2QXIA

High resolution structure of human kallikrein 7 in complex with suc-ala-ala-pro-phe-chloromethylketone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Kallikrein-7
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA02
2CF8H 5A8XA 1GBLA 1GG6C 2FIRH 1F0TA 1TONA 3M5NA 5DJ7A 2BQWB 5DP3A 1VJAU 3SU3A 1EZQA 1GJ6A 4K1TA 4I8HA 3UOPA 1UTLM 3BTME 1O2SA 3BEIB 1GJBB 1TPAE 3NCLA 4NSVA 1LMWB 1OOKB 2FOFA 1G3BA 4X2YA 2FX6A 1C5VA 1NU9A 1OWKA 3Q3XA 3A85A 2UWLA 1WTGH 1BTYA 3SV9A 1RD3B 1SGFG 3QN7A 1GHBG 1O3CA 3U9AH 1NRSH 2ZP0H 2GT8A 1TX8A 1Y5BT 4K1SA 4NIYA 2WPLS 4F4OC 3M3TA 2A2XH 2BDCA 3PLPA 3A86A 1THPB 3VB6A 3R3GB 2F9PA 1O2XA 1T8LA 2BY8X 1UHBB 2VIPA 2Z9LA 4MPXA 1C2DA 4ISNA 5A8YA 1C4Y2 4E7RG 2B5TB 6CHAB 1F7ZA 3GY7A 3URDA 1SGPE 1PPFE 3EYDA 4FUDA 1FIWA 1DY9A 1MKWK 6LPRA 1VGCC 1BTWA 1WUNH 1AUJA 1T4UH 3QTVH 5EPNA 5FXLA 1RS0A 2TGDA 1QL7A 3TJUA 1P2MA 2DE8A 2DE9A 3DHKH 1YLDA 3E91A 4JZFH 1TOMH 2AERH 4MG3A 1TGBA 3LU9B 3SJIA 4CRAA 2F9BH 1VJ9U 1O36A 3RXLA 2G5NA 4A5TS 2VIQA 2GZ7A 1GDNA 3ZVFA 1EB2A 1GJ5H 1NFWA 1ZGVA 2FS9A 1C1WH 4X1QU 2VIVA 2BZAA 1O3BA 1SBWA 1KY9A 1SGDE 1UCYE 1P12E 3RC6A 2NU2E 3SJ9A 4DURA 3SV2H 1IAUA 1D9IA 3LGYA 2F91A 1OP0A 1C1NA 1DPOA 5L2ZH 4J2YB 1RFNA 3M61U 3A8DA 3MI4A 3MU8A 1BUIA 3MH4A 1EX3A 2OC1A 1GGDC 2FXRA 4NZLA 4M7GA 1GBEA 1ZMNA 3U1IB 4NA8A 1YCPM 2WYGA 1Z71A 4X1RU 2D26C 1XVOA 4I7YH 1O2TA 4IGDA 1S6FA 2QXGA 1FIZA 4RSPA 1O3HA 2A45B 1FY3A 4JZEH 4H6SB 4D8NA 4YT7H 2SGEE 3A7WA 2GDDA 3BTQE 1O2ZA 1BMAA 3EA8A 1P2IA 3MO9A 1S6HA 1KDQB 1UTMA 1P9SA 1UHBA 3MU4A 3RMMH 4Q7YA 3LJJA 3URCA 2A0QB 1OWJA 4TPIZ 2ZFTA 2GV6A 1UVOA 4HTCH 2NU0E 1EATA 2P8OB 3A84A 3LH1A 4X1SU 3SI3H 3P95A 2FI3E 4X8UH 5EOKA 1Q31A 1HAGE 3P70B 2BLWA 1OX1A 4MVNA 1NZQH 4AYVB 3BTWE 3GCHB 5JPMH 5EG4A 1GVKB 1NFXA 4YT6H 3RXDA 3SNBA 1Z6JH 3ZV9A 1YLCA 1K1NA 4YLUA 1AY6H 1Z8RA 1PYTD 2QN5T 1YC0A 2I6QA 1NU7B 4GAWA 1TGTA 3EAJA 1AGJA 4TWYA 4ABDA 4INHA 1MH0A 4YOJA 2A7JA 3T5FH 3A87A 2NU3E 3P8NA 2UUFB 5FX6A 1P0SH 1Z8IB 4XOJA 3GCTF 1W13U 2BHGA 1VITH 4MNXA 2AYWA 4IN1A 3EDXB 2UWPA 3T25A 3QZQA 5C3NA 4FUHA 2ALPA 2CF9H 2XWBI 4DG4A 1C5RA 3TITA 4JZ1A 2ZFRH 5JDUB 1TB6H 2J2UA 1KTSB 4ABAA 3A89A 3B8JA 4UFGH 1L1GA 2XCNA 5HYOA 2GMTC 2JH0D 6ESTA 4Y76A 2PHBA 1HXEH 2XWAA 2ZU5A 8GCHF 2A7CA 3V7TA 2FOGA 2Y81A 4BOHA 4HGCA 1OXGA 1GMDF 1W7XH 2VJ1A 1GHXH 4RKOB 1IQEA 1DFPA 1HNEE 1EP6A 1FLEE 3ZZBA 1GI3A 2ZCKP 3T26A 4LZ4B 1A3EH 5I46H 3CP7A 1CVWH 4ZAEA 2STBE 4JYUH 2GCTC 4GHTA 1TABE 1GPZA 1C1VH 2C93B 4GCHF 1KLTA 2I6SA 3FANA 4GHQA 3PLKA 4B71A 1KSNA 2FLRH 1G37A 1QTFA 4DJZB 1TMBH 2B8OH 1AN1E 2ODPA 2WPJS 5L2YH 2A4QA 4X2WA 1FAXA 7KMEH 2ZA5A 1A1RA 1KXEA 4ZHLU 4NG9H 2VB0A 1OWIA 3Q3YA 1ELVA 1O5DH 4FUEA 2BD7A 2GVFA 2ZU2A 2Y5GA 3RXKA 1T8NA 4H6TA 1CA0B 1K2I1 1XUHA 1DITH 1D3TB 1AE5A 4I31A 3AAUA 1NN6A 2R2WU 4CHAB 3BTGE 3ZZ4A 2FOMB 2ZG0H 3GDVA 1UTPA 1GMDG 4ABBA 1GI0A 3ZV8A 3PV4A 1H8IH 3KGPA 3PWCA 1K1JA 4VGCB 4AFQA 4FUIA 4FU9A 1TWXB 2W7UA 1CBWB 1SLUB 3ATIA 1ABIH 2WPKS 4I32A 2ZDMA 1TX7A 3ATLA 1HAVA 3FZDA 3MH6A 4NA7A 3A88A 1WOFA 3HK3B 3FP8E 1FNIA 1DY8A 3CS0A 4E05H 1RTKA 3I78A 2C3SA 1O30A 2ZCLP 4LK4A 3GCOA 1RIWB 4YOGA 4OS5A 2FZZA 1ESTA 1A3BH 2PKSB 4O9VA 2BDBA 4BAKB 3P6ZB 4WXIA 5DP9A 4J1YA 2QXHA 5T3HA 1FPHH 4Y71A 1ZOMA 1C4V2 4WY3A 1EP5A 3QTOH 1NRQH 2GCHF 5EXLA 3PM3A 1OSSA 4JZDH 2ZGXH 3AVZA 1PPCE 1YM0A 3CENA 1NS3A 1J17T 2BDHA 1SGQE 1CU1A 1T8OA 4JMYA 2OXSA 3WY8A 3BTTE 4U30A 2O8TA 2W3KA 3RXJA 2W26A 3GDSA 1YYY1 7ESTE 2Q1JA 4ZMAH 4DIHH 4KTUA 4IBLH 3TGKE 1FY5A 1BJUA 1OP2A 5FCKA 3LGIA 2QA9E 3LDXH 1MD7A 1V2OT 2LNCA 3MH5A 1SFIA 3T62A 2AFQB 1V2PT 3GY4A 3LGWA 1MZDA 4FUJA 1BTXA 1P04A 1PQ8A 5T6FA 4Y8YA 3RXFA 3SUEA 2GP9B 3H7TA 2BDIA 3ZVBA 1IQFA 1IQMA 1QJ1B 3BN9A 2VIDA 2YNBA 1O3PB 5F8ZA 1ELCA 5FHTA 1FY1A 1MTNC 1NESE 3KHVA 5C1UA 1LKBA 3PB1E 2HGTH 3PLBA 4Z6AH 2HALA 2CXVA 1G3EA 1GBIA 3SU5A 2ZHWH 1F5LA 2QY0B 3D23A 1XX9A 2F9OA 5EQQA 4AB8A 4HI3A 1HXFH 2ZPRA 1HJ8A 1HRTH 2VGCB 3SUGA 4AFSA 4A92A 1HGTH 5LGOA 5EQSA 1NRRH 3SNEA 1RRKA 4X6MA 2Q6GA 1BTHH 1YPLH 1GMHG 3A83A 2OQUA 4ZKSU 3UR6A 3UNQA 3QK1A 5FX5A 1P2NA 4D9RA 2JH5D 1RTFB 1AB9C 1SQAA 4I8GA 2XC4A 1S85A 1XVMA 2XBVA 5L30H 3KF2A 3TU7H 3SU2A 2CHAB 1C2GA 4WWYA 4Q7ZA 1Z1JA 3VB5A 1O2VA 3K6ZA 4NA9H 1F92A 5AFYH 1U6QA 2BLQA 4Y0ZE 1YPGH 4O03A 2EI6A 3UIRA 1C5OH 1PYTC 9ESTA 1C1QA 4BTUB 2ZTYA 4Q2KA 4UDWH 4DW2U 3PMHB 3SU4A 2BY9X 3TGIE 1JBUH 1C5MD 1SQOA 2VU8E 1UK2A 3PTNA 2UUYA 4OS4A 1ZR0A 4AOQA 2V0BA 1JIMA 1DVAH 2CMYA 4AZ2B 3DT0H 1L0ZA 2PLXA 5F03A 1D3QB 2ZTXA 2XBXA 1EOLA 1C1MA 1IHSH 1MKXK 2M5TA 1ZZZA 3F9GA 2NU1E 1GI5A 2BD8A 1V6DA 4Y8XA 1KIGH 1Y3UA 4X6OA 4ABHA 3W94A 3BG4B 3NUMA 1BRBE 1P57B 1GI4A 4JYVH 1HIAB 5HM2A 1EJAA 1ARBA 1RXPA 2SGAA 1IQGA 1S0RA 3TGJE 2AGGX 4INLA 4INKA 3MU0A 3LIWA 1NT1A 2GV7A 2K1QA 1P3CA 3UFAA 2GT7A 2HNTC 1QFKH 4CRBA 3OU0A 2O8LA 2A32A 1O2GH 4Y0YE 1JRTA 1GL0E 2IJOB 3RXPA 5SGAE 1EKBB 1H9IE 5JB8S 2BM2A 2VWOA 2H5DA 2KAIB 1QRZA 1ZYOA 3DFJA 1SLWB 3SU6A 4GLYA 1FN6A 1FN8A 1O38A 3QDZB 4WXVA 5CHAB 4FUBA 2B9LA 4I8KA 5EW2H 1C1SA 4WMEA 4DVAU 3TPIZ 1HFDA 2AIPA 1ZTKA 1K1PA 4U2WA 1YCPH 4NWKA 3RXVA 3SU0A 4FUCA 3UQVA 1YPKH 1AZZA 4NWLA 2ZU4A 2XRCA 1C5XB 2UWOA 1QA0A 3LH3A 2F9NA 4WJG2 4NIVA 1CGIE 1P9UA 1TAWA 2ALVA 1FAKH 1SVPA 2FPZA 4OS2A 4U01A 4A1XA 3S9CA 8KME2 1LPZB 4H42U 2EI7A 3FAOA 5FBIA 1BMNH 1DICA 3BTEE 4AN7A 2FYRA 1QNJA 1TPSA 3FZZA 3NKKA 4CRCA 1XXFA 2PFEA 4OS7A 2JETB 4XFQA 2SGQE 3U8OH 1A7SA 1HJAC 4MPVA 4B2BA 4RKJB 2ZDLA 1AU8A 3MMGA 3PMAB 3SI4H 2OINA 3TLOA 1TX6A 1DXPA 1C5NH 1H4WA 1OS8A 3KQEA 3P17H 4BXSA 1HBTH 1TNKA 1TA6A 1IQNA 4OGXA 2ASUB 4AG1A 2F9VA 2PSYA 3FP7E 3GCTG 1UTKA 4XBDA 1E36B 2XTTB 2VWNA 1MKWH 1J16A 1OWDA 2AMDA 2GTBA 1TE0A 1Y5AT 2BDAA 2HVXA 2ZKSA 4AGJA 1MTVA 1LTOA 1O2UA 1YGCH 1ACBE 1O2WA 1O5FH 2KAIA 1ZMJA 2UUJB 2FOBA 2J34A 1FY8E 5GJ4B 2OUAA 3RU4T 4TY6A 1BRAA 2ZC9H 1CO7E 2R3UA 1VCQA 2R0KA 2VVVA 5HM9A 1L4DA 1BTZA 2ZHQH 2G52A 5HMAA 2ZPSA 4CRGA 1Y3WA 3ODFA 2BDGA 2ESTE 3PMJA 3ZYDA 2ZIQH 5PTPA 1G30B 1V2KT 2AIQA 1ELBA 1KXFA 1LHFH 1G36A 1BMMH 1JOUB 1VCPA 2ILNA 1BB0B 1DWBH 2FEQH 1AVGH 3V3MA 1AKSB 1IHTH 4K3JA 3SHCH 2Z3DA 1PFXC 4A1TA 5IYTA 3R0FA 2XC5A 1QL9A 3ZZ5A 1PQ5A 1A61H 4ABGA 2P3FH 3A7ZA 5A0BA 2EI8A 1UMAH 4YZUA 1TNHA 1CT4E 2AEIH 2H6MA 2V35A 1GJ8B 3O8DA 1O5CB 1MTSA 1GBBA 2XXLA 2P3TB 4CH2B 7GCHG 1EPTB 5ETXA 3HGNA 4D76A 1PPHE 1QB1A 3K6YA 1O3NA 1C5LH 2BY7X 4UFFH 1KTTB 3RXOA 2SGFE 3BTDE 1TLDA 1QBNA 3KN2A 4HFPB 1UTQA 1WBGB 1ZRBA 1BT7A 1CGJE 3LGUA 2BTCE 1O3DA 1GWAA 4B73A 5E0GA 3MYWA 4BTTB 2H2ZA 4ZKOU 1VITG 3NPSA 3DFLA 1UK3A 1AVXA 4AYYB 2VVUA 1HAOH 3K9XB 1FXYA 1KXDA 3SN8A 1O2MA 2H9TH 2Z94A 1LVMA 3OTJE 3F9HA 3M3SA 1GBCA 1QJ7B 1QQ4A 1AFQB 1NO9H 3DA9B 5FBEA 4CREA 2ZGHA 1ANCA 1FJSA 4F49A 3TK9A 4U32A 2W3IA 2A4GA 3U8TH 3RU4E 1NY22 1DANH 2P3UB 1SOZA 4TPYA 2ZHFH 1EAXA 1C1TA 1SGIB 1IQLA 1WAYB 1G32B 4ZKNU 4ABIA 1KXCA 3ZYEA 1C4U2 1DDJA 2WYJA 1DM4B 1C5PA 2QIQA 3GY5A 1QQUA 3NK8A 5E0JA 3KEEA 1V2VT 3HKJB 1P06A 3LOXA 1KYNA 3SORA 1K21H 3RM2H 2ZO3H 1ZLRA 2WPIS 1W2KH 3M35A 4ISHH 4IC6A 1HAIH 3T2NA 3BTFE 1N8OB 2RG3A 3MNBA 2FOHA 3MFJA 1SGFA 3KNXA 2FMJA 1H8DH 1SHHB 2VINA 5EXMA 1GCTC 1EPTA 1TPPA 1C2JA 1QBOA 2ANMH 5A8ZA 1C5ZB 1FZZA 3T27A 5I25A 1K9OE 1MTWA 1O2NA 5GWZA 2BOHB 1GJAB 1GHZA 3S7HB 1MUEB 1BQYA 1DLKB 1F5RA 1ZHRA 1O3EA 3PO1B 5DG6A 2Z9IA 5BPEA 4YLQH 2RCEA 5A2MH 2R2MB 1QCPA 3SNCA 1O2JA 1UTNA 3N7OA 1C2KA 4GSOA 4ISOA 5ABWA 3GOVB 5CE1A 2Z7FE 1GI8B 1FV9A 1LPKB 4B1TA 1GCDA 3ZVGA 3QLPH 1VITF 2OP9A 1O3JA 3P92A 2ODYB 4A6LA 4AFZA 3MNXA 3BIVH 3TIUA 4FUGA 3RXHA 2ZGJA 3KCGH 3E16B 3SV6A 2IPHA 3A7XA 5J4SA 3A8CA 1O3GA 1W12U 1IQIA 3ZZ3A 4OS6A 1ZHPA 5T6GA 1MBMA 1P2QA 1O37A 3SGQE 1SI5H 1O2IA 1O2PA 1C1RA 2FS8A 3M3VA 1GI2A 3V12A 1D3PB 1MAYA 1GHAG 4YTAA 1EB1H 1O3AA 3NZIA 5FPYA 1LQDB 1G2MA 1BHXF 1O5AB 1O2LA 4UD9H 1J8AA 1Z1IA 3VPKA 4ISIH 4IW4E 1TQ7B 2ZEBA 4YESB 2VVCA 3RLWH 5K0HA 1QRXA 4MPUA 1ETTH 1O2OA 1W11U 4GUXA 1N6XA 1HUTH 1GBDA 2VIOA 4AX9H 3VGCB 3VB3A 3PYHA 1BITA 1L4ZA 1UCYH 3VXFH 1PPGE 3SGAE 1WSSH 3SV7A 1C2HA 1W14U 3M37A 1W8BH 1TRYA 5BRRE 3RMOH 4ESTE 2WPHS 4WH6A 2AGEX 3PTBA 1BJVA 1LO6A 1GG6B 1MTUA 4ISLA 1K1OA 1WYKA 3E6PH 3T28A 1OWHA 3TJOA 3P8FA 2SFAA 4NCYA 3SQEE 2LPRA 3MNCA 1WTHD 3STJA 1BA8B 1YPJH 2ZI2H 1IQJA 1AUTC 1ZRKA 1XKBC 1GJ4H 1XUGA 5E2OA 1SG8B 2WV5A 1JRSA 3C1KA 1AFEH 3MOCA 2QC2A 2STAE 3A8AA 1SL3A 2P59A 2Y6TA 4DT7B 1TGNA 2H9HA 2O8WA 1L1NA 1GHWH 5T6DA 3M5LA 2AMQA 3A82A 1C5UA 3BTHE 3BF6H 1C2IA 4CBOA 1GVZA 2FESH 3EA7A 4MNYA 4TYDA 2Z6BD 1P2JA 3UPEA 1HAVB 5DKMA 4ZHMU 1C5TA 3ZZ9A 1A4WH 1W3CA 1KLJH 2J4IA 4JK6A 4MDSA 3GDUA 1FONA 3ZZ6A 1QURH 1P09A 1HAYB 3PMBB 4KGAA 1FUJA 5GXPA 2HNTF 1BZXE 6CHAC 1P3EA 1HAHH 3HK6B 2A7HA 4WF8A 1BBRK 1SC8U 2RA3A 2QYIA 2BXTH 1UTJA 2PTCE 5DO4H 1VGCB 1F0UA 3W95A 4NIWA 3GY2A 1FDPA 3LKWA 4CRDA 3E0PB 2FOAA 2XYAA 4YO9A 1XMNB 1AKSA 1GI1A 2ZU1A 1B0EA 1KDQA 1ANBA 2PTNA 5HXFA 4GCHG 3U8RH 3OX7U 2VWMA 2GD4B 1EAWA 2J95A 3ODDA 2FODA 5EU8A 3U69H 3T29A 1DWCH 1GI6A 2ANYA 2GX4A 2O8MA 3EA9A 2WUBA 1HLTH 1O2HA 5GCHG 2HPPH 4D7GA 4UFDH 3F9FA 1ELAA 5C2ZA 3M7QA 8ESTE 1DOJA 1TA2A 1T8MA 3GY6A 3H5CB 2Y5HA 3D65E 3JZ1B 1BBRH 2GKVE 3F1SB 2ZGCA 1DUAA 1E35B 1GGDB 4JZIA 1EJNA 3UTUH 2OC8A 1QJ6B 4I33A 2OCVB 3E3TA 2HNTE 1VR1H 1T31A 3TH4H 5B6OA 8LPRA 5C20A 2A1DB 3S69A 3UY9A 1TNLA 3GISB 5ESTE 2IOTA 2G51A 1ZTLA 1CA8B 2ULLA 3HPTB 4ABEA 1L1JA 2HOBA 5DGJA 3K65B 4NGAH 1DSTA 3LPRA 1GDQA 1W7GH 5GDSH 3V13A 1LHEH 1ZPCA 5EPYA 3HATH 1CHGA 4K60A 2TGPZ 1JXPA 4CR5A 1YPEH 5LPFA 2P8OC 4ZUHA 1YPHC 1V2TT 1YKTA 4A1VA 4X1PU 1DLEA 1AMHA 5JBTA 7GCHF 1KXBA 3RMNH 3ATMA 1AE8H 1S83A 3GCHC 3C27B 3VEQB 1MCTA 1TGCA 3M7TA 1ESAA 1ELFA 2OC0A 2D2DA 1GJ7B 2BQ6B 1GBAA 2BLOA 4AB9A 1HAPH 5DPAA 1YF4A 2A4RA 2G8TA 1OYTH 4BAQB 4X6PA 1H9HE 2Z9KA 2ZF0H 3FFGA 1WCZA 3AW1A 1O34A 3E90B 2J9NA 3A81A 3RLYH 2TGTA 1DWEH 1EOJA 4KELA 3ATKA 3FVFB 3SNAA 4CBNA 1Y5UT 1FQ3A 1QB9A 1CE5A 1RJXB 3D49H 4O3TA 4UE7H 2RDLA 1YPHE 4AGKA 1P02A 1EQ9A 5A09A 1J14A 2CGAA 1LDTT 2OC7A 1CSOE 1V2RT 3UUZA 1LVBA 2BXUH 3TJNA 2ZTZA 1NRPH 2OD3B 1O2YA 3QUMP 1NM6A 4MPWA 1MKXH 4RN6A 2BY6X 1ABJH 1ELDE 4I8LA 2GMTB 1K1LA 2BMGB 1ZSJA 3M5OA 4X8VH 4NZQA 2BD3A 5LH8A 2D1JA 5AHGH 4KTSA 3RXAA 2TGAA 3ESTA 1P8VC 5K7RA 2VWLA 2BDYA 2BVXH 2C90B 2C8YB 5JB9S 1HAXB 1O5EH 1Y3XA 2XC0A 2ZDAH 4OS1A 1RGQA 2NU4E 2Y7ZA 1QB6A 1JIRA 1TMUH 3MWIU 1TYNA 1UTOA 1IOEA 3ZZDA 3LONA 3SO3A 1XM1A 1ZPZA 4B2AA 1SR5C 2QXIA 7LPRA 4PROA 1EUFA 2GCTB 2PWXA 2P94A 1V2UT 5AVDA 1GHVH 3RXTA 3TH3H 3SJ8A 4LZ1H 1PPZA 5C1YA 5F8XA 1C2LA 1A5HA 2ZCHP 1QRWA 3CS7A 1P2KA 3D62A 4GVUA 5FCRA 3ATWA 4DCDA 3MU5A 1LCYA 5EW1H 2TRMA 1V3XA 1HDTH 4MNWA 1SMFE 3VXEH 1GMCF 4A7IB 2ZECA 1TMTH 1QA7A 1C1OA 1DS2E 1AIXH 1NFUA 9LPRA 5C5NA 3MHWU 1CT0E 4O3UA 3A7TA 3GYLB 4JYTA 2QV1A 3SW2B 1XXDA 1OWEA 1ANDA 2CN0H 3ITIA 1ZMLA 4K5ZA 3KQDA 1ZJDA 1HCGA 2BZ6H 3B23B 4AFUA 3F9EA 1ANEA 1CA0C 1SHYA 1SGNE 2BB4A 1O3FA 1MAXA 1O33A 1BCUH 2B0FA 4NFEA 1T7CA 2RA0A 4CHAC 1F2SE 1K22H 4R0IA 1UVTH 1H1BA 2JH6D 3KIDU 4VGCC 3EE0B 1GI9B 2AH4X 1CBWC 4KKDA 4O97A 4ABFA 3O8RA 4HZHA 1H9LB 2AMPA 3L33A 1MBQA 1QR3E 1SFQB 3TVJB 1WV7H 1QHRB 1QIXB 1SOTA 1TALA 1TFXA 2P16A 3S9BA 2BYAX 1UCYK 1ETSH 1GHBF 2ZFPH 1ZSKA 3LC5A 2ZDVH 3DUXH 1Z8GA 1HB0B 1SGRE 1O3KA 4GPGA 1HIAA 2WV4A 1RIWC 4MNVA 1LVYA 2R0LA 5A0AE 2PKSC 1NFYA 1O35A 4CR9A 2PKAB 2ZHDA 1DXWA 5J4QA 4Y11E 4D9QA 1UO6A 1C2EA 4WMDA 1Y3YA 3I29A 2Z9JA 2F3CE 2JKHA 3KQBA 4IN2A 1GJ9B 3DD2H 1EASA 1GBJA 4ZROA 1K28D 3SQHE 4SGBE 1F0RA 3TH2H 2Y5FA 1CT2E 1VZQH 1FI8A 1O5BB 1ELEE 1AWFH 1PQAA 1YBWA 2FTLE 2G81E 2OQ5A 4K1EA 1UVUH 4ZH8A 1TRMA 1GBKA 3SUDA 2P95A 2WINI 2NWNA 1C1PA 2UUKB 4MLFB 5G4BA 1O39A 2EC9H 2ZFQH 2F83A 3E1XB 4FUFA 4OGYA 1DX5M 1O3OA 1MD8A 4LOYH 1XUIA 4FU8A 1EZXC 2CJIA 2QF3A 2XNIA 1TOCB 2SGDE 5FAHA 1AQ7A 3ELAH 3SJKA 1MTNB 4B74A 1A5GH 3MH7A 4BAHB 2G00A 2XBWA 1SGCA 1GBHA 5AFZH 2V3HH 1AHTH 1E34B 1A0HB 2A31A 5TCCA 1AO5A 1TBZH 4Y10E 2TBSA 2ANKH 1OPHB 4I8JA 1EAUA 3QO6A 1K1IA 1ZGIA 2ZNKH 2VGCC 1HAZB 3LT3A 2VIWA 5A0CA 1BRCE 2Q6DA 4X8SH 3F68H 3SGBE 3SZNA 5EXNA 1DWDH 1OYQA 4BANB 1D6RA 3EQ0H 3IITA 1TGSZ 4XBBA 1DE7H 3TK6A 1XKAC 1NTPA 1TBQH 2GDEH 2PKAA 1AB9B 2BY5X 3VFEA 1W0YH 1UK4A 2J92A 3KL6A 1THRH 3NXPA 1D3DB 1NRNH 1LHDH 2FWWA 2V3OH 2CHAC 1JWTA 2ZZUH 2R9PA 1GJDB 1TNGA 1QGFA 2D8WA 2THFB 2YOLA 2P93A 3EGKH 1IQKA 2ZU3A 2Y82A 3LC3A 1BTPA 1GBFA 4Y6DA 1GL1A 3SBKA 1ARCA 5FPSA 2Q6FA 3TNSA 4K69A 3GCNA 2FI4E 3BSQA 1B7XB 3SOSA 5GCHF 3M5MA 1CGHA 1UJ1A 3E8LA 3BIUH 2C8WB 3RC4A 1IQHA 1BTUA 1V2NT 1GJCB 2O9QA 1QY6A 3ZVEA 2A5IA 3Q76A 2FDAA 3S7KB 1O3LA 3BG8A 4DGJA 2ANWA 1ELGA 4XDEA 4CH8B 1MMJN 2G55A 3BG4C 3UWJH 2QGRA 1V2JT 3LJOA 2FX4A 1WU1A 1Z8JB 3RMLH 3L6PA 1G2LA 2EEKA 3QX5H 1KXAA 1LKAA 4E06H 1ZJKA 3ENSB 1GVLA 3GY3A 4ZKRU 1CHOG 3UNRA 4KP0A 3QGJA 4K2YA 1TNIA 1HYLA 2BD4A 2BD9A 2VNTA 3OY5U 3MO3A 5HGGA 2FM2A 1AVWA 2GCHG 1OP8A 3MO6A 1TIOA 1NC6A 4WH8A 1WQSA 4UEHH 4DY7B 5IDKA 1GI7B 3HGPA 4DIIH 1TPOA 2PGQB 5C5OA 1SLXB 5CHAC 3F6UH 1S84A 3A80A 4FVBA 3ZZ7A 1JMOH 3ZZAA 4Z0KA 3RDZA 5DP7A 1C5SA 1KLIH 2FI5E 2R3YA 3RXUA 1QL8A 2GZ8A 3AW0A 1G3DA 1AI8H 1V2ST 2BQ7B 1SGEE 1V2LT 2EA3A 4H4FA 2PV9B 1C2FA 2GGVB 3MNSA 3UQOA 2BX3A 4WMFA 4SGAE 4ZHAA 4K8YA 1XUJA 5C67A 2OBOA 1SPJA 2PW8H 4XSKU 1BDAA 4WVPE 2Z9GA 3SU1A 2DUCA 3O8BA 1TBRH 1ZPBA 4IMZA 4E7NA 4K8BA 1O32A 3K2UA 1MU8B 2JETC 1W10U 3IWMA 3U98H 1TNJA 3BEUA 1HJAB 4JK5A 4TWWA 3PWBA 3ZVDA 1GMHF 3PROA 3Q77A 3AAVA 1LVOA 1CHOF 1P2OA 3RM0H 1LQEA 3RXQA 3OY6U 2HWLB 5C1XA 3M36A 4YM9A 2PGBB 3RXIA 1EXFA 5ESBA 1F5KU 3OSYA 1YCPK 5E0HA 2FOEA 1AZ8A 5LPEA 2G4UA 5CMXH 3VB7A 1S81A 2A5KA 3QZRA 4Y7BA 5GPIB 1MZAA 4BAOB 1XUFA 1BHXB 2C8ZB 5DP5A 3SV8A 2SGPE 4X2XA 1Y59T 1V2WT 1VCWA 3GY8A 1C9TA 5DP6A 3S0NA 1LHCH 1HPGA 4ZXXH 2XCFA 2YNAA 5F8TA 2W7SA 3SUFA 4BTIB 4B76A 4CRFA 1NROH 6GCHF 1F0SA 2W5EA 1MQ6A 3O8CA 5EODA 1SLVB 2GZ9A 2ZFFH 2FO9A 4R8TB 1E37B 4AORA 1J15A 1V2QT 4YOIA 3A8BA 2H1UA 3L3TA 2V6NA 2VH0A 5JBAS 2HRVA 3MTYA 3OYPA 4Y8ZA 1ORFA 3M7UA 2SNVA 2BD2A 2PUXB 5DP4A 4TY7A 3UWIA 2FLBH 4X1NU 1Q2WA 1D6WA 3RXRA 2BX4A 3I77A 4X2VA 1GBMA 2Y80A 1DUEA 1INCA 1V2MT 1Z6EA 1A0JA 3ZVCA 2PSXA 2OLGA 3SNDA 2OTVA 1B5GH 2XW9A 1ESBA 4IMQA 2ZFSA 1K1MA 1OKXA 1BRUP 4FVDA 5H4IB 2J94A 1GDUA 1EPTC 1PPEE 5E2PA 2BOKA 1PJPA 3RXGA 4XE4A 4FU7A 3A7VA 3ZVAA 2QF0A 1O3IA 2FOCA 2CV3A 4X0WU 5LPRA 1XUKA 3QWCH 3A7YA 1C5WB 4NIXA 4QT8C 1P05A 3B9FH 1T4VH 1C5YB 2WPMS 3TNTA 4BXWA 1GMCG 1W0ZU 4ZXYH 3MU1A 4MTBA 1AD8H 2HLCA 1BIOA 4Q7XA 1A46H 3FP6E 1TRNA 1L2EA 3RXEA 2G4TA 1AFQC 3RXBA 3KQCA 1QBVH 1TQ0B 3GICB 3NWUA 2F9UA 2QXJA 3JZ2B 2TIOA 1G3CA 3ZZ8A 3LGVA 1HJ9A 6GCHG 3G01A 1MQ5A 3RUOA 2H5CA 3UNSA 5TCAA 3UR9A 1SGTA 2QCYA 4NFFA 2OBQA 3S9AA 4Y7AA 5JBCS 4Y79A 4NSYA 2ZPQA 1GBTA 1S82A 1PQ7A 2ZDNA 2ZQ1A 1AWHB 2O8UA 3H7OA 5JYIA 1HV7A 1ZHMA 2ODQA 1EZSC 2ZHEH 3AASA 3IG6B 2A2QH 3VB4A 3Q00A 1O31A 3RXSA 5JBBS 1J9CH 4LXBH 1N8OC 3BTKE 1EJMA 2Z3EA 1O5GH 1GCTB 1GHYH 1P03A 1A5IA 2Z3CA 2ZGBH 3SHAH 1MU6B 4UFEH 3UREA 2G5VA 1O3MA 3GYMA 3QGNB 1C1UH 1SB1H 1P11E 5EGMA 1WQVH 3STIA 3RXMA 1LPGB 2ZQ2A 1PPBH 3TK5A 5FPTA 4AG2A 4B75A 1N6YA 1Q3XA 4THNH 4D7FA 3LGTA 3TJVA 1G9IE 3P8OA 1E38B 2BVSH 3PO1C 1RTLA 1MCVA 2XBYA 1SQTA 2H9EH 2C8XB 2A5AA 4JCNA 1EAIA 5DK1A 2HPQH 2QAAA 1DSUA 5TJXA 1A0LA 1FPCH 2TPIZ 4KTCA 2VH6A 4UONA 2FP7B 2Y7XA 2ZWLH 3RC5A 4FXGH 1P01A 4XBCA 5DP8A 2B7DH 5E8EH 3U1JB 4DOQA 4ABJA 1NPMA 3HKIB 3E0NB 1ETRH 1SSXA 4X8TH 2IN2A 1X7AC 2C4FH 1M9UA 2ZDKA 3V0XA 1E0FD 4MQAA 1C9PA 2FTMA 1Y3VA 3UOUA 2PR3A 1THSH 1O0DH 2AS9A 1C5QA 1O2RA 5L6NH 4BNRA 2A4OA 3RP2A 1YP9A 1S0QA 1FMGA 1S5SA 1B0FA 3Q3KA 3BEFB 2PUQH 1D4PB 4Q80A 1Y8TA 1UVPA 1ZTJA 1UVSH 1FY4A 1BMLA 8GCHG 1C2MA 1ID5H 4ASHA 3BV9B 2WUCA 3RXCA 3SJOA 1BOQA 2AGIX 4BAMB 2BVRH 1LHGH 5F6MA 2FYQA 1O2QA 1ZSLA 5EQRA 3ZZCA 1A2CH 1ELTA 1YPMH 1P10A 4IC5A 3VGCC 2BLVA 3RU4D 1T32A 1Z7KA 2J38A 1GHAF 4B2CA 1DT2A 1O2KA 1BBRE 2BD5A 1EZUC 5GIBA 1N1LA 3P8GA 2SNWA 4IS5A 1SGYE 1CQQA 5AF9H 4X6NA
chains in the Genus database with same CATH superfamily
2CF8H 5A8XA 1GBLA 1GG6C 2FIRH 1F0TA 1TONA 1SKYE 3M5NA 5DJ7A 2BQWB 5DP3A 1VJAU 3SU3A 1EZQA 1GJ6A 4K1TA 4I8HA 3UOPA 1UTLM 3BTME 1O2SA 3BEIB 1GJBB 1TPAE 3NCLA 4NSVA 1LMWB 1OOKB 3F2HA 2FOFA 1G3BA 4X2YA 2FX6A 1C5VA 1NU9A 1OWKA 3Q3XA 3A85A 2UWLA 1WTGH 1BTYA 3SV9A 1RD3B 1SGFG 3QN7A 1GHBG 1O3CA 3UB0A 3U9AH 1NRSH 2ZP0H 2GT8A 1TX8A 1Y5BT 4K1SA 4NIYA 3N99A 2WPLS 4F4OC 3M3TA 2A2XH 2BDCA 3PLPA 3A86A 1THPB 3VB6A 3R3GB 2F9PA 1O2XA 1T8LA 2BY8X 1UHBB 2VIPA 2Z9LA 4MPXA 1C2DA 4ISNA 5A8YA 1C4Y2 4E7RG 2B5TB 6CHAB 1F7ZA 3GY7A 3URDA 1SGPE 1PPFE 3EYDA 4FUDA 1FIWA 1DY9A 1MKWK 6LPRA 1VGCC 1BTWA 1WUNH 1AUJA 1T4UH 3QTVH 5EPNA 5FXLA 3MQKC 1RS0A 2TGDA 1QL7A 3TJUA 1P2MA 2DE8A 2DE9A 3DHKH 3OEED 1YLDA 3E91A 4JZFH 1TOMH 2AERH 4MG3A 2KR7A 1TGBA 3LU9B 3SJIA 4CRAA 2F9BH 1VJ9U 1O36A 3RXLA 2G5NA 4A5TS 2VIQA 2GZ7A 1GDNA 3ZVFA 1EB2A 1GJ5H 4B6FA 1NFWA 1ZGVA 2FS9A 1C1WH 4X1QU 2VIVA 2BZAA 1O3BA 1SBWA 1KY9A 1SGDE 1UCYE 1P12E 3RC6A 2NU2E 3SJ9A 4DURA 5DN6D 3SV2H 2KCPA 5EJ1A 1IAUA 1D9IA 3LGYA 5T1VA 2F91A 1OP0A 1C1NA 1DPOA 5L2ZH 4J2YB 1RFNA 3M61U 3A8DA 3MI4A 3MU8A 1BUIA 3MH4A 1EX3A 2OC1A 1GGDC 2FXRA 4NZLA 4M7GA 1GBEA 1ZMNA 3U1IB 4NA8A 1YCPM 2WYGA 1Z71A 4X1RU 2D26C 1XVOA 4I7YH 1O2TA 4IGDA 1S6FA 2QXGA 1FIZA 4RSPA 1O3HA 2A45B 1FY3A 4JZEH 4H6SB 4D8NA 4YT7H 2SGEE 3A7WA 2GDDA 3BTQE 1O2ZA 1BMAA 3EA8A 1P2IA 3MO9A 1S6HA 1KDQB 1UTMA 1P9SA 1UHBA 3MU4A 3RMMH 3WWBA 2WPDD 4Q7YA 3LJJA 3URCA 2A0QB 1OWJA 4TPIZ 2ZFTA 2GV6A 1UVOA 4HTCH 2NU0E 1EATA 5FL7D 2P8OB 3A84A 3LH1A 4X1SU 3SI3H 3P95A 2FI3E 4X8UH 5EOKA 1Q31A 1HAGE 1COWD 3P70B 1YY3A 2BLWA 1OX1A 4MVNA 1NZQH 4AYVB 3BTWE 3GCHB 5JPMH 5EG4A 1GVKB 1NFXA 4YT6H 3RXDA 3SNBA 1Z6JH 3ZV9A 1YLCA 1K1NA 3DCLA 1AY6H 1Z8RA 1PYTD 2QN5T 4YLUA 1YC0A 2I6QA 1NU7B 4GAWA 1TGTA 3EAJA 1AGJA 4TWYA 4ABDA 4INHA 1MH0A 4YOJA 2A7JA 3T5FH 2K8IA 3A87A 2NU3E 3P8NA 2UUFB 5FX6A 1P0SH 3OTPA 1Z8IB 4XOJA 3GCTF 1W13U 2BHGA 2L74A 1VITH 4MNXA 2AYWA 4IN1A 3EDXB 2UWPA 3T25A 3QZQA 5C3NA 4FUHA 2ALPA 2CF9H 2XWBI 2YMSC 4DG4A 1C5RA 3TITA 4JZ1A 2ZFRH 5JDUB 1TB6H 2J2UA 1KTSB 4ABAA 3A89A 3B8JA 4UFGH 1L1GA 2XCNA 5HYOA 2QE7D 2GMTC 2W6ID 2JH0D 6ESTA 4Y76A 2PHBA 4B6EA 1HXEH 2XWAA 2ZU5A 8GCHF 2A7CA 3V7TA 2FOGA 2Y81A 4BOHA 4HGCA 1OXGA 1GMDF 1W7XH 2VJ1A 1GHXH 4RKOB 1IQEA 1DFPA 1HNEE 1EP6A 1FLEE 3ZZBA 1GI3A 2XOKD 2ZCKP 3T26A 4LZ4B 1A3EH 2F43B 5I46H 3CP7A 3ZIAD 1CVWH 4ZAEA 2STBE 4JYUH 3U28C 2GCTC 4GHTA 1TABE 1GPZA 1C1VH 2C93B 4GCHF 1KLTA 2I6SA 3FANA 4GHQA 3KQ5A 3PLKA 2WSSD 4B71A 1KSNA 2FLRH 1G37A 1QTFA 4DJZB 1TMBH 2B8OH 1AN1E 4YXWD 2ODPA 2WPJS 5L2YH 4RI0A 2A4QA 4X2WA 1FAXA 7KMEH 2ZA5A 3F0OA 1A1RA 1KXEA 4ZHLU 4NG9H 2VB0A 1OWIA 3Q3YA 1ELVA 1O5DH 4FUEA 2BD7A 2GVFA 2ZU2A 2Y5GA 3RXKA 1T8NA 4H6TA 1CA0B 1K2I1 1XUHA 3PV2A 1DITH 2CK3D 1D3TB 1AE5A 4I31A 3AAUA 1NN6A 2R2WU 4CHAB 3BTGE 1QZ8A 3ZZ4A 2FOMB 2ZG0H 3GDVA 1UTPA 1GMDG 4ABBA 1GI0A 3ZV8A 3PV4A 1H8IH 3KGPA 3PWCA 1K1JA 4Z1MD 4VGCB 4AFQA 4FUIA 4FU9A 1TWXB 2W7UA 1CBWB 1SLUB 3ATIA 1ABIH 2WPKS 4I32A 2ZDMA 1TX7A 3ATLA 1HAVA 3FZDA 3MH6A 4NA7A 5F53A 3A88A 1WOFA 3HK3B 3FP8E 1FNIA 1DY8A 3CS0A 4E05H 1RTKA 3I78A 2C3SA 1O30A 2ZCLP 4LK4A 3GCOA 5C17A 1RIWB 4YOGA 4OS5A 2FZZA 1ESTA 1A3BH 2PKSB 4O9VA 2BDBA 4BAKB 3P6ZB 4WXIA 5DP9A 4J1YA 2QXHA 5T3HA 1FPHH 4Y71A 1ZOMA 1C4V2 4WY3A 1EP5A 2LELA 3QTOH 1NRQH 2GCHF 5EXLA 3PM3A 1K0HA 1OSSA 4JZDH 2ZGXH 3AVZA 1PPCE 1YM0A 3CENA 1NS3A 1J17T 2BDHA 1SGQE 1CU1A 1T8OA 4JMYA 2OXSA 3WY8A 3BTTE 4U30A 2O8TA 2W3KA 3RXJA 2W26A 3GDSA 1YYY1 7ESTE 2Q1JA 4ZMAH 4DIHH 4KTUA 4IBLH 3TGKE 1FY5A 1BJUA 1OP2A 5FCKA 3LGIA 1UW7A 2QA9E 3LDXH 3OFND 1MD7A 1V2OT 2LNCA 3MH5A 1SFIA 3T62A 2AFQB 1V2PT 2KCYA 3GY4A 3LGWA 1MZDA 4FUJA 1BTXA 1P04A 1PQ8A 5T6FA 4Y8YA 3RXFA 3SUEA 2GP9B 3H7TA 2BDIA 3ZVBA 1IQFA 1IQMA 1QJ1B 3BN9A 2VIDA 2YNBA 1O3PB 5F8ZA 1ELCA 5FHTA 1FY1A 1MTNC 1NESE 3FO8D 3KHVA 5C1UA 1LKBA 3PB1E 2HGTH 2V3MA 3PLBA 4Z6AH 2HALA 2CXVA 1G3EA 1GBIA 2KZ4A 3SU5A 2ZHWH 1F5LA 2QY0B 3D23A 1XX9A 2F9OA 5EQQA 4AB8A 4HI3A 1HXFH 2ZPRA 1HJ8A 1HRTH 2VGCB 3SUGA 4AFSA 4A92A 1HGTH 5LGOA 4TT3D 5EQSA 1NRRH 3SNEA 1RRKA 4X6MA 2Q6GA 1BTHH 1YPLH 1GMHG 3A83A 2OQUA 4ZKSU 3UR6A 3UNQA 3QK1A 5FX5A 1P2NA 2J98B 4D9RA 2YMSD 2JH5D 1RTFB 1AB9C 1SQAA 4I8GA 2XC4A 1S85A 1VKYA 3DSGA 1XVMA 2XBVA 5L30H 3KF2A 3TU7H 3SU2A 2CHAB 1C2GA 4WWYA 4Q7ZA 1Z1JA 3VB5A 1O2VA 3K6ZA 4NA9H 1F92A 5AFYH 1U6QA 2BLQA 4Y0ZE 1YPGH 4O03A 2EI6A 3UIRA 1C5OH 1PYTC 9ESTA 1C1QA 4BTUB 2ZTYA 4Q2KA 4UDWH 4DW2U 3PMHB 3SU4A 3UAIC 2BY9X 3TGIE 1JBUH 1C5MD 1SQOA 2VU8E 1UK2A 3PTNA 2UUYA 4OS4A 5HIZA 1ZR0A 4AOQA 2V0BA 5EIYA 1JIMA 1DVAH 2CMYA 4AZ2B 3DT0H 1L0ZA 2PLXA 5F03A 1D3QB 2ZTXA 2XBXA 1EOLA 1YWUA 1C1MA 1IHSH 1MKXK 2M5TA 1ZZZA 3F9GA 2NU1E 1GI5A 2BD8A 1V6DA 4Y8XA 1KIGH 1Y3UA 4X6OA 4ABHA 3W94A 3BG4B 3NUMA 1BRBE 1P57B 1GI4A 4JYVH 1HIAB 5HM2A 1EJAA 1ARBA 1RXPA 2SGAA 1IQGA 1S0RA 3TGJE 2AGGX 2GJGA 4INLA 4INKA 3MU0A 3LIWA 1NT1A 2GV7A 2K1QA 1P3CA 3UFAA 2GT7A 2HNTC 1QFKH 4CRBA 3OU0A 2O8LA 2A32A 1O2GH 4Y0YE 1JRTA 1GL0E 2IJOB 3KYFA 3RXPA 5SGAE 1EKBB 1FX0B 1H9IE 5JB8S 2BM2A 2VWOA 2H5DA 2KAIB 1QRZA 1ZYOA 3DFJA 1SLWB 3SU6A 4GLYA 1FN6A 1FN8A 4OM9A 1O38A 3QDZB 4WXVA 5CHAB 4FUBA 2B9LA 4I8KA 5EW2H 1C1SA 4WMEA 4DVAU 3TPIZ 1HFDA 2AIPA 1ZTKA 1K1PA 4U2WA 1YCPH 4NWKA 3RXVA 2XNDD 3SU0A 4FUCA 3UQVA 1YPKH 1AZZA 4NWLA 2ZU4A 2XRCA 1C5XB 2UWOA 5DSFA 1QA0A 3LH3A 2F9NA 4WJG2 2W6JD 4NIVA 1CGIE 1P9UA 1TAWA 2ALVA 1FAKH 1SVPA 2FPZA 2IJD1 4OS2A 4U01A 4A1XA 3S9CA 8KME2 1LPZB 4H42U 2EI7A 3FAOA 5FBIA 1BMNH 1DICA 3BTEE 4AN7A 2FYRA 1QNJA 1TPSA 3FZZA 3NKKA 4CRCA 1XXFA 2PFEA 4OS7A 2JETB 4XFQA 2SGQE 1EFRD 3U8OH 1A7SA 1HJAC 4MPVA 4B2BA 4ASUD 4RKJB 2ZDLA 1AU8A 3MMGA 3PMAB 3SI4H 2OINA 3TLOA 1TX6A 1DXPA 1C5NH 1H4WA 1OS8A 3KQEA 3P17H 4BXSA 1HBTH 1TNKA 1TA6A 1IQNA 4OGXA 2ASUB 5CHBA 4AG1A 2F9VA 3N7DA 2PSYA 3FP7E 3GCTG 1UTKA 4XBDA 1E36B 2XTTB 2VWNA 1MKWH 1J16A 1OWDA 2AMDA 2GTBA 2J97A 1TE0A 1Y5AT 2RFKC 2BDAA 2VBCA 2HVXA 2ZKSA 4AGJA 1MTVA 1LTOA 1O2UA 1YGCH 3AK5A 1ACBE 1O2WA 1O5FH 2KAIA 1ZMJA 2UUJB 2FOBA 2J34A 1FY8E 5GJ4B 2OUAA 3RU4T 4TY6A 1BRAA 2ZC9H 1CO7E 2R3UA 1VCQA 2R0KA 2RDEA 2VVVA 5HM9A 1L4DA 1BTZA 2ZHQH 2G52A 5HMAA 2ZPSA 4CRGA 1Y3WA 3ODFA 2BDGA 2ESTE 3PMJA 3ZYDA 2ZIQH 5PTPA 1G30B 1V2KT 2AIQA 1ELBA 1KXFA 1LHFH 1G36A 1BMMH 1JOUB 1VCPA 2ILNA 1BB0B 1DWBH 2FEQH 1AVGH 3V3MA 1AKSB 1IHTH 4K3JA 3SHCH 2Z3DA 1PFXC 4P02A 4A1TA 5IYTA 3F3BA 3R0FA 2XC5A 1QL9A 3ZZ5A 1PQ5A 1A61H 4ABGA 2P3FH 3A7ZA 5A0BA 2EI8A 1UMAH 4YZUA 1TNHA 1CT4E 2AEIH 2H6MA 2V35A 1GJ8B 3O8DA 1O5CB 1MTSA 1GBBA 2XXLA 2P3TB 4CH2B 7GCHG 1EPTB 5ETXA 3HGNA 4D76A 1PPHE 1QB1A 3K6YA 1O3NA 2KCAA 1C5LH 2BY7X 4UFFH 1KTTB 3WW7A 3RXOA 2SGFE 3BTDE 1TLDA 1QBNA 3KN2A 4HFPB 1UTQA 1WBGB 1ZRBA 1BT7A 1CGJE 3LGUA 2BTCE 1O3DA 1GWAA 4B73A 5E0GA 3MYWA 4BTTB 2H2ZA 4ZKOU 1VITG 3NPSA 3DFLA 1UK3A 1AVXA 4AYYB 2VVUA 1HAOH 3K9XB 1FXYA 1KXDA 3SN8A 1O2MA 2H9TH 2Z94A 1LVMA 3OTJE 3F9HA 3M3SA 1GBCA 1QJ7B 1QQ4A 1AFQB 1NO9H 3DA9B 5FBEA 4CREA 2ZGHA 1ANCA 1FJSA 4F49A 3TK9A 2F4LA 4U32A 2W3IA 2A4GA 3U8TH 3RU4E 1NY22 1DANH 2P3UB 2PP6A 1SOZA 4TPYA 2ZHFH 1EAXA 1C1TA 1SGIB 2QF4A 1IQLA 1WAYB 1G32B 4ZKNU 4ABIA 1KXCA 3ZYEA 1C4U2 1DDJA 2WYJA 1DM4B 1C5PA 2QIQA 3GY5A 1QQUA 3NK8A 5E0JA 3KEEA 1V2VT 3HKJB 1P06A 3LOXA 1KYNA 3SORA 1K21H 3RM2H 2ZO3H 1ZLRA 2WPIS 1W2KH 3M35A 4ISHH 4IC6A 1HAIH 1E1QD 3T2NA 3BTFE 1N8OB 2RG3A 3MNBA 2FOHA 3MFJA 1SGFA 3KNXA 2FMJA 1H8DH 1SHHB 2VINA 5EXMA 1GCTC 1EPTA 1TPPA 1C2JA 3PRBA 1W0JD 1QBOA 2ANMH 5A8ZA 1C5ZB 1FZZA 3T27A 5I25A 1K9OE 1MTWA 1O2NA 5GWZA 2BOHB 1S6LA 1GJAB 3FOAA 1GHZA 3S7HB 1MUEB 1BQYA 1DLKB 1F5RA 1ZHRA 1O3EA 3PO1B 5DG6A 2Z9IA 5BPEA 4YLQH 2RCEA 5A2MH 2R2MB 1QCPA 3SNCA 1O2JA 1UTNA 3N7OA 1C2KA 4GSOA 4ISOA 5ABWA 3GOVB 5CE1A 2Z7FE 1GI8B 1FV9A 1LPKB 4B1TA 1GCDA 3ZVGA 3QLPH 1VITF 2OP9A 1O3JA 3P92A 2ODYB 4A6LA 3SYJA 4AFZA 3MNXA 3BIVH 3TIUA 4FUGA 3RXHA 2ZGJA 3KCGH 5HKKD 3E16B 3SV6A 2IPHA 2JJ2D 3A7XA 5J4SA 3A8CA 1O3GA 1W12U 1W0KD 1IQIA 2EQNA 3ZZ3A 4OS6A 1ZHPA 5T6GA 1MBMA 1P2QA 1O37A 3SGQE 1SI5H 1O2IA 1O2PA 1C1RA 2FS8A 1SQRA 3M3VA 4M9FA 1GI2A 3V12A 1D3PB 1MAYA 1GHAG 4YTAA 1EB1H 1O3AA 3NZIA 5FPYA 1LQDB 1G2MA 1BHXF 1O5AB 1O2LA 4UD9H 1J8AA 1Z1IA 3VPKA 4ISIH 4IW4E 1TQ7B 2ZEBA 4YESB 2VVCA 3RLWH 5K0HA 1QRXA 4MPUA 1ETTH 5KGOA 1O2OA 1W11U 4GUXA 1N6XA 1HUTH 1GBDA 2VIOA 4AX9H 3VGCB 3VB3A 3PYHA 1BITA 1L4ZA 1UCYH 3VXFH 1PPGE 3SGAE 1WSSH 3SV7A 1C2HA 1W14U 3M37A 1W8BH 1TRYA 5BRRE 3RMOH 4ESTE 2WPHS 4WH6A 4RT1A 2AGEX 3PTBA 1BJVA 1LO6A 5EJZA 1GG6B 1MTUA 4ISLA 1K1OA 1WYKA 3E6PH 3T28A 1OWHA 3TJOA 3P8FA 2SFAA 4NCYA 3SQEE 2LPRA 3MNCA 1WTHD 3STJA 1BA8B 1YPJH 3W1EA 2KX4A 2ZI2H 1IQJA 1AUTC 1ZRKA 1XKBC 1GJ4H 1XUGA 5E2OA 1SG8B 2WV5A 4F55A 1JRSA 3C1KA 1AFEH 3MOCA 2QC2A 2STAE 3A8AA 1SL3A 2P59A 2Y6TA 4DT7B 1TGNA 2H9HA 2O8WA 1L1NA 1GHWH 5T6DA 3M5LA 2AMQA 3A82A 1C5UA 3BTHE 3BF6H 1C2IA 1WXRA 1GVZA 4CBOA 2FESH 3EA7A 4MNYA 4TYDA 2Z6BD 1P2JA 3UPEA 1HAVB 5DKMA 4ZHMU 1C5TA 3ZZ9A 1A4WH 1W3CA 1KLJH 2J4IA 4JK6A 4MDSA 3GDUA 1FONA 3ZZ6A 1QURH 1P09A 1HAYB 3PMBB 4KGAA 1FUJA 5GXPA 2HNTF 1BZXE 6CHAC 1P3EA 5C0UA 1HAHH 3HK6B 2A7HA 4WF8A 1BBRK 1SC8U 2RA3A 2QYIA 2BXTH 1UTJA 2PTCE 5DO4H 1VGCB 1F0UA 3W95A 4NIWA 3GY2A 1FDPA 3LKWA 4CRDA 3E0PB 2FOAA 1H8HD 2XYAA 4YO9A 1XMNB 1AKSA 1GI1A 2ZU1A 1B0EA 1KDQA 1ANBA 2PTNA 5HXFA 4GCHG 3U8RH 3OX7U 2VWMA 2GD4B 1EAWA 2J95A 3ODDA 1MABB 2FODA 5EU8A 3U69H 3T29A 2HLDD 1DWCH 1GI6A 2ANYA 2GX4A 2O8MA 3EA9A 2WUBA 1HLTH 1O2HA 5GCHG 2HPPH 4D7GA 4UFDH 3F9FA 1ELAA 5C2ZA 3M7QA 8ESTE 1DOJA 1TA2A 1T8MA 3GY6A 3H5CB 2Y5HA 3D65E 3JZ1B 1BBRH 2GKVE 3F1SB 2ZGCA 1DUAA 1E35B 1GGDB 4JZIA 1EJNA 3UTUH 2OC8A 1QJ6B 4I33A 2OCVB 3E3TA 2HNTE 1VR1H 1BMFD 1T31A 3TH4H 5B6OA 8LPRA 5C20A 1NBME 2A1DB 3S69A 3UY9A 4FETA 1TNLA 3GISB 5ESTE 2IOTA 2OK5A 2G51A 1ZTLA 1CA8B 2ULLA 3HPTB 4ABEA 1L1JA 2HOBA 5DGJA 3K65B 4NGAH 1DSTA 3LPRA 1GDQA 1W7GH 5GDSH 3V13A 1LHEH 1ZPCA 5EPYA 3HATH 1CHGA 4K60A 2TGPZ 1JXPA 4CR5A 1YPEH 5LPFA 2P8OC 4ZUHA 1YPHC 1V2TT 1KMHB 1YKTA 4A1VA 4X1PU 1DLEA 1AMHA 5JBTA 7GCHF 1KXBA 3RMNH 3ATMA 1AE8H 1S83A 3GCHC 3C27B 3VEQB 1MCTA 1TGCA 3M7TA 1ESAA 1ELFA 2OC0A 2D2DA 1GJ7B 2BQ6B 1GBAA 2BLOA 4AB9A 1HAPH 5DPAA 1YF4A 2A4RA 2G8TA 1OYTH 4BAQB 4X6PA 1H9HE 2Z9KA 2ZF0H 3FFGA 1WCZA 3AW1A 1O34A 3E90B 2J9NA 3A81A 3RLYH 2TGTA 1DWEH 1EOJA 4KELA 3ATKA 3FVFB 3SNAA 4CBNA 1Y5UT 2JJ1D 1FQ3A 1QB9A 1CE5A 1RJXB 5HIYA 3D49H 4O3TA 4UE7H 2RDLA 1YPHE 4AGKA 1P02A 1EQ9A 5A09A 2YMSB 1J14A 2CGAA 1LDTT 2OC7A 1CSOE 1V2RT 3UUZA 1LVBA 2BXUH 3TJNA 2ZTZA 1NRPH 2OD3B 1O2YA 3QUMP 1NM6A 4MPWA 4Q4LA 1MKXH 4RN6A 2BY6X 1ABJH 1ELDE 4I8LA 5CDFE 2GMTB 1K1LA 2BMGB 1ZSJA 3M5OA 4X8VH 4NZQA 2BD3A 5LH8A 2D1JA 5AHGH 4KTSA 3RXAA 2TGAA 3ESTA 1P8VC 5K7RA 2VWLA 2BDYA 2BVXH 2C90B 2C8YB 5JB9S 1HAXB 1O5EH 1Y3XA 2XC0A 2ZDAH 4OS1A 1RGQA 2NU4E 2Y7ZA 4FOUC 1QB6A 1JIRA 1TMUH 3MWIU 1TYNA 1UTOA 1IOEA 3ZZDA 3LONA 3SO3A 1XM1A 1ZPZA 4B2AA 1SR5C 2QXIA 7LPRA 4PROA 1EUFA 2GCTB 2PWXA 2P94A 1V2UT 5AVDA 1GHVH 3RXTA 3TH3H 3SJ8A 4LZ1H 1PPZA 5C1YA 5F8XA 1C2LA 1A5HA 2ZCHP 1QRWA 3CS7A 1P2KA 3D62A 3F2GA 3PRDA 4GVUA 3ATWA 5FCRA 3MU5A 4DCDA 1LCYA 2J98A 5EW1H 2TRMA 1V3XA 1HDTH 4MNWA 1SMFE 3VXEH 1GMCF 4A7IB 2ZECA 1TMTH 1QA7A 1C1OA 1DS2E 1AIXH 1NFUA 9LPRA 5C5NA 3MHWU 1CT0E 4O3UA 3A7TA 3GYLB 4JYTA 2QV1A 3SW2B 1XXDA 1OWEA 1ANDA 2CN0H 3ITIA 1ZMLA 4K5ZA 3KQDA 1ZJDA 1HCGA 2BZ6H 3B23B 4AFUA 4DT4A 3F9EA 1ANEA 1CA0C 1SHYA 1SGNE 2BB4A 1O3FA 1MAXA 1O33A 1BCUH 2B0FA 3FKSD 4NFEA 1T7CA 2RA0A 4CHAC 1F2SE 1K22H 4R0IA 1UVTH 1H1BA 2JH6D 3KIDU 4VGCC 3EE0B 1GI9B 2AH4X 1CBWC 4KKDA 4O97A 4ABFA 3O8RA 4HZHA 1H9LB 2AMPA 3L33A 1MBQA 1QR3E 1SFQB 3TVJB 1WV7H 1QHRB 1QIXB 1SOTA 1TALA 1TFXA 2P16A 3S9BA 5B6LA 2BYAX 1UCYK 1ETSH 1GHBF 2ZFPH 1ZSKA 3LC5A 2ZDVH 3DUXH 1Z8GA 1HB0B 1SGRE 1O3KA 4GPGA 1HIAA 2WV4A 1RIWC 4MNVA 1LVYA 2R0LA 1E79D 1NBMD 5A0AE 2PKSC 1NFYA 1O35A 4CR9A 2PKAB 2ZHDA 1DXWA 5J4QA 4Y11E 4D9QA 1UO6A 1C2EA 4WMDA 1Y3YA 3I29A 2Z9JA 2F3CE 2JKHA 3KQBA 4IN2A 1GJ9B 2WZQA 3DD2H 1EASA 1GBJA 4ZROA 1K28D 3SQHE 4SGBE 1F0RA 3TH2H 2Y5FA 1CT2E 1VZQH 1FI8A 1O5BB 1ELEE 1AWFH 1PQAA 1YBWA 2FTLE 2G81E 2OQ5A 4K1EA 1UVUH 4ZH8A 1TRMA 1GBKA 3SUDA 2P95A 2WINI 2NWNA 1C1PA 2UUKB 4MLFB 4ACBA 5G4BA 1O39A 2EC9H 2ZFQH 2F83A 3E1XB 4FUFA 4OGYA 1DX5M 1O3OA 1MD8A 4LOYH 3OAAD 1XUIA 4FU8A 1EZXC 2CJIA 2QF3A 4I86A 2XNIA 3SZEA 1TOCB 2SGDE 5FAHA 1AQ7A 2M2AA 3ELAH 3SJKA 2HVYB 1MTNB 4HG6A 4B74A 1A5GH 3MH7A 4BAHB 2G00A 1SGCA 2XBWA 1GBHA 5AFZH 1AHTH 2V3HH 1E34B 1A0HB 2A31A 5TCCA 1AO5A 1TBZH 4Y10E 2TBSA 2ANKH 1OPHB 4I8JA 1EAUA 3QO6A 1K1IA 1ZGIA 2ZNKH 2VGCC 1HAZB 3LT3A 2VIWA 5A0CA 1BRCE 2Q6DA 4X8SH 3F68H 3SGBE 3SZNA 5EXNA 1DWDH 2JIZD 1OYQA 4BANB 1D6RA 3EQ0H 3IITA 1TGSZ 4XBBA 1DE7H 3TK6A 1XKAC 1NTPA 1TBQH 2GDEH 5KEDA 2PKAA 1AB9B 4RT0A 2BY5X 3VFEA 1W0YH 1UK4A 2J92A 3KL6A 1THRH 3NXPA 1D3DB 1NRNH 1LHDH 2FWWA 2V3OH 2CHAC 1JWTA 2ZZUH 2R9PA 1GJDB 1TNGA 1QGFA 2D8WA 2THFB 2YOLA 2P93A 3EGKH 1IQKA 2ZU3A 2Y82A 3LC3A 1BTPA 1GBFA 4Y6DA 1GL1A 3SBKA 1ARCA 5FPSA 2Q6FA 3TNSA 4K69A 3GCNA 2FI4E 3BSQA 1B7XB 2KCOA 3SOSA 5GCHF 3M5MA 1CGHA 1UJ1A 3E8LA 3BIUH 2C8WB 3EE7A 3RC4A 1IQHA 1BTUA 1V2NT 1GJCB 2O9QA 1QY6A 3ZVEA 2A5IA 3Q76A 2FDAA 3S7KB 1O3LA 3BG8A 4DGJA 2ANWA 2K0QA 3GS9A 1E1RD 1ELGA 4XDEA 1YLNA 4CH8B 1MMJN 2G55A 3BG4C 2AHME 3UWJH 2QGRA 1V2JT 3LJOA 2FX4A 1WU1A 1Z8JB 3RMLH 3L6PA 1G2LA 2EEKA 2KFWA 3QX5H 1KXAA 1LKAA 4E06H 1ZJKA 3ENSB 1GVLA 3GY3A 4ZKRU 1CHOG 3UNRA 4KP0A 3QGJA 4K2YA 1TNIA 1HYLA 2BD4A 2BD9A 2VNTA 3OY5U 3MO3A 5HGGA 2FM2A 1AVWA 1OHHD 1OP8A 2GCHG 3MO6A 1TIOA 1NC6A 4WH8A 1WQSA 4UEHH 4DY7B 5IDKA 1GI7B 3HGPA 4DIIH 1TPOA 2PGQB 4Q63A 4XRNA 5C5OA 1SLXB 5CHAC 3F6UH 1S84A 3A80A 4FVBA 3ZZ7A 1JMOH 3ZZAA 4Z0KA 3RDZA 5DP7A 1C5SA 1KLIH 2FI5E 2R3YA 3RXUA 1QL8A 2GZ8A 3AW0A 1G3DA 1AI8H 1V2ST 2BQ7B 1SGEE 1V2LT 2EA3A 4H4FA 2WV9A 2PV9B 1C2FA 2GGVB 3MNSA 3UQOA 2BX3A 4WMFA 4SGAE 4AC9A 4ZHAA 4K8YA 1XUJA 2L6OA 2J5UA 5C67A 2OBOA 1SPJA 2PW8H 4XSKU 1BDAA 4WVPE 2Z9GA 3SU1A 2DUCA 3O8BA 1TBRH 1ZPBA 4IMZA 4E7NA 4K8BA 1O32A 3K2UA 1MU8B 2JETC 1W10U 3IWMA 3U98H 1TNJA 3BEUA 1HJAB 4JK5A 4TWWA 3PWBA 1WDIA 3ZVDA 1GMHF 3PROA 3Q77A 3AAVA 1LVOA 1CHOF 1P2OA 3RM0H 1LQEA 3RXQA 3OY6U 2HWLB 3KYGA 5C1XA 3M36A 4YM9A 2PGBB 3RXIA 1EXFA 5ESBA 1F5KU 3OSYA 1YCPK 5E0HA 2FOEA 1AZ8A 4P00A 5LPEA 2G4UA 5CMXH 3VB7A 1S81A 2A5KA 3QZRA 4Y7BA 5GPIB 1MZAA 4BAOB 1XUFA 1BHXB 2C8ZB 5DP5A 3SV8A 2SGPE 4X2XA 1Y59T 1V2WT 4F48B 1VCWA 3GY8A 1C9TA 5DP6A 3S0NA 1LHCH 1HPGA 4ZXXH 2XCFA 2YNAA 3OE7D 5F8TA 2W7SA 3SUFA 4B76A 4BTIB 4CRFA 1NROH 6GCHF 1F0SA 2W5EA 1MQ6A 3O8CA 5EODA 1SLVB 2GZ9A 2ZFFH 2FO9A 4R8TB 1E37B 4AORA 1J15A 3H09A 1V2QT 4YOIA 3A8BA 2H1UA 3L3TA 2V6NA 2VH0A 5JBAS 2HRVA 3MTYA 3OYPA 4Y8ZA 1ORFA 3M7UA 2SNVA 2BD2A 2PUXB 5DP4A 4TY7A 3UWIA 2FLBH 4X1NU 1Q2WA 3F2FA 5GNDA 1D6WA 2EY4C 3RXRA 2BX4A 3I77A 4X2VA 1GBMA 2Y80A 1DUEA 1INCA 1V2MT 1Z6EA 1A0JA 3ZVCA 2PSXA 2OLGA 3SNDA 2OTVA 1B5GH 2XW9A 1ESBA 4IMQA 2ZFSA 1K1MA 1OKXA 1BRUP 4FVDA 5H4IB 2J94A 1GDUA 1EPTC 4ACAA 2IPQX 1PPEE 5E2PA 2BOKA 1PJPA 3RXGA 2KM0A 4XE4A 4FU7A 1H8ED 3CNRA 3OEHD 3A7VA 3ZVAA 2QF0A 1O3IA 2FOCA 2CV3A 4X0WU 3NRLA 5LPRA 1XUKA 5EJLA 3QWCH 3A7YA 1C5WB 4NIXA 4QT8C 1P05A 3B9FH 1T4VH 1C5YB 5IK2D 2WPMS 3TNTA 4BXWA 1GMCG 1W0ZU 2QF5A 4ZXYH 3MU1A 4MTBA 1AD8H 2HLCA 1BIOA 3FN8A 2WHXA 4Q7XA 1A46H 3FP6E 1TRNA 1L2EA 3VG8A 3RXEA 2G4TA 1AFQC 3RXBA 3KQCA 1QBVH 1TQ0B 3GICB 3NWUA 2F9UA 2QXJA 3JZ2B 2TIOA 1G3CA 3ZZ8A 3LGVA 1HJ9A 6GCHG 3G01A 1MQ5A 3RUOA 2H5CA 3UNSA 5TCAA 3UR9A 1SGTA 2QCYA 3DSPA 2OBQA 4NFFA 3S9AA 4Y7AA 5JBCS 4Y79A 4NSYA 2ZPQA 1GBTA 1S82A 1PQ7A 2ZDNA 2ZQ1A 1AWHB 2O8UA 3H7OA 5JYIA 1HV7A 1ZHMA 2ODQA 1EZSC 2ZHEH 3AASA 3IG6B 2A2QH 3VB4A 3Q00A 1O31A 3RXSA 5JBBS 1J9CH 4LXBH 5C0TA 1N8OC 3BTKE 1EJMA 2Z3EA 1O5GH 1GCTB 1GHYH 1P03A 1A5IA 2Z3CA 2ZGBH 3SHAH 1MU6B 4UFEH 3UREA 2G5VA 1O3MA 3GYMA 3QGNB 1C1UH 1SB1H 1P11E 5EGMA 1WQVH 3STIA 3RXMA 1LPGB 2ZQ2A 1PPBH 3TK5A 5FPTA 4AG2A 4B75A 1N6YA 3WWFA 1Q3XA 4THNH 4D7FA 3LGTA 3TJVA 1G9IE 4TSFD 3P8OA 1E38B 2BVSH 3PO1C 1RTLA 1MCVA 1SQTA 2H9EH 2XBYA 2C8XB 2A5AA 4JCNA 1EAIA 5DK1A 2HPQH 2QAAA 1DSUA 5TJXA 1A0LA 1FPCH 2TPIZ 4KTCA 2VH6A 4UONA 2FP7B 2Y7XA 2ZWLH 3RC5A 4FXGH 1P01A 4XBCA 5DP8A 2B7DH 5E8EH 3U1JB 4DOQA 4ABJA 1NPMA 3F0PA 3HKIB 3E0NB 1ETRH 1SSXA 4X8TH 2IN2A 1X7AC 2C4FH 1M9UA 2ZDKA 3N7EA 3V0XA 1E0FD 4MQAA 1C9PA 2FTMA 1Y3VA 3UOUA 2JDID 2PR3A 4ZCNA 1THSH 1O0DH 2AS9A 1C5QA 1O2RA 2V7QD 5L6NH 4BNRA 2LP6A 4XD7D 2A4OA 3RP2A 1YP9A 1S0QA 1FMGA 1S5SA 1B0FA 3Q3KA 3BEFB 2PUQH 1D4PB 4Q80A 1Y8TA 1UVPA 1ZTJA 1UVSH 1FY4A 1BMLA 8GCHG 1C2MA 1ID5H 4ASHA 3DSOA 3BV9B 2WUCA 3RXCA 3SJOA 1BOQA 2AGIX 4BAMB 2BVRH 1LHGH 5F6MA 2FYQA 1O2QA 1ZSLA 5EQRA 3ZZCA 1A2CH 5C94A 1ELTA 1YPMH 5KECA 1P10A 4IC5A 3VGCC 2BLVA 3RU4D 1T32A 1Z7KA 2J38A 1GHAF 4B2CA 1DT2A 1O2KA 3PV5A 1BBRE 2BD5A 1EZUC 5GIBA 1N1LA 3P8GA 2SNWA 4IS5A 1SGYE 1CQQA 5AF9H 4X6NA
chains in the Genus database with same CATH topology
2CF8H 5A8XA 1GBLA 1GG6C 2FIRH 1F0TA 1TONA 3M5NA 5DJ7A 2BQWB 5DP3A 1VJAU 3SU3A 1EZQA 1GJ6A 4K1TA 4I8HA 3UOPA 1UTLM 3BTME 1O2SA 3BEIB 1GJBB 1TPAE 3NCLA 4NSVA 1LMWB 1OOKB 2FOFA 1G3BA 4X2YA 2FX6A 1C5VA 1NU9A 1OWKA 3Q3XA 3A85A 2UWLA 1WTGH 1BTYA 3SV9A 1RD3B 1SGFG 3QN7A 1GHBG 1O3CA 3U9AH 1NRSH 2ZP0H 2GT8A 1TX8A 1Y5BT 4K1SA 4NIYA 2WPLS 4F4OC 3M3TA 2A2XH 2BDCA 3PLPA 3A86A 1THPB 3VB6A 3R3GB 2F9PA 1O2XA 1T8LA 2BY8X 1UHBB 2VIPA 2Z9LA 4MPXA 1C2DA 4ISNA 5A8YA 1C4Y2 4E7RG 2B5TB 6CHAB 1F7ZA 3GY7A 3URDA 1SGPE 1PPFE 3EYDA 4FUDA 1FIWA 1DY9A 1MKWK 6LPRA 1VGCC 1BTWA 1WUNH 1AUJA 1T4UH 3QTVH 5EPNA 5FXLA 1RS0A 2TGDA 1QL7A 3TJUA 1P2MA 2DE8A 2DE9A 3DHKH 1YLDA 3E91A 4JZFH 1TOMH 2AERH 4MG3A 1TGBA 3LU9B 3SJIA 4CRAA 2F9BH 1VJ9U 1O36A 3RXLA 2G5NA 4A5TS 2VIQA 2GZ7A 1GDNA 3ZVFA 1EB2A 1GJ5H 1NFWA 1ZGVA 2FS9A 1C1WH 4X1QU 2VIVA 2BZAA 1O3BA 1SBWA 1KY9A 1SGDE 1UCYE 1P12E 3RC6A 2NU2E 3SJ9A 4DURA 3SV2H 1IAUA 1D9IA 3LGYA 2F91A 1OP0A 1C1NA 1DPOA 5L2ZH 4J2YB 1RFNA 3M61U 3A8DA 3MI4A 3MU8A 1BUIA 3MH4A 1EX3A 2OC1A 1GGDC 2FXRA 4NZLA 4M7GA 1GBEA 1ZMNA 3U1IB 4NA8A 1YCPM 2WYGA 1Z71A 4X1RU 2D26C 1XVOA 4I7YH 1O2TA 4IGDA 1S6FA 2QXGA 1FIZA 4RSPA 1O3HA 2A45B 1FY3A 4JZEH 4H6SB 4D8NA 4YT7H 2SGEE 3A7WA 2GDDA 3BTQE 1O2ZA 1BMAA 3EA8A 1P2IA 3MO9A 1S6HA 1KDQB 1UTMA 1P9SA 1UHBA 3MU4A 3RMMH 4Q7YA 3LJJA 3URCA 2A0QB 1OWJA 4TPIZ 2ZFTA 2GV6A 1UVOA 4HTCH 2NU0E 1EATA 2P8OB 3A84A 3LH1A 4X1SU 3SI3H 3P95A 2FI3E 4X8UH 5EOKA 1Q31A 1HAGE 3P70B 2BLWA 1OX1A 4MVNA 1NZQH 4AYVB 3BTWE 3GCHB 5JPMH 5EG4A 1GVKB 1NFXA 4YT6H 3RXDA 3SNBA 1Z6JH 3ZV9A 1YLCA 1K1NA 4YLUA 1AY6H 1Z8RA 1PYTD 2QN5T 1YC0A 2I6QA 1NU7B 4GAWA 1TGTA 3EAJA 1AGJA 4TWYA 4ABDA 4INHA 1MH0A 4YOJA 2A7JA 3T5FH 3A87A 2NU3E 3P8NA 2UUFB 5FX6A 1P0SH 1Z8IB 4XOJA 3GCTF 1W13U 2BHGA 1VITH 4MNXA 2AYWA 4IN1A 3EDXB 2UWPA 3T25A 3QZQA 5C3NA 4FUHA 2ALPA 2CF9H 2XWBI 4DG4A 1C5RA 3TITA 4JZ1A 2ZFRH 5JDUB 1TB6H 2J2UA 1KTSB 4ABAA 3A89A 3B8JA 4UFGH 1L1GA 2XCNA 5HYOA 2GMTC 2JH0D 6ESTA 4Y76A 2PHBA 1HXEH 2XWAA 2ZU5A 8GCHF 2A7CA 3V7TA 2FOGA 2Y81A 4BOHA 4HGCA 1OXGA 1GMDF 1W7XH 2VJ1A 1GHXH 4RKOB 1IQEA 1DFPA 1HNEE 1EP6A 1FLEE 3ZZBA 1GI3A 2ZCKP 3T26A 4LZ4B 1A3EH 5I46H 3CP7A 1CVWH 4ZAEA 2STBE 4JYUH 2GCTC 4GHTA 1TABE 1GPZA 1C1VH 2C93B 4GCHF 1KLTA 2I6SA 3FANA 4GHQA 3PLKA 4B71A 1KSNA 2FLRH 1G37A 1QTFA 4DJZB 1TMBH 2B8OH 1AN1E 2ODPA 2WPJS 5L2YH 2A4QA 4X2WA 1FAXA 7KMEH 2ZA5A 1A1RA 1KXEA 4ZHLU 4NG9H 2VB0A 1OWIA 3Q3YA 1ELVA 1O5DH 4FUEA 2BD7A 2GVFA 2ZU2A 2Y5GA 3RXKA 1T8NA 4H6TA 1CA0B 1K2I1 1XUHA 1DITH 1D3TB 1AE5A 4I31A 3AAUA 1NN6A 2R2WU 4CHAB 3BTGE 3ZZ4A 2FOMB 2ZG0H 3GDVA 1UTPA 1GMDG 4ABBA 1GI0A 3ZV8A 3PV4A 1H8IH 3KGPA 3PWCA 1K1JA 4VGCB 4AFQA 4FUIA 4FU9A 1TWXB 2W7UA 1CBWB 1SLUB 3ATIA 1ABIH 2WPKS 4I32A 2ZDMA 1TX7A 3ATLA 1HAVA 3FZDA 3MH6A 4NA7A 3A88A 1WOFA 3HK3B 3FP8E 1FNIA 1DY8A 3CS0A 4E05H 1RTKA 3I78A 2C3SA 1O30A 2ZCLP 4LK4A 3GCOA 1RIWB 4YOGA 4OS5A 2FZZA 1ESTA 1A3BH 2PKSB 4O9VA 2BDBA 4BAKB 3P6ZB 4WXIA 5DP9A 4J1YA 2QXHA 5T3HA 1FPHH 4Y71A 1ZOMA 1C4V2 4WY3A 1EP5A 3QTOH 1NRQH 2GCHF 5EXLA 3PM3A 1OSSA 4JZDH 2ZGXH 3AVZA 1PPCE 1YM0A 3CENA 1NS3A 1J17T 2BDHA 1SGQE 1CU1A 1T8OA 4JMYA 2OXSA 3WY8A 3BTTE 4U30A 2O8TA 2W3KA 3RXJA 2W26A 3GDSA 1YYY1 7ESTE 2Q1JA 4ZMAH 4DIHH 4KTUA 4IBLH 3TGKE 1FY5A 1BJUA 1OP2A 5FCKA 3LGIA 2QA9E 3LDXH 1MD7A 1V2OT 2LNCA 3MH5A 1SFIA 3T62A 2AFQB 1V2PT 3GY4A 3LGWA 1MZDA 4FUJA 1BTXA 1P04A 1PQ8A 5T6FA 4Y8YA 3RXFA 3SUEA 2GP9B 3H7TA 2BDIA 3ZVBA 1IQFA 1IQMA 1QJ1B 3BN9A 2VIDA 2YNBA 1O3PB 5F8ZA 1ELCA 5FHTA 1FY1A 1MTNC 1NESE 3KHVA 5C1UA 1LKBA 3PB1E 2HGTH 3PLBA 4Z6AH 2HALA 2CXVA 1G3EA 1GBIA 3SU5A 2ZHWH 1F5LA 2QY0B 3D23A 1XX9A 2F9OA 5EQQA 4AB8A 4HI3A 1HXFH 2ZPRA 1HJ8A 1HRTH 2VGCB 3SUGA 4AFSA 4A92A 1HGTH 5LGOA 5EQSA 1NRRH 3SNEA 1RRKA 4X6MA 2Q6GA 1BTHH 1YPLH 1GMHG 3A83A 2OQUA 4ZKSU 3UR6A 3UNQA 3QK1A 5FX5A 1P2NA 4D9RA 2JH5D 1RTFB 1AB9C 1SQAA 4I8GA 2XC4A 1S85A 1XVMA 2XBVA 5L30H 3KF2A 3TU7H 3SU2A 2CHAB 1C2GA 4WWYA 4Q7ZA 1Z1JA 3VB5A 1O2VA 3K6ZA 4NA9H 1F92A 5AFYH 1U6QA 2BLQA 4Y0ZE 1YPGH 4O03A 2EI6A 3UIRA 1C5OH 1PYTC 9ESTA 1C1QA 4BTUB 2ZTYA 4Q2KA 4UDWH 4DW2U 3PMHB 3SU4A 2BY9X 3TGIE 1JBUH 1C5MD 1SQOA 2VU8E 1UK2A 3PTNA 2UUYA 4OS4A 1ZR0A 4AOQA 2V0BA 1JIMA 1DVAH 2CMYA 4AZ2B 3DT0H 1L0ZA 2PLXA 5F03A 1D3QB 2ZTXA 2XBXA 1EOLA 1C1MA 1IHSH 1MKXK 2M5TA 1ZZZA 3F9GA 2NU1E 1GI5A 2BD8A 1V6DA 4Y8XA 1KIGH 1Y3UA 4X6OA 4ABHA 3W94A 3BG4B 3NUMA 1BRBE 1P57B 1GI4A 4JYVH 1HIAB 5HM2A 1EJAA 1ARBA 1RXPA 2SGAA 1IQGA 1S0RA 3TGJE 2AGGX 4INLA 4INKA 3MU0A 3LIWA 1NT1A 2GV7A 2K1QA 1P3CA 3UFAA 2GT7A 2HNTC 1QFKH 4CRBA 3OU0A 2O8LA 2A32A 1O2GH 4Y0YE 1JRTA 1GL0E 2IJOB 3RXPA 5SGAE 1EKBB 1H9IE 5JB8S 2BM2A 2VWOA 2H5DA 2KAIB 1QRZA 1ZYOA 3DFJA 1SLWB 3SU6A 4GLYA 1FN6A 1FN8A 1O38A 3QDZB 4WXVA 5CHAB 4FUBA 2B9LA 4I8KA 5EW2H 1C1SA 4WMEA 4DVAU 3TPIZ 1HFDA 2AIPA 1ZTKA 1K1PA 4U2WA 1YCPH 4NWKA 3RXVA 3SU0A 4FUCA 3UQVA 1YPKH 1AZZA 4NWLA 2ZU4A 2XRCA 1C5XB 2UWOA 1QA0A 3LH3A 2F9NA 4WJG2 4NIVA 1CGIE 1P9UA 1TAWA 2ALVA 1FAKH 1SVPA 2FPZA 4OS2A 4U01A 4A1XA 3S9CA 8KME2 1LPZB 4H42U 2EI7A 3FAOA 5FBIA 1BMNH 1DICA 3BTEE 4AN7A 2FYRA 1QNJA 1TPSA 3FZZA 3NKKA 4CRCA 1XXFA 2PFEA 4OS7A 2JETB 4XFQA 2SGQE 3U8OH 1A7SA 1HJAC 4MPVA 4B2BA 4RKJB 2ZDLA 1AU8A 3MMGA 3PMAB 3SI4H 2OINA 3TLOA 1TX6A 1DXPA 1C5NH 1H4WA 1OS8A 3KQEA 3P17H 4BXSA 1HBTH 1TNKA 1TA6A 1IQNA 4OGXA 2ASUB 4AG1A 2F9VA 2PSYA 3FP7E 3GCTG 1UTKA 4XBDA 1E36B 2XTTB 2VWNA 1MKWH 1J16A 1OWDA 2AMDA 2GTBA 1TE0A 1Y5AT 2BDAA 2HVXA 2ZKSA 4AGJA 1MTVA 1LTOA 1O2UA 1YGCH 1ACBE 1O2WA 1O5FH 2KAIA 1ZMJA 2UUJB 2FOBA 2J34A 1FY8E 5GJ4B 2OUAA 3RU4T 4TY6A 1BRAA 2ZC9H 1CO7E 2R3UA 1VCQA 2R0KA 2VVVA 5HM9A 1L4DA 1BTZA 2ZHQH 2G52A 5HMAA 2ZPSA 4CRGA 1Y3WA 3ODFA 2BDGA 2ESTE 3PMJA 3ZYDA 2ZIQH 5PTPA 1G30B 1V2KT 2AIQA 1ELBA 1KXFA 1LHFH 1G36A 1BMMH 1JOUB 1VCPA 2ILNA 1BB0B 1DWBH 2FEQH 1AVGH 3V3MA 1AKSB 1IHTH 4K3JA 3SHCH 2Z3DA 1PFXC 4A1TA 5IYTA 3R0FA 2XC5A 1QL9A 3ZZ5A 1PQ5A 1A61H 4ABGA 2P3FH 3A7ZA 5A0BA 2EI8A 1UMAH 4YZUA 1TNHA 1CT4E 2AEIH 2H6MA 2V35A 1GJ8B 3O8DA 1O5CB 1MTSA 1GBBA 2XXLA 2P3TB 4CH2B 7GCHG 1EPTB 5ETXA 3HGNA 4D76A 1PPHE 1QB1A 3K6YA 1O3NA 1C5LH 2BY7X 4UFFH 1KTTB 3RXOA 2SGFE 3BTDE 1TLDA 1QBNA 3KN2A 4HFPB 1UTQA 1WBGB 1ZRBA 1BT7A 1CGJE 3LGUA 2BTCE 1O3DA 1GWAA 4B73A 5E0GA 3MYWA 4BTTB 2H2ZA 4ZKOU 1VITG 3NPSA 3DFLA 1UK3A 1AVXA 4AYYB 2VVUA 1HAOH 3K9XB 1FXYA 1KXDA 3SN8A 1O2MA 2H9TH 2Z94A 1LVMA 3OTJE 3F9HA 3M3SA 1GBCA 1QJ7B 1QQ4A 1AFQB 1NO9H 3DA9B 5FBEA 4CREA 2ZGHA 1ANCA 1FJSA 4F49A 3TK9A 4U32A 2W3IA 2A4GA 3U8TH 3RU4E 1NY22 1DANH 2P3UB 1SOZA 4TPYA 2ZHFH 1EAXA 1C1TA 1SGIB 1IQLA 1WAYB 1G32B 4ZKNU 4ABIA 1KXCA 3ZYEA 1C4U2 1DDJA 2WYJA 1DM4B 1C5PA 2QIQA 3GY5A 1QQUA 3NK8A 5E0JA 3KEEA 1V2VT 3HKJB 1P06A 3LOXA 1KYNA 3SORA 1K21H 3RM2H 2ZO3H 1ZLRA 2WPIS 1W2KH 3M35A 4ISHH 4IC6A 1HAIH 3T2NA 3BTFE 1N8OB 2RG3A 3MNBA 2FOHA 3MFJA 1SGFA 3KNXA 2FMJA 1H8DH 1SHHB 2VINA 5EXMA 1GCTC 1EPTA 1TPPA 1C2JA 1QBOA 2ANMH 5A8ZA 1C5ZB 1FZZA 3T27A 5I25A 1K9OE 1MTWA 1O2NA 5GWZA 2BOHB 1GJAB 1GHZA 3S7HB 1MUEB 1BQYA 1DLKB 1F5RA 1ZHRA 1O3EA 3PO1B 5DG6A 2Z9IA 5BPEA 4YLQH 2RCEA 5A2MH 2R2MB 1QCPA 3SNCA 1O2JA 1UTNA 3N7OA 1C2KA 4GSOA 4ISOA 5ABWA 3GOVB 5CE1A 2Z7FE 1GI8B 1FV9A 1LPKB 4B1TA 1GCDA 3ZVGA 3QLPH 1VITF 2OP9A 1O3JA 3P92A 2ODYB 4A6LA 4AFZA 3MNXA 3BIVH 3TIUA 4FUGA 3RXHA 2ZGJA 3KCGH 3E16B 3SV6A 2IPHA 3A7XA 5J4SA 3A8CA 1O3GA 1W12U 1IQIA 3ZZ3A 4OS6A 1ZHPA 5T6GA 1MBMA 1P2QA 1O37A 3SGQE 1SI5H 1O2IA 1O2PA 1C1RA 2FS8A 3M3VA 1GI2A 3V12A 1D3PB 1MAYA 1GHAG 4YTAA 1EB1H 1O3AA 3NZIA 5FPYA 1LQDB 1G2MA 1BHXF 1O5AB 1O2LA 4UD9H 1J8AA 1Z1IA 3VPKA 4ISIH 4IW4E 1TQ7B 2ZEBA 4YESB 2VVCA 3RLWH 5K0HA 1QRXA 4MPUA 1ETTH 1O2OA 1W11U 4GUXA 1N6XA 1HUTH 1GBDA 2VIOA 4AX9H 3VGCB 3VB3A 3PYHA 1BITA 1L4ZA 1UCYH 3VXFH 1PPGE 3SGAE 1WSSH 3SV7A 1C2HA 1W14U 3M37A 1W8BH 1TRYA 5BRRE 3RMOH 4ESTE 2WPHS 4WH6A 2AGEX 3PTBA 1BJVA 1LO6A 1GG6B 1MTUA 4ISLA 1K1OA 1WYKA 3E6PH 3T28A 1OWHA 3TJOA 3P8FA 2SFAA 4NCYA 3SQEE 2LPRA 3MNCA 1WTHD 3STJA 1BA8B 1YPJH 2ZI2H 1IQJA