2QXIA

High resolution structure of human kallikrein 7 in complex with suc-ala-ala-pro-phe-chloromethylketone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
b'IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-7
molecule tags Hydrolase
source organism Homo sapiens
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxiA02
5DK1A 4ABHA 1CSOE 3L3TA 1HJ9A 2BVSH 1TIOA 1QL7A 1O3GA 3SI4H 4ABGA 1O3NA 2WPKS 1TGCA 1ZLRA 1AIXH 3UNRA 4X1SU 4X8VH 1IHSH 1YF4A 3KQCA 1KYNA 3C27B 1FY4A 3S0NA 1GVLA 1IAUA 2TIOA 1GPZA 3AVZA 1F7ZA 1FI8A 3RXVA 3O8RA 3PV4A 5HYOA 2NU2E 5FBIA 1MBMA 2ZDAH 2AMPA 4LXBH 2STAE 2G52A 1PYTC 1QBVH 1W12U 2OTVA 3GCNA 1SC8U 1BMLA 1E37B 2A4RA 2ZHDA 6CHAB 2M5TA 1PPHE 1CVWH 1SGEE 1C5NH 3SNCA 3GCOA 4GLYA 2ZDKA 2JETB 1V2WT 1TOMH 5HM9A 3BG8A 2UUYA 1NRRH 1SLUB 2XWBI 5EQRA 3GY3A 3STIA 3U1IB 4DGJA 1FAKH 1DE7H 1D3QB 1MU6B 1ETTH 3URDA 2EI7A 3BG4B 2GCTB 1BBRK 2XBYA 3EA7A 3RP2A 4O9VA 2WV5A 3PMBB 5A8ZA 5L6NH 2BXUH 4MVNA 5T6GA 1GJ9B 1E35B 1UHBA 5TCCA 1O3JA 4I31A 1A5GH 1LQDB 3E90B 3ESTA 4TY7A 2FLBH 7LPRA 1AU8A 4MPWA 3A81A 2BQWB 2Z9JA 2P95A 3NZIA 1DM4B 1NTPA 1PQ8A 1TNJA 3MO3A 3M36A 4D9RA 3E0NB 3P8NA 1DUAA 3RXEA 1EPTA 3VXFH 2G51A 1QRXA 1F2SE 1TQ7B 3DT0H 2V6NA 4ISOA 2Y80A 4A1TA 1EP6A 3E16B 1GBKA 2A4QA 3QZQA 3A7VA 4Z6AH 3ZZDA 1NRSH 3UREA 4AFQA 4X2YA 4Y7BA 2H9TH 1P09A 1YCPK 2G55A 4X8SH 1SLXB 5C1YA 4ZKRU 2ZDNA 1TNIA 4GHTA 4BXWA 2C8ZB 2BD2A 1OWDA 2BXTH 2A31A 3MU0A 4IN1A 1V2UT 2BY7X 3P95A 4X0WU 1MKXK 2AS9A 4NWKA 2GCTC 1AKSA 3VFEA 1O5BB 1ZMJA 2VVVA 1K1OA 1OX1A 1EB2A 1T4VH 1YYY1 1ARCA 3GY7A 1O5EH 2CXVA 3FP8E 1CHOF 3ZYDA 1HIAA 1VITF 3ATLA 1GJ7B 1NZQH 2Z3CA 4UEHH 2VGCC 2EEKA 2Z94A 1NFYA 2ZC9H 2BDCA 1C2EA 1Z8IB 1C1OA 1GHBF 1O5DH 4NIWA 5FCRA 4DW2U 5HM2A 2JH6D 1UK4A 1ANEA 3SZNA 3UR9A 3MWIU 1NS3A 1DY8A 1TMUH 1YGCH 3CENA 1GDNA 1HGTH 4K69A 3TLOA 1TGNA 2A45B 4NSYA 1QTFA 2XNIA 2ANWA 4OS2A 3A8CA 1PPBH 5A0AE 1QCPA 2AH4X 2QV1A 1PPEE 4X8UH 1C5VA 4JYUH 3RXFA 3E8LA 1HDTH 1J8AA 1JWTA 5T6FA 4CRBA 1GHAF 1VZQH 3ELAH 3ZV8A 4ABAA 2ANYA 1O3AA 3Q3KA 3SJ9A 3GY8A 2CHAB 3RLYH 3RM0H 1B0FA 2A4GA 2P94A 1WUNH 2GDEH 2B9LA 3OY5U 4INKA 3B8JA 3GDSA 3RC5A 3LDXH 3RXCA 1QHRB 5AFZH 1WTHD 5CE1A 1D9IA 4FU9A 1IQKA 1O3DA 1TWXB 1BRUP 1GMHF 4SGAE 4K1SA 1AI8H 1S6HA 2PGQB 4OS1A 4AFUA 2VIOA 3MNXA 2GCHG 1JBUH 1XUHA 1DT2A 3ZYEA 1E34B 1O2GH 1CA8B 3M3TA 4WMEA 3SV9A 2ZECA 1BUIA 3KCGH 3L33A 3LH3A 2H5DA 1ACBE 2Z6BD 1NPMA 1UTOA 1IQGA 3A84A 2WINI 3LGVA 1HYLA 2HPQH 5AFYH 4XBBA 5CHAC 1L1GA 1QA7A 1GMCF 1K21H 2GV7A 4B2BA 3ZZ8A 1WQSA 2ZTYA 1ZHRA 1TNLA 2R2WU 1FUJA 3U1JB 5DJ7A 1BHXB 1A7SA 4Q7ZA 3E6PH 1GCTC 4XBDA 1SGYE 2B5TB 1BOQA 2OC1A 5EQQA 1ESBA 1YPHE 5DP4A 3VEQB 1A1RA 1F0UA 1VGCC 4RKJB 4X2WA 5AVDA 3UTUH 3UQOA 3SNDA 2ANKH 2BD8A 2ZKSA 4A5TS 1T7CA 4DOQA 3RMNH 1UMAH 1ZTKA 1LKBA 4JK5A 1Y3UA 1C5MD 1MQ6A 4WF8A 1S0QA 3HK6B 3A8BA 1NFUA 4GSOA 1UK2A 1L0ZA 4XBCA 1SQTA 1H9IE 3SGBE 3S7HB 3S69A 4R0IA 4YT6H 1LVYA 3M5MA 1EPTB 3MNCA 4NIVA 4R8TB 2TGTA 4X1RU 1YPJH 4CRAA 4ZHAA 1MUEB 2VH0A 1QRZA 4D7GA 3F6UH 3PMHB 1EXFA 3MO9A 5LPFA 2W26A 5L2ZH 5EW2H 4U30A 1SGNE 3MYWA 3RLWH 2F3CE 4JZDH 1HV7A 1IQIA 2WPJS 1O33A 2AMQA 1SOTA 5EXNA 3A85A 1O3BA 2ZZUH 1BTPA 2FMJA 3UOPA 4B2AA 1XKBC 2VIVA 4B74A 1GI1A 1QQ4A 1MAYA 1P05A 4ISIH 2THFB 4A92A 2AIQA 1O3KA 1GBEA 2QYIA 5HXFA 2GT7A 3MNBA 1TE0A 2BDHA 1WCZA 3DFJA 1C5WB 1G3EA 1PQ5A 1SGTA 3Q76A 3TJVA 1BJUA 1X7AC 3EAJA 2Q6GA 1O2PA 1V2RT 3TH4H 1YBWA 2P16A 4FU8A 4O3TA 2Q1JA 2ZQ1A 4FXGH 1CU1A 3RMLH 3LJJA 2HNTC 2K1QA 4CRDA 3UWIA 1DANH 3UY9A 1D6WA 1ELBA 5A09A 4BTIB 1DLEA 2D8WA 1JRSA 1EQ9A 1ZGVA 2FOHA 4FU7A 1BITA 2F9UA 1XVMA 3SU4A 1CE5A 4Z0KA 4D7FA 1QBOA 2J34A 1XVOA 4XFQA 2I6QA 1T31A 1VCWA 3P8OA 1BTXA 1FQ3A 2UWOA 1DS2E 3ZVBA 4TWWA 1ZSKA 2PTNA 3ZZ5A 2VU8E 3ATMA 4I8GA 1MTVA 2P93A 3BTFE 2FOEA 3HGNA 3BTEE 3QO6A 1G30B 1C4U2 1GG6B 3ZZAA 1TNHA 1TMTH 4ISLA 3BEIB 2O9QA 1RTFB 1ZPZA 4CR5A 2Y7ZA 2BX4A 1VCPA 3E3TA 1V2MT 1UVSH 1O2TA 3PWBA 3IG6B 2F9NA 1EZXC 2GCHF 3V7TA 1NROH 1QB9A 5BRRE 1BCUH 1IHTH 1B5GH 2J95A 4IC5A 4XOJA 4NA7A 1YPMH 2H5CA 3TVJB 4BANB 1J16A 3GY6A 1D3PB 5C1UA 2V3OH 2HALA 2QXHA 5E2OA 3RXPA 4XDEA 4AN7A 5C1XA 1P04A 1N8OB 3TGKE 1J9CH 2V0BA 1MKXH 2LNCA 1GCTB 1WSSH 1WU1A 1IQFA 5FHTA 3GDVA 3BIVH 1O5CB 3EQ0H 1Y3XA 2IN2A 1T8OA 4DIHH 1UVTH 5C3NA 1UVOA 1L2EA 1SVPA 3NXPA 1P3EA 1DY9A 4K1TA 2BLQA 2ZU2A 2FOFA 1XM1A 3ZZCA 3ODDA 1EOLA 2O8TA 1K1JA 5C5NA 1GBAA 4BXSA 1JXPA 2H1UA 1ZPCA 1O34A 3BEUA 1DSUA 1D6RA 1BRBE 1GBIA 3U8RH 1AE5A 1SGQE 3M7QA 2XBVA 3NCLA 1MQ5A 4AGKA 1NU7B 4XSKU 5CHAB 4Y71A 2FODA 2SGDE 1EZUC 1MH0A 5ESBA 1LMWB 2OXSA 1YPKH 2BTCE 5FCKA 4WMFA 2GZ9A 1ELAA 3ZZBA 1AE8H 5LPEA 2J2UA 2OUAA 1ABJH 4Y10E 3URCA 1Q3XA 4WY3A 2SGPE 1ZPBA 2PUXB 5EPYA 1OYTH 1HUTH 3RU4E 4WXVA 1O2HA 1V2VT 1PPGE 2HGTH 4K8YA 1FONA 3TPIZ 1LHCH 1QR3E 1PQ7A 2BDAA 1LHDH 1RTLA 1ZRKA 2OC7A 1P10A 4BTUB 4KKDA 3A7TA 1YPEH 3UPEA 4DVAU 1DPOA 1C1VH 2ZIQH 1G37A 1WOFA 2WUBA 4E7NA 1VR1H 3F9EA 1P8VC 1NESE 2ZCKP 1QBNA 4NZLA 3M3VA 1IOEA 4RSPA 2AIPA 4BAHB 2XTTB 3Q77A 3GICB 3ZVAA 3P92A 2PLXA 2UUJB 1K1PA 3SORA 4OGXA 1FY8E 1PPCE 2W3IA 4YO9A 2FTMA 5J4SA 4FUHA 3F9GA 4MPVA 1LHGH 2F9BH 2ZTZA 5I46H 2BVRH 1BMMH 1L1NA 5F6MA 1GVKB 1RTKA 1RIWB 2LPRA 3TH2H 2R3UA 1ORFA 3QUMP 2ZU3A 2P8OC 5L30H 8GCHF 5JBAS 2ODYB 4B73A 2BD9A 4ZHLU 1W3CA 3SJOA 2Y5GA 2STBE 1GHVH 1D4PB 4LK4A 3DUXH 1ELGA 3KGPA 3ATWA 1W13U 5J4QA 1C4Y2 4HI3A 2FI5E 1V2ST 5F03A 1SSXA 2A7CA 2C90B 5HMAA 1FN8A 4X2XA 4B1TA 1F0SA 1EB1H 1O30A 1MTUA 3RC6A 1JIMA 3KL6A 1VITG 1IQHA 3SI3H 5GCHG 3S7KB 7GCHG 2UUKB 3CP7A 1DUEA 1MAXA 1HAVA 3BTGE 1ZSLA 2Z9LA 1YPGH 4M7GA 1BT7A 1ZSJA 4ISNA 3KIDU 3CS7A 1SPJA 2EI6A 2A5IA 1O2YA 3OYPA 1TA2A 4JMYA 3SGQE 1Y5BT 3A7ZA 3HGPA 2ALVA 1SFQB 1HJ8A 2ZFQH 1O5AB 2GMTB 1HAOH 3MO6A 5L2YH 3KHVA 3M35A 4NA9H 3LGUA 1SLWB 2FYRA 1ANCA 1GI2A 5JDUB 4Q80A 5EGMA 4FUIA 2XBWA 5A2MH 1CT0E 1YCPM 3TITA 2VB0A 4AFZA 1IQMA 1O2LA 5EOKA 1QB1A 3NK8A 1A0JA 1O37A 1MCTA 5JPMH 1L4DA 1ARBA 2FI4E 2HRVA 2ZPSA 4Y76A 1SI5H 1P03A 2QCYA 4CH2B 2RG3A 3T28A 1W7XH 1GJ6A 1J17T 4AYYB 2Y7XA 4Y0YE 5DP8A 2BM2A 3M7UA 4BAOB 1FAXA 1ELCA 3I78A 4LOYH 1WBGB 4ZKOU 3K2UA 2Z9KA 4LZ4B 1LCYA 3DA9B 1OWKA 4UE7H 1ID5H 2UUFB 3SU1A 3BF6H 4ASHA 2GMTC 4NZQA 4DT7B 1SG8B 9LPRA 3QN7A 1XMNB 1TABE 1GBMA 1YM0A 3KN2A 4K3JA 1C2JA 1AN1E 1O2MA 2GZ7A 3B9FH 3F1SB 1C2DA 3UIRA 4JZFH 2ILNA 2G5VA 2AGIX 1LTOA 1NY22 3U9AH 1TBRH 1GJ4H 4NG9H 4A7IB 3SNEA 5EG4A 1TRYA 1P2JA 1C5QA 3FAOA 4THNH 1CT4E 3MU4A 4GUXA 4WJG2 2ZGBH 2QC2A 3T26A 4MDSA 3UUZA 5ESTE 3M61U 1DOJA 1Z6EA 2SGFE 1V2TT 3MU8A 4HFPB 3EA9A 1ELVA 2PKSC 1C9TA 1O36A 1K22H 2SGAA 2VWOA 4O97A 3V12A 4BOHA 2P3TB 3GISB 3LJOA 4K2YA 2QXGA 2CV3A 1TRMA 2GZ8A 1Y59T 2Y5FA 2PFEA 1UTPA 1DITH 3LH1A 4X8TH 5DP5A 4VGCB 2YNAA 1YPHC 1A5IA 5EQSA 2P3FH 3RXUA 1AFQB 1TX7A 2PKAA 5FX5A 1P02A 4ZKSU 4NFEA 1CGHA 4MQAA 4AB9A 1THSH 1P9UA 1Y3YA 1GHYH 4CRFA 1GBTA 2ZPRA 2PKSB 1TLDA 1UTNA 2P3UB 1HXFH 1Z71A 3TGIE 2ZQ2A 2FOGA 1ZRBA 1O3PB 3A82A 1U6QA 1A4WH 4BNRA 4WH6A 4FVBA 2ESTE 2BDYA 3RXRA 1O2NA 3ZZ7A 5ABWA 4DURA 1LVBA 2FX4A 5E2PA 2VIQA 4FUJA 4H6TA 1FXYA 1V2JT 4YM9A 1DFPA 1S6FA 2ZCLP 1ELEE 2ANMH 3A7YA 5JB9S 1P06A 1LPGB 1EKBB 1P0SH 1B0EA 2FOAA 1O3FA 1LO6A 1IQJA 3PLBA 2A32A 1AVWA 3HKJB 1VCQA 1TMBH 3RXKA 2C8XB 1ZJDA 1JOUB 4ISHH 5CMXH 1UVUH 4K60A 1T8NA 1EJNA 1C5SA 3HPTB 2DE8A 4IN2A 5DO4H 3LIWA 1AB9C 2GGVB 1EASA 4K1EA 4WVPE 1ZHMA 3AAVA 4CBNA 2WYJA 2PWXA 1BTYA 2G81E 5F8XA 2Z3DA 4E7RG 4INHA 5A8XA 1XX9A 1LHFH 4GCHF 2WPHS 5A0CA 2ZDVH 1WQVH 4JZ1A 2XRCA 1GBHA 1O2ZA 6LPRA 3E0PB 3S9AA 2C93B 1TGBA 3MH5A 4X2VA 3HK3B 1YC0A 1HBTH 1P2IA 3FP6E 3SJKA 1EPTC 3VXEH 3WY8A 1SGPE 3M3SA 4O3UA 1GHWH 4MNXA 4Y0ZE 3RXGA 2TRMA 4MPUA 3RXJA 5C2ZA 4CRGA 1TYNA 3P8GA 3K9XB 2ZGJA 5IDKA 2ZDMA 4KTCA 3PM3A 8ESTE 1SGFG 3SJIA 3R3GB 1GWAA 3ZZ6A 1KXDA 3BTHE 2WPIS 2GKVE 2OBOA 2OC8A 2C4FH 3PROA 1NN6A 1LHEH 3LC3A 4AZ2B 1G36A 1ELFA 2A4OA 5PTPA 1K1IA 1F0TA 2QN5T 4WH8A 1C2FA 1SQOA 3N7OA 4X6PA 1O3OA 2BDIA 4CRCA 1VJ9U 4H6SB 1RFNA 1SL3A 1DWDH 2QA9E 1O5GH 4ABFA 2QIQA 2J92A 3GCTF 4E05H 1ZZZA 1PYTD 1GHBG 1C1TA 1SGDE 1ZTJA 2W7SA 2Y6TA 3TNTA 1Z8RA 1ANBA 1OPHB 5A0BA 1B7XB 3SN8A 3LGTA 1WTGH 1GI3A 1P2OA 4MG3A 3BEFB 1LVMA 1K9OE 2QGRA 1E36B 6GCHF 1A3BH 1SHYA 1MD7A 2FOBA 1TPAE 2GDDA 4LZ1H 1C5XB 4UFEH 2H6MA 1DXWA 2YNBA 1FIWA 1ZMLA 1C5LH 1HCGA 3M5OA 2CN0H 3MFJA 1QL8A 2R9PA 4OS6A 3TU7H 3P70B 3SV8A 1P12E 2SGQE 1CBWC 1O5FH 3M37A 4WXIA 4JYTA 4DJZB 1J14A 3SOSA 1O2WA 2F9OA 1K2I1 4NIXA 1UHBB 1QL9A 3ZZ4A 2CHAC 1P2NA 2B0FA 1THPB 3PMJA 1F92A 2AGGX 3RXHA 2PW8H 1UTMA 1AQ7A 1V2NT 5DP6A 5SGAE 2BOHB 1AVXA 3MOCA 1TFXA 2G4TA 2PUQH 4I7YH 3W94A 5EPNA 3LGIA 3MI4A 2ZFFH 3MNSA 1KXEA 4JYVH 3RUOA 1HAZB 3SGAE 2ALPA 2OC0A 5DKMA 2VNTA 3AAUA 2UWPA 3GYMA 1O2QA 3ZZ9A 2FS8A 4YOIA 2OCVB 4AORA 3KF2A 4OS7A 1A2CH 2ZG0H 1CO7E 1C2HA 4YLQH 2WPLS 4F4OC 3PTBA 1KXAA 2Q6FA 1C9PA 2GD4B 1FJSA 1GBLA 1P2QA 5B6OA 1S0RA 2BX3A 1HAYB 2AMDA 2VVUA 2HWLB 3Q00A 3SUGA 2BB4A 3U69H 4YOJA 4J2YB 3Q3YA 2NU3E 1YPLH 3MU1A 1AFQC 2QF0A 1Q2WA 1NFWA 4FUFA 3F68H 1AWHB 1GG6C 4FUCA 2J38A 1KTSB 5FBEA 3NUMA 2ZNKH 4ABIA 2QY0B 1GJ5H 1TONA 1BJVA 1OXGA 2F91A 2RDLA 4X6NA 3ZVCA 2Q6DA 4JCNA 1H9LB 1H9HE 1SB1H 3QTVH 4MLFB 2EC9H 3RXAA 2TGDA 2KAIB 2O8MA 2EA3A 3ITIA 1Z6JH 1DWCH 1EX3A 4A1XA 1SMFE 2FZZA 4IGDA 5EXMA 4GHQA 4K5ZA 3K65B 3SU6A 3SHCH 1C1NA 4AFSA 1BMNH 1QJ6B 2ZWLH 2ZCHP 5C5OA 1C5ZB 3T5FH 4TPIZ 1C5PA 1GJBB 1Z7KA 1Z8JB 2A7HA 3MH7A 2WYGA 1GJAB 3BTWE 3OSYA 1PJPA 2A5AA 1HAIH 2CMYA 1H1BA 3O8BA 1SHHB 3UNQA 1TALA 1OWJA 2CF9H 2NU4E 2AYWA 1RRKA 5DPAA 2A0QB 2PTCE 1GHXH 4KGAA 4BAMB 3VB3A 1EATA 3EYDA 2ZA5A 1AKSB 1J15A 1GI8B 2OBQA 3V3MA 3TJUA 2BY9X 4WMDA 3SNAA 8LPRA 2HNTE 5DG6A 3RC4A 2D2DA 5T6DA 1AUTC 1DWBH 5E0GA 5TJXA 1XUKA 4B75A 1WYKA 1GVZA 1HLTH 2PSYA 2VIDA 1A61H 2G5NA 2WUCA 1GJ8B 1TPOA 1BTWA 2WV4A 4UDWH 5JB8S 2OP9A 1QB6A 2TGAA 4Y11E 1SGIB 2XW9A 4CBOA 2XC5A 1KDQA 1Y5AT 2FDAA 3U98H 1ZMNA 1C5RA 1TBZH 3GYLB 4TWYA 1NC6A 2BLVA 1LQEA 3D65E 2BY6X 2FXRA 1TQ0B 2WPMS 4OS5A 4CR9A 3UWJH 3H5CB 2JKHA 3QZRA 5LH8A 3A80A 2DUCA 4ABBA 2JH5D 4Y7AA 4DG4A 4UD9H 1K28D 3VGCB 3VB5A 1DLKB 1AZ8A 1AWFH 2FWWA 5EODA 3VB6A 2ZHWH 1BTUA 4UFFH 3FZDA 3PLPA 1SGRE 3TK6A 1DX5M 3Q3XA 2FP7B 1GDQA 1O3CA 2ZGCA 2VGCB 4YTAA 1XXDA 3ZZ3A 1LPZB 1HJAB 1FV9A 3A7XA 3GCHB 1GMDF 1AZZA 4ZKNU 1F5KU 1W8BH 4Y6DA 1A0LA 1TRNA 1QJ1B 1FLEE 5GCHF 2H9EH 4FUBA 4UFDH 2EI8A 4DCDA 4HGCA 3BTME 3SW2B 1G2LA 2VJ1A 3MH6A 1JIRA 3PTNA 4AX9H 3KNXA 4X6OA 2O8UA 3BIUH 2BMGB 3I77A 5IYTA 1SLVB 4I32A 3VB7A 2XYAA 1KSNA 5FPTA 1TPSA 1Z8GA 3ATKA 1ZOMA 1MZDA 1FZZA 3DHKH 1C1QA 1GMDG 1T32A 3P6ZB 1GBFA 5I25A 2ZFSA 1GBDA 1HAGE 4GCHG 2OLGA 3SHAH 1YLCA 2P59A 3G01A 1H8DH 2VIPA 3SQHE 2RA0A 2XWAA 1QIXB 4NFFA 3SBKA 4IMQA 1FY1A 1A3EH 2GP9B 1RIWC 1GI4A 1P57B 4U2WA 1EAUA 2PR3A 3PLKA 1GMHG 3RMMH 3LGYA 1PFXC 1UK3A 4Y79A 1FPHH 5DGJA 3A7WA 1Y3VA 1GI7B 3AASA 1GL0E 4H42U 1QA0A 2RCEA 1MD8A 3S9CA 5DP3A 2ZP0H 2VINA 3A8DA 1KY9A 2BD7A 2YOLA 3UFAA 3ZVGA 3OX7U 2J4IA 3KQBA 5FXLA 1E38B 4BTTB 1C2GA 3RXDA 2QF3A 3NWUA 1NFXA 1N1LA 1GMCG 4NCYA 3E1XB 1E0FD 4GPGA 2FEQH 3UR6A 4TYDA 4ESTE 1XKAC 1UJ1A 2ZDLA 3BTQE 4J1YA 6GCHG 1EZQA 1FY5A 1TX8A 4IW4E 1O2SA 2QAAA 2XBXA 1AO5A 1S84A 2OD3B 4X6MA 1N6YA 3FFGA 1ZJKA 2BZ6H 1CHGA 3T62A 5DP7A 1AVGH 1V2LT 3OY6U 1GBJA 3D49H 1TBQH 2PHBA 1AY6H 3JZ1B 2R3YA 5G4BA 3FANA 1DXPA 3SV6A 2ZF0H 3NPSA 1EZSC 5GPIB 2GV6A 1VITH 2R0KA 1MMJN 2PSXA 2FS9A 1TA6A 3OTJE 1EAXA 3TK9A 3RU4T 4I8KA 1EUFA 1O3IA 1D3TB 3AW1A 4OGYA 3TIUA 2VIWA 4Q2KA 1ZHPA 1G2MA 3R0FA 1BMAA 4INLA 1F5RA 1HAHH 1HAXB 1MTNB 5K0HA 1N8OC 1ZR0A 3QGJA 1CA0B 1WV7H 2HLCA 3F9FA 1AHTH 1YKTA 1NRQH 2O8WA 1MU8B 4YOGA 5EXLA 3M5NA 2VWLA 2GTBA 4ZMAH 1G9IE 3VB4A 1LPKB 3TK5A 1P9SA 1Z1IA 3BG4C 4RKOB 3P8FA 1QJ7B 3GCHC 2CF8H 1BIOA 1ELTA 3JZ2B 2J9NA 1OYQA 1T8LA 2AGEX 1HRTH 1NRNH 1AB9B 1QY6A 1KLTA 1Q31A 1PPZA 1MBQA 3SUFA 3EDXB 2Z9IA 3GY5A 3ATIA 3RU4D 1YCPH 3PB1E 1OWEA 1L4ZA 3RXOA 5HGGA 1S85A 2HNTF 3RMOH 4ABJA 4IBLH 3RXQA 6CHAC 4AB8A 1Y8TA 4WWYA 4B2CA 1BRCE 2OQ5A 1PPFE 3RXTA 1C2KA 2O8LA 4NA8A 3L6PA 3MTYA 1SR5C 1HNEE 2ZHFH 3SQEE 3DFLA 2BQ6B 1P3CA 3MHWU 1KIGH 2FM2A 1W14U 3BTKE 3F9HA 3RXBA 3GY4A 4DIIH 2ZU1A 1S81A 3TJOA 5DP9A 3RDZA 4X1QU 1OP0A 3PMAB 1V2OT 1T4UH 1NU9A 1G32B 4JK6A 3EE0B 1DDJA 3M7TA 1EP5A 2VWMA 4MNYA 2SGEE 4OS4A 1GGDB 4Q7XA 1GBCA 5JBCS 1D3DB 1LDTT 4IMZA 1AGJA 1RXPA 1C5TA 2JETC 2ZFRH 3K6YA 3S9BA 1GI5A 2FOCA 1O32A 5T3HA 1GHAG 3VPKA 1IQLA 1W0YH 2XCFA 4NIYA 1P01A 1G3DA 1BRAA 1M9UA 2BLOA 3SU3A 1V3XA 3T2NA 2C8WB 4Q7YA 5A8YA 2ZGXH 1MTNC 1O2JA 1O2XA 1EJAA 2ZFPH 2ZU5A 4O03A 4UFGH 4YLUA 3QX5H 4FUGA 1UCYH 3LC5A 1A0HB 2A2QH 1HAVB 2KAIA 3LT3A 2B7DH 3SV2H 1ZGIA 4MNWA 1DVAH 2IPHA 2FX6A 2FO9A 1K1LA 1W7GH 1V6DA 2CJIA 2ZHQH 1O2UA 1H8IH 2F9PA 4KTUA 3SO3A 4UONA 2A7JA 2BDGA 2ZO3H 1W11U 1EJMA 4YESB 3A86A 1O0DH 3BTDE 2Z7FE 4AGJA 4U01A 1INCA 1WAYB 1TNGA 3HATH 3ZVDA 1CGJE 1BA8B 1GBBA 4NSVA 4TPYA 1TGSZ 4CHAB 3MU5A 4I8HA 4PROA 1GDUA 4X1PU 2XCNA 3SUEA 1FN6A 2A2XH 3O8CA 5BPEA 2R0LA 2PGBB 2D26C 2R2MB 1QQUA 2P8OB 2BYAX 4I8JA 1MKWH 2FESH 1HXEH 3LONA 4ZXXH 1IQNA 1SBWA 2FI3E 3A89A 1N6XA 1MCVA 2J94A 1L1JA 3A87A 1OS8A 1F0RA 4IS5A 2ZGHA 4QT8C 2FLRH 1GI9B 1KLJH 2SNWA 9ESTA 2ZFTA 1V2KT 7ESTE 5FAHA 1JMOH 2GX4A 2CGAA 4MPXA 4Y8ZA 3KQEA 1GGDC 2W3KA 1BQYA 8KME2 3A88A 1SOZA 1THRH 3ODFA 1KXFA 2OINA 3K6ZA 1ZTLA 2Y82A 3T27A 3LOXA 1DICA 3PO1C 4MTBA 1EOJA 2ODQA 1GL1A 2DE9A 2NU1E 3SJ8A 2PKAB 4D76A 1TAWA 4AYVB 3FP7E 3RXMA 1OKXA 2Z9GA 1C1SA 5E8EH 4D8NA 1CBWB 1O38A 3NKKA 3SNBA 4D9QA 2IOTA 1V2QT 4B76A 1S83A 1QURH 1W0ZU 1ESTA 1UO6A 2BOKA 2RA3A 1UCYK 4SGBE 1CT2E 1IQEA 4ZH8A 4U32A 4CH8B 1ZYOA 2ASUB 1ELDE 2Y5HA 4JZIA 3A8AA 1O2VA 5AHGH 1F5LA 1KLIH 5FX6A 1NRPH 3TH3H 1ESAA 1TPPA 5C67A 2BZAA 4AG2A 1SGCA 3D23A 4NWLA 3SU0A 1UTQA 3GDUA 3HKIB 3EA8A 1BDAA 1O31A 3PO1B 3IITA 2XC0A 1HB0B 3SU5A 1GCDA 1C5UA 3LU9B 1VJAU 4ZROA 1W2KH 5F8ZA 2PV9B 3LPRA 2TBSA 1GJDB 1AD8H 3RXLA 1MTSA 2FOMB 4A1VA 2G8TA 1Y5UT 1QNJA 4ZHMU 1DSTA 4F49A 3SU2A 2ZTXA 2GVFA 2JH0D 2QXJA 2I6SA 1ETRH 3P17H 5AF9H 2SFAA 3QDZB 1PQAA 3LKWA 3QWCH 1QFKH 2NWNA 3UOUA 1FPCH 1OP2A 2BD4A 3H7OA 4KP0A 4KELA 1V2PT 2TGPZ 4DY7B 2XXLA 2BHGA 3FVFB 5K7RA 1SFIA 3QTOH 5GJ4B 3H7TA 2ULLA 1CA0C 1OWHA 5EU8A 1OP8A 1LKAA 6ESTA 2VH6A 2V35A 1RD3B 2BQ7B 2UWLA 3VGCC 1XUIA 4CHAC 1O2RA 1T8MA 3KQDA 2BD3A 1O2OA 1A46H 4B71A 1RJXB 4H4FA 3RXIA 5EW1H 1MZAA 4HZHA 1P2MA 2ZEBA 3RXSA 1OWIA 3QK1A 1S5SA 5TCAA 1TGTA 1YP9A 4YZUA 3STJA 1Y3WA 3GOVB 2ODPA 1HIAB 2BY8X 4I8LA 4TY6A 3MH4A 1G3BA 2ZHEH 1CGIE 1O2KA 2AERH 3TJNA 3O8DA 1TOCB 3T29A 5E0JA 1UTKA 4I33A 1FNIA 1C4V2 1SQAA 4XE4A 7GCHF 4BAQB 1TX6A 3V13A 3QGNB 1C2LA 2ZPQA 1EAWA 1ANDA 4YT7H 1HAPH 4ZUHA 2FIRH 3RM2H 3M5LA 3V0XA 1C1MA 1O2IA 1AMHA 1TB6H 3OU0A 4GAWA 3ZV9A 1HJAC 1NT1A 3SUDA 3BSQA 1H4WA 2HOBA 4KTSA 4E06H 2QXIA 2Y81A 3PYHA 3DD2H 1GI6A 2C8YB 4ZAEA 3TGJE 3LGWA 4ZXYH 5JBBS 1NO9H 1TNKA 3D62A 1O35A 2BDBA 3A83A 1C1RA 3SV7A 1KXBA 2W7UA 4FUEA 1O3MA 2HPPH 3ENSB 4JZEH 2SNVA 3PWCA 3BTTE 2ZI2H 1UVPA 2F83A 5F8TA 2BVXH 5ETXA 1FIZA 1YLDA 2H9HA 4HTCH 3CS0A 5LPRA 1MTWA 1JRTA 4RN6A 2FPZA 1OSSA 1P11E 1SGFA 5E0HA 1AFEH 1S82A 1FMGA 1QRWA 1EAIA 4IC6A 4A6LA 1MKWK 1BBRE 3UNSA 3TNSA 4ABEA 2AEIH 1C2MA 1Z1JA 5FPSA 1O3EA 2IJOB 2FYQA 1BZXE 1O3LA 1C1UH 2G00A 4CREA 2D1JA 3U8OH 1A5HA 3E91A 1XXFA 2HVXA 1BTZA 4MNVA 5GXPA 1W10U 5JYIA 1RGQA 1HPGA 2AFQB 2VWNA 2F9VA 1KTTB 1XUGA 3C1KA 1K1MA 1VGCB 1AUJA 1K1NA 4FUDA 5LGOA 1O3HA 2BY5X 3GCTG 2GT8A 3MMGA 4NGAH 1CHOG 3IWMA 1XUJA 2VVCA 2Z3EA 5GDSH 3T25A 4VGCC 5GIBA 2OQUA 3I29A 4ABDA 5FPYA 1NM6A 4K8BA 2ZU4A 2TPIZ 2C3SA 5H4IB 3UQVA 3BN9A 4Y8XA 5C20A 1FY3A 2NU0E 1ABIH 2H2ZA 5JBTA 1ETSH 4X1NU 3QLPH 1RS0A 1XUFA 4AOQA 1GJCB 1UTJA 3BV9B 1DWEH 4FVDA 4GVUA 2XC4A 4AG1A 2A1DB 2BLWA 3ZVEA 1C5OH 3EGKH 1FDPA 1GI0A 5GWZA 2BD5A 1OOKB 3FZZA 1BHXF 1P2KA 7KMEH 1G3CA 1QGFA 1UCYE 3AW0A 1CQQA 1KXCA 1C1WH 1UTLM 1O39A 1GHZA 1BTHH 1C2IA 2FTLE 8GCHG 1BB0B 2A5KA 1C1PA 1LVOA 4BAKB 3GY2A 2G4UA 3W95A 1C5YB 2W5EA 2B8OH 1BBRH 3B23B 3U8TH 2V3HH 4Y8YA 1KDQB 3KEEA 1HFDA 3ZVFA
chains in the Genus database with same CATH superfamily
5DK1A 4ABHA 1CSOE 3L3TA 1HJ9A 2BVSH 1TIOA 1QL7A 1O3GA 3SI4H 4ABGA 1O3NA 2WPKS 1TGCA 1ZLRA 1AIXH 3UNRA 3UB0A 4X1SU 4X8VH 1IHSH 1YF4A 3KQCA 1KYNA 3C27B 1FY4A 3S0NA 1GVLA 1IAUA 2TIOA 1GPZA 3AVZA 1F7ZA 1FI8A 3RXVA 3O8RA 3PV4A 5HYOA 2NU2E 5FBIA 1MBMA 2ZDAH 2AMPA 4LXBH 2STAE 2G52A 1PYTC 1QBVH 1W12U 2OTVA 3GCNA 1SC8U 3F2GA 1BMLA 1E37B 2A4RA 2ZHDA 6CHAB 2M5TA 1PPHE 1CVWH 1SGEE 1SQRA 1C5NH 3SNCA 3GCOA 4GLYA 2ZDKA 2JETB 1V2WT 2IJD1 1TOMH 2L74A 5HM9A 3BG8A 2UUYA 1NRRH 1SLUB 2XWBI 5EQRA 3GY3A 3STIA 3U1IB 4DGJA 1FAKH 1DE7H 1D3QB 1MU6B 1ETTH 3URDA 2EI7A 3BG4B 2GCTB 1BBRK 2XBYA 3EA7A 3RP2A 4O9VA 2WV5A 3PMBB 5A8ZA 5L6NH 2BXUH 4MVNA 5T6GA 1GJ9B 1E35B 1UHBA 5TCCA 1O3JA 4I31A 1A5GH 1LQDB 3E90B 3ESTA 4TY7A 2FLBH 7LPRA 1AU8A 4MPWA 3A81A 2BQWB 2Z9JA 2P95A 3NZIA 1DM4B 1NTPA 1PQ8A 1TNJA 3MO3A 3M36A 4D9RA 4RT0A 3E0NB 3P8NA 1DUAA 3RXEA 1EPTA 3VXFH 2G51A 1QRXA 1F2SE 1TQ7B 3DT0H 2V6NA 3F0OA 4ISOA 2Y80A 4A1TA 1EP6A 3E16B 1GBKA 2A4QA 3QZQA 3A7VA 4Z6AH 3ZZDA 1NRSH 3UREA 4AFQA 4X2YA 4Y7BA 2H9TH 1P09A 1YCPK 2G55A 4X8SH 1SLXB 5C1YA 4ZKRU 2ZDNA 4FOUC 1TNIA 4GHTA 4BXWA 2C8ZB 2BD2A 1OWDA 2BXTH 2A31A 3MU0A 4IN1A 1V2UT 5KECA 3SYJA 2BY7X 3P95A 4M9FA 4X0WU 1MKXK 2AS9A 4NWKA 2GCTC 1AKSA 3VFEA 1O5BB 1ZMJA 2VVVA 1K1OA 1OX1A 1EB2A 1T4VH 1YYY1 1ARCA 3GY7A 1O5EH 2CXVA 3FP8E 1CHOF 3ZYDA 1HIAA 1VITF 3ATLA 1GJ7B 1NZQH 2Z3CA 4UEHH 2VGCC 2EEKA 2Z94A 1NFYA 2ZC9H 2BDCA 1C2EA 1Z8IB 1C1OA 1GHBF 1O5DH 4NIWA 5FCRA 4DW2U 5HM2A 2JH6D 1UK4A 1ANEA 3SZNA 3UR9A 3MWIU 1NS3A 1DY8A 1TMUH 1YGCH 3CENA 1GDNA 1HGTH 4K69A 3TLOA 1TGNA 2A45B 2JJ2D 1QTFA 2XNIA 2ANWA 4NSYA 3A8CA 4OS2A 1PPBH 5A0AE 1QCPA 2AH4X 2QV1A 1PPEE 4X8UH 1C5VA 4JYUH 3RXFA 3E8LA 1HDTH 1J8AA 1JWTA 5T6FA 4CRBA 1GHAF 1VZQH 3ELAH 3ZV8A 4ABAA 2ANYA 1O3AA 3Q3KA 3SJ9A 3GY8A 2CHAB 3RLYH 3RM0H 1B0FA 2A4GA 2P94A 1WUNH 2GDEH 2B9LA 3OY5U 4INKA 3H09A 3B8JA 2V7QD 3GDSA 3RC5A 3LDXH 3RXCA 1QHRB 5AFZH 1WTHD 5CE1A 1D9IA 4FU9A 1IQKA 1O3DA 1TWXB 1BRUP 1GMHF 4SGAE 4K1SA 1AI8H 1S6HA 2PGQB 2KM0A 4OS1A 4AFUA 2VIOA 3MNXA 2GCHG 4HG6A 1JBUH 1XUHA 4XRNA 1DT2A 2XOKD 1SKYE 1E34B 3ZYEA 1O2GH 1CA8B 3M3TA 4WMEA 3SV9A 2ZECA 1BUIA 3KCGH 3L33A 3LH3A 2H5DA 1ACBE 2Z6BD 1NPMA 1UTOA 1IQGA 3A84A 2WINI 5HKKD 3LGVA 1HYLA 2HPQH 5AFYH 4XBBA 5CHAC 1L1GA 4DT4A 1QA7A 4Q4LA 1GMCF 1K21H 2GV7A 4B2BA 3ZZ8A 1WQSA 2ZTYA 1ZHRA 1TNLA 2R2WU 1FUJA 3U1JB 5DJ7A 1BHXB 1A7SA 4Q7ZA 3E6PH 1GCTC 4XBDA 1SGYE 1QZ8A 1BOQA 2B5TB 2OC1A 1ESBA 5EQQA 1UW7A 1YPHE 5DP4A 3VEQB 1A1RA 1F0UA 1VGCC 4RKJB 4X2WA 5AVDA 3N99A 3UTUH 3SNDA 3UQOA 2ANKH 2BD8A 2ZKSA 4A5TS 1T7CA 4DOQA 3RMNH 1UMAH 1ZTKA 1LKBA 4JK5A 1Y3UA 1C5MD 1MQ6A 4WF8A 1S0QA 3HK6B 5HIZA 3A8BA 1NFUA 4GSOA 1UK2A 1L0ZA 4XBCA 1SQTA 1H9IE 3SGBE 3S7HB 3S69A 4R0IA 4YT6H 1LVYA 3M5MA 1EPTB 2KCYA 3MNCA 4NIVA 4R8TB 2TGTA 4X1RU 2PP6A 1YPJH 4CRAA 4ZHAA 1MUEB 2VH0A 2EY4C 1QRZA 4D7GA 3F6UH 3PMHB 1EXFA 3MO9A 5LPFA 2W26A 5T1VA 5L2ZH 5EW2H 4U30A 1SGNE 3MYWA 3RLWH 2F3CE 4JZDH 1HV7A 1IQIA 2WPJS 1O33A 2AMQA 1SOTA 5EXNA 3A85A 1O3BA 2ZZUH 1BTPA 2FMJA 3UOPA 4B2AA 1XKBC 2VIVA 4B74A 1GI1A 1QQ4A 1MAYA 1P05A 4ISIH 2THFB 4A92A 2AIQA 1O3KA 1GBEA 2QYIA 5HXFA 3UAIC 2GT7A 3MNBA 1TE0A 2BDHA 1WCZA 3DFJA 1C5WB 1G3EA 1PQ5A 1SGTA 3Q76A 3TJVA 1BJUA 1X7AC 3EAJA 2Q6GA 1O2PA 1V2RT 5EIYA 3TH4H 1YBWA 2P16A 4FU8A 4O3TA 2Q1JA 2ZQ1A 1BMFD 4FXGH 1CU1A 3RMLH 3LJJA 2HNTC 2K1QA 4CRDA 3UWIA 1DANH 3UY9A 1D6WA 4F48B 1ELBA 5A09A 4BTIB 1DLEA 2D8WA 1JRSA 1EQ9A 2KR7A 1ZGVA 2FOHA 4FU7A 1BITA 2M2AA 2F9UA 1XVMA 3SU4A 1CE5A 4Z0KA 4D7FA 1QBOA 2J34A 1XVOA 4XFQA 2I6QA 1T31A 1VCWA 3P8OA 3CNRA 1BTXA 1FQ3A 2UWOA 1DS2E 3ZVBA 4TWWA 1ZSKA 2PTNA 3ZZ5A 2VU8E 3ATMA 3MQKC 4I8GA 1MTVA 2P93A 3BTFE 2FOEA 3HGNA 3BTEE 3QO6A 1G30B 1C4U2 1GG6B 2J98B 3ZZAA 1TNHA 2KCPA 1TMTH 4ISLA 3BEIB 2O9QA 1RTFB 3FN8A 1ZPZA 4CR5A 2Y7ZA 2BX4A 1VCPA 3E3TA 1V2MT 1UVSH 1O2TA 3PWBA 3IG6B 2F9NA 1EZXC 2GCHF 3V7TA 1NROH 1QB9A 5BRRE 1BCUH 1IHTH 1B5GH 2J95A 4IC5A 3OFND 4XOJA 4NA7A 1YPMH 2H5CA 3TVJB 4BANB 1J16A 3GY6A 1D3PB 2JIZD 5C1UA 2V3OH 2HALA 2QXHA 5E2OA 3RXPA 4XDEA 4AN7A 3F2FA 5C1XA 1P04A 1N8OB 3TGKE 1J9CH 2V0BA 1NBME 1MKXH 2LNCA 1GCTB 1WSSH 1WU1A 1IQFA 5FHTA 3GDVA 5KEDA 3BIVH 1O5CB 3EQ0H 1Y3XA 2IN2A 1T8OA 4DIHH 1UVTH 5GNDA 5C3NA 2AHME 1UVOA 1L2EA 1SVPA 3NXPA 4ASUD 1P3EA 1DY9A 4K1TA 2BLQA 2ZU2A 2FOFA 1XM1A 3ZZCA 3ODDA 1EOLA 2O8TA 1K1JA 5C5NA 1YLNA 1GBAA 4BXSA 1JXPA 2H1UA 1ZPCA 1O34A 3BEUA 1DSUA 1D6RA 1BRBE 1GBIA 3U8RH 2J98A 1AE5A 1SGQE 3M7QA 2XBVA 1W0KD 3NCLA 1MQ5A 4AGKA 1NU7B 2QF4A 4XSKU 5CHAB 4Y71A 2FODA 2SGDE 1EZUC 1MH0A 5ESBA 1LMWB 2OXSA 4F55A 1YPKH 2BTCE 5FCKA 4WMFA 2GZ9A 1ELAA 3ZZBA 1AE8H 5LPEA 2J2UA 1H8HD 2OUAA 1ABJH 4Y10E 3URCA 1Q3XA 4WY3A 2SGPE 1ZPBA 2PUXB 5EPYA 1OYTH 1HUTH 3RU4E 4WXVA 1O2HA 1V2VT 1PPGE 2HGTH 4K8YA 1FONA 3TPIZ 1LHCH 1QR3E 1PQ7A 2BDAA 3VG8A 1LHDH 1RTLA 1ZRKA 2OC7A 1P10A 4BTUB 4KKDA 3A7TA 1YPEH 3UPEA 4DVAU 4RI0A 1DPOA 1C1VH 2ZIQH 1G37A 1WOFA 2WUBA 4E7NA 1VR1H 3F9EA 1P8VC 1NESE 2ZCKP 1QBNA 4NZLA 3M3VA 1IOEA 4RSPA 2AIPA 4BAHB 2QF5A 2XTTB 3Q77A 3GICB 3ZVAA 3P92A 2PLXA 2UUJB 1K1PA 3SORA 4OGXA 1FY8E 1PPCE 2W3IA 4YO9A 2FTMA 5J4SA 2RFKC 4FUHA 3F9GA 4MPVA 1LHGH 2F9BH 2ZTZA 5I46H 2LELA 2BVRH 1BMMH 1L1NA 4YXWD 5F6MA 1GVKB 1RTKA 1RIWB 2LPRA 3TH2H 2R3UA 1ORFA 3QUMP 2ZU3A 3N7EA 2P8OC 5L30H 8GCHF 5JBAS 2ODYB 4B73A 2BD9A 4ZHLU 1W3CA 3SJOA 2Y5GA 2STBE 1GHVH 1D4PB 4LK4A 3DUXH 1ELGA 3KGPA 3ATWA 1W13U 5J4QA 1C4Y2 4HI3A 2FI5E 1V2ST 5F03A 1SSXA 2A7CA 2C90B 5HMAA 1FN8A 4X2XA 4B1TA 1F0SA 1EB1H 1O30A 1MTUA 3RC6A 1JIMA 3KL6A 1VITG 1IQHA 3SI3H 5GCHG 3S7KB 7GCHG 2UUKB 3CP7A 1DUEA 1MAXA 1HAVA 3BTGE 1ZSLA 2Z9LA 1YPGH 4M7GA 1BT7A 1ZSJA 4ISNA 3KIDU 3CS7A 1SPJA 2EI6A 2A5IA 1O2YA 3OYPA 1TA2A 4JMYA 2F43B 3SGQE 1Y5BT 3A7ZA 3HGPA 2ALVA 5DN6D 1SFQB 1HJ8A 2ZFQH 1O5AB 2GMTB 1YY3A 3DCLA 1HAOH 3MO6A 5L2YH 3KHVA 3M35A 4NA9H 3LGUA 1SLWB 2FYRA 1ANCA 1GI2A 5JDUB 4Q80A 5EGMA 4FUIA 2KZ4A 2XBWA 5A2MH 1CT0E 1YCPM 3TITA 2VB0A 4AFZA 1IQMA 1O2LA 5EOKA 2V3MA 1QB1A 3NK8A 1A0JA 1O37A 1MCTA 5JPMH 1L4DA 1ARBA 2FI4E 4Z1MD 2HRVA 2ZPSA 4Y76A 1SI5H 2WHXA 2OK5A 1P03A 2QCYA 4CH2B 2RG3A 3T28A 1W7XH 1GJ6A 1J17T 4AYYB 2Y7XA 4Y0YE 5DP8A 2BM2A 3M7UA 4BAOB 1FAXA 1ELCA 3I78A 4LOYH 1WBGB 4ZKOU 3K2UA 2Z9KA 4LZ4B 1LCYA 3DA9B 3WWBA 1OWKA 4UE7H 1ID5H 2UUFB 3SU1A 3BF6H 4ASHA 1K0HA 2GMTC 4NZQA 1W0JD 4DT7B 1SG8B 9LPRA 3QN7A 3PRBA 1XMNB 1TABE 1GBMA 1YM0A 3KN2A 4K3JA 1C2JA 1AN1E 1O2MA 2GZ7A 3B9FH 3F1SB 1C2DA 3UIRA 4JZFH 2ILNA 2G5VA 2AGIX 1LTOA 1NY22 3U9AH 1TBRH 1GJ4H 4NG9H 4A7IB 3SNEA 5EG4A 1TRYA 1P2JA 1C5QA 3FAOA 4THNH 1CT4E 3MU4A 4GUXA 4WJG2 2ZGBH 2QC2A 3T26A 4MDSA 3UUZA 5ESTE 3M61U 1DOJA 1Z6EA 2SGFE 1V2TT 3MU8A 4HFPB 3EA9A 1ELVA 2PKSC 1C9TA 1O36A 1K22H 2SGAA 2VWOA 4O97A 3V12A 4BOHA 2P3TB 3GISB 3W1EA 3LJOA 4K2YA 2QXGA 2CV3A 1TRMA 2GZ8A 1Y59T 2Y5FA 2IPQX 2PFEA 1UTPA 1DITH 3LH1A 4X8TH 5DP5A 4VGCB 4ACAA 2YNAA 1YPHC 1A5IA 5EQSA 2P3FH 3RXUA 1AFQB 1TX7A 2PKAA 5FX5A 1P02A 4ZKSU 4NFEA 1CGHA 4MQAA 4AB9A 1THSH 1P9UA 1Y3YA 1GHYH 2VBCA 4CRFA 1GBTA 2ZPRA 2PKSB 1TLDA 1UTNA 2P3UB 1HXFH 1Z71A 5C0TA 3TGIE 2ZQ2A 2FOGA 1ZRBA 1O3PB 3A82A 1U6QA 1A4WH 4BNRA 4WH6A 4FVBA 2ESTE 2BDYA 3RXRA 2WV9A 2WSSD 1O2NA 2YMSD 3ZZ7A 5ABWA 4DURA 1LVBA 2FX4A 5E2PA 2VIQA 4FUJA 4H6TA 1FXYA 1V2JT 4YM9A 1DFPA 1S6FA 2ZCLP 1ELEE 2ANMH 3A7YA 5JB9S 1P06A 1LPGB 1EKBB 1P0SH 1B0EA 2FOAA 1O3FA 1LO6A 1IQJA 3PLBA 2A32A 3F0PA 1AVWA 5KGOA 3HKJB 1VCQA 1TMBH 2KCOA 3RXKA 2C8XB 1ZJDA 1JOUB 4ISHH 3EE7A 5CMXH 1UVUH 4K60A 1T8NA 1EJNA 1C5SA 3HPTB 2DE8A 4IN2A 5DO4H 3LIWA 1AB9C 2GGVB 1EASA 4K1EA 4WVPE 1ZHMA 3AAVA 4CBNA 2WYJA 2PWXA 1BTYA 2G81E 5F8XA 2Z3DA 4E7RG 4P02A 4INHA 5A8XA 5IK2D 1XX9A 1LHFH 4GCHF 2WPHS 5A0CA 2ZDVH 2CK3D 1WQVH 4JZ1A 2XRCA 1GBHA 1O2ZA 3GS9A 6LPRA 3E0PB 3S9AA 2C93B 1TGBA 3MH5A 4X2VA 3HK3B 1YC0A 2L6OA 1HBTH 1P2IA 3FP6E 3SJKA 1EPTC 3VXEH 3WY8A 1SGPE 3M3SA 4O3UA 5CHBA 1GHWH 4MNXA 4Y0ZE 3RXGA 2TRMA 4MPUA 3RXJA 5C2ZA 4CRGA 2W6ID 1TYNA 3P8GA 3K9XB 2ZGJA 5IDKA 2ZDMA 4KTCA 3PM3A 8ESTE 1SGFG 3SJIA 1NBMD 3R3GB 1GWAA 3ZZ6A 1KXDA 3BTHE 2WPIS 2GKVE 2OBOA 2OC8A 2C4FH 3PROA 1NN6A 1LHEH 3LC3A 4AZ2B 1G36A 1ELFA 2A4OA 5PTPA 1K1IA 1F0TA 2QN5T 4WH8A 1C2FA 1SQOA 3N7OA 4X6PA 1O3OA 2BDIA 4CRCA 1VJ9U 4H6SB 1RFNA 1SL3A 1DWDH 2QA9E 1O5GH 4ABFA 2QIQA 2J92A 3GCTF 3WWFA 4E05H 1ZZZA 1PYTD 1GHBG 1C1TA 1SGDE 1ZTJA 2W7SA 2Y6TA 3TNTA 1Z8RA 1ANBA 1OPHB 5A0BA 1B7XB 3SN8A 3LGTA 1WTGH 1GI3A 1P2OA 4MG3A 3BEFB 2KCAA 1LVMA 1K9OE 2QGRA 1E36B 6GCHF 1A3BH 1SHYA 1MD7A 2FOBA 1TPAE 2GDDA 4LZ1H 1C5XB 4UFEH 2H6MA 1DXWA 2YNBA 1FIWA 1ZMLA 1C5LH 1HCGA 3M5OA 2CN0H 3MFJA 1QL8A 2R9PA 4OS6A 3TU7H 3P70B 4I86A 3SV8A 1P12E 2SGQE 1CBWC 1O5FH 3M37A 4WXIA 4JYTA 4DJZB 1J14A 3SOSA 1O2WA 2F9OA 1K2I1 4NIXA 5DSFA 1UHBB 1QL9A 3ZZ4A 2CHAC 1P2NA 2B0FA 1THPB 3PMJA 1F92A 2AGGX 3RXHA 2PW8H 1UTMA 1AQ7A 1V2NT 5DP6A 5SGAE 2BOHB 2XNDD 1AVXA 3MOCA 1TFXA 2G4TA 2PUQH 4I7YH 3W94A 4B6FA 5EPNA 3LGIA 3MI4A 2ZFFH 3MNSA 1KXEA 3OEHD 4JYVH 3RUOA 1HAZB 3SGAE 2ALPA 2OC0A 5DKMA 2VNTA 3AAUA 2UWPA 3GYMA 1O2QA 3ZZ9A 3DSGA 2FS8A 4YOIA 2OCVB 4AORA 3KF2A 4OS7A 1A2CH 2ZG0H 1CO7E 1C2HA 4YLQH 2WPLS 4P00A 4F4OC 3PTBA 1KXAA 2Q6FA 1C9PA 2GD4B 1FJSA 1GBLA 1P2QA 5B6OA 1S0RA 2BX3A 1HAYB 2AMDA 2VVUA 2HWLB 3Q00A 3SUGA 2BB4A 3U69H 4YOJA 4J2YB 3DSPA 4AC9A 3Q3YA 2NU3E 1YPLH 3MU1A 1AFQC 2QF0A 1Q2WA 1NFWA 4FUFA 2GJGA 3F68H 1AWHB 1GG6C 4FUCA 2J38A 1KTSB 5FBEA 3NUMA 2ZNKH 4ABIA 2QY0B 1GJ5H 1TONA 1BJVA 1OXGA 2F91A 2RDLA 4X6NA 3ZVCA 2Q6DA 4JCNA 1H9LB 1H9HE 1SB1H 3QTVH 4MLFB 2EC9H 3RXAA 2TGDA 2KAIB 2O8MA 3KYFA 2EA3A 3FKSD 3ITIA 5C0UA 1Z6JH 1DWCH 1EX3A 4A1XA 1SMFE 1VKYA 2FZZA 4IGDA 5EXMA 4GHQA 4K5ZA 3K65B 3SU6A 3SHCH 1C1NA 4AFSA 1BMNH 1QJ6B 2ZWLH 2ZCHP 5C5OA 1C5ZB 3T5FH 4ACBA 4TPIZ 1C5PA 1GJBB 1Z7KA 1Z8JB 2A7HA 3MH7A 2WYGA 1GJAB 1FX0B 3BTWE 3OSYA 1PJPA 2A5AA 1HAIH 2CMYA 1H1BA 3O8BA 1SHHB 3UNQA 1TALA 1OWJA 2CF9H 2NU4E 2AYWA 1RRKA 5DPAA 2A0QB 2PTCE 1GHXH 4KGAA 4BAMB 3VB3A 1EATA 3EYDA 2ZA5A 1AKSB 1J15A 1GI8B 2OBQA 3V3MA 3TJUA 2BY9X 4WMDA 3SNAA 8LPRA 2HNTE 5DG6A 3RC4A 2D2DA 5T6DA 1AUTC 1DWBH 5E0GA 5TJXA 1XUKA 4B75A 1WYKA 1GVZA 1HLTH 2PSYA 2VIDA 1A61H 2G5NA 2WUCA 1GJ8B 1TPOA 1BTWA 3N7DA 2WV4A 4UDWH 5JB8S 2OP9A 1QB6A 2TGAA 4Y11E 1SGIB 2XW9A 4CBOA 2XC5A 1KDQA 1Y5AT 2FDAA 3U98H 1ZMNA 1C5RA 4XD7D 1TBZH 3GYLB 4TWYA 1NC6A 2BLVA 1LQEA 3D65E 1KMHB 2BY6X 2FXRA 1TQ0B 2WPMS 4OS5A 4CR9A 3UWJH 3H5CB 2JKHA 3QZRA 5LH8A 3A80A 2DUCA 4ABBA 2JH5D 4Y7AA 4DG4A 4UD9H 1K28D 3VGCB 3VB5A 1DLKB 1AZ8A 1AWFH 2FWWA 5EODA 3VB6A 2ZHWH 1BTUA 4UFFH 3FZDA 3PLPA 1SGRE 3TK6A 1DX5M 3Q3XA 2FP7B 1GDQA 1O3CA 2ZGCA 2VGCB 4YTAA 1XXDA 3ZZ3A 1LPZB 1HJAB 1FV9A 1MABB 3A7XA 1S6LA 3GCHB 1GMDF 1AZZA 4ZKNU 1F5KU 1W8BH 4Y6DA 1A0LA 1TRNA 1QJ1B 1FLEE 5GCHF 2H9EH 4FUBA 4UFDH 2EI8A 4DCDA 4HGCA 3BTME 3SW2B 3ZIAD 1G2LA 2VJ1A 3MH6A 1JIRA 3PTNA 3OTPA 4AX9H 3KNXA 4X6OA 2O8UA 3BIUH 2BMGB 3I77A 5IYTA 1SLVB 4I32A 3VB7A 2XYAA 1KSNA 5FPTA 1TPSA 1Z8GA 3ATKA 1ZOMA 1MZDA 1FZZA 3DHKH 1C1QA 1GMDG 1T32A 3P6ZB 1GBFA 5I25A 2ZFSA 1GBDA 1HAGE 4GCHG 2OLGA 3SHAH 1YLCA 2P59A 3G01A 1H8DH 2VIPA 3SQHE 2RA0A 2XWAA 1QIXB 4NFFA 3SBKA 1OHHD 4IMQA 1FY1A 1A3EH 2GP9B 1RIWC 1GI4A 1P57B 4U2WA 1EAUA 2PR3A 3PLKA 1GMHG 3OEED 3RMMH 3LGYA 1PFXC 1UK3A 4Y79A 1FPHH 5DGJA 3A7WA 1Y3VA 1GI7B 3AASA 1GL0E 4H42U 1QA0A 2RCEA 1MD8A 3S9CA 5DP3A 2ZP0H 2VINA 3A8DA 1KY9A 3OE7D 2BD7A 2YOLA 3UFAA 3ZVGA 3U28C 3OX7U 2J4IA 3KQBA 5FXLA 1E38B 4BTTB 1C2GA 3RXDA 2QF3A 3NWUA 1NFXA 1N1LA 1GMCG 4NCYA 3E1XB 1E0FD 4GPGA 2FEQH 2HLDD 3UR6A 4TYDA 4ESTE 1XKAC 1UJ1A 2ZDLA 3BTQE 4J1YA 6GCHG 1EZQA 1FY5A 1TX8A 4IW4E 1O2SA 2QAAA 2XBXA 1AO5A 1S84A 2OD3B 4X6MA 1N6YA 3FFGA 1ZJKA 2QE7D 1E79D 2BZ6H 1CHGA 3T62A 5DP7A 1AVGH 1V2LT 3OY6U 1GBJA 3D49H 1TBQH 2PHBA 1AY6H 3JZ1B 2R3YA 5G4BA 3FANA 1DXPA 3SV6A 2ZF0H 3NPSA 1EZSC 5GPIB 2GV6A 1VITH 2R0KA 1MMJN 2PSXA 2FS9A 1H8ED 1TA6A 3OTJE 1EAXA 3TK9A 3RU4T 4I8KA 1EUFA 1O3IA 1D3TB 3AW1A 4OGYA 3TIUA 2VIWA 2YMSC 4Q2KA 3AK5A 1ZHPA 1G2MA 3R0FA 1BMAA 3WW7A 4INLA 1F5RA 1HAHH 1HAXB 1MTNB 5K0HA 1N8OC 1ZR0A 3QGJA 1CA0B 1WV7H 2HLCA 3F9FA 1AHTH 1YKTA 1NRQH 2O8WA 1MU8B 4YOGA 5EXLA 3M5NA 2K8IA 2GTBA 2K0QA 2VWLA 4ZMAH 1G9IE 3VB4A 1LPKB 2KX4A 3TK5A 1P9SA 1Z1IA 3BG4C 4RKOB 3P8FA 1QJ7B 3GCHC 2CF8H 1BIOA 1ELTA 2WPDD 3JZ2B 2J9NA 1OYQA 1T8LA 2AGEX 1HRTH 1NRNH 1AB9B 1QY6A 1KLTA 1Q31A 1PPZA 1MBQA 3SUFA 3EDXB 2Z9IA 3GY5A 3ATIA 3RU4D 1YCPH 3PB1E 1OWEA 1L4ZA 3RXOA 5HGGA 1S85A 2HNTF 3RMOH 4ABJA 5CDFE 4Q63A 4IBLH 3RXQA 6CHAC 4AB8A 1Y8TA 4WWYA 1E1RD 4B2CA 1BRCE 2OQ5A 2F4LA 1PPFE 3RXTA 1C2KA 2O8LA 4NA8A 3L6PA 3MTYA 1SR5C 1HNEE 2ZHFH 3SQEE 3DFLA 2BQ6B 1P3CA 3MHWU 1KIGH 2FM2A 1W14U 3BTKE 5EJ1A 3F9HA 3RXBA 3GY4A 4DIIH 2ZU1A 1S81A 2KFWA 3TJOA 5DP9A 2JJ1D 5EJZA 3RDZA 4B6EA 4X1QU 1OP0A 3PMAB 1V2OT 3F2HA 1T4UH 1NU9A 1G32B 4JK6A 3EE0B 1DDJA 3M7TA 1EP5A 2VWMA 4MNYA 2SGEE 4OS4A 1GGDB 4Q7XA 1GBCA 5JBCS 4ZCNA 1WXRA 1D3DB 1LDTT 4IMZA 1AGJA 1RXPA 1C5TA 2JETC 2ZFRH 3K6YA 3S9BA 1GI5A 2FOCA 1O32A 5T3HA 1GHAG 3VPKA 1IQLA 1W0YH 2XCFA 4NIYA 4TT3D 1P01A 1G3DA 1BRAA 1M9UA 2BLOA 3SU3A 1V3XA 3T2NA 2C8WB 4Q7YA 5A8YA 2ZGXH 1MTNC 1O2JA 1O2XA 1EJAA 2ZFPH 2ZU5A 4O03A 4UFGH 4YLUA 3QX5H 4FUGA 1UCYH 3LC5A 1A0HB 2A2QH 1HAVB 2KAIA 3LT3A 2B7DH 3SV2H 5F53A 1ZGIA 4MNWA 1DVAH 2IPHA 2FX6A 2FO9A 1K1LA 1W7GH 1V6DA 2CJIA 2ZHQH 1O2UA 1H8IH 2F9PA 4KTUA 3SO3A 4UONA 2A7JA 2BDGA 2ZO3H 1W11U 1EJMA 4YESB 5C17A 3A86A 1O0DH 3BTDE 2Z7FE 4AGJA 2W6JD 1INCA 4U01A 1WAYB 1TNGA 3HATH 3ZVDA 1CGJE 1BA8B 1GBBA 4NSVA 4TPYA 1TGSZ 4CHAB 3MU5A 4I8HA 4PROA 1GDUA 4X1PU 2XCNA 3SUEA 1FN6A 2A2XH 3O8CA 5BPEA 2R0LA 3PV5A 2PGBB 1EFRD 2D26C 2R2MB 1QQUA 2P8OB 2BYAX 4I8JA 1MKWH 2FESH 1HXEH 3LONA 4ZXXH 1IQNA 1SBWA 2FI3E 3A89A 1N6XA 1MCVA 2J94A 1L1JA 2EQNA 3A87A 1OS8A 1F0RA 4IS5A 2ZGHA 4QT8C 2FLRH 1GI9B 1KLJH 5B6LA 2SNWA 9ESTA 2ZFTA 1V2KT 7ESTE 2YMSB 5FAHA 1JMOH 2GX4A 2CGAA 4MPXA 4Y8ZA 3KQEA 1GGDC 2W3KA 1BQYA 8KME2 3A88A 1SOZA 1THRH 3ODFA 1KXFA 2J5UA 2OINA 3K6ZA 1ZTLA 2Y82A 3T27A 3LOXA 1DICA 3PO1C 4MTBA 1EOJA 2ODQA 1GL1A 2DE9A 2NU1E 3SJ8A 2PKAB 4D76A 1TAWA 4AYVB 3FP7E 3RXMA 4RT1A 1OKXA 2Z9GA 1C1SA 5E8EH 4D8NA 1CBWB 1O38A 3NKKA 3SNBA 4D9QA 2IOTA 1V2QT 4B76A 1S83A 1QURH 2WZQA 1W0ZU 1ESTA 1UO6A 2BOKA 2RA3A 1UCYK 2RDEA 4SGBE 1CT2E 1WDIA 1IQEA 4ZH8A 4U32A 3PRDA 4CH8B 1ZYOA 2ASUB 1ELDE 2Y5HA 4JZIA 3A8AA 1O2VA 5AHGH 1F5LA 1KLIH 5FX6A 1NRPH 3TH3H 1ESAA 1TPPA 5C67A 2BZAA 4AG2A 1SGCA 3D23A 4NWLA 3SU0A 1UTQA 3GDUA 3HKIB 3EA8A 5C94A 4TSFD 1BDAA 1O31A 3PO1B 3IITA 2XC0A 1HB0B 3SU5A 1GCDA 1C5UA 3LU9B 3FOAA 1VJAU 4ZROA 1W2KH 5F8ZA 2PV9B 3LPRA 2TBSA 1GJDB 1AD8H 3RXLA 1MTSA 2FOMB 4A1VA 2G8TA 1Y5UT 1QNJA 4ZHMU 1DSTA 4F49A 3SU2A 2ZTXA 2GVFA 2JH0D 2QXJA 2I6SA 1ETRH 3P17H 5AF9H 2SFAA 3QDZB 1PQAA 3LKWA 3QWCH 1QFKH 2NWNA 3UOUA 1FPCH 1OP2A 2BD4A 3H7OA 4KP0A 4KELA 1V2PT 2TGPZ 4DY7B 2XXLA 2BHGA 3FVFB 5K7RA 1SFIA 3QTOH 5GJ4B 3H7TA 2ULLA 1CA0C 1OWHA 5EU8A 1OP8A 1LKAA 6ESTA 2VH6A 2V35A 1RD3B 2BQ7B 2UWLA 3VGCC 1XUIA 4CHAC 1O2RA 1T8MA 3KQDA 2BD3A 1O2OA 1A46H 4B71A 3SZEA 1RJXB 4H4FA 3RXIA 5EW1H 1MZAA 4HZHA 1P2MA 2ZEBA 3RXSA 1OWIA 3QK1A 1S5SA 5TCAA 1TGTA 1YP9A 4YZUA 3STJA 1Y3WA 3GOVB 2ODPA 1HIAB 2BY8X 4I8LA 4TY6A 3MH4A 1G3BA 2ZHEH 1CGIE 1O2KA 2AERH 3PV2A 3TJNA 3O8DA 1TOCB 3T29A 5E0JA 1UTKA 4I33A 1FNIA 1C4V2 1SQAA 4XE4A 7GCHF 4BAQB 1TX6A 3V13A 3QGNB 1E1QD 1C2LA 2ZPQA 1EAWA 1ANDA 4YT7H 1HAPH 4ZUHA 2FIRH 3RM2H 3NRLA 3M5LA 3V0XA 1C1MA 1O2IA 1AMHA 1TB6H 3OU0A 4GAWA 3ZV9A 1HJAC 1NT1A 3SUDA 3BSQA 1H4WA 2HOBA 4KTSA 4E06H 2QXIA 2LP6A 2Y81A 3PYHA 3DD2H 1GI6A 2C8YB 4ZAEA 3TGJE 3LGWA 4ZXYH 5JBBS 1NO9H 1TNKA 3KQ5A 3FO8D 3D62A 1O35A 2BDBA 3A83A 1C1RA 3SV7A 1KXBA 2W7UA 4FUEA 1O3MA 2HPPH 3ENSB 4JZEH 2SNVA 4FETA 3PWCA 3BTTE 2ZI2H 1UVPA 2F83A 5F8TA 2BVXH 5ETXA 1FIZA 1YLDA 2H9HA 1YWUA 4HTCH 3CS0A 5LPRA 1MTWA 3F3BA 1JRTA 3OAAD 4RN6A 2FPZA 1OSSA 1P11E 1SGFA 5E0HA 1AFEH 1S82A 1FMGA 1QRWA 1EAIA 4IC6A 4A6LA 1MKWK 1BBRE 3UNSA 3TNSA 4ABEA 2AEIH 1C2MA 1Z1JA 5FPSA 1O3EA 2IJOB 1COWD 1BZXE 2FYQA 1O3LA 1C1UH 2G00A 4CREA 2J97A 2D1JA 3U8OH 1A5HA 3E91A 1XXFA 5EJLA 2HVXA 1BTZA 4MNVA 5GXPA 1W10U 5JYIA 1RGQA 1HPGA 2AFQB 2VWNA 2F9VA 1KTTB 2HVYB 1XUGA 3C1KA 1K1MA 1VGCB 1AUJA 1K1NA 4FUDA 5LGOA 1O3HA 2BY5X 3GCTG 2GT8A 3MMGA 4NGAH 1CHOG 3IWMA 1XUJA 2VVCA 2Z3EA 5GDSH 3T25A 4VGCC 3KYGA 5GIBA 2OQUA 3I29A 4ABDA 5FPYA 1NM6A 4K8BA 2JDID 2ZU4A 2TPIZ 2C3SA 5H4IB 3UQVA 3BN9A 4Y8XA 5C20A 1FY3A 2NU0E 1ABIH 2H2ZA 5JBTA 1ETSH 4X1NU 3QLPH 1RS0A 1XUFA 4AOQA 1GJCB 1UTJA 3BV9B 1DWEH 4FVDA 4GVUA 2XC4A 4AG1A 2A1DB 2BLWA 3ZVEA 1C5OH 3EGKH 1FDPA 1GI0A 5GWZA 2BD5A 3DSOA 1OOKB 3FZZA 1BHXF 1P2KA 7KMEH 1G3CA 1QGFA 5FL7D 4OM9A 1UCYE 3AW0A 1CQQA 1KXCA 1C1WH 1UTLM 1O39A 1GHZA 1BTHH 1C2IA 2FTLE 8GCHG 1BB0B 2A5KA 1C1PA 1LVOA 4BAKB 3GY2A 2G4UA 3W95A 1C5YB 2W5EA 2B8OH 1BBRH 3B23B 3U8TH 2V3HH 4Y8YA 5HIYA 1KDQB 3KEEA 1HFDA 3ZVFA
chains in the Genus database with same CATH topology
5DK1A 4ABHA 1CSOE 3L3TA 1HJ9A 2BVSH 1TIOA 1QL7A 1O3GA 3SI4H 4ABGA 1O3NA 2WPKS 1TGCA 1ZLRA 1AIXH 3UNRA 4X1SU 4X8VH 1IHSH 1YF4A 3KQCA 1KYNA 3C27B 1FY4A 3S0NA 1GVLA 1IAUA 2TIOA 1GPZA 3AVZA 1F7ZA 1FI8A 3RXVA 3O8RA 3PV4A 5HYOA 2NU2E 5FBIA 1MBMA 2ZDAH 2AMPA 4LXBH 2STAE 2G52A 1PYTC 1QBVH 1W12U 2OTVA 3GCNA 1SC8U 1BMLA 1E37B 2A4RA 2ZHDA 6CHAB 2M5TA 1PPHE 1CVWH 1SGEE 1C5NH 3SNCA 3GCOA 4GLYA 2ZDKA 2JETB 1V2WT 1TOMH 5HM9A 3BG8A 2UUYA 1NRRH 1SLUB 2XWBI 5EQRA 3GY3A 3STIA 3U1IB 4DGJA 1FAKH 1DE7H 1D3QB 1MU6B 1ETTH 3URDA 2EI7A 3BG4B 2GCTB 1BBRK 2XBYA 3EA7A 3RP2A 4O9VA 2WV5A 3PMBB 5A8ZA 5L6NH 2BXUH 4MVNA 5T6GA 1GJ9B 1E35B 1UHBA 5TCCA 1O3JA 4I31A 1A5GH 1LQDB 3E90B 3ESTA 4TY7A 2FLBH 7LPRA 1AU8A 4MPWA 3A81A 2BQWB 2Z9JA 2P95A 3NZIA 1DM4B 1NTPA 1PQ8A 1TNJA 3MO3A 3M36A 4D9RA 3E0NB 3P8NA 1DUAA 3RXEA 1EPTA 3VXFH 2G51A 1QRXA 1F2SE 1TQ7B 3DT0H 2V6NA 4ISOA 2Y80A 4A1TA 1EP6A 3E16B 1GBKA 2A4QA 3QZQA 3A7VA 4Z6AH 3ZZDA 1NRSH 3UREA 4AFQA 4X2YA 4Y7BA 2H9TH 1P09A 1YCPK 2G55A 4X8SH 1SLXB 5C1YA 4ZKRU 2ZDNA 1TNIA 4GHTA 4BXWA 2C8ZB 2BD2A 1OWDA 2BXTH 2A31A 3MU0A 4IN1A 1V2UT 2BY7X 3P95A 4X0WU 1MKXK 2AS9A 4NWKA 2GCTC 1AKSA 3VFEA 1O5BB 1ZMJA 2VVVA 1K1OA 1OX1A 1EB2A 1T4VH 1YYY1 1ARCA 3GY7A 1O5EH 2CXVA 3FP8E 1CHOF 3ZYDA 1HIAA 1VITF 3ATLA 1GJ7B 1NZQH 2Z3CA 4UEHH 2VGCC 2EEKA 2Z94A 1NFYA 2ZC9H 2BDCA 1C2EA 1Z8IB 1C1OA 1GHBF 1O5DH 4NIWA 5FCRA 4DW2U 5HM2A 2JH6D 1UK4A 1ANEA 3SZNA 3UR9A 3MWIU 1NS3A 1DY8A 1TMUH 1YGCH 3CENA 1GDNA 1HGTH 4K69A 3TLOA 1TGNA 2A45B 4NSYA 1QTFA 2XNIA 2ANWA 4OS2A 3A8CA 1PPBH 5A0AE 1QCPA 2AH4X 2QV1A 1PPEE 4X8UH 1C5VA 4JYUH 3RXFA 3E8LA 1HDTH 1J8AA 1JWTA 5T6FA 4CRBA 1GHAF 1VZQH 3ELAH 3ZV8A 4ABAA 2ANYA 1O3AA 3Q3KA 3SJ9A 3GY8A 2CHAB 3RLYH 3RM0H 1B0FA 2A4GA 2P94A 1WUNH 2GDEH 2B9LA 3OY5U 4INKA 3B8JA 3GDSA 3RC5A 3LDXH 3RXCA 1QHRB 5AFZH 1WTHD 5CE1A 1D9IA 4FU9A 1IQKA 1O3DA 1TWXB 1BRUP 1GMHF 4SGAE 4K1SA 1AI8H 1S6HA 2PGQB 4OS1A 4AFUA 2VIOA 3MNXA 2GCHG 1JBUH 1XUHA 1DT2A 3ZYEA 1E34B 1O2GH 1CA8B 3M3TA 4WMEA 3SV9A 2ZECA 1BUIA 3KCGH 3L33A 3LH3A 2H5DA 1ACBE 2Z6BD 1NPMA 1UTOA 1IQGA 3A84A 2WINI 3LGVA 1HYLA 2HPQH 5AFYH 4XBBA 5CHAC 1L1GA 1QA7A 1GMCF 1K21H 2GV7A 4B2BA 3ZZ8A 1WQSA 2ZTYA 1ZHRA 1TNLA 2R2WU 1FUJA 3U1JB 5DJ7A 1BHXB 1A7SA 4Q7ZA 3E6PH 1GCTC 4XBDA 1SGYE 2B5TB 1BOQA 2OC1A 5EQQA 1ESBA 1YPHE 5DP4A 3VEQB 1A1RA 1F0UA 1VGCC 4RKJB 4X2WA 5AVDA 3UTUH 3UQOA 3SNDA 2ANKH 2BD8A 2ZKSA 4A5TS 1T7CA 4DOQA 3RMNH 1UMAH 1ZTKA 1LKBA 4JK5A 1Y3UA 1C5MD 1MQ6A 4WF8A 1S0QA 3HK6B 3A8BA 1NFUA 4GSOA 1UK2A 1L0ZA 4XBCA 1SQTA 1H9IE 3SGBE 3S7HB 3S69A 4R0IA 4YT6H 1LVYA 3M5MA 1EPTB 3MNCA 4NIVA 4R8TB 2TGTA 4X1RU 1YPJH 4CRAA 4ZHAA 1MUEB 2VH0A 1QRZA 4D7GA 3F6UH 3PMHB 1EXFA 3MO9A 5LPFA 2W26A 5L2ZH 5EW2H 4U30A 1SGNE 3MYWA 3RLWH 2F3CE 4JZDH 1HV7A 1IQIA 2WPJS 1O33A 2AMQA 1SOTA 5EXNA 3A85A 1O3BA 2ZZUH 1BTPA 2FMJA 3UOPA 4B2AA 1XKBC 2VIVA 4B74A 1GI1A 1QQ4A 1MAYA 1P05A 4ISIH 2THFB 4A92A 2AIQA 1O3KA 1GBEA 2QYIA 5HXFA 2GT7A 3MNBA 1TE0A 2BDHA 1WCZA 3DFJA 1C5WB 1G3EA 1PQ5A 1SGTA 3Q76A 3TJVA 1BJUA 1X7AC 3EAJA 2Q6GA 1O2PA 1V2RT 3TH4H 1YBWA 2P16A 4FU8A 4O3TA 2Q1JA 2ZQ1A 4FXGH 1CU1A 3RMLH 3LJJA 2HNTC 2K1QA 4CRDA 3UWIA 1DANH 3UY9A 1D6WA 1ELBA 5A09A 4BTIB 1DLEA 2D8WA 1JRSA 1EQ9A 1ZGVA 2FOHA 4FU7A 1BITA 2F9UA 1XVMA 3SU4A 1CE5A 4Z0KA 4D7FA 1QBOA 2J34A 1XVOA 4XFQA 2I6QA 1T31A 1VCWA 3P8OA 1BTXA 1FQ3A 2UWOA 1DS2E 3ZVBA 4TWWA 1ZSKA 2PTNA 3ZZ5A 2VU8E 3ATMA 4I8GA 1MTVA 2P93A 3BTFE 2FOEA 3HGNA 3BTEE 3QO6A 1G30B 1C4U2 1GG6B 3ZZAA 1TNHA 1TMTH 4ISLA 3BEIB 2O9QA 1RTFB 1ZPZA 4CR5A 2Y7ZA 2BX4A 1VCPA 3E3TA 1V2MT 1UVSH 1O2TA 3PWBA 3IG6B 2F9NA 1EZXC 2GCHF 3V7TA 1NROH 1QB9A 5BRRE 1BCUH 1IHTH 1B5GH 2J95A 4IC5A 4XOJA 4NA7A 1YPMH 2H5CA 3TVJB 4BANB 1J16A 3GY6A 1D3PB 5C1UA 2V3OH 2HALA 2QXHA 5E2OA 3RXPA 4XDEA 4AN7A 5C1XA 1P04A 1N8OB 3TGKE 1J9CH 2V0BA 1MKXH 2LNCA 1GCTB 1WSSH 1WU1A 1IQFA 5FHTA 3GDVA 3BIVH 1O5CB 3EQ0H 1Y3XA 2IN2A 1T8OA 4DIHH 1UVTH 5C3NA 1UVOA 1L2EA 1SVPA 3NXPA 1P3EA 1DY9A 4K1TA 2BLQA 2ZU2A 2FOFA 1XM1A 3ZZCA 3ODDA 1EOLA 2O8TA 1K1JA 5C5NA 1GBAA 4BXSA 1JXPA 2H1UA 1ZPCA 1O34A 3BEUA 1DSUA 1D6RA 1BRBE 1GBIA 3U8RH 1AE5A 1SGQE 3M7QA 2XBVA 3NCLA 1MQ5A 4AGKA 1NU7B 4XSKU 5CHAB 4Y71A 2FODA 2SGDE 1EZUC 1MH0A 5ESBA 1LMWB 2OXSA 1YPKH 2BTCE 5FCKA 4WMFA 2GZ9A 1ELAA 3ZZBA 1AE8H 5LPEA 2J2UA 2OUAA 1ABJH 4Y10E 3URCA 1Q3XA 4WY3A 2SGPE 1ZPBA 2PUXB 5EPYA 1OYTH 1HUTH 3RU4E 4WXVA 1O2HA 1V2VT 1PPGE 2HGTH 4K8YA 1FONA 3TPIZ 1LHCH 1QR3E 1PQ7A 2BDAA 1LHDH 1RTLA 1ZRKA 2OC7A 1P10A 4BTUB 4KKDA 3A7TA 1YPEH 3UPEA 4DVAU 1DPOA 1C1VH 2ZIQH 1G37A 1WOFA 2WUBA 4E7NA 1VR1H 3F9EA 1P8VC 1NESE 2ZCKP 1QBNA 4NZLA 3M3VA 1IOEA 4RSPA 2AIPA 4BAHB 2XTTB 3Q77A 3GICB 3ZVAA 3P92A 2PLXA 2UUJB 1K1PA 3SORA 4OGXA 1FY8E 1PPCE 2W3IA 4YO9A 2FTMA 5J4SA 4FUHA 3F9GA 4MPVA 1LHGH 2F9BH 2ZTZA 5I46H 2BVRH 1BMMH 1L1NA 5F6MA 1GVKB 1RTKA 1RIWB 2LPRA 3TH2H 2R3UA 1ORFA 3QUMP 2ZU3A 2P8OC 5L30H 8GCHF 5JBAS 2ODYB 4B73A 2BD9A 4ZHLU 1W3CA 3SJOA 2Y5GA 2STBE 1GHVH 1D4PB 4LK4A 3DUXH 1ELGA 3KGPA 3ATWA 1W13U 5J4QA 1C4Y2 4HI3A 2FI5E 1V2ST 5F03A 1SSXA 2A7CA 2C90B 5HMAA 1FN8A 4X2XA 4B1TA 1F0SA 1EB1H 1O30A 1MTUA 3RC6A 1JIMA 3KL6A 1VITG 1IQHA 3SI3H 5GCHG 3S7KB 7GCHG 2UUKB 3CP7A 1DUEA 1MAXA 1HAVA 3BTGE 1ZSLA 2Z9LA 1YPGH 4M7GA 1BT7A 1ZSJA 4ISNA 3KIDU 3CS7A 1SPJA 2EI6A 2A5IA 1O2YA 3OYPA 1TA2A 4JMYA 3SGQE 1Y5BT 3A7ZA 3HGPA 2ALVA 1SFQB 1HJ8A 2ZFQH 1O5AB 2GMTB 1HAOH 3MO6A 5L2YH 3KHVA 3M35A 4NA9H 3LGUA 1SLWB 2FYRA 1ANCA 1GI2A 5JDUB 4Q80A 5EGMA 4FUIA 2XBWA 5A2MH 1CT0E 1YCPM 3TITA 2VB0A 4AFZA 1IQMA 1O2LA 5EOKA 1QB1A 3NK8A 1A0JA 1O37A 1MCTA 5JPMH 1L4DA 1ARBA 2FI4E 2HRVA 2ZPSA 4Y76A 1SI5H 1P03A 2QCYA 4CH2B 2RG3A 3T28A 1W7XH 1GJ6A 1J17T 4AYYB 2Y7XA 4Y0YE 5DP8A 2BM2A 3M7UA 4BAOB 1FAXA 1ELCA 3I78A 4LOYH 1WBGB 4ZKOU 3K2UA 2Z9KA 4LZ4B 1LCYA 3DA9B 1OWKA 4UE7H 1ID5H 2UUFB 3SU1A 3BF6H 4ASHA 2GMTC 4NZQA 4DT7B 1SG8B 9LPRA 3QN7A 1XMNB 1TABE 1GBMA 1YM0A 3KN2A 4K3JA 1C2JA 1AN1E 1O2MA 2GZ7A 3B9FH 3F1SB 1C2DA 3UIRA 4JZFH 2ILNA 2G5VA 2AGIX 1LTOA 1NY22 3U9AH 1TBRH 1GJ4H 4NG9H 4A7IB 3SNEA 5EG4A 1TRYA 1P2JA 1C5QA 3FAOA 4THNH 1CT4E 3MU4A 4GUXA 4WJG2 2ZGBH 2QC2A 3T26A 4MDSA 3UUZA 5ESTE 3M61U 1DOJA 1Z6EA 2SGFE 1V2TT 3MU8A 4HFPB 3EA9A 1ELVA 2PKSC 1C9TA 1O36A 1K22H 2SGAA 2VWOA 4O97A 3V12A 4BOHA 2P3TB 3GISB 3LJOA 4K2YA 2QXGA 2CV3A 1TRMA 2GZ8A 1Y59T 2Y5FA 2PFEA 1UTPA 1DITH 3LH1A 4X8TH 5DP5A 4VGCB 2YNAA 1YPHC 1A5IA 5EQSA 2P3FH 3RXUA 1AFQB 1TX7A 2PKAA 5FX5A 1P02A 4ZKSU 4NFEA 1CGHA 4MQAA 4AB9A 1THSH 1P9UA 1Y3YA 1GHYH 4CRFA 1GBTA 2ZPRA 2PKSB 1TLDA 1UTNA 2P3UB 1HXFH 1Z71A 3TGIE 2ZQ2A 2FOGA 1ZRBA 1O3PB 3A82A 1U6QA 1A4WH 4BNRA 4WH6A 4FVBA 2ESTE 2BDYA 3RXRA 1O2NA 3ZZ7A 5ABWA 4DURA 1LVBA 2FX4A 5E2PA 2VIQA 4FUJA 4H6TA 1FXYA 1V2JT 4YM9A 1DFPA 1S6FA 2ZCLP 1ELEE 2ANMH 3A7YA 5JB9S 1P06A 1LPGB 1EKBB 1P0SH 1B0EA 2FOAA 1O3FA 1LO6A 1IQJA 3PLBA 2A32A 1AVWA 3HKJB 1VCQA 1TMBH 3RXKA 2C8XB 1ZJDA 1JOUB 4ISHH 5CMXH 1UVUH 4K60A 1T8NA 1EJNA 1C5SA 3HPTB 2DE8A 4IN2A 5DO4H 3LIWA 1AB9C 2GGVB 1EASA 4K1EA 4WVPE 1ZHMA 3AAVA 4CBNA 2WYJA 2PWXA 1BTYA 2G81E 5F8XA 2Z3DA 4E7RG 4INHA 5A8XA 1XX9A 1LHFH 4GCHF 2WPHS 5A0CA 2ZDVH 1WQVH 4JZ1A 2XRCA 1GBHA 1O2ZA 6LPRA 3E0PB 3S9AA 2C93B 1TGBA 3MH5A 4X2VA 3HK3B 1YC0A 1HBTH 1P2IA 3FP6E 3SJKA 1EPTC 3VXEH 3WY8A 1SGPE 3M3SA 4O3UA 1GHWH 4MNXA 4Y0ZE 3RXGA 2TRMA 4MPUA 3RXJA 5C2ZA 4CRGA 1TYNA 3P8GA 3K9XB 2ZGJA 5IDKA 2ZDMA 4KTCA 3PM3A 8ESTE 1SGFG 3SJIA 3R3GB 1GWAA 3ZZ6A 1KXDA 3BTHE 2WPIS 2GKVE 2OBOA 2OC8A 2C4FH 3PROA 1NN6A 1LHEH 3LC3A 4AZ2B 1G36A 1ELFA 2A4OA 5PTPA 1K1IA 1F0TA 2QN5T 4WH8A 1C2FA 1SQOA 3N7OA 4X6PA 1O3OA 2BDIA 4CRCA 1VJ9U 4H6SB 1RFNA 1SL3A 1DWDH 2QA9E 1O5GH 4ABFA 2QIQA 2J92A 3GCTF 4E05H 1ZZZA 1PYTD 1GHBG 1C1TA 1SGDE 1ZTJA 2W7SA 2Y6TA 3TNTA 1Z8RA 1ANBA 1OPHB 5A0BA 1B7XB 3SN8A 3LGTA 1WTGH 1GI3A 1P2OA 4MG3A 3BEFB 1LVMA 1K9OE 2QGRA 1E36B 6GCHF 1A3BH 1SHYA 1MD7A 2FOBA 1TPAE 2GDDA 4LZ1H 1C5XB 4UFEH 2H6MA 1DXWA 2YNBA 1FIWA 1ZMLA 1C5LH 1HCGA 3M5OA 2CN0H 3MFJA 1QL8A 2R9PA 4OS6A 3TU7H