3PMJA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pmjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pmjA02
3OY6U 2WPLS 2GZ9A 1GMDF 2ZHWH 3OSYA 1ARCA 1ZTJA 3I77A 5FPTA 2QV1A 1E38B 1NFXA 2B0FA 4IMQA 2BY7X 1O3AA 3UPEA 6GCHG 2PWXA 2Z6BD 1L1GA 2W7UA 1W11U 1K1LA 3RMMH 4JZIA 1ELVA 1DWDH 2W7SA 2WPJS 1G30B 3R3GB 2BY5X 2Y5GA 4OS6A 1O2VA 5C20A 1O2OA 2Z9JA 1LVOA 3MTYA 1GBAA 4O3UA 1EOLA 4Z0KA 4U30A 3RXGA 1G2MA 5EW1H 2P94A 1DY8A 3B23B 1CVWH 1HAIH 1QRWA 2GCTB 4LZ1H 4ZXXH 3SJKA 2OXSA 4BNRA 3BIUH 5A09A 4JYVH 1IHTH 1ABIH 1LPKB 2J94A 1ZRKA 1A0JA 2UUJB 1L1JA 3A8AA 2ALVA 1SQAA 3P17H 4UFGH 2D26C 2A7CA 2EI7A 3SORA 4B74A 1LDTT 3VB3A 3SNEA 1O3EA 1C2FA 1D3PB 2BOHB 2HOBA 2F9VA 1GJ7B 1V2JT 1T4UH 2FOBA 3S0NA 1ESAA 4JK5A 4MPXA 3RXJA 2C4FH 1TOMH 2F9UA 3S9CA 2BD4A 3GYLB 4IBLH 1CO7E 1E34B 3LKWA 1TGTA 3VB6A 3FFGA 1QL8A 3PWBA 1P3CA 3A89A 5AF9H 1SLUB 2XTTB 3TVJB 1CT0E 1BITA 1FPCH 4DG4A 1NFUA 4FUDA 2P3UB 1D3QB 1ZHMA 2CGAA 3SU6A 2VIWA 3B9FH 1O2IA 5FX5A 2A32A 1AZZA 1O5DH 1NROH 1HGTH 4WMFA 1C5ZB 1N8OB 6ESTA 4OS7A 2ZPQA 2BDGA 1TX8A 4ZUHA 3S9AA 2B8OH 5DJ7A 2Q6FA 1AHTH 1P9SA 3BTME 1TPOA 2IOTA 2FLRH 3TU7H 2VIVA 3T26A 4BAOB 4HFPB 4XDEA 1TALA 1BCUH 4AB8A 4WY3A 1SQTA 3LGVA 2RA3A 1H1BA 4OS4A 1TONA 2G51A 1UJ1A 3VFEA 4YOJA 1HPGA 1EPTB 1MKXH 1XKBC 1XXDA 4ABDA 2IJOB 2C93B 2VWMA 4U2WA 1P2NA 1ZR0A 1TFXA 3MO9A 1UCYK 1PPFE 5F8TA 4K8YA 4MNWA 4Y0ZE 1WOFA 2AYWA 1WQVH 3T29A 2OCVB 4NWKA 3V7TA 2VH6A 1B0FA 1S6FA 4D76A 1JBUH 1QQUA 1HCGA 3RXEA 1WYKA 1O2WA 4GLYA 2AIQA 4DY7B 1CSOE 1G32B 2ZQ2A 4CBOA 1W0YH 1W0ZU 1DX5M 2Z3CA 4AB9A 1K22H 1YKTA 2V35A 1WV7H 4BTUB 4QT8C 4DVAU 1XUGA 3ZZ9A 4K60A 2G55A 4MNYA 3PLPA 4WXVA 2GD4B 4X1PU 4X8SH 1D4PB 1ABJH 2WYJA 1QJ7B 4X6OA 1CHGA 4CHAC 1V2KT 1INCA 3L33A 4I8JA 1C2MA 4INHA 4DGJA 3Q3XA 1UVSH 1S6HA 4B71A 3MH7A 2BQ7B 2BZ6H 5I25A 3V0XA 3F6UH 1GJ6A 1BOQA 1C5NH 2PSYA 1P04A 3LC3A 1SGRE 1OP0A 1O2XA 1CGIE 2ZG0H 3NXPA 2B7DH 1H8DH 2LNCA 4OS1A 1O0DH 3CS7A 2FODA 3GCTF 2ZGBH 1TGBA 4KTUA 1Q31A 3FVFB 3IG6B 2SFAA 1HIAA 1OS8A 1DM4B 2BDAA 1GHXH 1HJAC 1MTUA 1N6YA 3MH6A 2QXIA 4TWYA 3RC6A 3BTDE 2FO9A 1NTPA 2QY0B 5DP3A 1TRNA 4Y10E 1JIRA 1ZRBA 2VNTA 1KXEA 3SV2H 4YESB 1Y3YA 2VINA 1TPPA 2R0KA 3LT3A 2RA0A 5PTPA 1T4VH 2XCNA 1IQEA 2BD5A 3UFAA 1G3CA 2H2ZA 4A6LA 2TGAA 4O03A 1BTPA 1ZSLA 1O39A 2VU8E 2PKSC 5JBCS 3T62A 2D1JA 5EG4A 1SPJA 3TITA 1GJBB 1P2IA 3MHWU 1T32A 3ZV9A 1HBTH 1C4Y2 4NZQA 1GVKB 2GZ7A 4I8HA 4ZKSU 2GVFA 1VGCC 3RXTA 2Y5HA 2WYGA 2ZGXH 1THPB 3LH1A 3SNCA 1D9IA 1OWKA 2OQ5A 4ISNA 2PKSB 3SO3A 3MNCA 3LH3A 1RTFB 2P3FH 3ZZBA 1FMGA 3ODDA 3OTJE 3SGQE 4YOIA 4RKJB 3GISB 5LPRA 1O35A 1VGCB 1JIMA 3PO1C 3S7KB 1T31A 3GY2A 2AMQA 2THFB 3M7UA 2Z3DA 3LONA 3SNBA 1U6QA 2ZTYA 3TNTA 4FUIA 4JYUH 1FQ3A 3PO1B 1D6WA 4MPVA 3EYDA 2GV7A 1KY9A 5FXLA 1GL0E 1UTMA 2B5TB 1P2KA 3TH4H 2ODQA 3T28A 4UE7H 3A88A 4JK6A 3BG4C 3GCOA 2AEIH 3ATKA 1EAWA 1GJ9B 2WPKS 1YP9A 3SW2B 3GDSA 1EZSC 4XFQA 1K21H 5L2YH 4AYVB 2Z94A 4NA9H 2I6QA 1OKXA 4Q7ZA 1PJPA 4Y7BA 1BA8B 1Y3VA 2WINI 2ZECA 2YNAA 1A2CH 3A8DA 3B8JA 1BTWA 4Z6AH 3RU4D 1IQNA 2P93A 1V2WT 1X7AC 3MU0A 2BHGA 4MNXA 5DO4H 5C1XA 5I46H 3RXSA 1JOUB 1D6RA 4Y76A 4B1TA 2AH4X 2R3YA 4OS2A 2VGCB 1BRUP 1PPCE 3W94A 1DWBH 1PYTD 2NU0E 1OX1A 4Y0YE 3P8OA 2Z7FE 4DCDA 4ZKOU 3F68H 1KLTA 2ZHDA 3RXLA 4WXIA 1IQIA 3DUXH 1W2KH 2ZCKP 2ZO3H 2J95A 2A0QB 5A0AE 4ZKRU 1G37A 2XBVA 4FUEA 2W3KA 1GBMA 1EXFA 1SGIB 3RXAA 1N1LA 4ABAA 5E2OA 1NRNH 5T3HA 1BTHH 3T2NA 3HKJB 1BRAA 1GHZA 4ZKNU 3G01A 1ELFA 1BTXA 2Z9IA 2HNTE 3V3MA 2HNTC 1GJCB 1LQDB 2XC4A 1FONA 4WJG2 1AB9B 1TMUH 3A81A 1WU1A 1GJ5H 1QIXB 1SGTA 4X6MA 5JBAS 2A5IA 2H9HA 2ZFFH 1AD8H 2BDCA 4DIHH 4UFEH 3CENA 4K3JA 3QGNB 2ZPRA 4ISLA 4XOJA 2ZF0H 2PFEA 1E35B 5DGJA 4U32A 4MDSA 4IS5A 1LHEH 1TGSZ 3HATH 5HXFA 2FMJA 3H7TA 5FHTA 1EATA 1ESBA 1PQ8A 2TIOA 2OC0A 2VVUA 4ZAEA 1TPAE 4MPWA 4Y71A 1Y3UA 1BUIA 1DUEA 2K1QA 1GBJA 1XKAC 2P3TB 4ISHH 1ZHPA 4WVPE 1GHAF 5FAHA 3LIWA 2QCYA 1B5GH 3BEUA 5E0HA 1C1SA 3ZVAA 4BAHB 1KTSB 4D9QA 1W7GH 2AMPA 5B6OA 3GDVA 1OWJA 1QL9A 3GY7A 1GGDC 1HIAB 1C5UA 4B75A 2FM2A 2VVVA 3MMGA 4A1TA 1GDUA 1O2ZA 4DURA 1B0EA 1EOJA 4H4FA 3SGBE 5K7RA 1RTLA 3PMHB 4FUJA 4CRDA 2V3HH 2H5DA 1ACBE 1F5RA 1MKXK 2BYAX 1CA0B 1C2GA 5FCRA 4AFSA 3ZZ8A 2WV5A 3JZ1B 1G2LA 3BTGE 2C8ZB 2IN2A 4H6TA 1GI6A 2ULLA 3SV6A 4AG1A 1ZMLA 3ATLA 4Y6DA 1JWTA 1O3GA 3MU1A 3MU5A 4AZ2B 4XSKU 1AKSA 2SGAA 1NS3A 4GPGA 2DUCA 1FXYA 4X0WU 5EPYA 1F0UA 1O2RA 1SG8B 1TE0A 3ZYDA 3A83A 3LPRA 3VB7A 3UWIA 8GCHF 5LGOA 3BEFB 1KTTB 1P06A 2Q6DA 1QB1A 3F9HA 3RP2A 1ORFA 3GCHC 1MD7A 2FPZA 2D8WA 1C5WB 3QWCH 4UFDH 5F8ZA 1RD3B 2A4OA 2QYIA 3KHVA 1IQHA 1SOTA 1GMHF 1GDNA 3DD2H 1BQYA 3C1KA 1TNJA 2I6SA 1M9UA 1GI0A 1P2OA 1GWAA 3CP7A 3LGUA 1GBFA 4K5ZA 1MBMA 3MU8A 3GCHB 1K1MA 2BLQA 2F9NA 1Y59T 1TNGA 5BRRE 1H9IE 4K69A 1C5OH 1EZUC 2G5VA 1WTGH 2P59A 2BD7A 4B2BA 8ESTE 1JRSA 1NC6A 5C3NA 4AGJA 2WUBA 1O37A 1NZQH 2BD2A 4HGCA 3VB4A 5F6MA 4O9VA 4GUXA 1HJ9A 1FLEE 2UUFB 1BMNH 1GCTB 5ESTE 1TRMA 9ESTA 2VH0A 2ZC9H 3A7XA 2GCHG 3RM2H 5HYOA 2OC7A 1NFWA 1IOEA 1FY8E 1NFYA 5AFZH 5A0CA 3KIDU 3UQVA 3T25A 4FU8A 1EJAA 1HAZB 1S82A 1W14U 4Y11E 3ZVEA 1ZTLA 1VITH 3EAJA 2FOHA 4MNVA 3U98H 1LO6A 4Q7XA 4LK4A 2A4QA 4X2XA 4D7FA 1TMTH 3RC4A 2GDEH 3KGPA 3STJA 1P09A 1VJ9U 1O2SA 1EB1H 3RU4T 3L6PA 2QF0A 2SNWA 3UWJH 4FUBA 2ZGCA 4B2CA 5A0BA 1OWHA 1K1PA 1RXPA 1GJAB 1MKWH 1SR5C 4ZMAH 1C2EA 3M5LA 1L4ZA 1SL3A 3EGKH 3P95A 4FUFA 3NCLA 4X6PA 4A7IB 1HAHH 2J34A 1GBLA 1O5FH 4UD9H 1DWEH 4LZ4B 1GJ4H 1BBRK 4TWWA 1FY1A 1O2HA 2XBYA 4INLA 1Z71A 4KP0A 3ATWA 1L2EA 3MH4A 3SU5A 4B76A 1KXAA 2QC2A 3BF6H 1BMMH 1HAYB 3GY6A 3RM0H 1BMAA 4WWYA 1UVTH 1Y3XA 1Z8IB 1O32A 1EJMA 4D8NA 4XBBA 1FIZA 2AGIX 3RXRA 1ANEA 5EOKA 2ZDKA 1PPHE 3LDXH 4AN7A 2PTCE 1UTPA 3QZQA 2NU4E 3IWMA 1O3MA 1N6XA 3BG8A 1IAUA 2FWWA 2Y5FA 2PKAA 3NKKA 5FBIA 1V2UT 2B9LA 2JETC 1LQEA 1K1NA 1C1NA 2TRMA 1GI4A 3TIUA 3RXCA 3EDXB 1IQMA 1XUHA 3KQDA 5H4IB 3ZZ4A 2FOEA 3PB1E 3A7VA 1ZLRA 1V2OT 3SU3A 3D65E 5E0JA 3K9XB 1EKBB 2OP9A 2A4RA 1MU8B 1SGPE 1YC0A 2ZDVH 3P8FA 1YLDA 1PPGE 2W3IA 4NSVA 3SGAE 1TQ0B 5GWZA 5E0GA 1HAOH 2BXUH 3E6PH 1C4V2 5EXNA 1CHOF 1TBZH 1C1OA 4THNH 1AZ8A 2FOGA 2G00A 3GY4A 1P2QA 1FIWA 3OY5U 3SOSA 4UFFH 4VGCC 1C1PA 1ZSJA 1C5YB 4WH6A 1LHFH 3FP6E 1QB6A 5GPIB 2XBWA 2ZGJA 1KYNA 1SOZA 1KXFA 4YO9A 1AKSB 3I29A 5DK1A 5IYTA 1V2PT 1G3BA 4VGCB 1E0FD 4FUCA 5EQSA 3UIRA 1F5LA 1O5EH 3VEQB 2CV3A 6CHAC 1AQ7A 1QBNA 2ZDMA 2ZQ1A 4BOHA 3KCGH 1VITG 2M5TA 1DLEA 2QXGA 1NPMA 2SNVA 1NRPH 1QJ6B 7LPRA 4M7GA 2SGDE 4MVNA 1O3IA 4WMDA 2NU3E 1S81A 3W95A 1BHXB 1ANBA 1QRXA 2FTMA 3PMJA 1OXGA 1C5SA 3ZV8A 1C2LA 1SGFG 1GMDG 3TH2H 1UVOA 2Y81A 3SU4A 1G3EA 3Q76A 3UNSA 4CR9A 2WPMS 1K1OA 4UEHH 2FOAA 4AOQA 3P8NA 1NU7B 1J14A 3HK6B 3ELAH 3BTHE 1XMNB 2F83A 5DP7A 2UWLA 4IC5A 3M36A 1HFDA 1O3LA 2FOCA 1MAXA 1MTNC 4JZEH 3O8CA 3GCNA 3M3SA 4ZHMU 5HM9A 2A2QH 3VGCC 4TPIZ 1ZPBA 1YPEH 3K6YA 1JMOH 1QBVH 1QNJA 1V2ST 2ALPA 1DXWA 3VXEH 1J8AA 1LVBA 1AO5A 2ESTE 1WQSA 1F5KU 4BAKB 1A5IA 4WMEA 1G3DA 1TLDA 3ZVGA 2R3UA 3VGCB 3TK5A 2FDAA 1O34A 5L2ZH 4MQAA 5GCHG 4A5TS 1O30A 1C2JA 4CHAB 3DT0H 1LKAA 2BQWB 1Z7KA 3LJOA 4B2AA 1Y3WA 2C8XB 1HAPH 1UTKA 2UUKB 2O8MA 2UUYA 2BD9A 3ZVDA 2FS9A 1EASA 1DXPA 1DWCH 4JZFH 1C5RA 1D3DB 1ELBA 3S7HB 2WV4A 1H9LB 1EAXA 1V2LT 2XC0A 2VIPA 4RKOB 1OYTH 1K1JA 4KGAA 1O2KA 2G52A 3AW0A 4AX9H 4SGBE 4FUHA 1GPZA 1C1MA 2XC5A 3F9FA 1GG6C 4CH2B 4NSYA 2RG3A 2J38A 4I32A 4E05H 3TK9A 2ASUB 4Y8XA 1ZMJA 4BANB 4K1TA 1HJAB 1TX7A 1HXFH 3R0FA 1GJ8B 1C1QA 4K1EA 1BB0B 1CQQA 1GG6B 1V6DA 1KXDA 4A92A 4X2WA 3RXVA 2RCEA 5G4BA 1XXFA 2ZHFH 1ETRH 1G9IE 3LOXA 3KEEA 1O3CA 1TNHA 1MU6B 4KTSA 2STAE 2F3CE 1OOKB 2XRCA 1L0ZA 1TB6H 1GHBF 3FZDA 2Y7XA 1ZSKA 2ZP0H 3STIA 2PKAB 2Y7ZA 4LOYH 3RLYH 3P6ZB 2Y80A 3UR9A 2PV9B 4GSOA 1AVGH 3LGTA 1NRRH 1UTNA 1UVUH 3FAOA 4H6SB 3M3VA 2FI5E 1GHVH 1FY5A 4ZHAA 2BXTH 3OU0A 2ZU3A 1ID5H 4BTIB 1FI8A 3PLBA 2FI4E 1IQKA 1THSH 2WPHS 1QQ4A 1EAIA 3M7TA 2ZPSA 1VJAU 2GTBA 1AUJA 1IHSH 1W3CA 4NWLA 2PW8H 3E91A 3SI3H 1KLJH 3PTBA 1SFIA 1V3XA 1P03A 3ATMA 4SGAE 1O38A 1MUEB 2BVXH 2AIPA 2HNTF 3SU0A 4JZDH 5ETXA 3Q3KA 2EI6A 3V13A 4TYDA 1SB1H 3KNXA 1TNKA 4MLFB 1SC8U 1A3BH 2VIOA 3SU2A 5TCAA 5JB9S 1P10A 1Q3XA 2EI8A 5A8ZA 4F49A 1EQ9A 1QRZA 3SHAH 1AU8A 2FZZA 2CJIA 1A5GH 3ATIA 3BEIB 3BG4B 1LVMA 2NU2E 3HGNA 3SZNA 1O2JA 1MZDA 3QLPH 6LPRA 3KQCA 4R8TB 1GBCA 1GBKA 1NRQH 1SMFE 3E3TA 1MCTA 1BRCE 2GDDA 1HDTH 3NK8A 2F9BH 1XUKA 2GMTC 2ZHEH 4X2VA 3TJVA 3GYMA 1S84A 4ABEA 1C1RA 2AS9A 4IMZA 4I7YH 1V2TT 3SQHE 2NWNA 3GCTG 1A46H 5JBTA 4TPYA 1C9TA 1ZZZA 2ILNA 1LTOA 2ZU1A 3TJUA 4FU9A 2FTLE 1FZZA 1C5TA 1OPHB 2QXHA 2WPIS 3PYHA 1KLIH 4CRGA 8KME2 3RMNH 3EA8A 1T8MA 1C2DA 3A85A 1QB9A 5AFYH 4YOGA 4TY7A 1PPBH 3ZYEA 3EA9A 4Q2KA 1W10U 2HALA 1MQ6A 5LPEA 1YCPM 7GCHG 5GDSH 2H6MA 1EUFA 2PSXA 4KTCA 1GHYH 3AW1A 4NCYA 1QA7A 4RSPA 1UTQA 1OWIA 1ZJKA 3QN7A 4LXBH 2R0LA 4D9RA 4I33A 2R2MB 5ESBA 1SBWA 2C90B 2DE8A 4Y8ZA 3F9EA 1YLCA 1LHCH 4KELA 1C5MD 2BDHA 1UMAH 1AMHA 4ABHA 3SBKA 4AFQA 1MQ5A 3TNSA 1V2RT 1AFQC 1AUTC 1IQLA 2PLXA 3UY9A 4ZH8A 4XBDA 3M35A 4Q7YA 3MH5A 1P01A 3KL6A 2CXVA 2ZCLP 1ETTH 1ZMNA 3UOUA 3U8OH 1AVWA 3E8LA 4YLUA 1YPJH 1MD8A 3A7WA 1K28D 4NG9H 1HAXB 2BOKA 3RXFA 1GBHA 1LMWB 4GCHF 1SVPA 2O9QA 4INKA 3MYWA 4MTBA 1O5BB 2CHAC 2FYQA 4FVBA 1GI1A 5HM2A 2G5NA 1YBWA 3RXQA 4OGYA 4JMYA 1FN8A 1Z8GA 4JYTA 3EE0B 4YM9A 2GGVB 1LVYA 1O3OA 2A5KA 1YYY1 1DT2A 1QHRB 1NO9H 1TIOA 5DKMA 3PWCA 4ABBA 1GI9B 3E1XB 1GGDB 3RXOA 4ASHA 5C5NA 4HZHA 3RXIA 2UWOA 1S5SA 1TAWA 2HPQH 2BVSH 1TWXB 1TBQH 3M3TA 1QCPA 1V2VT 4NFEA 4J2YB 1MTSA 1EZQA 1W13U 2SGEE 6GCHF 2GV6A 5JYIA 3RLWH 1A0HB 1GMCG 3TGJE 5GXPA 4MPUA 1SGFA 2OINA 2SGQE 4X6NA 1MTVA 2ZDLA 5DP6A 4BXWA 3SUDA 2TBSA 1UTLM 2VIQA 4X1NU 1AN1E 1HUTH 2FESH 3MO3A 3U69H 3PM3A 4NIWA 1QGFA 2C8WB 1W12U 1DSTA 3M5OA 1S85A 2YNBA 1T8LA 1MMJN 4I8GA 5DP5A 3TLOA 1QY6A 5DP4A 4A1XA 2ZFQH 1CBWC 3GOVB 5EQQA 1DPOA 3BTKE 1Y5UT 1JRTA 1P8VC 4TY6A 5EODA 5JBBS 1SGNE 2JH6D 1PPEE 1QA0A 1CBWB 1SLXB 1P9UA 2BY8X 3KN2A 5T6GA 3VB5A 3A86A 2UWPA 1DE7H 3HGPA 3U9AH 4AORA 1EAUA 2ZWLH 5EQRA 2FEQH 1YPLH 2A2XH 3MNXA 4J1YA 1C4U2 1CA8B 1O3FA 4I31A 3URDA 2ZDNA 3UQOA 2ZTXA 1JXPA 2ZU2A 3BTTE 1O3HA 2ZKSA 1ETSH 4GVUA 1GBBA 1TMBH 4Y8YA 3M5MA 2A1DB 1ELCA 2BLOA 3K65B 2H9EH 5CMXH 4CBNA 1LHDH 1QR3E 3O8BA 4ISOA 4X8TH 3SHCH 1IQFA 1GBTA 1K1IA 2PTNA 2CF9H 3LGIA 2BTCE 3A82A 3RXUA 5CE1A 3RXDA 1Z6EA 1ZGIA 5E8EH 4UONA 1DANH 1GHAG 1YPMH 2LPRA 3ODFA 3PV4A 1PFXC 4IN1A 3KQBA 2W5EA 1C5XB 2QIQA 5FCKA 2YOLA 4X1QU 1FY3A 1GVLA 1O2MA 1QL7A 5HMAA 1LHGH 1KXCA 1T8NA 1J9CH 2Z9KA 3KQEA 5EXLA 2PUQH 1O3BA 3GICB 5LPFA 4DT7B 2HLCA 4E7RG 2CN0H 3F9GA 2A45B 3DHKH 1VCWA 4IC6A 4DOQA 2BDIA 1UTJA 4YLQH 3SJ9A 3SI4H 3S9BA 3A87A 2G8TA 1AI8H 3EQ0H 1AFEH 1O2PA 1TPSA 2P16A 5DPAA 1BDAA 5F03A 3ZZ3A 4U01A 3V12A 5T6DA 3NUMA 1ELGA 1A4WH 3QGJA 5DG6A 3QZRA 1PQ7A 3ENSB 3D49H 2HVXA 2XWAA 3UTUH 2GCTC 1MH0A 3FANA 3RXPA 3H5CB 1TNIA 2CF8H 8GCHG 4WF8A 1D3TB 2G81E 4UDWH 3ZVFA 1TRYA 1BHXF 1GHWH 5GJ4B 4JCNA 1EX3A 3ZZCA 5GIBA 3ITIA 3U8RH 2STBE 1XUJA 1O5CB 2CMYA 2PGBB 1BJUA 3BIVH 2R2WU 1GMHG 4XE4A 3RXKA 1CT2E 1F92A 1V2QT 1O31A 3SQEE 3SUGA 1TNLA 4WH8A 1PPZA 3GY8A 3UOPA 1QURH 5GCHF 2ZFTA 2BM2A 3DFJA 2BB4A 4IN2A 3TH3H 2FLBH 2Q6GA 1RIWC 2FX6A 2JETB 5EW2H 1KDQA 2XCFA 2ZFPH 3NZIA 1HAVA 1SGQE 1O5GH 2BLVA 1ZYOA 1H9HE 1W7XH 1FV9A 3SNAA 1RIWB 5JB8S 2EEKA 1DS2E 3MFJA 1AE5A 5EXMA 2ZU5A 1HNEE 1GVZA 1N8OC 1P57B 3MU4A 5LH8A 1XVMA 3TGKE 1SHYA 4CRBA 1YF4A 3WY8A 3QK1A 2RDLA 1XX9A 3CS0A 4AYYB 1NRSH 1BTUA 2BX3A 3GDUA 4ZXYH 1F0TA 1QTFA 4Y79A 1RRKA 3QDZB 1F7ZA 3GY5A 2XYAA 2BD3A 3A84A 2ANYA 2QN5T 1EPTC 1GCDA 1SLWB 5HGGA 2R9PA 1GBDA 1QJ1B 2BZAA 2ANMH 4A1VA 1TX6A 2EA3A 6CHAB 3TK6A 1AE8H 4NIVA 5DP8A 4HI3A 3A8CA 2HGTH 1HB0B 3QX5H 3O8DA 5EGMA 1QBOA 1GDQA 1O3PB 1F0RA 3E90B 4Q80A 2VWLA 1RFNA 4I8LA 3RMOH 1LPGB 3AASA 2A4GA 1BRBE 1NN6A 3M5NA 4YT6H 2BQ6B 4MG3A 1C9PA 5L6NH 2QXJA 3QTVH 4R0IA 1AVXA 1P05A 5EPNA 2ZDAH 1XVOA 2ZA5A 4CRFA 1O5AB 1S83A 1UK4A 4HTCH 2GT7A 2Z3EA 3GY3A 1C1WH 2W26A 1SFQB 3PTNA 3M7QA 1YGCH 1Y5BT 2AFQB 4NA7A 1C1VH 1FJSA 2ZZUH 2ZCHP 2VWNA 1MTNB 1EJNA 2BLWA 3E0PB 4OGXA 2J92A 2Q1JA 3MNSA 5DP9A 1O3KA 3I78A 2O8UA 1O2QA 3BTWE 4IGDA 1ZPZA 2ZEBA 4OS5A 4B73A 1SGEE 1YCPH 3EA7A 1SHHB 1A7SA 1CU1A 1K9OE 1KIGH 3T5FH 4YZUA 3TPIZ 1L4DA 3C27B 1DY9A 3PMAB 1ANCA 4F4OC 1FUJA 2FS8A 3SV9A 2OBOA 2F91A 1UK3A 2VJ1A 1Q2WA 3NWUA 1OWDA 3P8GA 1CGHA 1C1UH 1Z8RA 1SSXA 3A8BA 4X8VH 1TBRH 1A5HA 1V2NT 3BTEE 3QO6A 4O97A 1S0RA 1O3NA 1WCZA 2Z9GA 2G4UA 1L1NA 1NT1A 3UUZA 1AWFH 5C1UA 1XUFA 2F9OA 5J4SA 2ZFSA 4BTTB 1UVPA 1O2YA 1PQAA 1DITH 1CHOG 3SUEA 4AFZA 4RN6A 7KMEH 2PR3A 1P12E 5AHGH 3SU1A 1HV7A 2FOFA 1FN6A 3P70B 1T7CA 4IW4E 2O8LA 3BTFE 2G4TA 3OYPA 2OLGA 1MZAA 4GHQA 3LJJA 1O33A 1A3EH 1ZHRA 2FYRA 7GCHF 3TJOA 4K2YA 1Y8TA 2C8YB 3L3TA 3HK3B 3RXHA 1C5PA 4AFUA 4GAWA 1TABE 3K6ZA 1BMLA 2OQUA 2F9PA 1ZTKA 3AAUA 3HKIB 3UNQA 3DA9B 1HXEH 1OP8A 3PLKA 2VB0A 1SGCA 5FPYA 5IDKA 1O2TA 2FXRA 1DDJA 3PROA 2GP9B 2PGQB 3LGWA 2ANWA 5FBEA 1P3EA 1VCPA 1ARBA 1VZQH 2A7JA 2NU1E 2TPIZ 3PMBB 3TJNA 1KDQB 1SQOA 1XUIA 2SGFE 1HAVB 5A2MH 2OTVA 1IQGA 3N7OA 1BBRH 1V2MT 3SUFA 1E37B 5TJXA 1W8BH 4CH8B 3QUMP 4CR5A 1MCVA 4DW2U 1AY6H 3U1JB 2FX4A 1BIOA 2JH5D 3M37A 1VCQA 5L30H 9LPRA 2OC1A 1O2NA 2Z9LA 2QAAA 4BAMB 2FI3E 2AMDA 3UNRA 2O8WA 4D7GA 1QFKH 2ZI2H 1EP5A 4H42U 2ZHQH 1UHBA 1SGYE 2GKVE 4NIYA 1HAGE 2GX4A 5SGAE 1FPHH 1GI2A 1Z1IA 5FX6A 1C5VA 1ELTA 1O3DA 1MKWK 1F2SE 1FAXA 4CRCA 1AGJA 2C3SA 1GL1A 5K0HA 3ZZAA 1XM1A 2KAIA 2OC8A 2ZGHA 2ZTZA 1CE5A 2P95A 5C5OA 1P0SH 3RXMA 1G36A 2J2UA 3LC5A 3LGYA 1GMCF 3F1SB 3RUOA 1SLVB 5TCCA 3RMLH 1MBQA 1NU9A 3ZZ6A 1RJXB 2O8TA 3A7TA 3AAVA 3Q77A 1OYQA 3U1IB 1HJ8A 1E36B 1A0LA 1TQ7B 5J4QA 1J15A 2VGCC 2P8OC 2BX4A 1DFPA 3OX7U 1GBIA 2A5AA 1ELAA 2GMTB 1OSSA 2VWOA 2A31A 2AERH 5BPEA 3QTOH 5EU8A 3RC5A 2VVCA 3ESTA 1FY4A 4K1SA 1NESE 3BSQA 3ZVCA 1YM0A 4X2YA 1F0SA 2WUCA 2P8OB 2JH0D 5C1YA 4NGAH 1EP6A 3T27A 5F8XA 1LKBA 4YTAA 1J17T 2D2DA 1OP2A 1NM6A 1UK2A 4PROA 3FP8E 1HLTH 1AB9C 1DOJA 1Z8JB 3SJ8A 3LU9B 1C5QA 1DVAH 2BY6X 1BBRE 4FVDA 3BTQE 1C1TA 2XWBI 1C2HA 3MWIU 1BZXE 1TOCB 1TYNA 3FZZA 4FUGA 1C2IA 2VIDA 3K2UA 3A80A 3ZZ5A 1DICA 1MAYA 1GHBG 2BDBA 2J4IA 7ESTE 1UCYH 4ABIA 2BY9X 1O3JA 1S0QA 4NA8A 1HRTH 2GZ8A 3ZZDA 2BDYA 2XW9A 1K2I1 2AGGX 1C5LH 3IITA 2QGRA 2GCHF 3KF2A 4FXGH 1AFQB 1ELDE 1WAYB 2PHBA 3VXFH 1P02A 1GI3A 2H5CA 4Y7AA 4CREA 2JKHA 2BVRH 2IPHA 2ZIQH 2H9TH 4NZLA 1TGNA 1A1RA 1O2GH 1IQJA 1RGQA 1SI5H 2XXLA 1ZOMA 4E7NA 1RS0A 1P2MA 3Q00A 5C2ZA 3TGIE 3SV8A 1WTHD 5A8XA 3D62A 2HWLB 3UREA 3UR6A 2V6NA 1T8OA 2CHAB 3MNBA 4ABGA 5JPMH 3RU4E 1CA0C 4BXSA 1DSUA 3A7ZA 3SNDA 2J9NA 2ZU4A 2XNIA 1DLKB 1BJVA 4NFFA 2GT8A 3SJIA 3HPTB 3U8TH 2PUXB 1ZJDA 5T6FA 4AGKA 3SV7A 2ANKH 2BMGB 1FAKH 4X1RU 2AGEX 3O8RA 1PYTC 4NIXA 3ZZ7A 4K8BA 1FNIA 1H8IH 1TA2A 2QA9E 2FP7B 1KSNA 1UO6A 3JZ2B 4O3TA 1P2JA 4CRAA 4JZ1A 1PQ5A 1YPHE 1O2UA 1YPHC 8LPRA 1ZGVA 3E0NB 1TGCA 1YPGH 2FOMB 1BTYA 1NY22 1ESTA 2ODPA 2BD8A 5JDUB 1Z1JA 1BTZA 2V0BA 3DFLA 4E06H 3M61U 2TGTA 4GHTA 1UCYE 1UTOA 2XBXA 1GI8B 3SJOA 1FDPA 1Y5AT 1AWHB 1AIXH 1ELEE 1EB2A 1EPTA 4YT7H 1O2LA 4ISIH 2OUAA 1WSSH 2ZFRH 3NPSA 4XBCA 1LCYA 3MO6A 4BAQB 1P11E 3URCA 2OBQA 3BV9B 1HYLA 1YCPK 3MI4A 1MTWA 1GBEA 2ODYB 1ZPCA 3VPKA 3E16B 3AVZA 1YPKH 3D23A 3SN8A 5AVDA 3MOCA 1H4WA 2Y82A 4FU7A 3RXBA 4KKDA 4ZHLU 1UHBB 1SGDE 3BN9A 3S69A 2TGDA 1VR1H 1GCTC 2HRVA 2TGPZ 1LPZB 3P92A 3A7YA 2QF3A 1DUAA 4DJZB 4AG2A 2KAIB 1RTKA 5C67A 1J16A 1C2KA 2V3OH 1EZXC 2SGPE 1GJDB 2A7HA 4ABFA 3FP7E 1TA6A 1BT7A 1ANDA 1O36A 2FIRH 5CHAC 3Q3YA 2DE9A 5ABWA 2Y6TA 1WUNH 2OD3B 1GI5A 1Z6JH 3H7OA 1CT4E 4GCHG 4ZROA 2EC9H 3ZVBA 5FPSA 4X8UH 4ESTE 4I8KA 3RDZA 4DIIH 1OWEA 1KXBA 5CHAB 1A61H 1VITF 4ABJA 1B7XB 4X1SU 5E2PA 1GI7B 2HPPH 1THRH 2H1UA 1WBGB 2ZNKH 5A8YA 1CGJE
chains in the Genus database with same CATH superfamily
3OY6U 2WPLS 1SQRA 3DCLA 2GZ9A 1GMDF 2ZHWH 3OSYA 1ARCA 1ZTJA 2HLDD 3I77A 2QV1A 5FPTA 1E38B 1NFXA 2B0FA 4I86A 4IMQA 2BY7X 1O3AA 3UPEA 6GCHG 2PWXA 2Z6BD 1L1GA 2W7UA 1W11U 1K1LA 3RMMH 4JZIA 1ELVA 1DWDH 2XNDD 2W7SA 2WPJS 1G30B 3R3GB 2BY5X 2PP6A 2Y5GA 4OS6A 1O2VA 4Q63A 5C20A 5CHBA 1O2OA 2Z9JA 1LVOA 3MTYA 1GBAA 4O3UA 1EOLA 5KEDA 4Z0KA 4U30A 3RXGA 1G2MA 5EW1H 2P94A 1DY8A 3B23B 1CVWH 1HAIH 1QRWA 2GCTB 4LZ1H 4ZXXH 3SJKA 2OXSA 4BNRA 3BIUH 5A09A 2CK3D 4JYVH 2KR7A 1IHTH 1ABIH 1LPKB 2JDID 2J94A 1ZRKA 1A0JA 2UUJB 1L1JA 5EJLA 3A8AA 2ALVA 1SQAA 3P17H 4UFGH 2D26C 2A7CA 2EI7A 3SORA 4B74A 1LDTT 3VB3A 3SNEA 1O3EA 1C2FA 1D3PB 2BOHB 2HOBA 2F9VA 1GJ7B 1V2JT 1T4UH 2FOBA 3S0NA 1ESAA 5DN6D 4JK5A 4MPXA 3RXJA 2C4FH 1TOMH 2F9UA 3S9CA 2BD4A 3GYLB 4IBLH 1CO7E 1E34B 1YY3A 3LKWA 1TGTA 3VB6A 3FFGA 1QL8A 2GJGA 3PWBA 1P3CA 3A89A 5AF9H 2KFWA 1SLUB 2XTTB 3TVJB 1CT0E 1BITA 1FPCH 4DG4A 1NFUA 2KZ4A 4FUDA 2P3UB 4YXWD 1D3QB 1ZHMA 2CGAA 3SU6A 2VIWA 3B9FH 1O2IA 5FX5A 2A32A 1AZZA 1O5DH 1NROH 1HGTH 4WMFA 1C5ZB 1N8OB 6ESTA 4OS7A 2ZPQA 2BDGA 1TX8A 4ZUHA 3S9AA 2B8OH 5DJ7A 2Q6FA 1AHTH 1P9SA 3BTME 1TPOA 2IOTA 2FLRH 3TU7H 2VIVA 3T26A 4BAOB 4HFPB 4XDEA 1TALA 1BCUH 4AB8A 4WY3A 1SQTA 3LGVA 2RA3A 1H1BA 4OS4A 1TONA 2G51A 1UJ1A 3VFEA 4YOJA 1HPGA 1EPTB 1MKXH 1XKBC 1XXDA 4ABDA 2IJOB 2C93B 2VWMA 4U2WA 1P2NA 1ZR0A 1TFXA 3MO9A 1UCYK 1PPFE 5F8TA 4K8YA 4MNWA 4Y0ZE 1WOFA 2AYWA 1WQVH 3T29A 2OCVB 2KX4A 4NWKA 3V7TA 2VH6A 1B0FA 1S6FA 4D76A 1JBUH 1QQUA 1HCGA 2QF5A 1WYKA 3RXEA 1O2WA 5FL7D 4GLYA 2AIQA 4DY7B 1CSOE 1G32B 2ZQ2A 4CBOA 1W0YH 1W0ZU 1DX5M 2Z3CA 4P00A 4AB9A 1K22H 1YKTA 2V35A 1WV7H 4BTUB 4QT8C 4DVAU 1XUGA 3ZZ9A 4K60A 2G55A 4MNYA 3PLPA 4WXVA 2VBCA 2GD4B 4X1PU 4X8SH 1D4PB 4FOUC 1ABJH 2WYJA 1QJ7B 4X6OA 1CHGA 4CHAC 1V2KT 1INCA 3L33A 4I8JA 1C2MA 4INHA 4DGJA 3Q3XA 1UVSH 1S6HA 4B71A 3MH7A 2BQ7B 2BZ6H 1OHHD 5I25A 3V0XA 3F6UH 1GJ6A 1BOQA 1C5NH 2PSYA 1P04A 3LC3A 1SGRE 1OP0A 1O2XA 1CGIE 2ZG0H 3NXPA 2B7DH 1H8DH 2LNCA 4OS1A 1O0DH 3CS7A 2RFKC 2FODA 3GCTF 2ZGBH 2YMSB 1TGBA 4KTUA 1Q31A 3FVFB 3IG6B 2SFAA 1HIAA 1OS8A 1DM4B 2BDAA 1GHXH 1HJAC 1MTUA 1N6YA 3MH6A 2QXIA 4TWYA 3RC6A 3BTDE 2FO9A 1NTPA 2QY0B 5DP3A 1TRNA 4Y10E 1JIRA 1ZRBA 2VNTA 1KXEA 3SV2H 4YESB 1Y3YA 2VINA 1TPPA 2R0KA 3LT3A 2RA0A 5PTPA 1T4VH 2XCNA 1IQEA 2BD5A 3UFAA 1G3CA 2H2ZA 4A6LA 2TGAA 4O03A 1BTPA 1ZSLA 1O39A 2VU8E 2PKSC 5JBCS 3T62A 2D1JA 5EG4A 1SPJA 3TITA 1GJBB 2OK5A 1P2IA 3MHWU 4F55A 1T32A 3ZV9A 1HBTH 4XD7D 1C4Y2 4NZQA 1GVKB 2GZ7A 4I8HA 4ZKSU 2GVFA 1VGCC 3DSPA 3RXTA 2HVYB 2Y5HA 2WYGA 2ZGXH 1THPB 3LH1A 3SNCA 1D9IA 1OWKA 2M2AA 2OQ5A 4ISNA 2PKSB 3SO3A 3MNCA 3LH3A 1RTFB 2P3FH 3ZZBA 1FMGA 2JJ1D 3ODDA 3OTJE 3SGQE 4YOIA 4RKJB 3UAIC 3GISB 5LPRA 1O35A 1VGCB 1JIMA 3PO1C 5F53A 3S7KB 1T31A 3GY2A 2AMQA 2THFB 3M7UA 2Z3DA 3LONA 3SNBA 1SKYE 1U6QA 2ZTYA 3TNTA 4FUIA 4JYUH 1FQ3A 3PO1B 1D6WA 4MPVA 3EYDA 2J98A 2GV7A 1KY9A 5FXLA 1GL0E 1UTMA 2B5TB 1P2KA 3TH4H 2ODQA 3T28A 4UE7H 3A88A 1NBMD 3BG4C 3GCOA 2AEIH 4JK6A 3ATKA 1EAWA 1GJ9B 2WPKS 1YP9A 3SW2B 3GDSA 1EZSC 4XFQA 3F3BA 1K21H 5L2YH 4AYVB 2Z94A 4NA9H 2I6QA 1OKXA 4Q7ZA 1PJPA 4Y7BA 1BA8B 1Y3VA 2WINI 2ZECA 2YNAA 1A2CH 3A8DA 3B8JA 1BTWA 4Z6AH 3RU4D 1IQNA 2P93A 1V2WT 1X7AC 3MU0A 2BHGA 4MNXA 5DO4H 5C1XA 5I46H 3RXSA 1JOUB 1D6RA 4Y76A 4B1TA 2AH4X 2R3YA 4OS2A 2VGCB 1BRUP 1PPCE 3W94A 1DWBH 1PYTD 2NU0E 1OX1A 4Y0YE 3P8OA 2Z7FE 4DCDA 4ZKOU 3F68H 1KLTA 2ZHDA 3RXLA 4WXIA 1IQIA 3DUXH 1W2KH 2ZCKP 5C17A 2ZO3H 2J95A 2A0QB 5A0AE 4ZKRU 1G37A 2XBVA 4FUEA 2W3KA 1GBMA 1EXFA 1SGIB 3RXAA 1N1LA 4ABAA 5E2OA 1NRNH 5T3HA 1BTHH 3T2NA 3HKJB 1BRAA 1GHZA 4ZKNU 3G01A 1ELFA 1BTXA 2Z9IA 2HNTE 3V3MA 2HNTC 1GJCB 1LQDB 2XC4A 1FONA 4WJG2 1AB9B 1TMUH 3A81A 1WU1A 1GJ5H 1QIXB 1SGTA 4X6MA 5JBAS 2A5IA 2H9HA 2ZFFH 3WWFA 1AD8H 2BDCA 4DIHH 4UFEH 3CENA 4K3JA 3QGNB 2ZPRA 4ISLA 4XOJA 2ZF0H 2PFEA 1E35B 5DGJA 4U32A 4MDSA 4IS5A 1LHEH 1TGSZ 3HATH 5HXFA 2FMJA 3H7TA 5IK2D 5FHTA 1EATA 1ESBA 1PQ8A 2TIOA 2OC0A 2VVUA 4ZAEA 1TPAE 4MPWA 4Y71A 1Y3UA 1BUIA 1DUEA 2K1QA 1GBJA 1XKAC 2P3TB 4ISHH 1ZHPA 4WVPE 1GHAF 5FAHA 3LIWA 2QCYA 1B5GH 3BEUA 5E0HA 1C1SA 3ZVAA 4BAHB 1KTSB 4D9QA 1W7GH 2AMPA 5B6OA 3GDVA 5C0TA 1OWJA 1QL9A 3GY7A 1GGDC 1HIAB 1C5UA 2KCPA 4B75A 2FM2A 2VVVA 3MMGA 4A1TA 1GDUA 1O2ZA 4DURA 1B0EA 1EOJA 4H4FA 3SGBE 5K7RA 1RTLA 3PMHB 4FUJA 4CRDA 3KYGA 2V3HH 2WHXA 2H5DA 1ACBE 1F5RA 1MKXK 2BYAX 1CA0B 1C2GA 5FCRA 4AFSA 3ZZ8A 2WV5A 3JZ1B 1G2LA 3BTGE 2C8ZB 2IN2A 4H6TA 1GI6A 2ULLA 3SV6A 4AG1A 1ZMLA 3ATLA 4Y6DA 1JWTA 1O3GA 3MU1A 3MU5A 4AZ2B 4XSKU 1AKSA 2SGAA 1NS3A 4GPGA 2DUCA 1FXYA 4X0WU 5EPYA 1F0UA 1O2RA 1SG8B 1TE0A 3ZYDA 3A83A 3LPRA 3VB7A 3UWIA 8GCHF 5LGOA 3BEFB 1KTTB 1P06A 2Q6DA 1QB1A 3F9HA 3RP2A 1ORFA 3GCHC 1MD7A 2FPZA 2D8WA 1C5WB 3QWCH 4UFDH 5F8ZA 1RD3B 2A4OA 2QYIA 3W1EA 3KHVA 1IQHA 1SOTA 1GMHF 1GDNA 3DD2H 1BQYA 3C1KA 1TNJA 2I6SA 1M9UA 1GI0A 1P2OA 1GWAA 3CP7A 3LGUA 1GBFA 4K5ZA 1MBMA 3MU8A 3GCHB 1K1MA 2BLQA 2KCOA 2F9NA 1Y59T 1TNGA 5BRRE 1H9IE 4K69A 1C5OH 1EZUC 2G5VA 1WTGH 3F0OA 2P59A 2J98B 2BD7A 4B2BA 8ESTE 1JRSA 1NC6A 5C3NA 4AGJA 2WUBA 1O37A 1NZQH 2BD2A 4HGCA 3VB4A 5F6MA 3FKSD 4O9VA 4GUXA 1HJ9A 1FLEE 2UUFB 1BMNH 1GCTB 5ESTE 1TRMA 9ESTA 2VH0A 2ZC9H 3A7XA 2GCHG 3RM2H 5HYOA 2KCYA 2OC7A 1NFWA 1IOEA 1FY8E 1NFYA 5AFZH 5A0CA 3KIDU 3UQVA 3T25A 4FU8A 1EJAA 4RI0A 1HAZB 1S82A 1W14U 4Y11E 3ZVEA 1ZTLA 1VITH 3EAJA 2FOHA 4MNVA 3U98H 1LO6A 4Q7XA 4LK4A 1W0KD 2A4QA 1FX0B 3UB0A 4X2XA 4D7FA 1TMTH 3WWBA 3RC4A 2GDEH 3KGPA 3STJA 1P09A 1VJ9U 1O2SA 1EB1H 3RU4T 3L6PA 2QF0A 4HG6A 2SNWA 3UWJH 4FUBA 2ZGCA 4B2CA 5A0BA 1OWHA 1K1PA 2KM0A 1RXPA 1GJAB 1MKWH 1SR5C 3PRDA 3F0PA 3FN8A 4ZMAH 1C2EA 3M5LA 1L4ZA 1SL3A 3EGKH 2WV9A 3P95A 4FUFA 3NCLA 4X6PA 4A7IB 1HAHH 2J34A 1GBLA 1O5FH 4UD9H 1DWEH 4Q4LA 4LZ4B 1GJ4H 1BBRK 4TWWA 1FY1A 1O2HA 2XBYA 4INLA 3SYJA 1Z71A 4KP0A 3ATWA 1L2EA 3MH4A 3SU5A 3F2FA 4B76A 1KXAA 2QC2A 3BF6H 1BMMH 1HAYB 3GY6A 3RM0H 1BMAA 4WWYA 1UVTH 1Y3XA 1Z8IB 1O32A 1EJMA 4D8NA 4XBBA 1FIZA 2AGIX 3RXRA 1ANEA 5EOKA 2ZDKA 1KMHB 1PPHE 3LDXH 4AN7A 2PTCE 1UTPA 3QZQA 2NU4E 3IWMA 1O3MA 1N6XA 5B6LA 3BG8A 1IAUA 2FWWA 2Y5FA 2PKAA 3NKKA 5FBIA 1V2UT 2B9LA 2JETC 1LQEA 1WXRA 1K1NA 1C1NA 2TRMA 2V7QD 1GI4A 3F2GA 3TIUA 3RXCA 3EDXB 1IQMA 1XUHA 3KQDA 5H4IB 3ZZ4A 2WSSD 4OM9A 2FOEA 3PB1E 3A7VA 1ZLRA 1V2OT 3SU3A 3D65E 5E0JA 3K9XB 1EKBB 2OP9A 2A4RA 1MU8B 1SGPE 1YC0A 2ZDVH 3P8FA 1YLDA 1PPGE 2W3IA 4NSVA 3SGAE 1TQ0B 5GWZA 5E0GA 1HAOH 2WPDD 2K8IA 2BXUH 3E6PH 1C4V2 5EXNA 1CHOF 1TBZH 1C1OA 4THNH 1AZ8A 2FOGA 2G00A 3GY4A 1P2QA 1FIWA 3OY5U 3SOSA 4UFFH 4VGCC 1C1PA 1ZSJA 1C5YB 4WH6A 1LHFH 4F48B 3FP6E 1QB6A 5GPIB 2XBWA 2ZGJA 1KYNA 1SOZA 1KXFA 4YO9A 1AKSB 3F2HA 3I29A 3OEHD 5DK1A 5IYTA 1V2PT 1G3BA 4VGCB 1E0FD 4FUCA 5EQSA 3UIRA 1F5LA 1O5EH 3VEQB 2CV3A 6CHAC 1AQ7A 1QBNA 2ZDMA 2ZQ1A 4BOHA 3KCGH 1VITG 2M5TA 1DLEA 2QXGA 1NPMA 2SNVA 1NRPH 1QJ6B 7LPRA 2WZQA 4M7GA 1S6LA 2SGDE 4MVNA 1O3IA 4WMDA 2NU3E 1S81A 3W95A 1BHXB 1ANBA 1QRXA 2FTMA 3PMJA 1OXGA 1C5SA 3ZV8A 1C2LA 1SGFG 1GMDG 3TH2H 1UVOA 2Y81A 3SU4A 1G3EA 3Q76A 3UNSA 3N7EA 2WPMS 4CR9A 1K1OA 4UEHH 2FOAA 4AOQA 3P8NA 4RT0A 1NU7B 1J14A 3HK6B 3ELAH 3BTHE 1XMNB 2F83A 5DP7A 2UWLA 4IC5A 3M36A 1HFDA 1O3LA 2FOCA 1MAXA 1MTNC 1UW7A 4JZEH 3O8CA 3GCNA 3M3SA 4ZHMU 5HM9A 2A2QH 3VGCC 4TPIZ 1ZPBA 1YPEH 3K6YA 1JMOH 1QBVH 1QNJA 1V2ST 2ALPA 1DXWA 3VXEH 1J8AA 1LVBA 4M9FA 1AO5A 2ESTE 1WQSA 1F5KU 4BAKB 3VG8A 1A5IA 4WMEA 1G3DA 1TLDA 3ZVGA 2R3UA 3VGCB 3TK5A 2FDAA 1O34A 5L2ZH 4MQAA 2AHME 5GCHG 4A5TS 1O30A 1C2JA 4CHAB 3DT0H 1LKAA 2BQWB 4B6FA 1Z7KA 3LJOA 4B2AA 1Y3WA 2C8XB 1HAPH 1UTKA 2UUKB 2O8MA 2UUYA 2BD9A 3ZVDA 2FS9A 1EASA 1DXPA 1DWCH 4JZFH 1C5RA 1MABB 1D3DB 1ELBA 3S7HB 2WV4A 1H9LB 1EAXA 1V2LT 2XC0A 2VIPA 5KECA 4RKOB 1OYTH 1K1JA 4KGAA 1O2KA 2G52A 3AW0A 4AX9H 4SGBE 4FUHA 1GPZA 1C1MA 2XC5A 3F9FA 1GG6C 4CH2B 4NSYA 2RG3A 2J38A 4I32A 4E05H 3TK9A 2ASUB 4Y8XA 1ZMJA 4BANB 4K1TA 1HJAB 1TX7A 1HXFH 3R0FA 1GJ8B 1C1QA 4K1EA 1BB0B 1CQQA 1GG6B 1V6DA 1K0HA 2J5UA 1KXDA 4A92A 4X2WA 3RXVA 2RCEA 5G4BA 1XXFA 2ZHFH 1ETRH 1G9IE 3LOXA 3KEEA 1O3CA 1TNHA 1MU6B 4KTSA 2STAE 2F3CE 1OOKB 2XRCA 1L0ZA 1TB6H 1GHBF 3FZDA 5EJZA 2Y7XA 1ZSKA 2ZP0H 3STIA 2PKAB 2Y7ZA 4LOYH 2QF4A 3RLYH 3P6ZB 2Y80A 3UR9A 2PV9B 4GSOA 1AVGH 3LGTA 1NRRH 1UTNA 1UVUH 3FAOA 4H6SB 3M3VA 2FI5E 1GHVH 1FY5A 1E79D 4ZHAA 2BXTH 3OU0A 2ZU3A 1ID5H 4BTIB 1FI8A 3PLBA 2FI4E 1IQKA 1THSH 2WPHS 1QQ4A 1EAIA 3M7TA 2ZPSA 1VJAU 2GTBA 1AUJA 1IHSH 1W3CA 3SZEA 4NWLA 2PW8H 3E91A 3SI3H 2L6OA 1KLJH 3PTBA 1SFIA 1V3XA 1P03A 3ATMA 4SGAE 1O38A 1MUEB 2BVXH 2AIPA 1H8HD 2HNTF 3SU0A 4JZDH 5ETXA 3Q3KA 2EI6A 3V13A 4TYDA 1SB1H 3KNXA 1TNKA 4MLFB 1SC8U 1A3BH 2VIOA 3SU2A 5TCAA 5JB9S 1P10A 1Q3XA 2EI8A 5A8ZA 4F49A 1EQ9A 1QRZA 3SHAH 1AU8A 2FZZA 4AC9A 2CJIA 1A5GH 3ATIA 3BEIB 3BG4B 1LVMA 2NU2E 3HGNA 3SZNA 1O2JA 1MZDA 3QLPH 6LPRA 3KQCA 4R8TB 1GBCA 1GBKA 1NRQH 1SMFE 3E3TA 1MCTA 1BRCE 2GDDA 1HDTH 3NK8A 2F9BH 3PRBA 1XUKA 2GMTC 2ZHEH 4X2VA 3TJVA 3GYMA 1S84A 4ABEA 1C1RA 2AS9A 4IMZA 4I7YH 1V2TT 3SQHE 2NWNA 3GCTG 1A46H 5JBTA 4TPYA 1C9TA 1ZZZA 2ILNA 1LTOA 2ZU1A 3TJUA 4FU9A 2FTLE 1FZZA 1C5TA 1OPHB 2QXHA 2WPIS 3PYHA 1KLIH 3OAAD 4CRGA 8KME2 3RMNH 3EA8A 1T8MA 1C2DA 5HIYA 3A85A 1QB9A 5AFYH 4YOGA 4TY7A 1PPBH 3ZYEA 3EA9A 4Q2KA 1W10U 2HALA 1MQ6A 5LPEA 1YCPM 7GCHG 5GDSH 2H6MA 1EUFA 2PSXA 4KTCA 1GHYH 3AW1A 4NCYA 1QA7A 4RSPA 1UTQA 1OWIA 1ZJKA 3QN7A 4LXBH 2R0LA 4D9RA 4I33A 2R2MB 5ESBA 1BMFD 1SBWA 2C90B 2DE8A 5HKKD 4Y8ZA 3F9EA 1YLCA 1LHCH 4KELA 1C5MD 2BDHA 1UMAH 1AMHA 4B6EA 4ABHA 3SBKA 4AFQA 1MQ5A 3TNSA 1V2RT 1AFQC 1AUTC 1IQLA 2PLXA 3UY9A 4ZH8A 4XBDA 3M35A 4Q7YA 3MH5A 1P01A 3KL6A 2CXVA 2ZCLP 1ETTH 1ZMNA 3UOUA 3U8OH 1AVWA 3E8LA 4YLUA 1YPJH 1MD8A 3A7WA 1K28D 4NG9H 1HAXB 2BOKA 3RXFA 1GBHA 1LMWB 4GCHF 1SVPA 2O9QA 4INKA 3MYWA 2KCAA 4MTBA 1O5BB 2CHAC 2FYQA 4DT4A 4FVBA 1GI1A 5HM2A 2G5NA 1YBWA 3RXQA 4OGYA 4JMYA 1FN8A 1Z8GA 4JYTA 3EE0B 4YM9A 2GGVB 1LVYA 1O3OA 2A5KA 1YYY1 1DT2A 1QHRB 1NO9H 1TIOA 5DKMA 3PWCA 4ABBA 1GI9B 3E1XB 1GGDB 3RXOA 4ASHA 5C5NA 4HZHA 3RXIA 2UWOA 1S5SA 1TAWA 2HPQH 2BVSH 1TWXB 1TBQH 3M3TA 1QCPA 1V2VT 4NFEA 4J2YB 3H09A 1MTSA 1EZQA 1W13U 2SGEE 6GCHF 2GV6A 5JYIA 3RLWH 1A0HB 1GMCG 3TGJE 5GXPA 5EIYA 5C94A 4MPUA 1SGFA 2OINA 2SGQE 4X6NA 1MTVA 2ZDLA 5DP6A 4BXWA 3SUDA 2TBSA 1UTLM 2VIQA 4X1NU 1AN1E 1HUTH 2FESH 3MO3A 3U69H 3AK5A 3PM3A 4NIWA 1EFRD 1QGFA 2C8WB 1W12U 1DSTA 5CDFE 3M5OA 2LELA 1S85A 2YNBA 1T8LA 1MMJN 4I8GA 5DP5A 3TLOA 1QY6A 5DP4A 4A1XA 2ZFQH 1CBWC 3GOVB 5EQQA 1DPOA 2F4LA 3BTKE 1Y5UT 1JRTA 1P8VC 4TY6A 5EODA 2JIZD 5JBBS 1SGNE 2JH6D 1PPEE 1QA0A 1CBWB 1H8ED 1SLXB 1P9UA 2BY8X 3KN2A 5T1VA 5T6GA 3VB5A 3A86A 2UWPA 1DE7H 3HGPA 3U9AH 4AORA 1YLNA 1EAUA 2ZWLH 5EQRA 2FEQH 1YPLH 2A2XH 2RDEA 3MNXA 4J1YA 1C4U2 1CA8B 1O3FA 4I31A 3URDA 2ZDNA 3UQOA 2ZTXA 1JXPA 2ZU2A 3BTTE 1O3HA 2ZKSA 1ETSH 3OTPA 1YWUA 4GVUA 1GBBA 1TMBH 4Y8YA 3M5MA 2A1DB 1ELCA 2BLOA 3K65B 2H9EH 5CMXH 4CBNA 1LHDH 1QR3E 3O8BA 4ISOA 4X8TH 3SHCH 1IQFA 2XOKD 1GBTA 1K1IA 2PTNA 2CF9H 3LGIA 3FOAA 2BTCE 3A82A 3RXUA 5CE1A 3RXDA 1Z6EA 1ZGIA 5E8EH 4UONA 1DANH 2EY4C 1GHAG 1YPMH 2LPRA 3ODFA 3PV4A 1PFXC 4IN1A 3KQBA 2W5EA 1C5XB 2QIQA 5FCKA 2YOLA 2JJ2D 4X1QU 1FY3A 1GVLA 1O2MA 1QL7A 5HMAA 1LHGH 1KXCA 1T8NA 1J9CH 5HIZA 3N99A 2Z9KA 3KQEA 5EXLA 2PUQH 1O3BA 3GICB 5LPFA 4DT7B 2HLCA 4E7RG 2CN0H 3F9GA 2A45B 3DHKH 1VCWA 4IC6A 4DOQA 2BDIA 1UTJA 4YLQH 3SJ9A 3SI4H 3S9BA 3A87A 2G8TA 1AI8H 3EQ0H 4ACBA 1AFEH 1O2PA 1TPSA 2P16A 5DPAA 1BDAA 5F03A 3ZZ3A 4U01A 3V12A 5T6DA 3NUMA 1ELGA 1A4WH 3QGJA 5DG6A 3QZRA 1PQ7A 3ENSB 3D49H 2HVXA 2XWAA 3UTUH 2GCTC 1MH0A 3FANA 3RXPA 3H5CB 1TNIA 2CF8H 8GCHG 4WF8A 1D3TB 2F43B 2W6ID 2G81E 4UDWH 3ZVFA 1E1RD 1BHXF 1GHWH 1TRYA 5GJ4B 4JCNA 1EX3A 3ZZCA 5GIBA 3ITIA 3U8RH 2STBE 1XUJA 1O5CB 1QZ8A 2CMYA 2PGBB 1BJUA 3BIVH 2R2WU 1GMHG 4XE4A 3RXKA 1CT2E 1F92A 1V2QT 1O31A 3SQEE 3SUGA 1TNLA 4WH8A 1PPZA 3GY8A 4RT1A 3UOPA 1QURH 5GCHF 2ZFTA 2BM2A 3DFJA 2BB4A 4IN2A 3TH3H 2FLBH 2Q6GA 3U28C 1RIWC 2FX6A 2JETB 5EW2H 1KDQA 2XCFA 2ZFPH 3NZIA 1HAVA 1SGQE 1O5GH 2BLVA 1WDIA 2L74A 1ZYOA 1H9HE 5GNDA 1W7XH 1FV9A 3SNAA 3N7DA 2IPQX 1RIWB 5JB8S 2EEKA 1DS2E 3MFJA 1AE5A 5EXMA 2ZU5A 1HNEE 1GVZA 1N8OC 1P57B 3MU4A 5LH8A 1XVMA 3TGKE 1SHYA 4CRBA 1YF4A 3WY8A 3QK1A 2RDLA 1XX9A 2YMSD 3CS0A 4AYYB 1NRSH 1BTUA 3WW7A 2BX3A 3GDUA 4ZXYH 1F0TA 1QTFA 4Y79A 1RRKA 3QDZB 1F7ZA 3GY5A 2XYAA 2BD3A 2EQNA 3A84A 2ANYA 2QN5T 1EPTC 1GCDA 1SLWB 5HGGA 2R9PA 1GBDA 1QJ1B 2BZAA 2ANMH 4A1VA 1TX6A 2EA3A 6CHAB 3TK6A 1AE8H 4NIVA 5DP8A 4HI3A 3A8CA 4Z1MD 2HGTH 1HB0B 3QX5H 3O8DA 5EGMA 1QBOA 1GDQA 1O3PB 1F0RA 3E90B 4Q80A 2VWLA 1RFNA 4I8LA 3RMOH 1LPGB 3AASA 2A4GA 1BRBE 1NN6A 3M5NA 4YT6H 2BQ6B 3CNRA 4MG3A 1C9PA 5L6NH 3KYFA 2QXJA 3QTVH 4R0IA 2K0QA 1AVXA 1P05A 5EPNA 2ZDAH 1XVOA 2ZA5A 4CRFA 1O5AB 1S83A 1UK4A 4HTCH 2GT7A 2Z3EA 3GY3A 1C1WH 2W26A 1SFQB 3NRLA 3PTNA 3M7QA 1YGCH 1Y5BT 2AFQB 4NA7A 1C1VH 1FJSA 2ZZUH 2ZCHP 2VWNA 2V3MA 1MTNB 1EJNA 2BLWA 3E0PB 5C0UA 4OGXA 2J92A 2Q1JA 3MNSA 4P02A 5DP9A 1O3KA 3I78A 2O8UA 1O2QA 3BTWE 4IGDA 1ZPZA 2ZEBA 4OS5A 4B73A 1SGEE 1YCPH 3EA7A 1SHHB 1A7SA 1CU1A 1K9OE 1KIGH 1VKYA 3T5FH 4YZUA 3TPIZ 1L4DA 3C27B 1DY9A 3PMAB 1ANCA 4F4OC 1FUJA 2FS8A 3SV9A 2OBOA 2F91A 1UK3A 2VJ1A 1Q2WA 3NWUA 1OWDA 3P8GA 1CGHA 2YMSC 1C1UH 1Z8RA 1SSXA 3A8BA 4X8VH 1TBRH 1A5HA 1V2NT 3BTEE 3QO6A 4O97A 1S0RA 1O3NA 1WCZA 2Z9GA 2G4UA 1L1NA 1NT1A 3UUZA 1AWFH 5C1UA 1XUFA 2F9OA 5J4SA 2ZFSA 4BTTB 1UVPA 1O2YA 1PQAA 1DITH 1CHOG 3SUEA 4AFZA 4FETA 4RN6A 7KMEH 2PR3A 1P12E 5AHGH 3SU1A 1HV7A 2FOFA 1FN6A 3P70B 1T7CA 4IW4E 2O8LA 3BTFE 2G4TA 3OYPA 2OLGA 1MZAA 4GHQA 4XRNA 3LJJA 2J97A 1O33A 1A3EH 1ZHRA 2FYRA 7GCHF 3TJOA 4K2YA 1Y8TA 2C8YB 3L3TA 3HK3B 3RXHA 1C5PA 4AFUA 4GAWA 1TABE 3K6ZA 1BMLA 2OQUA 2F9PA 1ZTKA 3GS9A 3AAUA 3HKIB 3UNQA 3DA9B 4ASUD 1HXEH 1OP8A 3PLKA 2VB0A 1SGCA 5FPYA 5EJ1A 5IDKA 1O2TA 2FXRA 1DDJA 3PROA 2GP9B 2PGQB 3LGWA 2ANWA 5FBEA 1P3EA 1VCPA 1ARBA 1VZQH 2A7JA 2NU1E 2TPIZ 3PMBB 3TJNA 1KDQB 1SQOA 1XUIA 2SGFE 1HAVB 5A2MH 2OTVA 1IQGA 3N7OA 1BBRH 1V2MT 3SUFA 1E37B 5TJXA 1W8BH 4CH8B 3QUMP 4CR5A 1MCVA 4DW2U 1AY6H 3U1JB 2FX4A 1BIOA 2JH5D 3M37A 3DSGA 1VCQA 5L30H 9LPRA 2OC1A 1O2NA 2Z9LA 2QAAA 4BAMB 2FI3E 2AMDA 3UNRA 2O8WA 4D7GA 2LP6A 1QFKH 2ZI2H 1EP5A 4H42U 2ZHQH 1UHBA 1SGYE 2GKVE 4NIYA 1HAGE 2GX4A 5SGAE 1FPHH 1GI2A 1Z1IA 5FX6A 1C5VA 1ELTA 1O3DA 1MKWK 3PV2A 1F2SE 1FAXA 4CRCA 1AGJA 2C3SA 5DSFA 1GL1A 5K0HA 3ZZAA 4TT3D 1XM1A 2KAIA 3MQKC 2OC8A 2ZGHA 2ZTZA 1CE5A 2P95A 5C5OA 1P0SH 3RXMA 1G36A 2J2UA 3LC5A 3LGYA 1GMCF 3F1SB 3RUOA 1SLVB 5TCCA 3RMLH 1MBQA 1NU9A 3ZZ6A 1RJXB 2O8TA 3A7TA 3AAVA 3Q77A 1OYQA 3U1IB 1HJ8A 1E36B 1A0LA 1TQ7B 5J4QA 1J15A 2VGCC 2P8OC 1W0JD 2BX4A 1DFPA 3OX7U 1GBIA 4ACAA 2A5AA 1ELAA 2GMTB 1OSSA 2VWOA 2A31A 2AERH 5BPEA 3QTOH 5EU8A 3RC5A 2VVCA 3ESTA 1FY4A 4K1SA 1NESE 3BSQA 3ZVCA 1YM0A 4X2YA 1F0SA 2WUCA 2P8OB 2JH0D 5C1YA 4NGAH 1EP6A 3T27A 5F8XA 1LKBA 5KGOA 4YTAA 1J17T 2D2DA 1OP2A 1NM6A 1UK2A 4PROA 3FP8E 1HLTH 1AB9C 1DOJA 1Z8JB 3SJ8A 3LU9B 1C5QA 1DVAH 2BY6X 1BBRE 4FVDA 3BTQE 1C1TA 2XWBI 1C2HA 3MWIU 1BZXE 1TOCB 1TYNA 3FZZA 4FUGA 1C2IA 2VIDA 3K2UA 3A80A 3ZZ5A 1DICA 1MAYA 1GHBG 2BDBA 2J4IA 7ESTE 1UCYH 4ABIA 2BY9X 1O3JA 1S0QA 4NA8A 1HRTH 2GZ8A 3ZZDA 2BDYA 2XW9A 1K2I1 2AGGX 1C5LH 3IITA 2QGRA 2W6JD 2GCHF 3KF2A 3OFND 4FXGH 1AFQB 1ELDE 1WAYB 2PHBA 3VXFH 1P02A 2QE7D 1GI3A 2H5CA 4Y7AA 4CREA 2JKHA 2BVRH 1NBME 2IPHA 2ZIQH 2H9TH 4NZLA 1TGNA 1A1RA 1O2GH 1IQJA 1RGQA 1SI5H 2XXLA 1ZOMA 4E7NA 1RS0A 3OEED 1P2MA 3Q00A 3ZIAD 5C2ZA 3TGIE 3SV8A 1WTHD 5A8XA 3D62A 2HWLB 3UREA 3UR6A 2V6NA 1T8OA 2CHAB 3OE7D 3MNBA 4ABGA 5JPMH 3RU4E 1CA0C 4BXSA 1DSUA 3A7ZA 3SNDA 2J9NA 2ZU4A 2XNIA 1DLKB 1BJVA 4NFFA 2GT8A 3SJIA 3HPTB 3U8TH 2PUXB 1ZJDA 5T6FA 4AGKA 3SV7A 2ANKH 2BMGB 1FAKH 4X1RU 2AGEX 3O8RA 1PYTC 4NIXA 3ZZ7A 4K8BA 1FNIA 1H8IH 1TA2A 2QA9E 2FP7B 1KSNA 1UO6A 3JZ2B 4O3TA 1P2JA 4CRAA 4JZ1A 1PQ5A 1YPHE 1O2UA 1YPHC 8LPRA 1ZGVA 3E0NB 1TGCA 1YPGH 2FOMB 4ZCNA 1BTYA 1NY22 1ESTA 2ODPA 2BD8A 1COWD 5JDUB 1Z1JA 1BTZA 2V0BA 3DFLA 4E06H 3M61U 2TGTA 4GHTA 1UCYE 1UTOA 2XBXA 1GI8B 3SJOA 1FDPA 1Y5AT 1AWHB 1AIXH 1ELEE 1EB2A 1EPTA 4YT7H 1O2LA 4ISIH 2OUAA 1WSSH 2ZFRH 3NPSA 4XBCA 1LCYA 3MO6A 4BAQB 1P11E 3URCA 2OBQA 3BV9B 1HYLA 1YCPK 3MI4A 1MTWA 1GBEA 2ODYB 1ZPCA 1E1QD 3VPKA 3E16B 3AVZA 3EE7A 1YPKH 3D23A 3SN8A 5AVDA 3MOCA 1H4WA 2Y82A 4FU7A 3PV5A 3RXBA 4KKDA 4ZHLU 1UHBB 1SGDE 3BN9A 3S69A 2TGDA 1VR1H 1GCTC 2HRVA 2TGPZ 1LPZB 3FO8D 3P92A 3A7YA 2QF3A 1DUAA 4DJZB 4AG2A 2KAIB 1RTKA 5C67A 1J16A 1C2KA 2V3OH 1EZXC 2SGPE 1GJDB 2A7HA 4ABFA 3FP7E 1TA6A 1BT7A 1ANDA 1O36A 2FIRH 5CHAC 2IJD1 3Q3YA 2DE9A 5ABWA 2Y6TA 1WUNH 2OD3B 1GI5A 1Z6JH 3DSOA 1CT4E 3H7OA 4GCHG 4ZROA 2EC9H 3ZVBA 5FPSA 4X8UH 4ESTE 4TSFD 4I8KA 3RDZA 4DIIH 1OWEA 1KXBA 5CHAB 1A61H 1VITF 4ABJA 1B7XB 4X1SU 5E2PA 1GI7B 3KQ5A 2HPPH 1THRH 2H1UA 1WBGB 2ZNKH 5A8YA 1CGJE
chains in the Genus database with same CATH topology
3OY6U 2WPLS 2GZ9A 1GMDF 2ZHWH 3OSYA 1ARCA 1ZTJA 3I77A 5FPTA 2QV1A 1E38B 1NFXA 2B0FA 4IMQA 2BY7X 1O3AA 3UPEA 6GCHG 2PWXA 2Z6BD 1L1GA 2W7UA 1W11U 1K1LA 3RMMH 4JZIA 1ELVA 1DWDH 2W7SA 2WPJS 1G30B 3R3GB 2BY5X 2Y5GA 4OS6A 1O2VA 5C20A 1O2OA 2Z9JA 1LVOA 3MTYA 1GBAA 4O3UA 1EOLA 4Z0KA 4U30A 3RXGA 1G2MA 5EW1H 2P94A 1DY8A 3B23B 1CVWH 1HAIH 1QRWA 2GCTB 4LZ1H 4ZXXH 3SJKA 2OXSA 4BNRA 3BIUH 5A09A 4JYVH 1IHTH 1ABIH 1LPKB 2J94A 1ZRKA 1A0JA 2UUJB 1L1JA 3A8AA 2ALVA 1SQAA 3P17H 4UFGH 2D26C 2A7CA 2EI7A 3SORA 4B74A 1LDTT 3VB3A 3SNEA 1O3EA 1C2FA 1D3PB 2BOHB 2HOBA 2F9VA 1GJ7B 1V2JT 1T4UH 2FOBA 3S0NA 1ESAA 4JK5A 4MPXA 3RXJA 2C4FH 1TOMH 2F9UA 3S9CA 2BD4A 3GYLB 4IBLH 1CO7E 1E34B 3LKWA 1TGTA 3VB6A 3FFGA 1QL8A 3PWBA 1P3CA 3A89A 5AF9H 1SLUB 2XTTB 3TVJB 1CT0E 1BITA 1FPCH 4DG4A 1NFUA 4FUDA 2P3UB 1D3QB 1ZHMA 2CGAA 3SU6A 2VIWA 3B9FH 1O2IA 5FX5A 2A32A 1AZZA 1O5DH 1NROH 1HGTH 4WMFA 1C5ZB 1N8OB 6ESTA 4OS7A 2ZPQA 2BDGA 1TX8A 4ZUHA 3S9AA 2B8OH 5DJ7A 2Q6FA 1AHTH 1P9SA 3BTME 1TPOA 2IOTA 2FLRH 3TU7H 2VIVA 3T26A 4BAOB 4HFPB 4XDEA 1TALA 1BCUH 4AB8A 4WY3A 1SQTA 3LGVA 2RA3A 1H1BA 4OS4A 1TONA 2G51A 1UJ1A 3VFEA 4YOJA 1HPGA 1EPTB 1MKXH 1XKBC 1XXDA 4ABDA 2IJOB 2C93B 2VWMA 4U2WA 1P2NA 1ZR0A 1TFXA 3MO9A 1UCYK 1PPFE 5F8TA 4K8YA 4MNWA 4Y0ZE 1WOFA 2AYWA 1WQVH 3T29A 2OCVB 4NWKA 3V7TA 2VH6A 1B0FA 1S6FA 4D76A 1JBUH 1QQUA 1HCGA 3RXEA 1WYKA 1O2WA 4GLYA 2AIQA 4DY7B 1CSOE 1G32B 2ZQ2A 4CBOA 1W0YH 1W0ZU 1DX5M 2Z3CA 4AB9A 1K22H 1YKTA 2V35A 1WV7H 4BTUB 4QT8C 4DVAU 1XUGA 3ZZ9A 4K60A 2G55A 4MNYA 3PLPA 4WXVA 2GD4B 4X1PU 4X8SH 1D4PB 1ABJH 2WYJA 1QJ7B 4X6OA 1CHGA 4CHAC 1V2KT 1INCA 3L33A 4I8JA 1C2MA 4INHA 4DGJA 3Q3XA 1UVSH 1S6HA 4B71A 3MH7A 2BQ7B 2BZ6H 5I25A 3V0XA 3F6UH 1GJ6A 1BOQA 1C5NH 2PSYA 1P04A 3LC3A 1SGRE 1OP0A 1O2XA 1CGIE 2ZG0H 3NXPA 2B7DH 1H8DH 2LNCA 4OS1A 1O0DH 3CS7A 2FODA 3GCTF 2ZGBH 1TGBA 4KTUA 1Q31A 3FVFB 3IG6B 2SFAA 1HIAA 1OS8A 1DM4B 2BDAA 1GHXH 1HJAC 1MTUA 1N6YA 3MH6A 2QXIA 4TWYA 3RC6A 3BTDE 2FO9A 1NTPA 2QY0B 5DP3A 1TRNA 4Y10E 1JIRA 1ZRBA 2VNTA 1KXEA 3SV2H 4YESB 1Y3YA 2VINA 1TPPA 2R0KA 3LT3A 2RA0A 5PTPA 1T4VH 2XCNA 1IQEA 2BD5A 3UFAA 1G3CA 2H2ZA 4A6LA 2TGAA 4O03A 1BTPA 1ZSLA 1O39A 2VU8E 2PKSC 5JBCS 3T62A 2D1JA 5EG4A 1SPJA 3TITA 1GJBB 1P2IA 3MHWU 1T32A 3ZV9A 1HBTH 1C4Y2 4NZQA 1GVKB 2GZ7A 4I8HA 4ZKSU 2GVFA 1VGCC 3RXTA 2Y5HA 2WYGA 2ZGXH 1THPB 3LH1A 3SNCA 1D9IA 1OWKA 2OQ5A 4ISNA 2PKSB 3SO3A 3MNCA 3LH3A 1RTFB 2P3FH 3ZZBA 1FMGA 3ODDA 3OTJE 3SGQE 4YOIA 4RKJB 3GISB 5LPRA 1O35A 1VGCB 1JIMA 3PO1C 3S7KB 1T31A 3GY2A 2AMQA 2THFB 3M7UA 2Z3DA 3LONA 3SNBA 1U6QA 2ZTYA 3TNTA 4FUIA 4JYUH 1FQ3A 3PO1B 1D6WA 4MPVA 3EYDA 2GV7A 1KY9A 5FXLA 1GL0E 1UTMA 2B5TB 1P2KA 3TH4H 2ODQA 3T28A 4UE7H 3A88A 4JK6A 3BG4C 3GCOA 2AEIH 3ATKA 1EAWA 1GJ9B 2WPKS 1YP9A 3SW2B 3GDSA 1EZSC 4XFQA 1K21H 5L2YH 4AYVB 2Z94A 4NA9H 2I6QA 1OKXA 4Q7ZA 1PJPA 4Y7BA 1BA8B 1Y3VA 2WINI 2ZECA 2YNAA 1A2CH 3A8DA 3B8JA 1BTWA 4Z6AH 3RU4D 1IQNA 2P93A 1V2WT 1X7AC 3MU0A 2BHGA 4MNXA 5DO4H 5C1XA 5I46H 3RXSA 1JOUB 1D6RA 4Y76A 4B1TA 2AH4X 2R3YA 4OS2A 2VGCB 1BRUP 1PPCE 3W94A 1DWBH 1PYTD 2NU0E 1OX1A 4Y0YE 3P8OA 2Z7FE 4DCDA 4ZKOU 3F68H 1KLTA 2ZHDA 3RXLA 4WXIA 1IQIA 3DUXH 1W2KH 2ZCKP 2ZO3H 2J95A 2A0QB 5A0AE 4ZKRU 1G37A 2XBVA 4FUEA 2W3KA 1GBMA 1EXFA 1SGIB 3RXAA 1N1LA 4ABAA 5E2OA 1NRNH 5T3HA 1BTHH 3T2NA 3HKJB 1BRAA 1GHZA 4ZKNU 3G01A 1ELFA 1BTXA 2Z9IA 2HNTE 3V3MA 2HNTC 1GJCB 1LQDB 2XC4A 1FONA 4WJG2 1AB9B 1TMUH 3A81A 1WU1A 1GJ5H 1QIXB 1SGTA 4X6MA 5JBAS 2A5IA 2H9HA 2ZFFH 1AD8H 2BDCA 4DIHH 4UFEH 3CENA 4K3JA 3QGNB 2ZPRA 4ISLA 4XOJA 2ZF0H 2PFEA 1E35B 5DGJA 4U32A 4MDSA 4IS5A 1LHEH 1TGSZ 3HATH 5HXFA 2FMJA 3H7TA 5FHTA 1EATA 1ESBA 1PQ8A 2TIOA 2OC0A 2VVUA 4ZAEA 1TPAE 4MPWA 4Y71A 1Y3UA 1BUIA 1DUEA 2K1QA 1GBJA 1XKAC 2P3TB 4ISHH 1ZHPA 4WVPE 1GHAF 5FAHA 3LIWA 2QCYA 1B5GH 3BEUA 5E0HA 1C1SA 3ZVAA 4BAHB 1KTSB 4D9QA 1W7GH 2AMPA 5B6OA 3GDVA 1OWJA 1QL9A 3GY7A 1GGDC 1HIAB 1C5UA 4B75A 2FM2A 2VVVA 3MMGA 4A1TA 1GDUA 1O2ZA 4DURA 1B0EA 1EOJA 4H4FA 3SGBE 5K7RA 1RTLA 3PMHB 4FUJA 4CRDA 2V3HH 2H5DA 1ACBE 1F5RA 1MKXK 2BYAX 1CA0B 1C2GA 5FCRA 4AFSA 3ZZ8A 2WV5A 3JZ1B 1G2LA 3BTGE 2C8ZB 2IN2A 4H6TA 1GI6A 2ULLA 3SV6A 4AG1A 1ZMLA 3ATLA 4Y6DA 1JWTA 1O3GA 3MU1A 3MU5A 4AZ2B 4XSKU 1AKSA 2SGAA 1NS3A 4GPGA 2DUCA 1FXYA 4X0WU 5EPYA 1F0UA 1O2RA 1SG8B 1TE0A 3ZYDA 3A83A 3LPRA 3VB7A 3UWIA 8GCHF 5LGOA 3BEFB 1KTTB 1P06A 2Q6DA 1QB1A 3F9HA 3RP2A 1ORFA 3GCHC 1MD7A 2FPZA 2D8WA 1C5WB 3QWCH 4UFDH 5F8ZA 1RD3B 2A4OA 2QYIA 3KHVA 1IQHA 1SOTA 1GMHF 1GDNA 3DD2H 1BQYA 3C1KA 1TNJA 2I6SA 1M9UA 1GI0A 1P2OA 1GWAA 3CP7A 3LGUA 1GBFA 4K5ZA 1MBMA 3MU8A 3GCHB 1K1MA 2BLQA 2F9NA 1Y59T 1TNGA 5BRRE 1H9IE 4K69A 1C5OH 1EZUC 2G5VA 1WTGH 2P59A 2BD7A 4B2BA 8ESTE 1JRSA 1NC6A 5C3NA 4AGJA 2WUBA 1O37A 1NZQH 2BD2A 4HGCA 3VB4A 5F6MA 4O9VA 4GUXA 1HJ9A 1FLEE 2UUFB 1BMNH 1GCTB 5ESTE 1TRMA 9ESTA 2VH0A 2ZC9H 3A7XA 2GCHG 3RM2H 5HYOA 2OC7A 1NFWA 1IOEA 1FY8E 1NFYA 5AFZH 5A0CA 3KIDU 3UQVA 3T25A 4FU8A 1EJAA 1HAZB 1S82A 1W14U 4Y11E 3ZVEA 1ZTLA 1VITH 3EAJA 2FOHA 4MNVA 3U98H 1LO6A 4Q7XA 4LK4A 2A4QA 4X2XA 4D7FA 1TMTH 3RC4A 2GDEH 3KGPA 3STJA 1P09A 1VJ9U 1O2SA 1EB1H 3RU4T 3L6PA 2QF0A 2SNWA 3UWJH 4FUBA 2ZGCA 4B2CA 5A0BA 1OWHA 1K1PA 1RXPA 1GJAB 1MKWH 1SR5C 4ZMAH 1C2EA 3M5LA 1L4ZA 1SL3A 3EGKH 3P95A 4FUFA 3NCLA 4X6PA 4A7IB 1HAHH 2J34A 1GBLA 1O5FH 4UD9H 1DWEH 4LZ4B 1GJ4H 1BBRK 4TWWA 1FY1A 1O2HA 2XBYA 4INLA 1Z71A 4KP0A 3ATWA 1L2EA 3MH4A 3SU5A 4B76A 1KXAA 2QC2A 3BF6H 1BMMH 1HAYB 3GY6A 3RM0H 1BMAA 4WWYA 1UVTH 1Y3XA 1Z8IB 1O32A 1EJMA 4D8NA 4XBBA 1FIZA 2AGIX 3RXRA 1ANEA 5EOKA 2ZDKA 1PPHE 3LDXH 4AN7A 2PTCE 1UTPA 3QZQA 2NU4E 3IWMA 1O3MA 1N6XA 3BG8A 1IAUA 2FWWA 2Y5FA 2PKAA 3NKKA 5FBIA 1V2UT 2B9LA 2JETC 1LQEA 1K1NA 1C1NA 2TRMA 1GI4A 3TIUA 3RXCA 3EDXB 1IQMA 1XUHA 3KQDA 5H4IB 3ZZ4A 2FOEA 3PB1E 3A7VA 1ZLRA 1V2OT 3SU3A 3D65E 5E0JA 3K9XB 1EKBB 2OP9A 2A4RA 1MU8B 1SGPE 1YC0A 2ZDVH 3P8FA 1YLDA 1PPGE 2W3IA 4NSVA 3SGAE 1TQ0B 5GWZA 5E0GA 1HAOH 2BXUH 3E6PH 1C4V2 5EXNA 1CHOF 1TBZH 1C1OA 4THNH 1AZ8A 2FOGA 2G00A 3GY4A 1P2QA 1FIWA 3OY5U 3SOSA 4UFFH 4VGCC 1C1PA 1ZSJA 1C5YB 4WH6A 1LHFH 3FP6E 1QB6A 5GPIB 2XBWA 2ZGJA 1KYNA 1SOZA 1KXFA 4YO9A 1AKSB 3I29A 5DK1A 5IYTA 1V2PT 1G3BA 4VGCB 1E0FD 4FUCA 5EQSA 3UIRA 1F5LA 1O5EH 3VEQB 2CV3A 6CHAC 1AQ7A 1QBNA 2ZDMA 2ZQ1A 4BOHA 3KCGH 1VITG 2M5TA 1DLEA 2QXGA 1NPMA 2SNVA 1NRPH 1QJ6B 7LPRA 4M7GA 2SGDE 4MVNA 1O3IA 4WMDA 2NU3E 1S81A 3W95A 1BHXB 1ANBA 1QRXA 2FTMA 3PMJA 1OXGA 1C5SA 3ZV8A 1C2LA 1SGFG 1GMDG 3TH2H 1UVOA 2Y81A 3SU4A 1G3EA 3Q76A 3UNSA 4CR9A 2WPMS 1K1OA 4UEHH 2FOAA 4AOQA 3P8NA 1NU7B 1J14A 3HK6B 3ELAH 3BTHE 1XMNB 2F83A 5DP7A 2UWLA 4IC5A 3M36A 1HFDA 1O3LA 2FOCA 1MAXA 1MTNC 4JZEH 3O8CA 3GCNA 3M3SA 4ZHMU 5HM9A 2A2QH 3VGCC 4TPIZ 1ZPBA 1YPEH 3K6YA 1JMOH 1QBVH 1QNJA 1V2ST 2ALPA 1DXWA 3VXEH 1J8AA 1LVBA 1AO5A 2ESTE 1WQSA 1F5KU 4BAKB 1A5IA 4WMEA 1G3DA 1TLDA 3ZVGA 2R3UA 3VGCB 3TK5A 2FDAA 1O34A 5L2ZH 4MQAA 5GCHG 4A5TS 1O30A 1C2JA 4CHAB 3DT0H 1LKAA 2BQWB 1Z7KA 3LJOA 4B2AA 1Y3WA 2C8XB 1HAPH 1UTKA 2UUKB 2O8MA 2UUYA 2BD9A 3ZVDA 2FS9A 1EASA 1DXPA 1DWCH 4JZFH 1C5RA 1D3DB 1ELBA 3S7HB 2WV4A 1H9LB 1EAXA 1V2LT 2XC0A 2VIPA 4RKOB 1OYTH 1K1JA 4KGAA 1O2KA 2G52A 3AW0A 4AX9H 4SGBE 4FUHA 1GPZA 1C1MA 2XC5A 3F9FA 1GG6C 4CH2B 4NSYA 2RG3A 2J38A 4I32A 4E05H 3TK9A 2ASUB 4Y8XA 1ZMJA 4BANB 4K1TA 1HJAB 1TX7A 1HXFH 3R0FA 1GJ8B 1C1QA 4K1EA 1BB0B 1CQQA 1GG6B 1V6DA 1KXDA 4A92A 4X2WA 3RXVA 2RCEA 5G4BA 1XXFA 2ZHFH 1ETRH 1G9IE 3LOXA 3KEEA 1O3CA 1TNHA 1MU6B 4KTSA 2STAE 2F3CE 1OOKB 2XRCA 1L0ZA 1TB6H 1GHBF 3FZDA 2Y7XA 1ZSKA 2ZP0H 3STIA 2PKAB 2Y7ZA 4LOYH 3RLYH 3P6ZB 2Y80A 3UR9A 2PV9B 4GSOA 1AVGH 3LGTA 1NRRH 1UTNA 1UVUH 3FAOA 4H6SB 3M3VA 2FI5E 1GHVH 1FY5A 4ZHAA 2BXTH 3OU0A 2ZU3A 1ID5H 4BTIB 1FI8A 3PLBA 2FI4E 1IQKA 1THSH 2WPHS 1QQ4A 1EAIA 3M7TA 2ZPSA 1VJAU 2GTBA 1AUJA 1IHSH 1W3CA 4NWLA 2PW8H 3E91A 3SI3H 1KLJH 3PTBA 1SFIA 1V3XA 1P03A 3ATMA 4SGAE 1O38A 1MUEB 2BVXH 2AIPA 2HNTF 3SU0A 4JZDH 5ETXA 3Q3KA 2EI6A 3V13A 4TYDA 1SB1H 3KNXA 1TNKA