3FN8A

Crystal structure of merb complexed with mercury
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MerB complexed with mercury
rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Alkylmercury lyase
total genus 58
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3fn8A00
5C0UA 3F0PA 3F0OA 3F2FA 5C0TA 5C17A 3FN8A 3F2GA 5DSFA 3F2HA
chains in the Genus database with same CATH superfamily
3SU0A 2RA3A 1YPLH 1FV9A 1GHAF 2ZKSA 4A5TS 1ABJH 2ODQA 1TGSZ 2BVXH 4NIXA 1TNLA 1Y5UT 1CA0B 1LPKB 4ABDA 1SBWA 1K1IA 1MTNB 5FPTA 4F48B 3VXEH 4XBCA 4AN7A 3QX5H 2FOEA 3MFJA 1C5RA 1DXWA 5FCKA 1W0KD 1PPEE 1UK4A 2GCHG 2R2WU 2EI7A 3NPSA 3UB0A 1OS8A 3BG8A 5BPEA 1E79D 1AE8H 3M7QA 1E1RD 2J4IA 1O2SA 1H4WA 4BTUB 3I29A 4AYYB 2VVUA 1AIXH 2C8WB 1T4VH 3K6YA 4F49A 1O5AB 3T27A 2J94A 4O9VA 2G51A 2FODA 5F8ZA 3BTKE 4KTUA 1NESE 2PSYA 4JYUH 4X8VH 4ZKRU 2QXGA 5A0CA 1ABIH 4ISHH 1HAXB 2Y81A 2VIOA 4YXWD 1GI7B 4UEHH 3MOCA 4WH6A 3EA8A 1L1GA 3UQVA 1VJ9U 3LGYA 2OLGA 1FAXA 4U01A 3NKKA 3H09A 3PRDA 1AUJA 3WWFA 4TPYA 1RIWB 5C20A 2ZHDA 1G32B 1O2OA 1PPBH 2BDYA 2GKVE 1FLEE 1C2MA 5EW2H 2FOFA 1RIWC 9LPRA 1Y3WA 4YO9A 1Q2WA 1C2DA 5B6OA 3GY3A 1YPJH 4NFFA 2DE8A 1TMUH 1SKYE 2KM0A 4E7NA 1MUEB 5DP7A 4YTAA 4MNWA 4ZKSU 4TPIZ 2JJ1D 2ZU1A 3GYMA 1WQVH 2L6OA 2AMQA 2J98B 3ZV9A 3UNQA 1WTGH 3O8DA 1LHEH 1UTJA 1D6RA 2ZPSA 1EX3A 2ZWLH 2GJGA 1SGDE 3T26A 1PQ7A 3AW0A 2ILNA 4B6FA 2PKSC 1W12U 3F3BA 4JZ1A 1HCGA 3UNSA 3DSPA 3STJA 2BDAA 2P3FH 5L2ZH 2XNIA 4XDEA 1GJ9B 1SHYA 5CMXH 1ELVA 1UVPA 1UCYK 4OS6A 2XOKD 1ZSJA 2YMSD 1V2LT 4K5ZA 1UTMA 2RFKC 1NPMA 3GDUA 5FCRA 3RXFA 3RMMH 5JBCS 1FN6A 3QUMP 2RDEA 4JZDH 5CDFE 3A8DA 1OXGA 1ZHPA 4CRGA 6CHAB 1P2NA 2JDID 4X2VA 1BIOA 3ZVDA 3F2FA 3TPIZ 1H1BA 1FY1A 2RA0A 5E2PA 1T8LA 2BX4A 1P05A 3RXDA 4D9QA 1BTUA 1DITH 4AZ2B 4NA9H 3TGKE 2PW8H 2ZPQA 3CP7A 1GBDA 1RJXB 1GCTB 1GHWH 1MAYA 4FETA 4JYTA 2PGBB 2J98A 4YESB 1NN6A 2PKAB 1OWDA 3KGPA 1LKBA 2WZQA 2O8TA 3H5CB 2PTNA 1TOCB 2TGAA 3RLYH 1HXFH 1UHBA 1FPHH 1J17T 3TNTA 2C8YB 4RKOB 4FU7A 2BVSH 1XVMA 3U8OH 1VITF 3QO6A 1FX0B 3ZZ6A 3U1IB 2BDIA 1MABB 5A8XA 1SGYE 4TSFD 1G3EA 1X7AC 3LGWA 1GDQA 3FANA 1AKSA 1DFPA 5G4BA 1ZPZA 1P06A 1XUFA 3UNRA 4DT4A 1O2HA 2ZU2A 1UMAH 3ZZ3A 1O2GH 4SGBE 4UFGH 1C5NH 2ZQ2A 1ZMNA 2Y5GA 4X2YA 5K7RA 3O8BA 2A2QH 1BCUH 1Z1JA 3EA7A 1BUIA 2A7JA 1C2IA 8ESTE 4UD9H 1K1OA 4AX9H 1FJSA 1S0QA 1KLJH 1YGCH 1A3EH 5EJLA 1RD3B 3UREA 4H6TA 2FM2A 2WINI 1BMAA 1KLIH 4A7IB 1BRUP 3MU4A 4OM9A 3BIUH 1C2LA 1UVOA 2VNTA 1T31A 5EG4A 2FXRA 5E0JA 6GCHG 2H9TH 2QYIA 3EDXB 1XUIA 2G00A 1GI6A 1P04A 1QGFA 2NU2E 4JZEH 3MO3A 4WF8A 1QL8A 3OAAD 3V0XA 2EQNA 4MPWA 3C1KA 2V0BA 1W0JD 4JYVH 1UTQA 2QGRA 2PKSB 1V2TT 2OP9A 3DUXH 1AWHB 2JJ2D 1MD8A 2ANYA 2FS8A 1QZ8A 4GUXA 3SGAE 2CGAA 4K8BA 1N1LA 1GJDB 4AG2A 2PV9B 2FOHA 1ID5H 5FBIA 3AAUA 1KDQB 1K1MA 2A31A 4YM9A 2PTCE 1GJ7B 4P00A 1XM1A 1H8HD 4NA7A 5EOKA 4GAWA 2ODPA 1KXAA 1OWHA 3M5NA 1K1PA 2FZZA 3EQ0H 3VEQB 3RMLH 1BHXB 2JH0D 3GCTG 1PFXC 2VWNA 4NIWA 5A0BA 4JCNA 4ZXXH 2BMGB 1GGDC 1FIWA 4LK4A 3UWJH 4ZCNA 2A4OA 2F9NA 3EA9A 2ZCLP 2XWAA 3PLPA 1GJBB 1SQTA 5HMAA 3SN8A 1ELAA 2V3MA 3LT3A 4B6EA 1HRTH 5IDKA 1TABE 1ZSKA 4UFEH 4KKDA 1JRTA 4X8UH 5DP5A 3JZ1B 3SHAH 2WPMS 2ZO3H 5A0AE 4O3UA 1GI2A 1KSNA 1W0ZU 1WDIA 4Q7XA 2A1DB 2W7SA 5DP3A 3RXVA 1BDAA 3QLPH 3URCA 3TK9A 1GMCG 2ZNKH 3VB3A 3STIA 1QJ7B 1UTKA 4X1SU 1FIZA 1DE7H 5JBAS 5J4QA 1TMTH 2BX3A 1BTYA 4NFEA 3TK6A 4FUEA 2ANWA 3C27B 4NSYA 3P6ZB 3P95A 1BHXF 5FXLA 1Q3XA 2BOKA 3NWUA 4ASUD 3FAOA 1GVLA 3DHKH 3KQEA 1A0LA 3K6ZA 1QBOA 2BOHB 3K2UA 4RKJB 1DVAH 1Z8JB 4I7YH 1G37A 2OC1A 1C4V2 1SGEE 3A87A 4ZHLU 4FXGH 1ZHRA 5C5OA 3E0PB 2F83A 3GY4A 1CBWB 2SNVA 1A7SA 1KXBA 2BD5A 2B5TB 3DT0H 1TONA 2NU0E 3PMHB 5LPFA 5HIZA 2C3SA 5EW1H 1A2CH 3SU1A 3FN8A 3KIDU 1O3NA 2OBOA 4HI3A 1XMNB 4BTTB 3SV7A 5ABWA 1C1TA 2FTLE 5HYOA 4Y8ZA 3EE0B 1C5WB 4CREA 3PTNA 2H6MA 2YMSB 4THNH 4DURA 3HK6B 3ZZAA 3DFLA 4AOQA 1T8MA 4TY6A 2Q6GA 5FL7D 4NZLA 2BTCE 1HJAC 2WUBA 4O3TA 2V6NA 3ENSB 2F43B 4ACAA 2ZHFH 3SZEA 1WAYB 1WOFA 4IBLH 1ZYOA 1Y59T 3I78A 3FZZA 1C1SA 2BQ6B 2ZC9H 3RC6A 1ANBA 2R0KA 4YLQH 5DK1A 1EZUC 1CT2E 2XW9A 4D7GA 3A86A 2GVFA 2OCVB 1A5IA 2RCEA 3UOPA 5E2OA 3SV9A 1EPTA 2FOCA 4MQAA 4K69A 1CO7E 1W7GH 3Q00A 2PHBA 2BY8X 1C1UH 2K1QA 1C1WH 1OHHD 1FN8A 1O5DH 1TNJA 1GGDB 2XNDD 1CT0E 1H8DH 3SZNA 1YBWA 1GCTC 2PGQB 1F5KU 1O2KA 1SGTA 1YCPH 3HKJB 2P3UB 1E38B 4NSVA 1P09A 3BG4C 1IAUA 1GDNA 2VBCA 2OTVA 4AFUA 3ZIAD 2H2ZA 4WMEA 2VIPA 1AI8H 1UTPA 2ZFRH 1TALA 2G4UA 4IMZA 3SYJA 4BNRA 5E8EH 2ZU3A 4J2YB 1SMFE 3B8JA 2ZPRA 2F3CE 2VH0A 4X1PU 4Y0ZE 5I46H 1IQGA 4ZROA 1MKXK 2ZG0H 2AGGX 1L2EA 3QZQA 2F9PA 3UFAA 2A7HA 4RT0A 4GHTA 1FZZA 1OWKA 3U69H 7KMEH 2W3KA 4FUIA 3UQOA 1TGBA 2A4QA 3RXJA 2FOAA 1W14U 3RC5A 1EAWA 1KMHB 1O3HA 4LOYH 3M3SA 4DJZB 2IJOB 1SLVB 1F0TA 3FVFB 4M7GA 2GMTC 4CHAB 2IPQX 2PSXA 3ATMA 2TGDA 5DKMA 2GDEH 1WBGB 2P94A 5DPAA 1KXCA 1TAWA 3OY6U 1UO6A 3A83A 1T32A 3GY2A 1FY3A 4Y8YA 3GY6A 2DUCA 1CGIE 3E0NB 2ZGJA 1XUHA 1HUTH 1C2JA 3TH2H 5FAHA 2ZU4A 1L1NA 1MU8B 2GCTC 1OOKB 1IQJA 4GPGA 1CU1A 1NFYA 1GJAB 1QA7A 2FMJA 1FMGA 3RXMA 1O3KA 1MTUA 1YLNA 2GDDA 1YP9A 8LPRA 2SFAA 3KQDA 2HRVA 4F4OC 1GJ8B 5SGAE 3SOSA 1WSSH 4WXIA 2QV1A 5EXLA 4NA8A 1OX1A 4X1NU 3S7KB 2FIRH 1AU8A 3SORA 2ZHEH 1C5XB 1JMOH 5KEDA 1TGTA 5GIBA 2ESTE 3MTYA 1MAXA 3P8NA 1ELTA 3H7OA 3ZZCA 3SI4H 2KR7A 4B2AA 2TGPZ 1LVMA 4GHQA 1ZTKA 3FZDA 3VB4A 2GV6A 4XOJA 5AFYH 1J16A 1EJAA 1O3GA 1UVSH 3SGBE 1YCPM 1QB9A 3SU4A 1GMHF 4FOUC 3TVJB 3GCNA 3D23A 1TX8A 2PFEA 1PQAA 1ZLRA 2OC8A 2BZAA 3D62A 2F9UA 1GHBG 4AORA 4AG1A 2KX4A 2ZQ1A 2R9PA 1GHZA 3P8GA 2SGEE 5DP8A 4D8NA 3A82A 4B76A 1O2XA 2CJIA 2ZTXA 1P12E 2ALVA 5EGMA 1FI8A 5CHAB 5A8YA 1S84A 1ELDE 1A1RA 3KYFA 3RXRA 1UHBB 1RXPA 2AGEX 1V2NT 1O3DA 4YOJA 1D4PB 2FI3E 1GG6C 2FDAA 2KCYA 3T29A 1V2WT 3LGIA 2I6SA 2PWXA 4I8KA 2WPHS 1VCWA 1O3LA 2G4TA 4Y79A 3TLOA 1OPHB 1AVGH 2YNAA 2F9BH 3DD2H 2WYGA 4NWKA 1RFNA 1TBZH 1T8OA 1GHXH 2XC4A 1LHCH 7LPRA 1K21H 4OS1A 5LPRA 1GCDA 1O3FA 4GCHG 1ELBA 1O3EA 1AD8H 2Z3DA 3MYWA 3QTOH 1TX7A 5C5NA 2ZFSA 2F9VA 1LQEA 2AYWA 3KNXA 4Z6AH 1P2QA 2Y5FA 3F6UH 2NU1E 3AVZA 4A6LA 5J4SA 2ZHWH 3GCOA 4Q7YA 3VFEA 3FP6E 1P9UA 3N99A 1FAKH 1MZDA 1NFXA 3MU8A 4Y7AA 2TIOA 2XTTB 2FYQA 2W26A 3ZVBA 1O5GH 4WH8A 1QFKH 5AVDA 2P3TB 1QA0A 2HALA 3ZZ7A 5TCAA 1C5VA 1DXPA 1WQSA 2C90B 4YOGA 1O2RA 1HAGE 1BTHH 2B0FA 1C2HA 3S9CA 1XUGA 2BD8A 1QQUA 1AQ7A 1P8VC 2AIQA 3OY5U 1GJCB 1KIGH 4CRCA 1LVYA 1ZPBA 2W6ID 2A4GA 3ZZ8A 5L2YH 2WYJA 1YPGH 4AC9A 1D3PB 1PQ5A 3RXQA 3SBKA 1DUEA 4DT7B 2GZ9A 1JRSA 1K28D 5JBTA 1BBRK 2BY7X 1GMCF 3NK8A 2GZ7A 2ZFFH 6ESTA 3LJJA 5TCCA 1G9IE 5HXFA 4RN6A 3S69A 3ZZ4A 1MBQA 1C5YB 3RU4D 1ZTLA 5EXNA 4O97A 4K3JA 1NRRH 3M7TA 1D3QB 1O3BA 1DSTA 5KECA 1LDTT 3TJNA 2ZGHA 1VKYA 1BRAA 4ABJA 1SLUB 1TMBH 2R0LA 1AKSB 2ANKH 3M3VA 1G36A 3GOVB 2UWLA 1LVBA 2HNTE 2JKHA 1OWIA 3SNDA 4JZFH 2XRCA 4WMFA 4AFSA 1CHOF 4NIYA 1ZMJA 3OFND 1EAUA 4INKA 1HAOH 2STAE 1FONA 2PR3A 1ESBA 4SGAE 1ZR0A 1GJ5H 2V35A 1SGFG 2Z9IA 3LPRA 4IN2A 1TNIA 1KLTA 1EPTC 2OQ5A 3TJVA 1V6DA 2O8WA 3ELAH 1BQYA 4ABAA 1SLXB 1KYNA 2ZDMA 4ABBA 2FPZA 5L30H 2HPQH 3LIWA 3G01A 3A7YA 5GCHG 1C2FA 5DN6D 1QBNA 2YNBA 2AERH 2FO9A 4ABGA 3OYPA 1MBMA 2OK5A 1BRBE 1MQ5A 4X1RU 4XBBA 1P2MA 2Y7XA 1O32A 1DM4B 4YT7H 1O33A 1NFWA 3OX7U 5BRRE 3T25A 4IS5A 4R0IA 5CHBA 2G81E 1DLEA 2WSSD 3SUEA 2OD3B 3GY7A 5C1YA 3ZZDA 1ZGVA 4F55A 3TIUA 1V2KT 2QE7D 2P93A 2W5EA 1V2RT 3V12A 2FX6A 3M5OA 2AHME 1TNKA 1JXPA 5C67A 3KQBA 4X0WU 3M36A 2YOLA 3BTME 2HNTC 4BXSA 1P02A 2P59A 1B5GH 1C5MD 2K0QA 3FKSD 1HXEH 3T62A 1AN1E 2SGAA 1WTHD 3FOAA 1GDUA 3BEIB 3FO8D 4CR5A 2Y6TA 3KQCA 1KXFA 4NGAH 7GCHF 1NBMD 1C5SA 1YM0A 1V2ST 2J9NA 4Q4LA 5TJXA 2P16A 1QB1A 3L3TA 1YCPK 3N7OA 1AZ8A 5L6NH 5HIYA 3VG8A 4GCHF 1KTTB 1MQ6A 4Q80A 3A85A 3MU0A 1UTOA 5HM9A 1O3JA 6CHAC 1F5LA 2UWPA 4B73A 4ZHMU 2O8MA 5EQRA 1AUTC 3JZ2B 2VIQA 1GBTA 3LGUA 4ZH8A 1PPFE 3RP2A 2QXIA 4K2YA 1VGCC 2BQWB 1TX6A 2FYRA 3D49H 1VJAU 1VITG 2BD4A 4CBNA 1TIOA 1ZPCA 1MKWH 2WPJS 3TU7H 3BN9A 1XXFA 3SHCH 1TRNA 1QQ4A 2CN0H 3BTDE 4KELA 1O3AA 3SJ9A 1DWCH 5EPNA 2C4FH 3F9FA 3SUFA 2QY0B 1J15A 4DIHH 1NO9H 1SQOA 4CRDA 1OP0A 1GHAG 1S82A 1BJUA 2Y80A 2JETC 4MVNA 1QJ6B 1P2JA 3PTBA 4LZ4B 2ZFPH 1J9CH 1DUAA 1Y5AT 3M7UA 3RXSA 3UIRA 4Q7ZA 2B7DH 2A5AA 3GISB 1C1QA 3RLWH 1FXYA 1D3TB 2GTBA 2J34A 4I32A 1H9HE 3W1EA 3HK3B 1SGIB 3Q77A 1T4UH 1E36B 1UTLM 2G8TA 3ZVEA 3UWIA 1DWEH 1BJVA 1CHOG 3VXFH 3DSGA 2G55A 3S7HB 3MI4A 5A8ZA 3QK1A 2SGFE 3VB5A 3GDVA 3TJUA 3BG4B 2ZI2H 1O2YA 1MH0A 1RTFB 3MH6A 2ODYB 4HGCA 3O8RA 3E16B 2KAIA 3W95A 2AFQB 4Y7BA 3LGTA 5DSFA 2KFWA 1TQ0B 2STBE 3DSOA 1QTFA 4B71A 1ZSLA 3RXLA 2Z3EA 3ESTA 1G3DA 1EAIA 1ZGIA 2FOGA 3UPEA 1NBME 5C1XA 2GZ8A 1MCTA 1C5QA 1HIAB 3QTVH 4E7RG 2R2MB 1UJ1A 2GX4A 2CHAB 1C5OH 3N7DA 3K9XB 1THPB 3E90B 1P11E 4DIIH 2WHXA 1BOQA 4QT8C 3GS9A 1CGHA 4BAOB 1EOLA 1O39A 3ATIA 1HAHH 1PJPA 1TQ7B 3Q3XA 1GBKA 3DCLA 3ODFA 3RM0H 2BD3A 1N8OB 1A4WH 2A5IA 2FLBH 3KEEA 1Z8IB 3A7XA 4FUGA 4IW4E 4BTIB 3SU3A 1XKBC 3UY9A 1QRWA 1GBFA 2P8OC 4FUJA 3BTGE 1UVUH 3HPTB 3F9HA 1OP8A 5JPMH 1A0JA 3AW1A 3F1SB 3RMNH 1GL0E 2IJD1 5I25A 3SU5A 1E37B 4K1SA 5JB8S 1SGQE 4Y10E 2EEKA 1DSUA 1ELGA 5EIYA 2W7UA 1IQIA 3MU5A 1EKBB 3U9AH 1OYTH 1EJNA 1W8BH 4IN1A 4XSKU 2THFB 1G2LA 1B0EA 1TNGA 1L1JA 2GCTB 1W10U 1BMMH 3BTTE 4FUBA 5T6FA 1FNIA 2WV4A 1SFQB 1MTNC 5T6DA 2W3IA 1EZQA 3PB1E 3M5MA 1Z1IA 4YLUA 4ABEA 1SG8B 3SV8A 4Y8XA 3U1JB 2Z94A 1V2MT 2WUCA 4O03A 2AIPA 1ZOMA 4Y6DA 4Y76A 2VVCA 1DX5M 3ZZBA 2GCHF 4LXBH 2ZDAH 5GPIB 1O2JA 4A1TA 3M5LA 1L0ZA 1SSXA 1G2MA 1O30A 1KY9A 2BVRH 2VGCC 4K8YA 1ETRH 2HWLB 5T1VA 2ZDKA 1AB9C 4WWYA 1K1LA 2FEQH 1P3CA 2NU4E 5LGOA 2ZGBH 1M9UA 3A88A 1SI5H 2DE9A 3AASA 2BD7A 2BDGA 2BLOA 1GHBF 2ZTYA 1Y8TA 1O2UA 2PUQH 1A0HB 2ZGCA 4H4FA 1O34A 4U32A 2GMTB 1EAXA 1O0DH 2H5CA 1NRQH 2M5TA 2PUXB 1RTLA 1YPHE 4ACBA 3MWIU 3KYGA 3SI3H 4ZKOU 1CQQA 5DP4A 2LPRA 5GXPA 2A0QB 2A5KA 1K0HA 1ZHMA 4WMDA 3SNAA 3LGVA 3ZYEA 2W6JD 4E05H 1TOMH 3MH4A 4MNXA 2D26C 2WV5A 4BAKB 1QBVH 1PPHE 1O3PB 1PYTD 3GCHC 1ELFA 2ZF0H 1O2QA 1A3BH 1D9IA 2OINA 4DY7B 1TGNA 1WU1A 1XVOA 2CV3A 2A32A 3UR9A 1MMJN 4DVAU 2XC0A 5EJZA 1VR1H 4MDSA 7ESTE 1TRYA 1CBWC 1BBRE 2A2XH 1F92A 1TRMA 3MU1A 1SVPA 2B9LA 1BTPA 1NRSH 3F0OA 1COWD 1TLDA 1HAYB 1EJMA 1W0YH 1C4U2 1PPZA 1YKTA 1O36A 2J97A 5C1UA 5C0TA 1XXDA 5ETXA 1GMDF 2TBSA 1HAPH 2F91A 3ZVFA 4FVBA 1HJ8A 1SGNE 1SOTA 5C3NA 2VB0A 2HVXA 3DA9B 2GGVB 2Z7FE 3WWBA 2YMSC 3F2HA 1YYY1 2BZ6H 1AZZA 3MNCA 1FQ3A 1GPZA 1K1NA 4ABHA 1AFQB 1YF4A 2P8OB 1D3DB 1W11U 1YPHC 2ZCHP 4ABIA 1OSSA 2AGIX 3PO1B 3PO1C 3OEED 2ZGXH 3O8CA 1YPEH 2ZEBA 4NZQA 1WV7H 2PP6A 1WXRA 3T2NA 1KXDA 3SJOA 1WUNH 3SJ8A 4XE4A 1H9IE 5HM2A 1IQMA 4UDWH 2SGPE 1SR5C 3CS7A 3B23B 1ELCA 3RXAA 1O3IA 3BTQE 1YLCA 2QF5A 3SNBA 4I86A 1JBUH 1Y3YA 1ZZZA 3L6PA 4D7FA 3H7TA 2WPDD 1H8ED 2FS9A 3KQ5A 1ZRKA 4CR9A 1EZSC 3SUDA 1EQ9A 2CF9H 3F9GA 3RXHA 1QURH 3RXTA 2V3HH 3GY8A 1CSOE 3WW7A 3S0NA 1SQAA 1HPGA 1S85A 2VWLA 3A81A 3F9EA 3TGJE 3ZYDA 4JK6A 3NRLA 1GBHA 1ORFA 4UFFH 2JIZD 6GCHF 1ESTA 2BHGA 1SHHB 4YOIA 1O5EH 1LKAA 1K2I1 1QCPA 3RU4T 1IHTH 1GJ6A 3TNSA 2AS9A 2L74A 1SGPE 3PRBA 5JYIA 2ULLA 1HAZB 3RU4E 2ASUB 4AB8A 3ATKA 1QY6A 1TPAE 2SGDE 2Z9GA 4OS4A 1O5FH 5ESBA 3M35A 4KTSA 1Y3UA 2G5VA 1EOJA 1DS2E 2VU8E 5FHTA 2GT7A 3PV2A 3UUZA 1Z71A 3LKWA 2P95A 2QF4A 3F0PA 4HTCH 3TJOA 1O5BB 1UTNA 3GCHB 3LH1A 5DG6A 2HLDD 2BDBA 3A89A 2EI6A 2GV7A 4CH8B 2JH6D 1AGJA 1B7XB 1E35B 1O38A 3ZVCA 1TFXA 3MO6A 3VB6A 1B0FA 1C9TA 3VB7A 2V7QD 3QZRA 3U98H 1EFRD 1AE5A 3SV6A 3S9AA 3RXBA 3ATWA 1NM6A 3VGCB 4CH2B 1KTSB 5DO4H 3PWBA 1VGCB 2ZZUH 3A84A 2KZ4A 2EC9H 1MCVA 1PPGE 2FX4A 1DWDH 2NU3E 5DP9A 1DDJA 3LC5A 5H4IB 2Y5HA 5C0UA 2BY5X 3SUGA 2C8ZB 2FI4E 3E1XB 4OGYA 1C1OA 3ATLA 1CHGA 1LTOA 2XBWA 1ZRBA 4RI0A 4AFQA 4AFZA 1QR3E 5LH8A 3SNCA 4I8HA 1FY5A 3CNRA 4TYDA 4X6PA 5DJ7A 3R0FA 1HLTH 4VGCB 2ZFQH 1EASA 2XXLA 1EATA 1HIAA 1K22H 1GL1A 2EY4C 3GYLB 3OSYA 4ASHA 3NCLA 5K0HA 5C94A 1BTXA 1YY3A 5FX6A 2VGCB 2I6QA 2IPHA 4X6NA 1GBBA 5HGGA 1LQDB 2ZHQH 3R3GB 2AH4X 4GSOA 2WPLS 3KN2A 1O5CB 2SNWA 3ZVAA 1BT7A 4TWWA 1QB6A 3Q3KA 1UCYH 1T8NA 1NRNH 2VVVA 1GI4A 1ANDA 2EI8A 4CRAA 1H8IH 4ZMAH 1MTWA 4K1EA 1GG6B 1O3OA 3ZZ9A 3PWCA 1AO5A 1TPSA 4H6SB 1V2QT 1VCQA 3HATH 4A92A 4NCYA 1AFQC 3RXCA 1NU7B 2XWBI 1FUJA 3U28C 6LPRA 4OS7A 1GVZA 3A7TA 1K9OE 1LHFH 1DY9A 3PROA 4MNVA 5EU8A 1C5TA 1TA2A 1Z8GA 1BTWA 8GCHG 1C1VH 4B2CA 2H5DA 1BTZA 1CE5A 4ISIH 3OEHD 4K1TA 1S6FA 2UUKB 2H9EH 3FFGA 2WPKS 2FI5E 3MHWU 3P70B 2XCFA 1F0SA 3P17H 3M37A 3V3MA 2HGTH 3K65B 4DCDA 2KCOA 3VPKA 3T5FH 1YPKH 2A7CA 1HV7A 2D1JA 5A2MH 1E34B 3BTWE 3E91A 1QL9A 3SJIA 3RXOA 4FUCA 1NTPA 3ODDA 2QXHA 4XBDA 2OXSA 1TWXB 2HOBA 2VJ1A 2B8OH 2O9QA 4OS5A 1DANH 3BV9B 1MTVA 2ALPA 3QWCH 1DOJA 1GBEA 2Z9LA 1O2NA 2UUYA 3A8AA 1MKWK 4MLFB 3PM3A 2Q1JA 1GI8B 5JBBS 3KCGH 2CHAC 4R8TB 2ZDLA 3P8OA 1BBRH 1P57B 4A1VA 1LPGB 3MH7A 1O31A 5AF9H 5T3HA 1ARBA 2VIDA 5DGJA 5E0HA 1P9SA 2FESH 4JZIA 1BMFD 1UK2A 2BLVA 1U6QA 3GDSA 4WY3A 1C1NA 4Y0YE 5EXMA 2BM2A 3OTJE 5FPYA 1SGCA 1IQNA 1RS0A 1GJ4H 1DICA 3LH3A 4BOHA 1Z6JH 2LELA 1CVWH 1GMHG 3UOUA 4HZHA 1THRH 3OU0A 4DOQA 3F2GA 2J5UA 3PV4A 2OC7A 4ISLA 2Z6BD 3W94A 3MO9A 4H42U 2HLCA 1QIXB 2AMPA 1NU9A 3ZVGA 3RUOA 1P2OA 1HB0B 1DY8A 3I77A 3AK5A 1WYKA 5F8TA 3LONA 4JK5A 1IQFA 3SU6A 3TH4H 1N6XA 1XUKA 1SFIA 2A45B 1S5SA 3CENA 1ZMLA 3LDXH 1ANCA 3U8RH 1BRCE 1UK3A 3SQHE 1GBIA 5JDUB 3SJKA 1E0FD 4NWLA 2KAIB 2QF0A 4CBOA 5FPSA 1VZQH 1O2VA 1V2JT 3E6PH 3KHVA 3SGQE 3ITIA 3LC3A 3HGPA 1Y5BT 1WCZA 1ANEA 1TNHA 2AEIH 1TBQH 1V2OT 3URDA 1ZTJA 3HGNA 2H1UA 4FUDA 3IITA 3WY8A 1FPCH 3A7WA 2TGTA 1W3CA 1F2SE 4X8TH 1CA0C 1GHVH 1TB6H 1SB1H 1C1RA 1S83A 2O8UA 3RXEA 4JMYA 3T28A 1EUFA 3EAJA 4AGJA 3B9FH 1GI5A 3P8FA 1LHDH 1PYTC 5GWZA 1C2GA 2PLXA 3A80A 1DPOA 3A7VA 4WJG2 5GDSH 1J14A 3F68H 1HYLA 4CRBA 1W7XH 2QCYA 2GD4B 3GCTF 4ABFA 4BXWA 5EJ1A 1KXEA 1AY6H 1BB0B 4ISNA 1SOZA 3PMJA 4I8GA 1O2TA 1P0SH 1Q31A 1P03A 2D8WA 5GNDA 1P2IA 2BXUH 3SNEA 1FY8E 3V13A 2D2DA 2J38A 3GICB 4XRNA 1IQKA 1MZAA 2OUAA 3RXKA 3M3TA 1S0RA 2LP6A 2VWMA 1D6WA 2G5NA 2H9HA 2HPPH 1TPOA 4FUHA 1CT4E 2F4LA 2R3YA 3BTHE 4BANB 1ZJKA 1SLWB 2Z9KA 4ESTE 1V2UT 4ZKNU 2J95A 2Q6FA 3LJOA 1A5HA 3TGIE 1AMHA 1TPPA 1HDTH 3A8CA 4I8LA 1QHRB 3QGJA 2ZP0H 1N8OC 1HJAB 2ZDNA 4FU9A 1LCYA 1GWAA 1G3CA 5C2ZA 3UAIC 2CK3D 4XFQA 1AHTH 1QRZA 1EB1H 3Q76A 3TH3H 1ACBE 3BF6H 4P02A 2R3UA 4KGAA 4ISOA 1LHGH 5EQSA 1GHYH 3GY5A 4OS2A 3QN7A 1IQLA 4DW2U 3PMAB 2V3OH 3BSQA 1SC8U 3L33A 2UUJB 3BTFE 4VGCC 4X2XA 4IC6A 1JIMA 1HBTH 1KDQA 1C4Y2 1VCPA 4YT6H 2CMYA 5F6MA 1C9PA 1C5PA 3NUMA 4AB9A 5C17A 2BQ7B 7GCHG 1HAVA 3PMBB 4B1TA 1O3MA 2XBXA 1HNEE 1OP2A 5E0GA 1MD7A 5FX5A 3MNBA 1V2VT 1P3EA 1GI9B 3HKIB 1BA8B 4OGXA 4Z0KA 4D9RA 3A8BA 8GCHF 2JETB 2QF3A 4ZHAA 4NIVA 2AMDA 1AVXA 1MKXH 2BDCA 9ESTA 2VWOA 5HKKD 2TRMA 1HGTH 1OYQA 3KL6A 1A46H 4HG6A 1F0RA 1NS3A 2Y82A 1LPZB 4Y71A 2OQUA 3V7TA 1QNJA 1E1QD 1A5GH 3UTUH 4I33A 3DFJA 4I31A 4INLA 2VINA 4MPXA 5AFZH 4PROA 3Q3YA 4Z1MD 2J2UA 1O2MA 2QXJA 2BD2A 2Z9JA 2FTMA 2PKAA 2LNCA 3QDZB 1GMDG 1O2IA 2ZECA 4UE7H 1EP6A 3EGKH 1S6LA 4B74A 1O2WA 3RDZA 2KCPA 3EE7A 5GCHF 3FP7E 3PLBA 8KME2 2OBQA 1O2LA 5JB9S 1YPMH 2FLRH 4FU8A 1JIRA 1GBCA 4BAQB 2BYAX 1S81A 1NRPH 4B2BA 4X1QU 2QA9E 1O35A 3SU2A 1J8AA 2WV9A 4I8JA 1SGFA 5A09A 1QJ1B 3BEFB 4KP0A 5IK2D 1RTKA 1O2PA 2VH6A 1RRKA 3E3TA 4IMQA 2VIVA 3SW2B 3NZIA 5EPYA 1G3BA 1XKAC 3LOXA 1BZXE 1P2KA 3RC4A 1THSH 1TYNA 1YWUA 2XCNA 1BITA 4BAMB 4U2WA 1Z6EA 4X6MA 4GVUA 3A7ZA 4Y11E 1W2KH 1HAIH 2FWWA 1EXFA 2UWOA 1C2KA 2Q6DA 1IHSH 2Z3CA 4INHA 3KF2A 2WPIS 2XBVA 1F7ZA 4YZUA 3LU9B 1NY22 3RXGA 3BTEE 1FY4A 5CE1A 3TK5A 2IN2A 3P92A 2BY9X 5F8XA 3D65E 5AHGH 1BMNH 1AWFH 1NROH 4MG3A 2RG3A 1DWBH 3PYHA 4TT3D 4DGJA 4Q2KA 2FP7B 3S9BA 1P01A 4LZ1H 2QC2A 2ZTZA 2ZA5A 2IOTA 2F9OA 1SQRA 1ZJDA 1UW7A 3RMOH 4AYVB 1BMLA 2M2AA 3MQKC 4WXVA 1VITH 1C2EA 4NG9H 1EPTB 5T6GA 5CHAC 2BDHA 1OWEA 3AAVA 2Y7ZA 4CRFA 1TE0A 2HVYB 1ESAA 2ZU5A 1FDPA 3N7EA 3E8LA 4B75A 3EYDA 4DG4A 1EB2A 1GBAA 1LVOA 1F0UA 4UONA 1K1JA 1TBRH 5GJ4B 1ETTH 1EZXC 3BEUA 4HFPB 3VGCC 2RDLA 1OWJA 2QIQA 5KGOA 4AGKA 1UVTH 1Z7KA 1RGQA 4KTCA 4ZAEA 5PTPA 3ZV8A 1CA8B 1P10A 4FUFA 1A61H 4E06H 2BLWA 1GI1A 2K8IA 4IC5A 2XBYA 1L4DA 3IG6B 4TY7A 1C1MA 5DP6A 1YC0A 1Y3XA 1NT1A 3PV5A 2FOBA 1HFDA 1H9LB 2OC0A 2BXTH 5IYTA 1GBMA 1V2PT 2C93B 5EQQA 3RXUA 1XUJA 2NWNA 1S6HA 1F5RA 2FOMB 2SGQE 3SQEE 1PPCE 2O8LA 2EA3A 2QAAA 4IGDA 4MTBA 1L4ZA 3NXPA 2ZFTA 1O3CA 2BB4A 5F03A 4GLYA 1HJ9A 4MPVA 5FBEA 2GP9B 4ZUHA 2J92A 2BLQA 3IWMA 2VIWA 1ARCA 4WVPE 3M61U 3SV2H 5LPEA 5EODA 1SGRE 1ETSH 4U30A 1DLKB 1TA6A 3OTPA 3RM2H 1C5UA 2CF8H 2ZCKP 3SO3A 1N6YA 2ZIQH 2ZDVH 4X2WA 4K60A 1TGCA 2GT8A 1NZQH 1DT2A 2JH5D 3PLKA 1G30B 3MMGA 4Q63A 1HAVB 4MPUA 5F53A 1GI0A 3TITA 3UR6A 1C5ZB 1LO6A 1AB9B 4A1XA 5B6LA 3QGNB 4MNYA 1MTSA 2HNTF 2C8XB 1T7CA 4CHAC 1IOEA 1O2ZA 1GBLA 1OKXA 3MNXA 1AVWA 4RT1A 2BD9A 2TPIZ 1ELEE 5ESTE 1LMWB 4BAHB 4X6OA 4UFDH 2G52A 1YLDA 3CS0A 1QL7A 1UCYE 3BIVH 1PQ8A 4M9FA 4J1YA 4D76A 3U8TH 1GVKB 1C1PA 1GBJA 3OE7D 2XC5A 3MNSA 3FP8E 1SL3A 1QRXA 1Y3VA 1CGJE 1IQEA 2ANMH 4RSPA 4FVDA 1MU6B 1AFEH 3RXPA 4TWYA 3ZZ5A 4XD7D 1EP5A 3MH5A 1O37A 1NFUA 1NC6A 1INCA 2A4RA 2CXVA 4X8SH 2BY6X 1IQHA 2KCAA 1C5LH 2UUFB 1Z8RA 1JOUB 1W13U 2XYAA 4ZXYH 2QN5T 1XX9A 1V3XA 1SPJA 1GI3A 3RXIA 1JWTA
chains in the Genus database with same CATH topology
3SU0A 3ZIAD 4B76A 3N7DA 3E90B 3SUDA 3PV5A 4B6FA 3SYJA 3VG8A 2WHXA 2OC0A 3F3BA 3GS9A 1RTLA 2LELA 5EQQA 2F4LA 2FM2A 4ASUD 3SU2A 3DSPA 1A1RA 3WW7A 3F2GA 2J5UA 3DCLA 3KN2A 2XNIA 2FOMB 2OC7A 2WV9A 5FPTA 1BT7A 5IK2D 4B73A 4OM9A 2O8MA 2XOKD 3KEEA 1DXWA 2OC1A 5EQRA 2YMSD 3NRLA 5EPYA 1DY8A 1W0KD 3LOXA 2W6JD 2KCYA 2JIZD 3RC4A 3SU3A 2XCNA 2A4QA 3AK5A 2CK3D 3RC5A 3UB0A 1KMHB 5CDFE 3OFND 4A92A 3LONA 2IJOB 3SU6A 4WF8A 3OAAD 2JDID 4NWKA 2OINA 5EQSA 5FPYA 3PRBA 1E79D 3F2FA 1DY9A 2IJD1 4NWLA 3SU1A 1E1RD 3FN8A 5EPNA 2OBOA 3SU5A 1W0JD 3KF2A 3OTPA 5FPSA 3SV7A 3SUFA 3OEHD 2JJ2D 5ESBA 2YMSB 2F9VA 2XCFA 4FETA 4Q63A 3F0OA 5C17A 1COWD 5F53A 3KNXA 4K8BA 4A1XA 1N1LA 5FL7D 5B6LA 3O8DA 5DN6D 2KCOA 3OYPA 1CU1A 3PV2A 4TT3D 2OK5A 2FP7B 3LKWA 2QF4A 3F0PA 5C0TA 2F43B 5ETXA 1W3CA 2HLDD 3SZEA 3N99A 2WZQA 3RC6A 2M2AA 4YXWD 5IDKA 1H8HD 2GGVB 5CHBA 3WWBA 2WSSD 2YMSC 3F2HA 4I32A 4WH6A 3M5MA 4JMYA 2QV1A 4WH8A 3SUEA 3SV8A 3W1EA 2V7QD 3M5NA 1EFRD 4F55A 5HKKD 3U1JB 3SV6A 2QE7D 4U01A 2GVFA 3N7EA 1DXPA 3H09A 1FX0B 3PRDA 3U1IB 4M9FA 4B75A 3EYDA 3SV9A 3OEED 3WWFA 4ZCNA 3P8NA 3M5OA 1MABB 3O8CA 1NS3A 2AHME 2KZ4A 2KR7A 1JXPA 3OE7D 4TSFD 5GPIB 4A1TA 3M5LA 1WXRA 1E1QD 2K1QA 2YOLA 5H4IB 5GJ4B 4I33A 4R8TB 4B6EA 2W6ID 2A4GA 4I31A 3P8OA 1OHHD 5C0UA 2P59A 3SUGA 3O8RA 2K0QA 4A1VA 5T1VA 3FKSD 3SU4A 4Z1MD 4DT4A 4XD7D 2XNDD 4RI0A 5DSFA 5GNDA 2KFWA 2A4RA 3FOAA 2KM0A 1SKYE 3DSOA 4B71A 2KCAA 3FO8D 2OC8A 1RGQA 4KTCA 1S6LA 4TYDA 2F9UA 1BMFD 2JJ1D 4B74A 2L6OA 2QF5A 2K8IA 2KCPA 1NBME 1NBMD 3L6PA 3O8BA 2VBCA 2OBQA 2WPDD 1H8ED 4Q4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0U A;  3F0P A;  3F0O A;  3F2F A;  5C0T A;  5C17 A;  3FN8 A;  3F2G A;  5DSF A;  3F2H A; 
#chains in the Genus database with same CATH topology
 3SU0 A;  2RA3 A;  1YPL H;  1FV9 A;  1GHA F;  2ZKS A;  4A5T S;  1ABJ H;  2ODQ A;  1TGS Z;  2BVX H;  4NIX A;  1TNL A;  1Y5U T;  1CA0 B;  1LPK B;  4ABD A;  1SBW A;  1K1I A;  1MTN B;  5FPT A;  4F48 B;  3VXE H;  4XBC A;  4AN7 A;  3QX5 H;  2FOE A;  3MFJ A;  1C5R A;  1DXW A;  5FCK A;  1W0K D;  1PPE E;  1UK4 A;  2GCH G;  2R2W U;  2EI7 A;  3NPS A;  3UB0 A;  1OS8 A;  3BG8 A;  5BPE A;  1E79 D;  1AE8 H;  3M7Q A;  1E1R D;  2J4I A;  1O2S A;  1H4W A;  4BTU B;  3I29 A;  4AYY B;  2VVU A;  1AIX H;  2C8W B;  1T4V H;  3K6Y A;  4F49 A;  1O5A B;  3T27 A;  2J94 A;  4O9V A;  2G51 A;  2FOD A;  5F8Z A;  3BTK E;  4KTU A;  1NES E;  2PSY A;  4JYU H;  4X8V H;  4ZKR U;  2QXG A;  5A0C A;  1ABI H;  4ISH H;  1HAX B;  2Y81 A;  2VIO A;  4YXW D;  1GI7 B;  4UEH H;  3MOC A;  4WH6 A;  3EA8 A;  1L1G A;  3UQV A;  1VJ9 U;  3LGY A;  2OLG A;  1FAX A;  4U01 A;  3NKK A;  3H09 A;  3PRD A;  1AUJ A;  3WWF A;  4TPY A;  1RIW B;  5C20 A;  2ZHD A;  1G32 B;  1O2O A;  1PPB H;  2BDY A;  2GKV E;  1FLE E;  1C2M A;  5EW2 H;  2FOF A;  1RIW C;  9LPR A;  1Y3W A;  4YO9 A;  1Q2W A;  1C2D A;  5B6O A;  3GY3 A;  1YPJ H;  4NFF A;  2DE8 A;  1TMU H;  1SKY E;  2KM0 A;  4E7N A;  1MUE B;  5DP7 A;  4YTA A;  4MNW A;  4ZKS U;  4TPI Z;  2JJ1 D;  2ZU1 A;  3GYM A;  1WQV H;  2L6O A;  2AMQ A;  2J98 B;  3ZV9 A;  3UNQ A;  1WTG H;  3O8D A;  1LHE H;  1UTJ A;  1D6R A;  2ZPS A;  1EX3 A;  2ZWL H;  2GJG A;  1SGD E;  3T26 A;  1PQ7 A;  3AW0 A;  2ILN A;  4B6F A;  2PKS C;  1W12 U;  3F3B A;  4JZ1 A;  1HCG A;  3UNS A;  3DSP A;  3STJ A;  2BDA A;  2P3F H;  5L2Z H;  2XNI A;  4XDE A;  1GJ9 B;  1SHY A;  5CMX H;  1ELV A;  1UVP A;  1UCY K;  4OS6 A;  2XOK D;  1ZSJ A;  2YMS D;  1V2L T;  4K5Z A;  1UTM A;  2RFK C;  1NPM A;  3GDU A;  5FCR A;  3RXF A;  3RMM H;  5JBC S;  1FN6 A;  3QUM P;  2RDE A;  4JZD H;  5CDF E;  3A8D A;  1OXG A;  1ZHP A;  4CRG A;  6CHA B;  1P2N A;  2JDI D;  4X2V A;  1BIO A;  3ZVD A;  3F2F A;  3TPI Z;  1H1B A;  1FY1 A;  2RA0 A;  5E2P A;  1T8L A;  2BX4 A;  1P05 A;  3RXD A;  4D9Q A;  1BTU A;  1DIT H;  4AZ2 B;  4NA9 H;  3TGK E;  2PW8 H;  2ZPQ A;  3CP7 A;  1GBD A;  1RJX B;  1GCT B;  1GHW H;  1MAY A;  4FET A;  4JYT A;  2PGB B;  2J98 A;  4YES B;  1NN6 A;  2PKA B;  1OWD A;  3KGP A;  1LKB A;  2WZQ A;  2O8T A;  3H5C B;  2PTN A;  1TOC B;  2TGA A;  3RLY H;  1HXF H;  1UHB A;  1FPH H;  1J17 T;  3TNT A;  2C8Y B;  4RKO B;  4FU7 A;  2BVS H;  1XVM A;  3U8O H;  1VIT F;  3QO6 A;  1FX0 B;  3ZZ6 A;  3U1I B;  2BDI A;  1MAB B;  5A8X A;  1SGY E;  4TSF D;  1G3E A;  1X7A C;  3LGW A;  1GDQ A;  3FAN A;  1AKS A;  1DFP A;  5G4B A;  1ZPZ A;  1P06 A;  1XUF A;  3UNR A;  4DT4 A;  1O2H A;  2ZU2 A;  1UMA H;  3ZZ3 A;  1O2G H;  4SGB E;  4UFG H;  1C5N H;  2ZQ2 A;  1ZMN A;  2Y5G A;  4X2Y A;  5K7R A;  3O8B A;  2A2Q H;  1BCU H;  1Z1J A;  3EA7 A;  1BUI A;  2A7J A;  1C2I A;  8EST E;  4UD9 H;  1K1O A;  4AX9 H;  1FJS A;  1S0Q A;  1KLJ H;  1YGC H;  1A3E H;  5EJL A;  1RD3 B;  3URE A;  4H6T A;  2FM2 A;  2WIN I;  1BMA A;  1KLI H;  4A7I B;  1BRU P;  3MU4 A;  4OM9 A;  3BIU H;  1C2L A;  1UVO A;  2VNT A;  1T31 A;  5EG4 A;  2FXR A;  5E0J A;  6GCH G;  2H9T H;  2QYI A;  3EDX B;  1XUI A;  2G00 A;  1GI6 A;  1P04 A;  1QGF A;  2NU2 E;  4JZE H;  3MO3 A;  4WF8 A;  1QL8 A;  3OAA D;  3V0X A;  2EQN A;  4MPW A;  3C1K A;  2V0B A;  1W0J D;  4JYV H;  1UTQ A;  2QGR A;  2PKS B;  1V2T T;  2OP9 A;  3DUX H;  1AWH B;  2JJ2 D;  1MD8 A;  2ANY A;  2FS8 A;  1QZ8 A;  4GUX A;  3SGA E;  2CGA A;  4K8B A;  1N1L A;  1GJD B;  4AG2 A;  2PV9 B;  2FOH A;  1ID5 H;  5FBI A;  3AAU A;  1KDQ B;  1K1M A;  2A31 A;  4YM9 A;  2PTC E;  1GJ7 B;  4P00 A;  1XM1 A;  1H8H D;  4NA7 A;  5EOK A;  4GAW A;  2ODP A;  1KXA A;  1OWH A;  3M5N A;  1K1P A;  2FZZ A;  3EQ0 H;  3VEQ B;  3RML H;  1BHX B;  2JH0 D;  3GCT G;  1PFX C;  2VWN A;  4NIW A;  5A0B A;  4JCN A;  4ZXX H;  2BMG B;  1GGD C;  1FIW A;  4LK4 A;  3UWJ H;  4ZCN A;  2A4O A;  2F9N A;  3EA9 A;  2ZCL P;  2XWA A;  3PLP A;  1GJB B;  1SQT A;  5HMA A;  3SN8 A;  1ELA A;  2V3M A;  3LT3 A;  4B6E A;  1HRT H;  5IDK A;  1TAB E;  1ZSK A;  4UFE H;  4KKD A;  1JRT A;  4X8U H;  5DP5 A;  3JZ1 B;  3SHA H;  2WPM S;  2ZO3 H;  5A0A E;  4O3U A;  1GI2 A;  1KSN A;  1W0Z U;  1WDI A;  4Q7X A;  2A1D B;  2W7S A;  5DP3 A;  3RXV A;  1BDA A;  3QLP H;  3URC A;  3TK9 A;  1GMC G;  2ZNK H;  3VB3 A;  3STI A;  1QJ7 B;  1UTK A;  4X1S U;  1FIZ A;  1DE7 H;  5JBA S;  5J4Q A;  1TMT H;  2BX3 A;  1BTY A;  4NFE A;  3TK6 A;  4FUE A;  2ANW A;  3C27 B;  4NSY A;  3P6Z B;  3P95 A;  1BHX F;  5FXL A;  1Q3X A;  2BOK A;  3NWU A;  4ASU D;  3FAO A;  1GVL A;  3DHK H;  3KQE A;  1A0L A;  3K6Z A;  1QBO A;  2BOH B;  3K2U A;  4RKJ B;  1DVA H;  1Z8J B;  4I7Y H;  1G37 A;  2OC1 A;  1C4V 2;  1SGE E;  3A87 A;  4ZHL U;  4FXG H;  1ZHR A;  5C5O A;  3E0P B;  2F83 A;  3GY4 A;  1CBW B;  2SNV A;  1A7S A;  1KXB A;  2BD5 A;  2B5T B;  3DT0 H;  1TON A;  2NU0 E;  3PMH B;  5LPF A;  5HIZ A;  2C3S A;  5EW1 H;  1A2C H;  3SU1 A;  3FN8 A;  3KID U;  1O3N A;  2OBO A;  4HI3 A;  1XMN B;  4BTT B;  3SV7 A;  5ABW A;  1C1T A;  2FTL E;  5HYO A;  4Y8Z A;  3EE0 B;  1C5W B;  4CRE A;  3PTN A;  2H6M A;  2YMS B;  4THN H;  4DUR A;  3HK6 B;  3ZZA A;  3DFL A;  4AOQ A;  1T8M A;  4TY6 A;  2Q6G A;  5FL7 D;  4NZL A;  2BTC E;  1HJA C;  2WUB A;  4O3T A;  2V6N A;  3ENS B;  2F43 B;  4ACA A;  2ZHF H;  3SZE A;  1WAY B;  1WOF A;  4IBL H;  1ZYO A;  1Y59 T;  3I78 A;  3FZZ A;  1C1S A;  2BQ6 B;  2ZC9 H;  3RC6 A;  1ANB A;  2R0K A;  4YLQ H;  5DK1 A;  1EZU C;  1CT2 E;  2XW9 A;  4D7G A;  3A86 A;  2GVF A;  2OCV B;  1A5I A;  2RCE A;  3UOP A;  5E2O A;  3SV9 A;  1EPT A;  2FOC A;  4MQA A;  4K69 A;  1CO7 E;  1W7G H;  3Q00 A;  2PHB A;  2BY8 X;  1C1U H;  2K1Q A;  1C1W H;  1OHH D;  1FN8 A;  1O5D H;  1TNJ A;  1GGD B;  2XND D;  1CT0 E;  1H8D H;  3SZN A;  1YBW A;  1GCT C;  2PGQ B;  1F5K U;  1O2K A;  1SGT A;  1YCP H;  3HKJ B;  2P3U B;  1E38 B;  4NSV A;  1P09 A;  3BG4 C;  1IAU A;  1GDN A;  2VBC A;  2OTV A;  4AFU A;  3ZIA D;  2H2Z A;  4WME A;  2VIP A;  1AI8 H;  1UTP A;  2ZFR H;  1TAL A;  2G4U A;  4IMZ A;  3SYJ A;  4BNR A;  5E8E H;  2ZU3 A;  4J2Y B;  1SMF E;  3B8J A;  2ZPR A;  2F3C E;  2VH0 A;  4X1P U;  4Y0Z E;  5I46 H;  1IQG A;  4ZRO A;  1MKX K;  2ZG0 H;  2AGG X;  1L2E A;  3QZQ A;  2F9P A;  3UFA A;  2A7H A;  4RT0 A;  4GHT A;  1FZZ A;  1OWK A;  3U69 H;  7KME H;  2W3K A;  4FUI A;  3UQO A;  1TGB A;  2A4Q A;  3RXJ A;  2FOA A;  1W14 U;  3RC5 A;  1EAW A;  1KMH B;  1O3H A;  4LOY H;  3M3S A;  4DJZ B;  2IJO B;  1SLV B;  1F0T A;  3FVF B;  4M7G A;  2GMT C;  4CHA B;  2IPQ X;  2PSX A;  3ATM A;  2TGD A;  5DKM A;  2GDE H;  1WBG B;  2P94 A;  5DPA A;  1KXC A;  1TAW A;  3OY6 U;  1UO6 A;  3A83 A;  1T32 A;  3GY2 A;  1FY3 A;  4Y8Y A;  3GY6 A;  2DUC A;  1CGI E;  3E0N B;  2ZGJ A;  1XUH A;  1HUT H;  1C2J A;  3TH2 H;  5FAH A;  2ZU4 A;  1L1N A;  1MU8 B;  2GCT C;  1OOK B;  1IQJ A;  4GPG A;  1CU1 A;  1NFY A;  1GJA B;  1QA7 A;  2FMJ A;  1FMG A;  3RXM A;  1O3K A;  1MTU A;  1YLN A;  2GDD A;  1YP9 A;  8LPR A;  2SFA A;  3KQD A;  2HRV A;  4F4O C;  1GJ8 B;  5SGA E;  3SOS A;  1WSS H;  4WXI A;  2QV1 A;  5EXL A;  4NA8 A;  1OX1 A;  4X1N U;  3S7K B;  2FIR H;  1AU8 A;  3SOR A;  2ZHE H;  1C5X B;  1JMO H;  5KED A;  1TGT A;  5GIB A;  2EST E;  3MTY A;  1MAX A;  3P8N A;  1ELT A;  3H7O A;  3ZZC A;  3SI4 H;  2KR7 A;  4B2A A;  2TGP Z;  1LVM A;  4GHQ A;  1ZTK A;  3FZD A;  3VB4 A;  2GV6 A;  4XOJ A;  5AFY H;  1J16 A;  1EJA A;  1O3G A;  1UVS H;  3SGB E;  1YCP M;  1QB9 A;  3SU4 A;  1GMH F;  4FOU C;  3TVJ B;  3GCN A;  3D23 A;  1TX8 A;  2PFE A;  1PQA A;  1ZLR A;  2OC8 A;  2BZA A;  3D62 A;  2F9U A;  1GHB G;  4AOR A;  4AG1 A;  2KX4 A;  2ZQ1 A;  2R9P A;  1GHZ A;  3P8G A;  2SGE E;  5DP8 A;  4D8N A;  3A82 A;  4B76 A;  1O2X A;  2CJI A;  2ZTX A;  1P12 E;  2ALV A;  5EGM A;  1FI8 A;  5CHA B;  5A8Y A;  1S84 A;  1ELD E;  1A1R A;  3KYF A;  3RXR A;  1UHB B;  1RXP A;  2AGE X;  1V2N T;  1O3D A;  4YOJ A;  1D4P B;  2FI3 E;  1GG6 C;  2FDA A;  2KCY A;  3T29 A;  1V2W T;  3LGI A;  2I6S A;  2PWX A;  4I8K A;  2WPH S;  1VCW A;  1O3L A;  2G4T A;  4Y79 A;  3TLO A;  1OPH B;  1AVG H;  2YNA A;  2F9B H;  3DD2 H;  2WYG A;  4NWK A;  1RFN A;  1TBZ H;  1T8O A;  1GHX H;  2XC4 A;  1LHC H;  7LPR A;  1K21 H;  4OS1 A;  5LPR A;  1GCD A;  1O3F A;  4GCH G;  1ELB A;  1O3E A;  1AD8 H;  2Z3D A;  3MYW A;  3QTO H;  1TX7 A;  5C5N A;  2ZFS A;  2F9V A;  1LQE A;  2AYW A;  3KNX A;  4Z6A H;  1P2Q A;  2Y5F A;  3F6U H;  2NU1 E;  3AVZ A;  4A6L A;  5J4S A;  2ZHW H;  3GCO A;  4Q7Y A;  3VFE A;  3FP6 E;  1P9U A;  3N99 A;  1FAK H;  1MZD A;  1NFX A;  3MU8 A;  4Y7A A;  2TIO A;  2XTT B;  2FYQ A;  2W26 A;  3ZVB A;  1O5G H;  4WH8 A;  1QFK H;  5AVD A;  2P3T B;  1QA0 A;  2HAL A;  3ZZ7 A;  5TCA A;  1C5V A;  1DXP A;  1WQS A;  2C90 B;  4YOG A;  1O2R A;  1HAG E;  1BTH H;  2B0F A;  1C2H A;  3S9C A;  1XUG A;  2BD8 A;  1QQU A;  1AQ7 A;  1P8V C;  2AIQ A;  3OY5 U;  1GJC B;  1KIG H;  4CRC A;  1LVY A;  1ZPB A;  2W6I D;  2A4G A;  3ZZ8 A;  5L2Y H;  2WYJ A;  1YPG H;  4AC9 A;  1D3P B;  1PQ5 A;  3RXQ A;  3SBK A;  1DUE A;  4DT7 B;  2GZ9 A;  1JRS A;  1K28 D;  5JBT A;  1BBR K;  2BY7 X;  1GMC F;  3NK8 A;  2GZ7 A;  2ZFF H;  6EST A;  3LJJ A;  5TCC A;  1G9I E;  5HXF A;  4RN6 A;  3S69 A;  3ZZ4 A;  1MBQ A;  1C5Y B;  3RU4 D;  1ZTL A;  5EXN A;  4O97 A;  4K3J A;  1NRR H;  3M7T A;  1D3Q B;  1O3B A;  1DST A;  5KEC A;  1LDT T;  3TJN A;  2ZGH A;  1VKY A;  1BRA A;  4ABJ A;  1SLU B;  1TMB H;  2R0L A;  1AKS B;  2ANK H;  3M3V A;  1G36 A;  3GOV B;  2UWL A;  1LVB A;  2HNT E;  2JKH A;  1OWI A;  3SND A;  4JZF H;  2XRC A;  4WMF A;  4AFS A;  1CHO F;  4NIY A;  1ZMJ A;  3OFN D;  1EAU A;  4INK A;  1HAO H;  2STA E;  1FON A;  2PR3 A;  1ESB A;  4SGA E;  1ZR0 A;  1GJ5 H;  2V35 A;  1SGF G;  2Z9I A;  3LPR A;  4IN2 A;  1TNI A;  1KLT A;  1EPT C;  2OQ5 A;  3TJV A;  1V6D A;  2O8W A;  3ELA H;  1BQY A;  4ABA A;  1SLX B;  1KYN A;  2ZDM A;  4ABB A;  2FPZ A;  5L30 H;  2HPQ H;  3LIW A;  3G01 A;  3A7Y A;  5GCH G;  1C2F A;  5DN6 D;  1QBN A;  2YNB A;  2AER H;  2FO9 A;  4ABG A;  3OYP A;  1MBM A;  2OK5 A;  1BRB E;  1MQ5 A;  4X1R U;  4XBB A;  1P2M A;  2Y7X A;  1O32 A;  1DM4 B;  4YT7 H;  1O33 A;  1NFW A;  3OX7 U;  5BRR E;  3T25 A;  4IS5 A;  4R0I A;  5CHB A;  2G81 E;  1DLE A;  2WSS D;  3SUE A;  2OD3 B;  3GY7 A;  5C1Y A;  3ZZD A;  1ZGV A;  4F55 A;  3TIU A;  1V2K T;  2QE7 D;  2P93 A;  2W5E A;  1V2R T;  3V12 A;  2FX6 A;  3M5O A;  2AHM E;  1TNK A;  1JXP A;  5C67 A;  3KQB A;  4X0W U;  3M36 A;  2YOL A;  3BTM E;  2HNT C;  4BXS A;  1P02 A;  2P59 A;  1B5G H;  1C5M D;  2K0Q A;  3FKS D;  1HXE H;  3T62 A;  1AN1 E;  2SGA A;  1WTH D;  3FOA A;  1GDU A;  3BEI B;  3FO8 D;  4CR5 A;  2Y6T A;  3KQC A;  1KXF A;  4NGA H;  7GCH F;  1NBM D;  1C5S A;  1YM0 A;  1V2S T;  2J9N A;  4Q4L A;  5TJX A;  2P16 A;  1QB1 A;  3L3T A;  1YCP K;  3N7O A;  1AZ8 A;  5L6N H;  5HIY A;  3VG8 A;  4GCH F;  1KTT B;  1MQ6 A;  4Q80 A;  3A85 A;  3MU0 A;  1UTO A;  5HM9 A;  1O3J A;  6CHA C;  1F5L A;  2UWP A;  4B73 A;  4ZHM U;  2O8M A;  5EQR A;  1AUT C;  3JZ2 B;  2VIQ A;  1GBT A;  3LGU A;  4ZH8 A;  1PPF E;  3RP2 A;  2QXI A;  4K2Y A;  1VGC C;  2BQW B;  1TX6 A;  2FYR A;  3D49 H;  1VJA U;  1VIT G;  2BD4 A;  4CBN A;  1TIO A;  1ZPC A;  1MKW H;  2WPJ S;  3TU7 H;  3BN9 A;  1XXF A;  3SHC H;  1TRN A;  1QQ4 A;  2CN0 H;  3BTD E;  4KEL A;  1O3A A;  3SJ9 A;  1DWC H;  5EPN A;  2C4F H;  3F9F A;  3SUF A;  2QY0 B;  1J15 A;  4DIH H;  1NO9 H;  1SQO A;  4CRD A;  1OP0 A;  1GHA G;  1S82 A;  1BJU A;  2Y80 A;  2JET C;  4MVN A;  1QJ6 B;  1P2J A;  3PTB A;  4LZ4 B;  2ZFP H;  1J9C H;  1DUA A;  1Y5A T;  3M7U A;  3RXS A;  3UIR A;  4Q7Z A;  2B7D H;  2A5A A;  3GIS B;  1C1Q A;  3RLW H;  1FXY A;  1D3T B;  2GTB A;  2J34 A;  4I32 A;  1H9H E;  3W1E A;  3HK3 B;  1SGI B;  3Q77 A;  1T4U H;  1E36 B;  1UTL M;  2G8T A;  3ZVE A;  3UWI A;  1DWE H;  1BJV A;  1CHO G;  3VXF H;  3DSG A;  2G55 A;  3S7H B;  3MI4 A;  5A8Z A;  3QK1 A;  2SGF E;  3VB5 A;  3GDV A;  3TJU A;  3BG4 B;  2ZI2 H;  1O2Y A;  1MH0 A;  1RTF B;  3MH6 A;  2ODY B;  4HGC A;  3O8R A;  3E16 B;  2KAI A;  3W95 A;  2AFQ B;  4Y7B A;  3LGT A;  5DSF A;  2KFW A;  1TQ0 B;  2STB E;  3DSO A;  1QTF A;  4B71 A;  1ZSL A;  3RXL A;  2Z3E A;  3EST A;  1G3D A;  1EAI A;  1ZGI A;  2FOG A;  3UPE A;  1NBM E;  5C1X A;  2GZ8 A;  1MCT A;  1C5Q A;  1HIA B;  3QTV H;  4E7R G;  2R2M B;  1UJ1 A;  2GX4 A;  2CHA B;  1C5O H;  3N7D A;  3K9X B;  1THP B;  3E90 B;  1P11 E;  4DII H;  2WHX A;  1BOQ A;  4QT8 C;  3GS9 A;  1CGH A;  4BAO B;  1EOL A;  1O39 A;  3ATI A;  1HAH H;  1PJP A;  1TQ7 B;  3Q3X A;  1GBK A;  3DCL A;  3ODF A;  3RM0 H;  2BD3 A;  1N8O B;  1A4W H;  2A5I A;  2FLB H;  3KEE A;  1Z8I B;  3A7X A;  4FUG A;  4IW4 E;  4BTI B;  3SU3 A;  1XKB C;  3UY9 A;  1QRW A;  1GBF A;  2P8O C;  4FUJ A;  3BTG E;  1UVU H;  3HPT B;  3F9H A;  1OP8 A;  5JPM H;  1A0J A;  3AW1 A;  3F1S B;  3RMN H;  1GL0 E;  2IJD 1;  5I25 A;  3SU5 A;  1E37 B;  4K1S A;  5JB8 S;  1SGQ E;  4Y10 E;  2EEK A;  1DSU A;  1ELG A;  5EIY A;  2W7U A;  1IQI A;  3MU5 A;  1EKB B;  3U9A H;  1OYT H;  1EJN A;  1W8B H;  4IN1 A;  4XSK U;  2THF B;  1G2L A;  1B0E A;  1TNG A;  1L1J A;  2GCT B;  1W10 U;  1BMM H;  3BTT E;  4FUB A;  5T6F A;  1FNI A;  2WV4 A;  1SFQ B;  1MTN C;  5T6D A;  2W3I A;  1EZQ A;  3PB1 E;  3M5M A;  1Z1I A;  4YLU A;  4ABE A;  1SG8 B;  3SV8 A;  4Y8X A;  3U1J B;  2Z94 A;  1V2M T;  2WUC A;  4O03 A;  2AIP A;  1ZOM A;  4Y6D A;  4Y76 A;  2VVC A;  1DX5 M;  3ZZB A;  2GCH F;  4LXB H;  2ZDA H;  5GPI B;  1O2J A;  4A1T A;  3M5L A;  1L0Z A;  1SSX A;  1G2M A;  1O30 A;  1KY9 A;  2BVR H;  2VGC C;  4K8Y A;  1ETR H;  2HWL B;  5T1V A;  2ZDK A;  1AB9 C;  4WWY A;  1K1L A;  2FEQ H;  1P3C A;  2NU4 E;  5LGO A;  2ZGB H;  1M9U A;  3A88 A;  1SI5 H;  2DE9 A;  3AAS A;  2BD7 A;  2BDG A;  2BLO A;  1GHB F;  2ZTY A;  1Y8T A;  1O2U A;  2PUQ H;  1A0H B;  2ZGC A;  4H4F A;  1O34 A;  4U32 A;  2GMT B;  1EAX A;  1O0D H;  2H5C A;  1NRQ H;  2M5T A;  2PUX B;  1RTL A;  1YPH E;  4ACB A;  3MWI U;  3KYG A;  3SI3 H;  4ZKO U;  1CQQ A;  5DP4 A;  2LPR A;  5GXP A;  2A0Q B;  2A5K A;  1K0H A;  1ZHM A;  4WMD A;  3SNA A;  3LGV A;  3ZYE A;  2W6J D;  4E05 H;  1TOM H;  3MH4 A;  4MNX A;  2D26 C;  2WV5 A;  4BAK B;  1QBV H;  1PPH E;  1O3P B;  1PYT D;  3GCH C;  1ELF A;  2ZF0 H;  1O2Q A;  1A3B H;  1D9I A;  2OIN A;  4DY7 B;  1TGN A;  1WU1 A;  1XVO A;  2CV3 A;  2A32 A;  3UR9 A;  1MMJ N;  4DVA U;  2XC0 A;  5EJZ A;  1VR1 H;  4MDS A;  7EST E;  1TRY A;  1CBW C;  1BBR E;  2A2X H;  1F92 A;  1TRM A;  3MU1 A;  1SVP A;  2B9L A;  1BTP A;  1NRS H;  3F0O A;  1COW D;  1TLD A;  1HAY B;  1EJM A;  1W0Y H;  1C4U 2;  1PPZ A;  1YKT A;  1O36 A;  2J97 A;  5C1U A;  5C0T A;  1XXD A;  5ETX A;  1GMD F;  2TBS A;  1HAP H;  2F91 A;  3ZVF A;  4FVB A;  1HJ8 A;  1SGN E;  1SOT A;  5C3N A;  2VB0 A;  2HVX A;  3DA9 B;  2GGV B;  2Z7F E;  3WWB A;  2YMS C;  3F2H A;  1YYY 1;  2BZ6 H;  1AZZ A;  3MNC A;  1FQ3 A;  1GPZ A;  1K1N A;  4ABH A;  1AFQ B;  1YF4 A;  2P8O B;  1D3D B;  1W11 U;  1YPH C;  2ZCH P;  4ABI A;  1OSS A;  2AGI X;  3PO1 B;  3PO1 C;  3OEE D;  2ZGX H;  3O8C A;  1YPE H;  2ZEB A;  4NZQ A;  1WV7 H;  2PP6 A;  1WXR A;  3T2N A;  1KXD A;  3SJO A;  1WUN H;  3SJ8 A;  4XE4 A;  1H9I E;  5HM2 A;  1IQM A;  4UDW H;  2SGP E;  1SR5 C;  3CS7 A;  3B23 B;  1ELC A;  3RXA A;  1O3I A;  3BTQ E;  1YLC A;  2QF5 A;  3SNB A;  4I86 A;  1JBU H;  1Y3Y A;  1ZZZ A;  3L6P A;  4D7F A;  3H7T A;  2WPD D;  1H8E D;  2FS9 A;  3KQ5 A;  1ZRK A;  4CR9 A;  1EZS C;  3SUD A;  1EQ9 A;  2CF9 H;  3F9G A;  3RXH A;  1QUR H;  3RXT A;  2V3H H;  3GY8 A;  1CSO E;  3WW7 A;  3S0N A;  1SQA A;  1HPG A;  1S85 A;  2VWL A;  3A81 A;  3F9E A;  3TGJ E;  3ZYD A;  4JK6 A;  3NRL A;  1GBH A;  1ORF A;  4UFF H;  2JIZ D;  6GCH F;  1EST A;  2BHG A;  1SHH B;  4YOI A;  1O5E H;  1LKA A;  1K2I 1;  1QCP A;  3RU4 T;  1IHT H;  1GJ6 A;  3TNS A;  2AS9 A;  2L74 A;  1SGP E;  3PRB A;  5JYI A;  2ULL A;  1HAZ B;  3RU4 E;  2ASU B;  4AB8 A;  3ATK A;  1QY6 A;  1TPA E;  2SGD E;  2Z9G A;  4OS4 A;  1O5F H;  5ESB A;  3M35 A;  4KTS A;  1Y3U A;  2G5V A;  1EOJ A;  1DS2 E;  2VU8 E;  5FHT A;  2GT7 A;  3PV2 A;  3UUZ A;  1Z71 A;  3LKW A;  2P95 A;  2QF4 A;  3F0P A;  4HTC H;  3TJO A;  1O5B B;  1UTN A;  3GCH B;  3LH1 A;  5DG6 A;  2HLD D;  2BDB A;  3A89 A;  2EI6 A;  2GV7 A;  4CH8 B;  2JH6 D;  1AGJ A;  1B7X B;  1E35 B;  1O38 A;  3ZVC A;  1TFX A;  3MO6 A;  3VB6 A;  1B0F A;  1C9T A;  3VB7 A;  2V7Q D;  3QZR A;  3U98 H;  1EFR D;  1AE5 A;  3SV6 A;  3S9A A;  3RXB A;  3ATW A;  1NM6 A;  3VGC B;  4CH2 B;  1KTS B;  5DO4 H;  3PWB A;  1VGC B;  2ZZU H;  3A84 A;  2KZ4 A;  2EC9 H;  1MCV A;  1PPG E;  2FX4 A;  1DWD H;  2NU3 E;  5DP9 A;  1DDJ A;  3LC5 A;  5H4I B;  2Y5H A;  5C0U A;  2BY5 X;  3SUG A;  2C8Z B;  2FI4 E;  3E1X B;  4OGY A;  1C1O A;  3ATL A;  1CHG A;  1LTO A;  2XBW A;  1ZRB A;  4RI0 A;  4AFQ A;  4AFZ A;  1QR3 E;  5LH8 A;  3SNC A;  4I8H A;  1FY5 A;  3CNR A;  4TYD A;  4X6P A;  5DJ7 A;  3R0F A;  1HLT H;  4VGC B;  2ZFQ H;  1EAS A;  2XXL A;  1EAT A;  1HIA A;  1K22 H;  1GL1 A;  2EY4 C;  3GYL B;  3OSY A;  4ASH A;  3NCL A;  5K0H A;  5C94 A;  1BTX A;  1YY3 A;  5FX6 A;  2VGC B;  2I6Q A;  2IPH A;  4X6N A;  1GBB A;  5HGG A;  1LQD B;  2ZHQ H;  3R3G B;  2AH4 X;  4GSO A;  2WPL S;  3KN2 A;  1O5C B;  2SNW A;  3ZVA A;  1BT7 A;  4TWW A;  1QB6 A;  3Q3K A;  1UCY H;  1T8N A;  1NRN H;  2VVV A;  1GI4 A;  1AND A;  2EI8 A;  4CRA A;  1H8I H;  4ZMA H;  1MTW A;  4K1E A;  1GG6 B;  1O3O A;  3ZZ9 A;  3PWC A;  1AO5 A;  1TPS A;  4H6S B;  1V2Q T;  1VCQ A;  3HAT H;  4A92 A;  4NCY A;  1AFQ C;  3RXC A;  1NU7 B;  2XWB I;  1FUJ A;  3U28 C;  6LPR A;  4OS7 A;  1GVZ A;  3A7T A;  1K9O E;  1LHF H;  1DY9 A;  3PRO A;  4MNV A;  5EU8 A;  1C5T A;  1TA2 A;  1Z8G A;  1BTW A;  8GCH G;  1C1V H;  4B2C A;  2H5D A;  1BTZ A;  1CE5 A;  4ISI H;  3OEH D;  4K1T A;  1S6F A;  2UUK B;  2H9E H;  3FFG A;  2WPK S;  2FI5 E;  3MHW U;  3P70 B;  2XCF A;  1F0S A;  3P17 H;  3M37 A;  3V3M A;  2HGT H;  3K65 B;  4DCD A;  2KCO A;  3VPK A;  3T5F H;  1YPK H;  2A7C A;  1HV7 A;  2D1J A;  5A2M H;  1E34 B;  3BTW E;  3E91 A;  1QL9 A;  3SJI A;  3RXO A;  4FUC A;  1NTP A;  3ODD A;  2QXH A;  4XBD A;  2OXS A;  1TWX B;  2HOB A;  2VJ1 A;  2B8O H;  2O9Q A;  4OS5 A;  1DAN H;  3BV9 B;  1MTV A;  2ALP A;  3QWC H;  1DOJ A;  1GBE A;  2Z9L A;  1O2N A;  2UUY A;  3A8A A;  1MKW K;  4MLF B;  3PM3 A;  2Q1J A;  1GI8 B;  5JBB S;  3KCG H;  2CHA C;  4R8T B;  2ZDL A;  3P8O A;  1BBR H;  1P57 B;  4A1V A;  1LPG B;  3MH7 A;  1O31 A;  5AF9 H;  5T3H A;  1ARB A;  2VID A;  5DGJ A;  5E0H A;  1P9S A;  2FES H;  4JZI A;  1BMF D;  1UK2 A;  2BLV A;  1U6Q A;  3GDS A;  4WY3 A;  1C1N A;  4Y0Y E;  5EXM A;  2BM2 A;  3OTJ E;  5FPY A;  1SGC A;  1IQN A;  1RS0 A;  1GJ4 H;  1DIC A;  3LH3 A;  4BOH A;  1Z6J H;  2LEL A;  1CVW H;  1GMH G;  3UOU A;  4HZH A;  1THR H;  3OU0 A;  4DOQ A;  3F2G A;  2J5U A;  3PV4 A;  2OC7 A;  4ISL A;  2Z6B D;  3W94 A;  3MO9 A;  4H42 U;  2HLC A;  1QIX B;  2AMP A;  1NU9 A;  3ZVG A;  3RUO A;  1P2O A;  1HB0 B;  1DY8 A;  3I77 A;  3AK5 A;  1WYK A;  5F8T A;  3LON A;  4JK5 A;  1IQF A;  3SU6 A;  3TH4 H;  1N6X A;  1XUK A;  1SFI A;  2A45 B;  1S5S A;  3CEN A;  1ZML A;  3LDX H;  1ANC A;  3U8R H;  1BRC E;  1UK3 A;  3SQH E;  1GBI A;  5JDU B;  3SJK A;  1E0F D;  4NWL A;  2KAI B;  2QF0 A;  4CBO A;  5FPS A;  1VZQ H;  1O2V A;  1V2J T;  3E6P H;  3KHV A;  3SGQ E;  3ITI A;  3LC3 A;  3HGP A;  1Y5B T;  1WCZ A;  1ANE A;  1TNH A;  2AEI H;  1TBQ H;  1V2O T;  3URD A;  1ZTJ A;  3HGN A;  2H1U A;  4FUD A;  3IIT A;  3WY8 A;  1FPC H;  3A7W A;  2TGT A;  1W3C A;  1F2S E;  4X8T H;  1CA0 C;  1GHV H;  1TB6 H;  1SB1 H;  1C1R A;  1S83 A;  2O8U A;  3RXE A;  4JMY A;  3T28 A;  1EUF A;  3EAJ A;  4AGJ A;  3B9F H;  1GI5 A;  3P8F A;  1LHD H;  1PYT C;  5GWZ A;  1C2G A;  2PLX A;  3A80 A;  1DPO A;  3A7V A;  4WJG 2;  5GDS H;  1J14 A;  3F68 H;  1HYL A;  4CRB A;  1W7X H;  2QCY A;  2GD4 B;  3GCT F;  4ABF A;  4BXW A;  5EJ1 A;  1KXE A;  1AY6 H;  1BB0 B;  4ISN A;  1SOZ A;  3PMJ A;  4I8G A;  1O2T A;  1P0S H;  1Q31 A;  1P03 A;  2D8W A;  5GND A;  1P2I A;  2BXU H;  3SNE A;  1FY8 E;  3V13 A;  2D2D A;  2J38 A;  3GIC B;  4XRN A;  1IQK A;  1MZA A;  2OUA A;  3RXK A;  3M3T A;  1S0R A;  2LP6 A;  2VWM A;  1D6W A;  2G5N A;  2H9H A;  2HPP H;  1TPO A;  4FUH A;  1CT4 E;  2F4L A;  2R3Y A;  3BTH E;  4BAN B;  1ZJK A;  1SLW B;  2Z9K A;  4EST E;  1V2U T;  4ZKN U;  2J95 A;  2Q6F A;  3LJO A;  1A5H A;  3TGI E;  1AMH A;  1TPP A;  1HDT H;  3A8C A;  4I8L A;  1QHR B;  3QGJ A;  2ZP0 H;  1N8O C;  1HJA B;  2ZDN A;  4FU9 A;  1LCY A;  1GWA A;  1G3C A;  5C2Z A;  3UAI C;  2CK3 D;  4XFQ A;  1AHT H;  1QRZ A;  1EB1 H;  3Q76 A;  3TH3 H;  1ACB E;  3BF6 H;  4P02 A;  2R3U A;  4KGA A;  4ISO A;  1LHG H;  5EQS A;  1GHY H;  3GY5 A;  4OS2 A;  3QN7 A;  1IQL A;  4DW2 U;  3PMA B;  2V3O H;  3BSQ A;  1SC8 U;  3L33 A;  2UUJ B;  3BTF E;  4VGC C;  4X2X A;  4IC6 A;  1JIM A;  1HBT H;  1KDQ A;  1C4Y 2;  1VCP A;  4YT6 H;  2CMY A;  5F6M A;  1C9P A;  1C5P A;  3NUM A;  4AB9 A;  5C17 A;  2BQ7 B;  7GCH G;  1HAV A;  3PMB B;  4B1T A;  1O3M A;  2XBX A;  1HNE E;  1OP2 A;  5E0G A;  1MD7 A;  5FX5 A;  3MNB A;  1V2V T;  1P3E A;  1GI9 B;  3HKI B;  1BA8 B;  4OGX A;  4Z0K A;  4D9R A;  3A8B A;  8GCH F;  2JET B;  2QF3 A;  4ZHA A;  4NIV A;  2AMD A;  1AVX A;  1MKX H;  2BDC A;  9EST A;  2VWO A;  5HKK D;  2TRM A;  1HGT H;  1OYQ A;  3KL6 A;  1A46 H;  4HG6 A;  1F0R A;  1NS3 A;  2Y82 A;  1LPZ B;  4Y71 A;  2OQU A;  3V7T A;  1QNJ A;  1E1Q D;  1A5G H;  3UTU H;  4I33 A;  3DFJ A;  4I31 A;  4INL A;  2VIN A;  4MPX A;  5AFZ H;  4PRO A;  3Q3Y A;  4Z1M D;  2J2U A;  1O2M A;  2QXJ A;  2BD2 A;  2Z9J A;  2FTM A;  2PKA A;  2LNC A;  3QDZ B;  1GMD G;  1O2I A;  2ZEC A;  4UE7 H;  1EP6 A;  3EGK H;  1S6L A;  4B74 A;  1O2W A;  3RDZ A;  2KCP A;  3EE7 A;  5GCH F;  3FP7 E;  3PLB A;  8KME 2;  2OBQ A;  1O2L A;  5JB9 S;  1YPM H;  2FLR H;  4FU8 A;  1JIR A;  1GBC A;  4BAQ B;  2BYA X;  1S81 A;  1NRP H;  4B2B A;  4X1Q U;  2QA9 E;  1O35 A;  3SU2 A;  1J8A A;  2WV9 A;  4I8J A;  1SGF A;  5A09 A;  1QJ1 B;  3BEF B;  4KP0 A;  5IK2 D;  1RTK A;  1O2P A;  2VH6 A;  1RRK A;  3E3T A;  4IMQ A;  2VIV A;  3SW2 B;  3NZI A;  5EPY A;  1G3B A;  1XKA C;  3LOX A;  1BZX E;  1P2K A;  3RC4 A;  1THS H;  1TYN A;  1YWU A;  2XCN A;  1BIT A;  4BAM B;  4U2W A;  1Z6E A;  4X6M A;  4GVU A;  3A7Z A;  4Y11 E;  1W2K H;  1HAI H;  2FWW A;  1EXF A;  2UWO A;  1C2K A;  2Q6D A;  1IHS H;  2Z3C A;  4INH A;  3KF2 A;  2WPI S;  2XBV A;  1F7Z A;  4YZU A;  3LU9 B;  1NY2 2;  3RXG A;  3BTE E;  1FY4 A;  5CE1 A;  3TK5 A;  2IN2 A;  3P92 A;  2BY9 X;  5F8X A;  3D65 E;  5AHG H;  1BMN H;  1AWF H;  1NRO H;  4MG3 A;  2RG3 A;  1DWB H;  3PYH A;  4TT3 D;  4DGJ A;  4Q2K A;  2FP7 B;  3S9B A;  1P01 A;  4LZ1 H;  2QC2 A;  2ZTZ A;  2ZA5 A;  2IOT A;  2F9O A;  1SQR A;  1ZJD A;  1UW7 A;  3RMO H;  4AYV B;  1BML A;  2M2A A;  3MQK C;  4WXV A;  1VIT H;  1C2E A;  4NG9 H;  1EPT B;  5T6G A;  5CHA C;  2BDH A;  1OWE A;  3AAV A;  2Y7Z A;  4CRF A;  1TE0 A;  2HVY B;  1ESA A;  2ZU5 A;  1FDP A;  3N7E A;  3E8L A;  4B75 A;  3EYD A;  4DG4 A;  1EB2 A;  1GBA A;  1LVO A;  1F0U A;  4UON A;  1K1J A;  1TBR H;  5GJ4 B;  1ETT H;  1EZX C;  3BEU A;  4HFP B;  3VGC C;  2RDL A;  1OWJ A;  2QIQ A;  5KGO A;  4AGK A;  1UVT H;  1Z7K A;  1RGQ A;  4KTC A;  4ZAE A;  5PTP A;  3ZV8 A;  1CA8 B;  1P10 A;  4FUF A;  1A61 H;  4E06 H;  2BLW A;  1GI1 A;  2K8I A;  4IC5 A;  2XBY A;  1L4D A;  3IG6 B;  4TY7 A;  1C1M A;  5DP6 A;  1YC0 A;  1Y3X A;  1NT1 A;  3PV5 A;  2FOB A;  1HFD A;  1H9L B;  2OC0 A;  2BXT H;  5IYT A;  1GBM A;  1V2P T;  2C93 B;  5EQQ A;  3RXU A;  1XUJ A;  2NWN A;  1S6H A;  1F5R A;  2FOM B;  2SGQ E;  3SQE E;  1PPC E;  2O8L A;  2EA3 A;  2QAA A;  4IGD A;  4MTB A;  1L4Z A;  3NXP A;  2ZFT A;  1O3C A;  2BB4 A;  5F03 A;  4GLY A;  1HJ9 A;  4MPV A;  5FBE A;  2GP9 B;  4ZUH A;  2J92 A;  2BLQ A;  3IWM A;  2VIW A;  1ARC A;  4WVP E;  3M61 U;  3SV2 H;  5LPE A;  5EOD A;  1SGR E;  1ETS H;  4U30 A;  1DLK B;  1TA6 A;  3OTP A;  3RM2 H;  1C5U A;  2CF8 H;  2ZCK P;  3SO3 A;  1N6Y A;  2ZIQ H;  2ZDV H;  4X2W A;  4K60 A;  1TGC A;  2GT8 A;  1NZQ H;  1DT2 A;  2JH5 D;  3PLK A;  1G30 B;  3MMG A;  4Q63 A;  1HAV B;  4MPU A;  5F53 A;  1GI0 A;  3TIT A;  3UR6 A;  1C5Z B;  1LO6 A;  1AB9 B;  4A1X A;  5B6L A;  3QGN B;  4MNY A;  1MTS A;  2HNT F;  2C8X B;  1T7C A;  4CHA C;  1IOE A;  1O2Z A;  1GBL A;  1OKX A;  3MNX A;  1AVW A;  4RT1 A;  2BD9 A;  2TPI Z;  1ELE E;  5EST E;  1LMW B;  4BAH B;  4X6O A;  4UFD H;  2G52 A;  1YLD A;  3CS0 A;  1QL7 A;  1UCY E;  3BIV H;  1PQ8 A;  4M9F A;  4J1Y A;  4D76 A;  3U8T H;  1GVK B;  1C1P A;  1GBJ A;  3OE7 D;  2XC5 A;  3MNS A;  3FP8 E;  1SL3 A;  1QRX A;  1Y3V A;  1CGJ E;  1IQE A;  2ANM H;  4RSP A;  4FVD A;  1MU6 B;  1AFE H;  3RXP A;  4TWY A;  3ZZ5 A;  4XD7 D;  1EP5 A;  3MH5 A;  1O37 A;  1NFU A;  1NC6 A;  1INC A;  2A4R A;  2CXV A;  4X8S H;  2BY6 X;  1IQH A;  2KCA A;  1C5L H;  2UUF B;  1Z8R A;  1JOU B;  1W13 U;  2XYA A;  4ZXY H;  2QN5 T;  1XX9 A;  1V3X A;  1SPJ A;  1GI3 A;  3RXI A;  1JWT A; 
#chains in the Genus database with same CATH homology
 3SU0 A;  3ZIA D;  4B76 A;  3N7D A;  3E90 B;  3SUD A;  3PV5 A;  4B6F A;  3SYJ A;  3VG8 A;  2WHX A;  2OC0 A;  3F3B A;  3GS9 A;  1RTL A;  2LEL A;  5EQQ A;  2F4L A;  2FM2 A;  4ASU D;  3SU2 A;  3DSP A;  1A1R A;  3WW7 A;  3F2G A;  2J5U A;  3DCL A;  3KN2 A;  2XNI A;  2FOM B;  2OC7 A;  2WV9 A;  5FPT A;  1BT7 A;  5IK2 D;  4B73 A;  4OM9 A;  2O8M A;  2XOK D;  3KEE A;  1DXW A;  2OC1 A;  5EQR A;  2YMS D;  3NRL A;  5EPY A;  1DY8 A;  1W0K D;  3LOX A;  2W6J D;  2KCY A;  2JIZ D;  3RC4 A;  3SU3 A;  2XCN A;  2A4Q A;  3AK5 A;  2CK3 D;  3RC5 A;  3UB0 A;  1KMH B;  5CDF E;  3OFN D;  4A92 A;  3LON A;  2IJO B;  3SU6 A;  4WF8 A;  3OAA D;  2JDI D;  4NWK A;  2OIN A;  5EQS A;  5FPY A;  3PRB A;  1E79 D;  3F2F A;  1DY9 A;  2IJD 1;  4NWL A;  3SU1 A;  1E1R D;  3FN8 A;  5EPN A;  2OBO A;  3SU5 A;  1W0J D;  3KF2 A;  3OTP A;  5FPS A;  3SV7 A;  3SUF A;  3OEH D;  2JJ2 D;  5ESB A;  2YMS B;  2F9V A;  2XCF A;  4FET A;  4Q63 A;  3F0O A;  5C17 A;  1COW D;  5F53 A;  3KNX A;  4K8B A;  4A1X A;  1N1L A;  5FL7 D;  5B6L A;  3O8D A;  5DN6 D;  2KCO A;  3OYP A;  1CU1 A;  3PV2 A;  4TT3 D;  2OK5 A;  2FP7 B;  3LKW A;  2QF4 A;  3F0P A;  5C0T A;  2F43 B;  5ETX A;  1W3C A;  2HLD D;  3SZE A;  3N99 A;  2WZQ A;  3RC6 A;  2M2A A;  4YXW D;  5IDK A;  1H8H D;  2GGV B;  5CHB A;  3WWB A;  2WSS D;  2YMS C;  3F2H A;  4I32 A;  4WH6 A;  3M5M A;  4JMY A;  2QV1 A;  4WH8 A;  3SUE A;  3SV8 A;  3W1E A;  2V7Q D;  3M5N A;  1EFR D;  4F55 A;  5HKK D;  3U1J B;  3SV6 A;  2QE7 D;  4U01 A;  2GVF A;  3N7E A;  1DXP A;  3H09 A;  1FX0 B;  3PRD A;  3U1I B;  4M9F A;  4B75 A;  3EYD A;  3SV9 A;  3OEE D;  3WWF A;  4ZCN A;  3P8N A;  3M5O A;  1MAB B;  3O8C A;  1NS3 A;  2AHM E;  2KZ4 A;  2KR7 A;  1JXP A;  3OE7 D;  4TSF D;  5GPI B;  4A1T A;  3M5L A;  1WXR A;  1E1Q D;  2K1Q A;  2YOL A;  5H4I B;  5GJ4 B;  4I33 A;  4R8T B;  4B6E A;  2W6I D;  2A4G A;  4I31 A;  3P8O A;  1OHH D;  5C0U A;  2P59 A;  3SUG A;  3O8R A;  2K0Q A;  4A1V A;  5T1V A;  3FKS D;  3SU4 A;  4Z1M D;  4DT4 A;  4XD7 D;  2XND D;  4RI0 A;  5DSF A;  5GND A;  2KFW A;  2A4R A;  3FOA A;  2KM0 A;  1SKY E;  3DSO A;  4B71 A;  2KCA A;  3FO8 D;  2OC8 A;  1RGQ A;  4KTC A;  1S6L A;  4TYD A;  2F9U A;  1BMF D;  2JJ1 D;  4B74 A;  2L6O A;  2QF5 A;  2K8I A;  2KCP A;  1NBM E;  1NBM D;  3L6P A;  3O8B A;  2VBC A;  2OBQ A;  2WPD D;  1H8E D;  4Q4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...