3FN8A

Crystal structure of merb complexed with mercury
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Alkylmercury lyase
publication title Crystal Structure of MerB complexed with mercury
rcsb
source organism Escherichia coli
total genus 58
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3fn8A00
3F0PA 5C0TA 3F2GA 3FN8A 5C17A 3F2HA 5C0UA 3F2FA 5DSFA 3F0OA
chains in the Genus database with same CATH superfamily
2H9EH 4U32A 3TIUA 1GBAA 1SI5H 2A7JA 1VCQA 3ZZ5A 2ZC9H 1W14U 4X1RU 2OLGA 3MH4A 5JBCS 2F4LA 3UTUH 3F2GA 1J15A 1OWDA 4MQAA 2ZQ1A 1RIWC 4JYVH 3FVFB 4I8GA 1UCYE 3BG4C 5ETXA 4ZHMU 4X2XA 2R9PA 3RXKA 1SQTA 3SW2B 2JIZD 1YPHC 2ZO3H 4E05H 1ANEA 4BXWA 3TITA 3PRDA 1BRUP 1W0YH 1KLTA 1F0SA 1AVGH 1X7AC 4LZ1H 1GI1A 1O2QA 1UK3A 1P2QA 3A7YA 2R2MB 2JH6D 3CNRA 1MCTA 3QUMP 4CR9A 5TCCA 3AK5A 1ESTA 3HK6B 1GBMA 3KQCA 1FI8A 4D7FA 3NUMA 2BB4A 1SLUB 4X2VA 4I32A 1W0JD 1NTPA 1N8OB 3A7TA 1QJ1B 4X8VH 1E38B 3EAJA 1FN8A 2EQNA 3GCNA 2BTCE 2BY8X 1HAYB 4LOYH 1H8ED 4KELA 1K22H 2XC0A 3BV9B 4AC9A 3BEIB 4MNYA 4OGYA 1EB2A 2GZ9A 3RXTA 1RTFB 3UIRA 2ZNKH 1ARCA 8GCHF 4ISOA 2J4IA 3SHAH 3LGYA 3KQ5A 1J9CH 4B73A 5LPEA 2ZDLA 3SU6A 2SNWA 4YT7H 4U30A 3DFLA 5A0CA 1C5NH 1XXDA 1O33A 4NA7A 4FU8A 2TGDA 4X6OA 2ZP0H 5AFYH 1WUNH 4X0WU 3QN7A 2RDEA 2YNBA 5FXLA 3TK9A 1HPGA 4ABGA 1S85A 3ZVBA 3A85A 3RU4D 5JYIA 3ESTA 3RXAA 1DS2E 2B0FA 1FQ3A 4RSPA 5A0AE 1SQRA 3LU9B 1AIXH 3RXVA 3SGBE 4F4OC 1AE5A 1JWTA 3PB1E 1O2PA 2Y5HA 2P59A 2I6QA 2C93B 2P8OC 1V2TT 3FANA 2OXSA 2RG3A 2PHBA 4BOHA 3GYLB 3DFJA 2SGEE 2J38A 2KX4A 1AE8H 1SGRE 3DUXH 4M7GA 2BQWB 2CGAA 1NZQH 4UFDH 2FOMB 4F55A 5C3NA 2KAIB 2W26A 4JZEH 1YYY1 1O3GA 3FP7E 2AYWA 1UTOA 3QLPH 4FUBA 4X1QU 4JZIA 2KCPA 5J4QA 1QCPA 1GJ4H 1F5LA 1TPSA 4MPVA 2ZWLH 2JDID 1G2LA 1ELBA 1UTKA 2Y81A 2F9NA 3BTDE 1GDQA 2Z3CA 1TQ7B 1EJAA 3UQOA 1LVMA 5AVDA 2BXTH 5F6MA 1UK2A 3EE0B 3SORA 5C1UA 5CHAC 3T29A 3K6ZA 1FXYA 1NT1A 1EP6A 1O38A 2XW9A 2FXRA 5C1XA 1E37B 1OP0A 2IN2A 1DX5M 3DA9B 3N7OA 5DKMA 2ASUB 2ZU1A 5PTPA 2PKAB 3RM0H 1H4WA 2Y7XA 1BMNH 2WPKS 3CS0A 3PLKA 4J2YB 1EJNA 1YPEH 1SB1H 3M7TA 1XM1A 3SZEA 2ZGBH 1VGCC 1O3AA 2KFWA 1QA7A 3LGVA 3A86A 1SFIA 3P17H 1SLVB 1S84A 2ZIQH 3V12A 1Z1JA 2GJGA 3R3GB 4DG4A 4OS5A 2G4UA 4FUEA 3MTYA 1WU1A 5F8TA 2C8YB 3UWIA 1E36B 1HAVA 3WY8A 1TBZH 1Z6JH 1O2JA 1VITF 1XX9A 4BAOB 1G3EA 2Z3DA 1L1GA 1NRQH 2THFB 1ZSJA 2XOKD 1L4DA 1DANH 1YBWA 1CVWH 1DUAA 3D65E 4K60A 5EW1H 3SV2H 3PTNA 2ZFFH 2ZG0H 1O34A 5BRRE 4Q63A 1TAWA 2CK3D 1QFKH 3LH1A 1GVZA 1HLTH 2DE9A 4B2CA 4Y8YA 1ID5H 3ENSB 7ESTE 1IQMA 1KXDA 1P57B 1O2GH 2AIQA 5HGGA 2SGQE 1Z8RA 2H2ZA 2Y5GA 5T6FA 3A88A 3RC5A 4AFQA 1WDIA 3ZV8A 3E0NB 2A5IA 3T62A 4YXWD 1CSOE 4AB8A 4KTCA 3SNBA 2GT8A 4NFFA 3EE7A 1A3BH 3A81A 3TNSA 2FPZA 1BMFD 1V2NT 4OS7A 3PTBA 1FAKH 2A45B 1YLDA 4NCYA 3OTJE 2FOFA 4HGCA 1NPMA 5A8ZA 3SU0A 1O3HA 1C4V2 1P10A 2F9PA 3SNEA 1DM4B 6GCHG 4BTIB 5F8XA 4X8UH 2P95A 2OQUA 3RXJA 1AZ8A 1BIOA 1WCZA 3MU5A 4ZXXH 4ABBA 2GTBA 1MQ5A 2BLOA 3FKSD 4GUXA 1AUJA 4GCHF 1P2IA 5EGMA 3ATMA 1C2KA 2GCTC 3Q3KA 2O9QA 2P16A 2XC4A 1ETRH 1GHYH 1ABJH 1IQNA 1HAXB 4Y0ZE 4FOUC 3Q77A 3FP6E 2HVYB 5EXMA 3SV7A 2OC0A 1O3NA 2FOCA 1OP8A 1YY3A 4FXGH 4CHAB 4K1SA 4RI0A 4UDWH 4ISHH 1C2JA 2PLXA 1D3DB 4MNWA 5FPTA 2ZU4A 1O39A 2QGRA 1QB6A 2AFQB 1TX7A 3MO3A 1C5RA 5A2MH 1TPPA 3BTEE 4QT8C 1KTSB 1C1VH 3BIUH 3LGIA 2VINA 3UFAA 3RP2A 1GL1A 3DD2H 1A3EH 1C2EA 1TGTA 3M37A 1XKBC 3OTPA 1H9LB 4MPUA 4FUDA 1JBUH 1G36A 3QGJA 3SUEA 1RTKA 2GGVB 1NC6A 3ZVDA 1MTNC 1V2UT 4TWYA 1CA0B 2XTTB 3PO1B 1QRZA 2JH5D 2VWMA 1YKTA 3GCTF 5L6NH 1IQJA 1O3JA 3SU3A 2F43B 1FY4A 4GLYA 1TRMA 3RU4T 1MTSA 3SUFA 3UNRA 4AGKA 1LHEH 1IHTH 4O97A 4ABAA 2HNTE 1A0HB 2J5UA 3VPKA 4RN6A 1AD8H 4OM9A 1SGFA 3T25A 1TPOA 2PTNA 3DSGA 4TT3D 1ZMJA 3RLWH 3U9AH 5C0UA 1GVLA 2GMTB 1KLIH 3L3TA 3ZVFA 1K1PA 1Y5BT 5EPNA 1GJ5H 2BQ7B 2CXVA 2GV7A 5I46H 1C9TA 2VWLA 3LC3A 1D4PB 1UJ1A 1XUGA 4JZFH 4O9VA 1PQ5A 3TGIE 1GHBF 1O3OA 3GY4A 1NBMD 3VXFH 3SQEE 1W11U 2PGBB 2F91A 3M36A 2ZPSA 2GVFA 2AERH 5HIZA 4H42U 4WY3A 1JRSA 4B75A 1LMWB 1OWKA 1W0KD 2JH0D 1MTUA 1VITH 4IMZA 1OS8A 3MOCA 2Q1JA 1CQQA 1LKBA 2F83A 3WW7A 2K8IA 2OC7A 3ZZ7A 1V2QT 1G3DA 2R3UA 5JPMH 1LCYA 1AUTC 5G4BA 5TJXA 1GI5A 3PV2A 2PGQB 4ESTE 4ZHAA 2G4TA 3TJOA 1Z7KA 1GGDC 4MDSA 1QJ6B 5DP4A 1C5PA 4NIWA 2WHXA 3OSYA 4CRFA 3KNXA 3MO9A 1GMHF 3E1XB 1TGBA 1SQAA 1D9IA 2Y5FA 5EJZA 4BTTB 3M5OA 2VIDA 2RA3A 3RXDA 3A7WA 2EI6A 2FTLE 2SGFE 3BTTE 1CT2E 3VGCC 3E91A 5E0JA 2JETB 2BDYA 1V2PT 4K1EA 8ESTE 5F53A 2KCOA 2ZTXA 1EASA 1F0RA 2P3FH 2KCYA 1P11E 3NWUA 5DN6D 5GCHG 1LPZB 5IDKA 1SHHB 1FDPA 1PYTC 2AGIX 3A7VA 1SFQB 3FAOA 1SGNE 1O5GH 5EQSA 1UVOA 3URCA 2BX4A 3MU8A 1VR1H 3H09A 1TMUH 3SNAA 2FLBH 2KCAA 1BHXF 1NY22 1AVXA 4ZKOU 1IQIA 1GHWH 1YP9A 5EW2H 4CRAA 5J4SA 2XBVA 1H8IH 5A0BA 1YC0A 2QF0A 4NG9H 2WPJS 3F3BA 2AIPA 2M2AA 1A5HA 3ELAH 5C5NA 3Q76A 1G37A 4X6MA 2LP6A 3F68H 1C5XB 2VBCA 1BBRH 2OP9A 1SL3A 2KR7A 4UE7H 3OAAD 4WH8A 5FBEA 1GG6C 1LKAA 3Q00A 3JZ2B 4I8LA 4GHTA 3PLPA 2STAE 3TU7H 2GT7A 2XCNA 3UPEA 1D3TB 4ZKSU 4X2YA 1CHOG 3TVJB 4GHQA 2FYQA 5E2OA 1MTWA 2ANKH 4BAQB 4UFFH 3RMNH 1UO6A 4HI3A 3RXBA 1QQUA 3LONA 3CS7A 4X1PU 1BBRK 4AORA 3RC6A 4ZCNA 3QGNB 3UY9A 5AHGH 3E6PH 1QL8A 2G55A 3UREA 1HAVB 4FVDA 4E06H 2FYRA 4AYYB 1SBWA 1XUHA 1EAWA 3MWIU 1UK4A 3BG4B 3FO8D 4F48B 1GJCB 1FNIA 2EA3A 2PW8H 2V6NA 2V0BA 2HRVA 1V2JT 1NRPH 1ZPZA 2FOGA 4MTBA 3BSQA 1K1MA 3LJOA 1TGCA 3MNXA 4BTUB 1O32A 1O2VA 1HXEH 5GJ4B 1GI2A 5AFZH 1ELCA 3WWBA 4YLQH 1UTNA 1UW7A 1B0FA 3ZVGA 1TYNA 3QX5H 1QRXA 1LTOA 4NA9H 3U8TH 3STIA 1AKSA 1AFQC 3GOVB 2AMDA 3UQVA 1H9IE 3U98H 2R0KA 1P06A 1NRRH 3W95A 3AAVA 2BZ6H 2BLVA 4NSVA 2VVCA 2XWAA 3HKJB 1O31A 1EX3A 1KXBA 3RXGA 1V2MT 4R0IA 3AASA 3NZIA 4ABIA 2BY5X 1GJ8B 1ZTKA 2XRCA 1FX0B 4JZ1A 4AFUA 1NU9A 4Y79A 3GDUA 3RXCA 5B6LA 3S7KB 3LT3A 4A92A 1FONA 4YOGA 1UCYK 1ELEE 3VB3A 1AGJA 2F9OA 1HIAA 2VIQA 2CMYA 2AGGX 5DP5A 1C2FA 4LZ4B 1DOJA 1OHHD 4ACBA 1M9UA 2C90B 1C5ZB 3TH4H 1PPZA 1G3CA 5FX6A 1EUFA 5C1YA 1KMHB 2BDBA 1P9SA 2CHAC 1AVWA 4DY7B 3SGQE 3KQBA 5KECA 1AWHB 1QTFA 1UMAH 2BQ6B 1FY1A 1ZMLA 4Z6AH 1CGHA 1C4Y2 4A7IB 2Z9GA 3PV5A 3BTKE 4KKDA 4DJZB 2QXIA 1C2MA 1A1RA 5T6DA 1GMCF 3VB5A 3E3TA 1PPBH 3SUDA 4HTCH 2P8OB 2HNTC 4OGXA 1O35A 3PWCA 1SGEE 2IJOB 2IPHA 1DY8A 1GBFA 2H9HA 1DXWA 3ATKA 1V2LT 1K21H 5C17A 4THNH 4DCDA 1ANCA 2NU0E 1DICA 3TPIZ 3F6UH 1C4U2 5HYOA 4TY6A 3I29A 3MH6A 1MMJN 1LQEA 1VJ9U 3P6ZB 1SG8B 3QWCH 4IN2A 1T31A 1YPJH 3F9GA 3G01A 4CRDA 1BITA 1PPHE 2VIPA 1O3BA 1ELGA 4H6TA 2QXGA 1MKXH 3KIDU 3P8FA 1VCWA 4JK5A 1HV7A 1C1PA 1QJ7B 1RGQA 3QZQA 4FVBA 2QXJA 1OP2A 4FU7A 1TX8A 4I8KA 5CHAB 3MI4A 1ETTH 4NGAH 1GJAB 1T8NA 1S83A 4UD9H 3SJ9A 8LPRA 3NK8A 3P8NA 2FO9A 3TK5A 2BDAA 1TNKA 3ZZ6A 3V3MA 4XRNA 3RUOA 3KQEA 4WMDA 2Z9IA 4ISIH 3TLOA 1TFXA 2HVXA 1XXFA 1QGFA 1JIMA 1BRCE 2OBOA 3A89A 1HXFH 1MKXK 1MKWK 1SGCA 3HGNA 3SU2A 1GI0A 2ANYA 3TJNA 1C2IA 3EGKH 1LQDB 1OYQA 1HJ9A 1PFXC 1VGCB 2G51A 5EQRA 3RXLA 2D26C 1AQ7A 5JBAS 2H5DA 3I77A 1IOEA 4CREA 1PYTD 4A6LA 4Q7ZA 1OYTH 2G8TA 1W0ZU 1ZSLA 1VKYA 1W8BH 3OX7U 1ZMNA 1KDQA 2W6ID 1O3MA 3GY8A 1IQHA 5DGJA 5K0HA 3GY7A 1C1RA 3RXSA 1TABE 1O37A 3HATH 4INLA 1TLDA 4CRCA 4D9QA 2RFKC 2OINA 4XE4A 1EAIA 2ZDAH 1INCA 3BF6H 3B9FH 2HALA 3TH2H 4Z1MD 3DSOA 3RXUA 3BTHE 1V2OT 2GCHG 1TALA 3H7OA 1HAOH 1EZUC 3F9HA 4CR5A 3BTWE 3RMLH 2HLCA 1TPAE 3A7ZA 3LC5A 5FAHA 1FIZA 1RRKA 1BMMH 4DGJA 1GMDF 4FU9A 1B7XB 4BAKB 2HWLB 5E0GA 2A5KA 3ZZCA 1EAXA 3ZVEA 4NIYA 1GHZA 1P2MA 2J2UA 1ZZZA 1IHSH 4NA8A 4WH6A 2ZPRA 5GXPA 1RTLA 2QA9E 3B23B 1BOQA 1CGJE 3D23A 9LPRA 1Y3YA 1T8MA 2ILNA 5GNDA 1Z1IA 1VITG 2AEIH 1BDAA 2PV9B 2ZU3A 4Z0KA 5K7RA 1WXRA 3GS9A 1MD8A 1BTWA 4ACAA 1O2TA 1Y3VA 1OWJA 2ZCKP 3LDXH 5DP7A 1GJ7B 1MZDA 2WV5A 1UVPA 3GISB 1NO9H 4RKOB 1SQOA 4IN1A 3RXPA 3QTOH 1TQ0B 1D6WA 3E8LA 1TNLA 3M7UA 1SGYE 4UFEH 1C2LA 1QQ4A 1LHCH 2GCTB 4MVNA 1K1JA 2XWBI 1HAZB 4I8HA 4XFQA 3TH3H 1O2RA 4ABFA 2Z9LA 4Q2KA 4HG6A 1SGDE 3CENA 4ASUD 2VB0A 1AMHA 1YPMH 1XUFA 5C67A 1OWEA 2IOTA 1EPTC 3RU4E 4ZKNU 2R3YA 1TRNA 4TPYA 2FOEA 1QHRB 1HAGE 2VIWA 2I6SA 1QBOA 4TWWA 4IS5A 4Y7AA 1O2HA 3RXMA 1SPJA 1DLKB 1ZHRA 1CT4E 3LGUA 2ZFRH 2W7UA 3PM3A 3SUGA 1DDJA 1W7GH 2ZQ2A 2ZDMA 2ZTYA 3ZV9A 1BMAA 1NU7B 1XUKA 2ZA5A 1NFUA 4AG1A 1GI4A 5DP8A 1BCUH 2V35A 3A8DA 4Q7XA 3UOPA 5C20A 2BDGA 1A2CH 1L1JA 4I86A 4INHA 1SOZA 2WYGA 2BD3A 3EA7A 3SOSA 1MTNB 3SV8A 1P01A 3SN8A 5EIYA 5E2PA 2BY9X 2J9NA 1AHTH 3MNCA 2JJ2D 2Z7FE 4A1XA 4O3TA 5HKKD 3BEFB 4I31A 1ZJKA 1DSUA 2PWXA 1RXPA 1V6DA 3IG6B 2FWWA 5A8YA 3RLYH 2PSYA 1S6FA 2FS9A 2ZGXH 1AKSB 3M61U 1IQFA 3ZZDA 3A8BA 5A09A 5F8ZA 5L2ZH 3ZZBA 4X6NA 4A5TS 2BX3A 1V2RT 2C3SA 3KN2A 3MH7A 1NRSH 1BHXB 1QL7A 5JBBS 4B71A 1OOKB 5FPYA 2ZHDA 4DT7B 2DUCA 2QF3A 3ZYEA 2J98B 2EEKA 5F03A 4YZUA 2IJD1 4CH8B 1YWUA 3C1KA 3PROA 2C8WB 3VXEH 1A4WH 2K1QA 4X8TH 2AGEX 2O8LA 2NWNA 1MAYA 1BRBE 1PPFE 1UVSH 1DWBH 2AMPA 4FUIA 4P00A 4DT4A 4NFEA 5H4IB 1MCVA 4ISNA 4SGBE 2ZHEH 3VG8A 2K0QA 4O3UA 1HIAB 5FCRA 2ZU5A 2BD5A 4TSFD 1G9IE 2VGCC 1BT7A 3SQHE 2FOHA 3TK6A 2OTVA 5C94A 1GGDB 2BVXH 3ZYDA 1C5TA 1BA8B 3A84A 4Y6DA 4AX9H 2TIOA 2AHME 4BAMB 2FEQH 1EOJA 4CBNA 1JRTA 1RJXB 3PRBA 2H1UA 1WOFA 1Y3WA 5HM9A 3PMAB 1O5EH 1MZAA 2H6MA 3VGCB 1F92A 4OS6A 1ZLRA 5KEDA 3KQDA 4INKA 3DCLA 4ISLA 4RKJB 3P8GA 1HCGA 2NU2E 3OE7D 2AH4X 3PMBB 4Y0YE 1ZRKA 2CV3A 2W3IA 3RDZA 1AFEH 1SKYE 1CHGA 1WQVH 3UWJH 4K3JA 6GCHF 1GHXH 1UTQA 1TGSZ 3F9FA 3MH5A 2SGDE 3TJVA 7GCHF 3VB7A 1Z8IB 4K8YA 5KGOA 1TOMH 3AAUA 1FUJA 3O8RA 2BVRH 1W3CA 2CN0H 3W1EA 3VFEA 1VJAU 1DWDH 2A4GA 4H4FA 1C5SA 3N7EA 4WVPE 4IW4E 1Q3XA 4WXVA 5DP6A 5EXNA 3UR6A 1ZHPA 2WPIS 3DSPA 1ABIH 2HOBA 3KYFA 3RXHA 1C2HA 3VB6A 1GMHG 4JYTA 3M3SA 2G5VA 3GY3A 2ODPA 3ZZAA 1GG6B 4B2BA 6CHAC 3ZZ4A 3KEEA 1JIRA 2R2WU 1BTZA 2HLDD 3FFGA 1LHFH 1EPTA 1QIXB 1Y3UA 4NZQA 1G2MA 1YPHE 1T7CA 4Y10E 1O5BB 3RXQA 2HPQH 1T8LA 3Q3XA 1THRH 4X2WA 3S9BA 4ABHA 4IC5A 2WPMS 1KXFA 1O3KA 1WTHD 5DJ7A 2BOHB 1ZR0A 2WPHS 4FUFA 3I78A 1MQ6A 1W10U 3R0FA 1KXAA 2CF9H 4WMEA 1ZTLA 2VH6A 1C5YB 1EQ9A 2VJ1A 2BOKA 1KDQB 1ARBA 3V0XA 1TNIA 1EOLA 1TONA 1BZXE 5BPEA 1FZZA 1D3QB 5EPYA 1C9PA 2EC9H 3JZ1B 1Z8GA 1V3XA 4OS2A 5GIBA 1P3EA 5FCKA 1Y3XA 3AW1A 4AYVB 2TGTA 3MQKC 2BYAX 4I33A 3U69H 2FODA 3Q3YA 4AFZA 3V13A 2WYJA 2GZ7A 3W94A 5FBIA 7KMEH 1H1BA 4Q7YA 4A1TA 1HAIH 4IBLH 2GP9B 2XNIA 1AFQB 1EB1H 2OC1A 4FUJA 3LH3A 2NU1E 4TPIZ 2ZEBA 3KYGA 1YCPK 2FIRH 2D2DA 3SYJA 1P12E 1QNJA 1W7XH 3F1SB 2ANMH 5T6GA 4CRGA 1ETSH 2V3MA 1GHAF 4Q4LA 1J14A 4XDEA 1HDTH 1GBCA 3ATLA 3GDSA 4K5ZA 2FDAA 1GVKB 5ABWA 2ULLA 4FUGA 1O3LA 4UFGH 3OEED 1FN6A 2ZDKA 1O2WA 4XOJA 3RMMH 2BD4A 1ELAA 1CGIE 3IITA 5SGAE 1HFDA 4X1NU 2PUXB 1LVOA 1WQSA 5C2ZA 2Y7ZA 3T27A 1FPCH 1T32A 1S81A 1NBME 2BY6X 3GICB 3AVZA 4K8BA 3GYMA 3KGPA 1O5DH 4KP0A 1XUIA 4YOIA 5JDUB 1K2I1 1ELDE 3RXIA 2CHAB 2ESTE 2F9VA 1V2KT 2Y80A 3QO6A 5DPAA 3B8JA 1P02A 2QIQA 3K9XB 1MU8B 1GBHA 4ZAEA 2FMJA 5TCAA 3F0PA 3EA9A 2A2XH 5T1VA 2L6OA 2WZQA 2HPPH 3ZVCA 3SV9A 2A2QH 3TGKE 1IQKA 1LDTT 2ZECA 4GPGA 2LPRA 1N1LA 1C1QA 4ABJA 1RIWB 1ZRBA 2ALVA 1A0LA 3PWBA 3NPSA 2J95A 1DE7H 4B2AA 3P70B 2BM2A 5DG6A 5AF9H 2O8MA 3KL6A 3PMHB 3GY5A 4M9FA 1TA6A 2QE7D 3RXOA 5EQQA 3T26A 2GX4A 1GDNA 1WBGB 1PPGE 1J16A 1OWIA 4VGCC 5C0TA 3S9CA 2QC2A 2EI8A 4ASHA 1AB9C 4IGDA 2P94A 1UCYH 1ZOMA 2JKHA 1ZPBA 1KLJH 1XUJA 4MG3A 2BD9A 1TNJA 2TRMA 2XCFA 1K28D 2ZFPH 2VWOA 1Q31A 1YM0A 4ZXYH 1LHGH 4SGAE 4PROA 3S9AA 2OBQA 3N7DA 1P03A 1F5RA 1TMTH 1CHOF 4WMFA 1BTHH 1O3IA 5C5OA 5HM2A 3M5NA 2SNVA 2O8TA 5LPRA 1P3CA 1UVTH 3SJIA 2YNAA 2ZFSA 4X8SH 1RD3B 5I25A 1BMLA 1EZXC 1H8DH 2AS9A 4NZLA 2CF8H 2P93A 4D9RA 2PTCE 1A5GH 3E90B 2A4RA 5EU8A 1FY8E 1Z6EA 2XBWA 3MU1A 1SMFE 2VIVA 3KHVA 3F2HA 1CE5A 3MO6A 1XVOA 5DP9A 4ZKRU 5LGOA 3SJOA 3IWMA 1EATA 1QA0A 2ZHWH 1K1LA 2PP6A 3U1JB 1KYNA 2ZF0H 4KTUA 3SV6A 3N99A 1HJAC 2YMSC 4XBCA 3OU0A 1T4VH 3E16B 1NFYA 1GBIA 1BB0B 5HMAA 2C8XB 4D8NA 2PKSC 1YLCA 1F0TA 1AI8H 1C2DA 6ESTA 1EAUA 1LVYA 1FY3A 1E34B 1PPEE 1JXPA 1SC8U 1FAXA 2Q6FA 2QV1A 2Z94A 2J92A 1Y59T 5HXFA 3BG8A 4XD7D 1HAPH 2B8OH 1SGTA 3GCHC 4CH2B 1LO6A 2FM2A 8GCHG 4Y76A 3D62A 4IMQA 3D49H 1DPOA 4K69A 1CBWC 4ABDA 4AGJA 1O3FA 1PQAA 1KIGH 1TE0A 1P2JA 1D3PB 2BZAA 3H7TA 1O0DH 1O2SA 1PJPA 1FV9A 1VCPA 1Z71A 4ZROA 1Q2WA 1S5SA 4JK6A 2VVVA 1MKWH 2ZGCA 4WXIA 4Y8ZA 1NFXA 2ZCLP 3PLBA 3BTME 4NWKA 3BTFE 1S6LA 1C1MA 4HFPB 4AOQA 3FN8A 1GI3A 1O2ZA 1IQLA 1BTPA 1S0QA 3BN9A 1GBBA 4NSYA 2GKVE 4I7YH 4BANB 3RMOH 1DUEA 4KGAA 1C5MD 1ANDA 5E0HA 1VZQH 3LJJA 4JCNA 1COWD 3SBKA 3P95A 1GWAA 4H6SB 1C1SA 1TA2A 2FI4E 5GDSH 1SLXB 2B5TB 3LGWA 1F7ZA 1O2MA 2O8UA 1EZSC 2ZPQA 1GI8B 1OSSA 2R0LA 3MHWU 1GMDG 3GY2A 2EY4C 2OC8A 2HNTF 3ODFA 4WJG2 4GVUA 1YLNA 2B7DH 1HJ8A 1SSXA 2F9BH 2OD3B 1EPTB 3O8DA 1HRTH 2QYIA 1P2OA 3S7HB 2GV6A 1EJMA 4MNXA 5ESBA 1LHDH 2TBSA 1GI6A 2WV9A 1QB1A 4JYUH 1KTTB 1GCTC 2G52A 8KME2 1QZ8A 1C2GA 4XBBA 1MTVA 1WV7H 2NU4E 2A1DB 2UUYA 1FIWA 1L0ZA 1RFNA 1TNHA 1ZJDA 2UWOA 1QL9A 1T8OA 2W6JD 3QK1A 5CMXH 1PQ7A 3MU0A 2BHGA 1BJUA 2QY0B 1C5UA 4AB9A 1O2IA 1O2XA 1WAYB 2ZGHA 4MPXA 1AWFH 1TNGA 9ESTA 4K1TA 1Z8JB 1ACBE 2NU3E 1ELFA 2UUFB 4F49A 4ZH8A 1A61H 3KCGH 1Y5AT 2G5NA 2FZZA 5JB8S 4DVAU 4DIIH 2BDIA 5CDFE 2B9LA 3OFND 1W12U 4BAHB 4RT0A 1K1IA 1GBEA 4OS4A 3RXFA 2BD7A 1BTYA 2RCEA 1MBMA 1YF4A 2Q6DA 4TYDA 1EP5A 1P0SH 1XVMA 3RM2H 3MNSA 2G81E 1N8OC 2QF4A 2ZDNA 3TNTA 3OY6U 5FL7D 4BXSA 4ZHLU 1F0UA 2BVSH 1P2NA 2FOAA 1O2YA 2L74A 3MNBA 3UNSA 2GCHF 3RXEA 1H8HD 2OCVB 3A82A 3SNDA 3HPTB 1TBQH 2P3UB 3U1IB 2C8ZB 4DW2U 2VGCB 1ANBA 1KSNA 1ZTJA 3BIVH 4D76A 1J8AA 1SR5C 2VWNA 3CP7A 1SGFG 3MFJA 2CJIA 1BTUA 1G30B 4J1YA 4OS1A 2YOLA 3GY6A 3MU4A 4GSOA 3QTVH 2QAAA 2GZ8A 1LPGB 1O3DA 3E0PB 5HIYA 1PPCE 2UWPA 1ZGIA 5EXLA 1SOTA 2FI3E 1YCPM 4A1VA 3ATWA 1CO7E 2WPLS 3A7XA 3SNCA 3SU4A 2Y6TA 1C5VA 2XC5A 2ZHFH 1GBTA 2M5TA 2STBE 5FX5A 1KXCA 1GBDA 3S0NA 1KXEA 2D1JA 2EI7A 1UVUH 4GCHG 2YMSD 4YM9A 3TGJE 1S82A 3F2FA 1G32B 1EKBB 5JB9S 1NFWA 2ZTZA 3P92A 1UTMA 2Y82A 3AW0A 1LVBA 4UONA 1ZGVA 2A4QA 1FPHH 1O2NA 1BJVA 2G00A 3DHKH 5T3HA 4I8JA 2BLQA 2ZI2H 2SFAA 2TGAA 5B6OA 2V3OH 4NIVA 3SZNA 4E7RG 1HAHH 3KF2A 2ZGJA 5EOKA 3M5MA 2A32A 1DFPA 6CHAB 2QF5A 3T2NA 1NESE 4MPWA 4YTAA 1UHBA 1BTXA 4YT6H 2ZFQH 1GBJA 1U6QA 1KY9A 3H5CB 4WF8A 1ELTA 2ZCHP 2FP7B 2W3KA 3UAIC 4D7GA 4X1SU 2PR3A 2QXHA 1OKXA 2BDHA 5IK2D 1AO5A 2FLRH 3GCTG 4UEHH 3SHCH 1K1OA 2TPIZ 1E1QD 1H9HE 1AN1E 4P02A 2PSXA 2FS8A 1V2ST 4DOQA 1S0RA 3UOUA 4YESB 7GCHG 2D8WA 3HK3B 1QB9A 1RS0A 1QY6A 1BQYA 2ZFTA 1YPKH 3L33A 1V2VT 2SGAA 2OUAA 2ODYB 2BY7X 2BD8A 2XNDD 1MUEB 3A83A 3ZIAD 1NRNH 3T28A 4Y71A 2ZDVH 1THPB 1IQEA 4Y7BA 2J94A 1UTJA 1GHBG 2O8WA 4R8TB 1AU8A 2BD2A 2A7HA 3UNQA 4TY7A 1PQ8A 5DO4H 2WUCA 2W7SA 4YOJA 2HGTH 1OWHA 3A8CA 3EDXB 1IAUA 2F3CE 3BTQE 3MYWA 1HNEE 1C1OA 1W2KH 3LKWA 4YO9A 1GJBB 1P9UA 2RDLA 5EJLA 4RT1A 1D6RA 1FY5A 1K0HA 4ZUHA 3ATIA 1HBTH 1TRYA 1DT2A 1P05A 1AY6H 1P2KA 2ZKSA 2PUQH 2ANWA 4AZ2B 1ZSKA 3A8AA 1ZHMA 3NKKA 2GD4B 2F9UA 2ODQA 1N6XA 5ESTE 1Y5UT 3RXRA 1F2SE 3LGTA 1EZQA 3HKIB 3NRLA 3SI4H 1O30A 1GCDA 4JZDH 5L30H 3SI3H 4WWYA 1SLWB 5DP3A 2IPQX 4AN7A 3OEHD 3DT0H 5DK1A 5FHTA 1UTPA 1C1NA 2VIOA 2TGPZ 1NM6A 3M3TA 5IYTA 2ZZUH 1SGIB 4FETA 2WV4A 3T5FH 3UR9A 1A0JA 2KZ4A 3LPRA 1Y8TA 1C5OH 1TMBH 3F0OA 1MAXA 1DSTA 1UTLM 3EQ0H 1A46H 1MH0A 1WSSH 2OQ5A 3F9EA 1JOUB 4DIHH 1C5QA 1FJSA 4U2WA 1DVAH 4YLUA 1O5FH 1L1NA 3PV4A 2VH0A 2FTMA 1GHAG 2LELA 2Z9JA 3P8OA 5EODA 2H9TH 1L4ZA 1YCPH 3WWFA 3K2UA 2XBXA 3STJA 1C5WB 2XXLA 1THSH 1GL0E 1DXPA 1K9OE 3M35A 1GJ9B 1MU6B 4E7NA 1WYKA 1ESAA 3GCOA 4NWLA 1CT0E 1ORFA 4O03A 3SU5A 1LPKB 3LOXA 2QN5T 1GBKA 4B74A 4CHAC 2ZU2A 1XKAC 1FLEE 2KAIA 3NXPA 4VGCB 2GDDA 1B0EA 3UUZA 1AB9B 1TBRH 4AFSA 1E1RD 3SO3A 5L2YH 1AZZA 3SU1A 3ITIA 2Q6GA 1TIOA 3GDVA 4K2YA 2C4FH 4MLFB 5EJ1A 1HUTH 1ESBA 1O3EA 1BUIA 1QBNA 2ALPA 2OK5A 3M7QA 4X6PA 1YGCH 1C1TA 1B5GH 1BRAA 1DITH 4LK4A 2KM0A 3K6YA 1DWEH 1GHVH 3FZZA 1O36A 3K65B 4B76A 5JBTA 1CA0C 1CU1A 3QDZB 3PO1C 2FX6A 3EYDA 1V2WT 3TJUA 1F5KU 3FZDA 3ZVAA 2PKAA 2Z9KA 4MNVA 4U01A 3ODDA 4XBDA 3EA8A 4AG2A 1ZPCA 1GI7B 4Y8XA 2WINI 4HZHA 1A5IA 1HJAB 2YMSB 1ZYOA 3U28C 1SVPA 2GMTC 1W13U 2A7CA 2P3TB 1O2UA 1GJ6A 2A31A 1MBQA 1O5AB 5GWZA 1O2KA 2FOBA 1O2OA 3NCLA 1K1NA 2PKSB 2W5EA 1YPGH 7LPRA 3OY5U 1O3CA 5GCHF 3S69A 1P09A 4ABEA 1P8VC 5FPSA 1XMNB 4FUCA 4ZMAH 2Z3EA 1HGTH 3UB0A 3OYPA 5CE1A 1WTGH 2A0QB 2SGPE 1EFRD 5LH8A 3GCHB 3BTGE 1C1UH 3ZZ3A 3PMJA 3SGAE 1J17T 4GAWA 1DY9A 2H5CA 1SHYA 4KTSA 1CBWB 2UWLA 4Y11E 3PYHA 2DE8A 1TX6A 1IQGA 2V7QD 5GPIB 2WSSD 3QZRA 2XYAA 1GJDB 3A80A 3C27B 2BXUH 2UUKB 4IC6A 6LPRA 4NIXA 4B6EA 3A87A 1ELVA 1SGQE 3U8OH 3SJKA 1L2EA 4CBOA 2BDCA 5E8EH 1NROH 2XBYA 2BMGB 2ZHQH 1QURH 3LIWA 2JJ1D 2Z6BD 3SJ8A 3FOAA 1A7SA 1JMOH 3HGPA 3M5LA 1C5LH 1O5CB 1TGNA 3ZZ9A 3BEUA 3ZZ8A 1TWXB 1OPHB 2VNTA 2JETC 3VEQB 1T4UH 1OXGA 2WPDD 2LNCA 4JMYA 1CA8B 4XSKU 1GI9B 2AMQA 1HB0B 2PFEA 1SGPE 4FUHA 1MD7A 1GMCG 4B6FA 2GDEH 4DURA 5A8XA 1GBLA 1C1WH 2FI5E 1O2LA 2FX4A 1TB6H 3M3VA 3O8BA 2J97A 3L6PA 4B1TA 2BLWA 1BBRE 3VB4A 1FMGA 1N6YA 3URDA 5DSFA 2V3HH 3O8CA 2J98A 2RA0A 1HYLA 1QBVH 3V7TA 4Q80A 1QR3E 1MABB 1OX1A 1G3BA 2VU8E 1P04A 2FESH 2J34A 1O3PB 2UUJB 1QRWA 1DLEA 3FP8E 1GDUA 1E35B 2QCYA 1UHBB 1YPLH 2A5AA 1E0FD 4LXBH 1EXFA 2A4OA 1S6HA 5LPFA 5EG4A 1E79D 5CHBA 2VVUA 3RC4A 1GCTB 1NS3A 1TOCB 2WUBA 1DWCH 3U8RH 4CRBA 1NN6A 3MMGA 1GPZA 4BNRA
chains in the Genus database with same CATH topology
1FX0B 5C0TA 1S6LA 4I33A 1EFRD 2CK3D 2P59A 2F43B 3SU3A 5B6LA 4A92A 3F3BA 2QF4A 1DY9A 2M2AA 3FN8A 4WF8A 3SUFA 5FL7D 2FP7B 2XCFA 4A1TA 2J5UA 5IK2D 4OM9A 2F4LA 3RC5A 2FOMB 4F55A 3DCLA 2XNIA 4TT3D 3F2GA 2V7QD 2OC1A 2VBCA 2OBQA 1OHHD 2WSSD 2W6ID 1E1QD 3N7DA 3OE7D 5GPIB 5C0UA 2KR7A 2LELA 1COWD 3M5NA 3P8OA 4YXWD 3SUGA 5ETXA 4KTCA 2KCPA 3OAAD 1SKYE 4WH8A 5EPNA 3WWFA 1H8HD 3SYJA 4B6EA 1KMHB 3U1IB 2JDID 2JIZD 1DXPA 2OINA 3PRDA 1BMFD 3E90B 1NBMD 2A4RA 2XCNA 2JJ1D 4Q4LA 4NWLA 3FOAA 3SU5A 4Z1MD 3M5LA 2GVFA 3LOXA 3PV5A 4B74A 2XNDD 3DSOA 4TYDA 3ZIAD 3SV8A 1A1RA 3F2HA 4B75A 3AK5A 2OC8A 3OEED 1W0KD 3SU0A 3SUDA 2JJ2D 2YOLA 3U1JB 2WPDD 4R8TB 4I32A 3N99A 4A1XA 3SV6A 2YMSC 1W3CA 1W0JD 3LONA 3W1EA 3O8RA 2IJOB 4JMYA 2A4GA 3O8DA 1E1RD 5HKKD 1DY8A 3N7EA 1DXWA 4I31A 3WW7A 2K8IA 2OC7A 3SU1A 5C17A 1H8ED 3RC6A 4ZCNA 3FKSD 1NBME 3LKWA 3DSPA 4B6FA 4K8BA 5ESBA 2OK5A 4A1VA 2WV9A 3PV2A 3SZEA 3O8BA 3SU4A 4WH6A 3L6PA 3FO8D 1RTLA 2KM0A 1JXPA 4B76A 3KN2A 2F9VA 1CU1A 2QV1A 2WHXA 3KEEA 2KFWA 4B71A 3KNXA 5DSFA 5FPYA 3O8CA 3EYDA 3SV7A 4XD7D 2YMSD 4B73A 2HLDD 5GNDA 2OC0A 3SU6A 2FM2A 3F2FA 3M5OA 2IJD1 1RGQA 2W6JD 5GJ4B 2F9UA 1MABB 3F0PA 3GS9A 4U01A 1WXRA 3WWBA 4RI0A 5T1VA 2K1QA 2L6OA 5FPTA 2WZQA 3SV9A 3NRLA 2A4QA 5F53A 2KCOA 1N1LA 2KCYA 2YMSB 4DT4A 5H4IB 3P8NA 5DN6D 5IDKA 4NWKA 3VG8A 2K0QA 5EQSA 2XOKD 3OEHD 4TSFD 1BT7A 3H09A 1E79D 2OBOA 5CHBA 2KCAA 2O8MA 3RC4A 3OTPA 3KF2A 1NS3A 4M9FA 2QE7D 4FETA 3SU2A 5CDFE 3OFND 5EQQA 3M5MA 3SUEA 5FPSA 2GGVB 5EPYA 2AHME 5EQRA 2KZ4A 3UB0A 3OYPA 3PRBA 4ASUD 4Q63A 3F0OA 2QF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0P A;  5C0T A;  3F2G A;  3FN8 A;  5C17 A;  3F2H A;  5C0U A;  3F2F A;  5DSF A;  3F0O A; 
#chains in the Genus database with same CATH topology
 2H9E H;  4U32 A;  3TIU A;  1GBA A;  1SI5 H;  2A7J A;  1VCQ A;  3ZZ5 A;  2ZC9 H;  1W14 U;  4X1R U;  2OLG A;  3MH4 A;  5JBC S;  2F4L A;  3UTU H;  3F2G A;  1J15 A;  1OWD A;  4MQA A;  2ZQ1 A;  1RIW C;  4JYV H;  3FVF B;  4I8G A;  1UCY E;  3BG4 C;  5ETX A;  4ZHM U;  4X2X A;  2R9P A;  3RXK A;  1SQT A;  3SW2 B;  2JIZ D;  1YPH C;  2ZO3 H;  4E05 H;  1ANE A;  4BXW A;  3TIT A;  3PRD A;  1BRU P;  1W0Y H;  1KLT A;  1F0S A;  1AVG H;  1X7A C;  4LZ1 H;  1GI1 A;  1O2Q A;  1UK3 A;  1P2Q A;  3A7Y A;  2R2M B;  2JH6 D;  3CNR A;  1MCT A;  3QUM P;  4CR9 A;  5TCC A;  3AK5 A;  1EST A;  3HK6 B;  1GBM A;  3KQC A;  1FI8 A;  4D7F A;  3NUM A;  2BB4 A;  1SLU B;  4X2V A;  4I32 A;  1W0J D;  1NTP A;  1N8O B;  3A7T A;  1QJ1 B;  4X8V H;  1E38 B;  3EAJ A;  1FN8 A;  2EQN A;  3GCN A;  2BTC E;  2BY8 X;  1HAY B;  4LOY H;  1H8E D;  4KEL A;  1K22 H;  2XC0 A;  3BV9 B;  4AC9 A;  3BEI B;  4MNY A;  4OGY A;  1EB2 A;  2GZ9 A;  3RXT A;  1RTF B;  3UIR A;  2ZNK H;  1ARC A;  8GCH F;  4ISO A;  2J4I A;  3SHA H;  3LGY A;  3KQ5 A;  1J9C H;  4B73 A;  5LPE A;  2ZDL A;  3SU6 A;  2SNW A;  4YT7 H;  4U30 A;  3DFL A;  5A0C A;  1C5N H;  1XXD A;  1O33 A;  4NA7 A;  4FU8 A;  2TGD A;  4X6O A;  2ZP0 H;  5AFY H;  1WUN H;  4X0W U;  3QN7 A;  2RDE A;  2YNB A;  5FXL A;  3TK9 A;  1HPG A;  4ABG A;  1S85 A;  3ZVB A;  3A85 A;  3RU4 D;  5JYI A;  3EST A;  3RXA A;  1DS2 E;  2B0F A;  1FQ3 A;  4RSP A;  5A0A E;  1SQR A;  3LU9 B;  1AIX H;  3RXV A;  3SGB E;  4F4O C;  1AE5 A;  1JWT A;  3PB1 E;  1O2P A;  2Y5H A;  2P59 A;  2I6Q A;  2C93 B;  2P8O C;  1V2T T;  3FAN A;  2OXS A;  2RG3 A;  2PHB A;  4BOH A;  3GYL B;  3DFJ A;  2SGE E;  2J38 A;  2KX4 A;  1AE8 H;  1SGR E;  3DUX H;  4M7G A;  2BQW B;  2CGA A;  1NZQ H;  4UFD H;  2FOM B;  4F55 A;  5C3N A;  2KAI B;  2W26 A;  4JZE H;  1YYY 1;  1O3G A;  3FP7 E;  2AYW A;  1UTO A;  3QLP H;  4FUB A;  4X1Q U;  4JZI A;  2KCP A;  5J4Q A;  1QCP A;  1GJ4 H;  1F5L A;  1TPS A;  4MPV A;  2ZWL H;  2JDI D;  1G2L A;  1ELB A;  1UTK A;  2Y81 A;  2F9N A;  3BTD E;  1GDQ A;  2Z3C A;  1TQ7 B;  1EJA A;  3UQO A;  1LVM A;  5AVD A;  2BXT H;  5F6M A;  1UK2 A;  3EE0 B;  3SOR A;  5C1U A;  5CHA C;  3T29 A;  3K6Z A;  1FXY A;  1NT1 A;  1EP6 A;  1O38 A;  2XW9 A;  2FXR A;  5C1X A;  1E37 B;  1OP0 A;  2IN2 A;  1DX5 M;  3DA9 B;  3N7O A;  5DKM A;  2ASU B;  2ZU1 A;  5PTP A;  2PKA B;  3RM0 H;  1H4W A;  2Y7X A;  1BMN H;  2WPK S;  3CS0 A;  3PLK A;  4J2Y B;  1EJN A;  1YPE H;  1SB1 H;  3M7T A;  1XM1 A;  3SZE A;  2ZGB H;  1VGC C;  1O3A A;  2KFW A;  1QA7 A;  3LGV A;  3A86 A;  1SFI A;  3P17 H;  1SLV B;  1S84 A;  2ZIQ H;  3V12 A;  1Z1J A;  2GJG A;  3R3G B;  4DG4 A;  4OS5 A;  2G4U A;  4FUE A;  3MTY A;  1WU1 A;  5F8T A;  2C8Y B;  3UWI A;  1E36 B;  1HAV A;  3WY8 A;  1TBZ H;  1Z6J H;  1O2J A;  1VIT F;  1XX9 A;  4BAO B;  1G3E A;  2Z3D A;  1L1G A;  1NRQ H;  2THF B;  1ZSJ A;  2XOK D;  1L4D A;  1DAN H;  1YBW A;  1CVW H;  1DUA A;  3D65 E;  4K60 A;  5EW1 H;  3SV2 H;  3PTN A;  2ZFF H;  2ZG0 H;  1O34 A;  5BRR E;  4Q63 A;  1TAW A;  2CK3 D;  1QFK H;  3LH1 A;  1GVZ A;  1HLT H;  2DE9 A;  4B2C A;  4Y8Y A;  1ID5 H;  3ENS B;  7EST E;  1IQM A;  1KXD A;  1P57 B;  1O2G H;  2AIQ A;  5HGG A;  2SGQ E;  1Z8R A;  2H2Z A;  2Y5G A;  5T6F A;  3A88 A;  3RC5 A;  4AFQ A;  1WDI A;  3ZV8 A;  3E0N B;  2A5I A;  3T62 A;  4YXW D;  1CSO E;  4AB8 A;  4KTC A;  3SNB A;  2GT8 A;  4NFF A;  3EE7 A;  1A3B H;  3A81 A;  3TNS A;  2FPZ A;  1BMF D;  1V2N T;  4OS7 A;  3PTB A;  1FAK H;  2A45 B;  1YLD A;  4NCY A;  3OTJ E;  2FOF A;  4HGC A;  1NPM A;  5A8Z A;  3SU0 A;  1O3H A;  1C4V 2;  1P10 A;  2F9P A;  3SNE A;  1DM4 B;  6GCH G;  4BTI B;  5F8X A;  4X8U H;  2P95 A;  2OQU A;  3RXJ A;  1AZ8 A;  1BIO A;  1WCZ A;  3MU5 A;  4ZXX H;  4ABB A;  2GTB A;  1MQ5 A;  2BLO A;  3FKS D;  4GUX A;  1AUJ A;  4GCH F;  1P2I A;  5EGM A;  3ATM A;  1C2K A;  2GCT C;  3Q3K A;  2O9Q A;  2P16 A;  2XC4 A;  1ETR H;  1GHY H;  1ABJ H;  1IQN A;  1HAX B;  4Y0Z E;  4FOU C;  3Q77 A;  3FP6 E;  2HVY B;  5EXM A;  3SV7 A;  2OC0 A;  1O3N A;  2FOC A;  1OP8 A;  1YY3 A;  4FXG H;  4CHA B;  4K1S A;  4RI0 A;  4UDW H;  4ISH H;  1C2J A;  2PLX A;  1D3D B;  4MNW A;  5FPT A;  2ZU4 A;  1O39 A;  2QGR A;  1QB6 A;  2AFQ B;  1TX7 A;  3MO3 A;  1C5R A;  5A2M H;  1TPP A;  3BTE E;  4QT8 C;  1KTS B;  1C1V H;  3BIU H;  3LGI A;  2VIN A;  3UFA A;  3RP2 A;  1GL1 A;  3DD2 H;  1A3E H;  1C2E A;  1TGT A;  3M37 A;  1XKB C;  3OTP A;  1H9L B;  4MPU A;  4FUD A;  1JBU H;  1G36 A;  3QGJ A;  3SUE A;  1RTK A;  2GGV B;  1NC6 A;  3ZVD A;  1MTN C;  1V2U T;  4TWY A;  1CA0 B;  2XTT B;  3PO1 B;  1QRZ A;  2JH5 D;  2VWM A;  1YKT A;  3GCT F;  5L6N H;  1IQJ A;  1O3J A;  3SU3 A;  2F43 B;  1FY4 A;  4GLY A;  1TRM A;  3RU4 T;  1MTS A;  3SUF A;  3UNR A;  4AGK A;  1LHE H;  1IHT H;  4O97 A;  4ABA A;  2HNT E;  1A0H B;  2J5U A;  3VPK A;  4RN6 A;  1AD8 H;  4OM9 A;  1SGF A;  3T25 A;  1TPO A;  2PTN A;  3DSG A;  4TT3 D;  1ZMJ A;  3RLW H;  3U9A H;  5C0U A;  1GVL A;  2GMT B;  1KLI H;  3L3T A;  3ZVF A;  1K1P A;  1Y5B T;  5EPN A;  1GJ5 H;  2BQ7 B;  2CXV A;  2GV7 A;  5I46 H;  1C9T A;  2VWL A;  3LC3 A;  1D4P B;  1UJ1 A;  1XUG A;  4JZF H;  4O9V A;  1PQ5 A;  3TGI E;  1GHB F;  1O3O A;  3GY4 A;  1NBM D;  3VXF H;  3SQE E;  1W11 U;  2PGB B;  2F91 A;  3M36 A;  2ZPS A;  2GVF A;  2AER H;  5HIZ A;  4H42 U;  4WY3 A;  1JRS A;  4B75 A;  1LMW B;  1OWK A;  1W0K D;  2JH0 D;  1MTU A;  1VIT H;  4IMZ A;  1OS8 A;  3MOC A;  2Q1J A;  1CQQ A;  1LKB A;  2F83 A;  3WW7 A;  2K8I A;  2OC7 A;  3ZZ7 A;  1V2Q T;  1G3D A;  2R3U A;  5JPM H;  1LCY A;  1AUT C;  5G4B A;  5TJX A;  1GI5 A;  3PV2 A;  2PGQ B;  4EST E;  4ZHA A;  2G4T A;  3TJO A;  1Z7K A;  1GGD C;  4MDS A;  1QJ6 B;  5DP4 A;  1C5P A;  4NIW A;  2WHX A;  3OSY A;  4CRF A;  3KNX A;  3MO9 A;  1GMH F;  3E1X B;  1TGB A;  1SQA A;  1D9I A;  2Y5F A;  5EJZ A;  4BTT B;  3M5O A;  2VID A;  2RA3 A;  3RXD A;  3A7W A;  2EI6 A;  2FTL E;  2SGF E;  3BTT E;  1CT2 E;  3VGC C;  3E91 A;  5E0J A;  2JET B;  2BDY A;  1V2P T;  4K1E A;  8EST E;  5F53 A;  2KCO A;  2ZTX A;  1EAS A;  1F0R A;  2P3F H;  2KCY A;  1P11 E;  3NWU A;  5DN6 D;  5GCH G;  1LPZ B;  5IDK A;  1SHH B;  1FDP A;  1PYT C;  2AGI X;  3A7V A;  1SFQ B;  3FAO A;  1SGN E;  1O5G H;  5EQS A;  1UVO A;  3URC A;  2BX4 A;  3MU8 A;  1VR1 H;  3H09 A;  1TMU H;  3SNA A;  2FLB H;  2KCA A;  1BHX F;  1NY2 2;  1AVX A;  4ZKO U;  1IQI A;  1GHW H;  1YP9 A;  5EW2 H;  4CRA A;  5J4S A;  2XBV A;  1H8I H;  5A0B A;  1YC0 A;  2QF0 A;  4NG9 H;  2WPJ S;  3F3B A;  2AIP A;  2M2A A;  1A5H A;  3ELA H;  5C5N A;  3Q76 A;  1G37 A;  4X6M A;  2LP6 A;  3F68 H;  1C5X B;  2VBC A;  1BBR H;  2OP9 A;  1SL3 A;  2KR7 A;  4UE7 H;  3OAA D;  4WH8 A;  5FBE A;  1GG6 C;  1LKA A;  3Q00 A;  3JZ2 B;  4I8L A;  4GHT A;  3PLP A;  2STA E;  3TU7 H;  2GT7 A;  2XCN A;  3UPE A;  1D3T B;  4ZKS U;  4X2Y A;  1CHO G;  3TVJ B;  4GHQ A;  2FYQ A;  5E2O A;  1MTW A;  2ANK H;  4BAQ B;  4UFF H;  3RMN H;  1UO6 A;  4HI3 A;  3RXB A;  1QQU A;  3LON A;  3CS7 A;  4X1P U;  1BBR K;  4AOR A;  3RC6 A;  4ZCN A;  3QGN B;  3UY9 A;  5AHG H;  3E6P H;  1QL8 A;  2G55 A;  3URE A;  1HAV B;  4FVD A;  4E06 H;  2FYR A;  4AYY B;  1SBW A;  1XUH A;  1EAW A;  3MWI U;  1UK4 A;  3BG4 B;  3FO8 D;  4F48 B;  1GJC B;  1FNI A;  2EA3 A;  2PW8 H;  2V6N A;  2V0B A;  2HRV A;  1V2J T;  1NRP H;  1ZPZ A;  2FOG A;  4MTB A;  3BSQ A;  1K1M A;  3LJO A;  1TGC A;  3MNX A;  4BTU B;  1O32 A;  1O2V A;  1HXE H;  5GJ4 B;  1GI2 A;  5AFZ H;  1ELC A;  3WWB A;  4YLQ H;  1UTN A;  1UW7 A;  1B0F A;  3ZVG A;  1TYN A;  3QX5 H;  1QRX A;  1LTO A;  4NA9 H;  3U8T H;  3STI A;  1AKS A;  1AFQ C;  3GOV B;  2AMD A;  3UQV A;  1H9I E;  3U98 H;  2R0K A;  1P06 A;  1NRR H;  3W95 A;  3AAV A;  2BZ6 H;  2BLV A;  4NSV A;  2VVC A;  2XWA A;  3HKJ B;  1O31 A;  1EX3 A;  1KXB A;  3RXG A;  1V2M T;  4R0I A;  3AAS A;  3NZI A;  4ABI A;  2BY5 X;  1GJ8 B;  1ZTK A;  2XRC A;  1FX0 B;  4JZ1 A;  4AFU A;  1NU9 A;  4Y79 A;  3GDU A;  3RXC A;  5B6L A;  3S7K B;  3LT3 A;  4A92 A;  1FON A;  4YOG A;  1UCY K;  1ELE E;  3VB3 A;  1AGJ A;  2F9O A;  1HIA A;  2VIQ A;  2CMY A;  2AGG X;  5DP5 A;  1C2F A;  4LZ4 B;  1DOJ A;  1OHH D;  4ACB A;  1M9U A;  2C90 B;  1C5Z B;  3TH4 H;  1PPZ A;  1G3C A;  5FX6 A;  1EUF A;  5C1Y A;  1KMH B;  2BDB A;  1P9S A;  2CHA C;  1AVW A;  4DY7 B;  3SGQ E;  3KQB A;  5KEC A;  1AWH B;  1QTF A;  1UMA H;  2BQ6 B;  1FY1 A;  1ZML A;  4Z6A H;  1CGH A;  1C4Y 2;  4A7I B;  2Z9G A;  3PV5 A;  3BTK E;  4KKD A;  4DJZ B;  2QXI A;  1C2M A;  1A1R A;  5T6D A;  1GMC F;  3VB5 A;  3E3T A;  1PPB H;  3SUD A;  4HTC H;  2P8O B;  2HNT C;  4OGX A;  1O35 A;  3PWC A;  1SGE E;  2IJO B;  2IPH A;  1DY8 A;  1GBF A;  2H9H A;  1DXW A;  3ATK A;  1V2L T;  1K21 H;  5C17 A;  4THN H;  4DCD A;  1ANC A;  2NU0 E;  1DIC A;  3TPI Z;  3F6U H;  1C4U 2;  5HYO A;  4TY6 A;  3I29 A;  3MH6 A;  1MMJ N;  1LQE A;  1VJ9 U;  3P6Z B;  1SG8 B;  3QWC H;  4IN2 A;  1T31 A;  1YPJ H;  3F9G A;  3G01 A;  4CRD A;  1BIT A;  1PPH E;  2VIP A;  1O3B A;  1ELG A;  4H6T A;  2QXG A;  1MKX H;  3KID U;  3P8F A;  1VCW A;  4JK5 A;  1HV7 A;  1C1P A;  1QJ7 B;  1RGQ A;  3QZQ A;  4FVB A;  2QXJ A;  1OP2 A;  4FU7 A;  1TX8 A;  4I8K A;  5CHA B;  3MI4 A;  1ETT H;  4NGA H;  1GJA B;  1T8N A;  1S83 A;  4UD9 H;  3SJ9 A;  8LPR A;  3NK8 A;  3P8N A;  2FO9 A;  3TK5 A;  2BDA A;  1TNK A;  3ZZ6 A;  3V3M A;  4XRN A;  3RUO A;  3KQE A;  4WMD A;  2Z9I A;  4ISI H;  3TLO A;  1TFX A;  2HVX A;  1XXF A;  1QGF A;  1JIM A;  1BRC E;  2OBO A;  3A89 A;  1HXF H;  1MKX K;  1MKW K;  1SGC A;  3HGN A;  3SU2 A;  1GI0 A;  2ANY A;  3TJN A;  1C2I A;  3EGK H;  1LQD B;  1OYQ A;  1HJ9 A;  1PFX C;  1VGC B;  2G51 A;  5EQR A;  3RXL A;  2D26 C;  1AQ7 A;  5JBA S;  2H5D A;  3I77 A;  1IOE A;  4CRE A;  1PYT D;  4A6L A;  4Q7Z A;  1OYT H;  2G8T A;  1W0Z U;  1ZSL A;  1VKY A;  1W8B H;  3OX7 U;  1ZMN A;  1KDQ A;  2W6I D;  1O3M A;  3GY8 A;  1IQH A;  5DGJ A;  5K0H A;  3GY7 A;  1C1R A;  3RXS A;  1TAB E;  1O37 A;  3HAT H;  4INL A;  1TLD A;  4CRC A;  4D9Q A;  2RFK C;  2OIN A;  4XE4 A;  1EAI A;  2ZDA H;  1INC A;  3BF6 H;  3B9F H;  2HAL A;  3TH2 H;  4Z1M D;  3DSO A;  3RXU A;  3BTH E;  1V2O T;  2GCH G;  1TAL A;  3H7O A;  1HAO H;  1EZU C;  3F9H A;  4CR5 A;  3BTW E;  3RML H;  2HLC A;  1TPA E;  3A7Z A;  3LC5 A;  5FAH A;  1FIZ A;  1RRK A;  1BMM H;  4DGJ A;  1GMD F;  4FU9 A;  1B7X B;  4BAK B;  2HWL B;  5E0G A;  2A5K A;  3ZZC A;  1EAX A;  3ZVE A;  4NIY A;  1GHZ A;  1P2M A;  2J2U A;  1ZZZ A;  1IHS H;  4NA8 A;  4WH6 A;  2ZPR A;  5GXP A;  1RTL A;  2QA9 E;  3B23 B;  1BOQ A;  1CGJ E;  3D23 A;  9LPR A;  1Y3Y A;  1T8M A;  2ILN A;  5GND A;  1Z1I A;  1VIT G;  2AEI H;  1BDA A;  2PV9 B;  2ZU3 A;  4Z0K A;  5K7R A;  1WXR A;  3GS9 A;  1MD8 A;  1BTW A;  4ACA A;  1O2T A;  1Y3V A;  1OWJ A;  2ZCK P;  3LDX H;  5DP7 A;  1GJ7 B;  1MZD A;  2WV5 A;  1UVP A;  3GIS B;  1NO9 H;  4RKO B;  1SQO A;  4IN1 A;  3RXP A;  3QTO H;  1TQ0 B;  1D6W A;  3E8L A;  1TNL A;  3M7U A;  1SGY E;  4UFE H;  1C2L A;  1QQ4 A;  1LHC H;  2GCT B;  4MVN A;  1K1J A;  2XWB I;  1HAZ B;  4I8H A;  4XFQ A;  3TH3 H;  1O2R A;  4ABF A;  2Z9L A;  4Q2K A;  4HG6 A;  1SGD E;  3CEN A;  4ASU D;  2VB0 A;  1AMH A;  1YPM H;  1XUF A;  5C67 A;  1OWE A;  2IOT A;  1EPT C;  3RU4 E;  4ZKN U;  2R3Y A;  1TRN A;  4TPY A;  2FOE A;  1QHR B;  1HAG E;  2VIW A;  2I6S A;  1QBO A;  4TWW A;  4IS5 A;  4Y7A A;  1O2H A;  3RXM A;  1SPJ A;  1DLK B;  1ZHR A;  1CT4 E;  3LGU A;  2ZFR H;  2W7U A;  3PM3 A;  3SUG A;  1DDJ A;  1W7G H;  2ZQ2 A;  2ZDM A;  2ZTY A;  3ZV9 A;  1BMA A;  1NU7 B;  1XUK A;  2ZA5 A;  1NFU A;  4AG1 A;  1GI4 A;  5DP8 A;  1BCU H;  2V35 A;  3A8D A;  4Q7X A;  3UOP A;  5C20 A;  2BDG A;  1A2C H;  1L1J A;  4I86 A;  4INH A;  1SOZ A;  2WYG A;  2BD3 A;  3EA7 A;  3SOS A;  1MTN B;  3SV8 A;  1P01 A;  3SN8 A;  5EIY A;  5E2P A;  2BY9 X;  2J9N A;  1AHT H;  3MNC A;  2JJ2 D;  2Z7F E;  4A1X A;  4O3T A;  5HKK D;  3BEF B;  4I31 A;  1ZJK A;  1DSU A;  2PWX A;  1RXP A;  1V6D A;  3IG6 B;  2FWW A;  5A8Y A;  3RLY H;  2PSY A;  1S6F A;  2FS9 A;  2ZGX H;  1AKS B;  3M61 U;  1IQF A;  3ZZD A;  3A8B A;  5A09 A;  5F8Z A;  5L2Z H;  3ZZB A;  4X6N A;  4A5T S;  2BX3 A;  1V2R T;  2C3S A;  3KN2 A;  3MH7 A;  1NRS H;  1BHX B;  1QL7 A;  5JBB S;  4B71 A;  1OOK B;  5FPY A;  2ZHD A;  4DT7 B;  2DUC A;  2QF3 A;  3ZYE A;  2J98 B;  2EEK A;  5F03 A;  4YZU A;  2IJD 1;  4CH8 B;  1YWU A;  3C1K A;  3PRO A;  2C8W B;  3VXE H;  1A4W H;  2K1Q A;  4X8T H;  2AGE X;  2O8L A;  2NWN A;  1MAY A;  1BRB E;  1PPF E;  1UVS H;  1DWB H;  2AMP A;  4FUI A;  4P00 A;  4DT4 A;  4NFE A;  5H4I B;  1MCV A;  4ISN A;  4SGB E;  2ZHE H;  3VG8 A;  2K0Q A;  4O3U A;  1HIA B;  5FCR A;  2ZU5 A;  2BD5 A;  4TSF D;  1G9I E;  2VGC C;  1BT7 A;  3SQH E;  2FOH A;  3TK6 A;  2OTV A;  5C94 A;  1GGD B;  2BVX H;  3ZYD A;  1C5T A;  1BA8 B;  3A84 A;  4Y6D A;  4AX9 H;  2TIO A;  2AHM E;  4BAM B;  2FEQ H;  1EOJ A;  4CBN A;  1JRT A;  1RJX B;  3PRB A;  2H1U A;  1WOF A;  1Y3W A;  5HM9 A;  3PMA B;  1O5E H;  1MZA A;  2H6M A;  3VGC B;  1F92 A;  4OS6 A;  1ZLR A;  5KED A;  3KQD A;  4INK A;  3DCL A;  4ISL A;  4RKJ B;  3P8G A;  1HCG A;  2NU2 E;  3OE7 D;  2AH4 X;  3PMB B;  4Y0Y E;  1ZRK A;  2CV3 A;  2W3I A;  3RDZ A;  1AFE H;  1SKY E;  1CHG A;  1WQV H;  3UWJ H;  4K3J A;  6GCH F;  1GHX H;  1UTQ A;  1TGS Z;  3F9F A;  3MH5 A;  2SGD E;  3TJV A;  7GCH F;  3VB7 A;  1Z8I B;  4K8Y A;  5KGO A;  1TOM H;  3AAU A;  1FUJ A;  3O8R A;  2BVR H;  1W3C A;  2CN0 H;  3W1E A;  3VFE A;  1VJA U;  1DWD H;  2A4G A;  4H4F A;  1C5S A;  3N7E A;  4WVP E;  4IW4 E;  1Q3X A;  4WXV A;  5DP6 A;  5EXN A;  3UR6 A;  1ZHP A;  2WPI S;  3DSP A;  1ABI H;  2HOB A;  3KYF A;  3RXH A;  1C2H A;  3VB6 A;  1GMH G;  4JYT A;  3M3S A;  2G5V A;  3GY3 A;  2ODP A;  3ZZA A;  1GG6 B;  4B2B A;  6CHA C;  3ZZ4 A;  3KEE A;  1JIR A;  2R2W U;  1BTZ A;  2HLD D;  3FFG A;  1LHF H;  1EPT A;  1QIX B;  1Y3U A;  4NZQ A;  1G2M A;  1YPH E;  1T7C A;  4Y10 E;  1O5B B;  3RXQ A;  2HPQ H;  1T8L A;  3Q3X A;  1THR H;  4X2W A;  3S9B A;  4ABH A;  4IC5 A;  2WPM S;  1KXF A;  1O3K A;  1WTH D;  5DJ7 A;  2BOH B;  1ZR0 A;  2WPH S;  4FUF A;  3I78 A;  1MQ6 A;  1W10 U;  3R0F A;  1KXA A;  2CF9 H;  4WME A;  1ZTL A;  2VH6 A;  1C5Y B;  1EQ9 A;  2VJ1 A;  2BOK A;  1KDQ B;  1ARB A;  3V0X A;  1TNI A;  1EOL A;  1TON A;  1BZX E;  5BPE A;  1FZZ A;  1D3Q B;  5EPY A;  1C9P A;  2EC9 H;  3JZ1 B;  1Z8G A;  1V3X A;  4OS2 A;  5GIB A;  1P3E A;  5FCK A;  1Y3X A;  3AW1 A;  4AYV B;  2TGT A;  3MQK C;  2BYA X;  4I33 A;  3U69 H;  2FOD A;  3Q3Y A;  4AFZ A;  3V13 A;  2WYJ A;  2GZ7 A;  3W94 A;  5FBI A;  7KME H;  1H1B A;  4Q7Y A;  4A1T A;  1HAI H;  4IBL H;  2GP9 B;  2XNI A;  1AFQ B;  1EB1 H;  2OC1 A;  4FUJ A;  3LH3 A;  2NU1 E;  4TPI Z;  2ZEB A;  3KYG A;  1YCP K;  2FIR H;  2D2D A;  3SYJ A;  1P12 E;  1QNJ A;  1W7X H;  3F1S B;  2ANM H;  5T6G A;  4CRG A;  1ETS H;  2V3M A;  1GHA F;  4Q4L A;  1J14 A;  4XDE A;  1HDT H;  1GBC A;  3ATL A;  3GDS A;  4K5Z A;  2FDA A;  1GVK B;  5ABW A;  2ULL A;  4FUG A;  1O3L A;  4UFG H;  3OEE D;  1FN6 A;  2ZDK A;  1O2W A;  4XOJ A;  3RMM H;  2BD4 A;  1ELA A;  1CGI E;  3IIT A;  5SGA E;  1HFD A;  4X1N U;  2PUX B;  1LVO A;  1WQS A;  5C2Z A;  2Y7Z A;  3T27 A;  1FPC H;  1T32 A;  1S81 A;  1NBM E;  2BY6 X;  3GIC B;  3AVZ A;  4K8B A;  3GYM A;  3KGP A;  1O5D H;  4KP0 A;  1XUI A;  4YOI A;  5JDU B;  1K2I 1;  1ELD E;  3RXI A;  2CHA B;  2EST E;  2F9V A;  1V2K T;  2Y80 A;  3QO6 A;  5DPA A;  3B8J A;  1P02 A;  2QIQ A;  3K9X B;  1MU8 B;  1GBH A;  4ZAE A;  2FMJ A;  5TCA A;  3F0P A;  3EA9 A;  2A2X H;  5T1V A;  2L6O A;  2WZQ A;  2HPP H;  3ZVC A;  3SV9 A;  2A2Q H;  3TGK E;  1IQK A;  1LDT T;  2ZEC A;  4GPG A;  2LPR A;  1N1L A;  1C1Q A;  4ABJ A;  1RIW B;  1ZRB A;  2ALV A;  1A0L A;  3PWB A;  3NPS A;  2J95 A;  1DE7 H;  4B2A A;  3P70 B;  2BM2 A;  5DG6 A;  5AF9 H;  2O8M A;  3KL6 A;  3PMH B;  3GY5 A;  4M9F A;  1TA6 A;  2QE7 D;  3RXO A;  5EQQ A;  3T26 A;  2GX4 A;  1GDN A;  1WBG B;  1PPG E;  1J16 A;  1OWI A;  4VGC C;  5C0T A;  3S9C A;  2QC2 A;  2EI8 A;  4ASH A;  1AB9 C;  4IGD A;  2P94 A;  1UCY H;  1ZOM A;  2JKH A;  1ZPB A;  1KLJ H;  1XUJ A;  4MG3 A;  2BD9 A;  1TNJ A;  2TRM A;  2XCF A;  1K28 D;  2ZFP H;  2VWO A;  1Q31 A;  1YM0 A;  4ZXY H;  1LHG H;  4SGA E;  4PRO A;  3S9A A;  2OBQ A;  3N7D A;  1P03 A;  1F5R A;  1TMT H;  1CHO F;  4WMF A;  1BTH H;  1O3I A;  5C5O A;  5HM2 A;  3M5N A;  2SNV A;  2O8T A;  5LPR A;  1P3C A;  1UVT H;  3SJI A;  2YNA A;  2ZFS A;  4X8S H;  1RD3 B;  5I25 A;  1BML A;  1EZX C;  1H8D H;  2AS9 A;  4NZL A;  2CF8 H;  2P93 A;  4D9R A;  2PTC E;  1A5G H;  3E90 B;  2A4R A;  5EU8 A;  1FY8 E;  1Z6E A;  2XBW A;  3MU1 A;  1SMF E;  2VIV A;  3KHV A;  3F2H A;  1CE5 A;  3MO6 A;  1XVO A;  5DP9 A;  4ZKR U;  5LGO A;  3SJO A;  3IWM A;  1EAT A;  1QA0 A;  2ZHW H;  1K1L A;  2PP6 A;  3U1J B;  1KYN A;  2ZF0 H;  4KTU A;  3SV6 A;  3N99 A;  1HJA C;  2YMS C;  4XBC A;  3OU0 A;  1T4V H;  3E16 B;  1NFY A;  1GBI A;  1BB0 B;  5HMA A;  2C8X B;  4D8N A;  2PKS C;  1YLC A;  1F0T A;  1AI8 H;  1C2D A;  6EST A;  1EAU A;  1LVY A;  1FY3 A;  1E34 B;  1PPE E;  1JXP A;  1SC8 U;  1FAX A;  2Q6F A;  2QV1 A;  2Z94 A;  2J92 A;  1Y59 T;  5HXF A;  3BG8 A;  4XD7 D;  1HAP H;  2B8O H;  1SGT A;  3GCH C;  4CH2 B;  1LO6 A;  2FM2 A;  8GCH G;  4Y76 A;  3D62 A;  4IMQ A;  3D49 H;  1DPO A;  4K69 A;  1CBW C;  4ABD A;  4AGJ A;  1O3F A;  1PQA A;  1KIG H;  1TE0 A;  1P2J A;  1D3P B;  2BZA A;  3H7T A;  1O0D H;  1O2S A;  1PJP A;  1FV9 A;  1VCP A;  1Z71 A;  4ZRO A;  1Q2W A;  1S5S A;  4JK6 A;  2VVV A;  1MKW H;  2ZGC A;  4WXI A;  4Y8Z A;  1NFX A;  2ZCL P;  3PLB A;  3BTM E;  4NWK A;  3BTF E;  1S6L A;  1C1M A;  4HFP B;  4AOQ A;  3FN8 A;  1GI3 A;  1O2Z A;  1IQL A;  1BTP A;  1S0Q A;  3BN9 A;  1GBB A;  4NSY A;  2GKV E;  4I7Y H;  4BAN B;  3RMO H;  1DUE A;  4KGA A;  1C5M D;  1AND A;  5E0H A;  1VZQ H;  3LJJ A;  4JCN A;  1COW D;  3SBK A;  3P95 A;  1GWA A;  4H6S B;  1C1S A;  1TA2 A;  2FI4 E;  5GDS H;  1SLX B;  2B5T B;  3LGW A;  1F7Z A;  1O2M A;  2O8U A;  1EZS C;  2ZPQ A;  1GI8 B;  1OSS A;  2R0L A;  3MHW U;  1GMD G;  3GY2 A;  2EY4 C;  2OC8 A;  2HNT F;  3ODF A;  4WJG 2;  4GVU A;  1YLN A;  2B7D H;  1HJ8 A;  1SSX A;  2F9B H;  2OD3 B;  1EPT B;  3O8D A;  1HRT H;  2QYI A;  1P2O A;  3S7H B;  2GV6 A;  1EJM A;  4MNX A;  5ESB A;  1LHD H;  2TBS A;  1GI6 A;  2WV9 A;  1QB1 A;  4JYU H;  1KTT B;  1GCT C;  2G52 A;  8KME 2;  1QZ8 A;  1C2G A;  4XBB A;  1MTV A;  1WV7 H;  2NU4 E;  2A1D B;  2UUY A;  1FIW A;  1L0Z A;  1RFN A;  1TNH A;  1ZJD A;  2UWO A;  1QL9 A;  1T8O A;  2W6J D;  3QK1 A;  5CMX H;  1PQ7 A;  3MU0 A;  2BHG A;  1BJU A;  2QY0 B;  1C5U A;  4AB9 A;  1O2I A;  1O2X A;  1WAY B;  2ZGH A;  4MPX A;  1AWF H;  1TNG A;  9EST A;  4K1T A;  1Z8J B;  1ACB E;  2NU3 E;  1ELF A;  2UUF B;  4F49 A;  4ZH8 A;  1A61 H;  3KCG H;  1Y5A T;  2G5N A;  2FZZ A;  5JB8 S;  4DVA U;  4DII H;  2BDI A;  5CDF E;  2B9L A;  3OFN D;  1W12 U;  4BAH B;  4RT0 A;  1K1I A;  1GBE A;  4OS4 A;  3RXF A;  2BD7 A;  1BTY A;  2RCE A;  1MBM A;  1YF4 A;  2Q6D A;  4TYD A;  1EP5 A;  1P0S H;  1XVM A;  3RM2 H;  3MNS A;  2G81 E;  1N8O C;  2QF4 A;  2ZDN A;  3TNT A;  3OY6 U;  5FL7 D;  4BXS A;  4ZHL U;  1F0U A;  2BVS H;  1P2N A;  2FOA A;  1O2Y A;  2L74 A;  3MNB A;  3UNS A;  2GCH F;  3RXE A;  1H8H D;  2OCV B;  3A82 A;  3SND A;  3HPT B;  1TBQ H;  2P3U B;  3U1I B;  2C8Z B;  4DW2 U;  2VGC B;  1ANB A;  1KSN A;  1ZTJ A;  3BIV H;  4D76 A;  1J8A A;  1SR5 C;  2VWN A;  3CP7 A;  1SGF G;  3MFJ A;  2CJI A;  1BTU A;  1G30 B;  4J1Y A;  4OS1 A;  2YOL A;  3GY6 A;  3MU4 A;  4GSO A;  3QTV H;  2QAA A;  2GZ8 A;  1LPG B;  1O3D A;  3E0P B;  5HIY A;  1PPC E;  2UWP A;  1ZGI A;  5EXL A;  1SOT A;  2FI3 E;  1YCP M;  4A1V A;  3ATW A;  1CO7 E;  2WPL S;  3A7X A;  3SNC A;  3SU4 A;  2Y6T A;  1C5V A;  2XC5 A;  2ZHF H;  1GBT A;  2M5T A;  2STB E;  5FX5 A;  1KXC A;  1GBD A;  3S0N A;  1KXE A;  2D1J A;  2EI7 A;  1UVU H;  4GCH G;  2YMS D;  4YM9 A;  3TGJ E;  1S82 A;  3F2F A;  1G32 B;  1EKB B;  5JB9 S;  1NFW A;  2ZTZ A;  3P92 A;  1UTM A;  2Y82 A;  3AW0 A;  1LVB A;  4UON A;  1ZGV A;  2A4Q A;  1FPH H;  1O2N A;  1BJV A;  2G00 A;  3DHK H;  5T3H A;  4I8J A;  2BLQ A;  2ZI2 H;  2SFA A;  2TGA A;  5B6O A;  2V3O H;  4NIV A;  3SZN A;  4E7R G;  1HAH H;  3KF2 A;  2ZGJ A;  5EOK A;  3M5M A;  2A32 A;  1DFP A;  6CHA B;  2QF5 A;  3T2N A;  1NES E;  4MPW A;  4YTA A;  1UHB A;  1BTX A;  4YT6 H;  2ZFQ H;  1GBJ A;  1U6Q A;  1KY9 A;  3H5C B;  4WF8 A;  1ELT A;  2ZCH P;  2FP7 B;  2W3K A;  3UAI C;  4D7G A;  4X1S U;  2PR3 A;  2QXH A;  1OKX A;  2BDH A;  5IK2 D;  1AO5 A;  2FLR H;  3GCT G;  4UEH H;  3SHC H;  1K1O A;  2TPI Z;  1E1Q D;  1H9H E;  1AN1 E;  4P02 A;  2PSX A;  2FS8 A;  1V2S T;  4DOQ A;  1S0R A;  3UOU A;  4YES B;  7GCH G;  2D8W A;  3HK3 B;  1QB9 A;  1RS0 A;  1QY6 A;  1BQY A;  2ZFT A;  1YPK H;  3L33 A;  1V2V T;  2SGA A;  2OUA A;  2ODY B;  2BY7 X;  2BD8 A;  2XND D;  1MUE B;  3A83 A;  3ZIA D;  1NRN H;  3T28 A;  4Y71 A;  2ZDV H;  1THP B;  1IQE A;  4Y7B A;  2J94 A;  1UTJ A;  1GHB G;  2O8W A;  4R8T B;  1AU8 A;  2BD2 A;  2A7H A;  3UNQ A;  4TY7 A;  1PQ8 A;  5DO4 H;  2WUC A;  2W7S A;  4YOJ A;  2HGT H;  1OWH A;  3A8C A;  3EDX B;  1IAU A;  2F3C E;  3BTQ E;  3MYW A;  1HNE E;  1C1O A;  1W2K H;  3LKW A;  4YO9 A;  1GJB B;  1P9U A;  2RDL A;  5EJL A;  4RT1 A;  1D6R A;  1FY5 A;  1K0H A;  4ZUH A;  3ATI A;  1HBT H;  1TRY A;  1DT2 A;  1P05 A;  1AY6 H;  1P2K A;  2ZKS A;  2PUQ H;  2ANW A;  4AZ2 B;  1ZSK A;  3A8A A;  1ZHM A;  3NKK A;  2GD4 B;  2F9U A;  2ODQ A;  1N6X A;  5EST E;  1Y5U T;  3RXR A;  1F2S E;  3LGT A;  1EZQ A;  3HKI B;  3NRL A;  3SI4 H;  1O30 A;  1GCD A;  4JZD H;  5L30 H;  3SI3 H;  4WWY A;  1SLW B;  5DP3 A;  2IPQ X;  4AN7 A;  3OEH D;  3DT0 H;  5DK1 A;  5FHT A;  1UTP A;  1C1N A;  2VIO A;  2TGP Z;  1NM6 A;  3M3T A;  5IYT A;  2ZZU H;  1SGI B;  4FET A;  2WV4 A;  3T5F H;  3UR9 A;  1A0J A;  2KZ4 A;  3LPR A;  1Y8T A;  1C5O H;  1TMB H;  3F0O A;  1MAX A;  1DST A;  1UTL M;  3EQ0 H;  1A46 H;  1MH0 A;  1WSS H;  2OQ5 A;  3F9E A;  1JOU B;  4DIH H;  1C5Q A;  1FJS A;  4U2W A;  1DVA H;  4YLU A;  1O5F H;  1L1N A;  3PV4 A;  2VH0 A;  2FTM A;  1GHA G;  2LEL A;  2Z9J A;  3P8O A;  5EOD A;  2H9T H;  1L4Z A;  1YCP H;  3WWF A;  3K2U A;  2XBX A;  3STJ A;  1C5W B;  2XXL A;  1THS H;  1GL0 E;  1DXP A;  1K9O E;  3M35 A;  1GJ9 B;  1MU6 B;  4E7N A;  1WYK A;  1ESA A;  3GCO A;  4NWL A;  1CT0 E;  1ORF A;  4O03 A;  3SU5 A;  1LPK B;  3LOX A;  2QN5 T;  1GBK A;  4B74 A;  4CHA C;  2ZU2 A;  1XKA C;  1FLE E;  2KAI A;  3NXP A;  4VGC B;  2GDD A;  1B0E A;  3UUZ A;  1AB9 B;  1TBR H;  4AFS A;  1E1R D;  3SO3 A;  5L2Y H;  1AZZ A;  3SU1 A;  3ITI A;  2Q6G A;  1TIO A;  3GDV A;  4K2Y A;  2C4F H;  4MLF B;  5EJ1 A;  1HUT H;  1ESB A;  1O3E A;  1BUI A;  1QBN A;  2ALP A;  2OK5 A;  3M7Q A;  4X6P A;  1YGC H;  1C1T A;  1B5G H;  1BRA A;  1DIT H;  4LK4 A;  2KM0 A;  3K6Y A;  1DWE H;  1GHV H;  3FZZ A;  1O36 A;  3K65 B;  4B76 A;  5JBT A;  1CA0 C;  1CU1 A;  3QDZ B;  3PO1 C;  2FX6 A;  3EYD A;  1V2W T;  3TJU A;  1F5K U;  3FZD A;  3ZVA A;  2PKA A;  2Z9K A;  4MNV A;  4U01 A;  3ODD A;  4XBD A;  3EA8 A;  4AG2 A;  1ZPC A;  1GI7 B;  4Y8X A;  2WIN I;  4HZH A;  1A5I A;  1HJA B;  2YMS B;  1ZYO A;  3U28 C;  1SVP A;  2GMT C;  1W13 U;  2A7C A;  2P3T B;  1O2U A;  1GJ6 A;  2A31 A;  1MBQ A;  1O5A B;  5GWZ A;  1O2K A;  2FOB A;  1O2O A;  3NCL A;  1K1N A;  2PKS B;  2W5E A;  1YPG H;  7LPR A;  3OY5 U;  1O3C A;  5GCH F;  3S69 A;  1P09 A;  4ABE A;  1P8V C;  5FPS A;  1XMN B;  4FUC A;  4ZMA H;  2Z3E A;  1HGT H;  3UB0 A;  3OYP A;  5CE1 A;  1WTG H;  2A0Q B;  2SGP E;  1EFR D;  5LH8 A;  3GCH B;  3BTG E;  1C1U H;  3ZZ3 A;  3PMJ A;  3SGA E;  1J17 T;  4GAW A;  1DY9 A;  2H5C A;  1SHY A;  4KTS A;  1CBW B;  2UWL A;  4Y11 E;  3PYH A;  2DE8 A;  1TX6 A;  1IQG A;  2V7Q D;  5GPI B;  2WSS D;  3QZR A;  2XYA A;  1GJD B;  3A80 A;  3C27 B;  2BXU H;  2UUK B;  4IC6 A;  6LPR A;  4NIX A;  4B6E A;  3A87 A;  1ELV A;  1SGQ E;  3U8O H;  3SJK A;  1L2E A;  4CBO A;  2BDC A;  5E8E H;  1NRO H;  2XBY A;  2BMG B;  2ZHQ H;  1QUR H;  3LIW A;  2JJ1 D;  2Z6B D;  3SJ8 A;  3FOA A;  1A7S A;  1JMO H;  3HGP A;  3M5L A;  1C5L H;  1O5C B;  1TGN A;  3ZZ9 A;  3BEU A;  3ZZ8 A;  1TWX B;  1OPH B;  2VNT A;  2JET C;  3VEQ B;  1T4U H;  1OXG A;  2WPD D;  2LNC A;  4JMY A;  1CA8 B;  4XSK U;  1GI9 B;  2AMQ A;  1HB0 B;  2PFE A;  1SGP E;  4FUH A;  1MD7 A;  1GMC G;  4B6F A;  2GDE H;  4DUR A;  5A8X A;  1GBL A;  1C1W H;  2FI5 E;  1O2L A;  2FX4 A;  1TB6 H;  3M3V A;  3O8B A;  2J97 A;  3L6P A;  4B1T A;  2BLW A;  1BBR E;  3VB4 A;  1FMG A;  1N6Y A;  3URD A;  5DSF A;  2V3H H;  3O8C A;  2J98 A;  2RA0 A;  1HYL A;  1QBV H;  3V7T A;  4Q80 A;  1QR3 E;  1MAB B;  1OX1 A;  1G3B A;  2VU8 E;  1P04 A;  2FES H;  2J34 A;  1O3P B;  2UUJ B;  1QRW A;  1DLE A;  3FP8 E;  1GDU A;  1E35 B;  2QCY A;  1UHB B;  1YPL H;  2A5A A;  1E0F D;  4LXB H;  1EXF A;  2A4O A;  1S6H A;  5LPF A;  5EG4 A;  1E79 D;  5CHB A;  2VVU A;  3RC4 A;  1GCT B;  1NS3 A;  1TOC B;  2WUB A;  1DWC H;  3U8R H;  4CRB A;  1NN6 A;  3MMG A;  1GPZ A;  4BNR A; 
#chains in the Genus database with same CATH homology
 1FX0 B;  5C0T A;  1S6L A;  4I33 A;  1EFR D;  2CK3 D;  2P59 A;  2F43 B;  3SU3 A;  5B6L A;  4A92 A;  3F3B A;  2QF4 A;  1DY9 A;  2M2A A;  3FN8 A;  4WF8 A;  3SUF A;  5FL7 D;  2FP7 B;  2XCF A;  4A1T A;  2J5U A;  5IK2 D;  4OM9 A;  2F4L A;  3RC5 A;  2FOM B;  4F55 A;  3DCL A;  2XNI A;  4TT3 D;  3F2G A;  2V7Q D;  2OC1 A;  2VBC A;  2OBQ A;  1OHH D;  2WSS D;  2W6I D;  1E1Q D;  3N7D A;  3OE7 D;  5GPI B;  5C0U A;  2KR7 A;  2LEL A;  1COW D;  3M5N A;  3P8O A;  4YXW D;  3SUG A;  5ETX A;  4KTC A;  2KCP A;  3OAA D;  1SKY E;  4WH8 A;  5EPN A;  3WWF A;  1H8H D;  3SYJ A;  4B6E A;  1KMH B;  3U1I B;  2JDI D;  2JIZ D;  1DXP A;  2OIN A;  3PRD A;  1BMF D;  3E90 B;  1NBM D;  2A4R A;  2XCN A;  2JJ1 D;  4Q4L A;  4NWL A;  3FOA A;  3SU5 A;  4Z1M D;  3M5L A;  2GVF A;  3LOX A;  3PV5 A;  4B74 A;  2XND D;  3DSO A;  4TYD A;  3ZIA D;  3SV8 A;  1A1R A;  3F2H A;  4B75 A;  3AK5 A;  2OC8 A;  3OEE D;  1W0K D;  3SU0 A;  3SUD A;  2JJ2 D;  2YOL A;  3U1J B;  2WPD D;  4R8T B;  4I32 A;  3N99 A;  4A1X A;  3SV6 A;  2YMS C;  1W3C A;  1W0J D;  3LON A;  3W1E A;  3O8R A;  2IJO B;  4JMY A;  2A4G A;  3O8D A;  1E1R D;  5HKK D;  1DY8 A;  3N7E A;  1DXW A;  4I31 A;  3WW7 A;  2K8I A;  2OC7 A;  3SU1 A;  5C17 A;  1H8E D;  3RC6 A;  4ZCN A;  3FKS D;  1NBM E;  3LKW A;  3DSP A;  4B6F A;  4K8B A;  5ESB A;  2OK5 A;  4A1V A;  2WV9 A;  3PV2 A;  3SZE A;  3O8B A;  3SU4 A;  4WH6 A;  3L6P A;  3FO8 D;  1RTL A;  2KM0 A;  1JXP A;  4B76 A;  3KN2 A;  2F9V A;  1CU1 A;  2QV1 A;  2WHX A;  3KEE A;  2KFW A;  4B71 A;  3KNX A;  5DSF A;  5FPY A;  3O8C A;  3EYD A;  3SV7 A;  4XD7 D;  2YMS D;  4B73 A;  2HLD D;  5GND A;  2OC0 A;  3SU6 A;  2FM2 A;  3F2F A;  3M5O A;  2IJD 1;  1RGQ A;  2W6J D;  5GJ4 B;  2F9U A;  1MAB B;  3F0P A;  3GS9 A;  4U01 A;  1WXR A;  3WWB A;  4RI0 A;  5T1V A;  2K1Q A;  2L6O A;  5FPT A;  2WZQ A;  3SV9 A;  3NRL A;  2A4Q A;  5F53 A;  2KCO A;  1N1L A;  2KCY A;  2YMS B;  4DT4 A;  5H4I B;  3P8N A;  5DN6 D;  5IDK A;  4NWK A;  3VG8 A;  2K0Q A;  5EQS A;  2XOK D;  3OEH D;  4TSF D;  1BT7 A;  3H09 A;  1E79 D;  2OBO A;  5CHB A;  2KCA A;  2O8M A;  3RC4 A;  3OTP A;  3KF2 A;  1NS3 A;  4M9F A;  2QE7 D;  4FET A;  3SU2 A;  5CDF E;  3OFN D;  5EQQ A;  3M5M A;  3SUE A;  5FPS A;  2GGV B;  5EPY A;  2AHM E;  5EQR A;  2KZ4 A;  3UB0 A;  3OYP A;  3PRB A;  4ASU D;  4Q63 A;  3F0O A;  2QF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...