3PMJA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pmjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pmjA02
2UWOA 1IOEA 1PQ7A 1TOMH 2ZQ1A 2ZGBH 3MU4A 4XBCA 1EKBB 2C8ZB 2BDIA 5GPIB 1P3CA 4X6MA 4Y76A 1GI4A 4K1SA 4X1NU 2B0FA 5EQRA 2QY0B 1YCPK 1SGFG 4B1TA 3OY6U 4TY7A 1TBQH 1O2IA 3PLPA 3QWCH 1QB6A 4YO9A 1V2UT 2VH6A 2FYRA 1C5OH 2VVVA 3RM0H 1BRBE 1D3QB 1B0EA 1LVYA 3E16B 3LIWA 1PPZA 1JXPA 1GJAB 1FY3A 1O2KA 1V2VT 1DUAA 1GJ9B 2ZPSA 3SHAH 1C1QA 1EAXA 1GL0E 1KXEA 3F9EA 4HGCA 4O97A 1LO6A 1HAOH 1O5DH 3D49H 3LPRA 1DLKB 2PHBA 1OWJA 2WYGA 1C1NA 4K2YA 2AS9A 2FOCA 4YLUA 3P92A 5SGAE 5HXFA 1BBRH 4GAWA 5GCHG 1XMNB 1TPPA 4YOJA 9LPRA 4JYVH 1AVGH 1GJBB 2Z94A 2HLCA 3M61U 3LGUA 3UOPA 4AB9A 3ZVBA 3A82A 1XUJA 2VB0A 2ASUB 1CGHA 1O5FH 4FUBA 4ABDA 1O2JA 1T32A 2QXIA 1ANEA 1UCYK 1ZPCA 1GGDB 2GCTC 2GZ7A 3Q77A 1FAKH 2HOBA 1O3HA 1V2OT 2GX4A 3SJOA 1F5RA 1XM1A 3SU1A 3SUFA 2ZPQA 1O3MA 3ZYDA 1CO7E 3SO3A 1YCPM 2CMYA 2H9EH 2ZKSA 4IMQA 4IBLH 7KMEH 2ESTE 1C2KA 1QR3E 2Z9JA 3UNSA 1V3XA 1A3BH 5F8ZA 1E36B 2F9VA 2HNTC 3HGPA 2GKVE 4RSPA 1VITG 3T26A 5JB9S 5A8ZA 2XBVA 3SJ8A 2EC9H 1P3EA 1UTMA 1JOUB 1UTPA 3SN8A 2GZ8A 1SVPA 1TMUH 1ORFA 1S85A 4B73A 5B6OA 3DA9B 3DFJA 3UWJH 1O39A 3E8LA 2Z9GA 1UTNA 1DPOA 3L6PA 2QF3A 3ZVCA 4JZIA 4CRAA 3SV9A 1RIWB 2CN0H 4JYUH 1SL3A 1BZXE 1OWKA 2PLXA 1MAYA 3M7TA 3SV7A 1MKWH 3OTJE 3EAJA 2PW8H 3GY6A 1PPGE 3RU4T 1IQJA 2BVSH 5EG4A 2DE9A 1YM0A 4BTUB 2Q1JA 1C5PA 5TCAA 1QJ7B 3IITA 4X1SU 2OBOA 3M5MA 3V0XA 2ZTXA 1GG6C 1ARCA 3ATLA 3ATMA 2ZTYA 2GCHF 3SW2B 3ZV9A 1Y8TA 4X8VH 1TNHA 3T29A 4UDWH 1V2ST 2XXLA 1XUHA 1YYY1 5ESTE 3OX7U 1O2RA 4FUFA 1RTLA 4WMFA 1QRZA 1CU1A 1TGTA 1MMJN 2STBE 3KCGH 1GI9B 2VGCB 4ZUHA 3A80A 4WMEA 1B5GH 1G32B 1GVLA 3AVZA 4OS6A 1A2CH 3E3TA 4KTUA 2ZFQH 3LH3A 4JZ1A 1QRWA 1UTJA 1VR1H 4BOHA 5FPSA 1SHHB 3NWUA 1QA0A 1ESAA 2F9UA 1FJSA 1O2VA 1Y5AT 1KIGH 4GCHF 2XC4A 1A5IA 1AWFH 2PWXA 3I77A 1GBBA 3E0PB 1IQGA 3KHVA 1AB9C 3ITIA 5GIBA 1Y3YA 1P2NA 1P8VC 3VB4A 2OTVA 2R0KA 1FN6A 2PTCE 4I8JA 3RMOH 2P3UB 1ZSJA 2ZECA 5AHGH 4ISNA 2ANMH 5DP4A 1QBVH 1YKTA 4AGKA 1LPGB 5EXNA 1MKXH 3HATH 3A84A 1DSUA 2ZPRA 1LHGH 6GCHG 3U69H 4E7NA 3VFEA 3SGAE 4FU8A 1XUKA 1ZPZA 1GGDC 1O5AB 4JZEH 4MDSA 1Z71A 2WPHS 3FANA 3SUEA 2BLQA 1YLDA 4XOJA 2YNBA 1WBGB 3QO6A 4J1YA 1UO6A 1C5VA 1F92A 2TBSA 3TNTA 2BLWA 1ID5H 2DE8A 3W95A 1W7XH 3HKIB 1VGCC 4MPVA 2G00A 3VB7A 1C1SA 3LGTA 1O31A 3PO1C 4AB8A 2M5TA 5DP5A 8KME2 2RA3A 2WPJS 3TK9A 1EOJA 3LC5A 2XTTB 1SSXA 4TWWA 4K69A 2WPMS 1FIWA 3GCNA 1SQAA 3F1SB 4XE4A 1LHCH 1P03A 4JZDH 3KL6A 5DP9A 2ODYB 2Y80A 1TX7A 2WV4A 3LH1A 1SMFE 4WH6A 1P57B 4X0WU 4BXSA 1DLEA 2H9HA 2R3UA 2RA0A 1XVOA 1ZMJA 1TX8A 1RIWC 2Z3EA 1A4WH 2SNVA 2ZNKH 4OS2A 2A5KA 3UR6A 1DE7H 5E8EH 1L1JA 3F9HA 4HI3A 3B8JA 4BAOB 2Y7XA 4WMDA 3B23B 1GBIA 1NESE 1PQAA 2P8OB 7GCHG 4FU7A 1SGPE 1KXDA 1GCTB 1NFWA 3QK1A 3VEQB 2W5EA 1YPHE 1RS0A 3CS0A 2OXSA 4O3UA 1GI8B 1KLTA 1S0QA 3TK6A 1O36A 1O2WA 1TPAE 3M37A 4CRCA 4RKJB 2SGQE 3TH3H 1SOTA 1K22H 1ELBA 3PYHA 3T28A 1GDQA 2FPZA 2QV1A 2Y5FA 3L3TA 1E38B 4J2YB 3GY2A 1O2MA 1WYKA 1TGNA 1FN8A 2AFQB 4BAKB 2BD9A 2A4OA 1LPZB 1GJCB 1AFQB 1F5LA 4YT6H 4AORA 2P3TB 1C5YB 1BTZA 4BAHB 3SOSA 4D76A 1DUEA 3AAUA 1ZHPA 2Y7ZA 1QQ4A 4OS7A 1OWIA 1TBZH 1TYNA 3SGBE 8GCHF 5ESBA 1QJ1B 3E6PH 1UTLM 2TRMA 2Y6TA 4I8KA 4JYTA 2VH0A 1SBWA 1O2NA 4JMYA 1P01A 3H5CB 4BTTB 4A92A 2O8UA 1O2TA 5AFZH 5DG6A 4A1XA 1UJ1A 3RMNH 2VIWA 1HV7A 3RXCA 5ETXA 2R9PA 2SFAA 3STJA 3KQBA 1O3GA 1ZJKA 1BTHH 4OS5A 1MU8B 1IQKA 1HYLA 2HNTF 3P8NA 1S82A 2VU8E 1IQNA 2VIDA 4NGAH 4X2VA 1DWBH 1W13U 1UVPA 1DT2A 1K1MA 2QF0A 4NCYA 1AMHA 1C2LA 4CRFA 1VCWA 1FV9A 1PYTD 2IJOB 2BOKA 1CA0C 1MQ6A 3SU0A 4NIWA 4BTIB 1F7ZA 2R3YA 5L6NH 1MCTA 1TMBH 1AQ7A 1HRTH 1QB9A 1VJAU 3M5OA 2G4UA 1P9SA 1YF4A 3AAVA 3IG6B 5DGJA 1UCYH 2FTMA 1SLXB 3RC5A 4X8UH 3PTNA 4A5TS 3PMHB 1Y59T 1GMDG 3TJNA 1D3PB 1X7AC 3FZZA 1SGNE 3ZZ8A 2CF8H 4ZKOU 1VJ9U 4TWYA 5L2YH 1AVWA 2BLOA 5GCHF 2RG3A 5FBEA 1SQTA 2TGAA 5A8XA 2F83A 3KNXA 4MTBA 1UHBB 3IWMA 2SGFE 3SQHE 3BTHE 2BDCA 5A8YA 5CE1A 3AW0A 2P8OC 1K9OE 3TPIZ 2FLRH 1MCVA 1EAUA 2PTNA 4A6LA 1KLIH 2ZFSA 4B2AA 1IHSH 1RJXB 1SOZA 3LONA 1EAIA 1BRCE 1S81A 2FOHA 5E2OA 1AU8A 1BTWA 1PPBH 2QA9E 1GI0A 1E0FD 2RDLA 3I78A 2JH5D 1YPLH 4Y0ZE 2OC8A 1QRXA 1TQ7B 1PPFE 4KELA 2FLBH 1VITF 2BD2A 4AFZA 1NZQH 3UQVA 1Y5BT 2D2DA 1H1BA 1CQQA 1O3IA 2GMTC 1SC8U 3SU4A 1TA6A 2XCFA 3S7KB 1P2MA 1LQDB 4B2BA 3ELAH 1TRYA 3UTUH 5EW2H 1JBUH 2ZDKA 2ZFPH 2ZFTA 3GYMA 3EE0B 2GCTB 5JBCS 1O2QA 3RXSA 3KIDU 3LGWA 1M9UA 2IN2A 1V2LT 3RXFA 2GVFA 1NO9H 1GBDA 4X2XA 4YOGA 3RLWH 3SNCA 1PQ8A 3MH6A 2QXJA 2VJ1A 2VIVA 1EZSC 3QZQA 3SORA 3A81A 1FAXA 3A7YA 5F8TA 3A8DA 4ZAEA 2ZHDA 1G30B 1HAVA 2PKAB 3UY9A 1WV7H 1DS2E 3RXEA 2QCYA 2GV7A 1D9IA 3VXEH 1J8AA 3SV2H 2ULLA 3M35A 1ZTKA 6LPRA 3SNEA 5C20A 1P2JA 1SLUB 4YZUA 5TJXA 2FM2A 2BDGA 2FZZA 1KTSB 1MTWA 1C5NH 3H7OA 3MU8A 1TFXA 2H6MA 3SI3H 3S69A 1S6HA 1HB0B 4FVBA 3RXTA 1BDAA 1C5TA 3VXFH 2FYQA 2ILNA 1OYTH 2ZGHA 3TJOA 4IN2A 4K8YA 1FI8A 1P02A 1C2DA 3A7TA 4DY7B 1ZSLA 1TRNA 1O3OA 1HLTH 1PYTC 1TABE 1ANCA 1PFXC 1W7GH 4ABHA 1TNLA 4XDEA 5HM2A 2D8WA 2ZFFH 1SGEE 1GG6B 1ZHMA 2EI7A 2ALVA 1ZMLA 1BTUA 2F3CE 3A7ZA 1KSNA 3N7OA 4BAMB 2GP9B 3A89A 1O3EA 3QUMP 1BB0B 1D6RA 1W0YH 1XKAC 2CJIA 3BG8A 2H2ZA 1GHWH 1EJMA 3GYLB 2G81E 1CBWC 1FLEE 1PJPA 1C9PA 2ZCKP 1C2MA 1QJ6B 5DP8A 3E1XB 3TK5A 2AGGX 1HJ9A 1MZAA 2V3HH 3MHWU 4CRDA 5DP3A 1K1NA 6GCHF 2BDHA 1UVUH 4X8TH 1NFXA 2ZHWH 3MU5A 3ODFA 1EB1H 2C93B 2ZDNA 3TITA 3NPSA 2XWBI 2ZU3A 3TIUA 3RMMH 4SGAE 3KGPA 1NRPH 2ZGJA 3P8OA 1OOKB 2G55A 5AVDA 3MOCA 2B5TB 4H6TA 3SU3A 4GSOA 3TGJE 5HGGA 2GT7A 2ZI2H 3K6YA 1TQ0B 1IQEA 1Q3XA 3SNAA 1AB9B 5EQSA 4MLFB 1BQYA 2BX3A 3RXJA 1JIRA 1GBEA 3T5FH 2CGAA 2R0LA 3EDXB 5BPEA 3RDZA 1TNKA 4CH2B 1DWEH 3BTTE 5C67A 4NIYA 1A0JA 1KY9A 1HIAB 2R2MB 2VNTA 4Y11E 1GJ7B 1V2QT 2BX4A 2B9LA 1SB1H 2CHAB 1C1VH 3Q76A 1WTGH 2ZHFH 1A46H 4O03A 3A7XA 4FU9A 1G3EA 1V2TT 1T8OA 2A31A 1J15A 2FOMB 3K65B 4K3JA 3ZVDA 3RXKA 1F0RA 3URCA 4ABEA 4OGXA 2HVXA 1GPZA 1ANDA 2V0BA 2QXHA 4U01A 2UUKB 2FP7B 1XX9A 1IQHA 4KTCA 2H5DA 1W0ZU 4PROA 1TBRH 4NFEA 7GCHF 4ZXXH 4GVUA 1VGCB 3HPTB 3RMLH 2FEQH 2ZGCA 4X1QU 3HK3B 1C2JA 4MPWA 2J94A 2HNTE 3PO1B 2A7HA 1XUIA 2BTCE 2WUCA 1DM4B 1GBAA 1JRSA 3BEFB 2FI5E 1AWHB 4O9VA 2ALPA 2AMQA 2BQ7B 1C1UH 2G8TA 4DOQA 1YP9A 4NFFA 1O32A 1E35B 1JRTA 1YGCH 1OP8A 1C5ZB 3EQ0H 1NRNH 4K1EA 1C2HA 1V2NT 1O3AA 1HFDA 2V6NA 1E34B 1TE0A 1BUIA 2FOBA 5H4IB 5ABWA 5LPFA 3RU4E 3ZYEA 2H9TH 8ESTE 1N8OC 2Y82A 3MH4A 3NXPA 1ELGA 4ZMAH 1HJAC 1A0LA 2BHGA 3SJIA 1NY22 4GLYA 1C4U2 1T7CA 2IOTA 3V12A 4YESB 3CP7A 4AN7A 3RUOA 2NU4E 2H1UA 1ELVA 1O3PB 2GZ9A 2J9NA 3LKWA 3KQEA 4CHAC 3F6UH 3ZZ6A 3SU6A 3FFGA 4AFUA 5I46H 8LPRA 2UWPA 5F6MA 4INKA 3E91A 1ZSKA 2AERH 2O8LA 2AIQA 2YNAA 4ABJA 1V2WT 2UWLA 5E0JA 4B2CA 2TGDA 4MNVA 3TGKE 4AG2A 4H4FA 4ESTE 5FCKA 2VIQA 1F0SA 3JZ1B 2P3FH 3EA7A 1DWCH 1XXDA 1J16A 1FZZA 1MD7A 3QX5H 3QGNB 4IGDA 2ZDVH 2ZU1A 2D26C 2O8TA 4FUEA 1G2MA 5C1YA 3PMBB 2G52A 1G2LA 3RXMA 4NIXA 1FY1A 3GISB 1GVKB 1A61H 5EW1H 1Y3UA 2BD4A 2Z3DA 1AD8H 4TPIZ 2QYIA 5FPYA 1C9TA 1DXPA 1WU1A 3T25A 1ELEE 2FXRA 1DY9A 3SUGA 1WUNH 1NT1A 3TJVA 1XVMA 3TU7H 1O2HA 5AFYH 3PWCA 3KN2A 4U2WA 4BXWA 2OD3B 4E06H 4LK4A 5EU8A 4IN1A 2BB4A 2ZCHP 1SR5C 3T27A 3TVJB 1J14A 1HCGA 1QA7A 5CHAB 1GMDF 1KXCA 1BMMH 1J17T 2CHAC 2XC0A 3ZZBA 3LC3A 1SGQE 2W7SA 5DO4H 1CA8B 2BLVA 4Y0YE 1ZRKA 2WPIS 1RD3B 2BZAA 2FI4E 2STAE 4M7GA 2OC1A 1AZZA 2A45B 5HM9A 3RXBA 2V35A 3C1KA 1G9IE 2FS9A 1AGJA 4R0IA 1O3CA 2G5VA 5JPMH 1FMGA 1CA0B 1ANBA 2BM2A 1GL1A 1K2I1 1LQEA 1MTUA 4A1VA 1O30A 1GJDB 1HAGE 1G36A 3EYDA 3SQEE 4UFFH 4HFPB 2LNCA 3HKJB 4ZHLU 1C5RA 2RCEA 3KF2A 1FIZA 4FUIA 3BTGE 3OSYA 3P8GA 2QAAA 1HJ8A 3F9GA 3DD2H 1EP6A 3OYPA 2P59A 3H7TA 4D7FA 1BMLA 1WAYB 4MNXA 4NIVA 2ZIQH 2G4TA 4YOIA 2ZA5A 1E37B 4Y7BA 1TX6A 1ELFA 5A0BA 1V2JT 2QIQA 1A5GH 3FP7E 3PWBA 1CT0E 1G37A 1BT7A 1OSSA 4ZXYH 1AFEH 2BVRH 3DHKH 3SBKA 3UPEA 4NG9H 3BTQE 2WYJA 3MH5A 4AOQA 4D7GA 1EAWA 2A7JA 3UIRA 1NRRH 2ZU2A 1DDJA 2NU0E 4KTSA 4Y7AA 2A4QA 5F8XA 4JCNA 1QL9A 3M3SA 2BXTH 6ESTA 1QBNA 4U32A 3HK6B 2FX4A 1HNEE 1T8MA 1ABJH 3V13A 3RXDA 1S5SA 1O2XA 3ZZ9A 1SGYE 2AGEX 1GJ8B 1Q31A 1O5BB 1EQ9A 1ACBE 1MTVA 1BHXF 1ETTH 1O34A 1UTQA 4MPXA 3ZV8A 3AW1A 1G3DA 2ZF0H 1W11U 1L0ZA 1AKSA 1OKXA 2KAIA 1C1PA 2VWNA 4ZKRU 4CBOA 3LDXH 2FODA 2BD7A 5FXLA 3AASA 3MNBA 3D62A 1LCYA 1AIXH 5GJ4B 1O3JA 1RGQA 2WV5A 1UK2A 3UFAA 1YPGH 4O3TA 2BZ6H 3LJOA 1V6DA 2GMTB 2XBWA 1K28D 2HPPH 3MFJA 5EPYA 2JH6D 5J4SA 2P16A 2FIRH 4DURA 1HXEH 1LTOA 3P70B 2AMPA 1BCUH 2SGDE 3SHCH 1N6XA 3S9BA 1GI5A 2FO9A 3TH2H 3NK8A 1BMNH 2AEIH 2VINA 2ZG0H 4XBDA 7ESTE 1OX1A 1DITH 1U6QA 5K0HA 4HZHA 4WXVA 1H9IE 6CHAC 1W10U 1O33A 2XNIA 2P95A 4BAQB 1CHGA 2ZDLA 2BYAX 2FI3E 1YCPH 3ATIA 1GBJA 1DFPA 2TPIZ 1HAIH 1GBTA 1P2OA 1PQ5A 5C1UA 1NU7B 4QT8C 3FP6E 4UEHH 5LH8A 1G3BA 1NS3A 2OC0A 2PSXA 5CHAC 4K5ZA 3UREA 1IQIA 3NCLA 1CT4E 1O3LA 3GICB 5C5OA 1K1PA 4X1PU 3MO9A 1TONA 5I25A 4I32A 2EI6A 3EGKH 3RC4A 3M36A 3P6ZB 1SGDE 3TH4H 1C5MD 1JMOH 1O2PA 4JZFH 3QLPH 1LHEH 3U8OH 5BRRE 1LDTT 1NM6A 2HWLB 1VCQA 4MG3A 4X8SH 1GHZA 3GCTG 1P2IA 2FMJA 5DP6A 5FX5A 2XW9A 1AY6H 1PPCE 4NWKA 1KDQA 2BDYA 5EXMA 1SFQB 3ZZ3A 4UONA 4UFDH 1QL8A 1TA2A 1Z8IB 1HDTH 1EPTA 4R8TB 4NWLA 1T4UH 3F68H 5FCRA 1GI3A 4B74A 3U9AH 3PLBA 3E0NB 1ELDE 1C2IA 1TIOA 1EJAA 4Y79A 1LHDH 2PR3A 4ZKSU 3MTYA 1PPEE 4F4OC 5EODA 4THNH 2BMGB 4ISIH 2PUXB 1EZXC 1S0RA 1CBWB 3NZIA 4H42U 5JB8S 4I33A 1PPHE 1ZTLA 3BEUA 2ZDMA 1YPJH 3MNSA 2P94A 1BTYA 1TGBA 1ESBA 5E0HA 1TB6H 3BTEE 1MH0A 3MU1A 1SQOA 3SU2A 1BHXB 4X6PA 1F0UA 1XUFA 5T6FA 2HPQH 4Y6DA 1C5XB 4DG4A 2GD4B 2C8WB 1GMHG 2UUJB 1O37A 1LVOA 1THPB 3I29A 1SGTA 2WINI 4WF8A 4Y8XA 1ELCA 4ZHMU 2FOEA 4BNRA 4LZ1H 2C4FH 2BVXH 3M5NA 3RM2H 4ZH8A 2F9OA 1HBTH 3G01A 1BRUP 3WY8A 4WJG2 1GJ5H 3ZVAA 1D4PB 1MTNB 3RC6A 1CHOG 1A7SA 1GJ6A 2FESH 1F0TA 3BIVH 1UVSH 3E90B 4FUJA 2AMDA 1MU6B 1V2PT 3U1IB 4HTCH 1C1MA 1GHYH 2BY5X 1OXGA 1Z6JH 5AF9H 2FDAA 1GBKA 1L4DA 3PLKA 1THRH 1GHBG 3BTWE 2J38A 1O2OA 3W94A 1BIOA 1FY4A 4YM9A 2NWNA 2JKHA 2DUCA 5EGMA 1DY8A 1QURH 1QTFA 3GDUA 3BF6H 5F03A 2GDDA 3GCHC 1ELTA 2VIPA 1Z6EA 4GUXA 1HAZB 4I31A 3K2UA 4Q7XA 3S0NA 3MO3A 3QTVH 1IHTH 3PM3A 3URDA 1O35A 1ETSH 1EJNA 3RXLA 4ABFA 1C1WH 3Q3KA 5T3HA 1DXWA 1FNIA 2QN5T 1N6YA 1ARBA 1Y3XA 5C1XA 2A7CA 5T6DA 3FP8E 3KQDA 2Z6BD 3D23A 2TGTA 5G4BA 2EEKA 3VGCC 2H5CA 4INLA 5FBIA 1T8NA 3PMJA 1OP2A 3GY5A 3LT3A 2QGRA 1SGIB 2FX6A 1TOCB 3CS7A 1G3CA 1OWDA 3JZ2B 2THFB 1N8OB 1S83A 1W14U 2OBQA 1SI5H 1HJAB 1OS8A 1NRQH 1NN6A 4X6NA 2VVUA 5CMXH 1S84A 4Y10E 2C8XB 1L4ZA 1UMAH 1UK3A 2UUYA 4VGCB 2Y5GA 3DUXH 3U1JB 2VVCA 4CHAB 1P04A 1OWHA 1F2SE 4YT7H 4DIHH 5L30H 1QFKH 4JK5A 3RXGA 1GI6A 4E05H 2ZCLP 1S6FA 2CXVA 3M7QA 3U8RH 1NRSH 2BQWB 1LVMA 3MMGA 4ISOA 2FTLE 2PKSC 3M3VA 3PROA 2SGPE 3SNBA 2Y5HA 1P05A 4Y71A 2A5IA 1CGJE 4AYYB 4OS1A 5FX6A 2ZO3H 5A0CA 4ZHAA 2C90B 3RXRA 4CR9A 4XBBA 1K21H 1XUGA 4K1TA 1MUEB 4MVNA 1KXBA 3MH7A 3U98H 5JYIA 1KYNA 1TGCA 5FPTA 3OU0A 3BTDE 3LOXA 2ZHQH 2PGBB 4K60A 5EPNA 2ZEBA 1A1RA 3M3TA 3A7VA 2A4GA 4B71A 3A83A 1GBCA 1QQUA 1ZGIA 1BMAA 2Z9LA 1ESTA 3HGNA 1K1JA 4UFEH 1MTNC 2BDBA 1VITH 4ABAA 1Y3VA 4D9RA 4ABBA 4AYVB 1Z8RA 1JWTA 1D6WA 1MAXA 1GHAG 1CGIE 2W3IA 3ESTA 2CV3A 3LGVA 1YPKH 2J95A 2Q6DA 3RXIA 1T4VH 3A8AA 3A85A 4DVAU 1QB1A 3QZRA 1LMWB 1MZDA 1H8DH 1BRAA 1EP5A 4IC6A 4FUGA 2W26A 2ZC9H 4NSVA 4K8BA 1AO5A 1EB2A 4MNYA 1YBWA 3PV4A 1W2KH 3CENA 5DKMA 1FQ3A 9ESTA 1O3DA 3RXHA 1UK4A 1AN1E 1ZHRA 2Q6FA 2VWOA 4KKDA 2SGAA 1EUFA 2YOLA 1TNGA 3D65E 4MPUA 1SLVB 1FPCH 3Q3YA 2Z3CA 1HAVB 1L2EA 2J4IA 2TGPZ 4ZROA 4ZKNU 1KXFA 1GBFA 1GMCG 4IMZA 1C5SA 4Z0KA 4KGAA 1TRMA 2C8YB 4JK6A 3BG4B 1TNIA 4OS4A 1NROH 4LXBH 5PTPA 3UNQA 3GY7A 3RXVA 1P09A 1BOQA 1NC6A 3LGIA 2GTBA 2O9QA 2I6QA 1YC0A 3A8BA 1ZRBA 1O2SA 2JH0D 2A2QH 1A5HA 3LJJA 3L33A 4VGCC 4ABIA 3EA9A 5EOKA 1UTKA 2JETC 2BD5A 1C1RA 5FAHA 5GDSH 1SG8B 1C2GA 5LGOA 1C5QA 2R2WU 1GJ4H 2ANKH 1H9HE 1C1OA 2ANWA 3ZVGA 1O2YA 4FUHA 1P2KA 1NFUA 1FPHH 3V7TA 3LU9B 2B8OH 2OQ5A 1EPTC 1UTOA 3RXOA 2LPRA 1CE5A 4ISLA 4TY6A 2G5NA 1SPJA 1TLDA 4LZ4B 3Q00A 2OUAA 4DGJA 5J4QA 2D1JA 3ZZCA 3S9AA 3TJUA 1O5CB 1EATA 3FZDA 1WSSH 3SJKA 3SGQE 1O0DH 4CREA 1YLCA 3BN9A 1CT2E 1CVWH 2BDAA 4NA7A 3GY3A 4A7IB 2ZWLH 5LPRA 1MBQA 3GCTF 1L1NA 6CHAB 3RLYH 1BA8B 1AUJA 4YTAA 4CRGA 2ZQ2A 2OQUA 4I8GA 2UUFB 3SV6A 5IDKA 1ELAA 2AYWA 2ODPA 1HUTH 1ETRH 2XBXA 1MQ5A 2A1DB 2A32A 4CR5A 1LHFH 2OLGA 2P93A 1SGRE 3GY8A 2FOFA 5JBBS 3P95A 1BBRE 4B76A 2F9PA 1IQMA 5C2ZA 2CF9H 1ZR0A 3P17H 3ATWA 1ZZZA 5EQQA 2VWLA 5E0GA 4AFQA 1NU9A 1SFIA 2GT8A 2EI8A 2PGQB 1FY5A 2XCNA 4A1TA 5A0AE 3T2NA 1XKBC 3LGYA 4X1RU 3OY5U 3BSQA 3ZZ7A 1B0FA 1QCPA 1FXYA 3MYWA 3R0FA 1WTHD 4B75A 3MU0A 1DX5M 1KXAA 3NKKA 1TPSA 2J2UA 2F9NA 4DIIH 3KEEA 1GMHF 1P10A 1ZOMA 3ENSB 1D3TB 1GDNA 2IPHA 4AGJA 4RKOB 1V2MT 1UVOA 1Z1JA 1TALA 1DANH 2A2XH 5DPAA 4LOYH 1YPMH 2V3OH 1O2GH 5DK1A 2F91A 1O3NA 5EXLA 4AZ2B 1Z7KA 1DSTA 3VB5A 3ATKA 1SLWB 1LKAA 1C5WB 1MD8A 1RRKA 1CHOF 1AHTH 1K1OA 2NU3E 2GDEH 1GHXH 3BTFE 4MNWA 2NU2E 2F9BH 3BG4C 3ZZDA 1AZ8A 3S7HB 3MNCA 1TPOA 3UWIA 3GY4A 3UOUA 1OPHB 2J34A 1C2FA 1F5KU 1GHBF 1UHBA 3A8CA 1EOLA 2Q6GA 4DW2U 3BV9B 4E7RG 1GWAA 2I6SA 1TNJA 1LKBA 1W3CA 1ZLRA 2XRCA 2HGTH 3O8BA 4GHTA 1K1IA 4IS5A 1O5EH 3K6ZA 3A87A 1ZGVA 1H9LB 3RXUA 2XC5A 1IQFA 2Z7FE 1P11E 7LPRA 1BBRK 1C4Y2 2XWAA 1DVAH 2BD8A 4FUDA 3A86A 1K1LA 3ZZ5A 1VCPA 1V2KT 1A0HB 2BOHB 5C3NA 4ASHA 5A09A 1N1LA 2ZFRH 4I8LA 2XBYA 1YPHC 4Q7YA 1ZPBA 1ZMNA 4AG1A 1HAPH 1Q2WA 2FS8A 2QXGA 5GWZA 2PUQH 2ZZUH 3SNDA 1RTFB 2WPKS 4FXGH 2OC7A 2A5AA 3BIUH 1O38A 1W8BH 1ABIH 2PFEA 2XYAA 3PB1E 2OCVB 4I7YH 3GCHB 2VGCC 3RXQA 4X6OA 2EA3A 4CBNA 1BJUA 1P2QA 1O2UA 3QN7A 3PTBA 3GOVB 1Z1IA 1AE5A 1KTTB 2O8WA 2PKAA 3BEIB 1RFNA 3FAOA 1O3BA 4Q2KA 1GCDA 3B9FH 2ZGXH 2O8MA 1QGFA 1UVTH 2BY6X 4U30A 3UNRA 3A7WA 1QNJA 2Z9IA 2GCHG 3MWIU 3VGCB 1SGFA 1TAWA 1KLJH 3O8DA 4Q80A 1WQVH 3SUDA 2Y81A 2PV9B 4YLQH 1VZQH 1MKWK 1HXFH 3UUZA 4CH8B 2VWMA 2ZU4A 2HALA 2A4RA 3SU5A 3ZZAA 2BY7X 4FUCA 4OGYA 4TYDA 5JBAS 5LPEA 4AFSA 1C4V2 4DCDA 3MNXA 2VIOA 1LVBA 2AGIX 1FUJA 3TGIE 1C1TA 4IW4E 4MQAA 1CSOE 4GCHG 5DJ7A 1O3FA 2WPLS 5C5NA 1XXFA 2BQ6B 2WUBA 5L2ZH 3STIA 2B7DH 1NTPA 5HYOA 4ABGA 3SI4H 4CRBA 1RXPA 2PKSB 2OINA 1BJVA 4GHQA 1AUTC 1OYQA 1OP0A 3UQOA 2SNWA 1EASA 4UFGH 2BD3A 1GHAF 1ZJDA 4DT7B 2TIOA 3R3GB 1BTPA 2SGEE 3F9FA 1HGTH 1QL7A 3MO6A 4ISHH 1Y3WA 4X2YA 1QIXB 1BITA 3SV8A 1EX3A 2OP9A 2FOAA 1GBLA 3SJ9A 4D8NA 2ZHEH 3RXPA 1WCZA 3C27B 5DP7A 3DFLA 1MTSA 3ZVFA 1GHVH 2C3SA 1FONA 2A0QB 1O3KA 1IQLA 3K9XB 4NA9H 5FHTA 3RP2A 1P06A 4RN6A 3QDZB 2PSYA 1GI2A 1NFYA 1TMTH 1HAHH 4Y8ZA 1ZTJA 2G51A 1H4WA 4NZQA 3SZNA 1GCTC 1MKXK 4INHA 4FVDA 4Q7ZA 3U8TH 1C5UA 3MI4A 3VB3A 5K7RA 1HAXB 1HIAA 2K1QA 3NUMA 2W7UA 2ZU5A 3GCOA 1AE8H 2W3KA 1C5LH 1J9CH 3TLOA 1AKSB 2KAIB 1C2EA 3VPKA 3BTKE 1SGCA 1FDPA 1GMCF 3QTOH 1Z8GA 3ODDA 1HAYB 4WY3A 1GI1A 1FY8E 4XSKU 2ZDAH 1SHYA 1O2LA 1TGSZ 5T6GA 1WOFA 4TPYA 3ZVEA 1YPEH 1DICA 3UR9A 3VB6A 4NA8A 1AI8H 2Z9KA 2AH4X 1ZYOA 1QHRB 3T62A 5IYTA 1GI7B 1TWXB 1OWEA 1AFQC 3EA8A 3M7UA 4NSYA 1GBMA 1L1GA 4AX9H 3V3MA 2GGVB 4WVPE 2ZTZA 4Z6AH 1DWDH 4UE7H 1V2RT 3A88A 3M5LA 1P0SH 4SGBE 1O5GH 3O8CA 1RTKA 3O8RA 1EZQA 1MBMA 4WH8A 2BY8X 1B7XB 4D9QA 1BTXA 3DT0H 4Y8YA 2J92A 1T31A 1HPGA 4WXIA 1W12U 1GVZA 1A3EH 3P8FA 1Y5UT 3RXAA 3QGJA 1LPKB 1QY6A 4X2WA 2NU1E 2FWWA 2ANYA 4DJZB 3FVFB 2BXUH 4XFQA 4KP0A 1T8LA 1EZUC 2ODQA 5E2PA 3Q3XA 4BANB 1D3DB 3RU4D 1DOJA 1GDUA 1EXFA 4UD9H 1JIMA 1O2ZA 1H8IH 2AIPA 3PMAB 5JBTA 1P12E 2JETB 1INCA 4I8HA 4F49A 3GDVA 1P9UA 1UCYE 3KQCA 3TNSA 1Z8JB 4H6SB 8GCHG 1KDQB 4WWYA 1AVXA 1THSH 4IC5A 1WQSA 5TCCA 2ZP0H 2GV6A 2FOGA 1QBOA 3ZZ4A 5JDUB 2BY9X 1GBHA 1IAUA 3S9CA 1EPTB 1NPMA 2HRVA 5A2MH 5HMAA 4GPGA 2QC2A 5GXPA 3GDSA 3BTME 4NZLA
chains in the Genus database with same CATH superfamily
2UWOA 1IOEA 1PQ7A 1TOMH 2YMSB 2ZGBH 2ZQ1A 3MU4A 4XBCA 1EKBB 2C8ZB 2BDIA 5GPIB 1P3CA 4X6MA 4Y76A 1GI4A 3OTPA 4K1SA 4X1NU 2QE7D 2B0FA 5EQRA 2QY0B 1YCPK 1SGFG 4B1TA 3OY6U 4TY7A 1TBQH 1O2IA 3PLPA 3QWCH 1QB6A 4YO9A 1V2UT 2M2AA 2VH6A 2FYRA 1C5OH 2VVVA 3RM0H 1BRBE 1D3QB 1B0EA 1LVYA 3E16B 3LIWA 1PPZA 1JXPA 1GJAB 1FY3A 1O2KA 1V2VT 1DUAA 1GJ9B 2ZPSA 3SHAH 1C1QA 1EAXA 1GL0E 1KXEA 3F9EA 4HGCA 4O97A 1LO6A 1HAOH 1O5DH 3D49H 3LPRA 1DLKB 2PHBA 1OWJA 2WYGA 3WW7A 1C1NA 4K2YA 2AS9A 2FOCA 4YLUA 3P92A 5SGAE 5HXFA 1BBRH 4GAWA 5B6LA 5GCHG 1XMNB 1TPPA 4YOJA 9LPRA 4JYVH 1AVGH 1GJBB 2Z94A 2HLCA 3M61U 3LGUA 3UOPA 4AB9A 3ZVBA 2RFKC 3A82A 1XUJA 4ASUD 2VB0A 2ASUB 1CGHA 1O5FH 4FUBA 4ABDA 1O2JA 1T32A 2QXIA 1ANEA 1UCYK 4FOUC 5FL7D 1ZPCA 1GGDB 2GCTC 2GZ7A 3Q77A 1FAKH 2HOBA 1O3HA 1V2OT 2GX4A 3SJOA 1F5RA 1XM1A 3SU1A 3SUFA 2ZPQA 1O3MA 3ZYDA 1CO7E 3SO3A 1YCPM 2CMYA 2H9EH 2ZKSA 4IMQA 4IBLH 7KMEH 2ESTE 1C2KA 1QR3E 2Z9JA 3UNSA 1V3XA 1A3BH 5F8ZA 1E36B 3DSPA 2F9VA 2HNTC 3HGPA 2GKVE 4RSPA 1VITG 3T26A 5JB9S 5A8ZA 2XBVA 5C0TA 3SJ8A 2EC9H 1P3EA 1UTMA 1JOUB 1UTPA 3SN8A 2GZ8A 1SVPA 1TMUH 1ORFA 1S85A 4B73A 5B6OA 3DA9B 3DFJA 3UWJH 1O39A 3E8LA 2Z9GA 1UTNA 1DPOA 3DSGA 2QF3A 3L6PA 3ZVCA 4JZIA 4CRAA 3SV9A 1RIWB 2CN0H 4JYUH 1SL3A 1BZXE 1OWKA 2PLXA 1MAYA 3M7TA 3SV7A 1MKWH 3OTJE 3EAJA 2PW8H 3GY6A 1PPGE 3RU4T 1IQJA 2BVSH 5EG4A 3GS9A 2DE9A 1YM0A 2KCAA 4BTUB 2Q1JA 1C5PA 5TCAA 1QJ7B 3IITA 4X1SU 2OBOA 3M5MA 3V0XA 2ZTXA 1GG6C 1ARCA 3ATLA 3ATMA 2ZTYA 2GCHF 3SW2B 3ZV9A 2YMSC 1Y8TA 4X8VH 1TNHA 3T29A 4UDWH 1V2ST 2XXLA 1XUHA 1YYY1 3F2FA 5ESTE 3OX7U 1WDIA 1O2RA 4FUFA 1RTLA 4WMFA 1QRZA 1COWD 1CU1A 1TGTA 1MMJN 2STBE 3KCGH 1GI9B 2VGCB 4ZUHA 3A80A 4WMEA 1B5GH 1G32B 1GVLA 3AVZA 4OS6A 1EFRD 1A2CH 3E3TA 4KTUA 2ZFQH 3LH3A 4JZ1A 1QRWA 4Z1MD 1UTJA 1VR1H 4BOHA 5FPSA 1SHHB 3NWUA 2WV9A 1QA0A 1ESAA 2F9UA 1FJSA 1O2VA 1Y5AT 1KIGH 4GCHF 2XC4A 1A5IA 1AWFH 2PWXA 3I77A 1GBBA 3E0PB 1IQGA 3KHVA 1AB9C 3ITIA 5GIBA 1Y3YA 1P2NA 1P8VC 3W1EA 3VB4A 2OTVA 2R0KA 1FN6A 2PTCE 4I8JA 3RMOH 2P3UB 1ZSJA 2ZECA 5AHGH 2LELA 4ISNA 2ANMH 5DP4A 1QBVH 1YKTA 4RT1A 1LPGB 4AGKA 5EXNA 1MKXH 3HATH 3A84A 1DSUA 2ZPRA 1LHGH 6GCHG 3U69H 4E7NA 2KFWA 3VFEA 3SGAE 4FU8A 1XUKA 1ZPZA 1GGDC 1O5AB 4JZEH 4MDSA 1Z71A 2WPHS 3FANA 1VKYA 2BLQA 1YLDA 4XOJA 3SUEA 2YNBA 1WBGB 3QO6A 4J1YA 1UO6A 1C5VA 1F92A 2TBSA 3TNTA 2BLWA 1ID5H 2DE8A 3W95A 1W7XH 3HKIB 1VGCC 4MPVA 2G00A 3VB7A 1C1SA 3LGTA 1O31A 3PO1C 4AB8A 3MQKC 2M5TA 5DP5A 8KME2 2RA3A 2WPJS 3TK9A 1EOJA 2JDID 3LC5A 2XTTB 1SSXA 4TWWA 4K69A 2WPMS 1FIWA 3GCNA 1SQAA 3F1SB 4XE4A 1LHCH 1P03A 4JZDH 3KL6A 5DP9A 2ODYB 2Y80A 1SKYE 1TX7A 2WV4A 3LH1A 1SMFE 4WH6A 1P57B 4X0WU 4BXSA 3VG8A 1DLEA 2H9HA 2R3UA 2RA0A 1XVOA 1ZMJA 1TX8A 1RIWC 2Z3EA 1A4WH 2SNVA 2ZNKH 3EE7A 2A5KA 4OS2A 1DE7H 3UR6A 5E8EH 1L1JA 3F9HA 4HI3A 3B8JA 4BAOB 2Y7XA 4WMDA 3B23B 1GBIA 1NESE 1PQAA 2P8OB 7GCHG 4FU7A 1SGPE 1KXDA 1GCTB 1NFWA 3QK1A 3VEQB 2W5EA 1YPHE 1RS0A 1H8ED 3CS0A 2OXSA 4O3UA 1GI8B 1KLTA 1S0QA 3TK6A 1O36A 1O2WA 1TPAE 1QZ8A 3M37A 4CRCA 4RKJB 2SGQE 3TH3H 2VBCA 1SOTA 1K22H 1ELBA 3PYHA 3T28A 1GDQA 2FPZA 2QV1A 2Y5FA 3L3TA 1E38B 4J2YB 3GY2A 1O2MA 1WYKA 1TGNA 1FN8A 2AFQB 4BAKB 2BD9A 2A4OA 1LPZB 1GJCB 1AFQB 1F5LA 4YT6H 4AORA 2P3TB 1C5YB 1BTZA 1FX0B 4BAHB 3SOSA 4D76A 1DUEA 3AAUA 1ZHPA 2Y7ZA 2J98A 1QQ4A 4OS7A 1OWIA 1TBZH 1TYNA 3SGBE 8GCHF 5ESBA 1QJ1B 3E6PH 1UTLM 2TRMA 4I86A 2Y6TA 4I8KA 4JYTA 2VH0A 1SBWA 1O2NA 4JMYA 1P01A 3H5CB 4BTTB 4A92A 2O8UA 1W0KD 1O2TA 5AFZH 5DG6A 4A1XA 4TT3D 1UJ1A 3U28C 3RMNH 2VIWA 1HV7A 3RXCA 5ETXA 2R9PA 2SFAA 3STJA 3KQBA 1O3GA 1ZJKA 1BTHH 4OS5A 1MU8B 1IQKA 1HYLA 2HNTF 3P8NA 1S82A 2F4LA 1IQNA 2VU8E 2VIDA 4NGAH 4X2VA 1DWBH 1W13U 1UVPA 1DT2A 1K1MA 2QF0A 3KQ5A 4NCYA 1AMHA 1C2LA 4CRFA 3SYJA 1VCWA 1FV9A 1PYTD 2IJOB 2BOKA 3NRLA 1CA0C 1MQ6A 3SU0A 4NIWA 1OHHD 4BTIB 1F7ZA 2R3YA 5L6NH 1MCTA 1TMBH 1AQ7A 1HRTH 1QB9A 1VJAU 3M5OA 2G4UA 1P9SA 1YF4A 3AAVA 3IG6B 5DGJA 1UCYH 2FTMA 1SLXB 3RC5A 4X8UH 3PTNA 3FO8D 5IK2D 4A5TS 3PMHB 1Y59T 1GMDG 3TJNA 1D3PB 1X7AC 3FZZA 1SGNE 3ZZ8A 3DCLA 2CF8H 4ZKOU 1VJ9U 4TWYA 5L2YH 1AVWA 2BLOA 5GCHF 2RG3A 2JIZD 5FBEA 1SQTA 2TGAA 5A8XA 3KYGA 2F83A 3KNXA 4MTBA 1UHBB 3IWMA 2SGFE 2L74A 3SQHE 3BTHE 2BDCA 5A8YA 5CE1A 2WSSD 3AW0A 2P8OC 1K9OE 3TPIZ 2FLRH 1MCVA 1EAUA 2PTNA 4A6LA 1KLIH 2ZFSA 4B2AA 1IHSH 1RJXB 1SOZA 3LONA 1EAIA 1BRCE 5GNDA 1S81A 2FOHA 3OE7D 1AU8A 5E2OA 1BTWA 1PPBH 2QA9E 1GI0A 1E0FD 2RDLA 3I78A 2JH5D 1YPLH 4Y0ZE 2OC8A 1QRXA 1TQ7B 1PPFE 4KELA 2FLBH 1VITF 2BD2A 4AFZA 1NZQH 3UQVA 1Y5BT 2D2DA 1H1BA 1CQQA 1O3IA 2GMTC 1SC8U 3SU4A 1TA6A 2XCFA 3S7KB 2KCPA 1P2MA 1LQDB 4B2BA 3ELAH 1TRYA 3UTUH 5EW2H 1JBUH 2ZDKA 2ZFPH 2ZFTA 3GYMA 3EE0B 1MABB 2GCTB 1O2QA 5JBCS 3RXSA 3KIDU 3LGWA 3WWBA 1M9UA 2IN2A 1V2LT 2J5UA 3RXFA 2GVFA 1NO9H 1GBDA 4X2XA 4YOGA 3RLWH 3SNCA 1PQ8A 3MH6A 2QXJA 2VJ1A 2VIVA 1EZSC 3QZQA 3SORA 5HKKD 3A81A 1FAXA 3A7YA 5F8TA 3A8DA 4ZAEA 2ZHDA 1G30B 1HAVA 2PKAB 3UY9A 1WV7H 1DS2E 1BMFD 3RXEA 2QCYA 2GV7A 1D9IA 3VXEH 1J8AA 2V3MA 3SV2H 2ULLA 3M35A 1ZTKA 6LPRA 3SNEA 5C20A 1P2JA 1SLUB 4YZUA 5TJXA 2FM2A 2BDGA 2FZZA 1KTSB 1MTWA 1C5NH 3H7OA 3MU8A 1TFXA 2H6MA 3SI3H 3S69A 1S6HA 1HB0B 3KYFA 4FVBA 3RXTA 1BDAA 1C5TA 3VXFH 2FYQA 2ILNA 1OYTH 2ZGHA 3TJOA 4IN2A 4K8YA 1FI8A 1P02A 1C2DA 3A7TA 4DY7B 1ZSLA 1TRNA 1O3OA 1HLTH 1PYTC 1TABE 1ANCA 1PFXC 1W7GH 4ABHA 1TNLA 4XDEA 5HM2A 2D8WA 2ZFFH 1SGEE 1GG6B 1ZHMA 2EI7A 2ALVA 1ZMLA 1BTUA 2F3CE 3A7ZA 1KSNA 2EQNA 3N7OA 4BAMB 2GP9B 4YXWD 3A89A 1O3EA 3QUMP 1BB0B 1D6RA 1W0YH 1XKAC 2CJIA 3BG8A 2H2ZA 1GHWH 1EJMA 3GYLB 2G81E 1CBWC 1FLEE 1PJPA 1C9PA 2ZCKP 1C2MA 1QJ6B 5DP8A 3E1XB 3TK5A 2AGGX 1HJ9A 1MZAA 2V3HH 3MHWU 4CRDA 5DP3A 1K1NA 6GCHF 2BDHA 1UVUH 4X8TH 1NFXA 2ZHWH 3MU5A 3ODFA 1EB1H 2C93B 2ZDNA 3TITA 3NPSA 2XWBI 2ZU3A 3TIUA 3RMMH 4SGAE 3KGPA 1NRPH 2ZGJA 3P8OA 1OOKB 2G55A 5AVDA 3MOCA 2B5TB 4H6TA 3SU3A 4GSOA 2K8IA 3TGJE 5HGGA 2XOKD 2GT7A 2ZI2H 3K6YA 1TQ0B 1IQEA 1Q3XA 3SNAA 1AB9B 5EQSA 4MLFB 1BQYA 2BX3A 3RXJA 1JIRA 1GBEA 2WHXA 3T5FH 1S6LA 2CGAA 2R0LA 3EDXB 5BPEA 3RDZA 1TNKA 4CH2B 1DWEH 3BTTE 5C67A 4NIYA 1A0JA 1KY9A 1HIAB 1YLNA 2R2MB 2VNTA 4Y11E 1GJ7B 1V2QT 2BX4A 2B9LA 1SB1H 4FETA 2CHAB 1C1VH 3Q76A 1WTGH 2ZHFH 1A46H 4O03A 3A7XA 4FU9A 1G3EA 1V2TT 1T8OA 2A31A 1J15A 2FOMB 3K65B 4K3JA 3ZVDA 3RXKA 1F0RA 3URCA 4ABEA 4OGXA 2HVXA 1GPZA 1ANDA 2V0BA 2QXHA 4U01A 2UUKB 2FP7B 1XX9A 1IQHA 4KTCA 2H5DA 1W0ZU 4PROA 1TBRH 4NFEA 7GCHF 4ZXXH 4GVUA 1VGCB 3HPTB 3RMLH 2FEQH 2ZGCA 4X1QU 3HK3B 1C2JA 4MPWA 2J94A 2HNTE 3PO1B 2A7HA 1XUIA 2BTCE 2WUCA 1DM4B 1GBAA 1JRSA 3BEFB 2FI5E 1AWHB 4O9VA 2ALPA 2AMQA 2BQ7B 1C1UH 4AC9A 2G8TA 4ZCNA 4DOQA 1YP9A 4NFFA 1O32A 1E35B 1JRTA 1YGCH 1OP8A 1C5ZB 3EQ0H 1NRNH 4K1EA 1C2HA 2XNDD 1V2NT 1O3AA 1HFDA 2V6NA 1E34B 1TE0A 1BUIA 2FOBA 2QF5A 5H4IB 5ABWA 5LPFA 1K0HA 3RU4E 3ZYEA 2H9TH 2K0QA 8ESTE 1N8OC 2W6JD 2Y82A 3MH4A 3NXPA 1ELGA 4ZMAH 1HJAC 1A0LA 2BHGA 3SJIA 1NY22 4GLYA 1C4U2 1T7CA 2IOTA 3V12A 4YESB 3CP7A 2IPQX 4AN7A 3RUOA 2NU4E 2H1UA 1ELVA 1O3PB 2GZ9A 2J9NA 3LKWA 3KQEA 4CHAC 3F6UH 3ZZ6A 3SU6A 3FFGA 4AFUA 5I46H 8LPRA 2UWPA 5F6MA 4INKA 3E91A 4Q63A 1ZSKA 2AERH 3N99A 2O8LA 2AIQA 2YNAA 4ABJA 1V2WT 2UWLA 5E0JA 3FKSD 2TGDA 4B2CA 4MNVA 3TGKE 4AG2A 4H4FA 4ESTE 5FCKA 2VIQA 1F0SA 3JZ1B 2P3FH 3EA7A 1DWCH 1XXDA 1J16A 1FZZA 1MD7A 3QX5H 3QGNB 4IGDA 2ZDVH 2ZU1A 2D26C 2O8TA 2OK5A 4FUEA 1G2MA 5C1YA 3PMBB 2G52A 1G2LA 3RXMA 4NIXA 1FY1A 3GISB 1GVKB 1A61H 5EW1H 1Y3UA 2BD4A 2Z3DA 1AD8H 4TPIZ 2QYIA 5FPYA 1C9TA 1DXPA 1WU1A 3T25A 1ELEE 2FXRA 1DY9A 3SUGA 4ACBA 1WUNH 1NT1A 3TJVA 1XVMA 3TU7H 1O2HA 5AFYH 3PWCA 3KN2A 4U2WA 4BXWA 2OD3B 4E06H 4LK4A 5EU8A 4IN1A 2BB4A 2ZCHP 1SR5C 3T27A 3FOAA 3TVJB 1J14A 1HCGA 1QA7A 5CHAB 1GMDF 1KXCA 1BMMH 1J17T 2CHAC 2XC0A 3ZZBA 3LC3A 1SGQE 2W7SA 5DO4H 1CA8B 1UW7A 2BLVA 1ZRKA 4Y0YE 2WPIS 2EY4C 1RD3B 2BZAA 2FI4E 2STAE 4M7GA 2OC1A 1AZZA 2A45B 5HM9A 3RXBA 2V35A 3C1KA 1G9IE 2FS9A 1AGJA 4R0IA 1O3CA 2G5VA 5JPMH 1FMGA 1CA0B 1ANBA 2BM2A 1GL1A 1K2I1 1LQEA 1MTUA 4A1VA 1O30A 1GJDB 1HAGE 1G36A 3EYDA 3SQEE 4UFFH 4HFPB 2LNCA 3HKJB 4ZHLU 1C5RA 2RCEA 3KF2A 1FIZA 4FUIA 1NBMD 3BTGE 3OSYA 3P8GA 2QAAA 1HJ8A 3F9GA 3DD2H 1EP6A 3OYPA 2P59A 3H7TA 4D7FA 1BMLA 1WAYB 4MNXA 4NIVA 2ZIQH 2G4TA 4YOIA 2RDEA 2ZA5A 1E37B 3PV5A 4Y7BA 1TX6A 1ELFA 5A0BA 1V2JT 2QIQA 1A5GH 3FP7E 3PWBA 1CT0E 1G37A 1BT7A 1OSSA 4ZXYH 1AFEH 2BVRH 3DHKH 3SBKA 3UPEA 4NG9H 3BTQE 2WYJA 3MH5A 4AOQA 4D7GA 1EAWA 2A7JA 3UIRA 1NRRH 2AHME 2ZU2A 1DDJA 2NU0E 4KTSA 4Y7AA 2A4QA 5C17A 5F8XA 4JCNA 1QL9A 3M3SA 2BXTH 5HIZA 6ESTA 1QBNA 4U32A 3HK6B 2FX4A 1HNEE 1T8MA 1ABJH 3V13A 3RXDA 1S5SA 1O2XA 3ZZ9A 1SGYE 2AGEX 1GJ8B 1Q31A 1O5BB 1EQ9A 1ACBE 1MTVA 1BHXF 1ETTH 1O34A 1UTQA 4MPXA 3ZV8A 3AW1A 1G3DA 2ZF0H 1W11U 1L0ZA 1AKSA 1OKXA 2KAIA 1C1PA 2VWNA 4ZKRU 4CBOA 3LDXH 2FODA 2BD7A 5FXLA 3AASA 3MNBA 3D62A 1LCYA 1AIXH 5GJ4B 1O3JA 1RGQA 2WV5A 1UK2A 3UFAA 1YPGH 4O3TA 2BZ6H 3LJOA 1V6DA 2GMTB 2XBWA 1K28D 2HPPH 3MFJA 5EPYA 2JH6D 4XRNA 5J4SA 4HG6A 2P16A 2FIRH 4DURA 1HXEH 1LTOA 3P70B 2AMPA 1BCUH 2SGDE 3SHCH 1N6XA 2KR7A 3S9BA 1GI5A 2FO9A 3TH2H 2KCOA 3NK8A 1BMNH 2AEIH 2VINA 2ZG0H 4XBDA 7ESTE 1OX1A 1DITH 1U6QA 5K0HA 4HZHA 5EIYA 4WXVA 1H9IE 6CHAC 1W10U 1O33A 2XNIA 1E1RD 2P95A 4BAQB 1CHGA 2ZDLA 2BYAX 2FI3E 1YCPH 3ATIA 1GBJA 1DFPA 2TPIZ 1HAIH 1GBTA 3PRBA 1P2OA 1PQ5A 5C1UA 1NU7B 4QT8C 3FP6E 4UEHH 4DT4A 5LH8A 1G3BA 1NS3A 2OC0A 2PSXA 5CHAC 4K5ZA 3UREA 1IQIA 3NCLA 1CT4E 1O3LA 3GICB 5C5OA 1K1PA 4X1PU 1E1QD 3MO9A 1TONA 5I25A 4I32A 2EI6A 1YY3A 3EGKH 1YWUA 3RC4A 3M36A 3P6ZB 1SGDE 3WWFA 3TH4H 1C5MD 4XD7D 1JMOH 1O2PA 4JZFH 3QLPH 1LHEH 3U8OH 5BRRE 1LDTT 1NM6A 5EJ1A 2HWLB 1VCQA 4MG3A 4X8SH 1GHZA 3GCTG 1P2IA 2FMJA 5DP6A 5FX5A 2XW9A 1AY6H 1PPCE 4NWKA 1KDQA 2BDYA 5EXMA 1SFQB 3ZZ3A 4TSFD 4UONA 4UFDH 1QL8A 1TA2A 1Z8IB 1HDTH 1EPTA 4R8TB 4NWLA 1T4UH 3F68H 5FCRA 1GI3A 4B74A 3U9AH 3PLBA 3E0NB 1ELDE 1C2IA 1TIOA 1EJAA 4Y79A 1LHDH 2PR3A 4ZKSU 3MTYA 1PPEE 4F4OC 5EODA 4THNH 2BMGB 5KEDA 4ISIH 2PUXB 1EZXC 1S0RA 1CBWB 3NZIA 4H42U 5JB8S 4I33A 1PPHE 1ZTLA 3BEUA 2ZDMA 1YPJH 3MNSA 2P94A 1BTYA 1TGBA 1ESBA 5E0HA 1TB6H 3BTEE 5F53A 1MH0A 3MU1A 1SQOA 3SU2A 1BHXB 4X6PA 1F0UA 1XUFA 5T6FA 2HPQH 4Y6DA 1C5XB 4DG4A 2GD4B 4P00A 2C8WB 1GMHG 2UUJB 1O37A 1LVOA 1THPB 3I29A 1SGTA 2WINI 4WF8A 4Y8XA 1ELCA 4ZHMU 2FOEA 4BNRA 4LZ1H 2C4FH 2BVXH 3M5NA 3RM2H 4ZH8A 2F9OA 1HBTH 3G01A 1BRUP 3WY8A 4WJG2 1GJ5H 3ZVAA 1D4PB 1MTNB 3RC6A 1CHOG 1A7SA 1GJ6A 2FESH 1F0TA 3BIVH 1UVSH 3E90B 4FUJA 2AMDA 1MU6B 1V2PT 3U1IB 4HTCH 1C1MA 1GHYH 2BY5X 1OXGA 1Z6JH 5AF9H 2FDAA 1GBKA 1L4DA 3PLKA 1THRH 1GHBG 3BTWE 2J38A 4RI0A 1O2OA 3W94A 1BIOA 1FY4A 4YM9A 2NWNA 2JKHA 2DUCA 5EGMA 1DY8A 1QURH 1QTFA 3GDUA 3BF6H 5F03A 2GDDA 3GCHC 1ELTA 2VIPA 1Z6EA 4GUXA 1HAZB 4I31A 3K2UA 2J97A 4Q7XA 3S0NA 3OEED 3MO3A 3QTVH 1IHTH 3PM3A 3URDA 1O35A 1ETSH 1EJNA 3RXLA 2J98B 4ABFA 1C1WH 3Q3KA 5T3HA 1DXWA 1FNIA 2QN5T 1N6YA 1ARBA 3CNRA 1Y3XA 5C1XA 2A7CA 5T6DA 3FP8E 3KQDA 1SQRA 2Z6BD 3D23A 2TGTA 5G4BA 2EEKA 3VGCC 2H5CA 4INLA 5FBIA 1T8NA 5C94A 3PMJA 1OP2A 3GY5A 3LT3A 2QGRA 1SGIB 5DSFA 2FX6A 1TOCB 3CS7A 1G3CA 1OWDA 3JZ2B 2THFB 1N8OB 1S83A 1W14U 2OBQA 1SI5H 1HJAB 1OS8A 1NRQH 1NN6A 4X6NA 3SZEA 2VVUA 3FN8A 5CMXH 1S84A 4Y10E 2C8XB 1L4ZA 1UMAH 1UK3A 2UUYA 4VGCB 2Y5GA 3DUXH 3U1JB 2VVCA 4CHAB 1P04A 1OWHA 1F2SE 4YT7H 4DIHH 5L30H 1QFKH 4JK5A 3RXGA 1GI6A 2QF4A 4E05H 2ZCLP 1S6FA 2CXVA 3M7QA 4B6FA 3U8RH 1NRSH 3OEHD 2BQWB 1LVMA 3MMGA 4ISOA 2FTLE 2PKSC 3M3VA 3PROA 2SGPE 3SNBA 2Y5HA 1P05A 4Y71A 2A5IA 1CGJE 4AYYB 4OS1A 5FX6A 2ZO3H 5A0CA 4ZHAA 2C90B 3RXRA 4CR9A 4XBBA 1K21H 1XUGA 4K1TA 1MUEB 4MVNA 1KXBA 3MH7A 3U98H 5JYIA 1KYNA 1TGCA 5FPTA 3OU0A 3BTDE 3LOXA 2ZHQH 2PGBB 4K60A 5EPNA 2ZEBA 1A1RA 3M3TA 3A7VA 2A4GA 4B71A 3A83A 1GBCA 1QQUA 2KM0A 1ZGIA 1BMAA 2Z9LA 1ESTA 3HGNA 1K1JA 4UFEH 1MTNC 2BDBA 1VITH 4ABAA 1Y3VA 4D9RA 4ABBA 4AYVB 1Z8RA 1JWTA 1D6WA 1MAXA 1GHAG 1CGIE 2W3IA 3ESTA 2CV3A 3LGVA 1YPKH 2J95A 2Q6DA 3RXIA 1T4VH 3A8AA 3A85A 4DVAU 1QB1A 3QZRA 1LMWB 1MZDA 3H09A 1H8DH 1BRAA 1EP5A 4IC6A 4FUGA 2W26A 2ZC9H 4NSVA 4K8BA 1AO5A 1EB2A 4MNYA 1YBWA 3PV4A 1W2KH 3CENA 5DKMA 1FQ3A 9ESTA 1O3DA 3RXHA 1UK4A 1AN1E 1ZHRA 2Q6FA 2VWOA 4KKDA 2LP6A 2SGAA 1EUFA 2YOLA 1TNGA 3D65E 5CDFE 4MPUA 1SLVB 1FPCH 3Q3YA 2Z3CA 1HAVB 1L2EA 2J4IA 2TGPZ 4ZROA 4ZKNU 1KXFA 1GBFA 1GMCG 4IMZA 1C5SA 4Z0KA 3F0OA 4KGAA 1TRMA 2C8YB 4JK6A 3BG4B 1TNIA 4OS4A 1NROH 4LXBH 5PTPA 3UNQA 1H8HD 3GY7A 3RXVA 1P09A 1BOQA 1NC6A 3LGIA 3OAAD 2GTBA 2O9QA 2I6QA 1YC0A 3A8BA 1ZRBA 1O2SA 2JH0D 2A2QH 1A5HA 3LJJA 3L33A 4VGCC 4ABIA 3EA9A 5EOKA 1UTKA 2JETC 2BD5A 1C1RA 5FAHA 5GDSH 1SG8B 2IJD1 1C2GA 5LGOA 1C5QA 4M9FA 2R2WU 1GJ4H 2ANKH 1H9HE 1C1OA 2ANWA 3ZVGA 1O2YA 4FUHA 1P2KA 1NFUA 1FPHH 3V7TA 2JJ2D 3LU9B 2B8OH 2OQ5A 1EPTC 1UTOA 3RXOA 2LPRA 1CE5A 4ISLA 4TY6A 2G5NA 1SPJA 1TLDA 3UB0A 4LZ4B 3Q00A 2OUAA 4DGJA 5J4QA 5DN6D 2D1JA 3ZZCA 3S9AA 3TJUA 1O5CB 1EATA 3PRDA 3FZDA 3F2HA 1WSSH 3SJKA 3SGQE 1O0DH 2HVYB 2WPDD 4CREA 1YLCA 3BN9A 1CT2E 1CVWH 2BDAA 4NA7A 3GY3A 4A7IB 2ZWLH 5LPRA 1MBQA 3GCTF 1L1NA 6CHAB 3RLYH 1BA8B 1AUJA 4YTAA 4CRGA 2ZQ2A 2OQUA 4I8GA 2L6OA 2UUFB 3SV6A 5IDKA 1ELAA 2AYWA 2ODPA 1HUTH 1ETRH 2XBXA 1MQ5A 2A1DB 2A32A 4RT0A 4CR5A 1LHFH 2OLGA 2P93A 1SGRE 3GY8A 2FOFA 5JBBS 3P95A 1BBRE 4B76A 2F9PA 1IQMA 5C2ZA 2CF9H 1ZR0A 3P17H 3ATWA 1ZZZA 5EQQA 2VWLA 5E0GA 4AFQA 1NU9A 1SFIA 2GT8A 2EI8A 2PGQB 1FY5A 3F3BA 2XCNA 4A1TA 5A0AE 3T2NA 1XKBC 3LGYA 4X1RU 3OY5U 3BSQA 3ZZ7A 1B0FA 1QCPA 1FXYA 3MYWA 3R0FA 1WTHD 4B75A 3MU0A 1DX5M 1KXAA 3NKKA 1TPSA 2J2UA 2F9NA 4DIIH 3KEEA 1GMHF 1P10A 1ZOMA 3ENSB 1D3TB 1GDNA 2IPHA 4AGJA 4RKOB 1V2MT 1UVOA 1Z1JA 5KECA 1TALA 2KZ4A 1DANH 2A2XH 5DPAA 4LOYH 1YPMH 2V3OH 1O2GH 5DK1A 2F91A 1WXRA 1O3NA 5EXLA 4AZ2B 1Z7KA 1DSTA 3VB5A 3ATKA 1SLWB 1LKAA 1C5WB 1MD8A 1RRKA 1CHOF 1AHTH 1K1OA 2NU3E 2GDEH 1GHXH 4F48B 3BTFE 4MNWA 2NU2E 2F9BH 3BG4C 3ZZDA 1AZ8A 3S7HB 3MNCA 1TPOA 3UWIA 3GY4A 3UOUA 1OPHB 1E79D 2J34A 1C2FA 1F5KU 1GHBF 1UHBA 3A8CA 1EOLA 2Q6GA 4DW2U 3BV9B 4E7RG 4ACAA 1GWAA 2I6SA 1TNJA 1LKBA 4P02A 1W3CA 1ZLRA 2XRCA 2HGTH 3O8BA 4GHTA 1K1IA 4IS5A 1O5EH 3K6ZA 3A87A 1ZGVA 1H9LB 3RXUA 2XC5A 1IQFA 2Z7FE 1P11E 7LPRA 1BBRK 5CHBA 1C4Y2 2XWAA 1DVAH 2BD8A 4FUDA 5KGOA 3A86A 1K1LA 3ZZ5A 1VCPA 1V2KT 1A0HB 2BOHB 5C3NA 4ASHA 5A09A 1N1LA 2ZFRH 4I8LA 2XBYA 3N7DA 1YPHC 4Q7YA 1ZPBA 1ZMNA 4AG1A 1HAPH 1Q2WA 2FS8A 2QXGA 3OFND 3DSOA 5GWZA 2PUQH 2ZZUH 3SNDA 1RTFB 2WPKS 3N7EA 4FXGH 2OC7A 2A5AA 3BIUH 1O38A 1W8BH 1ABIH 2PFEA 2XYAA 3PB1E 2OCVB 5HIYA 4I7YH 3GCHB 2VGCC 3RXQA 4X6OA 2EA3A 4CBNA 1BJUA 1P2QA 1O2UA 3QN7A 4F55A 3PTBA 3GOVB 1Z1IA 1AE5A 1KTTB 2O8WA 2PKAA 3BEIB 1RFNA 3FAOA 1O3BA 4Q2KA 4B6EA 1GCDA 3B9FH 2ZGXH 2O8MA 1QGFA 1UVTH 2BY6X 4U30A 3UNRA 3A7WA 1QNJA 3PV2A 2Z9IA 2GCHG 3MWIU 3VGCB 4OM9A 2CK3D 1SGFA 1TAWA 1KLJH 3O8DA 4Q80A 1WQVH 3SUDA 2Y81A 2PV9B 4YLQH 1VZQH 1MKWK 1HXFH 5EJZA 3UUZA 4CH8B 2VWMA 2ZU4A 2HALA 2A4RA 4Q4LA 3SU5A 3ZZAA 2BY7X 4FUCA 4OGYA 4TYDA 5JBAS 5LPEA 4AFSA 1C4V2 2PP6A 2JJ1D 4DCDA 3MNXA 2VIOA 3UAIC 1LVBA 2AGIX 1FUJA 3TGIE 1C1TA 4IW4E 4MQAA 1CSOE 4GCHG 5DJ7A 1O3FA 3AK5A 2WPLS 5C5NA 1XXFA 2BQ6B 2WUBA 5L2ZH 1NBME 3STIA 2B7DH 1NTPA 5HYOA 4ABGA 3SI4H 4CRBA 3ZIAD 1RXPA 2PKSB 2OINA 1BJVA 4GHQA 2HLDD 1AUTC 1OYQA 1OP0A 3UQOA 2SNWA 1EASA 4UFGH 2BD3A 1GHAF 1ZJDA 4DT7B 2TIOA 3R3GB 1BTPA 2SGEE 3F9FA 1HGTH 1QL7A 3MO6A 4ISHH 1Y3WA 4X2YA 1QIXB 1BITA 3SV8A 2W6ID 1EX3A 2OP9A 2FOAA 5EJLA 1GBLA 3SJ9A 1KMHB 2ZHEH 4D8NA 3RXPA 1WCZA 3C27B 5DP7A 3DFLA 1MTSA 3ZVFA 1GHVH 2C3SA 1FONA 2A0QB 1O3KA 1IQLA 3K9XB 4NA9H 5FHTA 3RP2A 1P06A 4RN6A 3QDZB 2PSYA 1GI2A 1NFYA 1TMTH 1HAHH 4Y8ZA 1ZTJA 2G51A 1H4WA 4NZQA 3SZNA 1GCTC 1MKXK 2V7QD 4INHA 4FVDA 4Q7ZA 3U8TH 1C5UA 3MI4A 3VB3A 5K7RA 1HAXB 1HIAA 2K1QA 3NUMA 2W7UA 2ZU5A 3GCOA 1AE8H 2W3KA 1C5LH 1J9CH 3TLOA 1AKSB 2KAIB 1C2EA 3VPKA 3BTKE 1SGCA 3F0PA 1FDPA 1GMCF 3QTOH 1Z8GA 2KCYA 3ODDA 1HAYB 2F43B 4WY3A 1GI1A 1FY8E 4XSKU 2ZDAH 1SHYA 1O2LA 1TGSZ 5T6GA 1WOFA 2KX4A 4TPYA 1W0JD 3ZVEA 1YPEH 1DICA 3UR9A 3VB6A 4NA8A 2WZQA 1AI8H 2Z9KA 2AH4X 1ZYOA 1QHRB 3T62A 5IYTA 1GI7B 1TWXB 1OWEA 1AFQC 3EA8A 3M7UA 4NSYA 1GBMA 1L1GA 4AX9H 3V3MA 2GGVB 4WVPE 2ZTZA 4Z6AH 1DWDH 4UE7H 1V2RT 3A88A 3M5LA 1P0SH 4SGBE 1O5GH 3O8CA 1RTKA 3O8RA 1EZQA 1MBMA 4WH8A 2BY8X 1B7XB 4D9QA 1BTXA 3DT0H 4Y8YA 2J92A 1T31A 1HPGA 4WXIA 1W12U 1GVZA 1A3EH 3P8FA 1Y5UT 3RXAA 3QGJA 1LPKB 1QY6A 4X2WA 2NU1E 2FWWA 2ANYA 4DJZB 3FVFB 2BXUH 4XFQA 4KP0A 1T8LA 1EZUC 2ODQA 5E2PA 3Q3XA 4BANB 5T1VA 1D3DB 3RU4D 1DOJA 1GDUA 1EXFA 4UD9H 1JIMA 1O2ZA 1H8IH 2AIPA 3PMAB 5JBTA 1P12E 2JETB 1INCA 4I8HA 4F49A 3GDVA 1P9UA 1UCYE 3KQCA 3TNSA 1Z8JB 4H6SB 8GCHG 1KDQB 4WWYA 1AVXA 1THSH 4IC5A 1WQSA 5TCCA 2ZP0H 2GJGA 2GV6A 2FOGA 1QBOA 3ZZ4A 5C0UA 5JDUB 2BY9X 2YMSD 1GBHA 3F2GA 1IAUA 3S9CA 1EPTB 1NPMA 2HRVA 5A2MH 5HMAA 4GPGA 2QC2A 5GXPA 3GDSA 3BTME 4NZLA
chains in the Genus database with same CATH topology
2UWOA 1IOEA 1PQ7A 1TOMH 2ZQ1A 2ZGBH 3MU4A 4XBCA 1EKBB 2C8ZB 2BDIA 5GPIB 1P3CA 4X6MA 4Y76A 1GI4A 4K1SA 4X1NU 2B0FA 5EQRA 2QY0B 1YCPK 1SGFG 4B1TA 3OY6U 4TY7A 1TBQH 1O2IA 3PLPA 3QWCH 1QB6A 4YO9A 1V2UT 2VH6A 2FYRA 1C5OH 2VVVA 3RM0H 1BRBE 1D3QB 1B0EA 1LVYA 3E16B 3LIWA 1PPZA 1JXPA 1GJAB 1FY3A 1O2KA 1V2VT 1DUAA 1GJ9B 2ZPSA 3SHAH 1C1QA 1EAXA 1GL0E 1KXEA 3F9EA 4HGCA 4O97A 1LO6A 1HAOH 1O5DH 3D49H 3LPRA 1DLKB 2PHBA 1OWJA 2WYGA 1C1NA 4K2YA 2AS9A 2FOCA 4YLUA 3P92A 5SGAE 5HXFA 1BBRH 4GAWA 5GCHG 1XMNB 1TPPA 4YOJA 9LPRA 4JYVH 1AVGH 1GJBB 2Z94A 2HLCA 3M61U 3LGUA 3UOPA 4AB9A 3ZVBA 3A82A 1XUJA 2VB0A 2ASUB 1CGHA 1O5FH 4FUBA 4ABDA 1O2JA 1T32A 2QXIA 1ANEA 1UCYK 1ZPCA 1GGDB 2GCTC 2GZ7A 3Q77A 1FAKH 2HOBA 1O3HA 1V2OT 2GX4A 3SJOA 1F5RA 1XM1A 3SU1A 3SUFA 2ZPQA 1O3MA 3ZYDA 1CO7E 3SO3A 1YCPM 2CMYA 2H9EH 2ZKSA 4IMQA 4IBLH 7KMEH 2ESTE 1C2KA 1QR3E 2Z9JA 3UNSA 1V3XA 1A3BH 5F8ZA 1E36B 2F9VA 2HNTC 3HGPA 2GKVE 4RSPA 1VITG 3T26A 5JB9S 5A8ZA 2XBVA 3SJ8A 2EC9H 1P3EA 1UTMA 1JOUB 1UTPA 3SN8A 2GZ8A 1SVPA 1TMUH 1ORFA 1S85A 4B73A 5B6OA 3DA9B 3DFJA 3UWJH 1O39A 3E8LA 2Z9GA 1UTNA 1DPOA 3L6PA 2QF3A 3ZVCA 4JZIA 4CRAA 3SV9A 1RIWB 2CN0H 4JYUH 1SL3A 1BZXE 1OWKA 2PLXA 1MAYA 3M7TA 3SV7A 1MKWH 3OTJE 3EAJA 2PW8H 3GY6A 1PPGE 3RU4T 1IQJA 2BVSH 5EG4A 2DE9A 1YM0A 4BTUB 2Q1JA 1C5PA 5TCAA 1QJ7B 3IITA 4X1SU 2OBOA 3M5MA 3V0XA 2ZTXA 1GG6C 1ARCA 3ATLA 3ATMA 2ZTYA 2GCHF 3SW2B 3ZV9A 1Y8TA 4X8VH 1TNHA 3T29A 4UDWH 1V2ST 2XXLA 1XUHA 1YYY1 5ESTE 3OX7U 1O2RA 4FUFA 1RTLA 4WMFA 1QRZA 1CU1A 1TGTA 1MMJN 2STBE 3KCGH 1GI9B 2VGCB 4ZUHA 3A80A 4WMEA 1B5GH 1G32B 1GVLA 3AVZA 4OS6A 1A2CH 3E3TA 4KTUA 2ZFQH 3LH3A 4JZ1A 1QRWA 1UTJA 1VR1H 4BOHA 5FPSA 1SHHB 3NWUA 1QA0A 1ESAA 2F9UA 1FJSA 1O2VA 1Y5AT 1KIGH 4GCHF 2XC4A 1A5IA 1AWFH 2PWXA 3I77A 1GBBA 3E0PB 1IQGA 3KHVA 1AB9C 3ITIA 5GIBA 1Y3YA 1P2NA 1P8VC 3VB4A 2OTVA 2R0KA 1FN6A 2PTCE 4I8JA 3RMOH 2P3UB 1ZSJA 2ZECA 5AHGH 4ISNA 2ANMH 5DP4A 1QBVH 1YKTA 4AGKA 1LPGB 5EXNA 1MKXH 3HATH 3A84A 1DSUA 2ZPRA 1LHGH 6GCHG 3U69H 4E7NA 3VFEA 3SGAE 4FU8A 1XUKA 1ZPZA 1GGDC 1O5AB 4JZEH 4MDSA 1Z71A 2WPHS 3FANA 3SUEA 2BLQA 1YLDA 4XOJA 2YNBA 1WBGB 3QO6A 4J1YA 1UO6A 1C5VA 1F92A 2TBSA 3TNTA 2BLWA 1ID5H 2DE8A 3W95A 1W7XH 3HKIB 1VGCC 4MPVA 2G00A 3VB7A 1C1SA 3LGTA 1O31A 3PO1C 4AB8A 2M5TA 5DP5A 8KME2 2RA3A 2WPJS 3TK9A 1EOJA 3LC5A 2XTTB 1SSXA 4TWWA 4K69A 2WPMS 1FIWA 3GCNA 1SQAA 3F1SB 4XE4A 1LHCH 1P03A 4JZDH 3KL6A 5DP9A 2ODYB 2Y80A 1TX7A 2WV4A 3LH1A 1SMFE 4WH6A 1P57B 4X0WU 4BXSA 1DLEA 2H9HA 2R3UA 2RA0A 1XVOA 1ZMJA 1TX8A 1RIWC 2Z3EA 1A4WH 2SNVA 2ZNKH 4OS2A 2A5KA 3UR6A 1DE7H 5E8EH 1L1JA 3F9HA 4HI3A 3B8JA 4BAOB 2Y7XA 4WMDA 3B23B 1GBIA 1NESE 1PQAA 2P8OB 7GCHG 4FU7A 1SGPE 1KXDA 1GCTB 1NFWA 3QK1A 3VEQB 2W5EA 1YPHE 1RS0A 3CS0A 2OXSA 4O3UA 1GI8B 1KLTA 1S0QA 3TK6A 1O36A 1O2WA 1TPAE 3M37A 4CRCA 4RKJB 2SGQE 3TH3H 1SOTA 1K22H 1ELBA 3PYHA 3T28A 1GDQA 2FPZA 2QV1A 2Y5FA 3L3TA 1E38B 4J2YB 3GY2A 1O2MA 1WYKA 1TGNA 1FN8A 2AFQB 4BAKB 2BD9A 2A4OA 1LPZB 1GJCB 1AFQB 1F5LA 4YT6H 4AORA 2P3TB 1C5YB 1BTZA 4BAHB 3SOSA 4D76A 1DUEA 3AAUA 1ZHPA 2Y7ZA 1QQ4A 4OS7A 1OWIA 1TBZH 1TYNA 3SGBE 8GCHF 5ESBA 1QJ1B 3E6PH 1UTLM 2TRMA 2Y6TA 4I8KA 4JYTA 2VH0A 1SBWA 1O2NA 4JMYA 1P01A 3H5CB 4BTTB 4A92A 2O8UA 1O2TA 5AFZH 5DG6A 4A1XA 1UJ1A 3RMNH 2VIWA 1HV7A 3RXCA 5ETXA 2R9PA 2SFAA 3STJA 3KQBA 1O3GA 1ZJKA 1BTHH 4OS5A 1MU8B 1IQKA 1HYLA 2HNTF 3P8NA 1S82A 2VU8E 1IQNA 2VIDA 4NGAH 4X2VA 1DWBH 1W13U 1UVPA 1DT2A 1K1MA 2QF0A 4NCYA 1AMHA 1C2LA 4CRFA 1VCWA 1FV9A 1PYTD 2IJOB 2BOKA 1CA0C 1MQ6A 3SU0A 4NIWA 4BTIB 1F7ZA 2R3YA 5L6NH 1MCTA 1TMBH 1AQ7A 1HRTH 1QB9A 1VJAU 3M5OA 2G4UA 1P9SA 1YF4A 3AAVA 3IG6B 5DGJA 1UCYH 2FTMA 1SLXB 3RC5A 4X8UH 3PTNA 4A5TS 3PMHB 1Y59T 1GMDG 3TJNA 1D3PB 1X7AC 3FZZA 1SGNE 3ZZ8A 2CF8H 4ZKOU 1VJ9U 4TWYA 5L2YH 1AVWA 2BLOA 5GCHF 2RG3A 5FBEA 1SQTA 2TGAA 5A8XA 2F83A 3KNXA 4MTBA 1UHBB 3IWMA 2SGFE 3SQHE 3BTHE 2BDCA 5A8YA 5CE1A 3AW0A 2P8OC 1K9OE 3TPIZ 2FLRH 1MCVA 1EAUA 2PTNA 4A6LA 1KLIH 2ZFSA 4B2AA 1IHSH 1RJXB 1SOZA 3LONA 1EAIA 1BRCE 1S81A 2FOHA 5E2OA 1AU8A 1BTWA 1PPBH 2QA9E 1GI0A 1E0FD 2RDLA 3I78A 2JH5D 1YPLH 4Y0ZE 2OC8A 1QRXA 1TQ7B 1PPFE 4KELA 2FLBH 1VITF 2BD2A 4AFZA 1NZQH 3UQVA 1Y5BT 2D2DA 1H1BA 1CQQA 1O3IA 2GMTC 1SC8U 3SU4A 1TA6A 2XCFA 3S7KB 1P2MA 1LQDB 4B2BA 3ELAH 1TRYA 3UTUH 5EW2H 1JBUH 2ZDKA 2ZFPH 2ZFTA 3GYMA 3EE0B 2GCTB 5JBCS 1O2QA 3RXSA 3KIDU 3LGWA 1M9UA 2IN2A 1V2LT 3RXFA 2GVFA 1NO9H 1GBDA 4X2XA 4YOGA 3RLWH 3SNCA 1PQ8A 3MH6A 2QXJA 2VJ1A 2VIVA 1EZSC 3QZQA 3SORA 3A81A 1FAXA 3A7YA 5F8TA 3A8DA 4ZAEA 2ZHDA 1G30B 1HAVA 2PKAB 3UY9A 1WV7H 1DS2E 3RXEA 2QCYA 2GV7A 1D9IA 3VXEH 1J8AA 3SV2H 2ULLA 3M35A 1ZTKA 6LPRA 3SNEA 5C20A 1P2JA 1SLUB 4YZUA 5TJXA 2FM2A 2BDGA 2FZZA 1KTSB 1MTWA 1C5NH 3H7OA 3MU8A 1TFXA 2H6MA 3SI3H 3S69A 1S6HA 1HB0B 4FVBA 3RXTA 1BDAA 1C5TA 3VXFH 2FYQA 2ILNA 1OYTH 2ZGHA 3TJOA 4IN2A 4K8YA 1FI8A 1P02A 1C2DA 3A7TA 4DY7B 1ZSLA 1TRNA 1O3OA 1HLTH 1PYTC 1TABE 1ANCA 1PFXC 1W7GH 4ABHA 1TNLA 4XDEA 5HM2A 2D8WA 2ZFFH 1SGEE 1GG6B 1ZHMA 2EI7A 2ALVA 1ZMLA 1BTUA 2F3CE 3A7ZA 1KSNA 3N7OA 4BAMB 2GP9B 3A89A 1O3EA 3QUMP 1BB0B 1D6RA 1W0YH 1XKAC 2CJIA 3BG8A 2H2ZA 1GHWH 1EJMA 3GYLB 2G81E 1CBWC 1FLEE 1PJPA 1C9PA 2ZCKP 1C2MA 1QJ6B 5DP8A 3E1XB 3TK5A 2AGGX 1HJ9A 1MZAA 2V3HH 3MHWU 4CRDA 5DP3A 1K1NA 6GCHF 2BDHA 1UVUH 4X8TH 1NFXA 2ZHWH 3MU5A 3ODFA 1EB1H 2C93B 2ZDNA 3TITA 3NPSA 2XWBI 2ZU3A 3TIUA 3RMMH 4SGAE 3KGPA 1NRPH 2ZGJA 3P8OA 1OOKB 2G55A 5AVDA 3MOCA 2B5TB 4H6TA 3SU3A 4GSOA 3TGJE 5HGGA 2GT7A 2ZI2H 3K6YA 1TQ0B 1IQEA 1Q3XA 3SNAA 1AB9B 5EQSA 4MLFB 1BQYA 2BX3A 3RXJA 1JIRA 1GBEA 3T5FH 2CGAA 2R0LA 3EDXB 5BPEA 3RDZA 1TNKA 4CH2B 1DWEH 3BTTE 5C67A 4NIYA 1A0JA 1KY9A 1HIAB 2R2MB 2VNTA 4Y11E 1GJ7B 1V2QT 2BX4A 2B9LA 1SB1H 2CHAB 1C1VH 3Q76A 1WTGH 2ZHFH 1A46H 4O03A 3A7XA 4FU9A 1G3EA 1V2TT 1T8OA 2A31A 1J15A 2FOMB 3K65B 4K3JA 3ZVDA 3RXKA 1F0RA 3URCA 4ABEA 4OGXA 2HVXA 1GPZA 1ANDA 2V0BA 2QXHA 4U01A 2UUKB 2FP7B 1XX9A 1IQHA 4KTCA 2H5DA 1W0ZU 4PROA 1TBRH 4NFEA 7GCHF 4ZXXH 4GVUA 1VGCB 3HPTB 3RMLH 2FEQH 2ZGCA 4X1QU 3HK3B 1C2JA 4MPWA 2J94A 2HNTE 3PO1B 2A7HA 1XUIA 2BTCE 2WUCA 1DM4B 1GBAA 1JRSA 3BEFB 2FI5E 1AWHB 4O9VA 2ALPA 2AMQA 2BQ7B 1C1UH 2G8TA 4DOQA 1YP9A 4NFFA 1O32A 1E35B 1JRTA 1YGCH 1OP8A 1C5ZB 3EQ0H 1NRNH 4K1EA 1C2HA 1V2NT 1O3AA 1HFDA 2V6NA 1E34B 1TE0A 1BUIA 2FOBA 5H4IB 5ABWA 5LPFA 3RU4E 3ZYEA 2H9TH 8ESTE 1N8OC 2Y82A 3MH4A 3NXPA 1ELGA 4ZMAH 1HJAC 1A0LA 2BHGA 3SJIA 1NY22 4GLYA 1C4U2 1T7CA 2IOTA 3V12A 4YESB 3CP7A 4AN7A 3RUOA 2NU4E 2H1UA 1ELVA 1O3PB 2GZ9A 2J9NA 3LKWA 3KQEA 4CHAC 3F6UH 3ZZ6A 3SU6A 3FFGA 4AFUA 5I46H 8LPRA 2UWPA 5F6MA 4INKA 3E91A 1ZSKA 2AERH 2O8LA 2AIQA 2YNAA 4ABJA 1V2WT 2UWLA 5E0JA 4B2CA 2TGDA 4MNVA 3TGKE 4AG2A 4H4FA 4ESTE 5FCKA 2VIQA 1F0SA 3JZ1B 2P3FH 3EA7A 1DWCH 1XXDA 1J16A 1FZZA 1MD7A 3QX5H 3QGNB 4IGDA 2ZDVH 2ZU1A 2D26C 2O8TA 4FUEA 1G2MA 5C1YA 3PMBB 2G52A 1G2LA 3RXMA 4NIXA 1FY1A 3GISB 1GVKB 1A61H 5EW1H 1Y3UA 2BD4A 2Z3DA 1AD8H 4TPIZ 2QYIA 5FPYA 1C9TA 1DXPA 1WU1A 3T25A 1ELEE 2FXRA 1DY9A 3SUGA 1WUNH 1NT1A 3TJVA 1XVMA 3TU7H 1O2HA 5AFYH 3PWCA 3KN2A 4U2WA 4BXWA 2OD3B 4E06H 4LK4A 5EU8A 4IN1A 2BB4A 2ZCHP 1SR5C 3T27A 3TVJB 1J14A 1HCGA 1QA7A 5CHAB 1GMDF 1KXCA 1BMMH 1J17T 2CHAC 2XC0A 3ZZBA 3LC3A 1SGQE 2W7SA 5DO4H 1CA8B 2BLVA 4Y0YE 1ZRKA 2WPIS 1RD3B 2BZAA 2FI4E 2STAE 4M7GA 2OC1A 1AZZA 2A45B 5HM9A 3RXBA 2V35A 3C1KA 1G9IE 2FS9A 1AGJA 4R0IA 1O3CA 2G5VA 5JPMH 1FMGA 1CA0B 1ANBA 2BM2A 1GL1A 1K2I1 1LQEA 1MTUA 4A1VA 1O30A 1GJDB 1HAGE 1G36A 3EYDA 3SQEE 4UFFH 4HFPB 2LNCA 3HKJB 4ZHLU 1C5RA 2RCEA 3KF2A 1FIZA 4FUIA 3BTGE 3OSYA 3P8GA 2QAAA 1HJ8A 3F9GA 3DD2H 1EP6A 3OYPA 2P59A 3H7TA 4D7FA 1BMLA 1WAYB 4MNXA 4NIVA 2ZIQH 2G4TA 4YOIA 2ZA5A 1E37B 4Y7BA 1TX6A 1ELFA 5A0BA 1V2JT 2QIQA 1A5GH 3FP7E 3PWBA 1CT0E 1G37A 1BT7A 1OSSA 4ZXYH 1AFEH 2BVRH 3DHKH 3SBKA 3UPEA 4NG9H 3BTQE 2WYJA 3MH5A 4AOQA 4D7GA 1EAWA 2A7JA 3UIRA 1NRRH 2ZU2A 1DDJA 2NU0E 4KTSA 4Y7AA 2A4QA 5F8XA 4JCNA 1QL9A 3M3SA 2BXTH 6ESTA 1QBNA 4U32A 3HK6B 2FX4A 1HNEE 1T8MA