2QXIA

High resolution structure of human kallikrein 7 in complex with suc-ala-ala-pro-phe-chloromethylketone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-7
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA02
2ANKH 4NZQA 1K1LA 1BTUA 2F91A 1DY8A 2ZFFH 1DANH 1PPHE 2ZG0H 4NA9H 4ZKSU 1EZXC 1GL1A 2VB0A 1ZMNA 4CRFA 1VITH 3RM0H 4RKOB 2QAAA 1O2WA 1QR3E 2B9LA 2VIPA 3D65E 3S9CA 2P93A 1C2IA 3PLPA 1O31A 4IBLH 1QB1A 3TH3H 4GAWA 1S83A 2WV5A 2AH4X 1KTTB 1GJ5H 2FTLE 4ABJA 1TIOA 2XCNA 1CT4E 2I6QA 1CBWB 1IAUA 1K22H 3OY6U 1T8MA 2ASUB 1ANBA 1HNEE 3BTHE 5FCRA 1NROH 2ZPSA 3BTWE 1TPAE 1EAWA 1VGCB 3AW0A 1D3PB 5GXPA 1AD8H 1UVOA 1SGNE 2VWMA 3KQEA 3LPRA 2QY0B 2BD3A 5TCAA 3E90B 3ZZ4A 2GCTB 1DITH 2PGBB 3MFJA 1SFIA 3TVJB 1TNGA 2P8OB 1TPSA 2WPIS 4FUEA 4OS1A 4KTUA 1HXFH 2BLQA 2ZU1A 4MNWA 1B0FA 3ODDA 1A4WH 2PKSB 2WYGA 1O3AA 1BIOA 2AIQA 3M3SA 5DP3A 2TGAA 2BDHA 3V12A 1KDQA 1ZTLA 3FVFB 1EJNA 3A89A 3SNAA 1BMMH 1RIWC 1EASA 3PWCA 2GDEH 1GG6C 1WTGH 5FX6A 1MTVA 1KXFA 1Z8GA 2QXJA 2BDYA 4ZHAA 1MZAA 3F6UH 4ISNA 3SUEA 4DY7B 4Y0ZE 2FMJA 1P3CA 5L6NH 1VZQH 1ZSKA 2FWWA 3VEQB 1IOEA 1LVOA 2ZDVH 1NFXA 4X8UH 1ZMLA 3OSYA 1O5FH 3ATWA 1O3FA 1ZSJA 3F9FA 5FCKA 3O8BA 1TBZH 2VH6A 1RXPA 2A0QB 2G55A 4JK5A 2P16A 1AHTH 1IQMA 1NU9A 2O9QA 1E35B 4D8NA 1Z7KA 1ZGVA 1C5OH 1M9UA 3G01A 3M36A 4DOQA 2B5TB 2Z3EA 1O5AB 1EP5A 2TGTA 3DUXH 4HZHA 2WPHS 1C1TA 3RC6A 1FIZA 2CHAC 4CHAC 1AUTC 4YM9A 1CE5A 1NRPH 3RXIA 1GJ4H 1TWXB 2FP7B 3STJA 3U8RH 1EXFA 4DIHH 3QK1A 1V2QT 1A46H 1FI8A 1LHGH 3A7XA 2ZIQH 1TBRH 2GZ8A 3LOXA 4UFDH 1O3GA 1A0LA 1H9HE 3PLKA 6CHAC 2PUXB 1CT2E 1QBVH 3AW1A 3O8CA 1HJ8A 1C2JA 1GCTB 1V6DA 1ARCA 1JMOH 3RXHA 2P3FH 3TH4H 1BTWA 3HPTB 4LZ4B 3LH1A 1SGIB 1Q3XA 1LDTT 1KLIH 3BSQA 1WV7H 3LC3A 2XBVA 1TMUH 3K2UA 2SFAA 1GGDC 3NXPA 1K21H 1T4UH 1HCGA 3LGWA 2WPMS 2YNBA 5SGAE 1O3CA 2AGIX 1Z1IA 3TJUA 1AFQB 3VB3A 2AERH 3M37A 3ELAH 1HXEH 2R2MB 2HVXA 1EJMA 1ZTKA 2PSYA 3ZZAA 2Y82A 4B2BA 1OPHB 1GBDA 4CRBA 1H8IH 5EXMA 1TGTA 4INLA 1DPOA 1P2QA 1NESE 2ESTE 3EA9A 4GPGA 1V2NT 4Y11E 3S69A 1GHBG 1J15A 1G9IE 1SGDE 4HTCH 1IQJA 1IQKA 3RXCA 4XOJA 5FBEA 4FUCA 3ZVCA 2UWLA 1C5LH 3T26A 1OYTH 3ZVDA 3MH4A 1NFYA 3SJ9A 2FIRH 2A5AA 1UVTH 4NG9H 1Y3VA 1EX3A 2J94A 4D7FA 2NU4E 3A7VA 4JZIA 2P95A 3P8GA 2IOTA 3L6PA 1QY6A 2Z9KA 2SNWA 1TLDA 4MPXA 2GMTB 2BY7X 5ESTE 1J9CH 3PO1C 1TMBH 3BTGE 8GCHF 1GI7B 5K0HA 1XUKA 1YCPM 1C2KA 3SV2H 4K2YA 1RTKA 2A2QH 4BTIB 3W95A 2R9PA 3TITA 1O2OA 4WF8A 1OWEA 3LGVA 1DWDH 1XUGA 5DKMA 3GY2A 2C8YB 4UFGH 1MMJN 3H7TA 1YBWA 3E0NB 4UEHH 1TONA 3RXJA 1P10A 1ZZZA 1QTFA 2ZI2H 1O5CB 4U30A 3UUZA 1DXWA 1DM4B 3QZQA 1O5EH 2SGPE 4DG4A 1AMHA 3BTME 3OU0A 1SMFE 1A5HA 1YPJH 3TU7H 1CGIE 8GCHG 2O8LA 1BB0B 1BTHH 1SGQE 1SPJA 5DJ7A 5E0GA 2R0KA 2XBWA 3RU4E 1O2VA 2P59A 1AE5A 1AB9C 5AF9H 4D9RA 5EG4A 4B71A 3AASA 3UFAA 5J4SA 1S5SA 2ZU5A 3STIA 2FLBH 1V2MT 3MU5A 2OUAA 4KGAA 2BD5A 2CXVA 3U98H 2ZDAH 2A4QA 3UTUH 3TH2H 3M61U 5JBCS 3SNBA 2QXHA 3F9HA 1LCYA 1P0SH 1EAIA 2G5NA 1LQDB 1F2SE 1O2TA 3TK9A 1THSH 4KELA 1YPHE 1QQ4A 1BRBE 5DG6A 2BY9X 3EAJA 1ETRH 1QJ7B 4IN2A 3H5CB 3T29A 4CH8B 1HAHH 3SU6A 1BTZA 1O5GH 2BD7A 3QTOH 1HAVA 3VB7A 1RD3B 1GWAA 1NO9H 2A4GA 1BZXE 3PMBB 3PV4A 4TWYA 1HGTH 1O37A 2C4FH 4YOIA 1LHDH 2BVRH 4OGYA 2PTNA 3ZZ7A 4Q7ZA 2TIOA 3T5FH 2FOEA 3RXOA 3GY6A 1TGNA 2HWLB 4NWKA 1XKAC 1LMWB 2BQ7B 3TK5A 3DHKH 2H9EH 1XVMA 3QWCH 2H9TH 4FU8A 2BOKA 1ETTH 1O36A 3CENA 2ZDLA 5GPIB 1C2EA 4MPVA 1AWFH 2JH5D 5FHTA 1O3OA 2J34A 1LHFH 1XKBC 3D23A 1GMDF 3K9XB 3VPKA 2D8WA 1G2MA 1O2YA 1Q2WA 2VVCA 2G52A 8ESTE 1VCWA 3GCOA 3EE0B 5GIBA 3TJNA 2Y6TA 1BTPA 1JRTA 2GV6A 3RXUA 1EOJA 1ZTJA 1GI2A 1CHGA 1MCTA 2FOMB 4CR9A 1GVKB 5CHAB 2BXUH 2H1UA 2V3OH 3MH5A 4XE4A 3UY9A 1GDQA 2ZU3A 3RP2A 1GHWH 4AG2A 1GI6A 2Z7FE 1ZPZA 3SQEE 1CO7E 3MH7A 1AQ7A 3V13A 1KYNA 3MHWU 1O2MA 3K65B 1GI1A 4BAKB 1KY9A 1V2VT 3SU5A 1HIAA 1MH0A 2WUCA 1ABIH 1BQYA 3QN7A 1GBAA 2P3UB 5TJXA 1O3BA 2ZFQH 1GJCB 1NT1A 4MLFB 2WUBA 1Y5BT 1MTNB 4ABDA 2SGAA 4GHTA 5DO4H 5GCHF 1FY4A 1C1QA 3TNSA 1AE8H 1ESAA 4FXGH 3ZVFA 4OS7A 1C5RA 4WMEA 1NU7B 2G8TA 1BHXB 1V2RT 4YESB 5HGGA 3FZDA 1KXEA 1UTPA 1P2MA 1O34A 1RJXB 1F0RA 1GMHF 4B75A 3S7HB 1QB9A 2G4UA 1ZOMA 3GY5A 5T6GA 4O9VA 4BAQB 3BN9A 8LPRA 2F9UA 5G4BA 5JDUB 2C8XB 1H8DH 1DOJA 2RG3A 1CU1A 4A1VA 3IITA 3EA8A 2PV9B 1P2JA 3OY5U 5CE1A 2ZKSA 1C1NA 4BXSA 3RLWH 5GCHG 3MNSA 2C93B 2ZGCA 3UNSA 4X8VH 2AFQB 1UTOA 1P2KA 1C5ZB 2LPRA 5DP8A 1VJAU 3SU0A 3BEUA 4GCHF 1O33A 4GVUA 4J2YB 2DE8A 2TBSA 3EA7A 4ISHH 3V3MA 1SBWA 5ABWA 1GBKA 3UWJH 1C1SA 1GMHG 3RUOA 2QA9E 2FOFA 3RMMH 1OS8A 2D2DA 2AYWA 3UR9A 4FUDA 4YOJA 3LDXH 4Q7XA 4X2YA 3LIWA 1YCPK 2CGAA 2SGFE 1W7XH 2BZAA 1HPGA 1P8VC 1OP8A 1W0YH 1GJBB 4YLQH 5HYOA 4WH6A 2A31A 1BDAA 1EUFA 2A2XH 1C2DA 3T2NA 1G37A 5EGMA 4X6OA 3KQCA 1C9PA 5HMAA 4TY6A 2Y5GA 5H4IB 3S9AA 5EW1H 1RIWB 4AFSA 4GCHG 1V2ST 2FXRA 1OKXA 1E36B 3VB5A 3RXFA 4SGAE 1AZ8A 1O2IA 1FMGA 1TOCB 3R0FA 3BIUH 1WQVH 1SLUB 1Y59T 2Y5FA 4QT8C 2QYIA 1QRXA 2Z9LA 1EATA 2UUKB 4A7IB 2ZFRH 3ATIA 4ISLA 3T62A 1ZR0A 1LPKB 2G00A 4XBDA 3MO9A 4JK6A 1O32A 2Q6DA 2OQ5A 1C4U2 1INCA 4DT7B 3UQVA 4NCYA 3RXVA 3SU2A 3SNDA 1UHBB 3A86A 3ESTA 4GUXA 1HB0B 4WVPE 3UREA 4XBCA 1FAKH 3M5MA 2M5TA 1O3IA 4CHAB 2CHAB 4JZDH 1SC8U 2PSXA 2RCEA 4H4FA 2OBOA 3BTTE 5C2ZA 1L1GA 2HLCA 4BNRA 4UE7H 1K1NA 1O3LA 1QFKH 2BB4A 2BMGB 3LH3A 1W3CA 3KHVA 3SNCA 3ZZ9A 4CR5A 3RU4T 2AS9A 1TX7A 3TPIZ 1SL3A 1C5YB 4O03A 1ANEA 3OTJE 6CHAB 2J4IA 3LGUA 1BHXF 1D4PB 4ISOA 4A92A 1IQFA 2PLXA 3NKKA 1V2OT 4Y8XA 1HAXB 4X1QU 3SUFA 3B8JA 5C3NA 4GSOA 1OXGA 1W14U 2Y81A 4IC5A 4CRCA 1EAXA 1DWEH 3L33A 1QQUA 5HXFA 7ESTE 5E0JA 2ZECA 1GGDB 1HAOH 4Y10E 3MNBA 4LOYH 1O38A 2R3UA 1AFEH 1JWTA 1WQSA 5A2MH 3SI3H 1F0UA 4X1PU 1MZDA 3Q3KA 5FX5A 5IYTA 3M7QA 1SGFA 1V2KT 1ZJDA 3PMJA 2EC9H 3B9FH 2GCHG 4JCNA 1C1OA 1NM6A 4BANB 2ZDKA 1A3EH 1SLVB 3P17H 1QGFA 7LPRA 3T28A 2QXGA 2WYJA 3SV9A 3LJOA 1KXBA 1XM1A 3FZZA 3RXSA 3T27A 1ELEE 1ZPBA 1TPPA 3VGCC 1RTFB 4BAHB 2ZFSA 1ZGIA 1DFPA 1V2TT 1NPMA 3RXMA 1GHAG 1WUNH 1O30A 1SGEE 1K9OE 1GJ9B 1EPTB 1N8OC 1BJVA 5EXNA 3BG8A 3MO3A 1P04A 2XYAA 3A7YA 1KIGH 1O2JA 1PPFE 5EODA 4X2WA 2BYAX 1THPB 1E38B 1LKBA 3NUMA 1YCPH 2BXTH 2D1JA 1OX1A 1JRSA 1GHZA 2W3IA 1C5TA 3TLOA 4AX9H 4OS4A 2FEQH 3DD2H 2VINA 1FQ3A 2BLWA 4FUHA 3RXGA 1BUIA 3SI4H 1T4VH 4D76A 2HGTH 4MPUA 5E0HA 4FU7A 1EZQA 1CSOE 1O2NA 5C1UA 2PTCE 2XWAA 3GYMA 1UCYE 3BEFB 1DXPA 1FAXA 1HYLA 1GBEA 1TA6A 1J8AA 2SNVA 1IHSH 1W7GH 1TNIA 3HGNA 5J4QA 1YPGH 3BG4C 2FOCA 2J92A 4NGAH 1O2SA 1BRCE 4IN1A 3BTFE 4O3UA 1PPEE 3KIDU 2QF0A 4YLUA 1UCYK 1YPKH 1T7CA 1QURH 3E91A 3QO6A 4E7NA 2HNTC 5DPAA 3JZ2B 4VGCC 4FVBA 1O5BB 2AMPA 1LO6A 2EEKA 3CP7A 4Y79A 4X0WU 3V0XA 3UR6A 4LZ1H 1Z6JH 1GHBF 1L0ZA 1NN6A 1ZJKA 2FOGA 3P70B 2Y80A 1HAYB 4U01A 1SVPA 2BD4A 1VR1H 5DP9A 1AO5A 5LPEA 1AB9B 3MU4A 1K28D 4K5ZA 5A0AE 1MUEB 2GD4B 4Y76A 1LVMA 5A8XA 2A4OA 1SI5H 2V0BA 1C2LA 2ZP0H 4B76A 1N6XA 2BY5X 2HPPH 3SUGA 1XUHA 4FUIA 4I32A 1G3EA 3A8DA 1SOZA 4K3JA 3NK8A 1P12E 2ANYA 3RXKA 1P01A 1EJAA 4ZHMU 4KP0A 2OLGA 4DW2U 4YTAA 4ASHA 4ABHA 3ZZ3A 1LVYA 4IC6A 4M7GA 4ABAA 4H6SB 1CA0C 3A83A 1IQHA 3AAUA 1UTJA 3ZZCA 4K60A 3SV8A 3UNRA 3SJIA 1GL0E 1BCUH 1UJ1A 4Y0YE 1JIMA 1YKTA 1EZSC 2KAIB 3SOSA 3S7KB 2F83A 2ZHDA 2Z9IA 3ODFA 1O2UA 2CN0H 4K1SA 3KCGH 3URCA 1RS0A 1V2JT 1V2UT 4ZUHA 4BOHA 1Y5UT 1Q31A 3MU1A 4X1RU 3PYHA 2A5KA 2F9NA 1O2ZA 2BQ6B 1GMCF 2STBE 3TNTA 1DWCH 4D9QA 2BDGA 1Z8IB 1Z8JB 1GBCA 1DS2E 1O3NA 2ZGBH 3P95A 1P06A 5ETXA 2OC8A 5T3HA 2QC2A 2Q6GA 1ELCA 1AKSB 1UK4A 3PMHB 2NWNA 4NA7A 2BY6X 2YNAA 3MH6A 4X2VA 4ABBA 2IPHA 4ZAEA 2AMDA 1SQAA 2H6MA 2XXLA 3GDUA 1VJ9U 3P8FA 3SU1A 4X8TH 3SJOA 1VCQA 4NFFA 4AZ2B 1HFDA 4KTSA 1Y3UA 3SV6A 2CV3A 1GMCG 2BLVA 1TFXA 3MU0A 2ZGHA 3MMGA 1GHXH 1TNLA 2VGCC 4ZMAH 5C20A 2F9PA 4CRGA 4Y71A 3A88A 4O97A 1TQ7B 2O8MA 3KN2A 1TAWA 3ZV8A 2OBQA 4BTTB 3ZZ5A 3B23B 2OP9A 1T8OA 4B74A 2J2UA 1QIXB 4JYTA 3MOCA 1CGHA 8KME2 3ATKA 1S6HA 2Z6BD 4ZH8A 2TGDA 1ESBA 4F4OC 1LVBA 4FUJA 1UCYH 3M5NA 1YC0A 1CGJE 1GCTC 2OTVA 3QLPH 1DX5M 4K8YA 4ZKOU 5AFYH 2ODYB 1FV9A 1TNHA 3P8OA 1C2HA 4ABIA 2BVSH 4MTBA 2ZDMA 1T8LA 3K6YA 1XXFA 5DGJA 1TRMA 2BDCA 2FOHA 1NRRH 5F8ZA 1QCPA 1ETSH 1C4Y2 1ZMJA 3MI4A 2ZPRA 1BRUP 3PMAB 2DUCA 1X7AC 2XWBI 5A8YA 1GCDA 1H9LB 3GY4A 1C1PA 4MQAA 4NWLA 1XUIA 5B6OA 3U8OH 1SQTA 1FLEE 5DK1A 1K1MA 5E2OA 1V3XA 1AI8H 2CMYA 5CMXH 5T6DA 4MDSA 5EQSA 5BPEA 2GTBA 1AVXA 1FN6A 2EI7A 3A7ZA 1ELGA 1W12U 1K1OA 1C4V2 4Y8ZA 3F9GA 3NPSA 1A3BH 2OC1A 2W7UA 2R2WU 2J9NA 1ZPCA 2ZQ2A 1MTUA 2ZHQH 5K7RA 4SGBE 1KDQB 1LTOA 1C9TA 1GJAB 3BTEE 2Z94A 1C1UH 1B5GH 2W26A 3P92A 2P94A 2G4TA 1O5DH 5JB9S 2ANMH 1QNJA 3SO3A 5L2ZH 1FJSA 1SQOA 1O2GH 1IQEA 4YT7H 5LPFA 3RXPA 1D6WA 2UUFB 2XTTB 1GBJA 4WH8A 2AEIH 3Q3XA 1GI8B 5JYIA 1Z6EA 2GP9B 1P57B 4O3TA 5A8ZA 2GZ9A 1C5MD 2AGEX 5JBBS 5C67A 1ESTA 2BD9A 1F92A 4Y7AA 2ODQA 3CS7A 4RN6A 2H2ZA 2I6SA 3E16B 1UTLM 3GCTF 4IS5A 7KMEH 1EPTA 2ZCLP 1HUTH 1PQ8A 2ZF0H 1O2HA 1A0JA 1XMNB 4K69A 1ORFA 1SOTA 3A8BA 3S9BA 2FS8A 1TPOA 1DICA 1FIWA 1EQ9A 1A5IA 1S0RA 3GCHC 5LPRA 1H1BA 1UK3A 2LNCA 5FXLA 4HI3A 1MTWA 1UTQA 2XC5A 1OWDA 3RXAA 3ZZDA 1N1LA 2PWXA 3U1JB 1BMAA 1DSUA 5JB8S 3SBKA 3GOVB 2G51A 2R0LA 1MAYA 3SV7A 1PPZA 1BA8B 1QRWA 3VB6A 2TGPZ 4Q7YA 1G3CA 4IMQA 3M3TA 4ZKNU 2PKAB 1WAYB 7GCHG 2VWNA 2FZZA 1NRQH 3GCTG 2RA0A 1NS3A 2R3YA 1Y8TA 2FYRA 2JH6D 2JH0D 1G2LA 2SGEE 4CRAA 1CVWH 1BOQA 5EPYA 1GI9B 4NIVA 1F7ZA 1JBUH 2Q1JA 2XRCA 1HBTH 3GDSA 1C5SA 1MKWK 2XNIA 4J1YA 3H7OA 1YLDA 1TB6H 1P2IA 2G5VA 2IN2A 2ZDNA 1K1JA 1JOUB 1PQ7A 5DP4A 2BVXH 3PB1E 1D3TB 1H9IE 3A84A 5I46H 3RC4A 1EOLA 3A7WA 3A8AA 3BTQE 3MO6A 1GI3A 4LK4A 2ZU4A 1G3DA 5BRRE 2FX4A 1O3KA 2ZNKH 1W2KH 4INKA 3BF6H 4E06H 3R3GB 3ZZ6A 2A32A 4AB8A 2RA3A 5C5OA 1HLTH 1J14A 1PJPA 4I33A 4DVAU 1GPZA 1GVLA 3LT3A 1JXPA 2VNTA 1EZUC 4MNVA 4XDEA 2Y7XA 1FDPA 5JBAS 1NC6A 4DJZB 1P03A 2PW8H 1ELDE 3HKIB 1BT7A 1L1NA 2GGVB 1PYTC 1SHYA 3IG6B 3AAVA 5F8TA 2D26C 3HK3B 5EXLA 1UVUH 1Z1JA 4UFEH 4I8GA 1MD8A 5LGOA 4UD9H 2STAE 2JETC 1MQ6A 4IGDA 5EQRA 1O2KA 2UWPA 1T8NA 2PFEA 6GCHG 1HAPH 1TOMH 1B7XB 1ZHMA 4UONA 2XBYA 4FUBA 4AYVB 1D6RA 3GDVA 4ZXYH 3EGKH 5FPTA 2ANWA 2ZHEH 5GWZA 2QIQA 1GBMA 3GY7A 5HM9A 4ISIH 3LC5A 4DGJA 1Y3XA 2VWLA 4AGJA 1BTYA 3MWIU 4TWWA 1GG6B 1SGTA 1N8OB 2BLOA 3TJOA 1ELAA 5PTPA 3HGPA 3ZVAA 1NFWA 1EP6A 4Q2KA 1MBMA 4NIYA 5F03A 1GDUA 1PPBH 1ELBA 3JZ1B 5AHGH 3UPEA 3M35A 2Z9GA 3ZZBA 1S0QA 2AMQA 3QTVH 3O8RA 2BZ6H 3QGNB 1HJAC 2P3TB 2TPIZ 4WWYA 1XUFA 4BXWA 2ZA5A 2NU2E 4AYYB 1O3DA 1HV7A 1WOFA 4CRDA 1HJ9A 1TQ0B 5E8EH 3RXRA 1AKSA 1C1VH 1Z71A 2FYQA 1DLEA 1UTKA 3KNXA 2CJIA 3Q76A 5EU8A 2OD3B 5GDSH 4ABFA 3KEEA 2VIVA 1ANCA 2THFB 3U9AH 3C1KA 4LXBH 3OYPA 4WJG2 4ZXXH 1D3QB 1NRSH 1XXDA 2VU8E 5EPNA 3BG4B 1C1RA 3SJKA 5F6MA 1MTNC 2J95A 5C1XA 3F68H 4DURA 1P09A 3DFJA 1A0HB 1OP0A 1P11E 3UQOA 4A5TS 1DSTA 5DP5A 1MBQA 2TRMA 3TGIE 2GCHF 1OSSA 2ZFPH 3WY8A 1ZHRA 1YP9A 1V2WT 5C1YA 1YPMH 1ELTA 2FI3E 4VGCB 4X8SH 4XFQA 3U8TH 3RC5A 2BHGA 3TK6A 1CA8B 5IDKA 4ESTE 4RSPA 1OWJA 1WCZA 1U6QA 2ZWLH 3MTYA 3KL6A 1MKWH 1GHAF 1THRH 3BIVH 2ZEBA 4D7GA 4OS2A 2ZHFH 2C8WB 1HAVB 1AVWA 2ZHWH 1E0FD 4NFEA 1D9IA 1ID5H 1CT0E 1NRNH 3P8NA 4TPYA 1PYTD 1DWBH 2ZGJA 1TABE 2ZO3H 4UDWH 3SGQE 3SZNA 4R0IA 2GVFA 1YF4A 4K8BA 1A61H 1FN8A 3KF2A 2HNTE 1IQIA 2O8TA 1MD7A 1O3PB 1SSXA 1SFQB 4AG1A 5A09A 4I8KA 1W0ZU 1MAXA 1AN1E 1G32B 2ODPA 2O8WA 1UK2A 3OX7U 1AVGH 2A4RA 2FI5E 3PLBA 4TY7A 4BAMB 3RXQA 1CA0B 1BBRE 4JMYA 3QUMP 1QA7A 1O2XA 1GJ7B 1T32A 1F5RA 3SNEA 1C5UA 3RXDA 2OINA 1BBRK 3NCLA 1BJUA 1S81A 4WXVA 4WMFA 4OS5A 2VVUA 3LU9B 2NU0E 3RMNH 1SGCA 4AB9A 1LPGB 5FAHA 5L30H 4U32A 3A81A 3PO1B 2K1QA 1OWIA 4MNYA 2QXIA 3GY8A 3PROA 2A7CA 1C1MA 1DUEA 1DVAH 3P6ZB 3BTKE 2FM2A 2WPLS 2FESH 5EW2H 1WSSH 3ZVGA 2XCFA 2OC0A 1SGPE 1GDNA 1O2LA 1HIAB 2XW9A 1BMLA 1L4DA 1XX9A 1TGSZ 1QJ6B 1BMNH 2NU1E 6LPRA 2A7HA 2V3HH 3I77A 1GI5A 1HAZB 1QL7A 3I29A 2HRVA 2HOBA 1FPHH 3RM2H 3E1XB 2NU3E 2FTMA 1A7SA 1SHHB 4B73A 3LGYA 2VGCB 2ZTZA 2VVVA 1QL9A 3TIUA 2ALVA 2XC4A 5FBIA 3MU8A 2PGQB 4AN7A 1AIXH 1HDTH 1QHRB 4B2AA 3ENSB 3SJ8A 3FANA 4AGKA 4KKDA 1Y3WA 4CREA 3RLYH 3SHAH 2A45B 1UVPA 1P2OA 4X2XA 2YOLA 1WBGB 2PKAA 2VH0A 2BTCE 1AWHB 2HNTF 1TX6A 1W10U 3SGAE 3RXLA 3U69H 1CBWC 2BX3A 1SB1H 1J17T 1P9UA 3ZYEA 1OWHA 1DLKB 1QL8A 3HK6B 4OS6A 2G81E 1VGCC 2ZQ1A 1TA2A 3RDZA 5JBTA 2ALPA 2FOBA 4AFQA 1GJ6A 1FUJA 1XVOA 1E37B 2EI8A 4Q80A 1LHEH 1O2RA 3RXEA 1FXYA 2GCTC 2FLRH 3VFEA 1TRNA 2FPZA 3BV9B 1S84A 2C90B 2P8OC 2DE9A 3MNXA 3GICB 1QRZA 3KGPA 4YOGA 1PQ5A 1HAGE 1DDJA 4NA8A 4FUGA 4WMDA 1YLCA 1BTXA 1G30B 4X6MA 3QX5H 2PKSC 1IQLA 2PR3A 1MKXK 2A1DB 4A1XA 4U2WA 2XC0A 3SN8A 1KTSB 1DY9A 1O35A 1C5XB 4ZROA 2QN5T 4ABGA 1P2NA 1EPTC 5EQQA 1S6FA 1L4ZA 1C2FA 4YT6H 5EOKA 3D49H 1G36A 3M5OA 3V7TA 1ZYOA 3PTNA 1TGBA 3O8DA 3BEIB 2Y7ZA 1IQGA 3TJVA 3E0PB 3RXTA 1L1JA 3ZYDA 2H9HA 5LH8A 1TBQH 3LJJA 2A7JA 1JIRA 3I78A 2WINI 1F0SA 1BBRH 2BDAA 4X6NA 1F5KU 1DUAA 2W7SA 4FUFA 2B8OH 2GKVE 1ZRBA 3GCNA 2WPJS 1RGQA 4IW4E 3VXEH 3ZZ8A 1H4WA 2B0FA 4K1TA 1QB6A 1ZRKA 1P3EA 1C2MA 1O0DH 3GCHB 4YO9A 2ZGXH 4FU9A 1FNIA 1A2CH 1KLTA 3GYLB 2ZC9H 1GJ8B 1PPCE 4NIWA 1B0EA 3A7TA 1OWKA 1VCPA 5E2PA 4R8TB 2OCVB 3MYWA 2BQWB 2GDDA 1O3MA 2B7DH 1K2I1 1GHYH 4BAOB 2XBXA 3ATMA 4AOQA 3M7UA 1FZZA 5DP6A 4TPIZ 2ZU2A 1UHBA 4X1NU 1GI0A 1QBOA 2AGGX 3SUDA 5F8XA 1GHVH 1ACBE 1GBLA 2BD2A 2GV7A 2VJ1A 3DFLA 2GT7A 3W94A 4INHA 1AU8A 4IMZA 4Z6AH 3HATH 1FY3A 4MNXA 4XBBA 1AFQC 3PWBA 1OOKB 1MTSA 1MCVA 1YM0A 1EAUA 1SGRE 3N7OA 3PM3A 3QDZB 2FO9A 2ILNA 1KXCA 4XSKU 2FDAA 3LGTA 1KLJH 2VWOA 3L3TA 1N6YA 1ELFA 1EB1H 1TNKA 5A0CA 2Z9JA 1FONA 4I7YH 3M3VA 3UOPA 2FOAA 1SR5C 2OXSA 3LKWA 1OYQA 1E34B 5FPYA 2GX4A 4Y8YA 1P02A 1TYNA 2GT8A 1NFUA 4AORA 1O39A 5T6FA 2F9BH 2CF8H 1SG8B 4RKJB 2PUQH 1GVZA 1FY1A 4I31A 4E05H 4E7RG 1MU6B 1TGCA 3K6ZA 4YZUA 3DT0H 1GJDB 2JETB 4X1SU 1UTMA 3Q3YA 1G3BA 9ESTA 3GY3A 3F9EA 3SW2B 1GBTA 4THNH 1TALA 2BDBA 1FY8E 1S85A 2GMTC 3DA9B 1PPGE 1C5QA 3ZV9A 3FAOA 2AIPA 4HFPB 1RRKA 1MKXH 7GCHF 5I25A 5L2YH 3QGJA 1DE7H 1ZLRA 4BTUB 4AFUA 3KQBA 2JKHA 2Q6FA 1SGYE 1KXAA 2VIOA 1BRAA 1YGCH 1WYKA 1C5WB 4KTCA 1CQQA 2ZTXA 1K1PA 1GBFA 3PTBA 4Y6DA 3UOUA 2V35A 4CBOA 3URDA 3BTDE 4H6TA 1ZSLA 1DT2A 2BY8X 4I8HA 2OQUA 1O2QA 4JZ1A 4UFFH 5FPSA 3GISB 1AY6H 2FX6A 3SGBE 1HJAB 2O8UA 1RFNA 2BDIA 2FI4E 1Y3YA 1V2LT 2CF9H 1TX8A 2ZFTA 1TMTH 2HALA 1UO6A 3Q77A 4MPWA 3ZVEA 1A5GH 1QJ1B 1S82A 3ATLA 1YPHC 2VIQA 3UIRA 3TGJE 3VB4A 2Y5HA 1GMDG 2EI6A 1CHOF 1GBIA 4K1EA 1D3DB 1NTPA 3M5LA 3SQHE 2GZ7A 4X6PA 3SHCH 1XUJA 2ZCKP 4DIIH 1O2PA 3RMOH 1HRTH 3EYDA 2SGQE 4PROA 1J16A 3CS0A 1KXDA 2ZTYA 1OP2A 3NWUA 3RXBA 5JPMH 1YPLH 3ITIA 1GBBA 9LPRA 2SGDE 1ABJH 5TCCA 2A5IA 2QF3A 1T31A 6GCHF 1ZHPA 2WPKS 3F1SB 3EDXB 4GLYA 3QZRA 2VIDA 2H5DA 4ZHLU 2IJOB 4Y7BA 1QBNA 1IHTH 2ZPQA 1CHOG 3Q00A 1LQEA 1Y5AT 1EKBB 2BD8A 2QGRA 3MNCA 2F9VA 4HGCA 3E6PH 3E8LA 4AFZA 4F49A 1V2PT 1P05A 3IWMA 1WTHD 1GBHA 4B2CA 1SLXB 1BITA 2PHBA 1W11U 3D62A 4GHQA 1KSNA 6ESTA 3SORA 4JYUH 1MU8B 3FP8E 1C5NH 1RTLA 3M7TA 5DP7A 1K1IA 3SU3A 1C5VA 2F9OA 4JZEH 1L2EA 4DCDA 5ESBA 1C5PA 4NIXA 4I8JA 3FP6E 1SLWB 4NSVA 3UWIA 1UTNA 4I8LA 1TNJA 2FODA 3VXFH 1PQAA 3A8CA 1AGJA 1UVSH 1F0TA 3LONA 4H42U 2OC7A 5GJ4B 3VGCB 1LPZB 1O3JA 1F5LA 5AFZH 1LHCH 2FS9A 3E3TA 4CBNA 4MVNA 1ELVA 1Z8RA 4ABEA 2EA3A 4MG3A 1EB2A 1C2GA 1YYY1 4ZKRU 3RU4D 2KAIA 1NY22 1W8BH 4WY3A 1ANDA 1QA0A 3ZVBA 1P9SA 4JYVH 2ULLA 4CH2B 1IQNA 2W5EA 1ARBA 2HPQH 1SGFG 3RMLH 4FVDA 4NZLA 2ZCHP 5C5NA 1UMAH 4OGXA 3A80A 2WV4A 1WU1A 4A1TA 1TE0A 3FP7E 3AVZA 1VITF 3UNQA 2C3SA 3S0NA 3TGKE 5CHAC 2ZZUH 3NZIA 2Z3DA 2V6NA 2UUYA 2W3KA 1YPEH 1FPCH 3A85A 4NSYA 3T25A 2VIWA 2BM2A 4WXIA 3A87A 1A1RA 2QCYA 3U1IB 5AVDA 1O3HA 4B1TA 1MQ5A 1TRYA 1C1WH 2BX4A 2RDLA 4Z0KA 1LKAA 2F3CE 2UWOA 3SU4A 2BOHB 3HKJB 5HM2A 3EQ0H 3A82A 1AUJA 1FY5A 1AZZA 1NZQH 4A6LA 1PFXC 1W13U 2C8ZB 2Z3CA 1HAIH 3LGIA 4TYDA 1VITG 3KQDA 1GI4A 3FFGA 2H5CA 2UUJB 2QV1A 1O3EA 4JZFH 3C27B 2J38A 5A0BA
chains in the Genus database with same CATH superfamily
2ANKH 4NZQA 1K1LA 1BTUA 2F91A 1DY8A 2ZFFH 1DANH 1PPHE 2ZG0H 4NA9H 4ZKSU 1NBMD 1EZXC 1GL1A 2VB0A 1ZMNA 4CRFA 1VITH 3RM0H 3KYGA 4RKOB 4M9FA 2QAAA 1O2WA 1QR3E 2B9LA 2VIPA 3D65E 3S9CA 2P93A 1C2IA 3PLPA 1O31A 4IBLH 1QB1A 3TH3H 4GAWA 1S83A 2WV5A 2AH4X 1KTTB 1GJ5H 2FTLE 4ABJA 1TIOA 2XCNA 1CT4E 2I6QA 1CBWB 1IAUA 1K22H 3OY6U 1T8MA 2ASUB 1ANBA 1HNEE 3BTHE 5FCRA 1NROH 2ZPSA 3BTWE 1TPAE 1EAWA 1VGCB 3AW0A 1D3PB 5GXPA 1AD8H 1UVOA 1SGNE 2VWMA 3KQEA 3LPRA 2QY0B 2BD3A 5TCAA 3E90B 3ZZ4A 2KCAA 2GCTB 1VKYA 1DITH 2PGBB 3MFJA 1SFIA 3TVJB 1TNGA 2P8OB 4ZCNA 1TPSA 2WPIS 4FUEA 4OS1A 4KTUA 1HXFH 2BLQA 2ZU1A 4MNWA 1B0FA 3ODDA 1A4WH 2PKSB 2WYGA 1O3AA 1BIOA 4P00A 2AIQA 3M3SA 5DP3A 2TGAA 2BDHA 3DSGA 3V12A 1KDQA 1ZTLA 3FVFB 4B6EA 1EJNA 3A89A 3SNAA 1BMMH 1RIWC 1EASA 3PWCA 2GDEH 1GG6C 1WTGH 5FX6A 1MTVA 1KXFA 1Z8GA 2QXJA 2BDYA 4ZHAA 1MZAA 3F6UH 4ISNA 3SUEA 4DY7B 4Y0ZE 2FMJA 1P3CA 5L6NH 1VZQH 1ZSKA 2FWWA 3VEQB 1IOEA 1LVOA 2ZDVH 1NFXA 4X8UH 1ZMLA 3OSYA 1O5FH 3ATWA 1O3FA 1ZSJA 3H09A 3F9FA 5FCKA 4B6FA 3O8BA 2YMSC 2KZ4A 1TBZH 2VH6A 1RXPA 2A0QB 2G55A 4JK5A 2P16A 1AHTH 1IQMA 1NU9A 2O9QA 1E35B 4D8NA 1Z7KA 1ZGVA 1C5OH 1M9UA 3G01A 3M36A 4DOQA 2B5TB 2Z3EA 1O5AB 1EP5A 2TGTA 3DUXH 4HZHA 2WPHS 1C1TA 3RC6A 1FIZA 2CHAC 4CHAC 1AUTC 4YM9A 1CE5A 1NRPH 3RXIA 1GJ4H 1TWXB 2FP7B 5KEDA 3STJA 3U8RH 1EXFA 4DIHH 3QK1A 1V2QT 1A46H 4RI0A 1FI8A 1LHGH 3A7XA 2ZIQH 1TBRH 2GZ8A 3LOXA 4UFDH 1O3GA 1A0LA 1H9HE 3PLKA 6CHAC 2PUXB 1CT2E 1QBVH 3AW1A 3O8CA 1HJ8A 1C2JA 3KQ5A 1GCTB 1V6DA 1ARCA 4F55A 1JMOH 3RXHA 2P3FH 3TH4H 1BTWA 3HPTB 4LZ4B 3LH1A 1SGIB 1Q3XA 1LDTT 1KLIH 3BSQA 1WV7H 3LC3A 2XBVA 1TMUH 3K2UA 2F4LA 2SFAA 1GGDC 3NXPA 1K21H 1T4UH 1HCGA 2K8IA 4FETA 3LGWA 2WPMS 2YNBA 5SGAE 1O3CA 2AGIX 1Z1IA 3TJUA 1AFQB 3VB3A 2AERH 3M37A 3ELAH 2KX4A 1HXEH 2R2MB 2HVXA 1EJMA 1ZTKA 2PSYA 3ZZAA 2Y82A 3PV2A 4B2BA 1OPHB 1GBDA 4CRBA 1H8IH 5EXMA 1TGTA 4INLA 5DSFA 1DPOA 1P2QA 1NESE 2ESTE 3EA9A 4GPGA 1V2NT 4Y11E 3S69A 1GHBG 1J15A 1G9IE 1SGDE 4HTCH 1IQJA 1IQKA 3RXCA 4XOJA 4OM9A 5FBEA 4FUCA 3ZVCA 2UWLA 1C5LH 3T26A 1OYTH 3ZVDA 3MH4A 1NFYA 3SJ9A 2FIRH 2A5AA 1UVTH 4NG9H 1Y3VA 1EX3A 2J94A 4D7FA 2NU4E 3A7VA 4JZIA 2P95A 3P8GA 2IOTA 3L6PA 1QY6A 3U28C 2Z9KA 2SNWA 1TLDA 4MPXA 5KECA 2GMTB 2BY7X 5ESTE 1J9CH 2YMSD 3PO1C 1TMBH 3BTGE 8GCHF 1GI7B 5K0HA 1XUKA 1YCPM 1C2KA 5DN6D 3SV2H 4K2YA 1RTKA 2A2QH 4BTIB 1OHHD 2JDID 3W95A 2R9PA 3TITA 1O2OA 4WF8A 1OWEA 3LGVA 1DWDH 1XUGA 5DKMA 3GY2A 2C8YB 4UFGH 1MMJN 3H7TA 1YBWA 3E0NB 4UEHH 1TONA 3RXJA 1P10A 1ZZZA 1QTFA 2ZI2H 3UB0A 1O5CB 4U30A 3UUZA 1DXWA 1DM4B 3QZQA 1O5EH 2SGPE 4DG4A 1AMHA 3BTME 3OU0A 1SMFE 1A5HA 1YPJH 3TU7H 1CGIE 8GCHG 2O8LA 1BB0B 1BTHH 1SGQE 1SPJA 2LP6A 5DJ7A 5E0GA 2R0KA 2XBWA 3RU4E 1O2VA 2P59A 1AE5A 1AB9C 5AF9H 1YWUA 4D9RA 4XRNA 5EG4A 4B71A 3AASA 3UFAA 5J4SA 1S5SA 2ZU5A 3STIA 2FLBH 2JJ2D 1V2MT 3MU5A 1H8HD 2OUAA 4KGAA 2BD5A 2CXVA 3U98H 2ZDAH 2A4QA 3UTUH 3TH2H 3M61U 5JBCS 3OFND 3F2GA 3SNBA 2QXHA 3F9HA 1LCYA 1P0SH 1EAIA 2G5NA 1LQDB 1F2SE 1O2TA 3TK9A 1THSH 4KELA 1YPHE 5EJLA 1QQ4A 1BRBE 5DG6A 2BY9X 3DSOA 3EAJA 1ETRH 1QJ7B 4IN2A 3SYJA 3H5CB 3T29A 4CH8B 1HAHH 3SU6A 1BTZA 1O5GH 2BD7A 3QTOH 1HAVA 3VB7A 1RD3B 1GWAA 1NO9H 2A4GA 1BZXE 3PMBB 3PV4A 5IK2D 4TWYA 1HGTH 1O37A 2C4FH 4YOIA 1LHDH 2BVRH 4OGYA 2PTNA 3ZZ7A 4Q7ZA 2TIOA 4I86A 3T5FH 2FOEA 3RXOA 3GY6A 4P02A 1TGNA 2HWLB 4NWKA 1XKAC 1LMWB 2BQ7B 1SQRA 3TK5A 3DHKH 2H9EH 1XVMA 3QWCH 2H9TH 4FU8A 2BOKA 1ETTH 1O36A 3CENA 2ZDLA 5GPIB 1C2EA 4MPVA 1AWFH 2JH5D 5FHTA 1NBME 2J34A 1O3OA 1LHFH 1XKBC 4TSFD 3D23A 1GMDF 3K9XB 3VPKA 2D8WA 1G2MA 1O2YA 1Q2WA 2VVCA 2G52A 8ESTE 1VCWA 3GCOA 3EE0B 5GIBA 3TJNA 2Y6TA 2W6JD 1BTPA 2XNDD 1JRTA 2GV6A 3F2HA 3RXUA 1EOJA 1ZTJA 1GI2A 1CHGA 1MCTA 2FOMB 4CR9A 1GVKB 5CHAB 2BXUH 2H1UA 2V3OH 3MH5A 4XE4A 3UY9A 1GDQA 2ZU3A 3RP2A 1GHWH 4AG2A 1GI6A 5C0UA 2Z7FE 1ZPZA 3SQEE 1CO7E 3MH7A 1AQ7A 3V13A 1KYNA 3MHWU 1O2MA 3K65B 1GI1A 4BAKB 1KY9A 1UW7A 1V2VT 3SU5A 1HIAA 1MH0A 2WUCA 1S6LA 1ABIH 1BQYA 3QN7A 1GBAA 2P3UB 5TJXA 1O3BA 2ZFQH 1GJCB 1NT1A 4MLFB 2WUBA 1Y5BT 1MTNB 4ABDA 2SGAA 4GHTA 5DO4H 5GCHF 1YLNA 1FY4A 1C1QA 3TNSA 1AE8H 1ESAA 4FXGH 3ZVFA 4OS7A 1C5RA 4WMEA 1NU7B 2G8TA 1BHXB 1V2RT 4YESB 5HGGA 3FZDA 1KXEA 1UTPA 3UAIC 1P2MA 1O34A 1RJXB 1F0RA 1GMHF 4B75A 3S7HB 1QB9A 2G4UA 1ZOMA 3GY5A 5T6GA 4O9VA 4BAQB 3BN9A 8LPRA 2F9UA 5G4BA 5JDUB 2C8XB 1H8DH 1DOJA 2RG3A 1CU1A 4A1VA 3IITA 3EA8A 2PV9B 1P2JA 3OY5U 5CE1A 2ZKSA 2F43B 1C1NA 4BXSA 3RLWH 5GCHG 3MNSA 2C93B 2ZGCA 3UNSA 4X8VH 2AFQB 1UTOA 1P2KA 1C5ZB 2LPRA 2WZQA 5DP8A 1VJAU 3SU0A 2M2AA 3BEUA 4GCHF 1O33A 4GVUA 4J2YB 2DE8A 2TBSA 3EA7A 4ISHH 3V3MA 1SBWA 5ABWA 1GBKA 3UWJH 1C1SA 1GMHG 3RUOA 2QA9E 2FOFA 3RMMH 2VBCA 1OS8A 2D2DA 5C94A 3KYFA 2AYWA 3UR9A 4FUDA 4YOJA 3LDXH 4Q7XA 4X2YA 3LIWA 1YCPK 2CGAA 3F2FA 2SGFE 1W7XH 2BZAA 1HPGA 1P8VC 1OP8A 1W0YH 1GJBB 4YLQH 5HYOA 4WH6A 2A31A 1BDAA 3F0OA 1EUFA 2A2XH 1C2DA 3T2NA 1G37A 5EGMA 4X6OA 3KQCA 1C9PA 5HMAA 4TY6A 2Y5GA 5H4IB 3S9AA 5EW1H 1RIWB 4AFSA 4GCHG 1V2ST 2FXRA 1OKXA 1E36B 3VB5A 3RXFA 4SGAE 1AZ8A 1O2IA 1FMGA 5F53A 1TOCB 3NRLA 3R0FA 3BIUH 1WQVH 1SLUB 1Y59T 2Y5FA 4QT8C 2QYIA 1QRXA 2Z9LA 1EATA 2UUKB 4A7IB 2ZFRH 3ATIA 4ISLA 3T62A 2YMSB 1K0HA 1ZR0A 1LPKB 2G00A 4XBDA 3MO9A 4JK6A 1O32A 2Q6DA 5KGOA 2OQ5A 1C4U2 1INCA 4DT7B 3UQVA 4NCYA 3RXVA 3SU2A 3SNDA 1UHBB 3A86A 1W0JD 3ESTA 4GUXA 1HB0B 4WVPE 3UREA 4XBCA 1FAKH 3M5MA 2M5TA 1O3IA 4CHAB 2CHAB 4JZDH 1SC8U 2PSXA 2RCEA 4H4FA 2OBOA 2WV9A 3BTTE 5C2ZA 1L1GA 2HLCA 4BNRA 4UE7H 4ACAA 1K1NA 1O3LA 1QFKH 2BB4A 2BMGB 3LH3A 1W3CA 3KHVA 3SNCA 3ZZ9A 4CR5A 3RU4T 2AS9A 1TX7A 1BMFD 4Z1MD 3TPIZ 4FOUC 1SL3A 1C5YB 4O03A 1ANEA 3OTJE 6CHAB 2J4IA 3LGUA 1BHXF 1D4PB 4ISOA 4A92A 1IQFA 2PLXA 3NKKA 1V2OT 4Y8XA 1HAXB 4X1QU 3SUFA 3B8JA 5C3NA 4GSOA 1EFRD 1OXGA 1W14U 2Y81A 4IC5A 4CRCA 1EAXA 1DWEH 3L33A 1QQUA 5HXFA 7ESTE 2EQNA 5E0JA 2ZECA 1GGDB 1HAOH 4Y10E 3MNBA 3WWFA 4LOYH 1O38A 2R3UA 1AFEH 1JWTA 1WQSA 5A2MH 3SI3H 1F0UA 4X1PU 1MZDA 2KCOA 3Q3KA 5FX5A 5IYTA 3M7QA 1SGFA 1V2KT 1ZJDA 3PMJA 2EC9H 3B9FH 2GCHG 4JCNA 1C1OA 1NM6A 4BANB 2ZDKA 1A3EH 1SLVB 3P17H 1QGFA 7LPRA 3T28A 2QXGA 2WYJA 3SV9A 3LJOA 1KXBA 1XM1A 3FZZA 3RXSA 3T27A 1ELEE 1ZPBA 1QZ8A 1TPPA 3VGCC 1RTFB 4BAHB 2ZFSA 1ZGIA 1DFPA 1V2TT 1NPMA 3RXMA 1GHAG 1WUNH 1O30A 1SGEE 1K9OE 1GJ9B 1EPTB 1N8OC 1BJVA 5EXNA 3BG8A 3MO3A 1P04A 2XYAA 3A7YA 1KIGH 1O2JA 1PPFE 5EODA 4X2WA 2BYAX 1THPB 1E38B 1LKBA 3NUMA 1YCPH 2BXTH 2D1JA 1OX1A 1JRSA 1GHZA 2W3IA 1C5TA 3TLOA 4AX9H 4OS4A 2FEQH 3DD2H 2VINA 5EJZA 1FQ3A 2BLWA 4FUHA 3RXGA 1BUIA 3SI4H 3W1EA 1T4VH 4D76A 2HGTH 4MPUA 5E0HA 2J98B 1E1RD 4FU7A 1EZQA 1CSOE 1O2NA 5C1UA 2PTCE 2XWAA 3GYMA 1UCYE 3BEFB 1DXPA 1FAXA 1HYLA 1GBEA 1TA6A 1J8AA 2SNVA 1IHSH 1W7GH 1TNIA 3HGNA 5J4QA 1YPGH 3BG4C 2FOCA 2J92A 4NGAH 1O2SA 1BRCE 4IN1A 3BTFE 4O3UA 1PPEE 3FO8D 2QF0A 3KIDU 1UCYK 1YPKH 1T7CA 4YLUA 3ZIAD 1QURH 3E91A 3SZEA 3QO6A 4E7NA 2HNTC 5DPAA 3JZ2B 4VGCC 4FVBA 1O5BB 2AMPA 1LO6A 2EEKA 3CP7A 4Y79A 4X0WU 3V0XA 3UR6A 4LZ1H 1Z6JH 3OEED 5GNDA 1GHBF 1L0ZA 1NN6A 1ZJKA 2FOGA 3P70B 2Y80A 1HAYB 4U01A 1SVPA 2BD4A 1VR1H 5DP9A 1AO5A 5LPEA 1AB9B 3MU4A 1K28D 4K5ZA 5A0AE 1MUEB 2GD4B 4Y76A 1LVMA 5A8XA 2A4OA 2JJ1D 1SI5H 2V0BA 1C2LA 2ZP0H 4B76A 1N6XA 2BY5X 5C17A 2HPPH 3SUGA 1XUHA 4FUIA 4I32A 1G3EA 3A8DA 1SOZA 4K3JA 3NK8A 2GJGA 1P12E 2ANYA 3RXKA 1P01A 1EJAA 4ZHMU 4KP0A 2OLGA 4DW2U 4YTAA 4ASHA 4ABHA 3ZZ3A 1LVYA 4IC6A 4M7GA 4ABAA 4H6SB 1CA0C 3A83A 1IQHA 3AAUA 1UTJA 3ZZCA 4K60A 5HIYA 3SV8A 3UNRA 3SJIA 1GL0E 1BCUH 1UJ1A 4Y0YE 1JIMA 1YKTA 1EZSC 2KAIB 3SOSA 3S7KB 5HKKD 2F83A 2ZHDA 2Z9IA 3ODFA 1O2UA 2CN0H 4K1SA 3KCGH 3URCA 1RS0A 1V2JT 1V2UT 4ZUHA 4BOHA 1Y5UT 1Q31A 3MU1A 3N99A 4X1RU 3PYHA 3N7DA 2A5KA 2F9NA 1O2ZA 2BQ6B 1GMCF 2STBE 3TNTA 1DWCH 4D9QA 5EIYA 2BDGA 1Z8IB 1Z8JB 5CHBA 1GBCA 1DS2E 1O3NA 2ZGBH 2W6ID 3P95A 1P06A 5ETXA 2OC8A 5T3HA 2QC2A 2Q6GA 1ELCA 1AKSB 1UK4A 3PMHB 2NWNA 4NA7A 2BY6X 2YNAA 3MH6A 4X2VA 4ABBA 2IPHA 4ZAEA 2AMDA 1SQAA 2H6MA 2XXLA 3GDUA 1VJ9U 3P8FA 3SU1A 4X8TH 2KM0A 3SJOA 1VCQA 4NFFA 4AZ2B 1HFDA 4KTSA 1Y3UA 3SV6A 2CV3A 1GMCG 2BLVA 1TFXA 3MU0A 2ZGHA 3MMGA 1GHXH 1TNLA 2VGCC 4ZMAH 5C20A 2F9PA 4CRGA 4Y71A 3DSPA 3A88A 4O97A 1TQ7B 2O8MA 3KN2A 1TAWA 3ZV8A 2OBQA 4BTTB 3ZZ5A 3B23B 2OP9A 1T8OA 4B74A 2J2UA 1QIXB 4JYTA 3MOCA 1CGHA 8KME2 3ATKA 1S6HA 2Z6BD 4ZH8A 2TGDA 1ESBA 4F4OC 1LVBA 4FUJA 1UCYH 3M5NA 3DCLA 1YC0A 1CGJE 1GCTC 2OTVA 3QLPH 1DX5M 4K8YA 4ZKOU 5AFYH 2ODYB 1FV9A 1TNHA 3P8OA 1C2HA 4ABIA 2QE7D 2BVSH 4MTBA 2ZDMA 1T8LA 3K6YA 1XXFA 5DGJA 1TRMA 2BDCA 2FOHA 1NRRH 5F8ZA 1WDIA 1QCPA 1ETSH 1C4Y2 1ZMJA 3MI4A 2ZPRA 1BRUP 3PMAB 2DUCA 1X7AC 2XWBI 5A8YA 1GCDA 1H9LB 3GY4A 1C1PA 4MQAA 4NWLA 1XUIA 5B6OA 3U8OH 1SQTA 1FLEE 3GS9A 5DK1A 1K1MA 5E2OA 1V3XA 1AI8H 2CMYA 5T1VA 5CMXH 5T6DA 4MDSA 5EQSA 5BPEA 4AC9A 2GTBA 1AVXA 1FN6A 2EI7A 3A7ZA 1ELGA 1W12U 1K1OA 1C4V2 4Y8ZA 3F9GA 3NPSA 5C0TA 1A3BH 2OC1A 3OE7D 2W7UA 2R2WU 2J9NA 1ZPCA 2ZQ2A 1MTUA 2ZHQH 5K7RA 4SGBE 1KDQB 1LTOA 1C9TA 1GJAB 3BTEE 2Z94A 1C1UH 1B5GH 2W26A 3P92A 2P94A 2G4TA 2LELA 1O5DH 5JB9S 2ANMH 1QNJA 3SO3A 5L2ZH 1FJSA 1SQOA 3F0PA 1O2GH 1IQEA 4RT1A 4YT7H 5LPFA 3RXPA 3FKSD 1D6WA 2UUFB 2XTTB 1GBJA 4WH8A 2AEIH 3Q3XA 1GI8B 5JYIA 1Z6EA 2GP9B 1P57B 4O3TA 5A8ZA 2GZ9A 1C5MD 2AGEX 5JBBS 5C67A 1ESTA 2BD9A 1F92A 4Y7AA 2ODQA 3CS7A 4RN6A 2H2ZA 2I6SA 3E16B 1UTLM 3GCTF 4IS5A 7KMEH 3AK5A 1EPTA 2ZCLP 1HUTH 1PQ8A 2ZF0H 1O2HA 1A0JA 1XMNB 4K69A 1ORFA 1SOTA 3A8BA 3S9BA 2FS8A 1TPOA 1DICA 1FIWA 1EQ9A 1A5IA 1S0RA 3GCHC 5LPRA 1H1BA 1UK3A 2LNCA 5FXLA 4HI3A 1MTWA 1UTQA 2XC5A 1OWDA 3RXAA 3ZZDA 1N1LA 2PWXA 3U1JB 4TT3D 1BMAA 1DSUA 5JB8S 3SBKA 3GOVB 2G51A 2R0LA 1MAYA 3WW7A 3SV7A 1PPZA 1BA8B 1QRWA 3VB6A 2J97A 2TGPZ 4Q7YA 1G3CA 4IMQA 3M3TA 4ZKNU 2PKAB 1WAYB 7GCHG 2VWNA 2FZZA 1NRQH 3GCTG 2RA0A 1NS3A 2R3YA 1Y8TA 2FYRA 2JH6D 2JH0D 1G2LA 2SGEE 4CRAA 1CVWH 2AHME 1BOQA 5EPYA 1GI9B 4NIVA 1F7ZA 1JBUH 2Q1JA 2XRCA 1HBTH 2JIZD 3GDSA 1C5SA 1MKWK 2XNIA 4J1YA 3H7OA 1YLDA 1TB6H 1P2IA 2G5VA 2IN2A 2ZDNA 1K1JA 1JOUB 1PQ7A 5DP4A 2BVXH 3PB1E 1D3TB 1H9IE 3A84A 5I46H 3RC4A 2L6OA 1EOLA 3A7WA 3A8AA 3BTQE 3MO6A 1GI3A 4LK4A 2ZU4A 1G3DA 5BRRE 4F48B 2FX4A 1O3KA 2ZNKH 1W2KH 4INKA 3BF6H 4E06H 5B6LA 3R3GB 3ZZ6A 2A32A 4AB8A 2RA3A 2K0QA 5C5OA 1HLTH 1J14A 1PJPA 4I33A 4DVAU 1GPZA 1GVLA 3LT3A 1JXPA 2VNTA 1EZUC 4MNVA 4XDEA 2Y7XA 1FDPA 5JBAS 1NC6A 4DJZB 2KCYA 1P03A 1E79D 2PW8H 1ELDE 3HKIB 1BT7A 1L1NA 2GGVB 1PYTC 1SHYA 3IG6B 3AAVA 3EE7A 5F8TA 2D26C 3HK3B 5EXLA 1UVUH 1Z1JA 4UFEH 4I8GA 1MD8A 5LGOA 4UD9H 2STAE 2JETC 1MQ6A 4IGDA 5EQRA 1O2KA 2UWPA 1T8NA 2PFEA 6GCHG 1HAPH 1TOMH 1B7XB 1ZHMA 4UONA 2XBYA 4FUBA 4AYVB 1D6RA 3GDVA 4ZXYH 3EGKH 5FPTA 2ANWA 2ZHEH 5GWZA 2QIQA 1GBMA 3GY7A 5HM9A 4ISIH 3LC5A 4DGJA 1Y3XA 2VWLA 4AGJA 1BTYA 3MWIU 4TWWA 1GG6B 3N7EA 1SGTA 1N8OB 2BLOA 3TJOA 1ELAA 5PTPA 3HGPA 3ZVAA 1NFWA 1EP6A 4Q2KA 1MBMA 4NIYA 5F03A 1GDUA 1PPBH 1ELBA 3JZ1B 5AHGH 3UPEA 3M35A 2Z9GA 3ZZBA 4HG6A 4ACBA 1S0QA 2AMQA 3QTVH 3O8RA 2BZ6H 3QGNB 1HJAC 2P3TB 2TPIZ 4WWYA 1XUFA 4BXWA 2ZA5A 2NU2E 4AYYB 1O3DA 1HV7A 1WOFA 4CRDA 1HJ9A 1TQ0B 5E8EH 3RXRA 1AKSA 1C1VH 1Z71A 2FYQA 1DLEA 1UTKA 2V7QD 3KNXA 2CJIA 3Q76A 5EU8A 2OD3B 5GDSH 4ABFA 3KEEA 2XOKD 2VIVA 1ANCA 2THFB 3U9AH 3C1KA 4LXBH 2WPDD 3OYPA 4WJG2 4ZXXH 1D3QB 1NRSH 1XXDA 2VU8E 5EPNA 3BG4B 1C1RA 3SJKA 5F6MA 1MTNC 2J95A 5C1XA 3F68H 4DURA 1P09A 3DFJA 1A0HB 1OP0A 1P11E 3UQOA 4A5TS 1DSTA 5DP5A 1MBQA 2TRMA 3TGIE 2GCHF 1OSSA 2J5UA 2ZFPH 3WY8A 1ZHRA 1YP9A 1V2WT 5C1YA 1YPMH 1ELTA 2FI3E 4VGCB 4X8SH 4XFQA 3U8TH 3RC5A 2BHGA 3TK6A 1CA8B 5IDKA 4ESTE 4RSPA 1OWJA 1WCZA 1U6QA 2ZWLH 3MTYA 3KL6A 1MKWH 1GHAF 1THRH 3BIVH 2ZEBA 4D7GA 4OS2A 2ZHFH 2C8WB 1HAVB 1AVWA 2ZHWH 1E0FD 4NFEA 1D9IA 1ID5H 1CT0E 1NRNH 3P8NA 4TPYA 1PYTD 1DWBH 2ZGJA 1TABE 2ZO3H 4UDWH 3SGQE 3SZNA 4R0IA 2GVFA 1YF4A 4K8BA 1A61H 1FN8A 3KF2A 2HNTE 1IQIA 2O8TA 1MD7A 1O3PB 1SSXA 1SFQB 4AG1A 1W0KD 2QF4A 5A09A 4I8KA 1W0ZU 1MAXA 1AN1E 1G32B 2ODPA 2O8WA 1UK2A 3OX7U 1AVGH 2A4RA 2FI5E 3PLBA 4TY7A 4BAMB 3RXQA 1CA0B 1BBRE 4JMYA 3QUMP 1QA7A 1O2XA 1GJ7B 1T32A 1F5RA 3SNEA 1C5UA 3RXDA 2OINA 1BBRK 2EY4C 1MABB 3NCLA 1BJUA 1S81A 4WXVA 4WMFA 4OS5A 2VVUA 3LU9B 2NU0E 3FOAA 3RMNH 1SGCA 4AB9A 1LPGB 5FAHA 5L30H 4U32A 3A81A 3PO1B 3MQKC 2K1QA 3CNRA 1OWIA 4MNYA 2QXIA 3GY8A 3PROA 2A7CA 1C1MA 1DUEA 1DVAH 3P6ZB 3BTKE 2FM2A 2WPLS 2FESH 5EW2H 1WSSH 3ZVGA 2XCFA 2OC0A 1COWD 1SGPE 1GDNA 1O2LA 1HIAB 2XW9A 1BMLA 1L4DA 1XX9A 1TGSZ 1QJ6B 1BMNH 2NU1E 6LPRA 2A7HA 2V3HH 3I77A 1GI5A 1HAZB 1QL7A 3VG8A 3I29A 2HRVA 2HOBA 1FPHH 3RM2H 3E1XB 2WHXA 2NU3E 2FTMA 1A7SA 1SHHB 4B73A 2IJD1 1YY3A 2VGCB 3LGYA 2ZTZA 2VVVA 1QL9A 2IPQX 3TIUA 2ALVA 2XC4A 5FBIA 3MU8A 2PGQB 4AN7A 1AIXH 1HDTH 1QHRB 4B2AA 3ENSB 3SJ8A 3FANA 4AGKA 4KKDA 1Y3WA 4CREA 3RLYH 3SHAH 2RDEA 2A45B 4DT4A 1H8ED 1UVPA 1P2OA 4X2XA 2YOLA 1WBGB 2PKAA 2VH0A 2BTCE 1AWHB 2HNTF 1TX6A 1W10U 3SGAE 3RXLA 3U69H 1CBWC 2BX3A 1SB1H 1J17T 1P9UA 3ZYEA 1OWHA 1DLKB 1QL8A 3HK6B 4OS6A 2G81E 1VGCC 1E1QD 4RT0A 2ZQ1A 1TA2A 3RDZA 5JBTA 2ALPA 2FOBA 4AFQA 1GJ6A 1FUJA 1XVOA 2KFWA 1E37B 2EI8A 4Q80A 1LHEH 1O2RA 3RXEA 1FXYA 2GCTC 2FLRH 3VFEA 1TRNA 2FPZA 3BV9B 2WSSD 1S84A 2C90B 2P8OC 2DE9A 3MNXA 3GICB 1QRZA 3KGPA 4YOGA 1PQ5A 1HAGE 1DDJA 1FX0B 4NA8A 4FUGA 4WMDA 1YLCA 1BTXA 1G30B 4X6MA 3QX5H 2PKSC 3PRBA 1IQLA 2PR3A 1MKXK 2A1DB 4A1XA 4U2WA 2XC0A 3SN8A 1KTSB 1DY9A 1O35A 1C5XB 4ZROA 2QN5T 4ABGA 1P2NA 1EPTC 5EQQA 1S6FA 1L4ZA 1C2FA 4YT6H 5EOKA 3D49H 1G36A 3M5OA 3V7TA 1ZYOA 3PTNA 1TGBA 3O8DA 3BEIB 2Y7ZA 1IQGA 3TJVA 3E0PB 3RXTA 1KMHB 1L1JA 3ZYDA 2H9HA 3F3BA 5LH8A 1TBQH 3LJJA 2A7JA 3PV5A 1JIRA 3I78A 2WINI 1F0SA 1BBRH 2BDAA 4X6NA 1F5KU 2HLDD 1DUAA 2W7SA 4FUFA 2B8OH 2GKVE 1ZRBA 3GCNA 2WPJS 1RGQA 4IW4E 2OK5A 3VXEH 1H4WA 3ZZ8A 2B0FA 4K1TA 1QB6A 1ZRKA 1P3EA 1C2MA 1O0DH 3GCHB 4YO9A 2ZGXH 4FU9A 1FNIA 1A2CH 1KLTA 3GYLB 2ZC9H 1GJ8B 3WWBA 1PPCE 4NIWA 2PP6A 1B0EA 1SKYE 3A7TA 1OWKA 1VCPA 5E2PA 4R8TB 2OCVB 3MYWA 2BQWB 2GDDA 1O3MA 2B7DH 1K2I1 1GHYH 4BAOB 2XBXA 3ATMA 4AOQA 3M7UA 1FZZA 5DP6A 4TPIZ 2ZU2A 1UHBA 4X1NU 1GI0A 1QBOA 2AGGX 3OAAD 3SUDA 3OTPA 2KCPA 5F8XA 1GHVH 1ACBE 1GBLA 2BD2A 2GV7A 2VJ1A 3DFLA 2GT7A 3W94A 4INHA 1AU8A 4IMZA 4Z6AH 2CK3D 3HATH 4Q4LA 2RFKC 1FY3A 4MNXA 4XBBA 1AFQC 3PWBA 1OOKB 1MTSA 1MCVA 1YM0A 1EAUA 1SGRE 3N7OA 3PM3A 3QDZB 2FO9A 2ILNA 1KXCA 4XSKU 2FDAA 3FN8A 3LGTA 1KLJH 2VWOA 3L3TA 1N6YA 1ELFA 1EB1H 1TNKA 5A0CA 2Z9JA 1FONA 4I7YH 3M3VA 3UOPA 2FOAA 1SR5C 4XD7D 2OXSA 3LKWA 1OYQA 1E34B 5FPYA 2GX4A 4Y8YA 1P02A 1TYNA 2GT8A 1NFUA 4AORA 1O39A 5T6FA 2F9BH 2CF8H 1SG8B 4RKJB 2PUQH 1GVZA 1FY1A 4I31A 4E05H 4E7RG 1MU6B 1TGCA 3K6ZA 4YZUA 3DT0H 1GJDB 2JETB 4X1SU 1UTMA 3Q3YA 1G3BA 9ESTA 3GY3A 3F9EA 3SW2B 1GBTA 4THNH 1TALA 2BDBA 1FY8E 1S85A 2GMTC 3DA9B 1PPGE 1C5QA 3ZV9A 3FAOA 2AIPA 4HFPB 1RRKA 1MKXH 7GCHF 5I25A 5L2YH 3QGJA 1DE7H 1ZLRA 4BTUB 4AFUA 3KQBA 2JKHA 2Q6FA 1SGYE 1KXAA 2VIOA 1BRAA 1YGCH 1WYKA 1C5WB 4KTCA 1CQQA 2ZTXA 1K1PA 1GBFA 3PTBA 4Y6DA 3UOUA 2V35A 4CBOA 3URDA 3BTDE 4H6TA 1ZSLA 1DT2A 2BY8X 4I8HA 2OQUA 1O2QA 4JZ1A 4UFFH 5FPSA 3GISB 1AY6H 2FX6A 3SGBE 1HJAB 2V3MA 2O8UA 5FL7D 1RFNA 2BDIA 2FI4E 1Y3YA 1V2LT 2CF9H 1TX8A 2ZFTA 1TMTH 2HALA 1UO6A 3Q77A 4MPWA 3ZVEA 1A5GH 1QJ1B 2J98A 1S82A 3ATLA 1YPHC 2VIQA 3UIRA 3TGJE 3VB4A 2Y5HA 1GMDG 2KR7A 2EI6A 1CHOF 1GBIA 4K1EA 1D3DB 1NTPA 3M5LA 3SQHE 2GZ7A 4X6PA 2HVYB 3SHCH 1XUJA 2ZCKP 4DIIH 1O2PA 3RMOH 1HRTH 3EYDA 2SGQE 4PROA 1J16A 3CS0A 1KXDA 2ZTYA 1OP2A 3NWUA 3RXBA 5JPMH 1YPLH 3ITIA 1GBBA 9LPRA 2SGDE 1ABJH 5TCCA 3OEHD 4Q63A 2A5IA 2QF3A 1T31A 6GCHF 1ZHPA 2WPKS 3F1SB 3EDXB 4GLYA 3QZRA 2VIDA 2H5DA 4ZHLU 2IJOB 4Y7BA 1QBNA 1IHTH 2ZPQA 1CHOG 3Q00A 1LQEA 1Y5AT 1EKBB 2BD8A 2QGRA 3MNCA 2F9VA 4HGCA 3E6PH 3E8LA 4AFZA 4F49A 1V2PT 1P05A 3IWMA 1WTHD 1GBHA 4B2CA 1SLXB 1BITA 2PHBA 1W11U 3D62A 4GHQA 1KSNA 6ESTA 3SORA 4JYUH 1MU8B 2L74A 3FP8E 1C5NH 1RTLA 3M7TA 5DP7A 1K1IA 3SU3A 1C5VA 5EJ1A 2F9OA 4JZEH 1L2EA 4DCDA 5ESBA 1C5PA 4NIXA 4I8JA 3FP6E 1SLWB 4NSVA 3UWIA 1UTNA 4I8LA 1TNJA 2FODA 3VXFH 1PQAA 3A8CA 1AGJA 1UVSH 1F0TA 3LONA 4H42U 2OC7A 5GJ4B 3VGCB 1LPZB 1O3JA 1F5LA 5AFZH 2QF5A 1LHCH 2FS9A 3E3TA 4CBNA 4MVNA 1ELVA 3PRDA 1Z8RA 4ABEA 2EA3A 4MG3A 1EB2A 1C2GA 1YYY1 4ZKRU 3RU4D 2KAIA 1NY22 1W8BH 4WY3A 4ASUD 1ANDA 1QA0A 3ZVBA 1P9SA 4JYVH 2ULLA 4CH2B 1IQNA 2W5EA 1ARBA 2HPQH 1SGFG 3RMLH 4FVDA 4NZLA 2ZCHP 5C5NA 1UMAH 4OGXA 3A80A 2WV4A 5HIZA 1WU1A 4A1TA 1TE0A 3FP7E 3AVZA 1VITF 3UNQA 2C3SA 3S0NA 3TGKE 5CHAC 2ZZUH 3NZIA 2Z3DA 2V6NA 2UUYA 2W3KA 1YPEH 1FPCH 3A85A 4NSYA 3T25A 2VIWA 2BM2A 4WXIA 3A87A 1A1RA 2QCYA 3U1IB 5AVDA 1O3HA 4B1TA 1MQ5A 1TRYA 1WXRA 1C1WH 2BX4A 2RDLA 4Z0KA 1LKAA 2F3CE 2UWOA 3SU4A 2BOHB 3HKJB 5HM2A 3EQ0H 3A82A 1AUJA 1FY5A 1AZZA 1NZQH 4A6LA 1PFXC 1W13U 2C8ZB 2Z3CA 1HAIH 3LGIA 4YXWD 4TYDA 1VITG 5CDFE 3KQDA 1GI4A 3FFGA 2H5CA 2UUJB 2QV1A 1O3EA 4JZFH 3C27B 2J38A 5A0BA
chains in the Genus database with same CATH topology
2ANKH 4NZQA 1K1LA 1BTUA 2F91A 1DY8A 2ZFFH 1DANH 1PPHE 2ZG0H 4NA9H 4ZKSU 1EZXC 1GL1A 2VB0A 1ZMNA 4CRFA 1VITH 3RM0H 4RKOB 2QAAA 1O2WA 1QR3E 2B9LA 2VIPA 3D65E 3S9CA 2P93A 1C2IA 3PLPA 1O31A 4IBLH 1QB1A 3TH3H 4GAWA 1S83A 2WV5A 2AH4X 1KTTB 1GJ5H 2FTLE 4ABJA 1TIOA 2XCNA 1CT4E 2I6QA 1CBWB 1IAUA 1K22H 3OY6U 1T8MA 2ASUB 1ANBA 1HNEE 3BTHE 5FCRA 1NROH 2ZPSA 3BTWE 1TPAE 1EAWA 1VGCB 3AW0A 1D3PB 5GXPA 1AD8H 1UVOA 1SGNE 2VWMA 3KQEA 3LPRA 2QY0B 2BD3A 5TCAA 3E90B 3ZZ4A 2GCTB 1DITH 2PGBB 3MFJA 1SFIA 3TVJB 1TNGA 2P8OB 1TPSA 2WPIS 4FUEA 4OS1A 4KTUA 1HXFH 2BLQA 2ZU1A 4MNWA 1B0FA 3ODDA 1A4WH 2PKSB 2WYGA 1O3AA 1BIOA 2AIQA 3M3SA 5DP3A 2TGAA 2BDHA 3V12A 1KDQA 1ZTLA 3FVFB 1EJNA 3A89A 3SNAA 1BMMH 1RIWC 1EASA 3PWCA 2GDEH 1GG6C 1WTGH 5FX6A 1MTVA 1KXFA 1Z8GA 2QXJA 2BDYA 4ZHAA 1MZAA 3F6UH 4ISNA 3SUEA 4DY7B 4Y0ZE 2FMJA 1P3CA 5L6NH 1VZQH 1ZSKA 2FWWA 3VEQB 1IOEA 1LVOA 2ZDVH 1NFXA 4X8UH 1ZMLA 3OSYA 1O5FH 3ATWA 1O3FA 1ZSJA 3F9FA 5FCKA 3O8BA 1TBZH 2VH6A 1RXPA 2A0QB 2G55A 4JK5A 2P16A 1AHTH 1IQMA 1NU9A 2O9QA 1E35B 4D8NA 1Z7KA 1ZGVA 1C5OH 1M9UA 3G01A 3M36A 4DOQA 2B5TB 2Z3EA 1O5AB 1EP5A 2TGTA 3DUXH 4HZHA 2WPHS 1C1TA 3RC6A 1FIZA 2CHAC 4CHAC 1AUTC 4YM9A 1CE5A 1NRPH 3RXIA 1GJ4H 1TWXB 2FP7B 3STJA 3U8RH 1EXFA 4DIHH 3QK1A 1V2QT 1A46H 1FI8A 1LHGH 3A7XA 2ZIQH 1TBRH 2GZ8A 3LOXA 4UFDH 1O3GA 1A0LA 1H9HE 3PLKA 6CHAC 2PUXB 1CT2E 1QBVH 3AW1A 3O8CA 1HJ8A 1C2JA 1GCTB 1V6DA 1ARCA 1JMOH 3RXHA 2P3FH 3TH4H 1BTWA 3HPTB 4LZ4B 3LH1A 1SGIB 1Q3XA 1LDTT 1KLIH 3BSQA 1WV7H 3LC3A 2XBVA 1TMUH 3K2UA 2SFAA 1GGDC 3NXPA 1K21H 1T4UH 1HCGA 3LGWA 2WPMS 2YNBA 5SGAE 1O3CA 2AGIX 1Z1IA 3TJUA 1AFQB 3VB3A 2AERH 3M37A 3ELAH 1HXEH 2R2MB 2HVXA 1EJMA 1ZTKA 2PSYA 3ZZAA 2Y82A 4B2BA 1OPHB 1GBDA 4CRBA 1H8IH 5EXMA 1TGTA 4INLA 1DPOA 1P2QA 1NESE 2ESTE 3EA9A 4GPGA 1V2NT 4Y11E 3S69A 1GHBG 1J15A 1G9IE 1SGDE 4HTCH 1IQJA 1IQKA 3RXCA 4XOJA 5FBEA 4FUCA 3ZVCA 2UWLA 1C5LH 3T26A 1OYTH 3ZVDA 3MH4A 1NFYA 3SJ9A 2FIRH 2A5AA 1UVTH 4NG9H 1Y3VA 1EX3A 2J94A 4D7FA 2NU4E 3A7VA 4JZIA 2P95A 3P8GA 2IOTA 3L6PA 1QY6A 2Z9KA 2SNWA 1TLDA 4MPXA 2GMTB 2BY7X 5ESTE 1J9CH 3PO1C 1TMBH 3BTGE 8GCHF 1GI7B 5K0HA 1XUKA 1YCPM 1C2KA 3SV2H 4K2YA 1RTKA 2A2QH 4BTIB 3W95A 2R9PA 3TITA 1O2OA 4WF8A 1OWEA 3LGVA 1DWDH 1XUGA 5DKMA 3GY2A 2C8YB 4UFGH 1MMJN 3H7TA 1YBWA 3E0NB 4UEHH 1TONA 3RXJA 1P10A 1ZZZA 1QTFA 2ZI2H 1O5CB 4U30A 3UUZA 1DXWA 1DM4B 3QZQA 1O5EH 2SGPE 4DG4A 1AMHA 3BTME 3OU0A 1SMFE 1A5HA 1YPJH 3TU7H 1CGIE 8GCHG 2O8LA 1BB0B 1BTHH 1SGQE 1SPJA 5DJ7A 5E0GA 2R0KA 2XBWA 3RU4E 1O2VA 2P59A 1AE5A 1AB9C 5AF9H 4D9RA 5EG4A 4B71A 3AASA 3UFAA 5J4SA 1S5SA 2ZU5A 3STIA 2FLBH 1V2MT 3MU5A 2OUAA 4KGAA 2BD5A 2CXVA 3U98H 2ZDAH 2A4QA 3UTUH 3TH2H 3M61U 5JBCS 3SNBA 2QXHA 3F9HA 1LCYA 1P0SH 1EAIA 2G5NA 1LQDB 1F2SE 1O2TA 3TK9A 1THSH 4KELA 1YPHE 1QQ4A 1BRBE 5DG6A 2BY9X 3EAJA 1ETRH 1QJ7B 4IN2A 3H5CB 3T29A 4CH8B 1HAHH 3SU6A 1BTZA 1O5GH 2BD7A 3QTOH 1HAVA 3VB7A 1RD3B 1GWAA 1NO9H 2A4GA 1BZXE 3PMBB 3PV4A 4TWYA 1HGTH 1O37A 2C4FH 4YOIA 1LHDH 2BVRH 4OGYA 2PTNA 3ZZ7A 4Q7ZA 2TIOA 3T5FH 2FOEA 3RXOA 3GY6A 1TGNA 2HWLB 4NWKA 1XKAC 1LMWB 2BQ7B 3TK5A 3DHKH 2H9EH 1XVMA 3QWCH 2H9TH 4FU8A 2BOKA 1ETTH 1O36A 3CENA 2ZDLA 5GPIB 1C2EA 4MPVA 1AWFH 2JH5D 5FHTA 1O3OA 2J34A 1LHFH 1XKBC 3D23A 1GMDF 3K9XB 3VPKA 2D8WA 1G2MA 1O2YA 1Q2WA 2VVCA 2G52A 8ESTE 1VCWA 3GCOA 3EE0B 5GIBA 3TJNA 2Y6TA 1BTPA 1JRTA 2GV6A 3RXUA 1EOJA 1ZTJA 1GI2A 1CHGA 1MCTA 2FOMB 4CR9A 1GVKB 5CHAB 2BXUH 2H1UA 2V3OH 3MH5A 4XE4A 3UY9A 1GDQA 2ZU3A 3RP2A 1GHWH 4AG2A 1GI6A 2Z7FE 1ZPZA 3SQEE 1CO7E 3MH7A 1AQ7A 3V13A 1KYNA 3MHWU 1O2MA 3K65B 1GI1A 4BAKB 1KY9A 1V2VT 3SU5A 1HIAA 1MH0A 2WUCA 1ABIH 1BQYA 3QN7A 1GBAA 2P3UB 5TJXA 1O3BA 2ZFQH 1GJCB 1NT1A 4MLFB 2WUBA 1Y5BT 1MTNB 4ABDA 2SGAA 4GHTA 5DO4H 5GCHF 1FY4A 1C1QA 3TNSA 1AE8H 1ESAA 4FXGH 3ZVFA 4OS7A 1C5RA 4WMEA 1NU7B 2G8TA 1BHXB 1V2RT 4YESB 5HGGA 3FZDA 1KXEA 1UTPA 1P2MA 1O34A 1RJXB 1F0RA 1GMHF 4B75A 3S7HB 1QB9A 2G4UA 1ZOMA 3GY5A 5T6GA 4O9VA 4BAQB 3BN9A 8LPRA 2F9UA 5G4BA 5JDUB 2C8XB 1H8DH 1DOJA 2RG3A 1CU1A 4A1VA 3IITA 3EA8A 2PV9B 1P2JA 3OY5U 5CE1A 2ZKSA 1C1NA 4BXSA 3RLWH 5GCHG 3MNSA 2C93B 2ZGCA 3UNSA 4X8VH 2AFQB 1UTOA 1P2KA 1C5ZB 2LPRA 5DP8A 1VJAU 3SU0A 3BEUA 4GCHF 1O33A 4GVUA 4J2YB 2DE8A 2TBSA 3EA7A 4ISHH 3V3MA 1SBWA 5ABWA 1GBKA 3UWJH 1C1SA 1GMHG 3RUOA 2QA9E 2FOFA 3RMMH 1OS8A 2D2DA 2AYWA 3UR9A 4FUDA 4YOJA 3LDXH 4Q7XA 4X2YA 3LIWA 1YCPK 2CGAA 2SGFE 1W7XH 2BZAA 1HPGA 1P8VC 1OP8A 1W0YH 1GJBB 4YLQH 5HYOA 4WH6A 2A31A 1BDAA 1EUFA 2A2XH 1C2DA 3T2NA 1G37A 5EGMA 4X6OA 3KQCA 1C9PA 5HMAA 4TY6A 2Y5GA 5H4IB 3S9AA 5EW1H 1RIWB 4AFSA 4GCHG 1V2ST 2FXRA 1OKXA 1E36B 3VB5A 3RXFA 4SGAE 1AZ8A 1O2IA 1FMGA 1TOCB 3R0FA 3BIUH 1WQVH 1SLUB 1Y59T 2Y5FA 4QT8C 2QYIA 1QRXA 2Z9LA 1EATA 2UUKB 4A7IB 2ZFRH 3ATIA 4ISLA 3T62A 1ZR0A 1LPKB 2G00A 4XBDA 3MO9A 4JK6A 1O32A 2Q6DA 2OQ5A 1C4U2 1INCA 4DT7B 3UQVA 4NCYA 3RXVA 3SU2A 3SNDA 1UHBB 3A86A 3ESTA 4GUXA 1HB0B 4WVPE 3UREA 4XBCA 1FAKH 3M5MA 2M5TA 1O3IA 4CHAB 2CHAB 4JZDH 1SC8U 2PSXA 2RCEA 4H4FA 2OBOA 3BTTE 5C2ZA 1L1GA 2HLCA 4BNRA 4UE7H 1K1NA 1O3LA 1QFKH 2BB4A 2BMGB 3LH3A 1W3CA 3KHVA 3SNCA 3ZZ9A 4CR5A 3RU4T 2AS9A 1TX7A 3TPIZ 1SL3A 1C5YB 4O03A 1ANEA 3OTJE 6CHAB 2J4IA 3LGUA 1BHXF 1D4PB 4ISOA 4A92A 1IQFA 2PLXA 3NKKA 1V2OT 4Y8XA 1HAXB 4X1QU 3SUFA 3B8JA 5C3NA 4GSOA 1OXGA 1W14U 2Y81A 4IC5A 4CRCA 1EAXA 1DWEH 3L33A 1QQUA 5HXFA 7ESTE 5E0JA 2ZECA 1GGDB 1HAOH 4Y10E 3MNBA 4LOYH 1O38A 2R3UA 1AFEH 1JWTA 1WQSA 5A2MH 3SI3H 1F0UA 4X1PU 1MZDA 3Q3KA 5FX5A 5IYTA 3M7QA 1SGFA 1V2KT 1ZJDA 3PMJA 2EC9H 3B9FH 2GCHG 4JCNA 1C1OA 1NM6A 4BANB 2ZDKA 1A3EH 1SLVB 3P17H 1QGFA 7LPRA 3T28A 2QXGA 2WYJA 3SV9A 3LJOA 1KXBA 1XM1A 3FZZA 3RXSA 3T27A 1ELEE 1ZPBA 1TPPA 3VGCC 1RTFB 4BAHB 2ZFSA 1ZGIA 1DFPA 1V2TT 1NPMA 3RXMA 1GHAG 1WUNH 1O30A 1SGEE 1K9OE 1GJ9B 1EPTB 1N8OC 1BJVA 5EXNA 3BG8A 3MO3A 1P04A 2XYAA 3A7YA 1KIGH 1O2JA 1PPFE 5EODA 4X2WA 2BYAX 1THPB 1E38B 1LKBA 3NUMA 1YCPH 2BXTH 2D1JA 1OX1A 1JRSA 1GHZA 2W3IA 1C5TA 3TLOA 4AX9H 4OS4A 2FEQH 3DD2H 2VINA 1FQ3A 2BLWA 4FUHA 3RXGA 1BUIA 3SI4H 1T4VH 4D76A 2HGTH 4MPUA 5E0HA 4FU7A 1EZQA 1CSOE 1O2NA 5C1UA 2PTCE 2XWAA 3GYMA 1UCYE 3BEFB 1DXPA 1FAXA 1HYLA 1GBEA 1TA6A 1J8AA 2SNVA 1IHSH 1W7GH 1TNIA 3HGNA 5J4QA 1YPGH 3BG4C 2FOCA 2J92A 4NGAH 1O2SA 1BRCE 4IN1A 3BTFE 4O3UA 1PPEE 3KIDU 2QF0A 4YLUA 1UCYK 1YPKH 1T7CA 1QURH 3E91A 3QO6A 4E7NA 2HNTC 5DPAA 3JZ2B 4VGCC 4FVBA 1O5BB 2AMPA 1LO6A 2EEKA 3CP7A 4Y79A 4X0WU 3V0XA 3UR6A 4LZ1H 1Z6JH 1GHBF 1L0ZA 1NN6A 1ZJKA 2FOGA 3P70B 2Y80A 1HAYB 4U01A 1SVPA 2BD4A 1VR1H 5DP9A 1AO5A 5LPEA 1AB9B 3MU4A 1K28D 4K5ZA 5A0AE 1MUEB 2GD4B 4Y76A 1LVMA 5A8XA 2A4OA 1SI5H 2V0BA 1C2LA 2ZP0H 4B76A 1N6XA 2BY5X 2HPPH 3SUGA 1XUHA 4FUIA 4I32A 1G3EA 3A8DA 1SOZA 4K3JA 3NK8A 1P12E 2ANYA 3RXKA 1P01A 1EJAA 4ZHMU 4KP0A 2OLGA 4DW2U 4YTAA 4ASHA 4ABHA 3ZZ3A 1LVYA 4IC6A 4M7GA 4ABAA 4H6SB 1CA0C 3A83A 1IQHA 3AAUA 1UTJA 3ZZCA 4K60A 3SV8A 3UNRA 3SJIA 1GL0E 1BCUH 1UJ1A 4Y0YE 1JIMA 1YKTA 1EZSC 2KAIB 3SOSA 3S7KB 2F83A 2ZHDA 2Z9IA 3ODFA 1O2UA 2CN0H 4K1SA 3KCGH 3URCA 1RS0A 1V2JT 1V2UT 4ZUHA 4BOHA 1Y5UT 1Q31A 3MU1A 4X1RU 3PYHA 2A5KA 2F9NA 1O2ZA 2BQ6B 1GMCF 2STBE 3TNTA 1DWCH 4D9QA 2BDGA 1Z8IB 1Z8JB 1GBCA 1DS2E 1O3NA 2ZGBH 3P95A 1P06A 5ETXA 2OC8A 5T3HA 2QC2A 2Q6GA 1ELCA 1AKSB 1UK4A 3PMHB 2NWNA 4NA7A 2BY6X 2YNAA 3MH6A 4X2VA 4ABBA 2IPHA 4ZAEA 2AMDA 1SQAA 2H6MA 2XXLA 3GDUA 1VJ9U 3P8FA 3SU1A 4X8TH 3SJOA 1VCQA 4NFFA 4AZ2B 1HFDA 4KTSA 1Y3UA 3SV6A 2CV3A 1GMCG 2BLVA 1TFXA 3MU0A 2ZGHA 3MMGA 1GHXH 1TNLA 2VGCC 4ZMAH 5C20A 2F9PA 4CRGA 4Y71A 3A88A 4O97A 1TQ7B 2O8MA 3KN2A 1TAWA 3ZV8A 2OBQA 4BTTB 3ZZ5A 3B23B 2OP9A 1T8OA 4B74A 2J2UA 1QIXB 4JYTA 3MOCA 1CGHA 8KME2 3ATKA 1S6HA 2Z6BD 4ZH8A 2TGDA 1ESBA 4F4OC 1LVBA 4FUJA 1UCYH 3M5NA 1YC0A 1CGJE 1GCTC 2OTVA 3QLPH 1DX5M 4K8YA 4ZKOU 5AFYH 2ODYB 1FV9A 1TNHA 3P8OA 1C2HA 4ABIA 2BVSH 4MTBA 2ZDMA 1T8LA 3K6YA 1XXFA 5DGJA 1TRMA 2BDCA 2FOHA 1NRRH 5F8ZA 1QCPA 1ETSH 1C4Y2 1ZMJA 3MI4A 2ZPRA 1BRUP 3PMAB 2DUCA 1X7AC 2XWBI 5A8YA 1GCDA 1H9LB