3FN8A

Crystal structure of merb complexed with mercury
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title Crystal Structure of MerB complexed with mercury
rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 58
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3fn8A00
3F2HA 3F0OA 5DSFA 3FN8A 5C17A 5C0TA 3F2GA 3F0PA 3F2FA 5C0UA
chains in the Genus database with same CATH superfamily
3RXTA 2OCVB 3BTHE 1GMHG 1FMGA 2ZEBA 5HXFA 2ZDKA 3ZVFA 3VB3A 3PLBA 4Z0KA 1A4WH 3SGAE 2KX4A 1YY3A 1CT0E 1P01A 3GCTF 4AX9H 2ZCLP 1G3BA 1A0HB 1O3EA 3LJOA 1VKYA 1DXWA 1P3EA 1RS0A 2YMSD 3EE0B 4RKOB 2XCNA 2QV1A 1C2IA 1AKSB 3T27A 4UD9H 5CHAC 4CRAA 4K1EA 1EKBB 1F5LA 3Q3XA 1IQHA 4DW2U 1BTZA 2ANWA 2BY8X 2Z3EA 1SQTA 2W6JD 4I31A 3BG4C 1GDQA 4ZAEA 1GMHF 4YO9A 3FN8A 1Y3XA 2Y80A 1EAWA 3WY8A 4ESTE 2ZHEH 4NA7A 5K0HA 1EZQA 5DSFA 5I25A 2HWLB 3SQHE 4X6MA 3NXPA 3ZVCA 4NZLA 1D6RA 1WUNH 1UJ1A 2V6NA 4FUCA 2J98A 3OY6U 1NRSH 3M3TA 1H8HD 1ZJKA 1AVXA 4RT1A 2BM2A 3RC4A 4DG4A 3SBKA 2ZCKP 3RXEA 2Z9IA 2VVUA 2I6SA 1WTGH 5C5OA 1OYTH 2PTNA 1XVMA 4A1TA 1V2NT 3SOSA 1UVSH 1AMHA 4OS6A 1EP6A 5GNDA 1SL3A 1GVLA 1XUHA 4AFZA 4ZKNU 1MU8B 2ZIQH 1C1SA 1RIWB 1TQ0B 2V0BA 5E2PA 2GTBA 4JYTA 1WOFA 2O9QA 2OBOA 4FVBA 3D65E 5IYTA 2O8TA 5EJLA 1PQ5A 2CXVA 4X1NU 1P3CA 1SGIB 1H8IH 4Y76A 4UFFH 3A8DA 2BVXH 1ZPBA 2ZDAH 3A88A 1KXDA 1NROH 2NU0E 2G4TA 2XTTB 4AB9A 3K9XB 3LDXH 3TGJE 1V2WT 1O35A 1W12U 2BMGB 4ZXYH 3SV2H 2J9NA 1G37A 1P57B 1YPMH 4GPGA 3UQVA 3K6YA 3SUEA 1HAHH 1QJ7B 1A0LA 4VGCB 1LMWB 2BQ6B 5T1VA 5JBBS 3SO3A 3UR9A 2J38A 1BOQA 1D6WA 2STAE 4X2XA 1F2SE 1NFYA 1GCTB 1P9SA 1UVUH 5DN6D 1Z7KA 3MU4A 1SLVB 1UMAH 3AW0A 2WPDD 1V2RT 2HVXA 1OSSA 1QQ4A 1PJPA 1TOCB 1TB6H 1C5TA 5E0JA 1V2MT 2EI7A 3URCA 3V13A 1O2LA 1T8OA 2OTVA 2HPQH 3KF2A 4B2BA 4RI0A 3HK3B 3PV2A 3KEEA 1INCA 1NFXA 2TPIZ 3SUDA 2Y5FA 1LHDH 4IW4E 4CREA 1O2ZA 3GDSA 3UWIA 1A2CH 2VVCA 4Q7XA 4CRDA 3KHVA 5FBEA 4MLFB 4CH2B 1W0JD 2FOCA 4DT4A 1P0SH 3TITA 5F6MA 2AYWA 4BAHB 1UTLM 3ZZ7A 1PQ8A 1F5KU 2FI5E 4IBLH 2R9PA 3KQCA 5DKMA 3QZRA 1QGFA 1FV9A 1LQEA 4RT0A 1HRTH 1UHBA 3RXHA 2BX4A 2OQUA 4U2WA 2YNBA 1QA7A 1HAPH 1MD7A 1VITH 3SV6A 1EB2A 3P17H 3R0FA 4ZHMU 2IJOB 2JIZD 1GHYH 1AZ8A 1ZMJA 1GJBB 4Y0ZE 3NZIA 2HNTE 1MTVA 3DFLA 3RXQA 1RJXB 3QUMP 3FFGA 3MYWA 6CHAB 4FUJA 4X2WA 2FM2A 2Y5GA 4MDSA 2HNTC 7GCHG 1GVKB 1EJMA 3TNSA 1OWEA 2D8WA 5EODA 5JB8S 1CGHA 2FLBH 1NBMD 1Y3YA 2HNTF 4JZEH 1NN6A 3SYJA 1GJ5H 3U1JB 1ESAA 3LOXA 2FX4A 3B8JA 1VCWA 3CS0A 1O2OA 1GBDA 5EQRA 5L6NH 4ISNA 4RN6A 2Z9GA 3SW2B 6ESTA 1O3HA 3PWBA 1QFKH 5FCRA 3O8RA 1OWJA 3RXDA 6LPRA 2A45B 3IITA 2FODA 4U30A 3H5CB 4D7FA 1VITF 1JWTA 1FY5A 1EPTC 4H4FA 4BAKB 1O3GA 1EPTA 4H42U 1TRYA 5HKKD 4ACAA 3U8TH 1IHSH 4JZIA 2GCTC 3WW7A 2A1DB 1G36A 1SFQB 1TFXA 1YLCA 3FVFB 1N8OB 1XXFA 1QIXB 4NFFA 4KTUA 3LGTA 2UWOA 1GHWH 1S83A 1HXEH 2FZZA 1ESTA 1TPPA 4Y7AA 5T6DA 2HOBA 2RFKC 4QT8C 1YYY1 3WWFA 4YOIA 3GDVA 3GY6A 4U32A 1OP2A 1SKYE 1GBLA 1CQQA 1EX3A 3MWIU 4TY7A 1O2UA 1MQ5A 3CNRA 3SZNA 1O5AB 1A3EH 3RXKA 1SLXB 5F8ZA 2R0LA 2LNCA 3RC6A 1ZYOA 4IC5A 1Z8GA 1HB0B 1EASA 1ELEE 1G9IE 2VIDA 3RXRA 1LHCH 1FY8E 2VH0A 4KGAA 3E0PB 1HBTH 4B71A 1P04A 2KCYA 2W6ID 3LH1A 1IHTH 1WQSA 2Z94A 3BSQA 3SU3A 3PMBB 1NZQH 2ZHWH 4INLA 5HIZA 2WINI 1CBWC 1XUJA 4WY3A 4NIVA 3MFJA 1IAUA 4K69A 3K2UA 1BCUH 1XKBC 4A5TS 5FAHA 1P9UA 1UVTH 2WPJS 5GWZA 1SGDE 4FETA 4CRBA 1RTFB 1E38B 3RLYH 2BQWB 5DK1A 4I8GA 4ZHLU 5L2YH 1ORFA 1FN6A 1QHRB 4GHQA 1EUFA 2IN2A 3V7TA 1THRH 3BIVH 4ISHH 1TE0A 1ZR0A 5FX5A 3H09A 2XWAA 3ODDA 1BA8B 2H9HA 3SUGA 2PGQB 1PPHE 1P12E 2NU3E 1XUIA 4I86A 4NCYA 1BHXB 3ELAH 5GCHF 2ODYB 3L33A 2KCAA 3I77A 3QGJA 4IMQA 1C5NH 5FPYA 3T5FH 1HIAA 2ZTZA 1YC0A 3LH3A 2GDEH 3Q76A 3RXGA 2J4IA 1GHZA 1P2JA 2P3FH 4WXVA 3ZYEA 2VVVA 1O2QA 3OE7D 9LPRA 1IQMA 3VG8A 4IMZA 1QB1A 3ZIAD 3MH5A 1QRZA 4UONA 2R2MB 1QQUA 4K60A 1C2JA 1QB6A 2ZP0H 3GCHC 2WHXA 5C0TA 1YLDA 1BJVA 3SJKA 1TWXB 2GT7A 1BBRE 2JDID 1C2DA 4B73A 1K2I1 1ABIH 2G4UA 3V3MA 3GCOA 1DOJA 2BDHA 2UWLA 2FO9A 2B5TB 2FIRH 3ZZBA 1QL8A 2BY6X 2G5NA 3T62A 4BOHA 1PQ7A 3T29A 1EOLA 1FPHH 1TGSZ 2KM0A 2W7SA 1G3DA 4WVPE 1KDQA 4CH8B 1A5IA 1ARBA 2AEIH 2ZDNA 2A5IA 4DVAU 5HMAA 5AFZH 3A86A 3R3GB 1E37B 4ACBA 1DXPA 5B6OA 3O8BA 3EGKH 3FAOA 4H6TA 1ELAA 1LKAA 4WH8A 3JZ2B 2RDEA 3TK5A 5AVDA 3TH4H 3ZVEA 2WPKS 1GMCF 4TPIZ 4F48B 1C5PA 5AF9H 5EG4A 4D9RA 5F8TA 3L6PA 1Q31A 3EA9A 2Y7XA 1AIXH 1AWHB 1N6XA 4DURA 2F9PA 1NO9H 4A7IB 3SZEA 1KLJH 1XVOA 1G3CA 3SU6A 1GBKA 3OY5U 2R0KA 3PO1C 4XBDA 5I46H 3NUMA 3RXMA 1GI1A 5J4SA 3M5NA 1GDNA 1TBZH 1LVYA 1C2EA 1TPOA 2WPLS 2A4QA 4LK4A 3D49H 3URDA 1JIMA 2KCOA 2OBQA 1THSH 4DOQA 3RU4T 1CE5A 1JMOH 4YM9A 3GY4A 4NIWA 2VIQA 1AB9C 5EW2H 4Y11E 1W0YH 1BUIA 2Y6TA 3M3SA 1V2QT 1QJ6B 4INKA 5SGAE 2J92A 3VPKA 1JRSA 1IQKA 4BAOB 1SGFG 1HJAB 1Z8IB 3F0OA 4MNXA 2LP6A 3BTME 1DSTA 1XUFA 4YT6H 2K1QA 3QWCH 4JYUH 1SGRE 3AK5A 1Z6EA 2BB4A 3SQEE 3D23A 3IG6B 1V2PT 1C5XB 1LPZB 1C5ZB 2AMQA 1VR1H 2WPMS 1C1NA 1CGJE 2PWXA 1KDQB 2ZGCA 1T32A 2ZU2A 2VGCB 2BX3A 3DHKH 1TMTH 2SGQE 1NC6A 2P94A 1GI0A 2PFEA 1S6LA 2FYRA 2EC9H 1A5HA 3RXOA 1NFUA 1C1TA 2FS9A 5A8XA 1V2ST 1GJ7B 1KYNA 1QRWA 3RXSA 2L74A 2ZFSA 2JETB 3PRDA 3T2NA 4FUHA 1TMUH 1CSOE 4KTSA 1C2FA 3T25A 5A8ZA 2YMSC 3RM2H 1KSNA 2CMYA 3E91A 1N6YA 1ETRH 2FMJA 1Z1JA 1ZMLA 1UW7A 3BTQE 2IJD1 2NU1E 4NGAH 4NZQA 8GCHG 1UCYE 4X8TH 1GCDA 3AW1A 5F8XA 1MABB 3ESTA 3LGWA 5B6LA 1AN1E 2GDDA 2Z9KA 3M3VA 4O97A 3M5OA 1P2IA 4A1VA 2O8UA 1HAZB 3MHWU 1GHAF 3M5LA 1EZSC 1J16A 5KGOA 1TABE 4AORA 3QLPH 1UVOA 1ACBE 4FU8A 1MTNB 2VWLA 1ZLRA 1SGPE 1O2GH 4BTUB 4ZMAH 3AAUA 1ELBA 2F91A 4JMYA 1DFPA 2A7CA 4ASHA 1ZOMA 1GJ6A 1V2OT 5DP3A 4WXIA 1VGCC 1O3CA 1EAUA 2A4OA 2UWPA 4MTBA 1FX0B 1YGCH 3PYHA 2R3UA 3RM0H 1FXYA 4BXWA 2AGIX 3O8DA 3ZV8A 1GL1A 1HXFH 1D3DB 3ZYDA 2G52A 2ULLA 1YP9A 1GVZA 4CR9A 1P02A 1V2TT 3MU0A 4KELA 3EQ0H 1O3LA 1MKWK 2ZA5A 1FPCH 3VEQB 2CF9H 2CHAC 1EXFA 1C5RA 3S7KB 4OGXA 2CF8H 3GCTG 5DGJA 4HGCA 5DP9A 1HFDA 1O3PB 2D2DA 3SUFA 5F03A 1AVGH 3T28A 2JH0D 3LPRA 2HLCA 1AFQB 4NSVA 3CP7A 3ZVAA 3ZVDA 1O5BB 2W26A 1WV7H 4AC9A 2VNTA 2VIVA 2ZU5A 4YLQH 6GCHG 1L4ZA 1SLWB 1D3PB 2EA3A 4YZUA 5G4BA 2H9EH 4NWKA 4NG9H 1BJUA 3ZZ9A 3UOPA 3B23B 4B75A 1C1RA 4AG1A 2C8YB 4FUFA 5GDSH 1QBVH 1YBWA 3RXVA 1YM0A 2ZGHA 2LELA 2GVFA 2XW9A 2KAIB 5FPTA 2F9BH 2M2AA 1NT1A 3ZZ6A 1JRTA 2ZDVH 3BN9A 4Y10E 4E7NA 1ETSH 2AMDA 5FX6A 1TNJA 1MH0A 2FXRA 3EE7A 1UTMA 1AZZA 1VZQH 1ZPZA 4F49A 1DSUA 5EW1H 3TJNA 4UE7H 4AN7A 3KCGH 5TJXA 3DSGA 5C20A 3HKJB 2OINA 1ELCA 6GCHF 2ZWLH 3UAIC 2ANYA 2WV5A 1PPFE 4K3JA 5EJ1A 1V2LT 3A82A 4JZDH 1NRNH 1EB1H 1DT2A 1HLTH 1T4VH 2FOHA 1C4V2 2ZI2H 3A7ZA 4ISLA 1IQNA 4X0WU 4K2YA 1NRPH 3A83A 2ZQ2A 1FQ3A 2TGDA 4ABIA 2BDYA 2ZF0H 3F9EA 3A7YA 2F3CE 3ZV9A 3DSOA 4LZ1H 2XRCA 1H9LB 5GXPA 3C27B 2FTMA 3SU4A 1PFXC 4WMFA 3TVJB 1GBEA 1LHEH 3UNSA 1VJAU 2ZC9H 3M36A 5LPEA 1LVMA 1PPBH 2BD2A 1TNKA 1RD3B 2BZAA 3DA9B 1K0HA 1GBCA 4MPUA 4I8JA 3ZZ4A 3TH3H 3F2HA 2EI8A 3MH6A 2A5AA 4NSYA 1ELVA 2XBWA 4X1SU 2PKSC 2H5DA 1X7AC 1S84A 4R0IA 2FS8A 1F5RA 1NBME 2XBYA 4D7GA 2VWNA 2C8WB 1HAIH 2TGPZ 1WQVH 3QTVH 1VJ9U 1CT2E 2RA3A 3MNBA 5KEDA 1YF4A 3KNXA 1OWDA 4X1QU 2QXJA 1H8DH 2J34A 2KZ4A 3S0NA 4OS4A 1J17T 1FY1A 3DSPA 4NA9H 3DUXH 1S0RA 4I8LA 1ANEA 3T26A 3E3TA 4CRGA 1AY6H 1CA8B 5CHAB 1KTSB 3UREA 3UTUH 4OS1A 4BANB 3UNQA 2PTCE 1UTKA 4J1YA 3FP7E 2ZTXA 1DX5M 1S85A 1AWFH 1O2RA 1UTQA 2BD7A 2QE7D 3F9FA 3BG4B 5JB9S 5EJZA 4OS5A 5HYOA 1MKXK 2GCHF 3SHAH 1CA0C 2RCEA 2ZHDA 5EXNA 4O3TA 1HAVA 1QA0A 1Y3VA 2JJ1D 5TCCA 3F68H 2M5TA 2J98B 2RG3A 4MG3A 1VCQA 1DANH 1EJAA 4YLUA 4B6EA 1K28D 3KIDU 3Q00A 2TIOA 4FOUC 1K22H 2QCYA 3ATIA 3KN2A 1TX7A 3LT3A 3A81A 1V6DA 2P8OC 1GG6C 2WV4A 1MKWH 1F0RA 1O3DA 2PKAA 1V2JT 4UFGH 2GMTC 1BB0B 1OX1A 1EQ9A 2ZGXH 3BEUA 4AYVB 1D3QB 1TNLA 1AD8H 5ESBA 1SQAA 1YPKH 2OC1A 2QYIA 1C2LA 1DE7H 1G2MA 4K8BA 3V12A 5E0HA 4YOJA 4IS5A 5FXLA 3LJJA 2BD5A 2VH6A 4FUGA 1BT7A 2C3SA 2OQ5A 1L0ZA 2F43B 4WF8A 1O3JA 2BD8A 3V0XA 1SGYE 1DPOA 1K1IA 3SJ9A 3UNRA 5FCKA 1PYTD 2FDAA 3PROA 3SN8A 3ZZDA 1KY9A 3UUZA 1VITG 3OU0A 1FUJA 2V35A 2IPHA 3GICB 1SHHB 2B8OH 1LPGB 2P59A 1TPAE 1FN8A 2FOEA 2WZQA 4DJZB 3NKKA 1H9IE 4Y79A 1E1QD 2CK3D 2GJGA 2GZ8A 3GYMA 1DICA 1S6FA 1GGDC 3FO8D 3B9FH 1BMNH 1J15A 1EAXA 1BTYA 1MBMA 4HG6A 3A8BA 3BEFB 5JDUB 3SJ8A 2BVRH 4CR5A 2G8TA 3VFEA 1FIZA 1GI4A 2PUQH 3QX5H 5H4IB 1T8NA 4MPXA 1O3AA 1K9OE 3ZZAA 1LPKB 1T8LA 2ZHFH 4ZKRU 1C5UA 4GUXA 1L1GA 1DLKB 1K1JA 3ZZ5A 3OFND 1A7SA 4LOYH 4XBCA 5T6FA 1J14A 1BQYA 1KXAA 1O38A 5ABWA 1YPGH 1AU8A 4FXGH 3MO9A 1DS2E 3NRLA 1GPZA 5C1UA 2H6MA 1RTLA 2OP9A 1QR3E 1Y3UA 1UHBB 2FWWA 3AVZA 3SNDA 4Z1MD 4AFQA 1H9HE 1C5WB 1COWD 1Y5AT 1GMDG 4Q7YA 8LPRA 5CHBA 2O8MA 3MMGA 3SU2A 2H2ZA 1NESE 1EZXC 4X8SH 4OS2A 1TGCA 1H4WA 1O3NA 1L1JA 4XSKU 4Q63A 4ZROA 5DP8A 3KQBA 2QA9E 5DP4A 1CT4E 3RXBA 1O2JA 1QCPA 1O3BA 1HAOH 1C1WH 5GCHG 3PMJA 2XNIA 1ELGA 3STJA 1JBUH 3SJIA 1B0EA 3P8NA 3PRBA 4HTCH 1SGCA 2OC7A 2GX4A 1GMDF 2UUKB 4M7GA 3MI4A 1TIOA 3TPIZ 1C5MD 1O33A 1O34A 2BD4A 4GVUA 1W7XH 1CHOG 3OAAD 1HDTH 2F4LA 3TJUA 5AHGH 4LZ4B 2Z7FE 4GHTA 3BIUH 1N1LA 1P09A 2XBXA 2Q6GA 1TMBH 1W3CA 1IOEA 1QNJA 3P8OA 1RTKA 2SGFE 1W2KH 1GJ8B 4Y8XA 2BDBA 2BDIA 2BHGA 1KXBA 1MKXH 2J5UA 2HLDD 3TGIE 1EPTB 3MU1A 4CHAC 3A7WA 4JK6A 1CU1A 2A7JA 3EDXB 5A8YA 1EJNA 1SHYA 1BMMH 2SGPE 1SBWA 5EPNA 1XUKA 4KKDA 3GCNA 2B0FA 2QC2A 4UFEH 1LCYA 2GCTB 3SV8A 1HV7A 5JYIA 1CHOF 3MQKC 1P06A 1ANBA 1OOKB 4AGJA 2BOKA 2P3TB 1TX6A 1GI7B 1F0TA 5C67A 2IPQX 3MNCA 3AAVA 4MPVA 2JKHA 2ZFTA 3PLPA 2FI3E 3RXUA 1RGQA 2FOGA 2H5CA 2QF4A 1GMCG 2ANMH 2SFAA 1YKTA 4MQAA 1YCPM 1FJSA 1WXRA 1IQIA 3RXPA 5FHTA 2W3KA 4X6NA 4B2AA 1BMAA 4BAMB 1P2QA 4TY6A 2Y82A 2SNWA 2AIPA 2VJ1A 1JIRA 4D9QA 4B74A 3U1IB 2G51A 3G01A 1P03A 2QF5A 1ELFA 1RXPA 1P10A 1WBGB 4X2YA 3PM3A 1C5VA 1O39A 3F1SB 5LH8A 3GY7A 2Z3CA 5L30H 4DT7B 3RP2A 3P92A 4D76A 2WYGA 2XYAA 4ZH8A 5A0BA 2GV6A 4ZKSU 1CBWB 4WJG2 1GI5A 1C5SA 1M9UA 5HIYA 3F0PA 1GWAA 1E35B 4XDEA 2DE8A 2AH4X 1ZTKA 1FAXA 1FAKH 3AASA 3LGYA 1O37A 1SQRA 2D26C 2WPIS 2V3MA 2ODQA 5EQQA 3ODFA 4TT3D 5DP6A 3RXIA 1H1BA 5C94A 1AQ7A 3RLWH 5JBTA 1OWIA 1MCTA 1K1NA 3ZVBA 1T7CA 2FP7B 5LPFA 1P2MA 2ASUB 1DVAH 1L4DA 1BDAA 5DPAA 5C1XA 1TBQH 3P6ZB 4Y6DA 1HIAB 3C1KA 3Q3KA 2CJIA 1PPEE 1G30B 2PGBB 4K1TA 1HUTH 2G5VA 1O3KA 1MTNC 2VINA 1IQJA 4Y7BA 1ZSKA 3RXJA 1GI6A 5A09A 3TIUA 3VB4A 3VGCC 1A61H 1OP0A 1SGTA 5A2MH 2GGVB 2FOAA 2QXIA 1Z8RA 3FANA 2NWNA 2WSSD 2A4RA 3A8AA 3GCHB 3KGPA 1D9IA 2OLGA 3UY9A 2SNVA 1SI5H 3QZQA 3GISB 2GZ9A 3HATH 1O2KA 3MH7A 4DCDA 1AE5A 5T3HA 4X6OA 1NPMA 2VIOA 5A0AE 1SQOA 1HCGA 3ZZCA 2FTLE 4MNVA 2B7DH 2ZU3A 5C0UA 5CDFE 4INHA 1SB1H 1MAXA 3HGNA 1P11E 1BTUA 1BZXE 3N7OA 3SHCH 2BDGA 4ZXXH 1GHAG 2A2QH 2BXTH 1TGNA 3P8FA 1BTXA 1ZPCA 3OYPA 1QBOA 3MNSA 3P95A 1KIGH 5A0CA 1HYLA 3ZVGA 3RXCA 1K1PA 1W7GH 1PPZA 2PSYA 3ITIA 1Z71A 1AUTC 2I6QA 1BIOA 2WPHS 3F9HA 2FPZA 3TH2H 1ELDE 2CN0H 3W94A 3GY5A 2YOLA 2FOFA 4JCNA 3NK8A 2QAAA 2K0QA 1QL7A 5JPMH 1ABJH 1LDTT 2UUJB 3PO1B 3QN7A 5E0GA 3TU7H 2GD4B 4WMDA 2HGTH 2FI4E 2BYAX 1F0UA 2BOHB 3O8CA 1Z1IA 1PPGE 1AKSA 4A1XA 2W7UA 3EAJA 1FY3A 1W8BH 4THNH 1O2TA 2FYQA 1ZHRA 3U69H 3TJOA 1UVPA 3SU1A 2GV7A 1KLIH 1YCPH 4IN1A 7LPRA 1FIWA 4D8NA 3VB7A 5C3NA 5GPIB 1S0QA 1GI2A 2RDLA 4UFDH 2PLXA 5EOKA 1GI8B 4B76A 1SOZA 2QN5T 1O2HA 1SFIA 1OP8A 1TRNA 3A85A 5LGOA 4B1TA 4Q80A 1O2SA 1W14U 2G81E 3PMAB 4P02A 1FY4A 2P93A 3SU5A 4AOQA 3RMMH 2J2UA 3ZZ3A 2Y7ZA 2JH6D 3S9CA 1FZZA 1B7XB 1HAGE 2VU8E 4RSPA 1NU7B 2DUCA 1RIWC 2NU4E 4CRFA 3K6ZA 1TOMH 1O36A 1OKXA 1T8MA 3SNBA 4FUDA 4CRCA 3M61U 5L2ZH 5JBCS 2FOBA 1MZDA 2ALVA 1DY9A 1CVWH 5PTPA 2ANKH 2ZFQH 1UO6A 2QXHA 1PPCE 3M5MA 2FX6A 2TGTA 1W11U 3RU4D 3Q77A 3LONA 1NY22 3A84A 1QRXA 2YMSB 2ZFPH 2BD9A 1TLDA 2EQNA 3H7TA 4DIIH 4ABAA 1VCPA 2ZDLA 1SGEE 2BXUH 1JOUB 3BG8A 1C5QA 3A8CA 4U01A 1TGTA 1OYQA 3LGVA 1OWKA 4SGAE 4AB8A 2ZNKH 3KQEA 4F4OC 1C5OH 2C93B 4VGCC 1MCVA 2ZTYA 1GHBF 2J97A 1DUAA 4TWYA 1V2UT 3BF6H 1ZRKA 3W1EA 1FNIA 2THFB 2BLVA 2XOKD 4XD7D 5ETXA 1GCTC 2A0QB 1TRMA 2GZ7A 2Z9LA 2HPPH 3U8RH 1TX8A 1VGCB 3BTDE 3KQ5A 3MH4A 4X1PU 3EA8A 5F53A 4BAQB 4GCHF 3CS7A 1ZTLA 4O3UA 1ESBA 1O5DH 2Q6DA 1ZHPA 3F2FA 3JZ1B 7KMEH 1AUJA 1GBFA 1DWDH 1SC8U 1UTOA 3A7VA 3SV9A 1P2KA 3QK1A 1S5SA 3SU0A 1YPHE 3Q3YA 2F9NA 4XBBA 1E34B 1DM4B 1Y3WA 5C1YA 4I8HA 1U6QA 2H1UA 1GBMA 2CHAB 1A0JA 1YPHC 1BTWA 1XUGA 3UR6A 1O2WA 1H8ED 3U8OH 3PV4A 1RFNA 2ZGBH 4NFEA 1F7ZA 3VXEH 1B0FA 2WUCA 1MTUA 1MZAA 1PYTC 2QIQA 1NS3A 1V2KT 2VB0A 1ELTA 2ZFFH 3BTFE 2AS9A 3RDZA 3DCLA 7ESTE 2OK5A 3STIA 1OPHB 1BRCE 3N7DA 3RC5A 2BLOA 2BQ7B 2GCHG 2V7QD 3NCLA 3ATLA 2XXLA 3BEIB 1O3FA 6CHAC 2QF3A 1KXCA 3F9GA 1TQ7B 1HJ9A 3BV9B 3SV7A 1O30A 3KYGA 4ABHA 5TCAA 1DWEH 2BY9X 2Y5HA 4ABFA 1EP5A 2O8LA 3GOVB 1C2GA 3M7UA 1GBAA 3TK6A 1CGIE 1E36B 1FI8A 2ZQ1A 3OTJE 2RA0A 1GI9B 3UB0A 3NWUA 1ZSLA 2CGAA 4DIHH 2AFQB 1RRKA 1BMFD 1C1MA 1MD8A 1C2HA 5EXMA 3LGUA 2QGRA 5CE1A 4GAWA 4GSOA 2JH5D 1OXGA 4X8VH 1S6HA 2AMPA 2GT8A 3RMLH 4O03A 3SI3H 3FKSD 2A2XH 4UDWH 1LHFH 1BBRK 1C2MA 3RXLA 1SMFE 2C4FH 2C8XB 5EU8A 2DE9A 3KYFA 1DY8A 5ESTE 4JZ1A 3TGKE 4I32A 1O0DH 5GIBA 1BTHH 3LIWA 4NA8A 2B9LA 2C8ZB 4LXBH 1UK4A 1WSSH 4DGJA 1C5LH 1DWCH 2A4GA 1O2MA 5IK2D 4RKJB 3HGPA 1C1PA 5J4QA 2XBVA 4CBNA 2BLQA 1TNGA 3HKIB 1P8VC 3SJOA 1ID5H 3UPEA 5FBIA 3E1XB 1N8OC 2XCFA 3FZZA 3I29A 1P2NA 2YNAA 1DUEA 1W13U 3ENSB 4MNYA 1O2PA 4H6SB 5DO4H 4AFSA 3A80A 1O3OA 2KFWA 2EI6A 1BRBE 4I33A 5HM9A 3VB6A 1KXEA 3M7QA 3SGBE 1O31A 1EZUC 2HALA 3M37A 1FLEE 1V2VT 2BD3A 2FLRH 2PKSB 3W95A 4Y8ZA 4K1SA 1HAYB 4YXWD 1YPLH 1DITH 1CHGA 1TA2A 4BTTB 1KXFA 1XM1A 3A89A 1XX9A 1V3XA 3DFJA 4TPYA 3P70B 1G3EA 1QTFA 1IQEA 3MTYA 1EFRD 1DLEA 1WTHD 3SGQE 2PR3A 3K65B 4JZFH 2G00A 1ZSJA 2J94A 1AO5A 4Q2KA 2FEQH 1S81A 3LC5A 4ABGA 1AE8H 2Z3DA 2R3YA 4YT7H 3KL6A 4KTCA 3E8LA 3UWJH 1FONA 1A1RA 1MBQA 3M35A 3TK9A 1C1VH 2SGAA 1MTWA 2AGGX 4WH6A 3UIRA 1NTPA 2R2WU 3FP6E 2H9TH 3N99A 2ZGJA 2KR7A 2OD3B 3TJVA 1KTTB 4ISOA 1HAVB 1HGTH 2QXGA 1CA0B 3SNEA 2XC0A 3HPTB 4MPWA 3FP8E 1EAIA 1GBTA 1LTOA 2ZECA 4TYDA 1WAYB 4KP0A 7GCHF 2BZ6H 1BHXF 2PP6A 3MNXA 2W5EA 3F2GA 1P05A 3LKWA 2F9OA 1Y5UT 4PROA 1O5CB 1TGBA 1HPGA 1K1OA 1ZZZA 2PKAB 5EIYA 1WU1A 2XC4A 1XMNB 3GDUA 4Y71A 5FPSA 2P8OB 1GG6B 2Y81A 3A87A 3BTEE 3GY8A 1IQFA 1UTNA 2GMTB 4UEHH 1O5EH 1GJAB 4HI3A 2GKVE 4O9VA 5E2OA 1ZGIA 2ODPA 1O32A 2ZHQH 1GJ9B 1YPJH 1XKAC 4GLYA 1BRAA 2PUXB 2BDAA 1B5GH 1SGQE 4JYVH 1LVBA 1SSXA 2L6OA 2J95A 5DJ7A 2XC5A 4FUBA 1GBJA 1SVPA 3U98H 5GJ4B 9ESTA 2VIWA 2O8WA 3EA7A 3RXAA 2G55A 4OGYA 1UCYK 1GDUA 1IQLA 3OX7U 1MMJN 1QURH 2TBSA 3QGNB 1QBNA 1FDPA 3LU9B 4TWWA 1A3BH 2A5KA 2F9UA 4R8TB 2ZU4A 2AHME 3SI4H 2HRVA 2QF0A 1C4Y2 1MQ6A 1W0KD 1SG8B 5DP5A 1P2OA 1Y8TA 2XNDD 1SLUB 3S69A 1ANCA 2Z6BD 1ARCA 1GGDB 4Q4LA 3BTKE 4JK5A 2WUBA 2FOMB 3I78A 2F9VA 2BY5X 1BRUP 1J8AA 1YPEH 1WCZA 2ZKSA 1UK2A 2KCPA 2C90B 3F3BA 3IWMA 2TRMA 4I8KA 2GP9B 3U9AH 3FZDA 1NFWA 1BBRH 1O2YA 1G2LA 4YESB 2PHBA 2PV9B 1C1QA 1EOJA 3UFAA 1Q2WA 1LQDB 1LKBA 1T31A 1T4UH 2WYJA 1YCPK 3VXFH 3GY3A 3QO6A 4Y0YE 1UTJA 3SNAA 4ASUD 3KQDA 2BY7X 5BRRE 4ISIH 4K8YA 2SGEE 4XRNA 1O2XA 1AI8H 3DT0H 1O2IA 4ABBA 4TSFD 3S9AA 2D1JA 1HJAC 4BTIB 2ZDMA 1L1NA 5E8EH 1AHTH 5EQSA 1C1OA 3OEED 1KLTA 4X1RU 1C2KA 4DY7B 3GYLB 1GJ4H 1ZHMA 2UUYA 5C17A 2V3HH 1YWUA 3P8GA 1BTPA 4SGBE 5EGMA 1BMLA 1GJCB 1QZ8A 3PMHB 3A7TA 1GJDB 3LGIA 1TONA 4ABEA 1NRRH 3PWCA 3F6UH 2VGCC 2PW8H 1ETTH 3MU5A 4AG2A 5KECA 1AFEH 2TGAA 3PB1E 3ZZ8A 2A32A 3PLKA 1TYNA 2ALPA 2OXSA 2BVSH 1E1RD 2OUAA 5LPRA 5DG6A 4AZ2B 2OC8A 1CO7E 1O2NA 5T6GA 4FVDA 2Z9JA 1LHGH 2JETC 4XOJA 3PV5A 1TA6A 2ILNA 4M9FA 1OWHA 5CMXH 3PTNA 2P95A 1BITA 3NPSA 1Z8JB 1LO6A 2EEKA 2IOTA 1QY6A 3SORA 4OM9A 1SGNE 1XXDA 3PTBA 1YLNA 1TNHA 2ZCHP 2ZPRA 1DWBH 1ZMNA 3OSYA 1UK3A 1NM6A 4XFQA 4E05H 1DDJA 1IQGA 1F92A 1ZGVA 4Z6AH 2QY0B 1G32B 2LPRA 2BLWA 4CHAB 1O3IA 1EATA 2A31A 1W0ZU 4AYYB 4NIXA 2ESTE 2ZU1A 4FUEA 2ZPSA 4X2VA 1TALA 1TAWA 1ZJDA 2AIQA 5EXLA 3TLOA 1JXPA 3E90B 1Q3XA 2XWBI 4K5ZA 4Q7ZA 4WWYA 4HFPB 3LC3A 1E0FD 1TNIA 3UQOA 1OHHD 1A5GH 2STBE 3UOUA 4AFUA 4J2YB 2A7HA 1L2EA 3S7HB 1K1MA 3ATMA 4FU7A 1KMHB 5EPYA 3N7EA 4Y8YA 1HAXB 1THPB 1ANDA 1K21H 2JJ2D 4OS7A 2W3IA 4XE4A 2VIPA 3RU4E 1Z6JH 3FOAA 3RXFA 1J9CH 2Q6FA 2WV9A 2CV3A 2EY4C 4ABDA 4ZCNA 8KME2 2NU2E 1UCYH 4FUIA 4YTAA 3U28C 2BDCA 1GL0E 1GBIA 3EYDA 1LVOA 1MU6B 3GY2A 4E7RG 3MO3A 1ZTJA 1AFQC 3GS9A 1OS8A 3OEHD 3TNTA 5BPEA 3ATKA 3HK6B 4BNRA 1SGFA 1TBRH 1HNEE 3D62A 4ZUHA 2ZPQA 3E6PH 1NU9A 4CBOA 4ZKOU 3QDZB 3RMOH 1PQAA 1GBBA 4A6LA 4B2CA 1C4U2 2ZZUH 1NRQH 5C5NA 1SPJA 2KAIA 3H7OA 1MUEB 4P00A 4NWLA 2VBCA 5HM2A 1K1LA 1D4PB 1ZRBA 2ZO3H 1AVWA 2K8IA 1C5YB 1C9PA 5HGGA 3BTGE 1SOTA 1AGJA 3S9BA 4MNWA 3DD2H 4X6PA 2Q1JA 1QL9A 4NIYA 1SR5C 5FL7D 5IDKA 1AB9B 2FESH 1TPSA 4ABJA 2ZFRH 4I7YH 1E79D 3A7XA 5DP7A 1GHVH 1O2VA 1Y59T 1C9TA 3MO6A 2SGDE 4X8UH 4MVNA 3VGCB 2VWOA 3E0NB 4BXSA 5AFYH 2HVYB 8GCHF 3RUOA 8ESTE 3OTPA 4F55A 2AGEX 1D3TB 4WMEA 1O5FH 5C2ZA 4IN2A 1WYKA 3E16B 3RMNH 1O3MA 4ZHAA 1WDIA 3MU8A 4FU9A 1MTSA 1UTPA 1HJ8A 1MAYA 2AERH 2F83A 5K7RA 1QB9A 1GI3A 2OC0A 1GHBG 3CENA 3QTOH 3M7TA 1S82A 1F0SA 4YOGA 1QJ1B 3WWBA 4IC6A 2V3OH 4A92A 5JBAS 3VB5A 1A46H 1O5GH 3MOCA 3L3TA 3ATWA 3BTWE 1C1UH 4B6FA 2BTCE 4HZHA 4IGDA 1GBHA 1Y5BT 3SNCA 4AGKA 4E06H 2VWMA 2ZG0H 3BTTE 2PSXA 1GHXH 2P16A 2P3UB 2UUFB 4GCHG 1W10U
chains in the Genus database with same CATH topology
3O8CA 2A4GA 3F2HA 3OEHD 3PRBA 5T1VA 5IK2D 2OC7A 5EQQA 5FPYA 4TT3D 3O8RA 4A1XA 3F2FA 3F0OA 2XCFA 2FP7B 2L6OA 1NBME 3OE7D 3SV9A 2K1QA 3AK5A 3SUFA 5DN6D 3SU0A 1DXWA 3VG8A 3OAAD 3ZIAD 2KFWA 2F4LA 5GJ4B 1E1RD 2P59A 2YMSD 4I33A 2WZQA 2XCNA 3SU1A 1N1LA 2QV1A 2OC8A 5HKKD 2WPDD 1W3CA 5C0TA 2WHXA 1E1QD 3P8OA 3KNXA 2CK3D 4NWLA 3PV5A 2VBCA 3WW7A 2JDID 1H8ED 5GPIB 4B73A 2W6JD 4YXWD 2J5UA 3FO8D 2K8IA 2KZ4A 4M9FA 4I31A 4NWKA 4B76A 4R8TB 2F9UA 3KF2A 2HLDD 4RI0A 4B75A 2AHME 3PV2A 3KEEA 1S6LA 3DSPA 3SUDA 3FN8A 1CU1A 2KM0A 1W0KD 5FL7D 5IDKA 3WWFA 1EFRD 2LELA 2GVFA 3SU5A 2GGVB 5FPTA 1NS3A 4OM9A 2XNDD 2M2AA 5DSFA 5EPNA 2WSSD 1SKYE 2A4RA 5H4IB 1E79D 3PRDA 3SV8A 3DCLA 4Q4LA 2OK5A 1W0JD 1DXPA 3O8BA 3N7DA 1H8HD 2QE7D 3RC5A 2YMSC 4B6FA 2FOMB 4DT4A 3RC6A 2V7QD 3OFND 4WH8A 2F9VA 3RC4A 2OINA 4KTCA 1RGQA 2IJD1 2QF4A 5CDFE 5C0UA 1DY9A 2JJ1D 2KCPA 3F3BA 4A1TA 1A1RA 1WXRA 3SV7A 1JXPA 1MABB 3E90B 3M5MA 5B6LA 3OTPA 5GNDA 3NRLA 4B6EA 4WH6A 3SV6A 4B71A 3L6PA 3M5OA 4F55A 3LONA 2KCYA 2W6ID 3KN2A 4A1VA 3SU3A 1RTLA 2YMSB 3M5LA 3N99A 2KR7A 2IJOB 2JIZD 4B74A 3OYPA 3U1IB 1OHHD 2OBOA 3UB0A 4Z1MD 3SZEA 2QF5A 3SU6A 1BMFD 4JMYA 4U01A 3P8NA 1COWD 5CHBA 2O8MA 4ASUD 3SU2A 4FETA 2OC0A 2FM2A 1KMHB 3M5NA 5EPYA 3N7EA 4TYDA 2JJ2D 2A4QA 3DSOA 3WWBA 4A92A 3FKSD 1FX0B 3F2GA 3LKWA 2KCOA 2OBQA 4TSFD 1NBMD 3SU4A 5ESBA 2YOLA 4Q63A 2OC1A 5EQSA 3FOAA 3SYJA 3H09A 3O8DA 4K8BA 3OEED 3W1EA 2WV9A 2K0QA 1DY8A 3F0PA 3LOXA 3U1JB 2XOKD 3SUGA 5FPSA 4XD7D 5ETXA 4I32A 4ZCNA 1BT7A 2XNIA 3SUEA 2F43B 5C17A 4WF8A 3EYDA 5EQRA 2KCAA 5F53A 3GS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2H A;  3F0O A;  5DSF A;  3FN8 A;  5C17 A;  5C0T A;  3F2G A;  3F0P A;  3F2F A;  5C0U A; 
#chains in the Genus database with same CATH topology
 3RXT A;  2OCV B;  3BTH E;  1GMH G;  1FMG A;  2ZEB A;  5HXF A;  2ZDK A;  3ZVF A;  3VB3 A;  3PLB A;  4Z0K A;  1A4W H;  3SGA E;  2KX4 A;  1YY3 A;  1CT0 E;  1P01 A;  3GCT F;  4AX9 H;  2ZCL P;  1G3B A;  1A0H B;  1O3E A;  3LJO A;  1VKY A;  1DXW A;  1P3E A;  1RS0 A;  2YMS D;  3EE0 B;  4RKO B;  2XCN A;  2QV1 A;  1C2I A;  1AKS B;  3T27 A;  4UD9 H;  5CHA C;  4CRA A;  4K1E A;  1EKB B;  1F5L A;  3Q3X A;  1IQH A;  4DW2 U;  1BTZ A;  2ANW A;  2BY8 X;  2Z3E A;  1SQT A;  2W6J D;  4I31 A;  3BG4 C;  1GDQ A;  4ZAE A;  1GMH F;  4YO9 A;  3FN8 A;  1Y3X A;  2Y80 A;  1EAW A;  3WY8 A;  4EST E;  2ZHE H;  4NA7 A;  5K0H A;  1EZQ A;  5DSF A;  5I25 A;  2HWL B;  3SQH E;  4X6M A;  3NXP A;  3ZVC A;  4NZL A;  1D6R A;  1WUN H;  1UJ1 A;  2V6N A;  4FUC A;  2J98 A;  3OY6 U;  1NRS H;  3M3T A;  1H8H D;  1ZJK A;  1AVX A;  4RT1 A;  2BM2 A;  3RC4 A;  4DG4 A;  3SBK A;  2ZCK P;  3RXE A;  2Z9I A;  2VVU A;  2I6S A;  1WTG H;  5C5O A;  1OYT H;  2PTN A;  1XVM A;  4A1T A;  1V2N T;  3SOS A;  1UVS H;  1AMH A;  4OS6 A;  1EP6 A;  5GND A;  1SL3 A;  1GVL A;  1XUH A;  4AFZ A;  4ZKN U;  1MU8 B;  2ZIQ H;  1C1S A;  1RIW B;  1TQ0 B;  2V0B A;  5E2P A;  2GTB A;  4JYT A;  1WOF A;  2O9Q A;  2OBO A;  4FVB A;  3D65 E;  5IYT A;  2O8T A;  5EJL A;  1PQ5 A;  2CXV A;  4X1N U;  1P3C A;  1SGI B;  1H8I H;  4Y76 A;  4UFF H;  3A8D A;  2BVX H;  1ZPB A;  2ZDA H;  3A88 A;  1KXD A;  1NRO H;  2NU0 E;  2G4T A;  2XTT B;  4AB9 A;  3K9X B;  3LDX H;  3TGJ E;  1V2W T;  1O35 A;  1W12 U;  2BMG B;  4ZXY H;  3SV2 H;  2J9N A;  1G37 A;  1P57 B;  1YPM H;  4GPG A;  3UQV A;  3K6Y A;  3SUE A;  1HAH H;  1QJ7 B;  1A0L A;  4VGC B;  1LMW B;  2BQ6 B;  5T1V A;  5JBB S;  3SO3 A;  3UR9 A;  2J38 A;  1BOQ A;  1D6W A;  2STA E;  4X2X A;  1F2S E;  1NFY A;  1GCT B;  1P9S A;  1UVU H;  5DN6 D;  1Z7K A;  3MU4 A;  1SLV B;  1UMA H;  3AW0 A;  2WPD D;  1V2R T;  2HVX A;  1OSS A;  1QQ4 A;  1PJP A;  1TOC B;  1TB6 H;  1C5T A;  5E0J A;  1V2M T;  2EI7 A;  3URC A;  3V13 A;  1O2L A;  1T8O A;  2OTV A;  2HPQ H;  3KF2 A;  4B2B A;  4RI0 A;  3HK3 B;  3PV2 A;  3KEE A;  1INC A;  1NFX A;  2TPI Z;  3SUD A;  2Y5F A;  1LHD H;  4IW4 E;  4CRE A;  1O2Z A;  3GDS A;  3UWI A;  1A2C H;  2VVC A;  4Q7X A;  4CRD A;  3KHV A;  5FBE A;  4MLF B;  4CH2 B;  1W0J D;  2FOC A;  4DT4 A;  1P0S H;  3TIT A;  5F6M A;  2AYW A;  4BAH B;  1UTL M;  3ZZ7 A;  1PQ8 A;  1F5K U;  2FI5 E;  4IBL H;  2R9P A;  3KQC A;  5DKM A;  3QZR A;  1QGF A;  1FV9 A;  1LQE A;  4RT0 A;  1HRT H;  1UHB A;  3RXH A;  2BX4 A;  2OQU A;  4U2W A;  2YNB A;  1QA7 A;  1HAP H;  1MD7 A;  1VIT H;  3SV6 A;  1EB2 A;  3P17 H;  3R0F A;  4ZHM U;  2IJO B;  2JIZ D;  1GHY H;  1AZ8 A;  1ZMJ A;  1GJB B;  4Y0Z E;  3NZI A;  2HNT E;  1MTV A;  3DFL A;  3RXQ A;  1RJX B;  3QUM P;  3FFG A;  3MYW A;  6CHA B;  4FUJ A;  4X2W A;  2FM2 A;  2Y5G A;  4MDS A;  2HNT C;  7GCH G;  1GVK B;  1EJM A;  3TNS A;  1OWE A;  2D8W A;  5EOD A;  5JB8 S;  1CGH A;  2FLB H;  1NBM D;  1Y3Y A;  2HNT F;  4JZE H;  1NN6 A;  3SYJ A;  1GJ5 H;  3U1J B;  1ESA A;  3LOX A;  2FX4 A;  3B8J A;  1VCW A;  3CS0 A;  1O2O A;  1GBD A;  5EQR A;  5L6N H;  4ISN A;  4RN6 A;  2Z9G A;  3SW2 B;  6EST A;  1O3H A;  3PWB A;  1QFK H;  5FCR A;  3O8R A;  1OWJ A;  3RXD A;  6LPR A;  2A45 B;  3IIT A;  2FOD A;  4U30 A;  3H5C B;  4D7F A;  1VIT F;  1JWT A;  1FY5 A;  1EPT C;  4H4F A;  4BAK B;  1O3G A;  1EPT A;  4H42 U;  1TRY A;  5HKK D;  4ACA A;  3U8T H;  1IHS H;  4JZI A;  2GCT C;  3WW7 A;  2A1D B;  1G36 A;  1SFQ B;  1TFX A;  1YLC A;  3FVF B;  1N8O B;  1XXF A;  1QIX B;  4NFF A;  4KTU A;  3LGT A;  2UWO A;  1GHW H;  1S83 A;  1HXE H;  2FZZ A;  1EST A;  1TPP A;  4Y7A A;  5T6D A;  2HOB A;  2RFK C;  4QT8 C;  1YYY 1;  3WWF A;  4YOI A;  3GDV A;  3GY6 A;  4U32 A;  1OP2 A;  1SKY E;  1GBL A;  1CQQ A;  1EX3 A;  3MWI U;  4TY7 A;  1O2U A;  1MQ5 A;  3CNR A;  3SZN A;  1O5A B;  1A3E H;  3RXK A;  1SLX B;  5F8Z A;  2R0L A;  2LNC A;  3RC6 A;  1ZYO A;  4IC5 A;  1Z8G A;  1HB0 B;  1EAS A;  1ELE E;  1G9I E;  2VID A;  3RXR A;  1LHC H;  1FY8 E;  2VH0 A;  4KGA A;  3E0P B;  1HBT H;  4B71 A;  1P04 A;  2KCY A;  2W6I D;  3LH1 A;  1IHT H;  1WQS A;  2Z94 A;  3BSQ A;  3SU3 A;  3PMB B;  1NZQ H;  2ZHW H;  4INL A;  5HIZ A;  2WIN I;  1CBW C;  1XUJ A;  4WY3 A;  4NIV A;  3MFJ A;  1IAU A;  4K69 A;  3K2U A;  1BCU H;  1XKB C;  4A5T S;  5FAH A;  1P9U A;  1UVT H;  2WPJ S;  5GWZ A;  1SGD E;  4FET A;  4CRB A;  1RTF B;  1E38 B;  3RLY H;  2BQW B;  5DK1 A;  4I8G A;  4ZHL U;  5L2Y H;  1ORF A;  1FN6 A;  1QHR B;  4GHQ A;  1EUF A;  2IN2 A;  3V7T A;  1THR H;  3BIV H;  4ISH H;  1TE0 A;  1ZR0 A;  5FX5 A;  3H09 A;  2XWA A;  3ODD A;  1BA8 B;  2H9H A;  3SUG A;  2PGQ B;  1PPH E;  1P12 E;  2NU3 E;  1XUI A;  4I86 A;  4NCY A;  1BHX B;  3ELA H;  5GCH F;  2ODY B;  3L33 A;  2KCA A;  3I77 A;  3QGJ A;  4IMQ A;  1C5N H;  5FPY A;  3T5F H;  1HIA A;  2ZTZ A;  1YC0 A;  3LH3 A;  2GDE H;  3Q76 A;  3RXG A;  2J4I A;  1GHZ A;  1P2J A;  2P3F H;  4WXV A;  3ZYE A;  2VVV A;  1O2Q A;  3OE7 D;  9LPR A;  1IQM A;  3VG8 A;  4IMZ A;  1QB1 A;  3ZIA D;  3MH5 A;  1QRZ A;  4UON A;  2R2M B;  1QQU A;  4K60 A;  1C2J A;  1QB6 A;  2ZP0 H;  3GCH C;  2WHX A;  5C0T A;  1YLD A;  1BJV A;  3SJK A;  1TWX B;  2GT7 A;  1BBR E;  2JDI D;  1C2D A;  4B73 A;  1K2I 1;  1ABI H;  2G4U A;  3V3M A;  3GCO A;  1DOJ A;  2BDH A;  2UWL A;  2FO9 A;  2B5T B;  2FIR H;  3ZZB A;  1QL8 A;  2BY6 X;  2G5N A;  3T62 A;  4BOH A;  1PQ7 A;  3T29 A;  1EOL A;  1FPH H;  1TGS Z;  2KM0 A;  2W7S A;  1G3D A;  4WVP E;  1KDQ A;  4CH8 B;  1A5I A;  1ARB A;  2AEI H;  2ZDN A;  2A5I A;  4DVA U;  5HMA A;  5AFZ H;  3A86 A;  3R3G B;  1E37 B;  4ACB A;  1DXP A;  5B6O A;  3O8B A;  3EGK H;  3FAO A;  4H6T A;  1ELA A;  1LKA A;  4WH8 A;  3JZ2 B;  2RDE A;  3TK5 A;  5AVD A;  3TH4 H;  3ZVE A;  2WPK S;  1GMC F;  4TPI Z;  4F48 B;  1C5P A;  5AF9 H;  5EG4 A;  4D9R A;  5F8T A;  3L6P A;  1Q31 A;  3EA9 A;  2Y7X A;  1AIX H;  1AWH B;  1N6X A;  4DUR A;  2F9P A;  1NO9 H;  4A7I B;  3SZE A;  1KLJ H;  1XVO A;  1G3C A;  3SU6 A;  1GBK A;  3OY5 U;  2R0K A;  3PO1 C;  4XBD A;  5I46 H;  3NUM A;  3RXM A;  1GI1 A;  5J4S A;  3M5N A;  1GDN A;  1TBZ H;  1LVY A;  1C2E A;  1TPO A;  2WPL S;  2A4Q A;  4LK4 A;  3D49 H;  3URD A;  1JIM A;  2KCO A;  2OBQ A;  1THS H;  4DOQ A;  3RU4 T;  1CE5 A;  1JMO H;  4YM9 A;  3GY4 A;  4NIW A;  2VIQ A;  1AB9 C;  5EW2 H;  4Y11 E;  1W0Y H;  1BUI A;  2Y6T A;  3M3S A;  1V2Q T;  1QJ6 B;  4INK A;  5SGA E;  2J92 A;  3VPK A;  1JRS A;  1IQK A;  4BAO B;  1SGF G;  1HJA B;  1Z8I B;  3F0O A;  4MNX A;  2LP6 A;  3BTM E;  1DST A;  1XUF A;  4YT6 H;  2K1Q A;  3QWC H;  4JYU H;  1SGR E;  3AK5 A;  1Z6E A;  2BB4 A;  3SQE E;  3D23 A;  3IG6 B;  1V2P T;  1C5X B;  1LPZ B;  1C5Z B;  2AMQ A;  1VR1 H;  2WPM S;  1C1N A;  1CGJ E;  2PWX A;  1KDQ B;  2ZGC A;  1T32 A;  2ZU2 A;  2VGC B;  2BX3 A;  3DHK H;  1TMT H;  2SGQ E;  1NC6 A;  2P94 A;  1GI0 A;  2PFE A;  1S6L A;  2FYR A;  2EC9 H;  1A5H A;  3RXO A;  1NFU A;  1C1T A;  2FS9 A;  5A8X A;  1V2S T;  1GJ7 B;  1KYN A;  1QRW A;  3RXS A;  2L74 A;  2ZFS A;  2JET B;  3PRD A;  3T2N A;  4FUH A;  1TMU H;  1CSO E;  4KTS A;  1C2F A;  3T25 A;  5A8Z A;  2YMS C;  3RM2 H;  1KSN A;  2CMY A;  3E91 A;  1N6Y A;  1ETR H;  2FMJ A;  1Z1J A;  1ZML A;  1UW7 A;  3BTQ E;  2IJD 1;  2NU1 E;  4NGA H;  4NZQ A;  8GCH G;  1UCY E;  4X8T H;  1GCD A;  3AW1 A;  5F8X A;  1MAB B;  3EST A;  3LGW A;  5B6L A;  1AN1 E;  2GDD A;  2Z9K A;  3M3V A;  4O97 A;  3M5O A;  1P2I A;  4A1V A;  2O8U A;  1HAZ B;  3MHW U;  1GHA F;  3M5L A;  1EZS C;  1J16 A;  5KGO A;  1TAB E;  4AOR A;  3QLP H;  1UVO A;  1ACB E;  4FU8 A;  1MTN B;  2VWL A;  1ZLR A;  1SGP E;  1O2G H;  4BTU B;  4ZMA H;  3AAU A;  1ELB A;  2F91 A;  4JMY A;  1DFP A;  2A7C A;  4ASH A;  1ZOM A;  1GJ6 A;  1V2O T;  5DP3 A;  4WXI A;  1VGC C;  1O3C A;  1EAU A;  2A4O A;  2UWP A;  4MTB A;  1FX0 B;  1YGC H;  3PYH A;  2R3U A;  3RM0 H;  1FXY A;  4BXW A;  2AGI X;  3O8D A;  3ZV8 A;  1GL1 A;  1HXF H;  1D3D B;  3ZYD A;  2G52 A;  2ULL A;  1YP9 A;  1GVZ A;  4CR9 A;  1P02 A;  1V2T T;  3MU0 A;  4KEL A;  3EQ0 H;  1O3L A;  1MKW K;  2ZA5 A;  1FPC H;  3VEQ B;  2CF9 H;  2CHA C;  1EXF A;  1C5R A;  3S7K B;  4OGX A;  2CF8 H;  3GCT G;  5DGJ A;  4HGC A;  5DP9 A;  1HFD A;  1O3P B;  2D2D A;  3SUF A;  5F03 A;  1AVG H;  3T28 A;  2JH0 D;  3LPR A;  2HLC A;  1AFQ B;  4NSV A;  3CP7 A;  3ZVA A;  3ZVD A;  1O5B B;  2W26 A;  1WV7 H;  4AC9 A;  2VNT A;  2VIV A;  2ZU5 A;  4YLQ H;  6GCH G;  1L4Z A;  1SLW B;  1D3P B;  2EA3 A;  4YZU A;  5G4B A;  2H9E H;  4NWK A;  4NG9 H;  1BJU A;  3ZZ9 A;  3UOP A;  3B23 B;  4B75 A;  1C1R A;  4AG1 A;  2C8Y B;  4FUF A;  5GDS H;  1QBV H;  1YBW A;  3RXV A;  1YM0 A;  2ZGH A;  2LEL A;  2GVF A;  2XW9 A;  2KAI B;  5FPT A;  2F9B H;  2M2A A;  1NT1 A;  3ZZ6 A;  1JRT A;  2ZDV H;  3BN9 A;  4Y10 E;  4E7N A;  1ETS H;  2AMD A;  5FX6 A;  1TNJ A;  1MH0 A;  2FXR A;  3EE7 A;  1UTM A;  1AZZ A;  1VZQ H;  1ZPZ A;  4F49 A;  1DSU A;  5EW1 H;  3TJN A;  4UE7 H;  4AN7 A;  3KCG H;  5TJX A;  3DSG A;  5C20 A;  3HKJ B;  2OIN A;  1ELC A;  6GCH F;  2ZWL H;  3UAI C;  2ANY A;  2WV5 A;  1PPF E;  4K3J A;  5EJ1 A;  1V2L T;  3A82 A;  4JZD H;  1NRN H;  1EB1 H;  1DT2 A;  1HLT H;  1T4V H;  2FOH A;  1C4V 2;  2ZI2 H;  3A7Z A;  4ISL A;  1IQN A;  4X0W U;  4K2Y A;  1NRP H;  3A83 A;  2ZQ2 A;  1FQ3 A;  2TGD A;  4ABI A;  2BDY A;  2ZF0 H;  3F9E A;  3A7Y A;  2F3C E;  3ZV9 A;  3DSO A;  4LZ1 H;  2XRC A;  1H9L B;  5GXP A;  3C27 B;  2FTM A;  3SU4 A;  1PFX C;  4WMF A;  3TVJ B;  1GBE A;  1LHE H;  3UNS A;  1VJA U;  2ZC9 H;  3M36 A;  5LPE A;  1LVM A;  1PPB H;  2BD2 A;  1TNK A;  1RD3 B;  2BZA A;  3DA9 B;  1K0H A;  1GBC A;  4MPU A;  4I8J A;  3ZZ4 A;  3TH3 H;  3F2H A;  2EI8 A;  3MH6 A;  2A5A A;  4NSY A;  1ELV A;  2XBW A;  4X1S U;  2PKS C;  2H5D A;  1X7A C;  1S84 A;  4R0I A;  2FS8 A;  1F5R A;  1NBM E;  2XBY A;  4D7G A;  2VWN A;  2C8W B;  1HAI H;  2TGP Z;  1WQV H;  3QTV H;  1VJ9 U;  1CT2 E;  2RA3 A;  3MNB A;  5KED A;  1YF4 A;  3KNX A;  1OWD A;  4X1Q U;  2QXJ A;  1H8D H;  2J34 A;  2KZ4 A;  3S0N A;  4OS4 A;  1J17 T;  1FY1 A;  3DSP A;  4NA9 H;  3DUX H;  1S0R A;  4I8L A;  1ANE A;  3T26 A;  3E3T A;  4CRG A;  1AY6 H;  1CA8 B;  5CHA B;  1KTS B;  3URE A;  3UTU H;  4OS1 A;  4BAN B;  3UNQ A;  2PTC E;  1UTK A;  4J1Y A;  3FP7 E;  2ZTX A;  1DX5 M;  1S85 A;  1AWF H;  1O2R A;  1UTQ A;  2BD7 A;  2QE7 D;  3F9F A;  3BG4 B;  5JB9 S;  5EJZ A;  4OS5 A;  5HYO A;  1MKX K;  2GCH F;  3SHA H;  1CA0 C;  2RCE A;  2ZHD A;  5EXN A;  4O3T A;  1HAV A;  1QA0 A;  1Y3V A;  2JJ1 D;  5TCC A;  3F68 H;  2M5T A;  2J98 B;  2RG3 A;  4MG3 A;  1VCQ A;  1DAN H;  1EJA A;  4YLU A;  4B6E A;  1K28 D;  3KID U;  3Q00 A;  2TIO A;  4FOU C;  1K22 H;  2QCY A;  3ATI A;  3KN2 A;  1TX7 A;  3LT3 A;  3A81 A;  1V6D A;  2P8O C;  1GG6 C;  2WV4 A;  1MKW H;  1F0R A;  1O3D A;  2PKA A;  1V2J T;  4UFG H;  2GMT C;  1BB0 B;  1OX1 A;  1EQ9 A;  2ZGX H;  3BEU A;  4AYV B;  1D3Q B;  1TNL A;  1AD8 H;  5ESB A;  1SQA A;  1YPK H;  2OC1 A;  2QYI A;  1C2L A;  1DE7 H;  1G2M A;  4K8B A;  3V12 A;  5E0H A;  4YOJ A;  4IS5 A;  5FXL A;  3LJJ A;  2BD5 A;  2VH6 A;  4FUG A;  1BT7 A;  2C3S A;  2OQ5 A;  1L0Z A;  2F43 B;  4WF8 A;  1O3J A;  2BD8 A;  3V0X A;  1SGY E;  1DPO A;  1K1I A;  3SJ9 A;  3UNR A;  5FCK A;  1PYT D;  2FDA A;  3PRO A;  3SN8 A;  3ZZD A;  1KY9 A;  3UUZ A;  1VIT G;  3OU0 A;  1FUJ A;  2V35 A;  2IPH A;  3GIC B;  1SHH B;  2B8O H;  1LPG B;  2P59 A;  1TPA E;  1FN8 A;  2FOE A;  2WZQ A;  4DJZ B;  3NKK A;  1H9I E;  4Y79 A;  1E1Q D;  2CK3 D;  2GJG A;  2GZ8 A;  3GYM A;  1DIC A;  1S6F A;  1GGD C;  3FO8 D;  3B9F H;  1BMN H;  1J15 A;  1EAX A;  1BTY A;  1MBM A;  4HG6 A;  3A8B A;  3BEF B;  5JDU B;  3SJ8 A;  2BVR H;  4CR5 A;  2G8T A;  3VFE A;  1FIZ A;  1GI4 A;  2PUQ H;  3QX5 H;  5H4I B;  1T8N A;  4MPX A;  1O3A A;  1K9O E;  3ZZA A;  1LPK B;  1T8L A;  2ZHF H;  4ZKR U;  1C5U A;  4GUX A;  1L1G A;  1DLK B;  1K1J A;  3ZZ5 A;  3OFN D;  1A7S A;  4LOY H;  4XBC A;  5T6F A;  1J14 A;  1BQY A;  1KXA A;  1O38 A;  5ABW A;  1YPG H;  1AU8 A;  4FXG H;  3MO9 A;  1DS2 E;  3NRL A;  1GPZ A;  5C1U A;  2H6M A;  1RTL A;  2OP9 A;  1QR3 E;  1Y3U A;  1UHB B;  2FWW A;  3AVZ A;  3SND A;  4Z1M D;  4AFQ A;  1H9H E;  1C5W B;  1COW D;  1Y5A T;  1GMD G;  4Q7Y A;  8LPR A;  5CHB A;  2O8M A;  3MMG A;  3SU2 A;  2H2Z A;  1NES E;  1EZX C;  4X8S H;  4OS2 A;  1TGC A;  1H4W A;  1O3N A;  1L1J A;  4XSK U;  4Q63 A;  4ZRO A;  5DP8 A;  3KQB A;  2QA9 E;  5DP4 A;  1CT4 E;  3RXB A;  1O2J A;  1QCP A;  1O3B A;  1HAO H;  1C1W H;  5GCH G;  3PMJ A;  2XNI A;  1ELG A;  3STJ A;  1JBU H;  3SJI A;  1B0E A;  3P8N A;  3PRB A;  4HTC H;  1SGC A;  2OC7 A;  2GX4 A;  1GMD F;  2UUK B;  4M7G A;  3MI4 A;  1TIO A;  3TPI Z;  1C5M D;  1O33 A;  1O34 A;  2BD4 A;  4GVU A;  1W7X H;  1CHO G;  3OAA D;  1HDT H;  2F4L A;  3TJU A;  5AHG H;  4LZ4 B;  2Z7F E;  4GHT A;  3BIU H;  1N1L A;  1P09 A;  2XBX A;  2Q6G A;  1TMB H;  1W3C A;  1IOE A;  1QNJ A;  3P8O A;  1RTK A;  2SGF E;  1W2K H;  1GJ8 B;  4Y8X A;  2BDB A;  2BDI A;  2BHG A;  1KXB A;  1MKX H;  2J5U A;  2HLD D;  3TGI E;  1EPT B;  3MU1 A;  4CHA C;  3A7W A;  4JK6 A;  1CU1 A;  2A7J A;  3EDX B;  5A8Y A;  1EJN A;  1SHY A;  1BMM H;  2SGP E;  1SBW A;  5EPN A;  1XUK A;  4KKD A;  3GCN A;  2B0F A;  2QC2 A;  4UFE H;  1LCY A;  2GCT B;  3SV8 A;  1HV7 A;  5JYI A;  1CHO F;  3MQK C;  1P06 A;  1ANB A;  1OOK B;  4AGJ A;  2BOK A;  2P3T B;  1TX6 A;  1GI7 B;  1F0T A;  5C67 A;  2IPQ X;  3MNC A;  3AAV A;  4MPV A;  2JKH A;  2ZFT A;  3PLP A;  2FI3 E;  3RXU A;  1RGQ A;  2FOG A;  2H5C A;  2QF4 A;  1GMC G;  2ANM H;  2SFA A;  1YKT A;  4MQA A;  1YCP M;  1FJS A;  1WXR A;  1IQI A;  3RXP A;  5FHT A;  2W3K A;  4X6N A;  4B2A A;  1BMA A;  4BAM B;  1P2Q A;  4TY6 A;  2Y82 A;  2SNW A;  2AIP A;  2VJ1 A;  1JIR A;  4D9Q A;  4B74 A;  3U1I B;  2G51 A;  3G01 A;  1P03 A;  2QF5 A;  1ELF A;  1RXP A;  1P10 A;  1WBG B;  4X2Y A;  3PM3 A;  1C5V A;  1O39 A;  3F1S B;  5LH8 A;  3GY7 A;  2Z3C A;  5L30 H;  4DT7 B;  3RP2 A;  3P92 A;  4D76 A;  2WYG A;  2XYA A;  4ZH8 A;  5A0B A;  2GV6 A;  4ZKS U;  1CBW B;  4WJG 2;  1GI5 A;  1C5S A;  1M9U A;  5HIY A;  3F0P A;  1GWA A;  1E35 B;  4XDE A;  2DE8 A;  2AH4 X;  1ZTK A;  1FAX A;  1FAK H;  3AAS A;  3LGY A;  1O37 A;  1SQR A;  2D26 C;  2WPI S;  2V3M A;  2ODQ A;  5EQQ A;  3ODF A;  4TT3 D;  5DP6 A;  3RXI A;  1H1B A;  5C94 A;  1AQ7 A;  3RLW H;  5JBT A;  1OWI A;  1MCT A;  1K1N A;  3ZVB A;  1T7C A;  2FP7 B;  5LPF A;  1P2M A;  2ASU B;  1DVA H;  1L4D A;  1BDA A;  5DPA A;  5C1X A;  1TBQ H;  3P6Z B;  4Y6D A;  1HIA B;  3C1K A;  3Q3K A;  2CJI A;  1PPE E;  1G30 B;  2PGB B;  4K1T A;  1HUT H;  2G5V A;  1O3K A;  1MTN C;  2VIN A;  1IQJ A;  4Y7B A;  1ZSK A;  3RXJ A;  1GI6 A;  5A09 A;  3TIU A;  3VB4 A;  3VGC C;  1A61 H;  1OP0 A;  1SGT A;  5A2M H;  2GGV B;  2FOA A;  2QXI A;  1Z8R A;  3FAN A;  2NWN A;  2WSS D;  2A4R A;  3A8A A;  3GCH B;  3KGP A;  1D9I A;  2OLG A;  3UY9 A;  2SNV A;  1SI5 H;  3QZQ A;  3GIS B;  2GZ9 A;  3HAT H;  1O2K A;  3MH7 A;  4DCD A;  1AE5 A;  5T3H A;  4X6O A;  1NPM A;  2VIO A;  5A0A E;  1SQO A;  1HCG A;  3ZZC A;  2FTL E;  4MNV A;  2B7D H;  2ZU3 A;  5C0U A;  5CDF E;  4INH A;  1SB1 H;  1MAX A;  3HGN A;  1P11 E;  1BTU A;  1BZX E;  3N7O A;  3SHC H;  2BDG A;  4ZXX H;  1GHA G;  2A2Q H;  2BXT H;  1TGN A;  3P8F A;  1BTX A;  1ZPC A;  3OYP A;  1QBO A;  3MNS A;  3P95 A;  1KIG H;  5A0C A;  1HYL A;  3ZVG A;  3RXC A;  1K1P A;  1W7G H;  1PPZ A;  2PSY A;  3ITI A;  1Z71 A;  1AUT C;  2I6Q A;  1BIO A;  2WPH S;  3F9H A;  2FPZ A;  3TH2 H;  1ELD E;  2CN0 H;  3W94 A;  3GY5 A;  2YOL A;  2FOF A;  4JCN A;  3NK8 A;  2QAA A;  2K0Q A;  1QL7 A;  5JPM H;  1ABJ H;  1LDT T;  2UUJ B;  3PO1 B;  3QN7 A;  5E0G A;  3TU7 H;  2GD4 B;  4WMD A;  2HGT H;  2FI4 E;  2BYA X;  1F0U A;  2BOH B;  3O8C A;  1Z1I A;  1PPG E;  1AKS A;  4A1X A;  2W7U A;  3EAJ A;  1FY3 A;  1W8B H;  4THN H;  1O2T A;  2FYQ A;  1ZHR A;  3U69 H;  3TJO A;  1UVP A;  3SU1 A;  2GV7 A;  1KLI H;  1YCP H;  4IN1 A;  7LPR A;  1FIW A;  4D8N A;  3VB7 A;  5C3N A;  5GPI B;  1S0Q A;  1GI2 A;  2RDL A;  4UFD H;  2PLX A;  5EOK A;  1GI8 B;  4B76 A;  1SOZ A;  2QN5 T;  1O2H A;  1SFI A;  1OP8 A;  1TRN A;  3A85 A;  5LGO A;  4B1T A;  4Q80 A;  1O2S A;  1W14 U;  2G81 E;  3PMA B;  4P02 A;  1FY4 A;  2P93 A;  3SU5 A;  4AOQ A;  3RMM H;  2J2U A;  3ZZ3 A;  2Y7Z A;  2JH6 D;  3S9C A;  1FZZ A;  1B7X B;  1HAG E;  2VU8 E;  4RSP A;  1NU7 B;  2DUC A;  1RIW C;  2NU4 E;  4CRF A;  3K6Z A;  1TOM H;  1O36 A;  1OKX A;  1T8M A;  3SNB A;  4FUD A;  4CRC A;  3M61 U;  5L2Z H;  5JBC S;  2FOB A;  1MZD A;  2ALV A;  1DY9 A;  1CVW H;  5PTP A;  2ANK H;  2ZFQ H;  1UO6 A;  2QXH A;  1PPC E;  3M5M A;  2FX6 A;  2TGT A;  1W11 U;  3RU4 D;  3Q77 A;  3LON A;  1NY2 2;  3A84 A;  1QRX A;  2YMS B;  2ZFP H;  2BD9 A;  1TLD A;  2EQN A;  3H7T A;  4DII H;  4ABA A;  1VCP A;  2ZDL A;  1SGE E;  2BXU H;  1JOU B;  3BG8 A;  1C5Q A;  3A8C A;  4U01 A;  1TGT A;  1OYQ A;  3LGV A;  1OWK A;  4SGA E;  4AB8 A;  2ZNK H;  3KQE A;  4F4O C;  1C5O H;  2C93 B;  4VGC C;  1MCV A;  2ZTY A;  1GHB F;  2J97 A;  1DUA A;  4TWY A;  1V2U T;  3BF6 H;  1ZRK A;  3W1E A;  1FNI A;  2THF B;  2BLV A;  2XOK D;  4XD7 D;  5ETX A;  1GCT C;  2A0Q B;  1TRM A;  2GZ7 A;  2Z9L A;  2HPP H;  3U8R H;  1TX8 A;  1VGC B;  3BTD E;  3KQ5 A;  3MH4 A;  4X1P U;  3EA8 A;  5F53 A;  4BAQ B;  4GCH F;  3CS7 A;  1ZTL A;  4O3U A;  1ESB A;  1O5D H;  2Q6D A;  1ZHP A;  3F2F A;  3JZ1 B;  7KME H;  1AUJ A;  1GBF A;  1DWD H;  1SC8 U;  1UTO A;  3A7V A;  3SV9 A;  1P2K A;  3QK1 A;  1S5S A;  3SU0 A;  1YPH E;  3Q3Y A;  2F9N A;  4XBB A;  1E34 B;  1DM4 B;  1Y3W A;  5C1Y A;  4I8H A;  1U6Q A;  2H1U A;  1GBM A;  2CHA B;  1A0J A;  1YPH C;  1BTW A;  1XUG A;  3UR6 A;  1O2W A;  1H8E D;  3U8O H;  3PV4 A;  1RFN A;  2ZGB H;  4NFE A;  1F7Z A;  3VXE H;  1B0F A;  2WUC A;  1MTU A;  1MZA A;  1PYT C;  2QIQ A;  1NS3 A;  1V2K T;  2VB0 A;  1ELT A;  2ZFF H;  3BTF E;  2AS9 A;  3RDZ A;  3DCL A;  7EST E;  2OK5 A;  3STI A;  1OPH B;  1BRC E;  3N7D A;  3RC5 A;  2BLO A;  2BQ7 B;  2GCH G;  2V7Q D;  3NCL A;  3ATL A;  2XXL A;  3BEI B;  1O3F A;  6CHA C;  2QF3 A;  1KXC A;  3F9G A;  1TQ7 B;  1HJ9 A;  3BV9 B;  3SV7 A;  1O30 A;  3KYG A;  4ABH A;  5TCA A;  1DWE H;  2BY9 X;  2Y5H A;  4ABF A;  1EP5 A;  2O8L A;  3GOV B;  1C2G A;  3M7U A;  1GBA A;  3TK6 A;  1CGI E;  1E36 B;  1FI8 A;  2ZQ1 A;  3OTJ E;  2RA0 A;  1GI9 B;  3UB0 A;  3NWU A;  1ZSL A;  2CGA A;  4DIH H;  2AFQ B;  1RRK A;  1BMF D;  1C1M A;  1MD8 A;  1C2H A;  5EXM A;  3LGU A;  2QGR A;  5CE1 A;  4GAW A;  4GSO A;  2JH5 D;  1OXG A;  4X8V H;  1S6H A;  2AMP A;  2GT8 A;  3RML H;  4O03 A;  3SI3 H;  3FKS D;  2A2X H;  4UDW H;  1LHF H;  1BBR K;  1C2M A;  3RXL A;  1SMF E;  2C4F H;  2C8X B;  5EU8 A;  2DE9 A;  3KYF A;  1DY8 A;  5EST E;  4JZ1 A;  3TGK E;  4I32 A;  1O0D H;  5GIB A;  1BTH H;  3LIW A;  4NA8 A;  2B9L A;  2C8Z B;  4LXB H;  1UK4 A;  1WSS H;  4DGJ A;  1C5L H;  1DWC H;  2A4G A;  1O2M A;  5IK2 D;  4RKJ B;  3HGP A;  1C1P A;  5J4Q A;  2XBV A;  4CBN A;  2BLQ A;  1TNG A;  3HKI B;  1P8V C;  3SJO A;  1ID5 H;  3UPE A;  5FBI A;  3E1X B;  1N8O C;  2XCF A;  3FZZ A;  3I29 A;  1P2N A;  2YNA A;  1DUE A;  1W13 U;  3ENS B;  4MNY A;  1O2P A;  4H6S B;  5DO4 H;  4AFS A;  3A80 A;  1O3O A;  2KFW A;  2EI6 A;  1BRB E;  4I33 A;  5HM9 A;  3VB6 A;  1KXE A;  3M7Q A;  3SGB E;  1O31 A;  1EZU C;  2HAL A;  3M37 A;  1FLE E;  1V2V T;  2BD3 A;  2FLR H;  2PKS B;  3W95 A;  4Y8Z A;  4K1S A;  1HAY B;  4YXW D;  1YPL H;  1DIT H;  1CHG A;  1TA2 A;  4BTT B;  1KXF A;  1XM1 A;  3A89 A;  1XX9 A;  1V3X A;  3DFJ A;  4TPY A;  3P70 B;  1G3E A;  1QTF A;  1IQE A;  3MTY A;  1EFR D;  1DLE A;  1WTH D;  3SGQ E;  2PR3 A;  3K65 B;  4JZF H;  2G00 A;  1ZSJ A;  2J94 A;  1AO5 A;  4Q2K A;  2FEQ H;  1S81 A;  3LC5 A;  4ABG A;  1AE8 H;  2Z3D A;  2R3Y A;  4YT7 H;  3KL6 A;  4KTC A;  3E8L A;  3UWJ H;  1FON A;  1A1R A;  1MBQ A;  3M35 A;  3TK9 A;  1C1V H;  2SGA A;  1MTW A;  2AGG X;  4WH6 A;  3UIR A;  1NTP A;  2R2W U;  3FP6 E;  2H9T H;  3N99 A;  2ZGJ A;  2KR7 A;  2OD3 B;  3TJV A;  1KTT B;  4ISO A;  1HAV B;  1HGT H;  2QXG A;  1CA0 B;  3SNE A;  2XC0 A;  3HPT B;  4MPW A;  3FP8 E;  1EAI A;  1GBT A;  1LTO A;  2ZEC A;  4TYD A;  1WAY B;  4KP0 A;  7GCH F;  2BZ6 H;  1BHX F;  2PP6 A;  3MNX A;  2W5E A;  3F2G A;  1P05 A;  3LKW A;  2F9O A;  1Y5U T;  4PRO A;  1O5C B;  1TGB A;  1HPG A;  1K1O A;  1ZZZ A;  2PKA B;  5EIY A;  1WU1 A;  2XC4 A;  1XMN B;  3GDU A;  4Y71 A;  5FPS A;  2P8O B;  1GG6 B;  2Y81 A;  3A87 A;  3BTE E;  3GY8 A;  1IQF A;  1UTN A;  2GMT B;  4UEH H;  1O5E H;  1GJA B;  4HI3 A;  2GKV E;  4O9V A;  5E2O A;  1ZGI A;  2ODP A;  1O32 A;  2ZHQ H;  1GJ9 B;  1YPJ H;  1XKA C;  4GLY A;  1BRA A;  2PUX B;  2BDA A;  1B5G H;  1SGQ E;  4JYV H;  1LVB A;  1SSX A;  2L6O A;  2J95 A;  5DJ7 A;  2XC5 A;  4FUB A;  1GBJ A;  1SVP A;  3U98 H;  5GJ4 B;  9EST A;  2VIW A;  2O8W A;  3EA7 A;  3RXA A;  2G55 A;  4OGY A;  1UCY K;  1GDU A;  1IQL A;  3OX7 U;  1MMJ N;  1QUR H;  2TBS A;  3QGN B;  1QBN A;  1FDP A;  3LU9 B;  4TWW A;  1A3B H;  2A5K A;  2F9U A;  4R8T B;  2ZU4 A;  2AHM E;  3SI4 H;  2HRV A;  2QF0 A;  1C4Y 2;  1MQ6 A;  1W0K D;  1SG8 B;  5DP5 A;  1P2O A;  1Y8T A;  2XND D;  1SLU B;  3S69 A;  1ANC A;  2Z6B D;  1ARC A;  1GGD B;  4Q4L A;  3BTK E;  4JK5 A;  2WUB A;  2FOM B;  3I78 A;  2F9V A;  2BY5 X;  1BRU P;  1J8A A;  1YPE H;  1WCZ A;  2ZKS A;  1UK2 A;  2KCP A;  2C90 B;  3F3B A;  3IWM A;  2TRM A;  4I8K A;  2GP9 B;  3U9A H;  3FZD A;  1NFW A;  1BBR H;  1O2Y A;  1G2L A;  4YES B;  2PHB A;  2PV9 B;  1C1Q A;  1EOJ A;  3UFA A;  1Q2W A;  1LQD B;  1LKB A;  1T31 A;  1T4U H;  2WYJ A;  1YCP K;  3VXF H;  3GY3 A;  3QO6 A;  4Y0Y E;  1UTJ A;  3SNA A;  4ASU D;  3KQD A;  2BY7 X;  5BRR E;  4ISI H;  4K8Y A;  2SGE E;  4XRN A;  1O2X A;  1AI8 H;  3DT0 H;  1O2I A;  4ABB A;  4TSF D;  3S9A A;  2D1J A;  1HJA C;  4BTI B;  2ZDM A;  1L1N A;  5E8E H;  1AHT H;  5EQS A;  1C1O A;  3OEE D;  1KLT A;  4X1R U;  1C2K A;  4DY7 B;  3GYL B;  1GJ4 H;  1ZHM A;  2UUY A;  5C17 A;  2V3H H;  1YWU A;  3P8G A;  1BTP A;  4SGB E;  5EGM A;  1BML A;  1GJC B;  1QZ8 A;  3PMH B;  3A7T A;  1GJD B;  3LGI A;  1TON A;  4ABE A;  1NRR H;  3PWC A;  3F6U H;  2VGC C;  2PW8 H;  1ETT H;  3MU5 A;  4AG2 A;  5KEC A;  1AFE H;  2TGA A;  3PB1 E;  3ZZ8 A;  2A32 A;  3PLK A;  1TYN A;  2ALP A;  2OXS A;  2BVS H;  1E1R D;  2OUA A;  5LPR A;  5DG6 A;  4AZ2 B;  2OC8 A;  1CO7 E;  1O2N A;  5T6G A;  4FVD A;  2Z9J A;  1LHG H;  2JET C;  4XOJ A;  3PV5 A;  1TA6 A;  2ILN A;  4M9F A;  1OWH A;  5CMX H;  3PTN A;  2P95 A;  1BIT A;  3NPS A;  1Z8J B;  1LO6 A;  2EEK A;  2IOT A;  1QY6 A;  3SOR A;  4OM9 A;  1SGN E;  1XXD A;  3PTB A;  1YLN A;  1TNH A;  2ZCH P;  2ZPR A;  1DWB H;  1ZMN A;  3OSY A;  1UK3 A;  1NM6 A;  4XFQ A;  4E05 H;  1DDJ A;  1IQG A;  1F92 A;  1ZGV A;  4Z6A H;  2QY0 B;  1G32 B;  2LPR A;  2BLW A;  4CHA B;  1O3I A;  1EAT A;  2A31 A;  1W0Z U;  4AYY B;  4NIX A;  2EST E;  2ZU1 A;  4FUE A;  2ZPS A;  4X2V A;  1TAL A;  1TAW A;  1ZJD A;  2AIQ A;  5EXL A;  3TLO A;  1JXP A;  3E90 B;  1Q3X A;  2XWB I;  4K5Z A;  4Q7Z A;  4WWY A;  4HFP B;  3LC3 A;  1E0F D;  1TNI A;  3UQO A;  1OHH D;  1A5G H;  2STB E;  3UOU A;  4AFU A;  4J2Y B;  2A7H A;  1L2E A;  3S7H B;  1K1M A;  3ATM A;  4FU7 A;  1KMH B;  5EPY A;  3N7E A;  4Y8Y A;  1HAX B;  1THP B;  1AND A;  1K21 H;  2JJ2 D;  4OS7 A;  2W3I A;  4XE4 A;  2VIP A;  3RU4 E;  1Z6J H;  3FOA A;  3RXF A;  1J9C H;  2Q6F A;  2WV9 A;  2CV3 A;  2EY4 C;  4ABD A;  4ZCN A;  8KME 2;  2NU2 E;  1UCY H;  4FUI A;  4YTA A;  3U28 C;  2BDC A;  1GL0 E;  1GBI A;  3EYD A;  1LVO A;  1MU6 B;  3GY2 A;  4E7R G;  3MO3 A;  1ZTJ A;  1AFQ C;  3GS9 A;  1OS8 A;  3OEH D;  3TNT A;  5BPE A;  3ATK A;  3HK6 B;  4BNR A;  1SGF A;  1TBR H;  1HNE E;  3D62 A;  4ZUH A;  2ZPQ A;  3E6P H;  1NU9 A;  4CBO A;  4ZKO U;  3QDZ B;  3RMO H;  1PQA A;  1GBB A;  4A6L A;  4B2C A;  1C4U 2;  2ZZU H;  1NRQ H;  5C5N A;  1SPJ A;  2KAI A;  3H7O A;  1MUE B;  4P00 A;  4NWL A;  2VBC A;  5HM2 A;  1K1L A;  1D4P B;  1ZRB A;  2ZO3 H;  1AVW A;  2K8I A;  1C5Y B;  1C9P A;  5HGG A;  3BTG E;  1SOT A;  1AGJ A;  3S9B A;  4MNW A;  3DD2 H;  4X6P A;  2Q1J A;  1QL9 A;  4NIY A;  1SR5 C;  5FL7 D;  5IDK A;  1AB9 B;  2FES H;  1TPS A;  4ABJ A;  2ZFR H;  4I7Y H;  1E79 D;  3A7X A;  5DP7 A;  1GHV H;  1O2V A;  1Y59 T;  1C9T A;  3MO6 A;  2SGD E;  4X8U H;  4MVN A;  3VGC B;  2VWO A;  3E0N B;  4BXS A;  5AFY H;  2HVY B;  8GCH F;  3RUO A;  8EST E;  3OTP A;  4F55 A;  2AGE X;  1D3T B;  4WME A;  1O5F H;  5C2Z A;  4IN2 A;  1WYK A;  3E16 B;  3RMN H;  1O3M A;  4ZHA A;  1WDI A;  3MU8 A;  4FU9 A;  1MTS A;  1UTP A;  1HJ8 A;  1MAY A;  2AER H;  2F83 A;  5K7R A;  1QB9 A;  1GI3 A;  2OC0 A;  1GHB G;  3CEN A;  3QTO H;  3M7T A;  1S82 A;  1F0S A;  4YOG A;  1QJ1 B;  3WWB A;  4IC6 A;  2V3O H;  4A92 A;  5JBA S;  3VB5 A;  1A46 H;  1O5G H;  3MOC A;  3L3T A;  3ATW A;  3BTW E;  1C1U H;  4B6F A;  2BTC E;  4HZH A;  4IGD A;  1GBH A;  1Y5B T;  3SNC A;  4AGK A;  4E06 H;  2VWM A;  2ZG0 H;  3BTT E;  2PSX A;  1GHX H;  2P16 A;  2P3U B;  2UUF B;  4GCH G;  1W10 U; 
#chains in the Genus database with same CATH homology
 3O8C A;  2A4G A;  3F2H A;  3OEH D;  3PRB A;  5T1V A;  5IK2 D;  2OC7 A;  5EQQ A;  5FPY A;  4TT3 D;  3O8R A;  4A1X A;  3F2F A;  3F0O A;  2XCF A;  2FP7 B;  2L6O A;  1NBM E;  3OE7 D;  3SV9 A;  2K1Q A;  3AK5 A;  3SUF A;  5DN6 D;  3SU0 A;  1DXW A;  3VG8 A;  3OAA D;  3ZIA D;  2KFW A;  2F4L A;  5GJ4 B;  1E1R D;  2P59 A;  2YMS D;  4I33 A;  2WZQ A;  2XCN A;  3SU1 A;  1N1L A;  2QV1 A;  2OC8 A;  5HKK D;  2WPD D;  1W3C A;  5C0T A;  2WHX A;  1E1Q D;  3P8O A;  3KNX A;  2CK3 D;  4NWL A;  3PV5 A;  2VBC A;  3WW7 A;  2JDI D;  1H8E D;  5GPI B;  4B73 A;  2W6J D;  4YXW D;  2J5U A;  3FO8 D;  2K8I A;  2KZ4 A;  4M9F A;  4I31 A;  4NWK A;  4B76 A;  4R8T B;  2F9U A;  3KF2 A;  2HLD D;  4RI0 A;  4B75 A;  2AHM E;  3PV2 A;  3KEE A;  1S6L A;  3DSP A;  3SUD A;  3FN8 A;  1CU1 A;  2KM0 A;  1W0K D;  5FL7 D;  5IDK A;  3WWF A;  1EFR D;  2LEL A;  2GVF A;  3SU5 A;  2GGV B;  5FPT A;  1NS3 A;  4OM9 A;  2XND D;  2M2A A;  5DSF A;  5EPN A;  2WSS D;  1SKY E;  2A4R A;  5H4I B;  1E79 D;  3PRD A;  3SV8 A;  3DCL A;  4Q4L A;  2OK5 A;  1W0J D;  1DXP A;  3O8B A;  3N7D A;  1H8H D;  2QE7 D;  3RC5 A;  2YMS C;  4B6F A;  2FOM B;  4DT4 A;  3RC6 A;  2V7Q D;  3OFN D;  4WH8 A;  2F9V A;  3RC4 A;  2OIN A;  4KTC A;  1RGQ A;  2IJD 1;  2QF4 A;  5CDF E;  5C0U A;  1DY9 A;  2JJ1 D;  2KCP A;  3F3B A;  4A1T A;  1A1R A;  1WXR A;  3SV7 A;  1JXP A;  1MAB B;  3E90 B;  3M5M A;  5B6L A;  3OTP A;  5GND A;  3NRL A;  4B6E A;  4WH6 A;  3SV6 A;  4B71 A;  3L6P A;  3M5O A;  4F55 A;  3LON A;  2KCY A;  2W6I D;  3KN2 A;  4A1V A;  3SU3 A;  1RTL A;  2YMS B;  3M5L A;  3N99 A;  2KR7 A;  2IJO B;  2JIZ D;  4B74 A;  3OYP A;  3U1I B;  1OHH D;  2OBO A;  3UB0 A;  4Z1M D;  3SZE A;  2QF5 A;  3SU6 A;  1BMF D;  4JMY A;  4U01 A;  3P8N A;  1COW D;  5CHB A;  2O8M A;  4ASU D;  3SU2 A;  4FET A;  2OC0 A;  2FM2 A;  1KMH B;  3M5N A;  5EPY A;  3N7E A;  4TYD A;  2JJ2 D;  2A4Q A;  3DSO A;  3WWB A;  4A92 A;  3FKS D;  1FX0 B;  3F2G A;  3LKW A;  2KCO A;  2OBQ A;  4TSF D;  1NBM D;  3SU4 A;  5ESB A;  2YOL A;  4Q63 A;  2OC1 A;  5EQS A;  3FOA A;  3SYJ A;  3H09 A;  3O8D A;  4K8B A;  3OEE D;  3W1E A;  2WV9 A;  2K0Q A;  1DY8 A;  3F0P A;  3LOX A;  3U1J B;  2XOK D;  3SUG A;  5FPS A;  4XD7 D;  5ETX A;  4I32 A;  4ZCN A;  1BT7 A;  2XNI A;  3SUE A;  2F43 B;  5C17 A;  4WF8 A;  3EYD A;  5EQR A;  2KCA A;  5F53 A;  3GS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...