2QXIA

High resolution structure of human kallikrein 7 in complex with suc-ala-ala-pro-phe-chloromethylketone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-7
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA02
3M7UA 1FY8E 4BAOB 3MYWA 4BAQB 1RD3B 3F9GA 1AY6H 5IYTA 1ZPZA 1O38A 2BYAX 2P95A 3KL6A 2XBWA 1IHSH 2ZECA 2BD3A 4O3UA 1UCYH 2ZU1A 3E16B 4ISLA 3GCTG 4X2WA 2ODPA 2KAIA 1GI8B 4H42U 1KYNA 1S5SA 1NESE 2ILNA 1DM4B 2W3KA 1BZXE 1GG6B 5DP6A 1T7CA 4B73A 3V7TA 3VGCC 4Y0ZE 1O3LA 5HGGA 2Y5FA 1O5AB 3LONA 2ZNKH 4XE4A 1LHEH 1O2XA 3K65B 3NK8A 2H9HA 3LGVA 1HIAA 1Z1IA 2OINA 2Y5GA 3VB6A 4BAKB 3TJOA 2PKAB 1TGNA 1J16A 4JMYA 1NRNH 1H8IH 2ZU3A 3CP7A 1SLUB 3M5OA 5GDSH 1EPTC 3ZZ9A 1G2LA 3A8DA 1ACBE 4WMEA 3SNDA 1GBHA 4CRCA 2ZCKP 1BMMH 2Z6BD 4Z6AH 3S7KB 5F8TA 3SUDA 5AVDA 3UOPA 1DSUA 1O32A 1SR5C 1HPGA 1IQHA 5FX5A 1ARCA 3SJ8A 1Z8RA 2ZGCA 4A6LA 1RIWB 1N6YA 1S0QA 1A5IA 2NU0E 3T29A 4OS4A 1GHBF 3F9HA 5CMXH 4DVAU 4B2AA 4K5ZA 1V2JT 4XBDA 1XM1A 4NWLA 5E2PA 4HFPB 1UTOA 1NY22 2OC7A 4XFQA 1OWKA 1AMHA 2BTCE 1A0HB 1GHVH 1EKBB 1LKBA 1Z8GA 2SGQE 2IN2A 1CT2E 1O2LA 2BOKA 2FOBA 3EE0B 2BVSH 4ZXYH 3ZVCA 2UUYA 1GCTC 2R2MB 2WYJA 1GHZA 4YZUA 2STBE 3A7WA 2VINA 2A7JA 2GCTC 1GPZA 2ZDNA 1DLKB 4X2XA 1BTYA 4NFEA 1YKTA 4ISOA 1LO6A 2BDIA 1P8VC 1TB6H 4D7GA 1KTSB 1EUFA 2LPRA 4TY7A 2J2UA 5FAHA 2FS9A 1HXEH 2ZGBH 1GJAB 1NRRH 2Y80A 4ZKRU 2VIWA 1THPB 2HPPH 5C20A 3A7YA 1F0SA 1D3QB 1AQ7A 1GJ8B 5FHTA 5TJXA 5GPIB 3SI3H 3MH6A 4I32A 3SV2H 1F0TA 1QRWA 1SGFA 1OWDA 5FPSA 3KGPA 2QXJA 3OY6U 4B1TA 3M35A 4VGCC 5ETXA 1IQGA 1C5RA 1C4V2 1VJAU 2HNTF 2QV1A 4X2VA 4CRAA 4FUEA 5AFZH 1SQTA 2BLWA 1TBQH 1K1NA 1FAKH 3BTWE 1PQ5A 1RIWC 3UWIA 2G00A 1J14A 1AU8A 3MNCA 5EW1H 2JKHA 3PWBA 1O2RA 3LIWA 2WYGA 2WPKS 5EXNA 2VB0A 3KIDU 2PV9B 4AGJA 1K21H 1KLTA 1BA8B 1RGQA 1TFXA 1SQAA 4D9QA 1C5XB 1PPFE 4MQAA 3RU4E 1SGNE 1Y8TA 1V2MT 1TIOA 2AERH 4ZHMU 4DGJA 3RU4D 3MNXA 1IQFA 3RXFA 1TA6A 4NSYA 3RXPA 5C5NA 1HXFH 2GGVB 4X6OA 2SGDE 5A2MH 3DT0H 4JZEH 3QTVH 4B71A 1NRPH 1W8BH 5DGJA 2ZHQH 4I8HA 4F49A 1O5CB 3CS7A 1ZRKA 2A4RA 3SQEE 4XDEA 1EAWA 3Q00A 3SU5A 1DXPA 2JH6D 1Z71A 1C9TA 5EXMA 2B8OH 3GY5A 1MZDA 3E0NB 3KHVA 5A0CA 2Y82A 1O2KA 1A3BH 1UJ1A 3SW2B 4CRGA 1C4Y2 1V3XA 1AVGH 2CJIA 1AD8H 3RXQA 1V2WT 1NC6A 2FTLE 3UNRA 3RXCA 2J38A 1QL9A 1RTLA 5PTPA 1L0ZA 3M3SA 1UTPA 1O3FA 1MTWA 1O3NA 1C5QA 1D3DB 1C2JA 1S82A 4BAMB 5K0HA 2ZQ2A 1EJAA 1ZHMA 3SI4H 5ABWA 2GDEH 3D65E 2UUJB 2ZGHA 1O36A 1IQIA 5DPAA 2TIOA 3LT3A 2FI4E 1PQAA 2WINI 1HV7A 1ETSH 1OP2A 1JXPA 4Z0KA 1A0LA 2C4FH 1LVMA 1SI5H 1LTOA 3SU2A 1FY1A 1O5FH 4MPUA 3UPEA 1P05A 3MNBA 3ODDA 2O8UA 4FUJA 3TGJE 1HAHH 3RMOH 2BD9A 1BOQA 3P8FA 4X6MA 1PYTD 3M7QA 1HAIH 2OQ5A 1B7XB 1O3CA 3VEQB 1A5GH 1ZGIA 1ANCA 1QBNA 2GMTB 3CS0A 1KLJH 1GL0E 3L6PA 1GMDF 1OOKB 2PGQB 3M37A 2A7HA 1WBGB 1P0SH 3BSQA 1CVWH 1EZQA 3HGNA 3KCGH 2ZHWH 3TVJB 1BMAA 3A85A 2IJOB 2ZDMA 3QGNB 1SHYA 2FIRH 1NU9A 3TPIZ 2Y81A 2A4OA 3F68H 5FPYA 1YPMH 4NA8A 1O2WA 2FI5E 1O33A 4UFGH 9LPRA 2FOCA 3OU0A 3QDZB 7GCHF 1EOJA 1HAGE 3BEIB 1P3CA 1TX7A 1WTGH 1TX8A 1H9IE 3T5FH 1HCGA 4WMFA 1C5NH 3KQCA 3M5NA 3GCHB 1DWCH 4A1VA 7LPRA 2BY5X 2ZFSA 1Y3YA 2WV5A 1L1GA 3BN9A 3PROA 4GPGA 2BLOA 4ZKSU 3EQ0H 4NG9H 5DG6A 1K28D 1ELVA 2ASUB 2BB4A 3U69H 1UTMA 2DE9A 1C1RA 1Z8JB 2DUCA 1VJ9U 3UNSA 2I6QA 3A88A 4Q2KA 1SLXB 3NCLA 1IQJA 2TGAA 4Y76A 3GICB 5HMAA 1KSNA 1TNGA 1GJ4H 3RDZA 1FIWA 3SBKA 4ZHLU 2EEKA 1MTNB 1GVKB 4Q7XA 5DK1A 3DFLA 1GBLA 2P59A 2A2QH 2AMQA 1A4WH 1BUIA 2Z9IA 2TRMA 4MG3A 1NRQH 2C8XB 3GDUA 4KTSA 1EOLA 1BTZA 2AGGX 4TPYA 1GMHF 3TH4H 2R9PA 3A89A 1TNJA 2FTMA 2SNVA 2XTTB 4ZHAA 5C67A 3KEEA 2ZPSA 4AFUA 1ZLRA 1AUJA 2PUXB 2OQUA 3BF6H 4BAHB 2FI3E 2ZDKA 3VB3A 1E0FD 1QFKH 1FY4A 3GYLB 3P8GA 3P8OA 1G9IE 1GMHG 4I8JA 4O03A 1B0FA 2ZF0H 4JZFH 1C2GA 2G5NA 1ESBA 3RXVA 3MH5A 1WU1A 2TBSA 3GCNA 2ZHEH 3LH1A 4RN6A 3VFEA 2RDLA 1UVPA 3QZQA 2BDHA 1G3BA 3GCHC 1C2IA 1W14U 1F7ZA 2BDBA 1DITH 1YC0A 1C1UH 2BQWB 3SUFA 2ZKSA 2AYWA 4NZQA 2BMGB 2BXTH 3A8CA 4Y71A 3UWJH 4UEHH 1MQ6A 3MU5A 2XW9A 3C1KA 1XVOA 5EQRA 1TBZH 1C2MA 1UMAH 2ZGXH 3BV9B 3LGIA 1W2KH 2Y7XA 1S85A 2ULLA 3ZZBA 1EP5A 2J34A 1WAYB 4YOGA 1O5DH 1RJXB 5J4QA 3UIRA 4MNVA 1V2ST 4GUXA 1BBRH 1FJSA 1SSXA 4FUDA 5DO4H 2SFAA 1QTFA 1X7AC 1EATA 3BIUH 1LVBA 1ZMJA 1VGCB 1EZXC 1TBRH 2KAIB 1TOCB 1O2GH 1ABJH 1XXFA 7ESTE 2G52A 2SGPE 1ZTKA 3ATWA 1TYNA 2I6SA 2NU1E 2STAE 5C1YA 2RA0A 2HOBA 3SU6A 4FVDA 3FP7E 4YT6H 3RM2H 2R3YA 3LGUA 1XXDA 1C5PA 1DE7H 1H8DH 1FNIA 2AFQB 4ABDA 1PPZA 1LVOA 2EI7A 3PV4A 4INLA 4IS5A 3ZVFA 1HIAB 4CR9A 4B2CA 1FXYA 2PFEA 2FLRH 3RMLH 1T4VH 1PPHE 3V0XA 1ZTJA 4GHQA 4Y11E 3PLKA 1NPMA 1CT0E 5L30H 4DIHH 2SNWA 2ODYB 4NWKA 1LHGH 3I78A 3AASA 4KTCA 5C3NA 2QXIA 4HTCH 4M7GA 1E35B 1N1LA 1VCPA 2ZHFH 1ETRH 5F03A 1O39A 2PGBB 4BOHA 5C5OA 3P70B 2CHAC 3LGTA 4ZKOU 1W10U 1IQEA 1ARBA 1CO7E 2ZFTA 5H4IB 1EPTB 3VXFH 5JB8S 1GDUA 2BX3A 1ELBA 1H4WA 3VB4A 2HNTC 4AYVB 1VCQA 1BT7A 5E0GA 3LJJA 3ZVBA 2A2XH 4XSKU 4IC6A 5F8ZA 3DD2H 2H1UA 3UR9A 1GI7B 1ETTH 2F91A 2P94A 2J94A 3SU0A 1O2OA 3MH7A 4NIXA 3A7VA 4MTBA 1QQUA 2RA3A 1ZSJA 1CU1A 2BM2A 1G36A 2C8YB 1NFWA 3D23A 4BXSA 1VGCC 3GCTF 1TGCA 1AUTC 2BD2A 1FQ3A 1EJNA 3ZVGA 1ELDE 5JBAS 1BB0B 4JK6A 4RSPA 1DVAH 1P9UA 1F5KU 1UTLM 1GWAA 1AN1E 2QYIA 3MHWU 1QR3E 5LGOA 1G3DA 4MNXA 1BHXF 1ZPBA 1V6DA 2XYAA 2UWOA 1EZUC 3HKIB 2GKVE 3SUEA 3TH2H 2OC8A 3OX7U 1ZSKA 1GCTB 1SFQB 3RXIA 2ZU5A 2AGIX 1TNHA 2Q1JA 4AFQA 1F0RA 4K2YA 3HATH 1QHRB 2GCTB 2CXVA 1XUHA 3M61U 1NS3A 2GZ9A 1C2HA 2FOFA 1UVOA 1OWHA 2BY9X 4IMQA 1ESAA 5EODA 1GJ9B 1DY9A 2W7UA 3Q76A 1F92A 2WPHS 2YNBA 1AKSA 4ABBA 4YO9A 5BRRE 1MUEB 1TRMA 1OXGA 1GBBA 3AW0A 1GBTA 2BY6X 1BMNH 1PQ8A 1WOFA 1YCPH 2R3UA 3KQEA 3P17H 1NZQH 1O2IA 1GBEA 2O8MA 1DT2A 1EB2A 3U98H 2C3SA 4VGCB 1KXAA 4DIIH 4JZ1A 4CREA 1O5EH 1F2SE 1Y5AT 3VB7A 2P8OB 1W13U 1C5OH 1MCTA 1DANH 1KDQA 1UK2A 1C4U2 2PTCE 1SGRE 1SGPE 3SV9A 3BIVH 1MKWH 1AGJA 1NRSH 4UDWH 1P2JA 1EP6A 1FONA 3OY5U 1O3PB 1P57B 2C8WB 4WMDA 5EPNA 1XUJA 3BEFB 1MBMA 3W95A 3S0NA 1V2LT 1V2OT 4U2WA 5F6MA 1O2NA 2A0QB 1SGQE 2Z3CA 4WH6A 1P10A 4ISIH 4I8KA 1DWEH 1HGTH 2QF0A 2ALVA 2DE8A 1GVZA 1K1PA 1Z6JH 3O8DA 2W5EA 1PFXC 1UTKA 1P12E 4YT7H 4BXWA 2ZFPH 4WJG2 1O30A 5A0BA 2GTBA 1O34A 3ESTA 3O8BA 1MKXH 2EI8A 2ZP0H 2VWNA 1C2KA 1DUEA 1V2VT 3MO3A 2RG3A 3ITIA 4XBBA 4DW2U 1D3TB 4OGYA 5AHGH 3ZZ5A 1NN6A 5FPTA 1JIMA 3IG6B 1SGEE 1P09A 3UQOA 4TPIZ 4YLUA 2A5AA 1Y59T 1P3EA 1O3EA 2A4GA 1SL3A 4DCDA 1Y5BT 1J17T 1O2TA 2CMYA 1HJ8A 2Y7ZA 1O5GH 3A8AA 4XOJA 1IQNA 4H4FA 2UUFB 1KXEA 1KXCA 1H9LB 1GMCF 4YLQH 4RKOB 3QUMP 3UFAA 1TAWA 1ZHPA 3QO6A 1V2RT 3GY2A 2A7CA 2V6NA 3QTOH 4D7FA 5EQQA 1BTXA 2THFB 5JBBS 2H9EH 3K6ZA 3GDSA 3UY9A 1O3BA 3F1SB 3P92A 4OS5A 2P8OC 1T8NA 2A4QA 1AE8H 1GMCG 2XC4A 1LHFH 2W7SA 5ESTE 1G3EA 3PMBB 1HRTH 1L2EA 4K8BA 1GVLA 2ZO3H 3DHKH 3SJOA 3R3GB 3EA9A 1AO5A 5K7RA 3RXTA 2CGAA 1UK4A 3RXUA 5A8YA 4X8UH 4I8GA 2Z7FE 1B5GH 3KF2A 3U1IB 4CH8B 2ZG0H 2FPZA 4TY6A 3RM0H 1DFPA 1SGDE 2ZU4A 5JBTA 2ZDVH 2WUCA 1GI3A 1YGCH 1NO9H 4ABHA 3TK9A 1DPOA 1W0YH 1LKAA 1NFUA 4MVNA 1EJMA 1FAXA 1THSH 1LHCH 1GI5A 1O2QA 1XUGA 2NU3E 5HXFA 1G32B 1TQ7B 2OTVA 3ZVAA 1C2DA 1MU6B 3HGPA 1BDAA 5JBCS 1FIZA 1HAVA 3ZV8A 2BDYA 4GLYA 6ESTA 3SNCA 2H6MA 2W26A 2QY0B 1TNKA 1HFDA 1V2UT 4PROA 3LDXH 1C5MD 1GI9B 2UUKB 1C5LH 1ELCA 3H7TA 2ZGJA 2XWAA 1GHAF 1TPOA 1W0ZU 2F9UA 4AB9A 2FESH 2EC9H 2P3FH 4O9VA 4INHA 4AFZA 2AGEX 1GJ5H 1FY5A 2XBXA 4FXGH 1C1WH 4ZH8A 1JRSA 1NU7B 3JZ2B 3A87A 1RRKA 1HB0B 1SGCA 1UTJA 2ZWLH 6LPRA 4Q80A 4JYTA 1SBWA 1JBUH 2BZ6H 1GHAG 3SJKA 2P16A 1Y3VA 1BRBE 1CHOG 2FYRA 3F9EA 3KQDA 4YESB 4GSOA 2H5DA 3PTNA 4UFFH 2OP9A 5JPMH 2PSYA 3N7OA 1GL1A 1WV7H 1ESTA 1HAXB 3HK3B 4ESTE 3RLWH 1S83A 2SGFE 4AGKA 5CE1A 3P95A 2OCVB 5ESBA 1CGJE 1GBMA 5DP3A 1K1MA 3MI4A 3URCA 1YM0A 1AZ8A 2BVXH 1YCPM 1ZMLA 3FANA 2XCFA 4NIVA 1O3DA 4UFEH 5LPEA 2NWNA 3SJ9A 1O3KA 5EOKA 2F9NA 2WPMS 4AORA 1YP9A 4B74A 3LC5A 1D6WA 1CGHA 2TGDA 1UVTH 1O2MA 4K1SA 3T26A 1K9OE 5HYOA 1GJ6A 1S81A 3RXKA 1XMNB 1QB9A 4ZUHA 4B76A 2R0KA 2GZ8A 4YOJA 3VB5A 4D8NA 2BD4A 3SORA 3HPTB 3P6ZB 1O3AA 2Z94A 2OBQA 1MU8B 3GY8A 1Z7KA 2ZEBA 2GT8A 5DKMA 4GHTA 3SN8A 1HJAB 1VZQH 1ZGVA 4X8SH 3BG4C 1P2OA 3BTHE 1QB6A 5LPFA 2BOHB 3B23B 2VIVA 3RXJA 4CBOA 1RTKA 1EAUA 1PPCE 4RKJB 1Q3XA 1ZTLA 1VITG 2J92A 1O2VA 1TGSZ 1KLIH 3SNBA 4K1TA 5EG4A 3M5MA 5DP5A 3FZZA 3U8TH 1ANEA 1JWTA 2Q6GA 4FUFA 5FXLA 1LVYA 2GP9B 1SGIB 1ANBA 2F3CE 1QNJA 1V2TT 1MZAA 3RXAA 3L3TA 4FU7A 2FZZA 4KGAA 3SJIA 1GJDB 4JK5A 5J4SA 1O2HA 1ZMNA 2ZQ1A 1DS2E 1MAXA 3E91A 1C5UA 3K9XB 3TK6A 2W3IA 3GY7A 3AAVA 3I77A 2AIPA 3S9CA 1DXWA 3NZIA 2JH0D 3EAJA 1N8OB 4Y7BA 3A8BA 1ELFA 3STIA 3PM3A 1C1QA 3RU4T 2ZC9H 1J15A 1SG8B 4GCHF 1TA2A 3D62A 3BTFE 4LZ4B 3U1JB 1QL8A 1Y3UA 1DLEA 1K2I1 3SU3A 1CE5A 1EZSC 1VR1H 2BLVA 3RC5A 2LNCA 2HALA 4Q7ZA 3AVZA 2EA3A 4YTAA 1GBKA 4E7NA 3TIUA 5HM9A 1GI0A 2ZCHP 2HPQH 1E37B 1QA0A 4CHAB 4UD9H 4CRDA 2PR3A 4GCHG 5GCHF 5A8ZA 4J2YB 1D4PB 3CENA 3P8NA 2GD4B 1EQ9A 4R8TB 1BJVA 4A5TS 1CBWC 3PLBA 3FAOA 1HJAC 5G4BA 2C90B 3ZYDA 4CR5A 3D49H 2H5CA 1OWEA 5EQSA 1HLTH 4JYUH 1XUFA 3LGWA 2WPLS 2VWMA 1Y3WA 2ANMH 2AS9A 1SHHB 4FU9A 2O8LA 2VIOA 5GCHG 1P2IA 1G37A 2BXUH 2HRVA 3A7ZA 4K60A 2GVFA 3UNQA 3RMMH 3RXEA 1P2NA 4IN2A 3RC4A 3GISB 3F9FA 6GCHF 4JZDH 4LZ1H 5EPYA 5TCAA 1MCVA 2AMPA 2CHAB 5AFYH 4KP0A 4WXIA 5B6OA 2FX4A 1Y5UT 4TWWA 3DFJA 3MO9A 3RP2A 1BTWA 2JETB 4X6PA 3OYPA 2D2DA 5SGAE 4MPXA 1NROH 3E0PB 1NM6A 6GCHG 1S0RA 2FOEA 1YPLH 3ELAH 4ZMAH 1AVWA 1GI2A 5A8XA 1O37A 1CSOE 3ZZAA 1OPHB 2NU2E 3LPRA 2OLGA 5HM2A 1DWBH 2V3HH 2FP7B 3RUOA 1UCYK 1EX3A 1GJ7B 1N8OC 3SV7A 3GY3A 3SQHE 4KELA 1BIOA 1KIGH 4HZHA 4IMZA 1HUTH 2ZDAH 3ZZ7A 2FYQA 3EGKH 3MWIU 2CV3A 5A0AE 5CHAC 1DY8A 2TGPZ 3PLPA 1BJUA 4ABEA 2WUBA 3MOCA 1M9UA 1QGFA 4H6TA 4IN1A 3S69A 1SPJA 1QL7A 3QX5H 2B0FA 4CHAC 2A31A 3ZV9A 1Z8IB 3SGQE 1GCDA 4MPWA 2BX4A 1ZHRA 2GZ7A 1ELEE 1YPEH 1YPKH 1KY9A 4TYDA 1D6RA 3SNEA 1ZOMA 2ODQA 4K1EA 3QN7A 1FPCH 3LH3A 1UHBA 5T6GA 1TPSA 4UE7H 1WYKA 1P9SA 4Y10E 3SHAH 5FX6A 3M5LA 3RMNH 1GBCA 1HYLA 4I8LA 1L1JA 2J95A 3M36A 1BTUA 1UTNA 2O8WA 1SB1H 1BRUP 1AWHB 1DWDH 1FY3A 2VJ1A 1QB1A 2ZPQA 2VVVA 2ZU2A 1EXFA 2FX6A 2OC1A 1LQDB 2O8TA 3AAUA 2TGTA 2HNTE 1QBOA 1OP8A 1C1TA 1Z1JA 1IQMA 4Y0YE 2BY7X 3A84A 1W11U 2JETC 4A7IB 1AB9B 1TRYA 1TONA 2Q6FA 2ZIQH 3GCOA 4CRBA 1ZR0A 4ABGA 4DJZB 3AW1A 2ZA5A 1QRXA 3BTEE 2P93A 4NFFA 1AIXH 1TMUH 2ANWA 1KXFA 2CF9H 2VVUA 3KQBA 3MO6A 5FCRA 4X8VH 5L2ZH 3HKJB 1J8AA 1DDJA 4ASHA 1BQYA 3ZVEA 2B5TB 1CA0C 2J9NA 4AG2A 4ISHH 4K3JA 2XC5A 1ZJKA 3SU4A 1O2UA 3SGAE 1OP0A 1FN6A 1RTFB 2G8TA 1MMJN 3PO1B 5JYIA 1SFIA 1V2QT 1EAXA 1FN8A 4I33A 2VU8E 1DUAA 3NKKA 1XUKA 1ZSLA 1O2JA 5BPEA 4LXBH 1INCA 1UVSH 3M7TA 3PMAB 4FVBA 3BEUA 1UVUH 3PB1E 4D9RA 2CN0H 4AFSA 1O3HA 2PHBA 9ESTA 4GAWA 2WPJS 5E0JA 1D9IA 2A1DB 1ZYOA 3RXBA 1UCYE 5AF9H 4NCYA 2F9VA 4MPVA 2JH5D 3T25A 3IWMA 4YOIA 2BQ6B 1MD7A 1SGTA 1OYTH 1QJ1B 2VGCC 4DOQA 1BMLA 5GIBA 1MTUA 1TLDA 1O2YA 1OX1A 2VH6A 3BTTE 4NZLA 1OYQA 4CH2B 2FMJA 4Y8ZA 1NFXA 3ZZ4A 1SOZA 3FP6E 3JZ1B 1LQEA 1AFQB 3V13A 3UR6A 2VIQA 3GYMA 3GDVA 3Q3KA 1S84A 2VIPA 2XCNA 1T4UH 2G4UA 2FLBH 2HLCA 1T8MA 7KMEH 2ZFQH 4MNWA 1A1RA 3I29A 1FLEE 1TWXB 1AB9C 2Z9LA 3IITA 1LMWB 2HWLB 3MH4A 3TLOA 5TCCA 5FCKA 1WCZA 3RXSA 3E1XB 1Q31A 1VCWA 4CBNA 4X1PU 4WH8A 1HNEE 2QCYA 3PMJA 4Y6DA 4FUCA 1LHDH 1G30B 2EI6A 2TPIZ 1WSSH 4JZIA 1HAYB 4AG1A 1O5BB 1WQSA 3UREA 4AB8A 1HAVB 3LKWA 3PO1C 2V35A 4AZ2B 8LPRA 4GVUA 1O35A 1SC8U 3U9AH 1BITA 4NA9H 1P03A 1H1BA 1EPTA 1P11E 1QQ4A 1XVMA 1ELTA 1QBVH 1ZJDA 1C5YB 4IW4E 1TOMH 4F4OC 3RXGA 1VITH 4Y8YA 4NA7A 1TMBH 1TX6A 4Y7AA 2ESTE 1HBTH 3MMGA 1TRNA 4BNRA 1GJCB 3QGJA 2BD7A 4B2BA 1QJ6B 6CHAB 1U6QA 2BHGA 3TK5A 3RLYH 2AEIH 1KXBA 1C9PA 3O8RA 1K22H 1LPZB 3TJUA 1QCPA 1YPGH 1CA8B 2Z3EA 3W94A 2XXLA 3ATKA 3DUXH 5DP4A 2PW8H 3S7HB 1A3EH 1GHBG 2BD5A 4CRFA 3F6UH 4QT8C 4AOQA 1E38B 2Y6TA 5JDUB 3T62A 3A7TA 2Y5HA 4LK4A 1C1VH 1JIRA 4ABFA 1AFQC 2OBOA 1LPKB 1XKBC 2H9TH 2FDAA 1GG6C 1GHWH 1W7XH 4OS1A 2XC0A 4D76A 3M3TA 4IGDA 1PPBH 2QN5T 1C1MA 3Q3XA 4UONA 1IOEA 1FUJA 1JRTA 1XX9A 2G4TA 3ZZ6A 4ZKNU 2PUQH 3E8LA 4INKA 1O0DH 2BZAA 1O2PA 4LOYH 2PWXA 4DY7B 1CGIE 4YM9A 1EAIA 1YLDA 3B9FH 2ANKH 2D1JA 4FUGA 3QZRA 4Q7YA 1ANDA 1YF4A 2PSXA 4O3TA 4ABAA 2XBVA 5T6DA 2GV7A 3BTDE 3U8OH 1PQ7A 2BDGA 5EU8A 4ABJA 2ZFFH 1OSSA 1GDNA 2A45B 2R2WU 4B75A 1C1NA 3TNSA 2R0LA 4HI3A 4X2YA 2B7DH 2PKAA 4ZAEA 2YOLA 4FUBA 5A09A 3PMHB 1YYY1 4H6SB 2ZTZA 4ZXXH 1XUIA 2BDAA 3EYDA 2V3OH 1TPAE 4WY3A 2BDCA 1HJ9A 1BCUH 4X1SU 2VNTA 1WQVH 1K1JA 2ZZUH 2GCHF 4ISNA 6CHAC 4ABIA 5FBIA 1S6HA 3LU9B 1QJ7B 4JYVH 5F8XA 3FZDA 1XKAC 5FBEA 3FVFB 4KTUA 3URDA 5E0HA 1H9HE 1QRZA 3HK6B 1CHOF 2J4IA 2B9LA 2GCHG 4X1RU 3BTKE 2QAAA 2A5IA 2P3UB 3Q77A 5DP7A 3T28A 4MLFB 3M3VA 3ATLA 3BG4B 4Y79A 1GBJA 1NFYA 3B8JA 1FI8A 2Q6DA 1GDQA 3GOVB 8ESTE 1KTTB 4X6NA 1G2MA 3UTUH 1GI6A 3WY8A 2OUAA 1A7SA 1AE5A 1YPHE 1TNLA 3MNSA 4R0IA 1P2QA 1W7GH 8GCHF 3A86A 3MU1A 3ZZ8A 4MDSA 1Z6EA 1S6FA 1YPHC 3BTME 1RS0A 4FU8A 1D3PB 3FFGA 1CT4E 3S9BA 4BTIB 1F5LA 1V2PT 5E8EH 2A32A 1E34B 1AHTH 2UWLA 3A83A 3A7XA 2VIDA 5E2OA 4AYYB 1GGDB 2ALPA 1K1LA 4UFDH 8GCHG 3SUGA 1FMGA 1V2NT 4OGXA 1MBQA 2Z3DA 2NU4E 1C5WB 3A81A 1P04A 3LJOA 2QA9E 3PTBA 1C1SA 1C5SA 1CQQA 4U01A 4AX9H 4K8YA 2ZDLA 3OSYA 1OWJA 2PKSB 2G5VA 2HVXA 2QGRA 1DX5M 1O31A 3LGYA 1MAYA 1BHXB 3R0FA 5GXPA 5LH8A 2D26C 1GHXH 1G3CA 5EXLA 1UTQA 4NIWA 3BTQE 4E05H 1PYTC 2BD8A 5LPRA 4E06H 2FEQH 3SV8A 1O3JA 2F9BH 1VITF 2F9OA 1O3GA 1GBAA 1CBWB 2FM2A 4U30A 2RCEA 1C5ZB 1EB1H 1ELGA 1TALA 1YPJH 4OS2A 4E7RG 2VH0A 1UO6A 2G55A 3A80A 4FUIA 2AH4X 3BG8A 3LC3A 1V2KT 2O9QA 1DICA 3C27B 1PPEE 1YBWA 1IAUA 3SZNA 1TE0A 1MTSA 2QXHA 1W12U 4NIYA 1K1OA 1GMDG 4WWYA 3ZZDA 3SGBE 1SVPA 2OD3B 4NSVA 1BBRK 1SLWB 4SGBE 1BTPA 2CF8H 3QWCH 4XBCA 1A0JA 2ANYA 5I46H 2ZHDA 2BVRH 4WXVA 1ID5H 2HGTH 1RFNA 1FZZA 4DURA 1SGFG 2AMDA 1GBDA 4J1YA 2Z9JA 3SO3A 1W3CA 1GGDC 7GCHG 3SV6A 1TGBA 3O8CA 1QY6A 2V0BA 2C93B 4IC5A 1C1OA 3T27A 3TGIE 1K1IA 1P2MA 1L4DA 1PJPA 2GV6A 3PYHA 1LPGB 4X8TH 8KME2 1N6XA 1IHTH 3G01A 2BQ7B 1P06A 2OXSA 2PKSC 5CHAB 5C1XA 3NPSA 1F0UA 1P02A 5C1UA 5IDKA 3DA9B 4JCNA 1UHBB 3TGKE 5DP9A 3VPKA 1NTPA 2F83A 1A61H 2BLQA 1MTVA 3QK1A 2G81E 1QIXB 3EA8A 4KKDA 4WVPE 2GMTC 1O2ZA 2FO9A 4K69A 1B0EA 4A1XA 2FOAA 1ZZZA 2PLXA 3RC6A 3ZVDA 1HAPH 1QURH 1O2SA 4X0WU 2VWLA 4Y8XA 4BTTB 3OTJE 4TWYA 3MU4A 3RXHA 1ZRBA 1L1NA 1TPPA 3BTGE 2SGAA 2FWWA 3KN2A 1AVXA 2GX4A 3E90B 2FXRA 1CHGA 1MH0A 5GJ4B 1A5HA 2WPIS 1J9CH 1A46H 2FOGA 3ZZ3A 3RXMA 2G51A 3EDXB 1C5VA 1L4ZA 3V12A 1P2KA 3FP8E 5T6FA 3TU7H 1SGYE 5EGMA 2ZCLP 5I25A 3QLPH 1THRH 4THNH 4IBLH 3MU8A 4MNYA 1WUNH 4OS6A 2QIQA 5T3HA 3S9AA 4O97A 2FOMB 1OS8A 1GI4A 3ATMA 3RXLA 1OWIA 2QXGA 2ZFRH 1FPHH 1O3OA 2ZPRA 3K2UA 1BRCE 2OC0A 2SGEE 3LOXA 1GBFA 1EASA 2BY8X 1Q2WA 3VXEH 1TABE 1LDTT 1DOJA 1CA0B 3RXDA 3A82A 1BBRE 5GWZA 1AI8H 3E6PH 1UK3A 2VVCA 4WF8A 1LCYA 3ENSB 1T8LA 2P3TB 3STJA 2FODA 1C1PA 3MTYA 1DSTA 1MTNC 1IQLA 4A92A 3UUZA 1O3MA 3KNXA 5EW2H 3SHCH 1TMTH 3MU0A 2M5TA 1O3IA 2QF3A 3E3TA 1KXDA 1ABIH 1OKXA 1YLCA 2K1QA 1T8OA 1ELAA 1FV9A 1AKSB 3Q3YA 4SGAE 1JMOH 2C8ZB 2VWOA 2GDDA 1YCPK 1C2EA 3RXOA 2VGCB 1HAZB 1MQ5A 1SQOA 5DP8A 1FDPA 3H5CB 3NUMA 1GI1A 3ODFA 4I7YH 3GY6A 3L33A 4X1NU 1AZZA 1GHYH 3ATIA 1AFEH 5DJ7A 4BTUB 1C2LA 5JB9S 2Z9GA 2AIQA 1BTHH 3NWUA 1KDQB 1MKWK 3UQVA 4OS7A 2XBYA 2XNIA 3ZYEA 1GJBB 1JOUB 3VGCB 3TITA 3GY4A 4HGCA 1A2CH 3RXRA 3UOUA 4A1TA 3U8RH 2WV4A 1SMFE 1PPGE 3TJNA 2Z9KA 2F9PA 3NXPA 2IPHA 5L6NH 3T2NA 4DT7B 2FOHA 1AWFH 3SNAA 1RXPA 2XRCA 4NGAH 2IOTA 5C2ZA 4DG4A 1SOTA 3MFJA 2GT7A 4U32A 3SU1A 1TGTA 1T31A 1WTHD 1Y3XA 4BANB 3TNTA 1QA7A 3K6YA 2FS8A 3PWCA 4X1QU 1P01A 2PTNA 2YNAA 1BRAA 2H2ZA 2QC2A 3H7OA 1ORFA 1SLVB 1GBIA 3TJVA 1F5RA 1HDTH 2D8WA 2UWPA 1MD8A 2A5KA 1MKXK 3ZZCA 4FUHA 4ZROA 1C5TA 2ZI2H 3TH3H 1T32A 4I31A 4AN7A 2ZTYA 2XWBI 1TQ0B 1ZPCA 1TNIA 1E36B 3EA7A 1NT1A 2ZTXA 1IQKA 1HAOH 3V3MA 1C2FA 3SOSA 5L2YH
chains in the Genus database with same CATH superfamily
3M7UA 1FY8E 4BAOB 3MYWA 4BAQB 1RD3B 3F9GA 1AY6H 5IYTA 1ZPZA 1O38A 2BYAX 2P95A 3WWBA 3KL6A 2XBWA 1IHSH 2ZECA 2BD3A 4O3UA 5DN6D 1UCYH 2ZU1A 3E16B 4ISLA 3GCTG 4X2WA 2ODPA 2KAIA 1GI8B 4H42U 1KYNA 1S5SA 4FOUC 1NESE 2ILNA 1DM4B 2W3KA 1BZXE 1GG6B 5HKKD 5DP6A 1T7CA 4B73A 3V7TA 3VGCC 4Y0ZE 1O3LA 5HGGA 2Y5FA 1O5AB 3LONA 2ZNKH 4XE4A 3PV5A 1LHEH 1O2XA 3K65B 3NK8A 1K0HA 2H9HA 3LGVA 1HIAA 1Z1IA 2OINA 2Y5GA 3VB6A 4BAKB 3TJOA 2PKAB 1TGNA 1J16A 4JMYA 1NRNH 1H8IH 2ZU3A 3CP7A 1SLUB 3M5OA 5GDSH 1EPTC 3ZZ9A 1G2LA 3A8DA 1ACBE 4WMEA 3SNDA 1GBHA 4CRCA 2ZCKP 1BMMH 2Z6BD 4Z6AH 3S7KB 5F8TA 3SUDA 3VG8A 5AVDA 3UOPA 1DSUA 2J97A 1O32A 1SR5C 1HPGA 1IQHA 5FX5A 1ARCA 3SJ8A 1Z8RA 2ZGCA 4A6LA 1RIWB 1N6YA 1S0QA 1A5IA 2NU0E 3T29A 4OS4A 1GHBF 3F9HA 5CMXH 4DVAU 4B2AA 4K5ZA 5IK2D 1V2JT 4XBDA 2L6OA 1XM1A 4NWLA 5E2PA 1YLNA 1UTOA 4HFPB 1NY22 2OC7A 4XFQA 1OWKA 1AMHA 2BTCE 1A0HB 1GHVH 1EKBB 1LKBA 1Z8GA 2SGQE 2IN2A 1CT2E 1O2LA 2BOKA 2FOBA 3EE0B 2BVSH 4ZXYH 3ZVCA 2UUYA 1GCTC 2R2MB 2WYJA 1GHZA 4YZUA 2STBE 3A7WA 2VINA 2A7JA 2GCTC 1GPZA 2ZDNA 1DLKB 4X2XA 1BTYA 4NFEA 1YKTA 4ISOA 1LO6A 2BDIA 1P8VC 1TB6H 4D7GA 1KTSB 1EUFA 2LPRA 4TY7A 2J2UA 5FAHA 2FS9A 1HXEH 2ZGBH 1GJAB 1NRRH 2Y80A 4ZKRU 2VIWA 1THPB 2HPPH 5C20A 3A7YA 1F0SA 1D3QB 1AQ7A 1GJ8B 5FHTA 5TJXA 5GPIB 3SI3H 3MH6A 4I32A 3SV2H 1F0TA 1QRWA 1SGFA 1OWDA 5FPSA 3KGPA 2QXJA 3OY6U 1W0KD 4B1TA 3M35A 4VGCC 2WV9A 5ETXA 1IQGA 1C5RA 1C4V2 1VJAU 2HNTF 2QV1A 4X2VA 4CRAA 4FUEA 5AFZH 1SQTA 2KX4A 2BLWA 1TBQH 1K1NA 1COWD 1FAKH 1PQ5A 3BTWE 1RIWC 3UWIA 2G00A 1J14A 1AU8A 3MNCA 5EW1H 2JKHA 3PWBA 1O2RA 3LIWA 2WYGA 2WPKS 2KFWA 5EXNA 2VB0A 3KIDU 2PV9B 4AGJA 1K21H 1KLTA 1BA8B 1RGQA 1TFXA 1SQAA 4D9QA 1C5XB 1PPFE 4MQAA 3RU4E 1SGNE 1Y8TA 1V2MT 1TIOA 2AERH 4ZHMU 4DGJA 4Z1MD 3RU4D 3MNXA 4I86A 1IQFA 3RXFA 1TA6A 4NSYA 3RXPA 5C5NA 1HXFH 2GGVB 3U28C 4X6OA 2SGDE 5A2MH 3DT0H 4JZEH 3QTVH 4B71A 1NRPH 1W8BH 5DGJA 2ZHQH 4I8HA 4F49A 1O5CB 3CS7A 1ZRKA 2A4RA 3SQEE 4XDEA 4RI0A 1EAWA 3Q00A 3SU5A 1DXPA 2JH6D 1Z71A 1C9TA 5EXMA 2B8OH 3GY5A 1MZDA 3E0NB 3KHVA 5A0CA 2Y82A 1O2KA 1A3BH 1UJ1A 3SW2B 4CRGA 1C4Y2 1V3XA 1AVGH 2CJIA 1AD8H 3RXQA 1V2WT 1NC6A 2FTLE 3UNRA 3RXCA 2J38A 1QL9A 1RTLA 5EIYA 5PTPA 1L0ZA 3M3SA 1UTPA 1O3FA 1MTWA 1O3NA 1C5QA 1D3DB 3OEED 1C2JA 1S82A 4BAMB 5K0HA 3CNRA 2ZQ2A 1EJAA 1ZHMA 3SI4H 5ABWA 2GDEH 3D65E 2UUJB 2ZGHA 1O36A 1IQIA 5CHBA 5DPAA 2TIOA 3LT3A 2FI4E 1PQAA 2WINI 1HV7A 1ETSH 1OP2A 3N7DA 1JXPA 4Z0KA 1A0LA 2C4FH 1LVMA 1SI5H 1LTOA 3SU2A 1FY1A 1O5FH 4MPUA 3UPEA 1P05A 3MNBA 2RDEA 3ODDA 2O8UA 4FUJA 3TGJE 1HAHH 3RMOH 2BD9A 1BOQA 3P8FA 4X6MA 1PYTD 3M7QA 1HAIH 2OQ5A 1B7XB 1O3CA 3VEQB 1A5GH 1ZGIA 1ANCA 1QBNA 2GMTB 3CS0A 1KLJH 1GL0E 3L6PA 1GMDF 1OOKB 2PGQB 2WSSD 3M37A 2A7HA 1WBGB 1P0SH 3BSQA 1CVWH 1EZQA 3HGNA 3KCGH 2ZHWH 3TVJB 1BMAA 3A85A 2IJOB 2YMSB 2ZDMA 3QGNB 1SHYA 2FIRH 1NU9A 3TPIZ 2Y81A 2A4OA 3F68H 5FPYA 1YPMH 4NA8A 1O2WA 2FI5E 1O33A 4UFGH 9LPRA 2FOCA 3OU0A 3N99A 3QDZB 7GCHF 1EOJA 1E79D 3FO8D 1HAGE 3BEIB 1P3CA 1TX7A 1WTGH 1TX8A 1H9IE 3T5FH 1HCGA 4WMFA 1C5NH 3KQCA 3M5NA 3GCHB 1DWCH 4A1VA 3GS9A 2BY5X 2ZFSA 1Y3YA 7LPRA 2WV5A 1L1GA 3BN9A 3PROA 4GPGA 2BLOA 4ZKSU 3EQ0H 4NG9H 5DG6A 3F2FA 1K28D 1ELVA 2ASUB 2BB4A 3U69H 1UTMA 2DE9A 1C1RA 2JJ2D 1Z8JB 2DUCA 1VJ9U 2OK5A 3UNSA 2I6QA 3A88A 4Q2KA 1SLXB 2GJGA 3NCLA 1IQJA 2TGAA 4Y76A 3GICB 4ASUD 5HMAA 2M2AA 1KSNA 1TNGA 1GJ4H 3RDZA 1FIWA 3SBKA 4ZHLU 2EEKA 1MTNB 1GVKB 4Q7XA 5DK1A 3DFLA 1GBLA 2P59A 2A2QH 2AMQA 1A4WH 1BUIA 2Z9IA 2TRMA 4MG3A 1NRQH 2C8XB 3GDUA 4KTSA 1EOLA 1BTZA 2AGGX 4TPYA 1GMHF 3TH4H 2R9PA 2K0QA 1NBMD 3A89A 1TNJA 2FTMA 2SNVA 2XTTB 4ZHAA 2YMSC 5C67A 2J98B 3KEEA 2ZPSA 4AFUA 1ZLRA 1AUJA 2PUXB 2OQUA 3BF6H 4BAHB 2FI3E 2ZDKA 3VB3A 1E0FD 1QFKH 1FY4A 3GYLB 3P8GA 3P8OA 1G9IE 1GMHG 3F2HA 4I8JA 4O03A 1B0FA 2ZF0H 4JZFH 1C2GA 2G5NA 1ESBA 3RXVA 3MH5A 1WU1A 2PP6A 2TBSA 3GCNA 2ZHEH 3LH1A 4RN6A 3VFEA 2RDLA 3EE7A 5EJ1A 1UVPA 3QZQA 2BDHA 1G3BA 3GCHC 1C2IA 1W14U 1F7ZA 2BDBA 1DITH 1YC0A 1C1UH 2BQWB 3SUFA 2ZKSA 2KM0A 2AYWA 4NZQA 2BMGB 2BXTH 3A8CA 4Y71A 3UWJH 4UEHH 1MQ6A 3MU5A 2XW9A 3C1KA 1XVOA 5EQRA 1TBZH 1C2MA 1UMAH 2ZGXH 3BV9B 3LGIA 3UAIC 1W2KH 2Y7XA 1S85A 2ULLA 3ZZBA 1EP5A 2J34A 1WAYB 4YOGA 1O5DH 1RJXB 5J4QA 3UIRA 4MNVA 1V2ST 4GUXA 1BBRH 1KMHB 1FJSA 1SSXA 4FUDA 5DO4H 2SFAA 1QTFA 1X7AC 1EATA 2QF4A 3BIUH 1LVBA 1ZMJA 1VGCB 1EZXC 1TBRH 2KAIB 3WW7A 4P02A 1TOCB 1O2GH 4F48B 1ABJH 1XXFA 7ESTE 2G52A 2SGPE 1ZTKA 3ATWA 1TYNA 2I6SA 2NU1E 2STAE 5C1YA 2RA0A 2HOBA 3SU6A 4FVDA 3FP7E 2J5UA 4YT6H 3RM2H 2R3YA 3LGUA 1XXDA 1C5PA 1QZ8A 1DE7H 1H8DH 1FNIA 2AFQB 4ABDA 1H8ED 1PPZA 1LVOA 2EI7A 3PV4A 4INLA 4IS5A 3ZVFA 1HIAB 4CR9A 4B2CA 1FXYA 2PFEA 2FLRH 3RMLH 1T4VH 1PPHE 3V0XA 1ZTJA 4GHQA 4M9FA 4Y11E 3PLKA 1NPMA 1CT0E 5L30H 4DIHH 2SNWA 2ODYB 4NWKA 1LHGH 3I78A 3AASA 4KTCA 5C3NA 2QXIA 4HTCH 4M7GA 1E35B 1N1LA 1VCPA 2ZHFH 1ETRH 3SZEA 5F03A 1O39A 2PGBB 4BOHA 5C5OA 3P70B 2CHAC 3LGTA 5EJLA 4ZKOU 1W10U 1IQEA 1ARBA 1CO7E 2ZFTA 5H4IB 1EPTB 3VXFH 5JB8S 1GDUA 2BX3A 1ELBA 1H4WA 3VB4A 2HNTC 4AYVB 1VCQA 1BT7A 5E0GA 5KGOA 3LJJA 3ZVBA 2A2XH 4XSKU 4IC6A 5F8ZA 3DD2H 3KYGA 1BMFD 2H1UA 3UR9A 1GI7B 1MABB 2QE7D 1ETTH 2F91A 4ACAA 2RFKC 2P94A 2J94A 3SU0A 1O2OA 3MH7A 4NIXA 3A7VA 4MTBA 2HVYB 1QQUA 3PRBA 2RA3A 1ZSJA 1CU1A 2BM2A 1G36A 2C8YB 1NFWA 3D23A 4BXSA 1VGCC 3GCTF 1TGCA 1AUTC 2BD2A 1FQ3A 1EJNA 3ZVGA 1ELDE 5JBAS 4B6FA 1BB0B 4JK6A 4RSPA 1DVAH 1P9UA 1F5KU 2K8IA 1UTLM 1GWAA 1AN1E 2QYIA 3MHWU 1QR3E 5LGOA 1G3DA 4MNXA 1BHXF 1ZPBA 1V6DA 2XYAA 2UWOA 1EZUC 3HKIB 2GKVE 3SUEA 3TH2H 2OC8A 2EQNA 3OX7U 1ZSKA 1GCTB 1SFQB 3RXIA 2ZU5A 2AGIX 1TNHA 2Q1JA 4AFQA 1F0RA 4K2YA 3HATH 1QHRB 2GCTB 2CXVA 1XUHA 3M61U 1NS3A 2GZ9A 1C2HA 2FOFA 1UVOA 2LELA 1OWHA 2BY9X 4IMQA 4F55A 1ESAA 5EODA 1GJ9B 1DY9A 2W7UA 3Q76A 1F92A 2WPHS 2YNBA 1AKSA 4ABBA 4YO9A 5F53A 5BRRE 1MUEB 1TRMA 1OXGA 1GBBA 3AW0A 3PV2A 1GBTA 2BY6X 1BMNH 1PQ8A 1WOFA 1YCPH 2R3UA 3KQEA 3P17H 1NZQH 1O2IA 1GBEA 2O8MA 1DT2A 1EB2A 3U98H 2C3SA 4VGCB 1KXAA 4DIIH 4JZ1A 4CREA 1O5EH 1F2SE 1Y5AT 3VB7A 2P8OB 1W13U 1C5OH 1MCTA 2F43B 4RT1A 1DANH 1KDQA 1UK2A 1C4U2 2PTCE 1SGRE 1SGPE 3SV9A 3BIVH 1MKWH 1AGJA 1NRSH 4UDWH 1P2JA 1EP6A 1FONA 3OY5U 1O3PB 1P57B 2C8WB 4WMDA 5EPNA 1XUJA 3BEFB 1MBMA 3W95A 3S0NA 1V2LT 1V2OT 4U2WA 5F6MA 1O2NA 2A0QB 1SGQE 2Z3CA 4WH6A 1P10A 5CDFE 4ISIH 4I8KA 1DWEH 1HGTH 2QF0A 2ALVA 2DE8A 1GVZA 1K1PA 1Z6JH 3O8DA 2W5EA 1PFXC 1UTKA 1P12E 4YT7H 4BXWA 2ZFPH 4WJG2 1O30A 5A0BA 2GTBA 1O34A 2KZ4A 3ESTA 3O8BA 1MKXH 1SKYE 2EI8A 2ZP0H 2VWNA 1C2KA 1DUEA 1V2VT 3MO3A 2RG3A 3ITIA 4XBBA 4DW2U 1D3TB 4OGYA 5AHGH 3ZZ5A 1NN6A 5FPTA 1JIMA 3IG6B 1SGEE 1P09A 3UQOA 4TPIZ 4YLUA 2A5AA 1Y59T 1P3EA 1O3EA 2A4GA 1SL3A 4DCDA 1Y5BT 1J17T 1O2TA 2CMYA 1HJ8A 2Y7ZA 1O5GH 3A8AA 4XOJA 1IQNA 4H4FA 2UUFB 1KXEA 1KXCA 1H9LB 1GMCF 4YLQH 4RKOB 3QUMP 3UFAA 1TAWA 1ZHPA 3QO6A 1V2RT 3GY2A 2A7CA 2V6NA 3QTOH 4D7FA 5EQQA 1BTXA 2THFB 5JBBS 2H9EH 3K6ZA 3GDSA 3UY9A 1O3BA 4RT0A 3F1SB 3P92A 4OS5A 2P8OC 1T8NA 2A4QA 1AE8H 1GMCG 2XC4A 1LHFH 2W7SA 5ESTE 1G3EA 3PMBB 1HRTH 1L2EA 4K8BA 1GVLA 2ZO3H 3DHKH 3SJOA 3R3GB 3EA9A 1AO5A 5K7RA 3RXTA 2CGAA 1UK4A 3RXUA 5A8YA 3UB0A 4X8UH 4I8GA 2Z7FE 1B5GH 3KF2A 3U1IB 4CH8B 2ZG0H 2FPZA 4TY6A 3RM0H 1DFPA 1SGDE 4TSFD 2ZU4A 5JBTA 2ZDVH 2WUCA 1GI3A 1YGCH 1NO9H 4ABHA 3TK9A 1DPOA 1W0YH 1LKAA 1NFUA 4MVNA 1EJMA 1FAXA 1THSH 1LHCH 1GI5A 1O2QA 1XUGA 2NU3E 5HXFA 1G32B 1TQ7B 2KCOA 2OTVA 3ZVAA 1C2DA 1MU6B 3HGPA 1BDAA 5JBCS 1FIZA 1HAVA 3ZV8A 2BDYA 4GLYA 6ESTA 3DSPA 3SNCA 2H6MA 2W26A 2QY0B 1TNKA 1HFDA 1V2UT 5B6LA 4PROA 3LDXH 1C5MD 1GI9B 2UUKB 1C5LH 1ELCA 2IPQX 3H7TA 2ZGJA 2XWAA 1GHAF 1TPOA 1W0ZU 2F9UA 4AB9A 2FESH 2EC9H 2P3FH 4O9VA 4INHA 4AFZA 2AGEX 1GJ5H 1FY5A 2XBXA 4FXGH 1C1WH 4ZH8A 1JRSA 1NU7B 3JZ2B 3A87A 1RRKA 1HB0B 1SGCA 1UTJA 2ZWLH 6LPRA 4Q80A 4JYTA 1SBWA 2V3MA 1JBUH 2BZ6H 1GHAG 3SJKA 2P16A 1Y3VA 1BRBE 1CHOG 2FYRA 3F9EA 3KQDA 4YESB 4GSOA 2H5DA 3PTNA 4UFFH 2OP9A 5JPMH 2PSYA 3N7OA 1GL1A 1WV7H 1ESTA 1HAXB 3HK3B 4ESTE 3RLWH 5C0UA 1S83A 2SGFE 4AGKA 2CK3D 5CE1A 3P95A 2OCVB 5ESBA 1CGJE 2HLDD 1GBMA 5DP3A 1K1MA 3MI4A 3URCA 1YM0A 1AZ8A 2BVXH 1YCPM 1ZMLA 2AHME 3FANA 2XCFA 4NIVA 1O3DA 4UFEH 5LPEA 2NWNA 3SJ9A 1O3KA 5EOKA 2F9NA 2WPMS 4AORA 2WPDD 1YP9A 4B74A 3LC5A 1D6WA 1CGHA 2TGDA 1UVTH 1O2MA 4K1SA 3T26A 1K9OE 5HYOA 1GJ6A 1S81A 3RXKA 2JDID 1XMNB 1QB9A 4ZUHA 4B76A 2R0KA 2GZ8A 4YOJA 3VB5A 4D8NA 3FKSD 2BD4A 3SORA 3HPTB 3P6ZB 1O3AA 2Z94A 2OBQA 1MU8B 3GY8A 1Z7KA 2ZEBA 2GT8A 5DKMA 4GHTA 3SN8A 1HJAB 1VZQH 1ZGVA 4X8SH 3BG4C 1P2OA 3BTHE 1QB6A 5LPFA 2BOHB 3B23B 2VIVA 3OEHD 3RXJA 4CBOA 1RTKA 1EAUA 1PPCE 4RKJB 1Q3XA 1ZTLA 1VITG 2KCPA 2J92A 1O2VA 1TGSZ 1KLIH 3SNBA 4K1TA 5EG4A 3M5MA 5HIZA 5DP5A 3FZZA 3U8TH 1ANEA 1JWTA 2Q6GA 4FUFA 5FXLA 1LVYA 2GP9B 1SGIB 1ANBA 2F3CE 1W0JD 1QNJA 1V2TT 1MZAA 3RXAA 3L3TA 4FU7A 2FZZA 4KGAA 3SJIA 3OAAD 1GJDB 4JK5A 5J4SA 1O2HA 1ZMNA 2ZQ1A 3OE7D 1DS2E 1MAXA 3E91A 1C5UA 3K9XB 3TK6A 2W3IA 3GY7A 3AAVA 3I77A 2AIPA 3S9CA 1VKYA 1DXWA 3NZIA 2JH0D 3EAJA 1N8OB 4Y7BA 3A8BA 1ELFA 3STIA 3PM3A 1C1QA 1YWUA 3RU4T 2WZQA 4XD7D 2ZC9H 1J15A 1SG8B 4GCHF 1TA2A 3D62A 3BTFE 4LZ4B 3U1JB 1QL8A 1Y3UA 1DLEA 1K2I1 3SU3A 1CE5A 3F2GA 1EZSC 1VR1H 2BLVA 3RC5A 2LNCA 2HALA 4Q7ZA 3AVZA 2EA3A 4YTAA 1GBKA 4E7NA 3TIUA 5HM9A 1GI0A 2ZCHP 2HPQH 2YMSD 1E37B 1QA0A 4CHAB 4UD9H 4CRDA 2PR3A 4GCHG 5GCHF 5HIYA 5A8ZA 4J2YB 1D4PB 3CENA 3P8NA 2GD4B 1EQ9A 4R8TB 1BJVA 4A5TS 1CBWC 3PLBA 3FAOA 1HJAC 5G4BA 2C90B 3ZYDA 4CR5A 3D49H 2H5CA 1OWEA 5EQSA 1HLTH 4JYUH 1XUFA 3LGWA 5C0TA 5KECA 2WPLS 2VWMA 1Y3WA 2ANMH 2AS9A 1SHHB 4FU9A 2O8LA 2VIOA 5GCHG 1P2IA 1G37A 2BXUH 2HRVA 3A7ZA 4K60A 2GVFA 3UNQA 3RMMH 3RXEA 1P2NA 4IN2A 3RC4A 3GISB 3F9FA 6GCHF 4JZDH 4LZ1H 5EPYA 5TCAA 1MCVA 2JJ1D 2AMPA 2CHAB 5AFYH 4KP0A 4WXIA 5B6OA 2FX4A 1Y5UT 4TWWA 3DFJA 3MO9A 3RP2A 4P00A 1BTWA 2JETB 4X6PA 3OYPA 2D2DA 5SGAE 4MPXA 1NROH 3E0PB 1NM6A 6GCHG 1S0RA 2FOEA 1YPLH 3ELAH 4ZMAH 1AVWA 1GI2A 5A8XA 1O37A 1CSOE 3ZZAA 1OPHB 2NU2E 3LPRA 2OLGA 5HM2A 1DWBH 2V3HH 2FP7B 3RUOA 1UCYK 1EX3A 1GJ7B 1N8OC 3SV7A 3GY3A 3SQHE 4KELA 1BIOA 1KIGH 4HZHA 4IMZA 1HUTH 2ZDAH 3ZZ7A 2FYQA 3EGKH 3MWIU 2CV3A 5A0AE 5CHAC 1DY8A 2TGPZ 3PLPA 1BJUA 4ABEA 2WUBA 3MOCA 1M9UA 1QGFA 4H6TA 4IN1A 3S69A 1SPJA 1QL7A 3QX5H 2B0FA 3N7EA 4CHAC 2A31A 3ZV9A 1Z8IB 3SGQE 1GCDA 4MPWA 2BX4A 1ZHRA 2GZ7A 1ELEE 1YPEH 1YPKH 1KY9A 4TYDA 1D6RA 3SNEA 1ZOMA 2ODQA 4K1EA 3QN7A 1FPCH 3LH3A 1UHBA 5T6GA 1TPSA 4UE7H 1WYKA 1P9SA 4Y10E 3SHAH 5FX6A 3M5LA 3RMNH 1GBCA 5FL7D 1HYLA 4I8LA 1L1JA 2J95A 3M36A 2WHXA 1BTUA 1UTNA 2O8WA 1SB1H 1BRUP 4Q63A 1AWHB 1DWDH 1FY3A 2VJ1A 1QB1A 2ZPQA 2VVVA 2ZU2A 1EXFA 2FX6A 2OC1A 1LQDB 2O8TA 3AAUA 2TGTA 2HNTE 1QBOA 1OP8A 1C1TA 1Z1JA 1IQMA 4Y0YE 2BY7X 3A84A 1W11U 2JETC 4A7IB 1AB9B 1TRYA 1TONA 2Q6FA 2ZIQH 3GCOA 4CRBA 1ZR0A 4ABGA 4DJZB 3AW1A 2ZA5A 1QRXA 3BTEE 2P93A 4NFFA 1AIXH 1TMUH 2ANWA 1KXFA 2CF9H 2VVUA 3KQBA 3MO6A 5FCRA 4X8VH 5L2ZH 3HKJB 1J8AA 1DDJA 4ASHA 5KEDA 1BQYA 3ZVEA 2B5TB 1CA0C 2J9NA 4AG2A 4ISHH 4K3JA 2XC5A 1ZJKA 3SU4A 1O2UA 3SGAE 1OP0A 1FN6A 1RTFB 2G8TA 1MMJN 3PO1B 5JYIA 1SFIA 1V2QT 3KQ5A 1EAXA 1FN8A 4I33A 2VU8E 1DUAA 3NKKA 1XUKA 1ZSLA 1O2JA 5BPEA 4LXBH 1INCA 1UVSH 3M7TA 3PMAB 4FVBA 3BEUA 1UVUH 3PB1E 4D9RA 2CN0H 4AFSA 1O3HA 1EFRD 2PHBA 9ESTA 4GAWA 2WPJS 5E0JA 1D9IA 2A1DB 1ZYOA 3RXBA 1UCYE 5AF9H 4NCYA 2F9VA 4MPVA 2JH5D 3T25A 3IWMA 4YOIA 3F0PA 2BQ6B 1MD7A 2KR7A 1SGTA 1OYTH 1QJ1B 2VGCC 5T1VA 4DOQA 1BMLA 5GIBA 1MTUA 1TLDA 1O2YA 1OX1A 2VH6A 3BTTE 4NZLA 4XRNA 1OYQA 4CH2B 2FMJA 4Y8ZA 1NFXA 3ZZ4A 2JIZD 1SOZA 3FP6E 3JZ1B 1LQEA 1AFQB 3V13A 3UR6A 2VIQA 3GYMA 3GDVA 3Q3KA 1S84A 2VIPA 2W6ID 2XCNA 1SQRA 1T4UH 2G4UA 2FLBH 2KCYA 2HLCA 1T8MA 7KMEH 2XNDD 2ZFQH 4MNWA 1A1RA 3I29A 1FLEE 1TWXB 1AB9C 2Z9LA 3IITA 1LMWB 5C94A 2L74A 2VBCA 2HWLB 3MH4A 3TLOA 5TCCA 5FCKA 1WCZA 3RXSA 3E1XB 1Q31A 1VCWA 4CBNA 4X1PU 4WH8A 1HNEE 2QCYA 3PMJA 4Y6DA 4FUCA 1LHDH 1G30B 2EI6A 2TPIZ 1WSSH 4JZIA 1HAYB 4AG1A 1O5BB 1WQSA 3UREA 4AB8A 1HAVB 3KYFA 3LKWA 3PO1C 2V35A 4AC9A 4AZ2B 4GVUA 8LPRA 1O35A 1SC8U 3U9AH 1BITA 4NA9H 1P03A 1H1BA 1EPTA 1P11E 1QQ4A 1XVMA 1ELTA 1QBVH 1ZJDA 1C5YB 4IW4E 3F3BA 1TOMH 4F4OC 3RXGA 1VITH 4Y8YA 4NA7A 1TMBH 1TX6A 4Y7AA 2ESTE 1HBTH 3MMGA 1TRNA 4YXWD 4BNRA 1GJCB 3QGJA 2BD7A 4B2BA 1QJ6B 6CHAB 1U6QA 2BHGA 3TK5A 3RLYH 2AEIH 1KXBA 1C9PA 3O8RA 1K22H 1LPZB 3TJUA 1QCPA 1YPGH 1CA8B 2Z3EA 3W94A 2XXLA 3ATKA 4DT4A 3DUXH 5DP4A 2PW8H 3S7HB 1A3EH 1GHBG 2BD5A 4CRFA 3F6UH 4QT8C 4AOQA 1E38B 2Y6TA 5JDUB 3T62A 3A7TA 2Y5HA 3WWFA 4LK4A 1C1VH 1JIRA 4ABFA 1AFQC 2OBOA 1LPKB 1XKBC 2H9TH 2FDAA 1GG6C 1GHWH 1W7XH 2W6JD 4OS1A 2XC0A 4D76A 3M3TA 4IGDA 1PPBH 2QN5T 1C1MA 3Q3XA 3DSOA 4UONA 1IOEA 1FUJA 1JRTA 1XX9A 2G4TA 4OM9A 3ZZ6A 4ZKNU 2PUQH 3E8LA 4INKA 1O0DH 2BZAA 1O2PA 4LOYH 2PWXA 4DY7B 1CGIE 4YM9A 1EAIA 1YLDA 2F4LA 3B9FH 2ANKH 2D1JA 4FUGA 3QZRA 3SYJA 4Q7YA 1ANDA 1YF4A 2PSXA 4O3TA 4ABAA 1WXRA 2XBVA 3F0OA 3MQKC 5T6DA 2GV7A 3BTDE 3U8OH 1PQ7A 2BDGA 5EU8A 4ABJA 2ZFFH 1OSSA 1GDNA 2A45B 2R2WU 4B75A 1C1NA 3TNSA 2R0LA 4HI3A 4X2YA 2B7DH 1H8HD 2PKAA 4ZAEA 2YOLA 4FUBA 5A09A 3PMHB 1YYY1 4H6SB 2ZTZA 4ZXXH 1XUIA 2BDAA 3EYDA 2V3OH 1TPAE 4WY3A 2BDCA 1HJ9A 1BCUH 4X1SU 2VNTA 1WQVH 1K1JA 2ZZUH 2GCHF 4ISNA 6CHAC 4ABIA 5FBIA 1S6HA 3LU9B 3H09A 1QJ7B 4JYVH 5F8XA 3FZDA 1XKAC 5FBEA 3FVFB 4KTUA 3URDA 5E0HA 1H9HE 1QRZA 3HK6B 1CHOF 2J4IA 2B9LA 3FOAA 2GCHG 4X1RU 3BTKE 2QAAA 2A5IA 2P3UB 3Q77A 5DP7A 3T28A 4MLFB 3M3VA 3ATLA 3BG4B 4Y79A 1GBJA 1NFYA 3B8JA 1FI8A 1YY3A 2Q6DA 1GDQA 3GOVB 8ESTE 1KTTB 4X6NA 1G2MA 3UTUH 1GI6A 3WY8A 2OUAA 1A7SA 1AE5A 1YPHE 1TNLA 3MNSA 4R0IA 1P2QA 1W7GH 8GCHF 3A86A 4HG6A 3MU1A 3ZZ8A 4MDSA 1Z6EA 1S6FA 1YPHC 3BTME 1RS0A 4FU8A 1D3PB 3FFGA 1CT4E 3S9BA 4BTIB 1F5LA 1V2PT 5E8EH 2A32A 1E34B 1AHTH 2UWLA 3A83A 3A7XA 2VIDA 2LP6A 5E2OA 4AYYB 1GGDB 2ALPA 1K1LA 3NRLA 4UFDH 8GCHG 3SUGA 1FMGA 1E1QD 1V2NT 3OFND 4OGXA 3W1EA 1MBQA 2Z3DA 2NU4E 1C5WB 3A81A 1P04A 3LJOA 2QA9E 3PTBA 1C1SA 1C5SA 1CQQA 4U01A 4AX9H 4K8YA 2ZDLA 3OSYA 1OWJA 2PKSB 2G5VA 2HVXA 2QGRA 1DX5M 1O31A 3LGYA 1MAYA 1BHXB 3R0FA 5GXPA 5LH8A 2D26C 3FN8A 1S6LA 1GHXH 1G3CA 2QF5A 5EXLA 1UTQA 4NIWA 3BTQE 4E05H 3OTPA 1PYTC 2BD8A 5LPRA 4E06H 2FEQH 3SV8A 1O3JA 2F9BH 1VITF 2F9OA 1O3GA 1GBAA 1CBWB 2FM2A 4U30A 2RCEA 1C5ZB 1EB1H 1ELGA 4TT3D 1TALA 1YPJH 4OS2A 4E7RG 2VH0A 1UO6A 2G55A 3A80A 4FUIA 2AH4X 3BG8A 2V7QD 3LC3A 1V2KT 2O9QA 1DICA 3C27B 1PPEE 2KCAA 1YBWA 1IAUA 3SZNA 1TE0A 1MTSA 2QXHA 1W12U 4NIYA 1K1OA 1GMDG 4WWYA 3ZZDA 3SGBE 1SVPA 5DSFA 1OHHD 2OD3B 4NSVA 5C17A 1BBRK 1SLWB 4SGBE 1BTPA 2CF8H 3QWCH 4XBCA 1A0JA 2ANYA 5I46H 2ZHDA 2BVRH 4WXVA 1ID5H 2HGTH 1RFNA 1FZZA 4ACBA 4DURA 1SGFG 2AMDA 1GBDA 4J1YA 2Z9JA 3SO3A 1W3CA 1GGDC 7GCHG 3SV6A 1TGBA 3DCLA 3O8CA 1QY6A 2V0BA 2C93B 3PRDA 1C1OA 4IC5A 3T27A 3TGIE 1K1IA 1P2MA 1L4DA 1PJPA 2GV6A 3PYHA 2EY4C 1LPGB 4X8TH 8KME2 1N6XA 1IHTH 3G01A 2BQ7B 1P06A 2OXSA 2PKSC 1E1RD 5CHAB 5C1XA 3NPSA 1F0UA 1P02A 5C1UA 5IDKA 4Q4LA 3DA9B 4JCNA 1UW7A 1UHBB 3TGKE 5DP9A 3VPKA 1NTPA 2F83A 1A61H 2BLQA 3DSGA 1MTVA 3QK1A 2G81E 1QIXB 3EA8A 4KKDA 4WVPE 2GMTC 1O2ZA 2FO9A 4K69A 1B0EA 1NBME 4A1XA 2FOAA 1ZZZA 2PLXA 3RC6A 3ZVDA 1HAPH 1QURH 1O2SA 4X0WU 2VWLA 4Y8XA 4BTTB 3OTJE 4TWYA 3MU4A 3RXHA 1ZRBA 1L1NA 1TPPA 3BTGE 2SGAA 2FWWA 3KN2A 1AVXA 2GX4A 3E90B 2FXRA 1CHGA 1MH0A 5GJ4B 1A5HA 2WPIS 1J9CH 5GNDA 1A46H 2FOGA 3ZZ3A 4ZCNA 3RXMA 2G51A 3EDXB 1C5VA 1L4ZA 3V12A 1P2KA 3FP8E 5T6FA 3TU7H 1SGYE 5EGMA 2ZCLP 5I25A 3QLPH 1THRH 4THNH 4IBLH 3MU8A 4MNYA 3ZIAD 1WUNH 4OS6A 2QIQA 5T3HA 3S9AA 4O97A 2FOMB 1OS8A 1GI4A 3ATMA 3RXLA 1OWIA 2QXGA 2ZFRH 1FPHH 1O3OA 2ZPRA 3K2UA 1FX0B 1BRCE 2OC0A 2SGEE 4B6EA 3LOXA 1GBFA 1EASA 2BY8X 1Q2WA 3VXEH 1TABE 1LDTT 1DOJA 1CA0B 3RXDA 3A82A 1BBRE 5GWZA 1AI8H 3E6PH 1UK3A 2VVCA 4WF8A 1LCYA 3ENSB 1T8LA 2P3TB 3STJA 2FODA 1C1PA 3MTYA 1DSTA 5EJZA 1MTNC 1IQLA 4A92A 3UUZA 1O3MA 3KNXA 5EW2H 3SHCH 1TMTH 3MU0A 2M5TA 1O3IA 2QF3A 3E3TA 1KXDA 1ABIH 1OKXA 2IJD1 2K1QA 1YLCA 1T8OA 1ELAA 1FV9A 1AKSB 3Q3YA 4SGAE 1JMOH 2C8ZB 2VWOA 2GDDA 1YCPK 1C2EA 4FETA 3RXOA 2VGCB 2XOKD 1WDIA 1HAZB 1MQ5A 1SQOA 5DP8A 1FDPA 3H5CB 3NUMA 1GI1A 3ODFA 4I7YH 3GY6A 3L33A 4X1NU 1AZZA 1GHYH 3ATIA 1AFEH 5DJ7A 4BTUB 1C2LA 5JB9S 2Z9GA 2AIQA 1BTHH 3NWUA 1KDQB 1MKWK 3UQVA 4OS7A 2XBYA 2XNIA 3ZYEA 2J98A 1GJBB 1JOUB 3VGCB 3TITA 3GY4A 4HGCA 3AK5A 1A2CH 3RXRA 3UOUA 4A1TA 3U8RH 2WV4A 1SMFE 1PPGE 3TJNA 2Z9KA 2F9PA 3NXPA 2IPHA 5L6NH 3T2NA 4DT7B 2FOHA 1AWFH 3SNAA 1RXPA 2XRCA 4NGAH 2IOTA 5C2ZA 4DG4A 1SOTA 3MFJA 2GT7A 4U32A 3SU1A 1TGTA 1T31A 1WTHD 1Y3XA 4BANB 3TNTA 1QA7A 3K6YA 2FS8A 3PWCA 4X1QU 1P01A 2PTNA 2YNAA 1BRAA 2H2ZA 2QC2A 3H7OA 1ORFA 1SLVB 1GBIA 3TJVA 1F5RA 1HDTH 2D8WA 2UWPA 1MD8A 2A5KA 1MKXK 3ZZCA 4FUHA 4ZROA 1C5TA 2ZI2H 3TH3H 1T32A 4I31A 4AN7A 2ZTYA 2XWBI 1TQ0B 1ZPCA 1TNIA 1E36B 3EA7A 1NT1A 2ZTXA 1IQKA 1HAOH 3V3MA 1C2FA 3SOSA 5L2YH
chains in the Genus database with same CATH topology
3M7UA 1FY8E 4BAOB 3MYWA 4BAQB 1RD3B 3F9GA 1AY6H 5IYTA 1ZPZA 1O38A 2BYAX 2P95A 3KL6A 2XBWA 1IHSH 2ZECA 2BD3A 4O3UA 1UCYH 2ZU1A 3E16B 4ISLA 3GCTG 4X2WA 2ODPA 2KAIA 1GI8B 4H42U 1KYNA 1S5SA 1NESE 2ILNA 1DM4B 2W3KA 1BZXE 1GG6B 5DP6A 1T7CA 4B73A 3V7TA 3VGCC 4Y0ZE 1O3LA 5HGGA 2Y5FA 1O5AB 3LONA 2ZNKH 4XE4A 1LHEH 1O2XA 3K65B 3NK8A 2H9HA 3LGVA 1HIAA 1Z1IA 2OINA 2Y5GA 3VB6A 4BAKB 3TJOA 2PKAB 1TGNA 1J16A 4JMYA 1NRNH 1H8IH 2ZU3A 3CP7A 1SLUB 3M5OA 5GDSH 1EPTC 3ZZ9A 1G2LA 3A8DA 1ACBE 4WMEA 3SNDA 1GBHA 4CRCA 2ZCKP 1BMMH 2Z6BD 4Z6AH 3S7KB 5F8TA 3SUDA 5AVDA 3UOPA 1DSUA 1O32A 1SR5C 1HPGA 1IQHA 5FX5A 1ARCA 3SJ8A 1Z8RA 2ZGCA 4A6LA 1RIWB 1N6YA 1S0QA 1A5IA 2NU0E 3T29A 4OS4A 1GHBF 3F9HA 5CMXH 4DVAU 4B2AA 4K5ZA 1V2JT 4XBDA 1XM1A 4NWLA 5E2PA 4HFPB 1UTOA 1NY22 2OC7A 4XFQA 1OWKA 1AMHA 2BTCE 1A0HB 1GHVH 1EKBB 1LKBA 1Z8GA 2SGQE 2IN2A 1CT2E 1O2LA 2BOKA 2FOBA 3EE0B 2BVSH 4ZXYH 3ZVCA 2UUYA 1GCTC 2R2MB 2WYJA 1GHZA 4YZUA 2STBE 3A7WA 2VINA 2A7JA 2GCTC 1GPZA 2ZDNA 1DLKB 4X2XA 1BTYA 4NFEA 1YKTA 4ISOA 1LO6A 2BDIA 1P8VC 1TB6H 4D7GA 1KTSB 1EUFA 2LPRA 4TY7A 2J2UA 5FAHA 2FS9A 1HXEH 2ZGBH 1GJAB 1NRRH 2Y80A 4ZKRU 2VIWA 1THPB 2HPPH 5C20A 3A7YA 1F0SA 1D3QB 1AQ7A 1GJ8B 5FHTA 5TJXA 5GPIB 3SI3H 3MH6A 4I32A 3SV2H 1F0TA 1QRWA 1SGFA 1OWDA 5FPSA 3KGPA 2QXJA 3OY6U 4B1TA 3M35A 4VGCC 5ETXA 1IQGA 1C5RA 1C4V2 1VJAU 2HNTF 2QV1A 4X2VA 4CRAA 4FUEA 5AFZH 1SQTA 2BLWA 1TBQH 1K1NA 1FAKH 3BTWE 1PQ5A 1RIWC 3UWIA 2G00A 1J14A 1AU8A 3MNCA 5EW1H 2JKHA 3PWBA 1O2RA 3LIWA 2WYGA 2WPKS 5EXNA 2VB0A 3KIDU 2PV9B 4AGJA 1K21H 1KLTA 1BA8B 1RGQA 1TFXA 1SQAA 4D9QA 1C5XB 1PPFE 4MQAA 3RU4E 1SGNE 1Y8TA 1V2MT 1TIOA 2AERH 4ZHMU 4DGJA 3RU4D 3MNXA 1IQFA 3RXFA 1TA6A 4NSYA 3RXPA 5C5NA 1HXFH 2GGVB 4X6OA 2SGDE 5A2MH 3DT0H 4JZEH 3QTVH 4B71A 1NRPH 1W8BH 5DGJA 2ZHQH 4I8HA 4F49A 1O5CB 3CS7A 1ZRKA 2A4RA 3SQEE 4XDEA 1EAWA 3Q00A 3SU5A 1DXPA 2JH6D 1Z71A 1C9TA 5EXMA 2B8OH 3GY5A 1MZDA 3E0NB 3KHVA 5A0CA 2Y82A 1O2KA 1A3BH 1UJ1A 3SW2B 4CRGA 1C4Y2 1V3XA 1AVGH 2CJIA 1AD8H 3RXQA 1V2WT 1NC6A 2FTLE 3UNRA 3RXCA 2J38A 1QL9A 1RTLA 5PTPA 1L0ZA 3M3SA 1UTPA 1O3FA 1MTWA 1O3NA 1C5QA 1D3DB 1C2JA 1S82A 4BAMB 5K0HA 2ZQ2A 1EJAA 1ZHMA 3SI4H 5ABWA 2GDEH 3D65E 2UUJB 2ZGHA 1O36A 1IQIA 5DPAA 2TIOA 3LT3A 2FI4E 1PQAA 2WINI 1HV7A 1ETSH 1OP2A 1JXPA 4Z0KA 1A0LA 2C4FH 1LVMA 1SI5H 1LTOA 3SU2A 1FY1A 1O5FH 4MPUA 3UPEA 1P05A 3MNBA 3ODDA 2O8UA 4FUJA 3TGJE 1HAHH 3RMOH 2BD9A 1BOQA 3P8FA 4X6MA 1PYTD 3M7QA 1HAIH 2OQ5A 1B7XB 1O3CA 3VEQB 1A5GH 1ZGIA 1ANCA 1QBNA 2GMTB 3CS0A 1KLJH 1GL0E 3L6PA 1GMDF 1OOKB 2PGQB 3M37A 2A7HA 1WBGB 1P0SH 3BSQA 1CVWH 1EZQA 3HGNA 3KCGH 2ZHWH 3TVJB 1BMAA 3A85A 2IJOB 2ZDMA 3QGNB 1SHYA 2FIRH 1NU9A 3TPIZ 2Y81A 2A4OA 3F68H 5FPYA 1YPMH 4NA8A 1O2WA 2FI5E 1O33A 4UFGH 9LPRA 2FOCA 3OU0A 3QDZB 7GCHF 1EOJA 1HAGE 3BEIB 1P3CA 1TX7A 1WTGH 1TX8A 1H9IE 3T5FH 1HCGA 4WMFA 1C5NH 3KQCA 3M5NA 3GCHB 1DWCH 4A1VA 7LPRA 2BY5X 2ZFSA 1Y3YA 2WV5A 1L1GA 3BN9A 3PROA 4GPGA 2BLOA 4ZKSU 3EQ0H 4NG9H 5DG6A 1K28D 1ELVA 2ASUB 2BB4A 3U69H 1UTMA 2DE9A 1C1RA 1Z8JB 2DUCA 1VJ9U 3UNSA 2I6QA 3A88A 4Q2KA 1SLXB 3NCLA 1IQJA 2TGAA 4Y76A 3GICB 5HMAA 1KSNA 1TNGA 1GJ4H 3RDZA 1FIWA 3SBKA 4ZHLU 2EEKA 1MTNB 1GVKB 4Q7XA 5DK1A 3DFLA 1GBLA 2P59A 2A2QH 2AMQA 1A4WH 1BUIA 2Z9IA 2TRMA 4MG3A 1NRQH 2C8XB 3GDUA 4KTSA 1EOLA 1BTZA 2AGGX 4TPYA 1GMHF 3TH4H 2R9PA 3A89A 1TNJA 2FTMA 2SNVA 2XTTB 4ZHAA 5C67A 3KEEA 2ZPSA 4AFUA 1ZLRA 1AUJA 2PUXB 2OQUA 3BF6H 4BAHB 2FI3E 2ZDKA 3VB3A 1E0FD 1QFKH 1FY4A 3GYLB 3P8GA 3P8OA 1G9IE 1GMHG 4I8JA 4O03A 1B0FA 2ZF0H 4JZFH 1C2GA 2G5NA 1ESBA 3RXVA 3MH5A 1WU1A 2TBSA 3GCNA 2ZHEH 3LH1A 4RN6A 3VFEA 2RDLA 1UVPA 3QZQA 2BDHA 1G3BA 3GCHC 1C2IA 1W14U 1F7ZA 2BDBA 1DITH 1YC0A 1C1UH 2BQWB 3SUFA 2ZKSA 2AYWA 4NZQA 2BMGB 2BXTH 3A8CA 4Y71A 3UWJH 4UEHH 1MQ6A 3MU5A 2XW9A 3C1KA 1XVOA 5EQRA 1TBZH 1C2MA 1UMAH 2ZGXH 3BV9B 3LGIA 1W2KH 2Y7XA 1S85A 2ULLA 3ZZBA 1EP5A 2J34A 1WAYB 4YOGA 1O5DH 1RJXB 5J4QA 3UIRA 4MNVA 1V2ST 4GUXA 1BBRH 1FJSA 1SSXA 4FUDA 5DO4H 2SFAA 1QTFA 1X7AC 1EATA 3BIUH 1LVBA 1ZMJA 1VGCB 1EZXC 1TBRH 2KAIB 1TOCB 1O2GH 1ABJH 1XXFA 7ESTE 2G52A 2SGPE 1ZTKA 3ATWA 1TYNA 2I6SA 2NU1E 2STAE 5C1YA 2RA0A 2HOBA 3SU6A 4FVDA 3FP7E 4YT6H 3RM2H 2R3YA 3LGUA 1XXDA 1C5PA 1DE7H 1H8DH 1FNIA 2AFQB 4ABDA 1PPZA 1LVOA 2EI7A 3PV4A 4INLA 4IS5A 3ZVFA 1HIAB 4CR9A 4B2CA 1FXYA 2PFEA 2FLRH 3RMLH 1T4VH 1PPHE 3V0XA 1ZTJA 4GHQA 4Y11E 3PLKA 1NPMA 1CT0E 5L30H 4DIHH 2SNWA 2ODYB 4NWKA 1LHGH 3I78A 3AASA 4KTCA 5C3NA 2QXIA 4HTCH 4M7GA 1E35B 1N1LA 1VCPA 2ZHFH 1ETRH 5F03A 1O39A 2PGBB 4BOHA 5C5OA 3P70B 2CHAC 3LGTA 4ZKOU 1W10U 1IQEA 1ARBA 1CO7E 2ZFTA 5H4IB 1EPTB 3VXFH 5JB8S 1GDUA 2BX3A 1ELBA 1H4WA 3VB4A 2HNTC 4AYVB 1VCQA 1BT7A 5E0GA 3LJJA 3ZVBA 2A2XH 4XSKU 4IC6A 5F8ZA 3DD2H 2H1UA 3UR9A 1GI7B 1ETTH 2F91A 2P94A 2J94A 3SU0A 1O2OA 3MH7A 4NIXA 3A7VA 4MTBA 1QQUA 2RA3A 1ZSJA 1CU1A 2BM2A 1G36A 2C8YB 1NFWA 3D23A 4BXSA 1VGCC 3GCTF 1TGCA 1AUTC 2BD2A 1FQ3A 1EJNA 3ZVGA 1ELDE 5JBAS 1BB0B 4JK6A 4RSPA 1DVAH 1P9UA 1F5KU 1UTLM 1GWAA 1AN1E 2QYIA 3MHWU 1QR3E 5LGOA 1G3DA 4MNXA 1BHXF 1ZPBA 1V6DA 2XYAA 2UWOA 1EZUC 3HKIB 2GKVE 3SUEA 3TH2H 2OC8A 3OX7U 1ZSKA 1GCTB 1SFQB 3RXIA 2ZU5A 2AGIX 1TNHA 2Q1JA 4AFQA 1F0RA 4K2YA 3HATH 1QHRB 2GCTB 2CXVA 1XUHA 3M61U 1NS3A 2GZ9A 1C2HA 2FOFA 1UVOA 1OWHA 2BY9X 4IMQA 1ESAA 5EODA 1GJ9B 1DY9A 2W7UA 3Q76A 1F92A 2WPHS 2YNBA 1AKSA 4ABBA 4YO9A 5BRRE 1MUEB 1TRMA 1OXGA 1GBBA 3AW0A 1GBTA 2BY6X 1BMNH 1PQ8A 1WOFA 1YCPH 2R3UA 3KQEA 3P17H 1NZQH 1O2IA 1GBEA 2O8MA 1DT2A 1EB2A 3U98H 2C3SA 4VGCB 1KXAA 4DIIH 4JZ1A 4CREA 1O5EH 1F2SE 1Y5AT 3VB7A 2P8OB 1W13U 1C5OH 1MCTA 1DANH 1KDQA 1UK2A 1C4U2 2PTCE 1SGRE 1SGPE 3SV9A 3BIVH 1MKWH 1AGJA 1NRSH 4UDWH 1P2JA 1EP6A 1FONA 3OY5U 1O3PB 1P57B 2C8WB 4WMDA 5EPNA 1XUJA 3BEFB 1MBMA 3W95A 3S0NA 1V2LT 1V2OT 4U2WA 5F6MA 1O2NA 2A0QB 1SGQE 2Z3CA 4WH6A 1P10A 4ISIH 4I8KA 1DWEH 1HGTH 2QF0A 2ALVA 2DE8A 1GVZA 1K1PA 1Z6JH 3O8DA 2W5EA 1PFXC 1UTKA 1P12E 4YT7H 4BXWA 2ZFPH 4WJG2 1O30A 5A0BA 2GTBA 1O34A 3ESTA 3O8BA 1MKXH 2EI8A 2ZP0H 2VWNA 1C2KA 1DUEA 1V2VT 3MO3A 2RG3A 3ITIA 4XBBA 4DW2U 1D3TB 4OGYA 5AHGH 3ZZ5A 1NN6A 5FPTA 1JIMA 3IG6B 1SGEE 1P09A 3UQOA 4TPIZ 4YLUA 2A5AA 1Y59T 1P3EA 1O3EA 2A4GA 1SL3A 4DCDA 1Y5BT 1J17T 1O2TA 2CMYA 1HJ8A 2Y7ZA 1O5GH 3A8AA 4XOJA 1IQNA 4H4FA 2UUFB 1KXEA 1KXCA 1H9LB 1GMCF 4YLQH 4RKOB 3QUMP 3UFAA 1TAWA 1ZHPA 3QO6A 1V2RT 3GY2A 2A7CA 2V6NA 3QTOH 4D7FA 5EQQA 1BTXA 2THFB 5JBBS 2H9EH 3K6ZA 3GDSA 3UY9A 1O3BA 3F1SB 3P92A 4OS5A 2P8OC 1T8NA 2A4QA 1AE8H 1GMCG 2XC4A 1LHFH 2W7SA 5ESTE 1G3EA 3PMBB 1HRTH 1L2EA 4K8BA 1GVLA 2ZO3H 3DHKH 3SJOA 3R3GB 3EA9A 1AO5A 5K7RA 3RXTA 2CGAA 1UK4A 3RXUA 5A8YA 4X8UH 4I8GA 2Z7FE 1B5GH 3KF2A 3U1IB 4CH8B 2ZG0H 2FPZA 4TY6A 3RM0H 1DFPA 1SGDE 2ZU4A 5JBTA 2ZDVH 2WUCA 1GI3A 1YGCH 1NO9H 4ABHA 3TK9A 1DPOA 1W0YH 1LKAA 1NFUA 4MVNA 1EJMA 1FAXA 1THSH 1LHCH 1GI5A 1O2QA 1XUGA 2NU3E 5HXFA 1G32B 1TQ7B 2OTVA 3ZVAA 1C2DA 1MU6B 3HGPA 1BDAA 5JBCS 1FIZA 1HAVA 3ZV8A 2BDYA 4GLYA 6ESTA 3SNCA 2H6MA 2W26A 2QY0B 1TNKA 1HFDA 1V2UT 4PROA 3LDXH 1C5MD 1GI9B 2UUKB 1C5LH 1ELCA 3H7TA 2ZGJA 2XWAA 1GHAF 1TPOA 1W0ZU 2F9UA 4AB9A 2FESH 2EC9H 2P3FH 4O9VA 4INHA 4AFZA 2AGEX 1GJ5H 1FY5A 2XBXA 4FXGH 1C1WH 4ZH8A 1JRSA 1NU7B 3JZ2B 3A87A 1RRKA 1HB0B 1SGCA 1UTJA 2ZWLH 6LPRA 4Q80A 4JYTA 1SBWA 1JBUH 2BZ6H 1GHAG 3SJKA 2P16A 1Y3VA 1BRBE 1CHOG 2FYRA 3F9EA 3KQDA 4YESB 4GSOA 2H5DA 3PTNA 4UFFH 2OP9A 5JPMH 2PSYA 3N7OA 1GL1A 1WV7H 1ESTA 1HAXB 3HK3B 4ESTE 3RLWH 1S83A 2SGFE 4AGKA 5CE1A 3P95A 2OCVB 5ESBA 1CGJE 1GBMA 5DP3A 1K1MA 3MI4A 3URCA 1YM0A 1AZ8A 2BVXH 1YCPM 1ZMLA 3FANA 2XCFA 4NIVA 1O3DA 4UFEH 5LPEA 2NWNA 3SJ9A 1O3KA 5EOKA 2F9NA 2WPMS 4AORA 1YP9A 4B74A 3LC5A 1D6WA 1CGHA 2TGDA 1UVTH 1O2MA 4K1SA 3T26A 1K9OE 5HYOA 1GJ6A 1S81A 3RXKA 1XMNB 1QB9A 4ZUHA 4B76A 2R0KA 2GZ8A 4YOJA 3VB5A 4D8NA 2BD4A 3SORA 3HPTB 3P6ZB 1O3AA 2Z94A 2OBQA 1MU8B 3GY8A 1Z7KA 2ZEBA 2GT8A 5DKMA 4GHTA 3SN8A 1HJAB 1VZQH 1ZGVA 4X8SH 3BG4C 1P2OA 3BTHE 1QB6A 5LPFA 2BOHB 3B23B 2VIVA 3RXJA 4CBOA 1RTKA 1EAUA 1PPCE