3PMJA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pmjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pmjA02
1QBOA 3UQVA 1A1RA 1ESBA 1BQYA 1A7SA 1XVMA 3BSQA 3PMAB 4GPGA 2IPHA 1XX9A 2O8WA 3TJNA 1HCGA 2QIQA 1GWAA 2Y5GA 3P17H 2UUFB 4FVDA 3GISB 1BBRE 2P95A 1ETTH 4B76A 3SI3H 3M35A 1MAXA 1G37A 3HK6B 1BOQA 1SGQE 2NWNA 5FBEA 1BZXE 1TPOA 2H9TH 1L4DA 4WY3A 1OWIA 1OXGA 3F1SB 1ZGVA 3MH6A 1GJ9B 4QT8C 3TIUA 1AO5A 3RU4D 1H9IE 3RMNH 1C1SA 1FZZA 2I6SA 1RRKA 2A5IA 2GV6A 3SJ9A 1NS3A 3VB5A 5C1UA 5GDSH 3A89A 5DP6A 4ZXYH 4IC6A 1BMMH 1NFUA 1UCYH 3F9FA 1W3CA 3B8JA 3RMLH 3ZVBA 4FU8A 1P10A 1O3OA 3RXSA 1ZYOA 1UVTH 2HGTH 1FONA 2ZGCA 5DP5A 4ISNA 4GLYA 4WJG2 3SJIA 3L6PA 2XWAA 1O34A 4TYDA 1ZHPA 4XSKU 4BTIB 8ESTE 1LVOA 1BB0B 4ZHAA 1FXYA 1XUFA 1LPZB 1FY8E 1FAKH 4WH8A 4X6MA 2G5NA 1BMNH 1QY6A 3ZVEA 4CRBA 4ABIA 1EZSC 4X2XA 2ANWA 3VB4A 1LHFH 1ZTKA 4BANB 4X8SH 1BMAA 1C1OA 2K1QA 3C27B 3MU5A 3RXCA 2FOGA 1GHZA 1AMHA 3GY7A 2ZPRA 1ZHMA 1EPTB 4M7GA 5A0BA 1J15A 4YOIA 2VJ1A 3RP2A 1T32A 1Z6EA 4ISOA 2F83A 4CRGA 1PPZA 5IDKA 4MPUA 3P8FA 2VWNA 1O5AB 5DO4H 1O2UA 2AYWA 1W11U 3KQBA 1BA8B 1J8AA 5CE1A 1SQOA 3DUXH 1PPEE 2J9NA 1TABE 1SHHB 5A8XA 4CH8B 2BDAA 4RKJB 5A09A 3K6YA 1HNEE 3PV4A 1A0JA 5LGOA 4Q7YA 3EGKH 2A4GA 1HXFH 2RA0A 2BD2A 2WPJS 2H9EH 2ZFQH 3K6ZA 4MDSA 3BEFB 2Y5FA 2TGAA 3KGPA 1GHBG 4NCYA 2PKSC 1SGCA 3SO3A 1DSTA 2GKVE 1AWFH 3A7VA 1QIXB 1A5GH 3U9AH 4D7GA 3RXOA 4ZHLU 3SUFA 3ZVFA 3A81A 1HGTH 5EG4A 2BZAA 2F9PA 1AQ7A 3RXJA 2VIOA 4KP0A 4MNXA 3VFEA 3EE0B 1GI2A 1C2LA 2VVUA 5T3HA 3ENSB 3RXPA 1TLDA 1HDTH 4K3JA 1GCTB 1VZQH 1TPAE 2FOEA 2NU3E 2SNWA 4B73A 5ESBA 2OBQA 4U01A 1MU6B 1NRNH 2QXHA 3RXKA 2NU4E 1KXEA 5T6FA 2G4TA 1AE8H 2BDCA 4IMZA 2RDLA 3ZZ3A 2A7JA 2GZ8A 5ABWA 3F9HA 4FUCA 1K1LA 2ZDMA 1LHDH 2Y82A 1O2PA 3L3TA 4BOHA 1ANEA 3HATH 3RXFA 2GDDA 4BNRA 1DXWA 1EJNA 1LHEH 1O0DH 3SU5A 1CO7E 2ZHEH 1CT4E 2BY6X 5HM2A 4O9VA 2AS9A 2HNTE 3M5MA 1THPB 2RCEA 2VB0A 4BAKB 4YESB 1Y3WA 2GVFA 2UUJB 1BHXF 4WF8A 3UTUH 4WXVA 3ZYDA 1NRPH 1JXPA 4MLFB 1U6QA 4Y8XA 4TPIZ 4MTBA 1BDAA 1SLXB 2FDAA 2R2MB 1E35B 3CS7A 4I31A 3AAUA 2QY0B 2SGAA 3FZZA 1H4WA 1JWTA 1D3TB 1NM6A 2J92A 5G4BA 3SNAA 4MPVA 4MQAA 1H8IH 1ID5H 3PLBA 1LKAA 3U1IB 1C5NH 3SU6A 6LPRA 2SGPE 2THFB 3GDVA 2XTTB 3AW0A 2J34A 1WU1A 1RTLA 3UNSA 3RXQA 3ZYEA 2TGPZ 3ZVDA 1K22H 2FOMB 1O2MA 2VIVA 1NFWA 1P04A 1MMJN 3D62A 2P16A 1FY1A 2B9LA 1MCVA 1HV7A 2G00A 2EC9H 1UMAH 3TNSA 1S81A 4LOYH 1C5WB 1ZTJA 1S6HA 1CGIE 1BJVA 2ZDAH 3PWCA 2ODYB 1MTNC 4NWLA 1GJ7B 3GCHC 1Y5BT 2ZTYA 5EPYA 1GVKB 1QB9A 3ZZ5A 4AFUA 3TGJE 1PYTC 4WMEA 1W14U 5FPSA 3ZZ7A 2PSXA 1EAWA 2VH0A 3MO3A 5EOKA 1C2HA 2HPPH 1QQUA 2BD3A 1Z8GA 2ZFTA 1O2SA 5I25A 2OC1A 3RM2H 3KEEA 4BTUB 2VIWA 5HM9A 1P8VC 2FO9A 2ZG0H 2Z9KA 3Q76A 3FP7E 4AX9H 1EZQA 3SV2H 3RC6A 3GCHB 1BT7A 2HRVA 2BMGB 4OS2A 2FXRA 2AMPA 4AGJA 1P11E 4TPYA 1XUGA 4MVNA 4ZKOU 3OY6U 3RU4T 4GCHF 2A1DB 3M3VA 4OS4A 4AB8A 1KXAA 1X7AC 4YZUA 3CENA 1SSXA 3A87A 5E2OA 3S7KB 1D6WA 2VGCB 4YO9A 2FYQA 2WPMS 2QYIA 1FUJA 2G81E 3O8DA 2P3FH 1D3PB 1ZJKA 2QAAA 1BTUA 1C2MA 2V3HH 1SL3A 3K65B 3F9GA 1UCYK 1O2IA 4ISHH 1H9HE 1B0FA 1YYY1 1SI5H 2WPHS 1FPCH 3D65E 3DD2H 4D9RA 4K1TA 1TRMA 1XVOA 3ATKA 5DP8A 1O3JA 5F03A 3RU4E 1F0RA 1OS8A 1T8OA 2BM2A 2VU8E 1EJMA 1AKSA 1W10U 3UUZA 1FPHH 1SOZA 3GCTG 5J4SA 4NA9H 1AIXH 1C1WH 1GBJA 1GBMA 1OP8A 1TA2A 2BD4A 1L2EA 1S0RA 1TBZH 1YPHC 2FS9A 1MCTA 1QBVH 2CN0H 2ZC9H 1A2CH 3EQ0H 2R0KA 5E8EH 3UR9A 3C1KA 3V3MA 1TFXA 2A0QB 1Y5AT 1YPLH 1JMOH 1UTQA 1AVGH 1LDTT 2WV5A 3CS0A 5A8ZA 2XBXA 4KTCA 5EQRA 1O2VA 1CT0E 2R0LA 3E90B 1CBWC 1C5UA 1WTHD 2ZEBA 4CR9A 2IJOB 2OC7A 1C5MD 1QB1A 4AG2A 1SGTA 3BEIB 4K2YA 1G2LA 2BB4A 1F5RA 3UR6A 2H6MA 1ANDA 1IHTH 1HJ8A 3H7OA 1VJAU 2TGDA 2WUBA 1MQ5A 3SU3A 1MU8B 1KYNA 2ZU1A 3B9FH 1HRTH 2XC5A 2SNVA 3KCGH 1DUAA 3SORA 2FP7B 3T2NA 3E91A 4O3UA 3A8DA 2EA3A 1GJAB 5JB9S 1O36A 2ZU3A 2AFQB 1UK4A 2BX4A 2NU0E 1BHXB 1ELCA 4ISIH 1KSNA 3V0XA 4ZHMU 4ABAA 9LPRA 1CQQA 3NUMA 7ESTE 4A6LA 5FCRA 2V6NA 1E34B 1F92A 7GCHG 1TGCA 3BG4C 4FUIA 2QV1A 2D1JA 4K69A 1GI5A 1SGYE 1HXEH 2A45B 1J17T 1Z6JH 2O8UA 3M5NA 3HK3B 1P05A 4HTCH 4NIXA 4X1QU 3SJKA 1HBTH 1QJ1B 1SLUB 2YNBA 4X1NU 1W7XH 2CJIA 1NRSH 6ESTA 3UIRA 4ZH8A 4CHAB 1QRWA 1Y3VA 4U32A 1P02A 4R0IA 4YTAA 3MI4A 1CE5A 2OCVB 4FUEA 1K1JA 4IBLH 3ESTA 1RIWB 3BTTE 1DANH 1C5OH 4JK6A 1LO6A 1GL1A 1QTFA 4BTTB 2WPKS 1KLTA 5T6DA 2QCYA 2HLCA 3PMBB 1S85A 1WBGB 3RXLA 4ASHA 3IITA 1NO9H 3EA9A 1JIRA 1UK2A 5SGAE 3UPEA 6GCHF 1QL7A 2C4FH 1O2KA 2F3CE 1K1NA 1Q31A 1RTKA 1GJ6A 4JZDH 1L4ZA 5JPMH 3F6UH 4H4FA 2VVVA 1DXPA 3T26A 1WSSH 4SGAE 5H4IB 3QLPH 3ZZCA 1DT2A 1P2OA 1UHBB 2RG3A 4D7FA 5HXFA 7KMEH 1XXDA 2A4QA 1TPPA 2CF9H 1TNIA 1F0SA 1E0FD 3TLOA 2FODA 1N1LA 2ZHFH 4B71A 2GX4A 4XBCA 4CBOA 1UTKA 4WWYA 1H8DH 5GPIB 3GY5A 4YT7H 1VCWA 3H7TA 1YCPM 5C67A 1XUJA 4JK5A 1UTMA 3PYHA 2Y6TA 1ZSJA 2ESTE 1Q2WA 3PTBA 1BCUH 1ACBE 1MTWA 2Q6FA 1O5CB 5C1YA 5L2ZH 2V35A 1VGCC 1CHGA 2XWBI 1GJ5H 4INHA 1V2NT 1IOEA 1S84A 1UTNA 1RJXB 1QQ4A 1KDQA 3Q00A 1NN6A 1W8BH 1O32A 2VH6A 3S9AA 3SOSA 4Y6DA 3VEQB 1GMDF 3PLPA 4CREA 1PPGE 3D23A 4X0WU 1TQ7B 4HZHA 1QL9A 1EOLA 1OYQA 5B6OA 1S5SA 1JRTA 3AAVA 3OU0A 1LHCH 1YP9A 2QXIA 4ABDA 1AE5A 1GHAF 2ZCKP 1FNIA 1EX3A 1C4U2 1A5HA 1C2KA 2A31A 2ANYA 1NC6A 3T25A 1A3EH 4E05H 2D8WA 1GJCB 3SJOA 1LMWB 3PO1B 1V2KT 4DY7B 1MBMA 1TGTA 2AIPA 4XBBA 7LPRA 1B7XB 4ZMAH 3LDXH 1EKBB 1O2HA 1OWJA 3GYMA 3FFGA 2GV7A 2C90B 1K2I1 1H9LB 1PQ8A 1D4PB 4ABEA 3SU4A 3A8CA 3S69A 3RMOH 1XXFA 2PKAB 1CHOF 1TAWA 1WQVH 1ZPCA 1C4V2 5AF9H 4AORA 2BY5X 1T7CA 1TRYA 4THNH 2BD8A 2ZGHA 2QXJA 3TJVA 1C2GA 1XUIA 4ABHA 5F8ZA 3HKIB 5FAHA 3RLYH 3AASA 2ODQA 3ODFA 1O2ZA 5TJXA 1OP0A 1VITH 1ELAA 3E0PB 1YPKH 2ZFSA 2FTMA 3T29A 4FVBA 2H5DA 5FHTA 5LPFA 1K1MA 1B0EA 1W7GH 1HFDA 1G3CA 1NFYA 1P2MA 1W0YH 4SGBE 1DFPA 1RD3B 2EI8A 4I8GA 1TPSA 2WUCA 1C5TA 1FN8A 5GWZA 1YPMH 1ZMJA 2BQ7B 3RMMH 1C1QA 1JRSA 1TBQH 4NIWA 1P3CA 3L33A 4BXSA 4NIYA 2W7SA 1DX5M 4E7NA 1DWBH 2OUAA 4J2YB 2GT8A 2VVCA 1C1RA 2OBOA 2PHBA 3KL6A 3MNCA 1O2LA 1YBWA 1L1JA 3BTGE 2EEKA 1C1MA 1NU7B 1AN1E 1TMTH 1MAYA 4K8YA 1G2MA 3UNQA 1FV9A 4YLQH 2ULLA 1O5EH 2Q1JA 4Q7ZA 2Z3DA 1T4VH 2ZZUH 5EW2H 2FOAA 1AKSB 1V2JT 2BY7X 2GCTC 1SVPA 1CGHA 3ATWA 4INLA 3SZNA 5LH8A 1QJ7B 4GCHG 1BBRK 3MNXA 4FUJA 1O2NA 1ZRKA 2TBSA 4F49A 1JIMA 1TNGA 1UTLM 1GHYH 2CMYA 2GD4B 4FUDA 1GBHA 2BY9X 1G9IE 3A85A 3GY2A 1Y59T 4ZKRU 3MU8A 1HJ9A 2IN2A 2OP9A 3A80A 2XBYA 1D9IA 3BTKE 5AVDA 5C20A 1C1NA 3PB1E 3BIUH 5FPTA 4NG9H 2XXLA 2ZU2A 1TMUH 1SBWA 1OWHA 1ELEE 1VCQA 2FOFA 2R3YA 3UNRA 4XBDA 1GJ4H 1YC0A 1Y3XA 4VGCC 4X6OA 4IC5A 1T31A 4NIVA 1DS2E 5EGMA 3T5FH 1ZMLA 2M5TA 5DP4A 4Y7AA 1C2EA 2STAE 2FI4E 3EA8A 3SUEA 1EAIA 5C3NA 4A1XA 1GHVH 2W5EA 1PPHE 1HJAC 1O3BA 1VITF 2QN5T 1TNKA 2D26C 2BLVA 2VWLA 2FS8A 1TNHA 1AVWA 1O5GH 3RXGA 1TQ0B 3MU0A 2A4RA 3Q3YA 2PKSB 5HGGA 1FQ3A 1XMNB 4IS5A 3TGIE 1CA0C 4KKDA 5JYIA 1G3BA 3BEUA 2VWMA 3AW1A 3MO9A 1O5BB 1OWKA 1RFNA 1KXDA 2FIRH 1GI6A 1UHBA 1W2KH 4OS5A 1FJSA 1SFIA 3RUOA 4IN1A 4F4OC 1TWXB 1ZSKA 1HIAB 1PQAA 2FI5E 5C1XA 3M36A 3QO6A 3A7XA 1FMGA 1O2RA 2CF8H 2BVXH 3V13A 4Z6AH 2H1UA 3LGTA 5IYTA 2OINA 1AZ8A 1ARBA 1HAGE 1ELBA 3SNBA 2TPIZ 1DITH 2ZPSA 1OX1A 4ZUHA 1BRCE 2FI3E 3QGNB 4E7RG 1K1PA 1MZDA 1O5DH 1GCDA 3SU2A 1ABIH 1CA0B 3PMHB 2PFEA 4GVUA 3OY5U 3S0NA 1O3IA 2AGIX 3RDZA 4K5ZA 1SOTA 2P59A 5E0HA 3BTFE 3URCA 1KY9A 1BUIA 1MKXH 5TCAA 1QBNA 5AHGH 2CV3A 3P8NA 5C5NA 1PJPA 2A4OA 2B7DH 2P8OC 1A4WH 1EOJA 1O2YA 3BIVH 4JYVH 1WUNH 3RXMA 1AUJA 1GBBA 5DP9A 4UFGH 4FUHA 5FPYA 2XC4A 2DUCA 3KQCA 4H42U 1MZAA 2J2UA 2SGQE 4D9QA 2FLBH 2OD3B 2WYGA 2Z9GA 2SGDE 2OLGA 1QB6A 5JDUB 2ASUB 2UWOA 4NFEA 5CMXH 2QXGA 1XKAC 1FDPA 4ABBA 4AB9A 1HAOH 3QTVH 5TCCA 1UCYE 3QZRA 3KIDU 2HWLB 5LPEA 1FY5A 1V2OT 2STBE 3ZVAA 2PKAA 3SUDA 2BHGA 3ATLA 3LONA 1WV7H 1TX6A 1P2IA 2BDYA 4X1SU 1UO6A 1AFEH 5EQSA 1YPJH 3SNEA 1YPHE 1K9OE 4X6PA 2PV9B 6GCHG 3VXFH 5HMAA 1KDQB 1FY3A 2ALPA 1UK3A 1TOCB 2BD9A 4XOJA 3K2UA 2P93A 5FX5A 2H5CA 3A83A 4KTSA 1MTNB 2BTCE 4JZEH 4X1PU 1KTTB 1YF4A 5A0AE 4RSPA 1C4Y2 3BN9A 1A0LA 1Z7KA 2JETC 3A8BA 2FX6A 2UWLA 3VGCC 4Y0ZE 3O8RA 1ARCA 1QURH 4TWWA 1OOKB 2EI7A 5JBTA 1ZOMA 2AGGX 1Z1JA 2FX4A 1OWDA 3EYDA 2PW8H 1FAXA 2VWOA 4X8TH 3RXUA 1TNLA 5K0HA 1O31A 1EUFA 1AI8H 3DT0H 4NZLA 4GHTA 1RS0A 1O3EA 1BIOA 4DIHH 5BRRE 3E3TA 2ZWLH 1A5IA 1YM0A 5T6GA 1GBCA 1N8OC 4Y10E 2ZP0H 3SHAH 1EATA 1JBUH 1GMDG 2ZIQH 1GJBB 2KAIB 2ANMH 1LHGH 3BTME 2AERH 3LGYA 3W95A 3R3GB 3V12A 1IQFA 3U69H 1TE0A 1C2IA 4X2WA 3HKJB 1C5SA 4A1TA 4B2BA 3FZDA 4X8UH 1O3LA 3RM0H 1VCPA 3MFJA 2QA9E 2XCNA 1WAYB 2ZDVH 3PMJA 3U98H 2B0FA 3SGBE 1S83A 1AU8A 1GBIA 4I8JA 5GJ4B 3O8BA 1P2NA 2OC0A 4H6TA 1BITA 3M3SA 1DLEA 1ANBA 1TA6A 3BTHE 4IN2A 3TK5A 3SV6A 3T27A 1OWEA 2XW9A 1CHOG 2ODPA 4WMFA 1BBRH 1OP2A 4NA7A 1MTSA 2Z7FE 4DCDA 1MUEB 1QA0A 1NTPA 3KQEA 4J1YA 5A2MH 3KNXA 3M5LA 1ESTA 3FP8E 1A0HB 1LTOA 4DT7B 3NPSA 4OGYA 2PLXA 1MKWH 3UREA 4BAMB 1AWHB 1EP6A 1MD7A 2BDBA 1OKXA 3SU1A 2OQ5A 1NESE 4XFQA 3E8LA 4A92A 1OYTH 3QK1A 4DGJA 1GDNA 3LGUA 5GCHF 1NU9A 1DLKB 3GY4A 4B2AA 2GMTC 1AFQC 4K1EA 1ZTLA 3MU1A 3Q77A 1AD8H 1O3NA 1YCPK 3T28A 3M7UA 2UUKB 1NY22 3TNTA 1DM4B 2P3TB 1S82A 1W0ZU 3RXIA 1GGDC 1HAIH 4X2YA 3PM3A 1DWCH 2FM2A 4LZ1H 1GBDA 1IQNA 1C2JA 1LPKB 1XM1A 3MYWA 1KXFA 2SFAA 1CBWB 4Y7BA 2G8TA 1ELTA 1C5YB 3ZZ4A 5DJ7A 1J14A 1GDQA 2ZU4A 1IQHA 3V7TA 2QGRA 1VR1H 5FBIA 1SQAA 3P70B 2Z9JA 1IQMA 1LCYA 3QDZB 1HIAA 1IQKA 1TGBA 1DUEA 3M61U 1LVBA 3MOCA 5AFYH 1V6DA 2XRCA 1EASA 1O3HA 2P94A 1C9TA 4FU7A 4X1RU 5LPRA 3E16B 1MTVA 1IQJA 1QGFA 1BTWA 1TX7A 1YPEH 2F91A 3LH3A 1A61H 4JCNA 3QUMP 1GI0A 1V3XA 3MH7A 4KELA 1E37B 1D3QB 3A82A 1QA7A 5JBCS 3MWIU 1GBLA 2OQUA 2A32A 1GG6C 1P2QA 2GGVB 3LJJA 1Z1IA 1K1IA 1IQLA 3BG4B 1SFQB 1BMLA 1KXCA 3LH1A 1HAHH 4ABGA 1AHTH 1MTUA 1J9CH 8GCHF 3JZ2B 2BVRH 3LJOA 2G5VA 1HAVA 1E38B 4BAQB 1SB1H 3AVZA 3SI4H 1O3CA 1ANCA 2ZECA 1GMHF 3Q3XA 1Y8TA 2BOHB 2BQ6B 4WMDA 2XBVA 5CHAC 2ZHDA 4WVPE 3HGNA 2PUXB 3A88A 2Z3CA 1LQDB 2PUQH 1MKXK 4UFFH 1Z8JB 1C5ZB 2ZQ1A 2CHAC 1SGEE 1EQ9A 3GY3A 1GBAA 1NPMA 1B5GH 1LVMA 4OS1A 5EQQA 4MNWA 8KME2 1EZXC 1YGCH 2R3UA 4Y76A 1SC8U 1MD8A 4UFEH 1F0UA 3LC3A 3EA7A 3VB7A 3SN8A 3SNDA 3P8OA 1GI9B 6CHAC 3M3TA 5FX6A 5DK1A 3BV9B 4GAWA 1ZSLA 3EDXB 3LGIA 1YPGH 4JYUH 2F9NA 4ISLA 2BXUH 1SGRE 3MTYA 2W3IA 3GCOA 2RA3A 5CHAB 1KXBA 5EPNA 2CGAA 2AIQA 9ESTA 1ELDE 1C5VA 2JH5D 1P3EA 2ZDLA 1C5XB 1WTGH 1ZR0A 1FLEE 4ZROA 1EJAA 1EZUC 4B1TA 5K7RA 1IQEA 2P3UB 3A7WA 3A7YA 4O3TA 3EAJA 2V3OH 3I77A 1VGCB 3G01A 1GBEA 3GICB 4E06H 2G4UA 1ABJH 4I32A 1RXPA 1TBRH 4KGAA 1N6XA 4Y8YA 2GTBA 4CH2B 1J16A 1ZJDA 2BD7A 1TYNA 3DFJA 1ORFA 3OYPA 1V2WT 1BTHH 1TOMH 2ZHWH 4AFZA 4CBNA 1V2ST 1BTZA 2KAIA 1FN6A 4I8KA 2XYAA 4HI3A 4I8HA 2NU1E 3GCNA 1C5LH 3RXDA 1O3GA 1XUHA 1ETRH 3U1JB 4Y8ZA 5F6MA 4DOQA 2C8YB 3FANA 3P95A 2HALA 3ATIA 1F0TA 4ABJA 1UVUH 2J95A 4OGXA 2ZU5A 1MQ6A 3STJA 4WXIA 3ZVCA 3OSYA 1QNJA 2FOBA 2Z3EA 1SGDE 2GP9B 1ZPBA 4YOGA 1HAPH 1TALA 5DP7A 1O35A 2SGEE 1NFXA 4B74A 3FP6E 1O37A 2BVSH 2PTNA 2AEIH 1EPTC 2BLOA 1QHRB 3ZZBA 2GCHF 1GVLA 3ZZ9A 1SLVB 4FXGH 2FESH 4IW4E 4MG3A 4MPXA 3QGJA 3A8AA 1L0ZA 3LGWA 1A46H 3T62A 2QC2A 4HGCA 3RLWH 2AH4X 1UVSH 1D3DB 1SGFG 4U2WA 1GI7B 1SLWB 1BTXA 1C5RA 1ZGIA 4OS6A 3MO6A 2F9BH 2PGBB 4GHQA 2HOBA 2QF0A 3F9EA 4AN7A 7GCHF 1P2JA 4Y11E 2ZI2H 2YNAA 1HUTH 1SGNE 2C8XB 1DY8A 2HVXA 1TB6H 3NKKA 3RXVA 3FAOA 4DURA 1L1NA 1TNJA 4ESTE 2DE9A 4KTUA 1ELFA 5DGJA 3DHKH 4ZKNU 1DWDH 5DKMA 3PTNA 2GDEH 4FU9A 3H5CB 1QR3E 1O2JA 2AMQA 4NA8A 2ZTZA 2R2WU 2FWWA 5E2PA 4IMQA 4WH6A 2VIDA 4JZIA 1O30A 1EAUA 2HNTF 1MKWK 2ZDNA 3M7QA 3OX7U 2YOLA 1YCPH 1KLJH 1TX8A 2VIPA 2H2ZA 1GCTC 3Q3KA 1PQ7A 3S9CA 2XBWA 1O5FH 3QZQA 2GCTB 1CU1A 1AZZA 4AGKA 4B2CA 2WYJA 1O2OA 1EAXA 4MPWA 2PSYA 2VNTA 4ZKSU 4BAHB 1MBQA 4CR5A 3CP7A 3I29A 1ZHRA 4U30A 2LPRA 4JYTA 4JMYA 2PGQB 8LPRA 3VPKA 1SG8B 3GDSA 2XCFA 3E6PH 1O3DA 1GVZA 3DFLA 3QX5H 4AG1A 4TY6A 1IHSH 1BTYA 1O2XA 4I33A 2BOKA 1FI8A 2O8MA 4NSYA 3QN7A 3W94A 3NZIA 3A7ZA 4INKA 1F5KU 2SGFE 2FYRA 4K60A 1GBFA 1HYLA 1A3BH 2BDIA 1PFXC 5AFZH 4D8NA 1DY9A 1CT2E 4VGCB 2R9PA 1YLDA 1XUKA 1NT1A 1L1GA 2WV4A 2EI6A 1SGFA 1HAYB 1YKTA 1GMCF 4LK4A 1S6FA 1UJ1A 2ZTXA 4BAOB 3HPTB 4X6NA 3MMGA 1HJAB 4ZAEA 2UWPA 3BTWE 2V0BA 5L2YH 1GHWH 4O97A 1C1PA 5I46H 3BTQE 5EXNA 1JOUB 3SNCA 5GCHG 3RXEA 5A0CA 1K21H 1Y5UT 3TU7H 1PPBH 1T4UH 1TRNA 4DW2U 1V2TT 3NWUA 1LVYA 4GSOA 1NRQH 1NRRH 4YOJA 1Z71A 2DE8A 4A1VA 3NCLA 1K28D 3U8OH 4AYYB 1SMFE 4A7IB 2F9OA 3MH4A 3LU9B 3P6ZB 2ZCHP 1AVXA 5EODA 2BDGA 2TIOA 3TH2H 1O3FA 3VB3A 1DPOA 2B5TB 1Z8IB 3N7OA 1HAVB 2IOTA 1FIZA 1DDJA 1EB1H 1QJ6B 4YM9A 1UTOA 1O3KA 3D49H 4XE4A 3TJOA 3UFAA 5L30H 3TPIZ 2G51A 3LIWA 1SPJA 3ELAH 1H1BA 3A84A 1GDUA 1W12U 4R8TB 2H9HA 1G3DA 4NGAH 1V2MT 1P2KA 1P06A 1GI8B 4Q2KA 3SJ8A 3ATMA 1WYKA 2ZF0H 3SHCH 5EW1H 2P8OB 4DJZB 1FY4A 5BPEA 1IAUA 2ZO3H 1HB0B 4H6SB 5J4QA 1ELGA 1P9UA 2W3KA 4JZ1A 1EP5A 2ZGXH 4CRAA 2C93B 3SQHE 1QCPA 5GIBA 8GCHG 3SUGA 2CXVA 4DVAU 1C1VH 1P12E 1UVOA 1QL8A 3ZZ8A 3TH3H 1ESAA 2J4IA 3SBKA 2BQWB 1S0QA 1TONA 2VGCC 2HPQH 1GMHG 1GPZA 1V2RT 4NZQA 4Q80A 2HNTC 5PTPA 3GY8A 1QRZA 3E1XB 4FUGA 3QTOH 3ZVGA 1WCZA 4MNYA 1W13U 3HGPA 1ZRBA 1DE7H 3LKWA 5JB8S 2O8LA 2PWXA 3QWCH 3GDUA 4UE7H 1EXFA 1V2QT 1LPGB 1O38A 1C5PA 3JZ1B 3SU0A 1O39A 2VIQA 1V2PT 2PTCE 3MNSA 1SQTA 2A2XH 4Q7XA 1RTFB 1UVPA 3RXBA 1IQGA 1P0SH 3MNBA 2AGEX 1OPHB 2TRMA 1F2SE 2FZZA 4K1SA 3WY8A 4K8BA 3MH5A 2W7UA 1TIOA 4AYVB 3NK8A 3LPRA 3ZZAA 5E0GA 2Y7ZA 4LXBH 1G32B 2JH6D 1VJ9U 1PQ5A 1SR5C 4LZ4B 1HAXB 2LNCA 2FTLE 3KHVA 2A5AA 2NU2E 1ZPZA 1NZQH 3GYLB 4MNVA 3TH4H 4ABFA 3FVFB 1GHBF 2C8ZB 2JETB 2Y7XA 4X8VH 1BTPA 1P9SA 4YLUA 1KTSB 2JH0D 3VGCB 3TGKE 2TGTA 1V2LT 2ZHQH 1TGSZ 1LQEA 5C2ZA 2FPZA 2A7CA 3VXEH 3DA9B 1GL0E 1LKBA 1SGIB 1AY6H 3F68H 1KIGH 4RKOB 3R0FA 1GHAG 1EPTA 2ZKSA 3LC5A 3IWMA 3MU4A 4I8LA 5DP3A 4Y71A 2ZFPH 2PR3A 2J94A 1F7ZA 3I78A 2ZDKA 3KF2A 1AGJA 2FLRH 3SQEE 1N6YA 3SGAE 2VINA 4Z0KA 2BYAX 5ETXA 3SV8A 2UUYA 3LGVA 2Q6GA 5EU8A 3OTJE 4CRDA 3VB6A 1N8OB 3LOXA 1GJ8B 2AMDA 1ZZZA 1SHYA 1C1UH 1C2FA 1DWEH 3UOPA 4NSVA 1E36B 4FUFA 1F5LA 1RGQA 3TVJB 4ZXXH 3PLKA 3SV7A 3LT3A 1TGNA 1M9UA 1O3PB 2I6QA 2G52A 2Y81A 1HLTH 1BRBE 3PWBA 1GI1A 2FOCA 3UQOA 2O9QA 2GT7A 3KN2A 4PROA 1DVAH 3BTEE 1MH0A 1C2DA 2JKHA 2ZFRH 1SGPE 1ZMNA 3RC5A 1G30B 3KQDA 4I7YH 4IGDA 4BXWA 4FUBA 4JZFH 3E0NB 3M37A 1V2VT 4TY7A 5F8XA 4UD9H 1P57B 3UY9A 2G55A 2BD5A 1Z8RA 1GI3A 4NFFA 2GCHG 2ZQ2A 4DIIH 2A2QH 4Y79A 4CHAC 1ELVA 2F9VA 1HPGA 3RXAA 2D2DA 1O2TA 1UTJA 1T8NA 1BRAA 1CGJE 1KLIH 1RIWC 1ZLRA 5DG6A 2ALVA 1PYTD 3P92A 4UEHH 4OS7A 3O8CA 1C1TA 4Y0YE 4DG4A 3ZV8A 3M5OA 1AB9C 1Q3XA 5A8YA 1Y3YA 1O3AA 1PPCE 2GMTB 2WINI 5ESTE 2BY8X 1AFQB 1FIWA 2BLWA 2GZ9A 1GHXH 5JBBS 1O3MA 3RXRA 4D76A 3TK9A 1G3EA 3MHWU 2C8WB 1G36A 3S7HB 3RXTA 1IQIA 1O2GH 1GGDB 3URDA 1C9PA 1O2WA 2J38A 2Y5HA 3SGQE 1DICA 2ZA5A 2ZGBH 5EXMA 1K1OA 2BZ6H 2WPIS 1QRXA 2ANKH 3P8GA 3S9BA 1HAZB 1AUTC 2BX3A 2FOHA 5GXPA 5DPAA 1BRUP 2Y80A 2O8TA 3M7TA 1EB2A 1PPFE 1XKBC 1WQSA 1DOJA 2OC8A 3TK6A 2Z9LA 4AZ2B 2A7HA 4CRCA 1P09A 1V2UT 1O2QA 1UTPA 3BG8A 1AB9B 1GBKA 2ZFFH 3K9XB 5L6NH 2GZ7A 4AFSA 4RN6A 1TMBH 1THRH 3RXHA 1D6RA 2QF3A 1CA8B 3PROA 2FEQH 3ZZ6A 4CRFA 1O33A 5F8TA 4O03A 3A86A 2Z6BD 3NXPA 5HYOA 3UOUA 1YLCA 4GUXA 3BF6H 1CSOE 1C5QA 3ITIA 2ZPQA 3RC4A 2F9UA 5FCKA 4AFQA 4UDWH 2WPLS 3TITA 1GG6B 2Q6DA 2Z9IA 2C3SA 1VITG 1OSSA 1BJUA 1QFKH 4X2VA 2XNIA 2A5KA 4NWKA 1GJDB 1DSUA 1P01A 3ODDA 4XDEA 2ZNKH 2B8OH 3UWIA 3IG6B 4AOQA 2XC0A 4A5TS 3GOVB 3A7TA 3U8RH 3ZV9A 5JBAS 2BDHA 3PO1C 5EXLA 4UONA 4B75A 2W26A 1GBTA 2Z94A 2ZGJA 5E0JA 3SV9A 2FMJA 1WOFA 3U8TH 2BXTH 2CHAB 2ILNA 1GMCG 2ZCLP 5C5OA 4UFDH 1NROH 1P03A 4TWYA 1T8LA 3B23B 2OTVA 5FXLA 3STIA 3UWJH 3ZZDA 4YT6H 3TJUA 1INCA 2BLQA 3GY6A 4HFPB 1THSH 1Y3UA 1ETSH 3GCTF 3BTDE 6CHAB 1GI4A 3SW2B 1T8MA 1CVWH 2OXSA
chains in the Genus database with same CATH superfamily
1QBOA 3UQVA 1A1RA 1ESBA 1BQYA 1A7SA 1XVMA 3BSQA 3KYGA 3PMAB 4GPGA 2IPHA 1XX9A 2O8WA 3TJNA 2YMSB 1HCGA 2QIQA 1GWAA 2Y5GA 3P17H 2UUFB 4FVDA 3GISB 1BBRE 2P95A 1ETTH 4B76A 3SI3H 3M35A 1MAXA 1G37A 3HK6B 1BOQA 1SGQE 2NWNA 5FBEA 1BZXE 1TPOA 2H9TH 1L4DA 4WY3A 1OWIA 1OXGA 3F1SB 1ZGVA 3MH6A 1GJ9B 4QT8C 3TIUA 1AO5A 3RU4D 1H9IE 3RMNH 1C1SA 1FZZA 2I6SA 1RRKA 2A5IA 2GV6A 2J98A 2WHXA 3SJ9A 1NS3A 4RT1A 3VB5A 5C1UA 5GDSH 3A89A 5DP6A 4ZXYH 4IC6A 1BMMH 1NFUA 1UCYH 3F9FA 1W3CA 3B8JA 3RMLH 3ZVBA 2KCOA 4FU8A 1P10A 1O3OA 1NBMD 4B6EA 3RXSA 1ZYOA 1UVTH 2HGTH 1FONA 2ZGCA 5DP5A 4ISNA 4GLYA 4WJG2 3SJIA 3L6PA 2XWAA 1O34A 4TYDA 1ZHPA 4XSKU 4BTIB 8ESTE 1LVOA 1BB0B 4ZHAA 1YLNA 1FXYA 1XUFA 1LPZB 1FY8E 1FAKH 4WH8A 4X6MA 2G5NA 1BMNH 1QY6A 3ZVEA 2V7QD 4CRBA 4ABIA 1EZSC 4X2XA 2ANWA 1SQRA 1LHFH 1ZTKA 3VB4A 4X8SH 4BANB 1BMAA 1C1OA 2K1QA 3C27B 3MU5A 3RXCA 2FOGA 1GHZA 1AMHA 3GY7A 2ZPRA 1ZHMA 1EPTB 4M7GA 5A0BA 1J15A 4YOIA 2VJ1A 3RP2A 1T32A 1Z6EA 4ISOA 2F83A 4CRGA 1PPZA 3VG8A 5IDKA 4MPUA 5KECA 3P8FA 2VWNA 1O5AB 5DO4H 1O2UA 2AYWA 1W11U 3KQBA 1BA8B 1J8AA 5CE1A 1SQOA 3DUXH 1PPEE 2J9NA 1TABE 1SHHB 5A8XA 4CH8B 2BDAA 4RKJB 5A09A 3K6YA 1HNEE 3PV4A 1A0JA 5LGOA 4Q7YA 3EGKH 2A4GA 1HXFH 2RA0A 2BD2A 2L6OA 2WPJS 2H9EH 2ZFQH 3K6ZA 4MDSA 3BEFB 2Y5FA 2TGAA 3KGPA 1GHBG 4NCYA 4ACAA 2PKSC 1SGCA 3SO3A 1DSTA 2GKVE 1AWFH 3A7VA 1QIXB 1A5GH 2KFWA 3U9AH 4D7GA 3RXOA 4ZHLU 3SUFA 3ZVFA 3A81A 1HGTH 5EG4A 2BZAA 2F9PA 1AQ7A 4ZCNA 3RXJA 2VIOA 4KP0A 4MNXA 3VFEA 3EE0B 1GI2A 2EY4C 1YY3A 1C2LA 2VVUA 5T3HA 3ENSB 3RXPA 1TLDA 1HDTH 4K3JA 1GCTB 1VZQH 1TPAE 2FOEA 2NU3E 2SNWA 4B73A 5ESBA 2OBQA 4U01A 1MU6B 1NRNH 2QXHA 3RXKA 2NU4E 1KXEA 5T6FA 2G4TA 1AE8H 5CDFE 2BDCA 4IMZA 2RDLA 3ZZ3A 2A7JA 2GZ8A 5ABWA 3F9HA 4FUCA 1K1LA 3WW7A 2ZDMA 1LHDH 2Y82A 1O2PA 3L3TA 4BOHA 1ANEA 3HATH 3RXFA 2GDDA 4BNRA 1DXWA 1EJNA 1LHEH 1O0DH 3SU5A 1CO7E 2ZHEH 1CT4E 2BY6X 5HM2A 4O9VA 2AS9A 2HNTE 3M5MA 1THPB 2RCEA 2VB0A 4BAKB 4YESB 1Y3WA 2GVFA 2UUJB 1BHXF 2XNDD 4WF8A 3UTUH 4WXVA 3ZYDA 1NRPH 1JXPA 2KCPA 4MLFB 3SYJA 1U6QA 4Y8XA 4TPIZ 4MTBA 1BDAA 1SLXB 2FDAA 2R2MB 1E35B 3CS7A 4I31A 3AAUA 2QY0B 2SGAA 3FZZA 1H4WA 1JWTA 1D3TB 1NM6A 2J92A 5G4BA 3SNAA 4MPVA 4MQAA 1H8IH 1ID5H 3PLBA 1LKAA 3U1IB 1C5NH 3SU6A 6LPRA 2SGPE 4OM9A 2THFB 3GDVA 4TSFD 2XTTB 3AW0A 2J34A 1WU1A 1RTLA 3UNSA 3RXQA 3ZYEA 1OHHD 2TGPZ 3ZVDA 1K22H 2FOMB 1O2MA 2VIVA 1NFWA 1P04A 1MMJN 3D62A 2P16A 1FY1A 2B9LA 1MCVA 1HV7A 2G00A 2EC9H 1UMAH 3TNSA 1S81A 4LOYH 1C5WB 1ZTJA 1S6HA 1CGIE 1BJVA 2ZDAH 3PWCA 2ODYB 1MTNC 4NWLA 1GJ7B 3GCHC 1Y5BT 2ZTYA 4YXWD 3KQ5A 5EPYA 1GVKB 1QB9A 3ZZ5A 4AFUA 3F0OA 3TGJE 1PYTC 2W6ID 4WMEA 1W14U 5FPSA 3ZZ7A 2KCYA 2PSXA 1EAWA 2VH0A 3MO3A 5EOKA 1C2HA 3PV2A 2HPPH 1QQUA 2BD3A 1Z8GA 2ZFTA 1O2SA 5I25A 2OC1A 3RM2H 3KEEA 4BTUB 2VIWA 5HM9A 1P8VC 2FO9A 2ZG0H 2Z9KA 3Q76A 3FP7E 4AX9H 1W0JD 1EZQA 1VKYA 3SV2H 3RC6A 3GCHB 1BT7A 2HRVA 2BMGB 4OS2A 5F53A 2FXRA 2AMPA 4AGJA 1P11E 3EE7A 4TPYA 1XUGA 4MVNA 4ZKOU 3OY6U 3RU4T 3N99A 4GCHF 2A1DB 3M3VA 4OS4A 4AB8A 1KXAA 1X7AC 4YZUA 3CENA 1SSXA 4XD7D 3A87A 5E2OA 3S7KB 1D6WA 2VGCB 4YO9A 2FYQA 2WPMS 2QYIA 1FUJA 2G81E 3OAAD 3O8DA 1D3PB 1ZJKA 2P3FH 2QAAA 1BTUA 1C2MA 2V3HH 1SL3A 3K65B 3F9GA 1UCYK 1O2IA 4ISHH 1H9HE 1B0FA 1YYY1 1SI5H 2WPHS 1FPCH 3D65E 3DD2H 4D9RA 4K1TA 1TRMA 1XVOA 3ATKA 5DP8A 1O3JA 5F03A 3RU4E 1F0RA 1OS8A 1T8OA 2BM2A 2VU8E 1EJMA 1AKSA 1W10U 3UUZA 1FPHH 1SOZA 3GCTG 5J4SA 4NA9H 1AIXH 1C1WH 1GBJA 1GBMA 1OP8A 1TA2A 2BD4A 5EIYA 1L2EA 1S0RA 1TBZH 1YPHC 2FS9A 1MCTA 1QBVH 1NBME 2CN0H 2ZC9H 1A2CH 3EQ0H 2R0KA 5E8EH 3UR9A 3C1KA 3V3MA 1TFXA 2A0QB 1Y5AT 1YPLH 4TT3D 1JMOH 1UTQA 1AVGH 1LDTT 2WV5A 3CS0A 2IPQX 5A8ZA 2XBXA 4KTCA 5EQRA 1O2VA 1CT0E 3DCLA 2R0LA 3E90B 1CBWC 1C5UA 1WTHD 2ZEBA 4CR9A 2IJOB 2OC7A 1C5MD 1QB1A 3F2HA 1SGTA 3BEIB 4K2YA 4AG2A 1G2LA 3FN8A 2BB4A 1F5RA 3UR6A 2H6MA 1ANDA 1IHTH 1HJ8A 3H7OA 1VJAU 2TGDA 2WUBA 1MQ5A 3SU3A 1MU8B 1KYNA 3PV5A 2ZU1A 3B9FH 1HRTH 2XC5A 2SNVA 3KCGH 1DUAA 1E1QD 2FP7B 3SORA 3T2NA 3E91A 4O3UA 3A8DA 2EA3A 1GJAB 5JB9S 1O36A 2ZU3A 2AFQB 1UK4A 2BX4A 2NU0E 2JDID 1BHXB 1ELCA 4ISIH 1KSNA 3V0XA 4ZHMU 4ABAA 9LPRA 1CQQA 3NUMA 7ESTE 4A6LA 2KM0A 5FCRA 2V6NA 1E34B 1F92A 7GCHG 1TGCA 3BG4C 4FUIA 2QV1A 2D1JA 4K69A 1GI5A 1SGYE 1HXEH 2A45B 1J17T 1Z6JH 2O8UA 3M5NA 3HK3B 1P05A 4HTCH 4NIXA 4X1QU 3SJKA 1HBTH 1QJ1B 1SLUB 2YNBA 4X1NU 1W7XH 2CJIA 1NRSH 6ESTA 3F0PA 3UIRA 4ZH8A 1E79D 4CHAB 1QRWA 1Y3VA 4U32A 1P02A 4R0IA 4YTAA 3MI4A 1CE5A 2OCVB 4FUEA 1K1JA 4IBLH 3ESTA 1RIWB 3BTTE 1DANH 1C5OH 4JK6A 1LO6A 1GL1A 3MQKC 1QTFA 4BTTB 2WPKS 1KLTA 1S6LA 5T6DA 2QCYA 2HLCA 3PMBB 1S85A 1WBGB 3RXLA 4ASHA 3IITA 1NO9H 3EA9A 1JIRA 1UK2A 5SGAE 3UPEA 6GCHF 1QL7A 2C4FH 1O2KA 2F3CE 1K1NA 1Q31A 1RTKA 1GJ6A 4JZDH 1L4ZA 5JPMH 3F6UH 4H4FA 2VVVA 4HG6A 1DXPA 3T26A 1WSSH 4SGAE 5H4IB 3QLPH 3ZZCA 2IJD1 1DT2A 1P2OA 1UHBB 2RG3A 5EJLA 4D7FA 5HXFA 7KMEH 1XXDA 2A4QA 1TPPA 2CF9H 1TNIA 1F0SA 1E0FD 3TLOA 2FODA 1N1LA 2ZHFH 4B71A 2GX4A 4XBCA 4CBOA 1UTKA 4WWYA 1H8DH 3OEHD 5GPIB 3GY5A 4YT7H 1VCWA 3H7TA 1YCPM 5C67A 1XUJA 4JK5A 1WXRA 1UTMA 3PYHA 2Y6TA 1ZSJA 2ESTE 1Q2WA 3PTBA 1BCUH 1ACBE 1MTWA 2Q6FA 1O5CB 5C1YA 5L2ZH 2V35A 1VGCC 2HLDD 1CHGA 2XWBI 1GJ5H 4INHA 1V2NT 1IOEA 1S84A 1UTNA 1RJXB 1QQ4A 1KDQA 3Q00A 1NN6A 1W8BH 1O32A 2VH6A 3S9AA 3SOSA 4Y6DA 3VEQB 1GMDF 3PLPA 4CREA 1PPGE 3D23A 4X0WU 1TQ7B 4HZHA 1QL9A 1EOLA 1OYQA 5B6OA 1S5SA 1JRTA 3AAVA 3OU0A 1LHCH 1YP9A 2QXIA 4ABDA 1AE5A 1GHAF 2KX4A 2ZCKP 1FNIA 1EX3A 1C4U2 1A5HA 1C2KA 2A31A 2ANYA 1NC6A 3T25A 1A3EH 4E05H 2D8WA 1GJCB 3SJOA 1LMWB 3PO1B 1V2KT 4DY7B 1MBMA 1TGTA 2AIPA 4XBBA 7LPRA 1B7XB 4ZMAH 3LDXH 1EKBB 1O2HA 1OWJA 3GYMA 3FFGA 2GV7A 2C90B 1K2I1 1H9LB 1PQ8A 1D4PB 4ABEA 3SU4A 3A8CA 3S69A 3RMOH 1XXFA 2PKAB 1CHOF 1TAWA 1WQVH 1ZPCA 1C4V2 5AF9H 4AORA 2BY5X 1T7CA 1TRYA 4THNH 2BD8A 2ZGHA 2QXJA 3TJVA 1C2GA 1XUIA 4ABHA 5F8ZA 3HKIB 5FAHA 3RLYH 3AASA 2ODQA 3ODFA 1O2ZA 5TJXA 1OP0A 1VITH 1ELAA 3E0PB 1YPKH 2ZFSA 2FTMA 3T29A 4FVBA 2H5DA 5FHTA 5LPFA 1K1MA 1B0EA 1W7GH 1HFDA 1G3CA 1NFYA 1P2MA 5DSFA 1W0YH 4SGBE 1DFPA 1RD3B 2EI8A 4I8GA 1TPSA 2WUCA 1C5TA 1FN8A 5GWZA 1YPMH 1ZMJA 2BQ7B 3RMMH 1C1QA 1JRSA 1TBQH 4NIWA 1P3CA 3L33A 4BXSA 4NIYA 2W7SA 3WWBA 1DX5M 4RT0A 4E7NA 1DWBH 2OUAA 4J2YB 2GT8A 2VVCA 1C1RA 2OBOA 2PHBA 3KL6A 3MNCA 1O2LA 1YBWA 1WDIA 1L1JA 3BTGE 2EEKA 1C1MA 1NU7B 1AN1E 1TMTH 1MAYA 4K8YA 1G2MA 3UNQA 1FV9A 4YLQH 2ULLA 1O5EH 2Q1JA 4Q7ZA 2Z3DA 1T4VH 2ZZUH 5EW2H 2FOAA 1AKSB 1V2JT 2BY7X 2GCTC 1SVPA 3WWFA 1CGHA 3ATWA 4INLA 3SZNA 5LH8A 1QJ7B 3ZIAD 4GCHG 1BBRK 3MNXA 4FUJA 4Q63A 1O2NA 1ZRKA 2TBSA 4F49A 1JIMA 1TNGA 1UTLM 1GHYH 2CMYA 2GD4B 4FUDA 1GBHA 2BY9X 1G9IE 3A85A 3GY2A 1Y59T 4ZKRU 3MU8A 1HJ9A 2IN2A 2OP9A 3A80A 2XBYA 1D9IA 3BTKE 5AVDA 5C17A 5C20A 1C1NA 3PB1E 3BIUH 5FPTA 4NG9H 5C0UA 2XXLA 2ZU2A 1TMUH 1SBWA 1OWHA 1ELEE 1VCQA 2FOFA 2R3YA 3UB0A 3UNRA 4XBDA 1GJ4H 1YC0A 1Y3XA 4VGCC 4X6OA 4IC5A 1T31A 4NIVA 1DS2E 5EGMA 3T5FH 1ZMLA 2M5TA 5DN6D 5DP4A 4Y7AA 1C2EA 2STAE 2FI4E 3EA8A 3SUEA 1EAIA 5C3NA 4A1XA 1GHVH 2W5EA 1PPHE 1HJAC 1O3BA 1VITF 2QN5T 1TNKA 2D26C 2BLVA 2VWLA 2LP6A 2FS8A 1TNHA 1AVWA 1O5GH 3RXGA 1TQ0B 3MU0A 2A4RA 2QF5A 3Q3YA 2PKSB 5HGGA 1FQ3A 1XMNB 4IS5A 3TGIE 4DT4A 1CA0C 4KKDA 5JYIA 1G3BA 3BEUA 2VWMA 3AW1A 2XOKD 3MO9A 1O5BB 3DSGA 1OWKA 1RFNA 1KXDA 2OK5A 2FIRH 1GI6A 4P02A 1UHBA 1W2KH 4OS5A 5EJ1A 1FJSA 1SFIA 3RUOA 4IN1A 4F4OC 1TWXB 1ZSKA 1HIAB 1PQAA 2FI5E 5C1XA 3M36A 3QO6A 3A7XA 1FMGA 1O2RA 2CF8H 2BVXH 3V13A 3FO8D 4Z6AH 2H1UA 3LGTA 5IYTA 1KMHB 2OINA 1AZ8A 1ARBA 1HAGE 1ELBA 3SNBA 2TPIZ 1DITH 2ZPSA 1OX1A 4ZUHA 1BRCE 2FI3E 3QGNB 4E7RG 1K1PA 1MZDA 1O5DH 1GCDA 3SU2A 1ABIH 1CA0B 3PMHB 2PFEA 4GVUA 3OY5U 3S0NA 1O3IA 2AGIX 3RDZA 4K5ZA 1SOTA 2P59A 5E0HA 3BTFE 3URCA 1KY9A 1BUIA 1MKXH 5TCAA 1QBNA 5AHGH 2CV3A 3P8NA 5C5NA 1PJPA 2A4OA 2B7DH 2P8OC 1A4WH 1EOJA 1O2YA 3BIVH 4JYVH 1WUNH 5HIYA 3RXMA 1AUJA 1GBBA 5DP9A 4UFGH 4FUHA 5FPYA 2XC4A 2DUCA 3KQCA 2HVYB 4H42U 1MZAA 2J2UA 2SGQE 4D9QA 2FLBH 2OD3B 2WYGA 2Z9GA 2SGDE 2OLGA 1QB6A 5JDUB 2ASUB 2UWOA 4NFEA 5CMXH 2QXGA 1XKAC 1FDPA 4ABBA 4AB9A 1HAOH 3QTVH 1K0HA 5TCCA 1UCYE 3QZRA 3KIDU 2HWLB 2V3MA 5LPEA 1FY5A 1V2OT 3F2FA 5T1VA 2STBE 3ZVAA 2PKAA 3SUDA 2BHGA 3ATLA 3LONA 1WV7H 1TX6A 1P2IA 2BDYA 4FETA 4X1SU 1UO6A 1AFEH 5EQSA 1YPJH 3SNEA 1YPHE 1K9OE 4X6PA 2PV9B 6GCHG 3VXFH 5HMAA 1KDQB 1FY3A 2ALPA 1UK3A 4I86A 1TOCB 2BD9A 4XOJA 3K2UA 2P93A 5FX5A 2H5CA 3A83A 1MABB 4KTSA 1MTNB 2BTCE 4JZEH 4X1PU 1KTTB 2WZQA 1YF4A 5A0AE 4RSPA 1C4Y2 3BN9A 1A0LA 1Z7KA 2JETC 3A8BA 2FX6A 2UWLA 3VGCC 4Y0ZE 3O8RA 1ARCA 1QURH 4TWWA 1OOKB 2EI7A 5JBTA 1ZOMA 2AGGX 1Z1JA 2FX4A 1OWDA 3EYDA 2PW8H 1FAXA 2VWOA 4X8TH 3RXUA 1TNLA 5K0HA 1O31A 5GNDA 1EUFA 1AI8H 3DT0H 3OFND 4NZLA 4GHTA 1RS0A 1O3EA 1BIOA 4DIHH 5BRRE 3E3TA 2ZWLH 1A5IA 1YM0A 5T6GA 1GBCA 1N8OC 4Y10E 2ZP0H 3SHAH 1EATA 1JBUH 1GMDG 2ZIQH 1GJBB 2KAIB 2ANMH 1LHGH 3BTME 2AERH 3LGYA 3PRDA 3R3GB 3V12A 1IQFA 3U69H 1TE0A 1C2IA 4X2WA 2JIZD 3HKJB 1C5SA 4A1TA 4B2BA 3FZDA 4X8UH 1O3LA 3RM0H 1VCPA 2F43B 3MFJA 2QA9E 2XCNA 1WAYB 2ZDVH 3PMJA 3U98H 2B0FA 3SGBE 2KCAA 1S83A 1AU8A 1GBIA 3CNRA 4I8JA 3O8BA 5GJ4B 1P2NA 2OC0A 4H6TA 1BITA 3M3SA 1DLEA 1ANBA 1TA6A 3BTHE 4IN2A 3TK5A 3SV6A 3T27A 1OWEA 2XW9A 3FKSD 1CHOG 2ODPA 4WMFA 1BBRH 1OP2A 4NA7A 1MTSA 2Z7FE 4DCDA 1MUEB 1QA0A 1NTPA 3KQEA 4J1YA 5A2MH 3KNXA 3M5LA 1ESTA 3FP8E 1A0HB 1LTOA 4DT7B 3NPSA 4OGYA 2PLXA 1MKWH 3UREA 4BAMB 1AWHB 1EP6A 1MD7A 2BDBA 1OKXA 3SU1A 2OQ5A 1NESE 4XFQA 3E8LA 4A92A 1OYTH 3QK1A 4DGJA 1GDNA 3LGUA 5GCHF 1NU9A 1DLKB 3GY4A 4B2AA 2GMTC 1AFQC 4K1EA 1ZTLA 3MU1A 3Q77A 1AD8H 1O3NA 1YCPK 3T28A 3M7UA 3GS9A 2UUKB 1NY22 3TNTA 1DM4B 1QZ8A 2P3TB 1S82A 1W0ZU 3RXIA 1GGDC 2W6JD 1HAIH 4X2YA 3PM3A 1DWCH 2FM2A 4LZ1H 1GBDA 1IQNA 1C2JA 1LPKB 1XM1A 3MYWA 1KXFA 2SFAA 1CBWB 4Y7BA 2G8TA 1ELTA 1C5YB 3ZZ4A 5DJ7A 1J14A 1GDQA 2ZU4A 1IQHA 3V7TA 2QGRA 1VR1H 5FBIA 1SQAA 3P70B 2Z9JA 1IQMA 1LCYA 3QDZB 1HIAA 1IQKA 1TGBA 1DUEA 1BMFD 1LVBA 3M61U 3MOCA 5AFYH 1V6DA 2XRCA 1EASA 1O3HA 2P94A 1C9TA 4FU7A 4X1RU 5LPRA 3E16B 1MTVA 1IQJA 1QGFA 1BTWA 1TX7A 1YPEH 2F91A 3LH3A 1A61H 4JCNA 1E1RD 3QUMP 1GI0A 1V3XA 3MH7A 4KELA 1E37B 1D3QB 3A82A 1QA7A 5JBCS 3MWIU 1GBLA 2OQUA 2A32A 1GG6C 1P2QA 5KGOA 2GGVB 3LJJA 1Z1IA 1K1IA 1IQLA 3BG4B 4XRNA 1SFQB 4FOUC 1BMLA 1KXCA 3LH1A 1HAHH 4ABGA 1AHTH 1MTUA 2GJGA 1J9CH 8GCHF 2L74A 3JZ2B 2BVRH 3LJOA 2G5VA 1HAVA 1E38B 4BAQB 1SB1H 3AVZA 3SI4H 1O3CA 1ANCA 2ZECA 1GMHF 3Q3XA 1Y8TA 2BOHB 2BQ6B 4WMDA 2XBVA 5CHAC 2ZHDA 4WVPE 3HGNA 2PUXB 3A88A 2Z3CA 1LQDB 5C94A 2PUQH 1MKXK 4UFFH 1Z8JB 4AC9A 1C5ZB 2ZQ1A 2CHAC 1SGEE 1EQ9A 3GY3A 1GBAA 1NPMA 1B5GH 1LVMA 4OS1A 5EQQA 4MNWA 8KME2 1EZXC 1YGCH 2R3UA 4Y76A 1SC8U 1MD8A 2M2AA 4UFEH 1F0UA 3LC3A 3EA7A 3VB7A 3SN8A 3SNDA 3P8OA 1GI9B 6CHAC 3M3TA 5FX6A 5DK1A 3BV9B 4GAWA 1ZSLA 2CK3D 3EDXB 3LGIA 1YPGH 4JYUH 2K0QA 2F9NA 4ISLA 2BXUH 1SGRE 3MTYA 2W3IA 3GCOA 2RA3A 5CHAB 1KXBA 2KZ4A 2CGAA 2YMSC 5EPNA 2AIQA 9ESTA 1ELDE 1C5VA 2JH5D 1P3EA 2ZDLA 4ASUD 1C5XB 1WTGH 1ZR0A 1FLEE 4ZROA 1EJAA 1EZUC 4B1TA 5K7RA 2WV9A 2EQNA 1IQEA 2P3UB 3A7WA 3A7YA 2F4LA 4O3TA 3EAJA 2V3OH 3I77A 1VGCB 3KYFA 3G01A 1GBEA 3GICB 4E06H 2G4UA 1ABJH 4I32A 3SZEA 1RXPA 1TBRH 4KGAA 1N6XA 4Y8YA 2GTBA 4CH2B 1W0KD 1J16A 1ZJDA 2BD7A 1TYNA 3DFJA 1ORFA 3OYPA 1V2WT 1BTHH 1TOMH 2ZHWH 4AFZA 4CBNA 1V2ST 1BTZA 2KAIA 1UW7A 1FN6A 2RDEA 4I8KA 2XYAA 4HI3A 4I8HA 2NU1E 3GCNA 1C5LH 3RXDA 1O3GA 1XUHA 1ETRH 3U1JB 4Y8ZA 5F6MA 4DOQA 2C8YB 3FANA 3P95A 2HALA 3ATIA 1F0TA 4ABJA 1UVUH 2J95A 4OGXA 2ZU5A 1MQ6A 3STJA 4WXIA 3ZVCA 4Q4LA 1YWUA 3OSYA 1QNJA 2FOBA 2Z3EA 1SGDE 2GP9B 1ZPBA 4YOGA 1HAPH 1TALA 5DP7A 1O35A 2SGEE 4RI0A 1NFXA 2JJ1D 4B74A 3FP6E 1O37A 2BVSH 2PTNA 2AEIH 1EPTC 2BLOA 5KEDA 1QHRB 3ZZBA 2GCHF 1GVLA 3ZZ9A 1SLVB 4FXGH 2FESH 4IW4E 4MG3A 4ACBA 4MPXA 3QGJA 3A8AA 1L0ZA 3LGWA 1A46H 3T62A 2QC2A 4HGCA 3RLWH 2AH4X 1UVSH 1D3DB 1SGFG 4U2WA 1GI7B 1SLWB 1BTXA 1C5RA 1ZGIA 4OS6A 3MO6A 2F9BH 2PGBB 4GHQA 2HOBA 2QF0A 5HIZA 3F9EA 4AN7A 7GCHF 1P2JA 4Y11E 2ZI2H 2YNAA 1HUTH 1SGNE 2C8XB 1DY8A 2HVXA 1TB6H 3NKKA 3RXVA 3FAOA 4DURA 1L1NA 1TNJA 4ESTE 2DE9A 4KTUA 1ELFA 5DGJA 3H09A 3DHKH 4ZKNU 1DWDH 5DKMA 3PTNA 2GDEH 5FL7D 4FU9A 3OE7D 3H5CB 1QR3E 1O2JA 3W95A 2AMQA 4NA8A 2ZTZA 2R2WU 2FWWA 3OEED 5E2PA 4IMQA 4WH6A 2VIDA 2WSSD 4JZIA 1O30A 1EAUA 2HNTF 1MKWK 2ZDNA 3M7QA 3N7EA 3OX7U 2YOLA 1YCPH 1KLJH 3OTPA 1TX8A 5IK2D 2VIPA 4F48B 2H2ZA 1GCTC 3Q3KA 1PQ7A 3S9CA 2XBWA 1O5FH 3QZQA 2GCTB 1CU1A 1AZZA 4AGKA 4B2CA 2WYJA 1EFRD 1O2OA 1EAXA 2YMSD 4MPWA 2PSYA 2VNTA 4ZKSU 4BAHB 1MBQA 4CR5A 3CP7A 3I29A 1ZHRA 4U30A 2LPRA 4JYTA 4JMYA 2PGQB 8LPRA 3VPKA 1SG8B 2RFKC 3GDSA 2XCFA 3E6PH 1O3DA 1GVZA 3DFLA 3QX5H 4AG1A 4TY6A 1IHSH 1BTYA 1O2XA 4I33A 2BOKA 1FI8A 2O8MA 4NSYA 3QN7A 3W94A 3NZIA 3A7ZA 4INKA 1F5KU 2SGFE 2FYRA 4K60A 1GBFA 1HYLA 1A3BH 2BDIA 1PFXC 5AFZH 4D8NA 1DY9A 1CT2E 4VGCB 2R9PA 1YLDA 4M9FA 1XUKA 1NT1A 1L1GA 2WV4A 2EI6A 1SGFA 1SKYE 1HAYB 1YKTA 1GMCF 4LK4A 4P00A 1S6FA 1UJ1A 2ZTXA 4BAOB 3HPTB 4X6NA 3MMGA 1HJAB 4B6FA 4ZAEA 2UWPA 3BTWE 2V0BA 5L2YH 1GHWH 4O97A 1C1PA 5I46H 3BTQE 5EXNA 1JOUB 3SNCA 5GCHG 3RXEA 5A0CA 1K21H 1Y5UT 5CHBA 3TU7H 1PPBH 1T4UH 1TRNA 4DW2U 1V2TT 3NWUA 1LVYA 4GSOA 1NRQH 1NRRH 4YOJA 1Z71A 2DE8A 4A1VA 3NCLA 1K28D 3U8OH 4AYYB 1SMFE 4A7IB 2F9OA 3MH4A 3LU9B 3P6ZB 2ZCHP 1AVXA 5EODA 2AHME 2BDGA 2TIOA 3TH2H 1O3FA 3VB3A 1DPOA 2B5TB 1Z8IB 3N7OA 1HAVB 2IOTA 1FIZA 1DDJA 1EB1H 1QJ6B 4YM9A 1UTOA 3W1EA 1O3KA 3D49H 4XE4A 3TJOA 3UFAA 5L30H 3TPIZ 2G51A 3LIWA 1SPJA 3ELAH 1H1BA 1COWD 3A84A 1GDUA 1W12U 4R8TB 2H9HA 1G3DA 4NGAH 1V2MT 1P2KA 1P06A 1GI8B 4Q2KA 3SJ8A 2K8IA 3ATMA 1WYKA 2ZF0H 3SHCH 5EW1H 2P8OB 4DJZB 1FY4A 5BPEA 1IAUA 2ZO3H 1HB0B 4H6SB 5J4QA 1ELGA 1P9UA 2W3KA 4JZ1A 1EP5A 2ZGXH 4CRAA 2C93B 3SQHE 1QCPA 5GIBA 8GCHG 3SUGA 2CXVA 4DVAU 2KR7A 1C1VH 1P12E 4Z1MD 1UVOA 1QL8A 3ZZ8A 3TH3H 1ESAA 2J4IA 3SBKA 2BQWB 1S0QA 1TONA 2VGCC 2HPQH 1GMHG 1GPZA 1V2RT 4NZQA 4Q80A 2HNTC 5PTPA 3GY8A 1QRZA 3E1XB 4FUGA 5C0TA 3QTOH 3ZVGA 1WCZA 4MNYA 1W13U 3HGPA 1ZRBA 1DE7H 3LKWA 5JB8S 2O8LA 2PWXA 3QWCH 3GDUA 4UE7H 1EXFA 1V2QT 1LPGB 1O38A 1C5PA 3JZ1B 3SU0A 3DSPA 1O39A 2VIQA 1V2PT 2PTCE 3MNSA 1SQTA 2A2XH 4Q7XA 1RTFB 1UVPA 3RXBA 1IQGA 1P0SH 3MNBA 2AGEX 1OPHB 2J5UA 1F2SE 2FZZA 2TRMA 4K1SA 3WY8A 4K8BA 3MH5A 2W7UA 1TIOA 4AYVB 3NK8A 3LPRA 3ZZAA 5E0GA 2Y7ZA 4LXBH 1G32B 2JH6D 1VJ9U 1PQ5A 1SR5C 2WPDD 1HAXB 4LZ4B 2LNCA 2FTLE 3KHVA 2A5AA 2NU2E 1ZPZA 1NZQH 3U28C 3GYLB 4MNVA 3TH4H 4ABFA 3FVFB 1GHBF 2C8ZB 2JETB 2Y7XA 4X8VH 1BTPA 1P9SA 4YLUA 1KTSB 2JH0D 3VGCB 3TGKE 2TGTA 1V2LT 2ZHQH 1TGSZ 1LQEA 5C2ZA 2FPZA 2A7CA 3VXEH 3DA9B 1GL0E 1LKBA 1SGIB 1AY6H 3F68H 1KIGH 4RKOB 3R0FA 1GHAG 1EPTA 2ZKSA 3LC5A 3IWMA 3MU4A 4I8LA 5DP3A 4Y71A 2ZFPH 2PR3A 2J94A 1F7ZA 3I78A 2ZDKA 3KF2A 1AGJA 2J98B 2FLRH 3SQEE 1N6YA 3SGAE 2VINA 4Z0KA 2BYAX 5ETXA 3SV8A 3UAIC 2UUYA 3LGVA 2Q6GA 5EU8A 3OTJE 4CRDA 3NRLA 3VB6A 1N8OB 3LOXA 1GJ8B 2AMDA 1ZZZA 3FOAA 1SHYA 1C1UH 1C2FA 1DWEH 3UOPA 2JJ2D 4NSVA 1E36B 4FUFA 1F5LA 1RGQA 3TVJB 4ZXXH 3PLKA 3SV7A 3LT3A 1TGNA 1M9UA 1O3PB 2I6QA 2G52A 2Y81A 1HLTH 1BRBE 3PWBA 1GI1A 2FOCA 3UQOA 2O9QA 2GT7A 5HKKD 3KN2A 4PROA 1DVAH 3BTEE 1MH0A 1C2DA 2JKHA 2ZFRH 1SGPE 1ZMNA 3RC5A 1G30B 3KQDA 4I7YH 4IGDA 4BXWA 5EJZA 4FUBA 4JZFH 3E0NB 2QF4A 5B6LA 3M37A 1V2VT 4TY7A 5F8XA 4UD9H 1P57B 3UY9A 2G55A 2BD5A 1Z8RA 1FX0B 1GI3A 4NFFA 2GCHG 2ZQ2A 4DIIH 2A2QH 4Y79A 4CHAC 1ELVA 2F9VA 1HPGA 3RXAA 2D2DA 1O2TA 1UTJA 1T8NA 1BRAA 1CGJE 1KLIH 1RIWC 1ZLRA 2PP6A 2ALVA 5DG6A 1PYTD 3P92A 4UEHH 4OS7A 3O8CA 1C1TA 4Y0YE 4DG4A 3ZV8A 3M5OA 1AB9C 1Q3XA 5A8YA 1Y3YA 1O3AA 1PPCE 2GMTB 2WINI 5ESTE 2BY8X 1AFQB 1FIWA 2BLWA 2GZ9A 1GHXH 5JBBS 1O3MA 3RXRA 4D76A 3TK9A 1G3EA 1H8ED 3MHWU 2C8WB 1G36A 3S7HB 3RXTA 1IQIA 1O2GH 1GGDB 3URDA 1C9PA 1O2WA 2J38A 2Y5HA 3SGQE 1DICA 2ZA5A 2ZGBH 5EXMA 1K1OA 2BZ6H 2WPIS 1QRXA 2ANKH 3P8GA 3S9BA 1HAZB 1AUTC 2BX3A 2FOHA 5GXPA 5DPAA 1BRUP 2Y80A 2O8TA 3M7TA 1EB2A 1PPFE 1XKBC 1WQSA 1DOJA 2OC8A 3TK6A 2Z9LA 4AZ2B 2A7HA 4CRCA 1P09A 1V2UT 1O2QA 1UTPA 3BG8A 1AB9B 1GBKA 2ZFFH 3K9XB 5L6NH 2GZ7A 4AFSA 4RN6A 1TMBH 1THRH 3RXHA 1D6RA 2QF3A 1CA8B 3PROA 2FEQH 3ZZ6A 4CRFA 1O33A 5F8TA 4O03A 3A86A 2Z6BD 3NXPA 3F3BA 3UOUA 5HYOA 1YLCA 4GUXA 3BF6H 1CSOE 1C5QA 3ITIA 2ZPQA 3RC4A 2F9UA 5FCKA 4AFQA 4UDWH 2WPLS 3TITA 1GG6B 2Q6DA 2Z9IA 3DSOA 2C3SA 1VITG 1OSSA 1BJUA 1QFKH 4X2VA 2XNIA 2A5KA 4NWKA 1GJDB 1DSUA 1P01A 3ODDA 4XDEA 2ZNKH 2B8OH 3UWIA 3IG6B 4AOQA 2XC0A 3AK5A 4A5TS 3F2GA 3GOVB 3A7TA 3U8RH 3ZV9A 5JBAS 2BDHA 3PO1C 5EXLA 4UONA 4B75A 2W26A 1GBTA 2LELA 2Z94A 2ZGJA 5E0JA 3SV9A 2FMJA 1WOFA 3U8TH 2BXTH 2CHAB 2ILNA 1GMCG 2ZCLP 5C5OA 4UFDH 1NROH 1P03A 2J97A 4TWYA 1T8LA 3B23B 2OTVA 5FXLA 3STIA 3UWJH 3ZZDA 4YT6H 3TJUA 1INCA 2BLQA 3GY6A 4HFPB 1THSH 1Y3UA 1ETSH 3PRBA 3GCTF 2QE7D 4F55A 2VBCA 3BTDE 6CHAB 1GI4A 3SW2B 1H8HD 1T8MA 1CVWH 3N7DA 2OXSA
chains in the Genus database with same CATH topology
1QBOA 3UQVA 1A1RA 1ESBA 1BQYA 1A7SA 1XVMA 3BSQA 3PMAB 4GPGA 2IPHA 1XX9A 2O8WA 3TJNA 1HCGA 2QIQA 1GWAA 2Y5GA 3P17H 2UUFB 4FVDA 3GISB 1BBRE 2P95A 1ETTH 4B76A 3SI3H 3M35A 1MAXA 1G37A 3HK6B 1BOQA 1SGQE 2NWNA 5FBEA 1BZXE 1TPOA 2H9TH 1L4DA 4WY3A 1OWIA 1OXGA 3F1SB 1ZGVA 3MH6A 1GJ9B 4QT8C 3TIUA 1AO5A 3RU4D 1H9IE 3RMNH 1C1SA 1FZZA 2I6SA 1RRKA 2A5IA 2GV6A 3SJ9A 1NS3A 3VB5A 5C1UA 5GDSH 3A89A 5DP6A 4ZXYH 4IC6A 1BMMH 1NFUA 1UCYH 3F9FA 1W3CA 3B8JA 3RMLH 3ZVBA 4FU8A 1P10A 1O3OA 3RXSA 1ZYOA 1UVTH 2HGTH 1FONA 2ZGCA 5DP5A 4ISNA 4GLYA 4WJG2 3SJIA 3L6PA 2XWAA 1O34A 4TYDA 1ZHPA 4XSKU 4BTIB 8ESTE 1LVOA 1BB0B 4ZHAA 1FXYA 1XUFA 1LPZB 1FY8E 1FAKH 4WH8A 4X6MA 2G5NA 1BMNH 1QY6A 3ZVEA 4CRBA 4ABIA 1EZSC 4X2XA 2ANWA 3VB4A 1LHFH 1ZTKA 4BANB 4X8SH 1BMAA 1C1OA 2K1QA 3C27B 3MU5A 3RXCA 2FOGA 1GHZA 1AMHA 3GY7A 2ZPRA 1ZHMA 1EPTB 4M7GA 5A0BA 1J15A 4YOIA 2VJ1A 3RP2A 1T32A 1Z6EA 4ISOA 2F83A 4CRGA 1PPZA 5IDKA 4MPUA 3P8FA 2VWNA 1O5AB 5DO4H 1O2UA 2AYWA 1W11U 3KQBA 1BA8B 1J8AA 5CE1A 1SQOA 3DUXH 1PPEE 2J9NA 1TABE 1SHHB 5A8XA 4CH8B 2BDAA 4RKJB 5A09A 3K6YA 1HNEE 3PV4A 1A0JA 5LGOA 4Q7YA 3EGKH 2A4GA 1HXFH 2RA0A 2BD2A 2WPJS 2H9EH 2ZFQH 3K6ZA 4MDSA 3BEFB 2Y5FA 2TGAA 3KGPA 1GHBG 4NCYA 2PKSC 1SGCA 3SO3A 1DSTA 2GKVE 1AWFH 3A7VA 1QIXB 1A5GH 3U9AH 4D7GA 3RXOA 4ZHLU 3SUFA 3ZVFA 3A81A 1HGTH 5EG4A 2BZAA 2F9PA 1AQ7A 3RXJA 2VIOA 4KP0A 4MNXA 3VFEA 3EE0B 1GI2A 1C2LA 2VVUA 5T3HA 3ENSB 3RXPA 1TLDA 1HDTH 4K3JA 1GCTB 1VZQH 1TPAE 2FOEA 2NU3E 2SNWA 4B73A 5ESBA 2OBQA 4U01A 1MU6B 1NRNH 2QXHA 3RXKA 2NU4E 1KXEA 5T6FA 2G4TA 1AE8H 2BDCA 4IMZA 2RDLA 3ZZ3A 2A7JA 2GZ8A 5ABWA 3F9HA 4FUCA 1K1LA 2ZDMA 1LHDH 2Y82A 1O2PA 3L3TA 4BOHA 1ANEA 3HATH 3RXFA 2GDDA 4BNRA 1DXWA 1EJNA 1LHEH 1O0DH 3SU5A 1CO7E 2ZHEH 1CT4E 2BY6X 5HM2A 4O9VA 2AS9A 2HNTE 3M5MA 1THPB 2RCEA 2VB0A 4BAKB 4YESB 1Y3WA 2GVFA 2UUJB 1BHXF 4WF8A 3UTUH 4WXVA 3ZYDA 1NRPH 1JXPA 4MLFB 1U6QA 4Y8XA 4TPIZ 4MTBA 1BDAA 1SLXB 2FDAA 2R2MB 1E35B 3CS7A 4I31A 3AAUA 2QY0B 2SGAA 3FZZA 1H4WA 1JWTA 1D3TB 1NM6A 2J92A 5G4BA 3SNAA 4MPVA 4MQAA 1H8IH 1ID5H 3PLBA 1LKAA 3U1IB 1C5NH 3SU6A 6LPRA 2SGPE 2THFB 3GDVA 2XTTB 3AW0A 2J34A 1WU1A 1RTLA 3UNSA 3RXQA 3ZYEA 2TGPZ 3ZVDA 1K22H 2FOMB 1O2MA 2VIVA 1NFWA 1P04A 1MMJN 3D62A 2P16A 1FY1A 2B9LA 1MCVA 1HV7A 2G00A 2EC9H 1UMAH 3TNSA 1S81A 4LOYH 1C5WB 1ZTJA 1S6HA 1CGIE 1BJVA 2ZDAH 3PWCA 2ODYB 1MTNC 4NWLA 1GJ7B 3GCHC 1Y5BT 2ZTYA 5EPYA 1GVKB 1QB9A 3ZZ5A 4AFUA 3TGJE 1PYTC 4WMEA 1W14U 5FPSA 3ZZ7A 2PSXA 1EAWA 2VH0A 3MO3A 5EOKA 1C2HA 2HPPH 1QQUA 2BD3A 1Z8GA 2ZFTA 1O2SA 5I25A 2OC1A 3RM2H 3KEEA 4BTUB 2VIWA 5HM9A 1P8VC 2FO9A 2ZG0H 2Z9KA 3Q76A 3FP7E 4AX9H 1EZQA 3SV2H 3RC6A 3GCHB 1BT7A 2HRVA 2BMGB 4OS2A 2FXRA 2AMPA 4AGJA 1P11E 4TPYA 1XUGA 4MVNA 4ZKOU 3OY6U 3RU4T 4GCHF 2A1DB 3M3VA 4OS4A 4AB8A 1KXAA 1X7AC 4YZUA 3CENA 1SSXA 3A87A 5E2OA 3S7KB 1D6WA 2VGCB 4YO9A 2FYQA 2WPMS 2QYIA 1FUJA 2G81E 3O8DA 2P3FH 1D3PB 1ZJKA 2QAAA 1BTUA 1C2MA 2V3HH 1SL3A 3K65B 3F9GA 1UCYK 1O2IA 4ISHH 1H9HE 1B0FA 1YYY1 1SI5H 2WPHS 1FPCH 3D65E 3DD2H 4D9RA 4K1TA 1TRMA 1XVOA 3ATKA 5DP8A 1O3JA 5F03A 3RU4E 1F0RA 1OS8A 1T8OA 2BM2A 2VU8E 1EJMA 1AKSA 1W10U 3UUZA 1FPHH 1SOZA 3GCTG 5J4SA 4NA9H 1AIXH 1C1WH 1GBJA 1GBMA 1OP8A 1TA2A 2BD4A 1L2EA 1S0RA 1TBZH 1YPHC 2FS9A 1MCTA 1QBVH 2CN0H 2ZC9H 1A2CH 3EQ0H 2R0KA 5E8EH 3UR9A 3C1KA 3V3MA 1TFXA 2A0QB 1Y5AT 1YPLH 1JMOH 1UTQA 1AVGH 1LDTT 2WV5A 3CS0A 5A8ZA 2XBXA 4KTCA 5EQRA 1O2VA 1CT0E 2R0LA 3E90B 1CBWC 1C5UA 1WTHD 2ZEBA 4CR9A 2IJOB 2OC7A 1C5MD 1QB1A 4AG2A 1SGTA 3BEIB 4K2YA 1G2LA 2BB4A 1F5RA 3UR6A 2H6MA 1ANDA 1IHTH 1HJ8A 3H7OA 1VJAU 2TGDA 2WUBA 1MQ5A 3SU3A 1MU8B 1KYNA 2ZU1A 3B9FH 1HRTH 2XC5A 2SNVA 3KCGH 1DUAA 3SORA 2FP7B 3T2NA 3E91A 4O3UA 3A8DA 2EA3A 1GJAB 5JB9S 1O36A 2ZU3A 2AFQB 1UK4A 2BX4A 2NU0E 1BHXB 1ELCA 4ISIH 1KSNA 3V0XA 4ZHMU 4ABAA 9LPRA 1CQQA 3NUMA 7ESTE 4A6LA 5FCRA 2V6NA 1E34B 1F92A 7GCHG 1TGCA 3BG4C 4FUIA 2QV1A 2D1JA 4K69A 1GI5A 1SGYE 1HXEH 2A45B 1J17T 1Z6JH 2O8UA 3M5NA 3HK3B 1P05A 4HTCH 4NIXA 4X1QU 3SJKA 1HBTH 1QJ1B 1SLUB 2YNBA 4X1NU 1W7XH 2CJIA 1NRSH 6ESTA 3UIRA 4ZH8A 4CHAB 1QRWA 1Y3VA 4U32A 1P02A 4R0IA 4YTAA 3MI4A 1CE5A 2OCVB 4FUEA 1K1JA 4IBLH 3ESTA 1RIWB 3BTTE 1DANH 1C5OH 4JK6A 1LO6A 1GL1A 1QTFA 4BTTB 2WPKS 1KLTA 5T6DA 2QCYA 2HLCA 3PMBB 1S85A 1WBGB 3RXLA 4ASHA 3IITA 1NO9H 3EA9A 1JIRA 1UK2A 5SGAE 3UPEA 6GCHF 1QL7A 2C4FH 1O2KA 2F3CE 1K1NA 1Q31A 1RTKA 1GJ6A 4JZDH 1L4ZA 5JPMH 3F6UH 4H4FA 2VVVA 1DXPA 3T26A 1WSSH 4SGAE 5H4IB 3QLPH 3ZZCA 1DT2A 1P2OA 1UHBB 2RG3A 4D7FA 5HXFA 7KMEH 1XXDA 2A4QA 1TPPA 2CF9H 1TNIA 1F0SA 1E0FD 3TLOA 2FODA 1N1LA 2ZHFH 4B71A 2GX4A 4XBCA 4CBOA 1UTKA 4WWYA 1H8DH 5GPIB 3GY5A 4YT7H 1VCWA 3H7TA 1YCPM 5C67A 1XUJA 4JK5A 1UTMA 3PYHA 2Y6TA 1ZSJA 2ESTE 1Q2WA 3PTBA 1BCUH 1ACBE 1MTWA 2Q6FA 1O5CB 5C1YA 5L2ZH 2V35A 1VGCC 1CHGA 2XWBI 1GJ5H 4INHA 1V2NT 1IOEA 1S84A 1UTNA 1RJXB 1QQ4A 1KDQA 3Q00A 1NN6A 1W8BH 1O32A 2VH6A 3S9AA 3SOSA 4Y6DA 3VEQB 1GMDF 3PLPA 4CREA 1PPGE 3D23A 4X0WU 1TQ7B 4HZHA 1QL9A 1EOLA 1OYQA 5B6OA 1S5SA 1JRTA 3AAVA 3OU0A 1LHCH 1YP9A 2QXIA 4ABDA 1AE5A 1GHAF 2ZCKP 1FNIA 1EX3A 1C4U2 1A5HA 1C2KA 2A31A 2ANYA 1NC6A 3T25A 1A3EH 4E05H 2D8WA 1GJCB 3SJOA 1LMWB 3PO1B 1V2KT 4DY7B 1MBMA 1TGTA 2AIPA 4XBBA 7LPRA 1B7XB 4ZMAH 3LDXH 1EKBB 1O2HA 1OWJA 3GYMA 3FFGA 2GV7A 2C90B 1K2I1 1H9LB 1PQ8A 1D4PB 4ABEA 3SU4A 3A8CA 3S69A 3RMOH 1XXFA 2PKAB 1CHOF 1TAWA 1WQVH 1ZPCA 1C4V2 5AF9H 4AORA 2BY5X 1T7CA 1TRYA 4THNH 2BD8A 2ZGHA 2QXJA 3TJVA 1C2GA 1XUIA 4ABHA 5F8ZA 3HKIB 5FAHA 3RLYH 3AASA 2ODQA 3ODFA 1O2ZA 5TJXA 1OP0A 1VITH 1ELAA 3E0PB 1YPKH 2ZFSA 2FTMA 3T29A 4FVBA 2H5DA 5FHTA 5LPFA 1K1MA 1B0EA 1W7GH 1HFDA 1G3CA 1NFYA 1P2MA 1W0YH 4SGBE 1DFPA 1RD3B 2EI8A 4I8GA 1TPSA 2WUCA 1C5TA 1FN8A 5GWZA 1YPMH 1ZMJA 2BQ7B 3RMMH 1C1QA 1JRSA 1TBQH 4NIWA 1P3CA 3L33A 4BXSA 4NIYA 2W7SA 1DX5M 4E7NA 1DWBH 2OUAA 4J2YB 2GT8A 2VVCA 1C1RA 2OBOA 2PHBA 3KL6A 3MNCA 1O2LA 1YBWA 1L1JA 3BTGE 2EEKA 1C1MA 1NU7B 1AN1E 1TMTH 1MAYA 4K8YA 1G2MA 3UNQA 1FV9A 4YLQH 2ULLA 1O5EH 2Q1JA 4Q7ZA 2Z3DA 1T4VH 2ZZUH 5EW2H 2FOAA 1AKSB 1V2JT 2BY7X 2GCTC 1SVPA 1CGHA 3ATWA 4INLA 3SZNA 5LH8A 1QJ7B 4GCHG 1BBRK 3MNXA 4FUJA 1O2NA 1ZRKA 2TBSA 4F49A 1JIMA 1TNGA 1UTLM 1GHYH 2CMYA 2GD4B 4FUDA 1GBHA 2BY9X 1G9IE 3A85A 3GY2A 1Y59T 4ZKRU 3MU8A 1HJ9A 2IN2A 2OP9A 3A80A 2XBYA 1D9IA 3BTKE 5AVDA 5C20A 1C1NA 3PB1E 3BIUH 5FPTA 4NG9H 2XXLA 2ZU2A 1TMUH 1SBWA 1OWHA 1ELEE 1VCQA 2FOFA 2R3YA 3UNRA 4XBDA 1GJ4H 1YC0A 1Y3XA 4VGCC 4X6OA 4IC5A 1T31A 4NIVA 1DS2E 5EGMA 3T5FH 1ZMLA 2M5TA 5DP4A 4Y7AA 1C2EA 2STAE 2FI4E 3EA8A 3SUEA 1EAIA 5C3NA 4A1XA 1GHVH 2W5EA 1PPHE 1HJAC 1O3BA 1VITF 2QN5T 1TNKA 2D26C 2BLVA 2VWLA 2FS8A 1TNHA 1AVWA 1O5GH 3RXGA 1TQ0B 3MU0A 2A4RA 3Q3YA 2PKSB 5HGGA 1FQ3A 1XMNB 4IS5A 3TGIE 1CA0C 4KKDA 5JYIA 1G3BA 3BEUA 2VWMA 3AW1A 3MO9A 1O5BB 1OWKA 1RFNA 1KXDA 2FIRH 1GI6A 1UHBA 1W2KH 4OS5A 1FJSA 1SFIA 3RUOA 4IN1A 4F4OC 1TWXB 1ZSKA 1HIAB 1PQAA 2FI5E 5C1XA 3M36A 3QO6A 3A7XA 1FMGA 1O2RA 2CF8H 2BVXH 3V13A 4Z6AH 2H1UA 3LGTA 5IYTA 2OINA 1AZ8A 1ARBA 1HAGE 1ELBA 3SNBA 2TPIZ 1DITH 2ZPSA 1OX1A 4ZUHA 1BRCE 2FI3E 3QGNB 4E7RG 1K1PA 1MZDA 1O5DH 1GCDA 3SU2A 1ABIH 1CA0B 3PMHB 2PFEA 4GVUA 3OY5U 3S0NA 1O3IA 2AGIX 3RDZA 4K5ZA 1SOTA 2P59A 5E0HA 3BTFE 3URCA 1KY9A 1BUIA 1MKXH 5TCAA 1QBNA 5AHGH 2CV3A 3P8NA 5C5NA 1PJPA 2A4OA 2B7DH 2P8OC 1A4WH 1EOJA 1O2YA 3BIVH 4JYVH 1WUNH 3RXMA 1AUJA 1GBBA 5DP9A 4UFGH 4FUHA 5FPYA 2XC4A 2DUCA 3KQCA 4H42U 1MZAA 2J2UA 2SGQE 4D9QA 2FLBH 2OD3B 2WYGA 2Z9GA 2SGDE 2OLGA 1QB6A 5JDUB 2ASUB 2UWOA 4NFEA 5CMXH 2QXGA 1XKAC 1FDPA 4ABBA 4AB9A 1HAOH 3QTVH 5TCCA 1UCYE 3QZRA 3KIDU 2HWLB 5LPEA 1FY5A 1V2OT 2STBE 3ZVAA 2PKAA 3SUDA 2BHGA 3ATLA 3LONA 1WV7H 1TX6A 1P2IA 2BDYA 4X1SU 1UO6A 1AFEH 5EQSA 1YPJH 3SNEA 1YPHE 1K9OE 4X6PA 2PV9B 6GCHG 3VXFH 5HMAA 1KDQB 1FY3A 2ALPA 1UK3A 1TOCB 2BD9A 4XOJA 3K2UA 2P93A 5FX5A 2H5CA 3A83A 4KTSA 1MTNB 2BTCE 4JZEH 4X1PU 1KTTB 1YF4A 5A0AE 4RSPA 1C4Y2 3BN9A 1A0LA 1Z7KA 2JETC 3A8BA 2FX6A 2UWLA 3VGCC 4Y0ZE 3O8RA 1ARCA 1QURH 4TWWA 1OOKB 2EI7A