 3VGCC 3GY6A 2ZIQH 3BTKE 3CENA 4ABJA 4ZAEA 1FPHH 4Q7XA 1EASA 1QBOA 4JYVH 3VFEA 1C1QA 2EI8A 3EYDA 3LOXA 1RTFB 2C4FH 1IQNA 2ZCLP 5T6DA 1DWDH 1J16A 3D49H 3FVFB 1SL3A 3URCA 2B8OH 3S0NA 3N7OA 3BG4B 1ELTA 1NC6A 2FOHA 4YOJA 3EA7A 1GMHG 1HAPH 1ABIH 4A1TA 2RA3A 3B9FH 1DS2E 1UVTH 1KXDA 1UTMA 2PTNA 2ZU4A 3BIUH 1V2VT 1TGTA 1ZSKA 1B0FA 1GG6C 1ELVA 2CV3A 4CH2B 4AFUA 2FLBH 1MAYA 1O2PA 1P03A 4HTCH 4LOYH 2AMQA 3GOVB 4YOIA 1P12E 2ZO3H 3PO1B 3MH5A 1WQVH 1Z1JA 2XWBI 1TABE 3K6YA 2QAAA 4E7NA 3QTOH 1G2MA 3TJOA 1TGCA 4DG4A 1O37A 3MYWA 4RKOB 1HFDA 3GY4A 1P11E 4FUIA 5LPFA 1MAXA 1CT2E 1EAXA 1Y59T 1D3DB 4U01A 2SGEE 3MO3A 2ANKH 1A7SA 1AB9B 3TPIZ 2P3TB 4THNH 1DDJA 1NRPH 4BAHB 1LKBA 2FP7B 2XBWA 2GP9B 1P3EA 1UCYK 2FI5E 4IMQA 1ANCA 1TMTH 1G32B 2IPHA 1N8OC 2GT8A 2R9PA 3PWCA 2O8MA 3RU4E 2ZFQH 3DT0H 1BBRH 1GMCF 1MKWH 1P09A 2HWLB 3TIUA 4ABFA 2VJ1A 2IOTA 3RU4T 4X2VA 1HJ8A 4ABEA 6CHAC 4Y71A 4CHAB 2UUJB 1KTSB 4A92A 4A1VA 4RKJB 4INLA 4I32A 2R0LA 1C1MA 1XUGA 1QL7A 2AYWA 5HXFA 3UNRA 1O32A 3E3TA 1XVMA 3SQHE 5EGMA 1P04A 1V2NT 1K21H 2WPLS 1DWCH 5EXLA 1MU8B 1QL9A 1T32A 4AN7A 1RIWC 4BAMB 1TOCB 3RU4D 6GCHG 2UWPA 3URDA 3LT3A 3R0FA 1GBKA 2CHAB 4B2AA 1ZHRA 3TK9A 4BOHA 1PFXC 2ZPSA 3UUZA 1FDPA 3D23A 2J4IA 1Y5UT 2H2ZA 1A3EH 1GI8B 2BZ6H 3M5MA 3MU5A 1GHAG 5A09A 3U1JB 1DLKB 1WYKA 3GDVA 2H9HA 5C20A 5HM2A 1GHYH 2Z7FE 2F9OA 1F2SE 1C5SA 3LJOA 1O3HA 5LPEA 1ETSH 1Y3XA 4NA7A 1ETTH 3TGJE 1EJAA 4DJZB 4YT7H 2W26A 1QURH 1C5ZB 1W7XH 3RC5A 4NCYA 5CMXH 3E1XB 3UR9A 2O8UA 4JZ1A 1O2VA 2D1JA 1H1BA 2Z9JA 3ATLA 2VINA 4VGCB 1A3BH 1LO6A 1TX8A 3OY5U 4TYDA 1RTKA 1KYNA 1TNKA 2PV9B 1SGPE 1IAUA 4O97A 2G51A 5EW1H 2ESTE 3PTNA 1BTZA 1L4ZA 1LHDH 1AGJA 2VIVA 1KXCA 1H9LB 5DK1A 4Q2KA 2FOFA 2ZG0H 1SFQB 4CR9A 2BOHB 4JZEH 2J9NA 2FTLE 1EZUC 2C90B 1D3PB 3M3VA 3RXDA 4K2YA 1TOMH 1HJAC 1E37B 2A2XH 2SFAA 1C5YB 1S84A 4GSOA 1GCTB 5DG6A 3OY6U 4AZ2B 1O5AB 3GCNA 2H9EH 1GHXH 2ZGCA 1AE8H 3BSQA 3MOCA 4MNYA 3RXFA 2ZC9H 1FV9A 2R2WU 1LPGB 1VCQA 1DICA 1FQ3A 1BRUP 1SBWA 1P01A 1UO6A 2TGPZ 4Y8XA 2KAIA 3PMHB 2PGBB 1SQAA 5F8TA 3ZYDA 1P2MA 1MU6B 1LPKB 1CO7E 2GDDA 1CHOG 1PPHE 1P2QA 1TWXB 3TGKE 4XBCA 2BLVA 3RMOH 1GBTA 2FOMB 1TIOA 2ZHWH 2SGQE 4FUDA 1ID5H 1GHAF 1IQKA 2VWMA 1AB9C 2CF9H 4CRDA 1EATA 3E16B 2F9NA 3A87A 1GWAA 1KXAA 4ISNA 4I8KA 1G9IE 1EJMA 5JBAS 3LH1A 3BTFE 1TLDA 1QQ4A 3L3TA 2HRVA 3SHCH 1Z8IB 1GL0E 1HAVB 2QXHA 4UFEH 1FLEE 3RXBA 3SV8A 2G55A 2BD4A 2OXSA 1SG8B 2ZP0H 3R3GB 2ZNKH 4AFQA 3ZZ5A 2GCTB 4Y7AA 3SU6A 7GCHG 1UTJA 2ALVA 1J8AA 3BTWE 1P9UA 2BDBA 1YLCA 5L30H 1GBIA 2H9TH 3SO3A 1C4V2 1YPHE 1Z1IA 4AG2A 1BHXF 5T6GA 1AD8H 2AIQA 4GAWA 2OC8A 2Q1JA 4BTTB 3NZIA 2J38A 3GY3A 2FOGA 5BPEA 3M3SA 1LHCH 3VB3A 5FX5A 1O2IA 1YPJH 1IQEA 3E0NB 1P2JA 3MNXA 1FZZA 4B76A 1GI5A 2WINI 2B0FA 5HYOA 5E0HA 5K0HA 1FY5A 1SGRE 2P3FH 3BTEE 2QA9E 3ZV8A 3H5CB 3KF2A 1FY3A 3P92A 3RXLA 1DSUA 2QF0A 2OLGA 4D8NA 5J4QA 4IN1A 1O30A 1TBZH 3Q76A 1NZQH 2ANWA 3AASA 1OYTH 4WH6A 3RC6A 1FIZA 1GGDB 2VIPA 5TCCA 4CRFA 1Y3UA 1ZPBA 3UY9A 1EZXC 1GJ9B 1ZRKA 1QRWA 4KTCA 1GMDF 1KIGH 4YT6H 4ABHA 2BVSH 3FAOA 4ABAA 1YCPK 3BTME 1BMNH 1O35A 1SLWB 1LQDB 1SLXB 1O3FA 2C8ZB 1GJ6A 2HALA 1O2JA 2XRCA 1SHYA 4WMDA 3TVJB 3SV9A 1MQ6A 5F6MA 2FI3E 1K28D 4BTIB 4D7GA 3O8RA 1KTTB 1TGSZ 3H7OA 3KIDU 1TGBA 1NU7B 3ZZ9A 5FBIA 1BHXB 2HNTE 2JETB 3SV6A 2D26C 1O2NA 1GCTC 2HGTH 2Y82A 3GCHB 1AVWA 4KELA 2ZF0H 4XOJA 7GCHF 1DM4B 1ZMLA 4ZHLU 3UFAA 2G4TA 1SGNE 2BXTH 3BTDE 4X1PU 4YZUA 3ZZBA 1BCUH 3F68H 3SI4H 6ESTA 4KTSA 1XXDA 1O33A 3CP7A 2GT7A 1QB9A 1QB1A 1K22H 2AMDA 1BTYA 1A1RA 1JRTA 4ABIA 4CRCA 1K1JA 4RSPA 1W2KH 2Z3CA 4GUXA 1GHZA 3TJNA 1EAIA 1L2EA 3ENSB 1EP5A 4GPGA 1MBQA 4TY6A 3V12A 2LNCA 2OD3B 4NG9H 1TMUH 4LK4A 1O3PB 4FUBA 1AZ8A 2JH0D 4XE4A 1DX5M 3RLYH 3B23B 1SFIA 3BEIB 4ZXYH 1SQOA 2GDEH 3V7TA 4GLYA 3ATKA 5E2PA 1Q2WA 4BXWA 2SNVA 3LH3A 3ZVAA 5C1UA 3SUDA 2A0QB 2A4RA 1QBNA 1TFXA 2XBXA 1K2I1 4DW2U 4WH8A 1RRKA 1C1PA 2J34A 1O2TA 4CH8B 4ZMAH 2P95A 4B1TA 4CRGA 3BTHE 1K1PA 1UK2A 2EEKA 3KEEA 1XXFA 2EI6A 4K1EA 2QCYA 4X8SH 1O0DH 2BDYA 2XBYA 5K7RA 2GCTC 4BTUB 1GG6B 4FUHA 2CMYA 3RLWH 1OP2A 2XCFA 1A2CH 2AGIX 3T27A 1UK4A 4HZHA 2H6MA 1HCGA 3SORA 3VEQB 2P3UB 3RXEA 2C8YB 4PROA 5A8YA 3RXJA 5F8XA 2NU3E 1S0RA 2WPJS 2VWOA 1TPAE 4I31A 4AYVB 4FUGA 1AZZA 3TH2H 1NTPA 1C2GA 5TCAA 1ZLRA 3E8LA 3K9XB 4FUFA 5FCRA 1KXEA 1CE5A 2Z9LA 3TK6A 2BDCA 1GDQA 1V2UT 1IHSH 1X7AC 3M35A 2GKVE 3UPEA 5ETXA 5GXPA 4ZROA 2QXGA 1JRSA 1XUJA 8LPRA 1TA2A 3NCLA 2A5IA 1C5RA 4I8JA 1DFPA 1ANEA 5JB9S 1SOTA 2R3UA 4K1SA 4F49A 3B8JA 1O2ZA 3QZQA 1O3IA 3DUXH 2BTCE 1GGDC 1ZZZA 2VWNA 1Y8TA 1YYY1 5C1YA 3CS0A 4O3TA 3MO9A 1ZGIA 4DVAU 1WCZA 2XW9A 1E36B 4AFZA 1CGIE 1A61H 1JIRA 1GDUA 5EPYA 1O3OA 1OWIA 2GVFA 1O36A 1P02A 2ILNA 1Z8RA 1DT2A 6LPRA 4X1RU 2ZCHP 1BRBE 2JETC 1CGJE 7KMEH 4X0WU 3SGQE 4TWWA 1PPEE 4X6NA 3E91A 4ISHH 1LTOA 1C1UH 1SLUB 2ANYA 3JZ1B 1GI9B 1O5FH 3TJUA 3LJJA 1ACBE 1KLIH 4ZKNU 3A8CA 1O5CB 1MTUA 1N6XA 1UTPA 4NWLA 5GIBA 3UQVA 4A5TS 4MPVA 3VB4A 5EQSA 4YM9A 1G30B 5DP7A 1C1NA 1IQIA 1IQFA 3U8TH 2ZTXA 2XNIA 3VB6A 3SOSA 3TU7H 3P8GA 1V2LT 4ABGA 1BMLA 4R8TB 3S9BA 2UWLA 2ASUB 4XBDA 1J17T 2QXIA 2WV4A 1TA6A 1FPCH 3T29A 1ETRH 1ARCA 2UUYA 1L4DA 1TNJA 4WF8A 3EA8A 1LVOA 5FPSA 1XKBC 2OP9A 1TX7A 2FI4E 2BY8X 3U8OH 2G00A 1O2KA 4LZ4B 1F0RA 1FUJA 5A0AE 1XM1A 1GBAA 1DXWA 1RXPA 1G36A 3P70B 4ZKRU 2BLOA 1HV7A 4Q7ZA 2G8TA 2PSXA 1RD3B 1HIAA 1BTXA 1QHRB 3M5NA 5DO4H 2A4QA 2ZTZA 1KDQB 1QBVH 1V2PT 3LGUA 3HATH 3EGKH 2BY6X 1HJAB 2NWNA 1OX1A 1QA7A 3RXGA 1C2MA 1RJXB 1YCPH 2V35A 5AHGH 1G3EA 1V6DA 4X8TH 3Q00A 4YLUA 5E0JA 3EAJA 2B5TB 3I77A 1MZAA 2BD7A 3MNSA 1YF4A 2AGEX 1CBWC 3QX5H 2GZ7A 3ATWA 3TH4H 1O3JA 4ISOA 3ZZAA 2V6NA 3KQCA 4TPIZ 3STJA 3P6ZB 2BMGB 3RXIA 2GD4B 1EB2A 2M5TA 4JMYA 3SW2B 1LKAA 3E6PH 4FU8A 1YCPM 1CT0E 3BG8A 2Y5HA 3LIWA 1MD7A 4KKDA 1ZPZA 5DP3A 1GBCA 1SGEE 3OYPA 1FY4A 2Y81A 2RA0A 4I8LA 3SQEE 1C2KA 3RXSA 3PYHA 4NSVA 3PLBA 1BRCE 3MWIU 2WYJA 3RM2H 3HKIB 2R3YA 1GJAB 2ZECA 5HM9A 1O2OA 2P94A 2HPPH 3F6UH 3RMLH 4AFSA 1N1LA 3OTJE 3PB1E 1GBDA 3UNSA 1GDNA 1BT7A 3ESTA 4K60A 1V2TT 2VU8E 4Y79A 1ZTLA 3PM3A 5FCKA 3ELAH 4H6TA 2FOEA 2A2QH 1F5RA 2FZZA 1J15A 3MTYA 1BB0B 2F9PA 3RXMA 2B9LA 3UWIA 3GCOA 1UVPA 1O3EA 4BANB 1CA0B 1T8OA 5FAHA 4J2YB 1O3AA 1GHVH 1SGYE 1TE0A