2QXIA

High resolution structure of human kallikrein 7 in complex with suc-ala-ala-pro-phe-chloromethylketone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Kallikrein-7
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA02
4U32A 3D62A 2FDAA 3KQBA 3A7WA 5L2ZH 5JDUB 1V2PT 4X1QU 3URCA 5GDSH 2ANKH 1VCWA 3DUXH 2VIQA 4Q7ZA 1OKXA 2R0KA 1TB6H 1ID5H 1FIWA 3A89A 1GDUA 2C8ZB 3U1IB 2FXRA 5EPNA 1C2GA 5DG6A 3PMAB 1D3QB 4E06H 1QB6A 3GDUA 1QFKH 3H7OA 3M5MA 3LJJA 4DW2U 4GHQA 1EAWA 2VIPA 1G30B 3M3SA 2Z9KA 1ZZZA 1UTKA 1QHRB 1TNJA 1Y3XA 2AMQA 1NTPA 3QLPH 1YPGH 4LXBH 4BOHA 1HJ8A 2QGRA 1EZXC 2G5VA 2W5EA 1FI8A 1GMCF 2R2MB 1BHXF 2OXSA 1Z1JA 2OD3B 3ZZCA 3L6PA 1O2ZA 1T32A 4VGCC 5JB9S 4ZHMU 2IOTA 7GCHG 4JZEH 2EI6A 2ZDLA 1C5SA 3A88A 3BG4C 3UOUA 1O3KA 5F03A 3RXBA 1QCPA 2EI8A 3M36A 2FS8A 2HVXA 1GHBG 1YGCH 2B9LA 4GSOA 8KME2 5I46H 4DJZB 3CS7A 1ZSLA 2XRCA 3TU7H 1UMAH 6CHAC 2UUFB 1K21H 4A1XA 2ZA5A 1AUJA 9LPRA 1AKSB 1QB1A 1EX3A 1KXDA 1PPCE 4GAWA 3OY5U 3MU4A 5GCHF 3S9CA 1QJ7B 5E2PA 8ESTE 2ZP0H 5C1XA 2A7HA 2XC0A 4AZ2B 4INHA 1C5MD 2ZC9H 1JXPA 1HBTH 3H7TA 2H5CA 3SNAA 1ELDE 1V2JT 3FZDA 3TJNA 1C5QA 1DOJA 1ELEE 1UVOA 2PGBB 4R8TB 1NROH 4A7IB 1RS0A 1Z1IA 1G3EA 1G2LA 1DSUA 2A4RA 3Q3YA 1V2RT 2ZGCA 1XUHA 1LHCH 3P6ZB 1A0JA 2BQ6B 3NZIA 2OC1A 3GCTF 5EXNA 3A87A 4IGDA 3RXEA 2PGQB 3QN7A 1M9UA 1MKWH 5E8EH 4GPGA 3PMHB 1KDQB 1KLJH 1CQQA 1C9TA 4ZHAA 3GDVA 4X8SH 3RXGA 2G8TA 3A7TA 2VVVA 1O5EH 4X6MA 1C5VA 2WYJA 2ZGHA 1LVOA 1C5TA 3FAOA 1GI1A 1AN1E 5GIBA 1NPMA 1Z8IB 1HAZB 1LKBA 4LZ4B 1SGFG 1RTKA 2AS9A 2CXVA 1TGCA 1F0SA 2ZQ2A 3TPIZ 4X6OA 3VGCB 2ZGBH 2BOHB 3UQVA 3H5CB 3AAVA 1GBFA 2WYGA 5A8XA 1CU1A 1GBKA 4GHTA 1DXWA 1GCTC 1W13U 1C2EA 1EQ9A 2OCVB 1KXBA 1O5BB 3U1JB 4YOIA 4WY3A 4MPXA 2DE9A 1DWEH 1GI5A 1V2MT 4AORA 5FAHA 1BJVA 1AB9C 4U01A 3UWJH 2FOMB 1IQIA 3NPSA 5AFYH 1GI0A 2O9QA 1A2CH 1FY8E 1SGCA 1T7CA 2PKSB 2BLVA 5C3NA 1V2NT 4ISLA 2A1DB 3MU8A 4X8TH 1LKAA 3TJUA 4NWLA 3URDA 2XWAA 1BDAA 3LJOA 1J14A 1W12U 2RA0A 4Y11E 1A7SA 1JWTA 1GWAA 5C20A 2A5AA 3MYWA 1EZQA 1T8OA 1FXYA 1P10A 1VCQA 4MLFB 3MH7A 2BD8A 1BQYA 1SMFE 2ODPA 3E91A 4BANB 1SLWB 3DA9B 1FONA 3SUDA 2QV1A 3M7TA 1Z6JH 3PTBA 4X8UH 1ZTLA 2Y6TA 3KQCA 2H9EH 2BYAX 1YBWA 2XCFA 1KTSB 4WMEA 2ASUB 4K2YA 2D1JA 2QF0A 1ZJDA 4RSPA 3SORA 3ZZ3A 1A1RA 5I25A 1WU1A 3FANA 2I6QA 4DT7B 1ELBA 2WPMS 3A7ZA 4J1YA 1ZRBA 1N6YA 1FY5A 1GI3A 2ALPA 4FUBA 4B1TA 4D7GA 2AGGX 1SGPE 5A8YA 4YLUA 3RXUA 2C3SA 1QGFA 5F8XA 1LMWB 1L1JA 2C90B 2PKAA 7GCHF 1O2GH 3GCTG 5A0AE 1W8BH 2UUKB 4ZKSU 3CP7A 1VGCB 1XUIA 2STBE 4FUHA 2QAAA 1MZAA 3RXTA 1C1VH 3A8BA 1HRTH 1BMMH 4K69A 4X0WU 3KF2A 2GCTC 1NU9A 2ZFRH 5A2MH 4IW4E 3D49H 4CR9A 3A85A 1S85A 1GI6A 1GCDA 1TPOA 3RM2H 1OP2A 2XBWA 2ZU3A 4NIWA 3F6UH 4UFDH 1CA8B 1L1NA 3JZ2B 1EATA 1QJ1B 4NWKA 1NFXA 1O2XA 4NZQA 3MMGA 1V3XA 1ZTJA 4KELA 4YM9A 2FX6A 1FMGA 1K9OE 1O31A 1AVGH 2FI5E 4KGAA 1ACBE 4Y79A 1SGRE 1EP6A 2BXTH 1O5DH 1Z8GA 2F9PA 3S7HB 1LCYA 1Y8TA 4JZFH 2OQ5A 4TPYA 1L2EA 1QQUA 1O3EA 1O3IA 1SHHB 1SHYA 2Z9GA 3GY6A 1O3MA 1P04A 1QRXA 3SJ9A 3RXFA 1QB9A 1WBGB 4GLYA 1XUGA 2RCEA 1GHXH 2JH5D 1DS2E 1KXEA 4JMYA 2XC5A 3RXPA 2FOCA 3KL6A 2ZHWH 1IQFA 1C1MA 4AYVB 1G36A 4B2AA 1MU6B 3LGWA 1HCGA 1RFNA 1TAWA 1O2PA 2PV9B 1LQDB 4IMQA 1HIAA 2PTCE 3P17H 2XBYA 1Q3XA 1Y5BT 1MMJN 1O2HA 1BTWA 1AFQC 2ANWA 1O2VA 3S9AA 3PMJA 1A46H 1GVLA 3ZZ7A 1KLIH 1BIOA 1OP0A 1F92A 1AUTC 1HNEE 2FTLE 1THSH 4NZLA 4ZXXH 1HFDA 3ATWA 2FI3E 1W3CA 3FP7E 3PROA 1MU8B 1GHAF 1ESBA 1A5HA 4FU7A 3TNTA 2SGAA 1O5GH 4THNH 2B8OH 2J92A 1HDTH 3ZVEA 2IPHA 1MKXH 1DUAA 1BUIA 5E2OA 4JZ1A 2UWLA 2J38A 2F3CE 1V2VT 3BN9A 1BT7A 1GBMA 1AGJA 1OSSA 1FQ3A 4MPUA 5AFZH 1U6QA 1DXPA 4CH8B 1GBBA 1ANCA 4BTIB 1C1NA 1PQ8A 1HV7A 2G51A 1JIRA 3MWIU 3UTUH 1ESTA 1S6HA 2BZ6H 3SV2H 1SGEE 2NU2E 3ZYDA 1ZHRA 1CO7E 3BTFE 3MH4A 2H9TH 1QL8A 1UK3A 1XUKA 1HAPH 3V7TA 1D4PB 2SGPE 1P3EA 4HGCA 1BMLA 1KYNA 1S0RA 2D8WA 2FOHA 2Y81A 2H5DA 2H2ZA 3LH3A 4AGKA 4FU9A 1DM4B 2CF8H 3T62A 6ESTA 1P2IA 4D7FA 3U69H 1QIXB 1GHZA 3PWCA 4Y0ZE 2AIQA 1PYTD 1PFXC 1PPHE 2HGTH 1G3DA 1LTOA 1PPZA 4K1EA 4ABEA 1BTUA 4BAKB 1GBTA 3VB7A 4BXSA 3MHWU 3TK9A 1TMUH 3V0XA 4A5TS 1C1TA 1T31A 2KAIB 2ZI2H 1MTSA 4K5ZA 2G4UA 3EQ0H 1Z8RA 4ABBA 2B7DH 1GVKB 1O2YA 3BEIB 1PPEE 2GZ8A 2UWOA 2ZEBA 2ZFTA 3SU0A 3RC4A 1FDPA 3LC5A 3MH5A 5L2YH 1QNJA 3ATLA 1SGNE 2QXGA 3RXLA 1E36B 1GJAB 1K1JA 3LU9B 1WOFA 2A5IA 3BIVH 3EAJA 2SNVA 1ELGA 4Q80A 1MTWA 1KIGH 5HXFA 2VH6A 3M3VA 1LVYA 1FY4A 1O0DH 2FOAA 1K1MA 1KXCA 3RLYH 3RMNH 1O3CA 1OWEA 1SLUB 1BBRE 2XTTB 1S84A 3M5NA 1EASA 4VGCB 3VFEA 3E8LA 4I8KA 2Z9JA 3P8FA 1K1OA 3KNXA 1AI8H 1LVMA 1KXFA 2Z3EA 1ZLRA 4B74A 1S82A 2AERH 1MAYA 2CN0H 2ZCKP 3SGQE 4Y76A 4FUDA 2GKVE 4I32A 1C1WH 1GHAG 4NSYA 1DVAH 4WWYA 3M61U 5DP9A 3A8DA 3P8OA 1P05A 5GWZA 1KSNA 4XDEA 2CHAC 1C2DA 1UTPA 5T6DA 1W7XH 1ZSJA 3T5FH 1OWJA 2AFQB 2ZDVH 5T6FA 3E0PB 4Z6AH 2ZO3H 4X2YA 4YLQH 1LVBA 2YOLA 4FXGH 1A0HB 2VIDA 4DGJA 2ZTZA 2XBXA 1C2IA 4NFFA 3C1KA 1KY9A 2XW9A 4INKA 2GCHF 3LGUA 1D9IA 2AIPA 3A8AA 4BAHB 2ZWLH 2BDYA 1T4VH 3SUGA 4BAOB 2OBOA 3RXQA 2VIWA 2NU3E 1JBUH 3AAUA 1IQMA 5DP5A 2PUQH 5JBTA 3TJOA 5LPFA 1WQSA 4DIHH 1BMAA 1HJAC 5EXLA 2HRVA 1A3BH 2BLWA 4FUJA 3GY2A 4X6PA 4BNRA 1C1RA 1O3JA 3OYPA 2A2XH 2ALVA 4CR5A 4ABAA 1FAXA 1O37A 1DUEA 2ZHDA 1ZMNA 2W26A 1NESE 1QJ6B 3E1XB 1ZPZA 1O30A 3T29A 3E90B 3ENSB 2ESTE 3MNBA 1HLTH 1NRSH 4U2WA 1SGIB 2F9BH 3SNEA 3T26A 4WH6A 3QZRA 1MBQA 1G9IE 3QWCH 2PTNA 1W14U 2BD5A 1HAHH 1ARCA 1H9IE 1G3BA 1ZR0A 5C1YA 1JRTA 4ZH8A 2GP9B 2ILNA 1AWFH 2FP7B 2THFB 4IMZA 3K6YA 4AG2A 5L30H 1ETTH 2Z3DA 1SGTA 1AZZA 1XXDA 3M7UA 4RN6A 3A7XA 3DFJA 2P3UB 1BBRH 4X1SU 1A0LA 1CBWC 3UQOA 2QY0B 4DOQA 2ZCLP 1FNIA 3HGNA 4NA8A 1SGYE 1TGSZ 1ZPCA 1MTVA 1D6WA 1Y3YA 1AE8H 1AB9B 4Y8ZA 2GVFA 3P70B 3ZVBA 1F0TA 1VITG 2CGAA 3U8RH 2WUBA 5JPMH 1ELFA 4IBLH 2A45B 3QDZB 1C5RA 4H4FA 5E0JA 2BM2A 1LHEH 1TABE 4E7NA 1TOCB 1PJPA 1V2WT 4FUEA 2R3YA 2AH4X 4ZAEA 3SNDA 2HLCA 2ODQA 1DWCH 2BD9A 3RXOA 1BRBE 5T3HA 2G4TA 1TALA 1WTGH 2JETC 1LQEA 2D26C 3Q00A 1SSXA 1WCZA 3U9AH 1SQTA 1C1PA 3GY3A 1RTFB 1DY9A 4NIXA 1EJNA 1AZ8A 3S7KB 3IG6B 1GI4A 4D9RA 4I8GA 4YTAA 2ZQ1A 4B73A 2ANMH 1PQAA 1P12E 1TNHA 3ZZ4A 3TH2H 2C93B 2VINA 4F49A 4I7YH 1TWXB 3UUZA 3SJOA 1OX1A 3UIRA 2VGCB 5JBAS 3TITA 1GBEA 1DANH 1F2SE 2WINI 1H1BA 2SFAA 1ZRKA 3MFJA 2KAIA 2BX3A 5GPIB 5EODA 1TRYA 1T8MA 3TH4H 3R3GB 4X2WA 4Q7XA 5AF9H 1AMHA 3BF6H 3RXMA 1TNGA 3T25A 4GCHG 3SJIA 3ZVFA 4YOGA 1VZQH 1C5WB 3PLKA 1QL7A 3UY9A 3ELAH 2O8UA 1C5UA 3BTME 1MD8A 3UFAA 3AW1A 4I8LA 1O2MA 1O2OA 1IQGA 1NN6A 1AFEH 1VGCC 4DVAU 1BCUH 2F9NA 4SGAE 1QQ4A 2BDAA 1ZSKA 2VIVA 1JRSA 1UTLM 1UVSH 4TPIZ 1HGTH 3SN8A 3QTVH 3Q3KA 2QF3A 5A0CA 2AGEX 1SG8B 1D3DB 2K1QA 2RG3A 2V0BA 1ZMLA 3ODFA 3UNQA 4X1RU 1NFUA 3KHVA 3KIDU 1Z8JB 4UDWH 1AVWA 3Q77A 6GCHF 2FOEA 4CBNA 1GBAA 3DHKH 4DG4A 3VB4A 1QL9A 1V2UT 4ISIH 2XNIA 4JYVH 4I8HA 1H8IH 1O3BA 1K1IA 1QRWA 2Z7FE 1GBCA 4R0IA 2Z6BD 1TFXA 1SI5H 1G2MA 3BTEE 4X1NU 5LH8A 1YC0A 1L4ZA 1HAVA 3W94A 3UR6A 3HKIB 1T4UH 1BTYA 1P11E 2GT7A 1P0SH 1BZXE 1ZHPA 2A0QB 2HNTC 1B0FA 3LPRA 1ANEA 2BMGB 5F8ZA 6LPRA 4DIIH 2ZFQH 2B0FA 5FBIA 2Q6GA 2BD7A 4O3UA 5ESBA 4IC5A 4CH2B 2ZG0H 3ATKA 3GCOA 1C5XB 2ZU4A 4NFEA 3B9FH 5AHGH 2VWLA 2SGQE 5G4BA 4IS5A 3BTKE 1BOQA 3BEUA 3O8DA 2GGVB 1OPHB 3KN2A 1O34A 4FUIA 1Z71A 4YT6H 2FOFA 2LPRA 3MH6A 1BHXB 3BEFB 1CT2E 2BQWB 2HNTE 2VIOA 4ABIA 1C2JA 1TPSA 2PHBA 3PYHA 3LC3A 5IDKA 2F9VA 1UVPA 3GICB 5K7RA 3F9HA 1WAYB 3RU4E 3RXIA 4KP0A 1DLEA 5LPEA 4Y0YE 1O36A 2ZIQH 2FO9A 2XC4A 4OS7A 4LZ1H 1TMBH 4LK4A 1ORFA 4B76A 4Q2KA 3P95A 4XFQA 3U8TH 1LHFH 1B7XB 1PPGE 1EAUA 5L6NH 2P93A 2EA3A 3MI4A 2XCNA 2FOGA 1INCA 1MBMA 1J8AA 1C2KA 3HK3B 3TVJB 2BOKA 3D23A 3BTGE 1BA8B 2C8WB 4XBCA 4NG9H 4UONA 2P95A 3F9GA 1OWKA 1C1QA 2PLXA 2P3TB 4UEHH 1JMOH 1SOZA 5FPYA 1RXPA 1UCYH 1DFPA 3A80A 3UR9A 1XUJA 2PFEA 4UFFH 2FTMA 1GBIA 5EW2H 1VJAU 2IJOB 1GBLA 1AWHB 1MD7A 1O2WA 1V2TT 1D6RA 1P2QA 1O5CB 2P8OC 4CRBA 1EJAA 3GYMA 3RXSA 3SU5A 2A32A 3PB1E 3VPKA 1UCYE 4AYYB 3BIUH 8GCHF 1O2NA 1OYTH 4M7GA 5C5OA 3PM3A 5LGOA 3Q76A 2TBSA 1UHBB 5E0HA 3LDXH 2V6NA 3RUOA 2EEKA 1NU7B 3M5LA 3OTJE 4Y8XA 3RC5A 2ZGXH 1YPKH 1NZQH 4AB8A 3GDSA 3PMBB 1GG6B 1C1SA 2BB4A 1UO6A 4NIVA 4MG3A 4DCDA 1UJ1A 5DP6A 5HMAA 1ELVA 1AY6H 1GGDC 3EA9A 2A4GA 3V3MA 4K3JA 3VB6A 2ANYA 1IQLA 3TK6A 1BTZA 1N8OC 2FM2A 3MNSA 2GMTC 2AGIX 1D3TB 3KEEA 2QN5T 2PR3A 3GCHC 1IOEA 4AGJA 2TGAA 3SI4H 1GI8B 2P3FH 4UE7H 3RM0H 2Q6FA 3I78A 2UUJB 1RIWC 2CV3A 4DURA 2PW8H 2ZHFH 1NRQH 1TE0A 2NWNA 5EG4A 2SGFE 1GCTB 2ZFSA 1K1LA 2BDHA 1BB0B 2Y80A 3RC6A 4HTCH 4UFGH 4XBDA 4JK5A 1E37B 3F9EA 1BJUA 3QGNB 4CRCA 2BY6X 2FWWA 4MVNA 1GI9B 4CREA 2WPKS 4OS4A 1O2LA 1UK2A 1FZZA 2PUXB 2Q1JA 4KTUA 5FPTA 1AHTH 1FAKH 1GI2A 1WUNH 1XXFA 5FHTA 3SQHE 2VWNA 1MTNB 2WV5A 1W2KH 2FESH 4D9QA 3FZZA 1OWDA 1P57B 4ASHA 4AFZA 1BRAA 4OS2A 1P2OA 2O8LA 2P16A 1GJ6A 1CE5A 1UTJA 3ZVDA 5EQQA 1AVXA 2IN2A 4WH8A 2HPPH 4H6TA 1HIAB 2Z3CA 3MO3A 1OYQA 2WPIS 1C9PA 2W3IA 2TGTA 1P9UA 1QR3E 2TGPZ 4MTBA 1HYLA 2PWXA 3RXHA 1E35B 4TWWA 1P02A 1W0YH 1P2MA 2FPZA 2CF9H 1O3NA 3SBKA 2A7CA 1CGHA 3C27B 2BY9X 1GJ9B 1Y3WA 3MNCA 3T27A 4INLA 1UVTH 4Y7BA 5DJ7A 1FUJA 3ATIA 3TGIE 3ZVGA 2G00A 1O38A 1UTOA 1BITA 3LOXA 3BTTE 5FBEA 1V2ST 5DP4A 1HJAB 3K2UA 1CT4E 3F68H 1XKBC 1LO6A 1XMNB 3PTNA 4WXIA 2YNBA 4ABFA 1A61H 1O35A 2W7UA 2CJIA 4MNXA 3GY7A 3BTWE 4XBBA 1TGBA 3LGYA 1JOUB 1AD8H 1TX7A 4I31A 3A86A 4KTSA 3RU4D 4B75A 1WTHD 5HM2A 3WY8A 2VWOA 5EGMA 2A5KA 1NFYA 1YPHE 1O3LA 2V35A 3O8CA 2Y5FA 1OWIA 3MNXA 1XVOA 4SGBE 3F9FA 2WPJS 1YYY1 3RU4T 3M3TA 1WYKA 1HB0B 1O2JA 1NM6A 2J4IA 1C2HA 3RXCA 2WPHS 3O8BA 5TCCA 2GCTB 4O9VA 1TX8A 1C4U2 2BY5X 2XYAA 3AASA 3SV9A 1H9LB 4CRGA 1VITH 1O5AB 2EI7A 4Y10E 6CHAB 1F5LA 1J15A 2GV7A 1DICA 4XOJA 4K1SA 1SQAA 1SGDE 4TY7A 3DT0H 4X2VA 1HAVB 1H9HE 3ODDA 1IHTH 1Y5AT 4X6NA 5F6MA 4JCNA 4ABJA 1F0UA 1GJ4H 4MNWA 3QZQA 2WV4A 5F8TA 4ZMAH 3SW2B 2H1UA 3FP6E 1W0ZU 1EPTA 1LPGB 2QC2A 3ITIA 3VXEH 1G3CA 3KGPA 1K2I1 1EB1H 1UTNA 2FIRH 3GY8A 3JZ1B 3QX5H 2B5TB 1CA0C 2P94A 5BPEA 5CE1A 1SPJA 2F9UA 1IQNA 1C1OA 1O3HA 4BAMB 3RP2A 5PTPA 4H6SB 1O3DA 2NU0E 3TGJE 1XVMA 1HAOH 1EAIA 1G37A 5FXLA 3STIA 1C2FA 5J4QA 3CENA 2BDBA 4MDSA 1Y3VA 3SUEA 1IQHA 2ZTXA 1HAYB 1XKAC 5DGJA 4KTCA 3TIUA 3QTOH 4YZUA 3A81A 2RA3A 1AQ7A 1BTXA 1A5GH 1WSSH 2M5TA 3QGJA 4YT7H 4X1PU 3PV4A 3CS0A 3GOVB 1QURH 1UHBA 4Y8YA 3LH1A 4AB9A 4Y7AA 2O8MA 1SBWA 4BTUB 5DPAA 3GCNA 4E05H 2BY7X 3VGCC 1HUTH 1UVUH 1C2MA 4CRAA 1GDNA 2QXHA 1P2KA 1VJ9U 2SNWA 1SLXB 1S83A 4FUCA 3MO6A 5FPSA 1GDQA 1GMHG 5C2ZA 3HK6B 2G52A 1C4Y2 1B5GH 3U8OH 4H42U 5CHAC 5HGGA 1C2LA 8GCHG 5K0HA 5CMXH 3M5OA 4K1TA 1ELAA 4AFQA 3SV7A 3ZZBA 2ZHQH 2FZZA 4D8NA 1IQEA 2FX4A 3RXKA 1GMDF 1V2QT 2ZECA 1AIXH 2A4OA 4YESB 2Y5GA 2OP9A 1YPEH 3K9XB 3RMLH 1FN6A 2PKSC 1IAUA 1EB2A 5ABWA 1V2KT 5DP8A 9ESTA 2O8TA 3M7QA 1O3GA 2PSXA 3HATH 1TGNA 5HYOA 1SFIA 2FEQH 1RRKA 1C5LH 3F1SB 1J16A 4RKJB 5DKMA 1O2SA 1Q2WA 1P9SA 1TA2A 2BZAA 1NC6A 3OSYA 3ZV9A 1MCVA 2A2QH 4B2BA 1CHOG 5JB8S 5ESTE 3ZVAA 3P8NA 4ZKNU 4TWYA 3RXDA 1C4V2 1GMCG 1C5YB 2OTVA 1AKSA 1O2KA 3SU4A 5EOKA 1RD3B 2ZGJA 5FX6A 4JZIA 2BD3A 1P09A 2ZU5A 1NFWA 1Z6EA 3Q3XA 2V3OH 2W3KA 1AU8A 1O3AA 1GI7B 2G5NA 4B71A 1F7ZA 3L3TA 3E0NB 3SV6A 2HWLB 2NU4E 1TBQH 3E16B 4ABGA 3GYLB 3KQEA 1MQ5A 2GDEH 4PROA 2GTBA 4AX9H 1CSOE 2ZHEH 1A3EH 2ZDKA 3FP8E 3T2NA 2ZZUH 1L4DA 3IWMA 2A31A 1MUEB 1SFQB 4LOYH 1TQ7B 1UK4A 3LGVA 5GCHG 1N6XA 4WMDA 4FUFA 4HFPB 4MNVA 3S69A 5DP7A 3GY4A 1O3OA 3G01A 1JIMA 2BHGA 1FPHH 1MCTA 3I29A 2AMPA 4X8VH 2I6SA 4ISOA 1P2JA 1QA0A 1TNIA 1FY3A 1Z7KA 1SR5C 2YNAA 1GPZA 3MTYA 2BXUH 2BDGA 4OS1A 4F4OC 3DFLA 2FLBH 3VXFH 1YCPK 1RGQA 2AMDA 3N7OA 4A1VA 3KCGH 1GHBF 2F91A 7ESTE 1O32A 5HM9A 3ESTA 1IQJA 1ZJKA 2OINA 3SI3H 4ZROA 3M35A 4U30A 3K6ZA 3DD2H 3A83A 1YPJH 3E6PH 4NIYA 3PO1B 2CHAB 3ZZAA 1E0FD 1BBRK 1GJBB 2BQ7B 5FCRA 1BTHH 1FV9A 4ABHA 5DP3A 3EE0B 1ETRH 1ETSH 1YPHC 3OY6U 3P8GA 1GMDG 5B6OA 1IQKA 3SHAH 4CHAC 1EPTB 2ZCHP 2SGEE 5TCAA 2P8OB 1O2TA 2PSYA 2W7SA 5A09A 2XWBI 1HPGA 4K8BA 2XBVA 3RXAA 2BX4A 1L1GA 4JZDH 1P01A 3QK1A 4FUGA 3SNBA 1FN8A 2UWPA 4K8YA 1ZMJA 1TBRH 4CRDA 1K1NA 1TYNA 1W7GH 1KTTB 3BTDE 2FYQA 4CBOA 2R3UA 3TGKE 1AFQB 1S81A 1YLDA 4AOQA 1J9CH 2OQUA 1YP9A 1EUFA 2VNTA 1GHWH 2HOBA 1AE5A 1GMHF 5AVDA 1Y59T 2JH6D 2BLQA 1SVPA 1UTQA 2C8YB 2BY8X 1ZYOA 3BG8A 5JBCS 1AO5A 1E34B 3SQEE 1GJ5H 1H8DH 2F83A 3AW0A 3PWBA 2AYWA 4OGXA 1TRNA 3BG4B 1O2IA 2FLRH 2JH0D 3EA8A 1HAXB 3QO6A 2CMYA 4Q7YA 2HPQH 1QBNA 2ZDNA 2QXJA 2OC8A 5GXPA 1W11U 5JBBS 1P06A 4MPVA 5EXMA 1C5PA 1C5NH 3VB3A 1ZTKA 4UFEH 4XSKU 4NGAH 2V3HH 1WQVH 1SL3A 2Z94A 3S0NA 1P3CA 3NXPA 3SU6A 1GHYH 1ZHMA 3SJKA 3E3TA 4IN2A 1CHOF 2QIQA 2JKHA 1G32B 4IN1A 3RLWH 1FY1A 1GL1A 4AG1A 4I33A 4WF8A 2ZDAH 1MTNC 1P03A 5DO4H 3A8CA 1XM1A 1Y5UT 2FS9A 3MU0A 1OOKB 3D65E 1L0ZA 2D2DA 4HI3A 4Y6DA 2ZPQA 2DUCA 5SGAE 3W95A 3T28A 1DT2A 5DK1A 3HKJB 1GJDB 1OXGA 4TYDA 1S0QA 2TPIZ 1HXEH 1UCYK 3BSQA 3MU5A 3OX7U 2ZPRA 4WXVA 2TGDA 1F0RA 1ELTA 2EC9H 1BRUP 3AVZA 2STAE 1GBDA 3BTHE 2ZU1A 1DPOA 1BTPA 4ABDA 3TJVA 4BTTB 1HAIH 1LDTT 1MTUA 5C1UA 4E7RG 1YCPH 2VB0A 3U98H 3SO3A 1SOTA 4A6LA 1QTFA 4B2CA 3EYDA 1EP5A 3PLPA 1S6FA 1P8VC 3KQDA 3OU0A 3I77A 4AFUA 1ANDA 3S9BA 3LONA 5FCKA 4ZXYH 1OP8A 1QA7A 3P92A 4CRFA 2A4QA 4WMFA 3ZZ6A 2R9PA 5H4IB 7LPRA 2Y82A 3EA7A 5EQRA 2H9HA 4ISHH 4FVDA 1NRRH 2VVUA 2C8XB 4OGYA 1GJ8B 3ZVCA 2BVSH 4UD9H 2GCHG 4ESTE 3TLOA 2ZF0H 2OC0A 2HNTF 3A82A 5EQSA 1EAXA 4OS6A 3TNSA 1C1UH 1B0EA 3LGIA 4GUXA 1Q31A 2BD4A 1DE7H 1MQ6A 1NT1A 4WVPE 3EDXB 3A84A 1O33A 3VB5A 1ZOMA 1XUFA 1LHDH 1TGTA 3SV8A 2GD4B 1DSTA 2ZU2A 1F5KU 1TPPA 1VITF 4XE4A 1D3PB 1LHGH 2WPLS 3GY5A 1C5OH 2ZNKH 5A8ZA 5BRRE 2A7JA 5T6GA 4RKOB 2GX4A 5J4SA 1TQ0B 3ZYEA 4A92A 2Y5HA 3LGTA 1NRNH 2VVCA 1S5SA 3L33A 1CA0B 1HJ9A 4GVUA 1V6DA 2Q6DA 2BDCA 1YF4A 2FI4E 1QRZA 1C5ZB 2NU1E 3LT3A 1ZGIA 5EW1H 4NA7A 1TA6A 2UUYA 3NUMA 2BTCE 4K60A 2H6MA 1T8LA 3NWUA 3RXRA 4FU8A 3R0FA 5C5NA 1O3FA 2QCYA 1TRMA 2RDLA 2O8WA 1TBZH 4NSVA 3BV9B 2VWMA 5GJ4B 1PYTC 1CGJE 5E0GA 2QYIA 2BLOA 1NY22 2TIOA 1MAXA 4ZUHA 1O2UA 1SLVB 1A4WH 3FVFB 4KKDA 1ANBA 1X7AC 2Z9LA 3SOSA 1MH0A 1PPFE 4JYTA 1DX5M 2OC7A 2ODYB 3NKKA 1O2RA 3SZNA 3ZV8A 1O2QA 1THRH 4GCHF 1T8NA 2F9OA 1TX6A 3RDZA 4YOJA 1GBHA 4MQAA 1QBVH 1BMNH 4D76A 2AEIH 2HALA 3HPTB 2FMJA 1O5FH 8LPRA 2J95A 1PPBH 5LPRA 1TMTH 3SJ8A 1EKBB 1CT0E 1ESAA 1YPMH 3M37A 4QT8C 2FOBA 1O3PB 3IITA 1V2OT 1W10U 4JYUH 1GJ7B 3ATMA 1XX9A 4BAQB 1VR1H 3NCLA 2C4FH 4J2YB 3UWIA 1HXFH 2QA9E 5CHAB 1DY8A 7KMEH 1ABJH 1K28D 1CBWB 4AFSA 3NK8A 2R0LA 4OS5A 2GZ7A 1EZSC 4X2XA 2ZTYA 5JYIA 4I8JA 1YKTA 3SU2A 1OWHA 1EZUC 3RXVA 1K22H 1ARBA 1SC8U 2ZKSA 4FVBA 1TIOA 1DWBH 1NRPH 3LKWA 2Y7XA 1YPLH 4O97A 1FJSA 3BTQE 3ZZ8A 1TOMH 2VJ1A 4DY7B 1KXAA 2ZDMA 1EOLA 3UOPA 1YM0A 5C67A 5EU8A 1LPKB 2SGDE 3SHCH 1TNLA 3RMOH 1QBOA 3STJA 4Z0KA 1MKXK 3FFGA 3SUFA 2GDDA 2ZFFH 1SGFA 3A7VA 1Y3UA 2FODA 2GZ9A 2J94A 1PQ7A 5A0BA 1RJXB 2JETB 1LPZB 3LIWA 1NO9H 1MZDA 4MNYA 1E38B 4ZHLU 3UREA 1BRCE 1PQ5A 1GJCB 4JK6A 1KDQA 2P59A 1ELCA 1TONA 3ZZ9A 1GBJA 1GVZA 2BVXH 3V12A 1NS3A 1A5IA 4ZKRU 3SU3A 3MOCA 3RXJA 3SNCA 3MO9A 3O8RA 1K1PA 1N1LA 1YCPM 2TRMA 3A7YA 1WV7H 2QXIA 4YO9A 2OBQA 2VGCC 4O3TA 1FLEE 6GCHG 1RTLA 1UTMA 1GG6C 1EOJA 3SGAE 3SGBE 1DITH 1SB1H 1EXFA 1TNKA 1IHSH 5EPYA 1MKWK 1GGDB 1CVWH 3PLBA 2J9NA 1GL0E 2ZFPH 1EJMA 1N8OB 2OUAA 4TY6A 2OLGA 5FX5A 2GMTB 4BXWA 1F5RA 2BVRH 1SGQE 1ZGVA 1DLKB 5TJXA 1QY6A 2BD2A 2GV6A 4O03A 3GCHB 3TK5A 2BDIA 1P2NA 4MPWA 3ZZ5A 4A1TA 3RMMH 5ETXA 2VU8E 5IYTA 1VCPA 1OS8A 2FYRA 3UPEA 1DDJA 4ISNA 1GHVH 3TH3H 1RIWB 3MU1A 1SQOA 1KLTA 3HGPA 2G81E 2PKAB 3QUMP 1J17T 1HAGE 1TLDA 1ZPBA 2R2WU 2LNCA 1FPCH 1CHGA 3GISB 2J2UA 1TPAE 3B8JA 4ZKOU 1CGIE 3EGKH 4Y71A 3ZZDA 4WJG2 2G55A 3V13A 1ABIH 2VH0A 2J34A 2ULLA 4AN7A 2WUCA 4NCYA 1FIZA 1V2LT 2ZPSA 3UNSA 3B23B 2GT8A 3VEQB 2XXLA 1YLCA 4NA9H 3PO1C 3SU1A 2Z9IA 3K65B 4IC6A 1DWDH 1O39A 2DE8A 1THPB 4HZHA 1H4WA 2Y7ZA 4CHAB 3UNRA 1EPTC
chains in the Genus database with same CATH superfamily
4U32A 3D62A 2FDAA 2W6ID 3KQBA 3A7WA 5L2ZH 5JDUB 1V2PT 4X1QU 3URCA 5GDSH 2ANKH 1VCWA 3DUXH 2VIQA 4Q7ZA 1OKXA 2R0KA 1TB6H 1ID5H 1FIWA 4XD7D 3A89A 1GDUA 2C8ZB 3U1IB 2FXRA 5EPNA 1C2GA 5DG6A 3PMAB 1D3QB 4E06H 1QB6A 3GDUA 1K0HA 1QFKH 3H7OA 3M5MA 3LJJA 4DW2U 2V3MA 4GHQA 1EAWA 2VIPA 1G30B 3M3SA 2Z9KA 1ZZZA 1SKYE 1UTKA 1QHRB 1TNJA 1Y3XA 2AMQA 1NTPA 3QLPH 1YPGH 4LXBH 4BOHA 1HJ8A 2QGRA 1EZXC 2G5VA 2W5EA 1FI8A 1GMCF 2R2MB 1BHXF 2OXSA 1Z1JA 2OD3B 1EFRD 3ZZCA 3L6PA 1O2ZA 1T32A 4VGCC 5JB9S 4ZHMU 2IOTA 7GCHG 4JZEH 2EI6A 2ZDLA 1C5SA 3A88A 3BG4C 3ZIAD 3H09A 3UOUA 5EJLA 1O3KA 5F03A 3RXBA 1QCPA 2EI8A 3M36A 2FS8A 2HVXA 1GHBG 1YGCH 2B9LA 4GSOA 8KME2 5I46H 4DJZB 3CS7A 1ZSLA 2XRCA 3TU7H 1UMAH 6CHAC 2UUFB 1K21H 4A1XA 2ZA5A 1AUJA 9LPRA 1AKSB 1QB1A 1EX3A 1KXDA 2KCOA 1PPCE 4GAWA 3OY5U 3MU4A 5GCHF 3S9CA 1QJ7B 5E2PA 8ESTE 2ZP0H 5C1XA 2A7HA 2XC0A 4AZ2B 4INHA 1C5MD 2ZC9H 1JXPA 1HBTH 3H7TA 2H5CA 3SNAA 1ELDE 1V2JT 3FZDA 3TJNA 1C5QA 1DOJA 1ELEE 1UVOA 2PGBB 4R8TB 1NROH 4A7IB 1RS0A 1Z1IA 1G3EA 1G2LA 1DSUA 2A4RA 3Q3YA 1V2RT 2ZGCA 1XUHA 1LHCH 3P6ZB 1A0JA 2XNDD 2BQ6B 3NZIA 2OC1A 3GCTF 5EXNA 3A87A 4IGDA 3RXEA 2PGQB 3QN7A 1M9UA 1MKWH 5E8EH 4GPGA 3PMHB 1KDQB 1KLJH 1CQQA 1C9TA 4ZHAA 2IPQX 3GDVA 4X8SH 3RXGA 2G8TA 3A7TA 3OFND 2VVVA 1O5EH 4X6MA 1C5VA 2WYJA 2ZGHA 1LVOA 1C5TA 3FAOA 1GI1A 1AN1E 3OEHD 5GIBA 1NPMA 1Z8IB 1HAZB 1LKBA 4LZ4B 1SGFG 1RTKA 2AS9A 2CXVA 1TGCA 1F0SA 2ZQ2A 3TPIZ 4X6OA 3VGCB 2ZGBH 3FKSD 2BOHB 2IJD1 3N99A 3UQVA 3H5CB 3AAVA 1GBFA 2WYGA 5A8XA 1CU1A 1GBKA 4GHTA 1DXWA 1GCTC 1W13U 1C2EA 1EQ9A 2OCVB 1KXBA 1O5BB 3U1JB 4YOIA 4WY3A 4MPXA 2DE9A 1DWEH 1GI5A 1V2MT 4AORA 5FAHA 3AK5A 1BJVA 1AB9C 4U01A 3UWJH 2FOMB 1IQIA 3NPSA 5AFYH 1GI0A 2O9QA 1A2CH 1FY8E 2GJGA 1SGCA 1T7CA 2PKSB 2BLVA 5C3NA 1V2NT 4ISLA 2A1DB 3MU8A 4X8TH 1LKAA 3TJUA 4NWLA 3URDA 2XWAA 1BDAA 3LJOA 1J14A 1W12U 2RA0A 4Y11E 1A7SA 1JWTA 1GWAA 5C20A 2A5AA 3MYWA 1EZQA 1T8OA 1FXYA 1P10A 1VCQA 4MLFB 3MH7A 4XRNA 2BD8A 3F0OA 2EY4C 1BQYA 1SMFE 2ODPA 3E91A 4BANB 1SLWB 3DA9B 1FONA 3SUDA 2QV1A 3M7TA 1Z6JH 3PTBA 4X8UH 1ZTLA 2Y6TA 3KQCA 2H9EH 2BYAX 1YBWA 2XCFA 1KTSB 4WMEA 2ASUB 4K2YA 2D1JA 2QF0A 1ZJDA 3FN8A 4RSPA 3SORA 3ZZ3A 1A1RA 5I25A 1WU1A 3FANA 2I6QA 4DT7B 2J97A 1ELBA 2WPMS 3A7ZA 4J1YA 1ZRBA 1N6YA 1FY5A 1GI3A 2ALPA 4FUBA 4B1TA 4D7GA 2AGGX 1SGPE 5A8YA 4YLUA 3RXUA 2C3SA 1QGFA 5F8XA 1LMWB 1L1JA 2C90B 2PKAA 7GCHF 1O2GH 3GCTG 5A0AE 1W8BH 2UUKB 3WWBA 2V7QD 4ZKSU 3CP7A 1VGCB 1XUIA 2STBE 4FUHA 2QAAA 1MZAA 3RXTA 1C1VH 3A8BA 1HRTH 1BMMH 4K69A 4X0WU 3KF2A 2GCTC 1NU9A 2ZFRH 4RT0A 5A2MH 4IW4E 3D49H 4CR9A 3A85A 1S85A 1GI6A 4RI0A 1GCDA 1TPOA 3RM2H 1OP2A 2WV9A 2XBWA 2ZU3A 4NIWA 3F6UH 4UFDH 1CA8B 1L1NA 3JZ2B 1EATA 1QJ1B 4NWKA 2PP6A 1NFXA 1O2XA 4NZQA 3MMGA 1V3XA 1ZTJA 4KELA 4YM9A 2FX6A 1FMGA 1K9OE 1O31A 1AVGH 2FI5E 4KGAA 1ACBE 4Y79A 5EJ1A 1SGRE 1EP6A 2BXTH 1O5DH 2F43B 1Z8GA 2F9PA 3S7HB 1LCYA 1Y8TA 4JZFH 2OQ5A 4TPYA 1L2EA 1QQUA 1O3EA 1O3IA 1SHHB 1SHYA 2Z9GA 3GY6A 1O3MA 1P04A 1QRXA 3SJ9A 2WHXA 3RXFA 1QB9A 1WBGB 4GLYA 1XUGA 2RCEA 1GHXH 2JH5D 1DS2E 1KXEA 4JMYA 2XC5A 3RXPA 2FOCA 3KL6A 2ZHWH 1IQFA 1C1MA 4AYVB 1G36A 4B2AA 1MU6B 4P00A 3LGWA 2QF4A 1HCGA 1RFNA 1TAWA 1O2PA 2EQNA 2PV9B 1LQDB 4IMQA 1HIAA 2PTCE 3P17H 2XBYA 1Q3XA 1Y5BT 1MMJN 1O2HA 1BTWA 1AFQC 2ANWA 1O2VA 3S9AA 2CK3D 1A46H 1GVLA 3PMJA 3ZZ7A 1KLIH 1BIOA 1OP0A 1YY3A 2FTLE 1F92A 1AUTC 1HNEE 1THSH 1E79D 4NZLA 4ZXXH 1HFDA 3ATWA 2FI3E 1W3CA 2L6OA 3FP7E 3PROA 1MU8B 1GHAF 1ESBA 1A5HA 4FU7A 3TNTA 3KYGA 2SGAA 1O5GH 4THNH 2B8OH 2J92A 1HDTH 3ZVEA 2IPHA 1MKXH 1DUAA 1BUIA 5E2OA 4JZ1A 2UWLA 2J38A 2F3CE 1V2VT 3BN9A 1BT7A 1GBMA 2KM0A 1AGJA 1OSSA 1FQ3A 5CDFE 4MPUA 5AFZH 1U6QA 1DXPA 4CH8B 1GBBA 1ANCA 4BTIB 1C1NA 1PQ8A 1HV7A 2G51A 1E1RD 1JIRA 3FO8D 3MWIU 3UTUH 1ESTA 1S6HA 2BZ6H 5EIYA 3SV2H 1SGEE 2NU2E 3ZYDA 1ZHRA 3F3BA 1CO7E 3BTFE 3MH4A 1BMFD 2H9TH 1QL8A 1UK3A 1XUKA 1HAPH 3V7TA 1D4PB 4TSFD 2SGPE 1P3EA 4HGCA 1BMLA 1KYNA 1S0RA 2D8WA 2FOHA 2Y81A 2H5DA 2H2ZA 3LH3A 4AGKA 4FU9A 1DM4B 2CF8H 3T62A 6ESTA 1P2IA 4D7FA 3U69H 1QIXB 1GHZA 4I86A 3PWCA 4Y0ZE 2AIQA 1PYTD 1PFXC 1PPHE 2HGTH 1G3DA 1LTOA 1PPZA 4K1EA 4ABEA 1BTUA 4BAKB 1GBTA 3VB7A 4BXSA 3MHWU 3TK9A 1TMUH 3V0XA 5HIZA 4A5TS 1C1TA 1T31A 2KAIB 2ZI2H 1MTSA 4K5ZA 2G4UA 3EQ0H 2K0QA 1Z8RA 4ABBA 2B7DH 1GVKB 1O2YA 3BEIB 1PPEE 2GZ8A 2UWOA 2ZEBA 2ZFTA 3SU0A 3RC4A 1FDPA 3LC5A 3MH5A 5L2YH 1QNJA 3ATLA 1SGNE 2QXGA 3RXLA 1E36B 1GJAB 1K1JA 3LU9B 1WOFA 2A5IA 3BIVH 3EAJA 2SNVA 1ELGA 4Q80A 1MTWA 1KIGH 5HXFA 2VH6A 3M3VA 1LVYA 1FY4A 1O0DH 2FOAA 1K1MA 1KXCA 3OAAD 3RLYH 3RMNH 2YMSD 1O3CA 1OWEA 1SLUB 1BBRE 2XTTB 1S84A 5KECA 3M5NA 1EASA 4VGCB 3VFEA 3E8LA 4I8KA 2Z9JA 3P8FA 1K1OA 3KNXA 1AI8H 1LVMA 1KXFA 2Z3EA 1ZLRA 4B74A 1S82A 2AERH 1MAYA 2CN0H 2ZCKP 3SGQE 4Y76A 4FUDA 2GKVE 4I32A 3WWFA 1C1WH 1GHAG 4NSYA 1DVAH 4WWYA 3M61U 5DP9A 3A8DA 3N7DA 3P8OA 1P05A 5GWZA 1KSNA 4XDEA 2CHAC 1C2DA 1UTPA 5T6DA 1W7XH 1ZSJA 1YWUA 3T5FH 1OWJA 2AFQB 2ZDVH 5T6FA 3E0PB 4Z6AH 2ZO3H 4X2YA 4YLQH 1LVBA 2YOLA 4FXGH 1A0HB 2VIDA 4DGJA 2ZTZA 3DSGA 2XBXA 1C2IA 4NFFA 3C1KA 1KY9A 2XW9A 4INKA 2GCHF 3LGUA 1D9IA 2AIPA 4FOUC 3A8AA 4BAHB 2ZWLH 2BDYA 1T4VH 3SUGA 4BAOB 2OBOA 3RXQA 2VIWA 2NU3E 1JBUH 3AAUA 1IQMA 5DP5A 2PUQH 5JBTA 1NBMD 3TJOA 5LPFA 1WQSA 4DIHH 2WZQA 1BMAA 1HJAC 5EXLA 2HRVA 1A3BH 2BLWA 4FUJA 3GY2A 4X6PA 4BNRA 1C1RA 1O3JA 3OYPA 2A2XH 3F0PA 2ALVA 4CR5A 4ABAA 1FAXA 1O37A 1DUEA 2ZHDA 1ZMNA 1NESE 1QJ6B 2W26A 3E1XB 1ZPZA 1O30A 3T29A 3E90B 5KEDA 3ENSB 2ESTE 3MNBA 1HLTH 1NRSH 4U2WA 1SGIB 2F9BH 3SNEA 3T26A 4WH6A 3QZRA 1MBQA 1G9IE 3QWCH 2PTNA 1W14U 2BD5A 1HAHH 1ARCA 1H9IE 1G3BA 1ZR0A 5C1YA 1JRTA 4ZH8A 2GP9B 2ILNA 1AWFH 2FP7B 2THFB 4ZCNA 4IMZA 3K6YA 4AG2A 5L30H 1ETTH 2Z3DA 1SGTA 1AZZA 1XXDA 3M7UA 4RN6A 3A7XA 3DFJA 2KCPA 2P3UB 1BBRH 4X1SU 4YXWD 1A0LA 1CBWC 1H8HD 3UQOA 2QY0B 4DOQA 2ZCLP 1FNIA 3HGNA 4NA8A 1WXRA 1SGYE 1TGSZ 1ZPCA 3DCLA 1MTVA 1D6WA 1Y3YA 1AE8H 1AB9B 2LP6A 4Y8ZA 2GVFA 3P70B 3ZVBA 2KCYA 1F0TA 1VITG 2CGAA 3U8RH 2WPDD 2WUBA 5JPMH 1ELFA 4IBLH 2A45B 3QDZB 1C5RA 4H4FA 5E0JA 2BM2A 1LHEH 1TABE 4E7NA 1TOCB 4TT3D 1PJPA 1V2WT 4FUEA 2R3YA 2AH4X 4ZAEA 4Q63A 3SNDA 2HLCA 2ODQA 1DWCH 2BD9A 3RXOA 5IK2D 1BRBE 5T3HA 2G4TA 1TALA 1WTGH 2JETC 1LQEA 2D26C 3Q00A 1SSXA 1WCZA 3U9AH 1SQTA 1C1PA 3GY3A 1RTFB 1DY9A 4NIXA 1EJNA 3N7EA 1AZ8A 3S7KB 3IG6B 1GI4A 4D9RA 2KR7A 4I8GA 2ZQ1A 4YTAA 4B73A 2ANMH 1PQAA 1P12E 1TNHA 3ZZ4A 3TH2H 2C93B 2VINA 4F49A 4I7YH 1TWXB 3UUZA 3SJOA 1OX1A 3UIRA 2VGCB 5JBAS 5KGOA 3TITA 1GBEA 1DANH 1F2SE 2WINI 1H1BA 2SFAA 1ZRKA 2YMSB 3MFJA 2KAIA 2BX3A 5GPIB 5EODA 1TRYA 1T8MA 3TH4H 3R3GB 4X2WA 4Q7XA 5AF9H 1AMHA 3BF6H 3RXMA 1TNGA 3T25A 3DSOA 1FX0B 4GCHG 3SJIA 3ZVFA 4YOGA 1VZQH 1C5WB 3PLKA 1QL7A 3UY9A 3ELAH 2O8UA 1C5UA 3BTME 1MD8A 3UFAA 3AW1A 4I8LA 1O2MA 1O2OA 1IQGA 1NN6A 1AFEH 1VGCC 4DVAU 1BCUH 2F9NA 4SGAE 1QQ4A 2BDAA 1ZSKA 2VIVA 1JRSA 1UTLM 1UVSH 2J98A 4TPIZ 1HGTH 3SN8A 3QTVH 3Q3KA 2QF3A 2WSSD 5A0CA 2AGEX 1SG8B 1D3DB 2K1QA 2RG3A 2V0BA 1ZMLA 3ODFA 3UNQA 4X1RU 1NFUA 3KHVA 3KIDU 1Z8JB 4UDWH 1AVWA 3Q77A 6GCHF 2FOEA 4CBNA 1GBAA 3DHKH 4DG4A 3VB4A 1QL9A 1V2UT 4ISIH 2XNIA 4JYVH 4I8HA 1H8IH 1O3BA 1K1IA 1QRWA 2Z7FE 1GBCA 2JIZD 4R0IA 2Z6BD 1TFXA 1SI5H 1G2MA 3BTEE 4X1NU 5LH8A 1YC0A 1L4ZA 2KCAA 1HAVA 3W94A 3UR6A 3CNRA 3HKIB 1T4UH 1BTYA 1P11E 2GT7A 1P0SH 1BZXE 1ZHPA 1COWD 2A0QB 2HNTC 1B0FA 3LPRA 4F55A 1ANEA 2BMGB 5F8ZA 6LPRA 4DIIH 2ZFQH 2B0FA 5FBIA 2Q6GA 5CHBA 2BD7A 4O3UA 5ESBA 4IC5A 4CH2B 2ZG0H 3ATKA 5HKKD 3GCOA 1C5XB 2ZU4A 4NFEA 3B9FH 5AHGH 2VWLA 2SGQE 3UB0A 5G4BA 4IS5A 3BTKE 1BOQA 3BEUA 3O8DA 2GGVB 1OPHB 3KN2A 1O34A 4FUIA 1Z71A 4YT6H 2FOFA 2LPRA 3MH6A 1BHXB 3BEFB 1CT2E 2BQWB 2HNTE 2VIOA 2J98B 4ABIA 1C2JA 1TPSA 2PHBA 3PYHA 3LC3A 5IDKA 2F9VA 1UVPA 3GICB 5K7RA 3F9HA 1WAYB 3RU4E 3RXIA 4KP0A 1DLEA 5LPEA 4Y0YE 2J5UA 1O36A 2ZIQH 2FO9A 2XC4A 4OS7A 4LZ1H 1TMBH 4LK4A 1ORFA 4B76A 4Q2KA 3P95A 4XFQA 3U8TH 1LHFH 1B7XB 1PPGE 1EAUA 5L6NH 2P93A 2EA3A 3MI4A 2FOGA 2XCNA 1INCA 1MBMA 1J8AA 1C2KA 3HK3B 3TVJB 2BOKA 3D23A 3BTGE 1OHHD 3F2HA 1BA8B 2QE7D 2C8WB 4XBCA 4NG9H 4UONA 2P95A 3F9GA 1OWKA 1C1QA 2PLXA 2P3TB 4UEHH 1JMOH 1SOZA 5FPYA 1RXPA 1UCYH 1DFPA 3A80A 3UR9A 1XUJA 2PFEA 4UFFH 2FTMA 1GBIA 5EW2H 1VJAU 2IJOB 1GBLA 1AWHB 1MD7A 1O2WA 1V2TT 1D6RA 1P2QA 1O5CB 2P8OC 4CRBA 1EJAA 3GYMA 2HLDD 3RXSA 3SU5A 2A32A 3PB1E 3VPKA 1UCYE 4AYYB 3BIUH 8GCHF 1O2NA 1OYTH 4M7GA 5C5OA 3PM3A 5LGOA 3Q76A 2TBSA 1UHBB 5E0HA 3LDXH 2V6NA 3RUOA 2EEKA 1NU7B 3M5LA 3OTJE 4Y8XA 3RC5A 5B6LA 2ZGXH 1YPKH 1NZQH 4AB8A 3GDSA 3PMBB 1GG6B 1C1SA 2BB4A 1UO6A 4NIVA 4MG3A 4P02A 4DCDA 1UJ1A 5DP6A 5HMAA 1ELVA 1AY6H 1GGDC 3EA9A 2A4GA 3V3MA 4K3JA 3VB6A 2ANYA 1IQLA 3TK6A 1BTZA 1N8OC 2FM2A 3MNSA 2GMTC 2AGIX 1D3TB 3KEEA 2QN5T 2PR3A 3GCHC 1IOEA 4AGJA 2TGAA 3SI4H 1GI8B 2P3FH 4UE7H 3RM0H 2Q6FA 3I78A 2UUJB 1RIWC 2CV3A 4DURA 2PW8H 2ZHFH 1NRQH 1TE0A 2NWNA 5EG4A 2SGFE 4B6EA 1GCTB 2ZFSA 1K1LA 2BDHA 1BB0B 2Y80A 3RC6A 4HTCH 4UFGH 4XBDA 4JK5A 1E37B 3F9EA 1BJUA 3NRLA 3QGNB 4OM9A 4CRCA 2BY6X 2FWWA 4MVNA 1GI9B 4CREA 2WPKS 4OS4A 1O2LA 1UK2A 1FZZA 2PUXB 2Q1JA 4KTUA 5FPTA 1AHTH 1FAKH 1GI2A 1WUNH 1XXFA 5FHTA 3SQHE 2VWNA 1MTNB 2WV5A 1W2KH 3FOAA 2FESH 4D9QA 3FZZA 1OWDA 1P57B 4ASHA 4AFZA 1BRAA 4OS2A 1P2OA 2O8LA 2P16A 1GJ6A 1CE5A 1UTJA 3ZVDA 5EQQA 1AVXA 2IN2A 4WH8A 2HPPH 4H6TA 1HIAB 2Z3CA 3MO3A 1OYQA 2WPIS 1C9PA 2W3IA 2TGTA 1P9UA 1QR3E 5HIYA 2TGPZ 4MTBA 1HYLA 2PWXA 3RXHA 1E35B 4TWWA 1P02A 1W0YH 1P2MA 2FPZA 2CF9H 1O3NA 3SBKA 2A7CA 1CGHA 3C27B 2BY9X 1GJ9B 1Y3WA 3MNCA 3T27A 4INLA 1UVTH 4Y7BA 5DJ7A 1FUJA 3ATIA 3TGIE 3ZVGA 2G00A 1O38A 1UTOA 1BITA 3LOXA 3BTTE 5FBEA 1V2ST 5DP4A 1HJAB 3K2UA 1CT4E 3F68H 1XKBC 1LO6A 1XMNB 3PTNA 4WXIA 2YNBA 4M9FA 4ABFA 2K8IA 1A61H 1O35A 2W7UA 2CJIA 4MNXA 3GY7A 3BTWE 4XBBA 5GNDA 1TGBA 3LGYA 1JOUB 1AD8H 1TX7A 4I31A 3A86A 4KTSA 3RU4D 4B75A 1WTHD 5HM2A 3WY8A 2VWOA 5EGMA 2A5KA 1NFYA 1YPHE 1O3LA 2V35A 3O8CA 2Y5FA 1OWIA 3MNXA 1XVOA 4SGBE 3F9FA 2W6JD 2WPJS 5T1VA 1YYY1 3RU4T 3M3TA 1WYKA 1HB0B 1O2JA 1NM6A 2J4IA 1C2HA 3RXCA 2WPHS 3O8BA 5TCCA 2GCTB 4O9VA 1TX8A 1C4U2 2BY5X 2XYAA 3AASA 3SV9A 1H9LB 4CRGA 1VITH 1O5AB 2EI7A 4Y10E 6CHAB 1F5LA 1J15A 2GV7A 1DICA 4XOJA 4K1SA 1SQAA 1SGDE 4TY7A 3DT0H 4X2VA 1HAVB 1H9HE 3ODDA 1IHTH 1Y5AT 4X6NA 5F6MA 4JCNA 4ABJA 1F0UA 1GJ4H 4MNWA 3QZQA 2WV4A 5F8TA 4ZMAH 3SW2B 2H1UA 3FP6E 1W0ZU 1EPTA 1LPGB 2QC2A 3ITIA 3VXEH 1G3CA 5C94A 3KGPA 1K2I1 1EB1H 1UTNA 2FIRH 3GY8A 3JZ1B 3QX5H 2B5TB 1CA0C 2P94A 5BPEA 5CE1A 1SPJA 2F9UA 1IQNA 1C1OA 1O3HA 4BAMB 3RP2A 5PTPA 4H6SB 1O3DA 2NU0E 3TGJE 1XVMA 1HAOH 1EAIA 1G37A 5FXLA 3STIA 1C2FA 5J4QA 3CENA 2BDBA 4MDSA 1Y3VA 3SUEA 1IQHA 2ZTXA 1HAYB 1XKAC 2KZ4A 5DGJA 4KTCA 3TIUA 3QTOH 4YZUA 3A81A 2RA3A 1AQ7A 1BTXA 1A5GH 1WSSH 2M5TA 3QGJA 4YT7H 4X1PU 3PRDA 3PV4A 3CS0A 3GOVB 1QURH 1UHBA 4Y8YA 3LH1A 4AB9A 4Y7AA 2O8MA 1SBWA 4BTUB 5DPAA 3GCNA 3SZEA 4E05H 2BY7X 3VGCC 1HUTH 1UVUH 1C2MA 4CRAA 1GDNA 2QXHA 1P2KA 1VJ9U 2SNWA 1SLXB 1S83A 4FUCA 3MO6A 5FPSA 1GDQA 2KFWA 1GMHG 4ACAA 5C2ZA 3HK6B 2G52A 5C0UA 1C4Y2 1B5GH 3U8OH 4H42U 5CHAC 5HGGA 1C2LA 8GCHG 5K0HA 5CMXH 3M5OA 4K1TA 1ELAA 4AFQA 3SV7A 3ZZBA 2ZHQH 2FZZA 4D8NA 1IQEA 2FX4A 3RXKA 1GMDF 1V2QT 2ZECA 1AIXH 3KQ5A 2A4OA 4YESB 2Y5GA 1WDIA 2OP9A 1YPEH 3K9XB 3RMLH 1FN6A 2PKSC 1IAUA 1EB2A 5ABWA 1V2KT 5DP8A 9ESTA 2O8TA 3M7QA 1O3GA 2PSXA 3HATH 1TGNA 5HYOA 1SFIA 2FEQH 1RRKA 1C5LH 3F1SB 1J16A 4RKJB 5DKMA 3PV2A 1O2SA 1Q2WA 3OE7D 1P9SA 1TA2A 2BZAA 1NC6A 3OSYA 3ZV9A 2JJ1D 1MCVA 2A2QH 4B2BA 1CHOG 5JB8S 5ESTE 3ZVAA 3P8NA 4ZKNU 4TWYA 3RXDA 1C4V2 1GMCG 1C5YB 2OTVA 1AKSA 1O2KA 3SU4A 5EOKA 1RD3B 2ZGJA 5FX6A 4JZIA 2BD3A 1P09A 2ZU5A 1NFWA 1Z6EA 3Q3XA 2V3OH 2W3KA 1AU8A 3OTPA 1O3AA 1GI7B 2G5NA 4B71A 1F7ZA 3L3TA 3E0NB 3SV6A 2HWLB 2NU4E 1TBQH 3E16B 4ABGA 3GYLB 1H8ED 3KQEA 1MQ5A 2GDEH 4PROA 2GTBA 4AX9H 1CSOE 2ZHEH 1A3EH 2ZDKA 3FP8E 4Q4LA 3T2NA 2ZZUH 1L4DA 3IWMA 2A31A 1MUEB 2JJ2D 1SFQB 4LOYH 1TQ7B 1UK4A 3LGVA 5GCHG 1N6XA 4WMDA 4FUFA 4HFPB 4MNVA 3S69A 3KYFA 5DP7A 3GY4A 1O3OA 3G01A 1JIMA 2BHGA 1FPHH 1MCTA 3I29A 2AMPA 4X8VH 3F2FA 2I6SA 4ISOA 1P2JA 1QA0A 1TNIA 3W1EA 1FY3A 1Z7KA 1SR5C 2YNAA 1GPZA 3MTYA 2BXUH 2BDGA 4OS1A 4F4OC 3DFLA 2FLBH 3VXFH 1YCPK 1RGQA 2AMDA 3N7OA 4A1VA 3KCGH 1GHBF 1NBME 2F91A 7ESTE 1O32A 5HM9A 3ESTA 1IQJA 1ZJKA 2OINA 3SI3H 4ZROA 3M35A 4U30A 3K6ZA 3DD2H 3A83A 1QZ8A 1YPJH 3E6PH 4NIYA 3PO1B 2CHAB 3ZZAA 1E0FD 3UAIC 1BBRK 1GJBB 2L74A 2BQ7B 5FCRA 1BTHH 1FV9A 1MABB 5DP3A 4ABHA 3EE0B 1ETRH 1ETSH 1YPHC 3OY6U 3P8GA 1GMDG 5B6OA 1IQKA 3SHAH 4CHAC 1EPTB 2ZCHP 2SGEE 5TCAA 2P8OB 1O2TA 2PSYA 2W7SA 5A09A 2XWBI 1HPGA 4K8BA 2XBVA 3RXAA 2BX4A 1L1GA 4JZDH 1P01A 3QK1A 4FUGA 3SNBA 1FN8A 2UWPA 2OK5A 4Z1MD 4K8YA 1ZMJA 1TBRH 4CRDA 1K1NA 1TYNA 1W7GH 1KMHB 1KTTB 3BTDE 2FYQA 2M2AA 4CBOA 2R3UA 3TGKE 1VKYA 1AFQB 1S81A 1YLDA 2XOKD 4AOQA 1J9CH 1YLNA 2OQUA 1SQRA 1YP9A 1EUFA 2VNTA 1GHWH 2HOBA 1AE5A 1GMHF 5AVDA 2QF5A 1Y59T 2JH6D 2BLQA 1SVPA 1UTQA 2C8YB 2BY8X 1ZYOA 3BG8A 5JBCS 1AO5A 1E34B 3SQEE 1GJ5H 1H8DH 2F83A 3AW0A 3PWBA 2AYWA 4OGXA 1TRNA 3BG4B 1O2IA 2FLRH 2JH0D 3EA8A 1HAXB 3QO6A 2CMYA 1UW7A 4Q7YA 2HPQH 1QBNA 2ZDNA 2QXJA 2OC8A 5GXPA 1W11U 5JBBS 1P06A 4MPVA 2AHME 5EXMA 1C5PA 1C5NH 3VB3A 1ZTKA 4UFEH 4XSKU 2VBCA 4NGAH 2V3HH 5C0TA 1WQVH 1SL3A 2Z94A 3EE7A 3S0NA 1P3CA 3NXPA 3SU6A 1GHYH 1ZHMA 3SJKA 3E3TA 4B6FA 4IN2A 1CHOF 2QIQA 2JKHA 1G32B 4IN1A 3RLWH 3MQKC 1FY1A 1GL1A 4AG1A 4I33A 4WF8A 2KX4A 2ZDAH 1MTNC 1P03A 5DO4H 3A8CA 1XM1A 1Y5UT 2FS9A 3MU0A 1OOKB 3D65E 1L0ZA 2D2DA 4HI3A 4Y6DA 1S6LA 2ZPQA 2DUCA 5SGAE 3W95A 3T28A 1DT2A 5DK1A 3HKJB 1GJDB 1OXGA 4TYDA 1S0QA 2TPIZ 1HXEH 1UCYK 3BSQA 3F2GA 3MU5A 2ZPRA 3OX7U 3PRBA 4WXVA 2TGDA 1F0RA 3GS9A 1ELTA 2EC9H 1BRUP 3AVZA 2STAE 1GBDA 3BTHE 2ZU1A 1DPOA 1BTPA 4ABDA 3TJVA 4BTTB 1HAIH 1LDTT 1MTUA 4HG6A 5C1UA 5C17A 4E7RG 1YCPH 2VB0A 3U98H 3SO3A 1SOTA 4A6LA 1QTFA 4B2CA 4F48B 3EYDA 1EP5A 3PLPA 1S6FA 1P8VC 3KQDA 3OU0A 3I77A 4AFUA 1ANDA 3S9BA 3LONA 5FCKA 4ZXYH 1OP8A 1QA7A 3P92A 4CRFA 2A4QA 4WMFA 3ZZ6A 2R9PA 5H4IB 7LPRA 2Y82A 3EA7A 5EQRA 2H9HA 4ISHH 4FVDA 1NRRH 2VVUA 2C8XB 4OGYA 1GJ8B 3ZVCA 2BVSH 4UD9H 2GCHG 4ESTE 3SYJA 3TLOA 2ZF0H 2OC0A 2HNTF 3A82A 5EQSA 1EAXA 3U28C 4OS6A 3TNSA 1C1UH 1B0EA 3LGIA 3PV5A 4GUXA 1Q31A 2BD4A 1DE7H 1MQ6A 1NT1A 4WVPE 3EDXB 3A84A 1O33A 3VB5A 1ZOMA 1XUFA 1LHDH 1TGTA 3SV8A 2GD4B 1DSTA 2ZU2A 1F5KU 1TPPA 1VITF 4XE4A 1D3PB 1LHGH 2WPLS 3GY5A 2RFKC 1C5OH 2ZNKH 5A8ZA 5BRRE 2A7JA 5T6GA 4ASUD 4RKOB 2GX4A 1E1QD 1TQ0B 3ZYEA 5J4SA 4A92A 2Y5HA 3LGTA 1NRNH 2VVCA 1S5SA 3L33A 1CA0B 1HJ9A 4GVUA 1V6DA 2Q6DA 2BDCA 1YF4A 2FI4E 1QRZA 1C5ZB 2NU1E 3LT3A 1ZGIA 5EW1H 4NA7A 1TA6A 2UUYA 3NUMA 2BTCE 4K60A 5EJZA 2H6MA 1T8LA 3NWUA 3RXRA 4FU8A 3R0FA 5C5NA 1O3FA 2QCYA 2LELA 1TRMA 2RDLA 2O8WA 1TBZH 4NSVA 3BV9B 2VWMA 5GJ4B 1PYTC 1CGJE 5E0GA 2QYIA 2BLOA 1NY22 2TIOA 1MAXA 4ZUHA 1O2UA 1SLVB 1A4WH 3FVFB 4KKDA 1ANBA 4RT1A 1X7AC 2Z9LA 3SOSA 1MH0A 1PPFE 4JYTA 1DX5M 2OC7A 2ODYB 3NKKA 1O2RA 3SZNA 4DT4A 3ZV8A 1O2QA 1THRH 4GCHF 1T8NA 2F9OA 1TX6A 3RDZA 4YOJA 1GBHA 4MQAA 1QBVH 1BMNH 4D76A 2AEIH 2HALA 3HPTB 2FMJA 1O5FH 8LPRA 2J95A 1PPBH 3OEED 5LPRA 1TMTH 3SJ8A 1EKBB 1CT0E 1ESAA 1YPMH 3M37A 4QT8C 2FOBA 1O3PB 3IITA 1V2OT 1W10U 4JYUH 1GJ7B 3ATMA 4AC9A 1XX9A 2RDEA 4BAQB 1VR1H 3NCLA 2C4FH 4J2YB 3UWIA 1HXFH 2QA9E 5CHAB 1DY8A 7KMEH 1ABJH 1K28D 1CBWB 4AFSA 5FL7D 3NK8A 2R0LA 4OS5A 2GZ7A 1EZSC 4X2XA 2ZTYA 5JYIA 4I8JA 1YKTA 3SU2A 1OWHA 1EZUC 3RXVA 1K22H 1ARBA 1SC8U 2ZKSA 4ACBA 4FVBA 1TIOA 1DWBH 1NRPH 3LKWA 2Y7XA 1YPLH 4O97A 1FJSA 3BTQE 3ZZ8A 1TOMH 2VJ1A 4DY7B 1KXAA 2ZDMA 1EOLA 3UOPA 1YM0A 5C67A 5EU8A 1LPKB 2SGDE 3SHCH 1TNLA 3RMOH 1QBOA 3STJA 4Z0KA 1MKXK 3FFGA 3SUFA 2GDDA 2ZFFH 1SGFA 3A7VA 1Y3UA 2FODA 2GZ9A 2J94A 1PQ7A 5A0BA 1RJXB 2JETB 1LPZB 3LIWA 1NO9H 1MZDA 4MNYA 1E38B 4ZHLU 3UREA 1BRCE 1PQ5A 1GJCB 4JK6A 1W0JD 1KDQA 2P59A 1ELCA 1TONA 3ZZ9A 1GBJA 1GVZA 2BVXH 3V12A 1NS3A 1A5IA 4ZKRU 3SU3A 3MOCA 3RXJA 3SNCA 3WW7A 3MO9A 3O8RA 1K1PA 1N1LA 1YCPM 3DSPA 2TRMA 3A7YA 1WV7H 2QXIA 4YO9A 2OBQA 2VGCC 4O3TA 1FLEE 6GCHG 1RTLA 1UTMA 1GG6C 1EOJA 3SGAE 4FETA 3SGBE 1DITH 2YMSC 1SB1H 1EXFA 1TNKA 1IHSH 5EPYA 1MKWK 1GGDB 1CVWH 3PLBA 2J9NA 1GL0E 2ZFPH 1EJMA 1N8OB 2OUAA 4TY6A 2OLGA 5FX5A 2GMTB 4BXWA 1F5RA 2BVRH 1SGQE 1ZGVA 1DLKB 5TJXA 1QY6A 2BD2A 2GV6A 4O03A 3GCHB 3TK5A 2BDIA 1P2NA 4MPWA 3ZZ5A 4A1TA 5DN6D 3RMMH 5ETXA 2VU8E 5IYTA 1VCPA 1OS8A 2FYRA 3UPEA 1DDJA 4ISNA 1GHVH 3TH3H 1RIWB 3MU1A 1SQOA 1KLTA 2HVYB 3HGPA 2G81E 2PKAB 3QUMP 1J17T 1HAGE 1TLDA 1ZPBA 2R2WU 2LNCA 1FPCH 1CHGA 3GISB 2J2UA 1TPAE 3B8JA 4ZKOU 1CGIE 3EGKH 4Y71A 3ZZDA 4WJG2 2G55A 3V13A 1ABIH 2JDID 2VH0A 2J34A 1W0KD 2ULLA 4AN7A 2WUCA 2F4LA 4NCYA 1FIZA 1V2LT 2ZPSA 3UNSA 3B23B 5F53A 2GT8A 3VEQB 3VG8A 2XXLA 5DSFA 1YLCA 4NA9H 3PO1C 3SU1A 2Z9IA 3K65B 4IC6A 1DWDH 1O39A 2DE8A 1THPB 4HZHA 1H4WA 2Y7ZA 4CHAB 3UNRA 1EPTC
chains in the Genus database with same CATH topology
4U32A 3D62A 2FDAA 3KQBA 3A7WA 5L2ZH 5JDUB 1V2PT 4X1QU 3URCA 5GDSH 2ANKH 1VCWA 3DUXH 2VIQA 4Q7ZA 1OKXA 2R0KA 1TB6H 1ID5H 1FIWA 3A89A 1GDUA 2C8ZB 3U1IB 2FXRA 5EPNA 1C2GA 5DG6A 3PMAB 1D3QB 4E06H 1QB6A 3GDUA 1QFKH 3H7OA 3M5MA 3LJJA 4DW2U 4GHQA 1EAWA 2VIPA 1G30B 3M3SA 2Z9KA 1ZZZA 1UTKA 1QHRB 1TNJA 1Y3XA 2AMQA 1NTPA 3QLPH 1YPGH 4LXBH 4BOHA 1HJ8A 2QGRA 1EZXC 2G5VA 2W5EA 1FI8A 1GMCF 2R2MB 1BHXF 2OXSA 1Z1JA 2OD3B 3ZZCA 3L6PA 1O2ZA 1T32A 4VGCC 5JB9S 4ZHMU 2IOTA 7GCHG 4JZEH 2EI6A 2ZDLA 1C5SA 3A88A 3BG4C 3UOUA 1O3KA 5F03A 3RXBA 1QCPA 2EI8A 3M36A 2FS8A 2HVXA 1GHBG 1YGCH 2B9LA 4GSOA 8KME2 5I46H 4DJZB 3CS7A 1ZSLA 2XRCA 3TU7H 1UMAH 6CHAC 2UUFB 1K21H 4A1XA 2ZA5A 1AUJA 9LPRA 1AKSB 1QB1A 1EX3A 1KXDA 1PPCE 4GAWA 3OY5U 3MU4A 5GCHF 3S9CA 1QJ7B 5E2PA 8ESTE 2ZP0H 5C1XA 2A7HA 2XC0A 4AZ2B 4INHA 1C5MD 2ZC9H 1JXPA 1HBTH 3H7TA 2H5CA 3SNAA 1ELDE 1V2JT 3FZDA 3TJNA 1C5QA 1DOJA 1ELEE 1UVOA 2PGBB 4R8TB 1NROH 4A7IB 1RS0A 1Z1IA 1G3EA 1G2LA 1DSUA 2A4RA 3Q3YA 1V2RT 2ZGCA 1XUHA 1LHCH 3P6ZB 1A0JA 2BQ6B 3NZIA 2OC1A 3GCTF 5EXNA 3A87A 4IGDA 3RXEA 2PGQB 3QN7A 1M9UA 1MKWH 5E8EH 4GPGA 3PMHB 1KDQB 1KLJH 1CQQA 1C9TA 4ZHAA 3GDVA 4X8SH 3RXGA 2G8TA 3A7TA 2VVVA 1O5EH 4X6MA 1C5VA 2WYJA 2ZGHA 1LVOA 1C5TA 3FAOA 1GI1A 1AN1E 5GIBA 1NPMA 1Z8IB 1HAZB 1LKBA 4LZ4B 1SGFG 1RTKA 2AS9A 2CXVA 1TGCA 1F0SA 2ZQ2A 3TPIZ 4X6OA 3VGCB 2ZGBH 2BOHB 3UQVA 3H5CB 3AAVA 1GBFA 2WYGA 5A8XA 1CU1A 1GBKA 4GHTA 1DXWA 1GCTC 1W13U 1C2EA 1EQ9A 2OCVB 1KXBA 1O5BB 3U1JB 4YOIA 4WY3A 4MPXA 2DE9A 1DWEH 1GI5A 1V2MT 4AORA 5FAHA 1BJVA 1AB9C 4U01A 3UWJH 2FOMB 1IQIA 3NPSA 5AFYH 1GI0A 2O9QA 1A2CH 1FY8E 1SGCA 1T7CA 2PKSB 2BLVA 5C3NA 1V2NT 4ISLA 2A1DB 3MU8A 4X8TH 1LKAA 3TJUA 4NWLA 3URDA 2XWAA 1BDAA 3LJOA 1J14A 1W12U 2RA0A 4Y11E 1A7SA 1JWTA 1GWAA 5C20A 2A5AA 3MYWA 1EZQA 1T8OA 1FXYA 1P10A 1VCQA 4MLFB 3MH7A 2BD8A 1BQYA 1SMFE 2ODPA 3E91A 4BANB 1SLWB 3DA9B 1FONA 3SUDA 2QV1A 3M7TA 1Z6JH 3PTBA 4X8UH 1ZTLA 2Y6TA 3KQCA 2H9EH 2BYAX 1YBWA 2XCFA 1KTSB 4WMEA 2ASUB 4K2YA 2D1JA 2QF0A 1ZJDA 4RSPA 3SORA 3ZZ3A 1A1RA 5I25A 1WU1A 3FANA 2I6QA 4DT7B 1ELBA 2WPMS 3A7ZA 4J1YA 1ZRBA 1N6YA 1FY5A 1GI3A 2ALPA 4FUBA 4B1TA 4D7GA 2AGGX 1SGPE 5A8YA 4YLUA 3RXUA 2C3SA 1QGFA 5F8XA 1LMWB 1L1JA 2C90B 2PKAA 7GCHF 1O2GH 3GCTG 5A0AE 1W8BH 2UUKB 4ZKSU 3CP7A 1VGCB 1XUIA 2STBE 4FUHA 2QAAA 1MZAA 3RXTA 1C1VH 3A8BA 1HRTH 1BMMH 4K69A 4X0WU 3KF2A 2GCTC 1NU9A 2ZFRH 5A2MH 4IW4E 3D49H 4CR9A 3A85A 1S85A 1GI6A 1GCDA 1TPOA 3RM2H 1OP2A 2XBWA 2ZU3A 4NIWA 3F6UH 4UFDH 1CA8B 1L1NA 3JZ2B 1EATA 1QJ1B 4NWKA 1NFXA 1O2XA 4NZQA 3MMGA 1V3XA 1ZTJA 4KELA 4YM9A 2FX6A 1FMGA 1K9OE 1O31A 1AVGH 2FI5E 4KGAA 1ACBE 4Y79A 1SGRE 1EP6A 2BXTH 1O5DH 1Z8GA 2F9PA 3S7HB 1LCYA 1Y8TA 4JZFH 2OQ5A 4TPYA 1L2EA 1QQUA 1O3EA 1O3IA 1SHHB 1SHYA 2Z9GA 3GY6A 1O3MA 1P04A 1QRXA 3SJ9A 3RXFA 1QB9A 1WBGB 4GLYA 1XUGA 2RCEA 1GHXH 2JH5D 1DS2E 1KXEA 4JMYA 2XC5A 3RXPA 2FOCA 3KL6A 2ZHWH 1IQFA 1C1MA 4AYVB 1G36A 4B2AA 1MU6B 3LGWA 1HCGA 1RFNA 1TAWA 1O2PA 2PV9B 1LQDB 4IMQA 1HIAA 2PTCE 3P17H 2XBYA 1Q3XA 1Y5BT 1MMJN 1O2HA 1BTWA 1AFQC 2ANWA 1O2VA 3S9AA 3PMJA 1A46H 1GVLA 3ZZ7A 1KLIH 1BIOA 1OP0A 1F92A 1AUTC 1HNEE 2FTLE 1THSH 4NZLA 4ZXXH 1HFDA 3ATWA 2FI3E 1W3CA 3FP7E 3PROA 1MU8B 1GHAF 1ESBA 1A5HA 4FU7A 3TNTA 2SGAA 1O5GH 4THNH 2B8OH 2J92A 1HDTH 3ZVEA 2IPHA 1MKXH 1DUAA 1BUIA 5E2OA 4JZ1A 2UWLA 2J38A 2F3CE 1V2VT 3BN9A 1BT7A 1GBMA 1AGJA 1OSSA 1FQ3A 4MPUA 5AFZH 1U6QA 1DXPA 4CH8B 1GBBA 1ANCA 4BTIB 1C1NA 1PQ8A 1HV7A 2G51A 1JIRA 3MWIU 3UTUH 1ESTA 1S6HA 2BZ6H 3SV2H 1SGEE 2NU2E 3ZYDA 1ZHRA 1CO7E 3BTFE 3MH4A 2H9TH 1QL8A 1UK3A 1XUKA 1HAPH 3V7TA 1D4PB 2SGPE 1P3EA 4HGCA 1BMLA 1KYNA 1S0RA 2D8WA 2FOHA 2Y81A 2H5DA 2H2ZA 3LH3A 4AGKA 4FU9A 1DM4B 2CF8H 3T62A 6ESTA 1P2IA 4D7FA 3U69H 1QIXB 1GHZA 3PWCA 4Y0ZE 2AIQA 1PYTD 1PFXC 1PPHE 2HGTH 1G3DA 1LTOA 1PPZA 4K1EA 4ABEA 1BTUA 4BAKB 1GBTA 3VB7A 4BXSA 3MHWU 3TK9A 1TMUH 3V0XA 4A5TS 1C1TA 1T31A 2KAIB 2ZI2H 1MTSA 4K5ZA 2G4UA 3EQ0H 1Z8RA 4ABBA 2B7DH 1GVKB 1O2YA 3BEIB 1PPEE 2GZ8A 2UWOA 2ZEBA 2ZFTA 3SU0A 3RC4A 1FDPA 3LC5A 3MH5A 5L2YH 1QNJA 3ATLA 1SGNE 2QXGA 3RXLA 1E36B 1GJAB 1K1JA 3LU9B 1WOFA 2A5IA 3BIVH 3EAJA 2SNVA 1ELGA 4Q80A 1MTWA 1KIGH 5HXFA 2VH6A 3M3VA 1LVYA 1FY4A 1O0DH 2FOAA 1K1MA 1KXCA 3RLYH 3RMNH 1O3CA 1OWEA 1SLUB 1BBRE 2XTTB 1S84A 3M5NA 1EASA 4VGCB 3VFEA 3E8LA 4I8KA 2Z9JA 3P8FA 1K1OA 3KNXA 1AI8H 1LVMA 1KXFA 2Z3EA 1ZLRA 4B74A 1S82A 2AERH 1MAYA 2CN0H 2ZCKP 3SGQE 4Y76A 4FUDA 2GKVE 4I32A 1C1WH 1GHAG 4NSYA 1DVAH 4WWYA 3M61U 5DP9A 3A8DA 3P8OA 1P05A 5GWZA 1KSNA 4XDEA 2CHAC 1C2DA 1UTPA 5T6DA 1W7XH 1ZSJA 3T5FH 1OWJA 2AFQB 2ZDVH 5T6FA 3E0PB 4Z6AH 2ZO3H 4X2YA 4YLQH 1LVBA 2YOLA 4FXGH 1A0HB 2VIDA 4DGJA 2ZTZA 2XBXA 1C2IA 4NFFA 3C1KA 1KY9A 2XW9A 4INKA 2GCHF 3LGUA 1D9IA 2AIPA 3A8AA 4BAHB 2ZWLH 2BDYA 1T4VH 3SUGA 4BAOB 2OBOA 3RXQA 2VIWA 2NU3E 1JBUH 3AAUA 1IQMA 5DP5A 2PUQH 5JBTA 3TJOA 5LPFA 1WQSA 4DIHH 1BMAA 1HJAC 5EXLA 2HRVA 1A3BH 2BLWA 4FUJA 3GY2A 4X6PA 4BNRA 1C1RA 1O3JA 3OYPA 2A2XH 2ALVA 4CR5A 4ABAA 1FAXA 1O37A 1DUEA 2ZHDA 1ZMNA 2W26A 1NESE 1QJ6B 3E1XB 1ZPZA 1O30A 3T29A 3E90B 3ENSB 2ESTE 3MNBA 1HLTH 1NRSH 4U2WA 1SGIB 2F9BH 3SNEA 3T26A 4WH6A 3QZRA 1MBQA 1G9IE 3QWCH 2PTNA 1W14U 2BD5A 1HAHH 1ARCA 1H9IE 1G3BA 1ZR0A 5C1YA 1JRTA 4ZH8A 2GP9B 2ILNA 1AWFH 2FP7B 2THFB 4IMZA 3K6YA 4AG2A 5L30H 1ETTH 2Z3DA 1SGTA 1AZZA 1XXDA 3M7UA 4RN6A 3A7XA 3DFJA 2P3UB 1BBRH 4X1SU 1A0LA 1CBWC 3UQOA 2QY0B 4DOQA 2ZCLP 1FNIA 3HGNA 4NA8A 1SGYE 1TGSZ 1ZPCA 1MTVA 1D6WA 1Y3YA 1AE8H 1AB9B 4Y8ZA 2GVFA 3P70B 3ZVBA 1F0TA 1VITG 2CGAA 3U8RH 2WUBA 5JPMH 1ELFA 4IBLH 2A45B 3QDZB 1C5RA 4H4FA 5E0JA 2BM2A 1LHEH 1TABE 4E7NA 1TOCB 1PJPA 1V2WT 4FUEA 2R3YA 2AH4X 4ZAEA 3SNDA 2HLCA 2ODQA 1DWCH 2BD9A 3RXOA 1BRBE 5T3HA 2G4TA 1TALA 1WTGH 2JETC 1LQEA 2D26C 3Q00A 1SSXA 1WCZA 3U9AH 1SQTA 1C1PA 3GY3A 1RTFB 1DY9A 4NIXA 1EJNA 1AZ8A 3S7KB 3IG6B 1GI4A 4D9RA 4I8GA 4YTAA 2ZQ1A 4B73A 2ANMH 1PQAA 1P12E 1TNHA 3ZZ4A 3TH2H 2C93B 2VINA 4F49A 4I7YH 1TWXB 3UUZA 3SJOA 1OX1A 3UIRA 2VGCB 5JBAS 3TITA 1GBEA 1DANH 1F2SE 2WINI 1H1BA 2SFAA 1ZRKA 3MFJA 2KAIA 2BX3A 5GPIB 5EODA 1TRYA 1T8MA 3TH4H 3R3GB 4X2WA 4Q7XA 5AF9H 1AMHA 3BF6H 3RXMA 1TNGA 3T25A 4GCHG 3SJIA 3ZVFA 4YOGA 1VZQH 1C5WB 3PLKA 1QL7A 3UY9A 3ELAH 2O8UA 1C5UA 3BTME 1MD8A 3UFAA 3AW1A 4I8LA 1O2MA 1O2OA 1IQGA 1NN6A 1AFEH 1VGCC 4DVAU 1BCUH 2F9NA 4SGAE 1QQ4A 2BDAA 1ZSKA 2VIVA 1JRSA 1UTLM 1UVSH 4TPIZ 1HGTH 3SN8A 3QTVH 3Q3KA 2QF3A 5A0CA 2AGEX 1SG8B 1D3DB 2K1QA 2RG3A 2V0BA 1ZMLA 3ODFA 3UNQA 4X1RU 1NFUA 3KHVA 3KIDU 1Z8JB 4UDWH 1AVWA 3Q77A 6GCHF 2FOEA 4CBNA 1GBAA 3DHKH 4DG4A 3VB4A 1QL9A 1V2UT 4ISIH 2XNIA 4JYVH 4I8HA 1H8IH 1O3BA 1K1IA 1QRWA 2Z7FE 1GBCA 4R0IA 2Z6BD 1TFXA 1SI5H 1G2MA 3BTEE 4X1NU 5LH8A 1YC0A 1L4ZA 1HAVA 3W94A 3UR6A 3HKIB 1T4UH 1BTYA 1P11E 2GT7A 1P0SH 1BZXE 1ZHPA 2A0QB 2HNTC 1B0FA 3LPRA 1ANEA 2BMGB 5F8ZA 6LPRA 4DIIH 2ZFQH 2B0FA 5FBIA 2Q6GA 2BD7A 4O3UA 5ESBA 4IC5A 4CH2B 2ZG0H 3ATKA 3GCOA 1C5XB 2ZU4A 4NFEA 3B9FH 5AHGH 2VWLA 2SGQE 5G4BA 4IS5A 3BTKE 1BOQA 3BEUA 3O8DA 2GGVB 1OPHB 3KN2A 1O34A 4FUIA 1Z71A 4YT6H 2FOFA 2LPRA 3MH6A 1BHXB 3BEFB 1CT2E 2BQWB 2HNTE 2VIOA 4ABIA 1C2JA 1TPSA 2PHBA 3PYHA 3LC3A 5IDKA 2F9VA 1UVPA 3GICB 5K7RA 3F9HA 1WAYB 3RU4E 3RXIA 4KP0A 1DLEA 5LPEA 4Y0YE 1O36A 2ZIQH 2FO9A 2XC4A 4OS7A 4LZ1H 1TMBH 4LK4A 1ORFA 4B76A 4Q2KA 3P95A 4XFQA 3U8TH 1LHFH 1B7XB 1PPGE 1EAUA 5L6NH 2P93A 2EA3A 3MI4A 2XCNA 2FOGA 1INCA 1MBMA 1J8AA 1C2KA 3HK3B 3TVJB 2BOKA 3D23A 3BTGE 1BA8B 2C8WB 4XBCA 4NG9H 4UONA 2P95A 3F9GA 1OWKA 1C1QA 2PLXA 2P3TB 4UEHH 1JMOH 1SOZA 5FPYA 1RXPA 1UCYH 1DFPA 3A80A 3UR9A 1XUJA 2PFEA 4UFFH 2FTMA 1GBIA 5EW2H 1VJAU 2IJOB 1GBLA 1AWHB 1MD7A 1O2WA 1V2TT 1D6RA 1P2QA 1O5CB 2P8OC 4CRBA 1EJAA 3GYMA 3RXSA 3SU5A 2A32A 3PB1E 3VPKA 1UCYE 4AYYB 3BIUH 8GCHF 1O2NA 1OYTH 4M7GA 5C5OA 3PM3A 5LGOA 3Q76A 2TBSA 1UHBB 5E0HA 3LDXH 2V6NA 3RUOA 2EEKA 1NU7B 3M5LA 3OTJE 4Y8XA 3RC5A 2ZGXH 1YPKH 1NZQH 4AB8A 3GDSA 3PMBB 1GG6B 1C1SA 2BB4A 1UO6A 4NIVA 4MG3A 4DCDA 1UJ1A 5DP6A 5HMAA 1ELVA 1AY6H 1GGDC