4OGYA

Crystal structure of fab dx-2930 in complex with human plasma kallikrein at 2.1 angstrom resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
239
structure length
239
Chain Sequence
b'IVGGTESSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILELSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLEYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasma kallikrein
publication title Inhibition of plasma kallikrein by a highly specific active site blocking antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/antibody
total genus 58
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature ec 3.4.21.34: Plasma kallikrein.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ogyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ogyA01
3GYMA 9LPRA 1HAPH 2SGPE 2VB0A 3MU0A 2A31A 1TIOA 3E6PH 2FDAA 1GVKB 1NU9A 1O0DH 4BAMB 1MTUA 4LZ4B 3A81A 4B71A 1BBRK 2J38A 4E7RG 1O2OA 2W5EA 1Y3XA 4A5TS 3ODFA 4JK6A 1KSNA 2NU1E 4CRGA 1GJ9B 3T28A 3LGVA 2A5KA 1SQAA 3TPIZ 5DO4H 2YOLA 1GCDA 1C4Y2 2ZF0H 3A80A 1C4V2 2BD2A 1GHYH 3KEEA 1GCTC 1KIGH 2VVUA 1O2KA 2OD3B 1ZPBA 3S9AA 4BAQB 1AY6H 2F3CE 2G55A 2OC1A 1O38A 5GCHG 1G2LA 3VFEA 4A7IB 2OC0A 4UE7H 3SU5A 9ESTA 3M3VA 4TWWA 1BIOA 2H5CA 3D23A 1ELGA 1BJUA 5EQRA 1P05A 1ETTH 1K9OE 4MNXA 3FANA 4U01A 1EZUC 3PWBA 1HXFH 1J8AA 1O3KA 1Y5UT 4H4FA 2P59A 5F03A 1OS8A 2ZHWH 3UR6A 1FIWA 4XFQA 1A3BH 3NWUA 2FI3E 1KY9A 3NCLA 1QJ7B 4ABFA 1SSXA 2ZQ1A 1TGNA 2A4QA 2Y81A 3EA7A 3L6PA 4ISLA 2OTVA 5IDKA 5JYIA 3M5MA 1ESTA 1D6RA 2BM2A 2ZGCA 1HJ8A 2GCHG 5LH8A 5GXPA 1C5RA 4NIYA 3A7TA 1GHXH 2F83A 4ZKNU 2ZFRH 2ZO3H 3PMHB 4Y79A 5FXLA 2ZHFH 3RXDA 3ZZ4A 3EGKH 2ZI2H 3RMLH 3ENSB 2BDHA 1Q31A 2C8XB 4ZH8A 2CV3A 2KAIB 4R8TB 3S9CA 1CHOF 1TOCB 1TABE 4Q2KA 1FDPA 1TPSA 1C2MA 1Z71A 2P16A 1GHBF 2P3FH 2A2QH 2HRVA 2BLWA 1YP9A 1C9TA 4F49A 3A8CA 2J34A 1OWEA 2OQ5A 2RDLA 2Z9IA 3P8NA 1QGFA 1TB6H 1ZJKA 1HRTH 1K1JA 1CGHA 1J17T 1NZQH 4D7GA 1UTNA 1ANDA 3U1IB 3VB3A 5CMXH 4D76A 2STBE 1BITA 1A2CH 1W11U 1W3CA 1SLWB 3QX5H 2TGDA 1NN6A 2UUFB 2B5TB 1W7GH 1GBKA 1XUGA 3M35A 1O2XA 4D9RA 3PM3A 2XXLA 1TWXB 3STJA 1UHBA 2O8UA 3ZVAA 5DP8A 1O31A 5PTPA 1AFEH 1O30A 4X1QU 1Z8RA 3M3TA 3MNSA 4I8LA 1YPEH 5L2ZH 1ELTA 2QIQA 1AB9C 3DA9B 2VNTA 1A46H 3A7XA 1P01A 1SQOA 1N6YA 4ABJA 3NUMA 1GBFA 2CF8H 4LXBH 4Q80A 1MZAA 1DSTA 1FV9A 5BPEA 3W94A 1PPFE 1GVZA 1FLEE 1QHRB 1EB2A 1K1PA 2FOCA 5HM2A 1BMMH 2NU0E 1HAOH 1SVPA 1XUJA 1O2HA 1A5GH 1P02A 2WUCA 1S85A 1BUIA 2FLRH 3VB4A 2BDIA 4ESTE 3RXSA 1O3LA 1BMNH 4B2AA 1EB1H 3A7YA 4OGXA 5FPSA 1GJ4H 3MU4A 3SNBA 2NU3E 1NPMA 4JZFH 3SJ8A 3RP2A 2FEQH 1CVWH 2V3HH 3LGWA 3SJOA 3UUZA 1B7XB 2VIWA 1C1NA 2B0FA 2ZCKP 3QGNB 1C5TA 1MUEB 2SGAA 3M7UA 1BTUA 3RXMA 4JZDH 1TOMH 1H1BA 3KCGH 4FXGH 2BQ6B 1MAXA 3DFJA 3BTGE 2BYAX 3UNSA 3GDSA 1IQKA 1P3CA 1V2OT 1W14U 5EXNA 2FOBA 2Z3CA 1O3MA 3UY9A 1ELAA 4CRAA 2W7UA 1LTOA 2ZDVH 4LOYH 1NROH 1KXBA 2H1UA 1FPHH 3QDZB 2VVCA 4NIVA 2BZ6H 1YBWA 1P2QA 2UUJB 2QCYA 3LPRA 4AX9H 1SGIB 1ZZZA 3RLYH 1GI9B 1C2JA 3MWIU 1TPOA 3PLBA 2HWLB 1SB1H 3MU8A 2XBYA 1K2I1 2FXRA 4AG1A 1IQFA 1BTPA 4B76A 2QN5T 3RC4A 2BHGA 4YESB 2ZHQH 1F0UA 2QGRA 3OX7U 4CR5A 2G5VA 1AVXA 3RC6A 5FX6A 1HCGA 1C5ZB 3UTUH 5FX5A 3SGAE 1ARBA 3GCTF 4ABEA 1YLCA 1ELBA 4FUDA 1PPHE 2ZU4A 2BX4A 4I31A 1LHFH 3AASA 3PB1E 1OP2A 3DUXH 5AFYH 2Y82A 1W8BH 3A7VA 1GL1A 4MPXA 4ZKOU 1PPGE 3RU4T 4UDWH 3Q76A 2GMTB 1TQ0B 3GOVB 1AZ8A 1D3QB 2JH6D 8GCHG 3TJUA 1UCYE 2AIQA 1L4DA 4GCHG 1JOUB 3UWJH 4ZROA 3SZNA 5JBCS 3SNAA 2UWLA 2PGQB 1C5LH 1BRCE 2Y5GA 4DOQA 2OC7A 1TMUH 3UWIA 1BOQA 3P6ZB 4K1TA 3SU0A 3FZDA 1SGYE 2AMPA 2ZFPH 4X1RU 3IWMA 1C2DA 5FBEA 1ZSLA 2P3UB 2ZP0H 4OS5A 1V3XA 1VJAU 3JZ1B 1SMFE 1D9IA 1HJAC 3CS7A 1PYTD 2BDCA 1F0SA 1BTXA 1UTKA 1SI5H 1FN8A 4GLYA 1AKSA 3PWCA 1PPBH 1AIXH 2BD3A 1OXGA 1CA0C 2PTNA 3SHCH 3RXFA 3O8DA 4DVAU 2J92A 4FUGA 1SLXB 1EPTB 1D3DB 1BRBE 2BDGA 1Q3XA 1MTVA 1ZHPA 1K1IA 1SGDE 3P95A 5ABWA 2UUYA 1TMTH 1DM4B 3SBKA 2Z9LA 4DG4A 1ETRH 2FYRA 4Y7AA 3UPEA 2SGFE 2DE9A 2EA3A 3SOSA 4X8SH 1HB0B 3A88A 2CMYA 2OBOA 5DP5A 2F9BH 3BTWE 1OWHA 1QTFA 1ESBA 2OP9A 1FMGA 1U6QA 2ZTYA 4CBOA 2GZ8A 1XMNB 1YCPH 3SUDA 2ZTXA 1GBMA 2H9TH 1Y5AT 4I7YH 3M37A 3ATLA 2ILNA 1GGDC 2PLXA 1O35A 1QQUA 1TX7A 4B2BA 1OWKA 3TGJE 4X6PA 1Z1JA 4ZXYH 2NWNA 1SOZA 8ESTE 4F4OC 2HGTH 5C1YA 4BTUB 3RXTA 2Y5FA 4IC5A 2A4RA 3Q3KA 2JKHA 1GBIA 1C5MD 1FONA 2IN2A 4AN7A 4Z6AH 1ZRBA 3UREA 3NPSA 4MPWA 5L6NH 2GV7A 1P2JA 3U8TH 3FFGA 1N8OC 3G01A 3BTDE 2OUAA 4FUEA 4XBBA 1NM6A 1IHSH 1YPMH 3Q3YA 4IBLH 4I8KA 1H4WA 4I8GA 3JZ2B 1G3EA 1EUFA 2ALPA 5DKMA 4KTCA 3LH1A 3VXEH 6CHAC 3TJOA 1NRSH 1P3EA 5E0HA 1O3NA 3HGNA 1HIAB 4OS7A 1ETSH 6GCHF 2VIDA 3LJJA 1HAVB 1P04A 1RTKA 4DIIH 3B8JA 2WPKS 3VPKA 2BX3A 1Z8JB 1RTLA 2SNVA 4A6LA 3HK3B 2FOFA 4X6OA 3A84A 1BBRH 3RXHA 1E35B 4U2WA 5F8ZA 1CBWC 4AB9A 1GBJA 1AMHA 1FZZA 2QA9E 1CT4E 2P8OC 2OBQA 2QF3A 5FBIA 2I6SA 1A3EH 3M7QA 1X7AC 2ZFTA 3ATMA 3IG6B 4XSKU 4IN2A 1MTNB 2OQUA 5A09A 4BTTB 3VEQB 2TBSA 4GPGA 1NFUA 2QAAA 2PTCE 1MKXK 1MKWK 1EATA 1CQQA 1EAIA 2I6QA 2V35A 1C1OA 3BF6H 1D4PB 5EW1H 1KDQA 5C1XA 1C1TA 1DVAH 3U69H 1UJ1A 2Y7ZA 1Z6JH 2Z9KA 1GJ7B 1FY8E 1VR1H 1G32B 2JETB 5DGJA 4ZXXH 2BVXH 3RXAA 4D7FA 4ZAEA 2RG3A 2R3YA 5A2MH 1EASA 3A7WA 2VWMA 4LK4A 3PTNA 5EU8A 4DJZB 1GI6A 1E37B 3HGPA 3A7ZA 2PW8H 1T8MA 3A8DA 4UFFH 2A2XH 1HAGE 5DG6A 3VB5A 2FOGA 1OP0A 3PV4A 3QZQA 4X0WU 4AYYB 1AQ7A 3BG4B 1EJNA 4RKOB 4AFQA 2ANKH 3PLKA 3RXLA 3T27A 4YO9A 3D49H 4I32A 3GY8A 3QO6A 3UR9A 1O2LA 5E8EH 3VGCC 4IGDA 1KTSB 1BTZA 3K6YA 3P92A 1L1JA 3LGTA 2ZKSA 4ABDA 5LPFA 3OY6U 2ZCLP 5C3NA 4WH8A 1A0LA 2AS9A 4WXIA 1GI4A 1KLTA 1KXCA 2JH5D 3BTEE 3SUEA 2NU4E 3TH2H 4ABAA 1UVPA 3GCHC 3A82A 3K6ZA 2R9PA 4OGYA 5J4SA 5FCRA 1ELCA 1GHZA 2IPHA 5BRRE 3PLPA 1DS2E 2FS8A 4WMDA 3LT3A 2W7SA 3ATWA 5I46H 1IOEA 1WSSH 1AHTH 1JBUH 5HMAA 3ZZDA 2FI5E 1NY22 1G3CA 1P9SA 1UMAH 1W13U 2ALVA 2ZEBA 4BAOB 3UQOA 3OU0A 1P8VC 4FU8A 4KKDA 2G8TA 1AWHB 1SLUB 1O3BA 2C8ZB 1UVOA 1ZPCA 4Y10E 5A8ZA 2BVRH 3N7OA 1PPEE 1Z8IB 1MU6B 2Z9GA 1LQEA 4INKA 3GY7A 3M61U 2SGEE 4LZ1H 2R2WU 3OTJE 1DSUA 2BB4A 4Y11E 1T8OA 3RM2H 3RU4D 2ULLA 1GI8B 3U9AH 4AORA 2TGPZ 1BMLA 1GWAA 1RIWB 1P10A 4CRBA 1O3DA 4QT8C 3FP6E 2BMGB 3BEUA 1GVLA 2IOTA 3ZVFA 4WH6A 1PFXC 2H6MA 1AN1E 4MQAA 1RTFB 1V2RT 1XXDA 2PKSB 7GCHG 1O5AB 4H42U 4Y0YE 2GD4B 3MH7A 2WYGA 1ZPZA 1LO6A 1QRXA 1O33A 2FTMA 2ZU3A 3TNSA 4AFSA 1SPJA 1K1OA 4KELA 3QK1A 2G51A 3CP7A 1WTHD 5TCAA 1IQNA 1HJ9A 3PMJA 1O5CB 1ID5H 1BB0B 2M5TA 4JCNA 4ASHA 3K2UA 3MI4A 1DUAA 3T26A 3L33A 4B74A 3ZVDA 7ESTE 4K8BA 1DFPA 1NRPH 2P95A 1HAIH 2BD8A 3SORA 3GYLB 4NA7A 5L2YH 3UOPA 2SFAA 3BTTE 1Z8GA 3SV7A 4AB8A 4ABHA 5TJXA 4YOJA 4ABBA 1THRH 1TGCA 5T3HA 1O2PA 1IHTH 1A0JA 2PKAA 3ATKA 3QZRA 4JK5A 4E05H 2A4OA 4XOJA 4NWKA 1FNIA 1SGTA 3O8CA 5T6FA 3A89A 2F9UA 2BDYA 2DUCA 2G81E 1XXFA 4KP0A 1C1UH 1THSH 1FJSA 4TWYA 3PO1C 2HNTE 2FYQA 3FVFB 5J4QA 4B2CA 1DXPA 3R0FA 1BRUP 4XBDA 2XCNA 3TJVA 1F5KU 2J4IA 1BHXB 1C5YB 2GX4A 3V3MA 4U32A 4JYTA 3SV9A 1DDJA 2EI6A 1AZZA 1IQHA 4GUXA 3AW1A 3ESTA 2A5IA 3EYDA 2PUQH 1WBGB 2V6NA 2BY6X 4MTBA 1JIRA 1GBTA 1TFXA 1O3OA 1XVOA 3BEIB 1HLTH 2F9PA 4FUFA 2Z9JA 1PQ5A 1WAYB 2PHBA 1LDTT 2Q1JA 4WF8A 5K7RA 4IMQA 2PWXA 1LMWB 1GHWH 3SNEA 3PROA 1S0RA 1A61H 2A5AA 1K22H 1C4U2 1O5GH 2ZPQA 1GPZA 3KHVA 1MZDA 3DHKH 1W0ZU 1VCWA 3BG8A 4WWYA 3C1KA 1ORFA 1HXEH 1EZSC 1WOFA 4ZHAA 1ZJDA 1ELDE 8KME2 4SGAE 1AI8H 1IQMA 1C1RA 3VXFH 5E2PA 3ZZ5A 3BN9A 1HDTH 1AFQB 5JBBS 1HAZB 1JRSA 1UO6A 1WU1A 2HNTF 1ZLRA 1WUNH 3LIWA 3T5FH 1NC6A 1C5QA 1W10U 4K1EA 1ZSJA 2D8WA 1DITH 2THFB 4CRCA 5GCHF 4HFPB 4UFEH 1Y3VA 3RXVA 5AF9H 2C90B 2HOBA 5JB9S 4Y7BA 4OS1A 1P11E 2VU8E 4NIXA 1B0FA 1QRZA 1UTJA 1F0RA 2XBWA 3SU1A 1TQ7B 1DOJA 5AHGH 1FAXA 3MU5A 2ZHDA 3V12A 3IITA 3ITIA 3ZZ8A 3M5NA 1QB1A 3TIUA 3NZIA 4DY7B 1ACBE 1F5RA 2YNAA 1Y3UA 3MU1A 2KAIA 1LPKB 4K1SA 1BRAA 4B73A 2ASUB 2VVVA 1O2VA 2VGCC 2XWBI 6LPRA 3LGUA 2G5NA 5IYTA 2VWLA 1E36B 1LVBA 1EX3A 1P2IA 5DJ7A 1HAYB 2GCHF 4X8TH 3TK5A 4D8NA 2HPPH 1TA6A 5DP7A 2J9NA 2FX4A 3LU9B 3ATIA 1HAXB 3F9EA 5F8XA 2J94A 4K60A 3MNXA 4BNRA 2ZDKA 2YNBA 2ODQA 1KXDA 1S84A 1O3PB 1MD7A 2WPIS 3U98H 5FPYA 1O2IA 1G3DA 4H6SB 1AU8A 1GL0E 1EP5A 1YPHE 2WPJS 5F8TA 3T62A 2BXTH 1GDQA 4WVPE 1ABJH 1EZXC 3EA8A 1HPGA 1V2UT 2BY7X 2JH0D 2ZGJA 4MNVA 1P03A 2XC0A 1VGCC 1RXPA 1AB9B 1ELFA 3D65E 3M36A 2FESH 5HGGA 1B5GH 1V2PT 5EXMA 1HFDA 3K65B 4YZUA 2QXJA 4ZKSU 3P8GA 3A86A 1O3GA 1MTWA 4D9QA 5FPTA 1N1LA 1MAYA 3TNTA 2EC9H 2Q6FA 4GVUA 2VJ1A 1BJVA 4YLQH 4GAWA 3TGKE 2O8MA 2ZPRA 1BCUH 1CA8B 5C1UA 1QBNA 4DURA 1NFYA 1GG6C 1K1LA 2ANMH 1MBQA 3AW0A 3SU3A 3LGIA 1SLVB 1V6DA 4YT7H 2H2ZA 2GCTC 4NG9H 1TRMA 3A8AA 4DW2U 4ISIH 3T2NA 1TAWA 1DWEH 3RMMH 5JDUB 2A45B 4ZMAH 2TPIZ 1P9UA 1RJXB 5GWZA 1BQYA 1GMCG 1WQSA 1V2TT 2AGGX 1QY6A 1MCTA 4CBNA 5C5NA 4THNH 2DE8A 2B8OH 1XUIA 8LPRA 1TX8A 1DICA 1UTPA 5CHAC 4ABGA 2ZTZA 4XDEA 1SGRE 1PQAA 2ZU1A 1AUJA 1C2IA 4BAHB 1L1GA 1W0YH 1O2GH 1VZQH 3I78A 2BLQA 3BEFB 4MNWA 2ZDMA 1C1WH 1IQJA 3UNRA 4AFUA 3M5OA 1ESAA 2FMJA 2ZU5A 1YM0A 3RXOA 1GI0A 1VITG 1QL8A 1P57B 1XKAC 1DY9A 3BTFE 3BTKE 1GMDG 1O3HA 2R0LA 4B1TA 1TNKA 1DWCH 3P8FA 1P12E 3O8RA 5ESBA 1QJ6B 1KDQB 3D62A 1QBVH 1QR3E 2BD7A 1SL3A 1SHYA 2G00A 3H7OA 4VGCC 1SBWA 3BTQE 3TK9A 1GJ6A 4AGKA 1GBHA 1H8IH 1G9IE 1JIMA 1QIXB 1ZMJA 2ESTE 3P8OA 3QUMP 4TY6A 4A92A 1C5WB 1LQDB 2PSYA 4ISHH 5DK1A 2XW9A 3SV6A 5EPNA 4NA9H 4CR9A 1JRTA 1C5UA 1GJDB 1XVMA 1IQIA 2OCVB 2W26A 3SU4A 1QB9A 1WV7H 1EJAA 4BXWA 3AAUA 3MH4A 1MH0A 3E16B 2ZFFH 1TBQH 1G2MA 3RLWH 5HYOA 1BBRE 5A0BA 4WMFA 2CHAC 2GZ7A 1H9LB 5L30H 3BIUH 2BXUH 1C1SA 4Y8YA 1ABIH 3ZZ6A 3SHAH 3SJ9A 2GKVE 1TGBA 1TNIA 1ZHRA 3BG4C 4ISNA 1T31A 1BTWA 1G30B 1DE7H 3DD2H 1FQ3A 1EOJA 4IN1A 4CHAC 1QB6A 4JMYA 2C4FH 1LVOA 1RD3B 1KTTB 2ZECA 5JBAS 2Z6BD 3URCA 2AH4X 4U30A 1BDAA 4CH2B 1HJAB 3FZZA 8GCHF 4ZHMU 2K1QA 1M9UA 4GCHF 3MO3A 5JB8S 1WTGH 1TNLA 4HGCA 1MCVA 1V2MT 1V2KT 2CF9H 2H9EH 1CA0B 3SU2A 2BY9X 3V7TA 2QXGA 2BQWB 1G37A 1QRWA 1PQ8A 2D26C 1JXPA 1S81A 1FXYA 2G4TA 1BT7A 2P93A 3T25A 2VH0A 1CSOE 1SGQE 4BXSA 2XCFA 3HKJB 4YLUA 1T32A 3RXRA 3PMAB 4O3TA 2TRMA 4RN6A 2AIPA 1GJCB 1GMCF 1KXAA 1OSSA 4K5ZA 3ZYDA 2FPZA 4X6MA 1EPTA 1BMAA 3MTYA 3GICB 2FOHA 1VITH 3MYWA 3HATH 3A87A 3E8LA 3A85A 3ZVCA 4DCDA 2XTTB 3TGIE 4TPIZ 3GY3A 4BOHA 1AE5A 4IW4E 3OSYA 4X1SU 4K8YA 4NGAH 4NFFA 3SW2B 5F6MA 3AVZA 2OC8A 2VIOA 1A7SA 4FUHA 1UCYK 5SGAE 2C93B 1GGDB 1L0ZA 2XBXA 2Y6TA 5DP9A 2FP7B 2WPMS 2BD4A 4JZ1A 5EG4A 3FAOA 1AO5A 3LONA 4TPYA 1D6WA 1MQ6A 1V2QT 1O3EA 2P94A 1INCA 1THPB 1XKBC 1ZMLA 4AG2A 1FY4A 4E7NA 1A5IA 1FAKH 4X2YA 4X2VA 2ZU2A 2XWAA 4J2YB 1AUTC 4Y76A 2PV9B 3GCNA 1N8OB 2W3KA 1LHCH 1OWDA 3ZVBA 1A5HA 5GPIB 5C67A 3M5LA 1C5PA 2WV5A 1HAHH 1JMOH 2GVFA 3SJIA 1GI7B 1P2MA 2FTLE 1AD8H 2VINA 1V2ST 6CHAB 3QN7A 1IQGA 3GY6A 7LPRA 2P3TB 1GI5A 1TLDA 1DX5M 4X6NA 3UIRA 4AFZA 2Z3DA 4B75A 1KYNA 3HPTB 2J95A 1YPLH 1O2TA 4NIWA 1CHOG 4UEHH 1E34B 1UTMA 4JZEH 4MNYA 1VCPA 2QXHA 2ZFQH 5DPAA 1GBEA 2BLOA 1C1VH 1EP6A 3LC5A 1GBDA 4NZQA 1GHBG 2H5DA 4SGBE 3LDXH 3F6UH 1P2OA 2QV1A 4TY7A 1BA8B 3FP8E 1LVYA 1YF4A 2ODPA 5ETXA 3CS0A 3E0NB 1HAVA 2Y80A 1CBWB 1SGEE 2PKAB 3KQDA 5LGOA 1DWDH 1O39A 1KLIH 2P8OB 1TYNA 1Z7KA 1QQ4A 2CN0H 1H8DH 1V2NT 1V2WT 1O2ZA 1QL9A 4NA8A 2ZHEH 3VB7A 3BSQA 5H4IB 3RMNH 6ESTA 1YC0A 4X8VH 1F5LA 1IQEA 1HBTH 2SGDE 3LC3A 3SUFA 3BV9B 1PPCE 1AE8H 1ZTLA 1GBBA 2Z94A 3NKKA 2A4GA 5TCCA 3OYPA 3ZZ7A 3T29A 1UHBB 5A0AE 1SG8B 1DANH 1XX9A 4FVBA 5FAHA 2C8WB 1J9CH 1NFWA 1TGSZ 4X2XA 5FHTA 2GT8A 4WMEA 4Y8XA 3ZVGA 3EA9A 4A1VA 1EKBB 2R0KA 4MPUA 3SJKA 4DIHH 1O5EH 2VWOA 2C3SA 4E06H 3SQEE 2G4UA 3SGQE 4Q7XA 1V2VT 3QTOH 3EDXB 3TVJB 3UFAA 4MG3A 1QA7A 3SUGA 3VGCB 4CRFA 3B23B 2AERH 2PUXB 5T6DA 4UD9H 4R0IA 3Q77A 4UFGH 2H9HA 2UUKB 1MBMA 3E90B 1Z1IA 2ZIQH 3GCHB 1B0EA 2QYIA 1QL7A 1AFQC 3S0NA 4IC6A 2BDBA 3TK6A 3BTME 1T7CA 2WV4A 5E2OA 4KTSA 1XUHA 4GHTA 1UK3A 4O3UA 3MO9A 4Y8ZA 1H9IE 3UQVA 1E0FD 1L1NA 1UTOA 2Z3EA 2W3IA 1YKTA 2VH6A 1O2NA 1T8LA 1TPPA 2ZC9H 4BAKB 4FUBA 1TNJA 4INLA 4Q7YA 1JWTA 2EI7A 2IJOB 1G36A 3MO6A 4YOIA 4I8HA 3SV8A 1ZHMA 2ANYA 2BQ7B 2V3OH 2ZFSA 3GY2A 3GCTG 2HALA 3EAJA 4DT7B 1DUEA 1EOLA 1GJBB 2XC4A 1N6XA 3NK8A 1D3TB 1WCZA 1DY8A 2AFQB 2ZGXH 1LHGH 1ZRKA 1V2LT 3LH3A 3GCOA 1SOTA 2FLBH 2FOAA 3NXPA 5JBTA 1YCPM 3MNCA 2OINA 4O9VA 1LVMA 1YPKH 2FM2A 1TBRH 1GI3A 5C2ZA 1PYTC 3KN2A 5GDSH 1LPGB 3SI4H 3ZV9A 3MNBA 1O37A 2AEIH 5EQSA 3QWCH 1P2NA 1SGCA 1GCTB 2BVSH 1XUKA 4FUIA 1ZTJA 3MHWU 2TIOA 4MVNA 2FS9A 3H7TA 2F9VA 5EQQA 1QFKH 4Z0KA 1KLJH 5EPYA 5T6GA 5C5OA 7KMEH 1GI1A 1OWJA 1CU1A 2FODA 1OWIA 1FY3A 4MDSA 3U8RH 4O97A 1QA0A 2ZQ2A 3SQHE 2XNIA 1ANEA 4WJG2 1S6HA 1ZMNA 1HGTH 4ABIA 3V0XA 1ANCA 3VB6A 2AMQA 2XC5A 2GMTC 1L4ZA 1ZGVA 5ESTE 1F92A 3W95A 4ZHLU 2BOHB 1KXFA 1LKBA 3RMOH 2TGTA 3SV2H 1ELVA 1SGFG 1L2EA 3S69A 1EJMA 1Y3YA 2GDDA 3TITA 7GCHF 1TNGA 3EE0B 1ZOMA 4YT6H 1XUFA 3U1JB 1VJ9U 4FUCA 5AFZH 1O36A 4X2WA 1NO9H 2UWPA 1S82A 2HNTC 3ODDA 3PYHA 5HM9A 3KF2A 1NFXA 1C2FA 2BLVA 1S0QA 1GMHG 1UK4A 1O2RA 1ANBA 2CXVA 2BOKA 3SO3A 4I33A 1Y59T 1UVSH 1EAWA 3ZZAA 1AKSB 3B9FH 5GIBA 3MOCA 2V0BA 2PR3A 1OX1A 2A1DB 1YLDA 2BD5A 3TLOA 1S5SA 2XBVA 3LJOA 3E1XB 1RGQA 4CH8B 3MMGA 5G4BA 4A1XA 1NESE 1UVTH 3PO1B 3BIVH 2J2UA 3PMBB 1TPAE 2OLGA 3TH3H 1LCYA 1A1RA 1QCPA 1V2JT 3EQ0H 2ZDLA 3ZZBA 1EPTC 2O8TA 3F68H 1AVGH 2GDEH 3I77A 3P70B 3RC5A 2ZG0H 1C2LA 4PROA 3S7KB 3H5CB 2D1JA 4GSOA 2BY5X 1OYQA 3F9GA 1AWFH 1OKXA 1O5FH 4INHA 1C2EA 2LNCA 1GJAB 1LHEH 2ZGBH 1ZR0A 3LKWA 1K21H 5DP4A 1P0SH 2QF0A 1DPOA 3SGBE 1WYKA 2FOEA 3ZZ9A 2CJIA 3BTHE 1NRNH 4NFEA 4I8JA 3S7HB 2BY8X 1C5SA 2TGAA 5A0CA 4K69A 3SNCA 1EQ9A 1ELEE 1CGJE 1MD8A 2GT7A 3WY8A 1LKAA 1NTPA 3RXUA 2ODYB 6GCHG 2A7HA 4YOGA 3DT0H 2EI8A 1DT2A 1Q2WA 2Q6DA 2LPRA 4WY3A 2HLCA 3RXKA 2QXIA 1C9PA 1QNJA 1TBZH 1SFQB 2BDAA 5AVDA 2O8LA 1UVUH 4ZKRU 5DP6A 3RXQA 2B9LA 2FI4E 3SI3H 2D2DA 4FUJA 4NWLA 2FZZA 3RXIA 4K2YA 2WPLS 2NU2E 1HYLA 3KL6A 2AMDA 2VWNA 1J15A 1DXWA 2ZNKH 4RKJB 3KQEA 2AGIX 3U8OH 2FWWA 2A32A 2VIQA 4IS5A 1TALA 2VIVA 1YGCH 3SU6A 1C5VA 3RU4E 1TE0A 1O2MA 3AAVA 1MKXH 1EXFA 1MKWH 4CRDA 3QLPH 1IQLA 1BTHH 4O03A 2PSXA 1J14A 1O3IA 4RSPA 1C2HA 2A7CA 1NS3A 5HXFA 4JYUH 1FUJA 3URDA 1F0TA 2AYWA 1GHVH 1P09A 2XYAA 3HK6B 4JZIA 4ZUHA 3TU7H 2GV6A 3ZZ3A 4GHQA 2B7DH 2PGBB 5EODA 1UCYH 1HV7A 4H6TA 1YPHC 5C20A 1C2GA 2Y7XA 1TA2A 3GDVA 1GBLA 2VGCB 1G3BA 1FN6A 2WUBA 2ZCHP 2ZGHA 3P17H 1SHHB 2Y5HA 1TONA 1GHAG 1P2KA 4AYVB 2ZDNA 1GMHF 1C1MA 1MU8B 3UOUA 1O2YA 1MTNC 1F2SE 2PFEA 1GBAA 4WXVA 3HKIB 1FIZA 5I25A 3RXGA 1NT1A 4Q7ZA 1VGCB 4NSYA 2ANWA 1C5NH 3GY5A 1CT0E 2WPHS 5FCKA 3K9XB 1O5DH 2JETC 5K0HA 3MH5A 4X1NU 1SQTA 2ZZUH 4HI3A 4IMZA 3RXBA 3F1SB 3F9FA 4Y71A 4XE4A 3ZZCA 1HNEE 3SNDA 1E38B 1GJ8B 1NU7B 3KQCA 2RCEA 3Q3XA 2UWOA 1W7XH 3ELAH 2A0QB 1GG6B 2F91A 3Q00A 3GY4A 4MLFB 1K1MA 2GCTB 3ZVEA 1SGPE 1Z6EA 2GTBA 3DFLA 1YYY1 4Y0ZE 2BZAA 1F7ZA 2ZDAH 1WQVH 2AGEX 1RRKA 3RUOA 2FIRH 2WINI 2RA0A 4BTIB 3LGYA 4YTAA 1DLKB 1W12U 1CE5A 5A8YA 4OS4A 5E0GA 1ZSKA 1IAUA 5GJ4B 1DLEA 3A83A 3O8BA 1AGJA 1ZGIA 4FVDA 1ARCA 2EEKA 5A8XA 1O2UA 5CHAB 1CT2E 5LPRA 4UFDH 1CO7E 1QBOA 3ZYEA 4HTCH 1MTSA 4MPVA 1K28D 1W2KH 2GZ9A 2O9QA 1TMBH 1UK2A 1FY5A 5DP3A 1SGNE 3FP7E 5EGMA 2OXSA 1YPGH 3KGPA 1T4VH 3F9HA 3RXCA 1O2SA 2A7JA 2ZA5A 1KXEA 3C27B 2VIPA 1A0HB 1VCQA 3KNXA 4KTUA 2FO9A 2GP9B 4YM9A 1HUTH 1Y5BT 1D3PB 4UONA 1LPZB 3M7TA 4X8UH 3V13A 2CGAA 1QURH 2QC2A 3OY5U 3GISB 1GI2A 3A8BA 3GDUA 2R3UA 1SR5C 2BD9A 2ZPSA 3ZV8A 4A1TA 3MFJA 3S9BA 3RXPA 1ZTKA 4M7GA 4AZ2B 5EXLA 1O34A 1S6FA 1GJ5H 4FU9A 1FPCH 1T4UH 1UTQA 4VGCB 1CHGA 1Y3WA 2XRCA 1OP8A 3KIDU 1O3JA 2R2MB 1QJ1B 1SFIA 1GDNA 3E0PB 2HVXA 1MMJN 2O8WA 1RFNA 2STAE 2FX6A 1EZQA 1Y8TA 1TNHA 1RIWC 1S83A 5JPMH 4ISOA 3TH4H 1TRNA 1OYTH 1VITF 2C8YB 1T8NA 1DWBH 1GMDF 1YPJH 1MQ5A 1OPHB 1NRRH 1GHAF 2G52A 4KGAA 1C5XB 2PKSC 2WYJA 4Y6DA 1LHDH 2BTCE 1EAUA 4FU7A 3RM0H 1K1NA 1C5OH 1XM1A 2CHAB 2Z7FE 4JYVH 3M3SA 5EW2H 2SNWA 3CENA 1BTYA 1RS0A 1O3CA 1YCPK 4K3JA 4NCYA 4J1YA 3L3TA 4OS2A 3RXEA 1PQ7A 3I29A 1P06A 4NSVA 4CHAB 1TRYA 4OS6A 2GGVB 2F9NA 1HIAA 1FY1A 1C1QA 2FOMB 3LOXA 5CE1A 4AOQA 5EOKA 1OOKB 3MH6A 3TJNA 1SC8U 4BANB 3RDZA 1EAXA 4NZLA 1NRQH 1H9HE 3STIA 3RXJA 1TX6A 1O3AA 4CREA 1UTLM 1O2JA 1J16A 3R3GB 5LPEA 4DGJA 1FI8A 5E0JA 4TYDA 2Q6GA 1O3FA 2QY0B 1PJPA 3E3TA 4HZHA 2SGQE 4XBCA 2HPQH 1AVWA 3SN8A 1O2WA 3QGJA 4AGJA 1GDUA 1C1PA 3QTVH 3UNQA 5B6OA 1TGTA 1O5BB 1A4WH 3PTBA 1C2KA 2RA3A 1O32A 1BZXE 3KQBA 1GBCA 1O2QA 1SGFA 3E91A 1ZYOA 1BHXF 2ZWLH 4X1PU 1PPZA 1CGIE 2F9OA
chains in the Genus database with same CATH superfamily
5C0UA 3GYMA 9LPRA 1HAPH 2SGPE 3OE7D 2VB0A 3MU0A 2A31A 1TIOA 3E6PH 2FDAA 1GVKB 1NU9A 1O0DH 4BAMB 1MTUA 4LZ4B 3A81A 4B71A 1BBRK 2J38A 4E7RG 1O2OA 2W5EA 1Y3XA 4HG6A 4A5TS 3FKSD 3ODFA 4JK6A 1KSNA 2NU1E 4CRGA 1GJ9B 3T28A 3LGVA 2A5KA 1SQAA 3TPIZ 5DO4H 2YOLA 1GCDA 1C4Y2 2ZF0H 3A80A 3PRDA 1C4V2 2BD2A 1OHHD 1GHYH 3KEEA 1GCTC 1KIGH 2VVUA 1O2KA 2OD3B 1ZPBA 3OFND 3S9AA 3EE7A 4BAQB 1AY6H 2F3CE 2G55A 2OC1A 1O38A 5GCHG 1G2LA 3VFEA 4A7IB 2OC0A 4UE7H 3SU5A 9ESTA 3M3VA 4TWWA 1BIOA 2H5CA 3D23A 1ELGA 1BJUA 5EQRA 1P05A 3FOAA 1ETTH 1K9OE 4MNXA 3FANA 4U01A 1EZUC 3PWBA 1HXFH 1J8AA 1O3KA 1Y5UT 4H4FA 2P59A 5F03A 4F55A 1OS8A 2ZHWH 3UR6A 1FIWA 2QF5A 4XFQA 1A3BH 4P00A 3NWUA 2FI3E 1KY9A 3NCLA 1QJ7B 4ABFA 1SSXA 2ZQ1A 1TGNA 2A4QA 2Y81A 3EA7A 3L6PA 4ISLA 2OTVA 5IDKA 5JYIA 3M5MA 1ESTA 1D6RA 2BM2A 2ZGCA 1HJ8A 2GCHG 5LH8A 5GXPA 1C5RA 4NIYA 3A7TA 1GHXH 2F83A 2XOKD 3KYGA 4Q4LA 4ZKNU 2ZFRH 2ZO3H 3PMHB 4Y79A 5FXLA 2ZHFH 3RXDA 3ZZ4A 3EGKH 3FO8D 3MQKC 2ZI2H 3RMLH 3ENSB 2BDHA 1Q31A 2C8XB 4ZH8A 2CV3A 2KAIB 4R8TB 3S9CA 1CHOF 2KM0A 1TOCB 1TABE 4Q2KA 1FDPA 1TPSA 2VBCA 1C2MA 2GJGA 1Z71A 2P16A 1GHBF 2P3FH 2A2QH 2HRVA 2BLWA 1YP9A 1C9TA 4F49A 3A8CA 2IPQX 1OWEA 2J34A 2OQ5A 2RDLA 2Z9IA 3P8NA 1QGFA 1TB6H 1ZJKA 1HRTH 1K1JA 1CGHA 1J17T 1NZQH 4D7GA 1UTNA 1ANDA 3U1IB 3VB3A 5CMXH 4D76A 2STBE 1BITA 2V7QD 1A2CH 1W11U 1W3CA 1SLWB 3QX5H 2TGDA 1NN6A 2UUFB 2B5TB 1KMHB 1W7GH 1GBKA 1XUGA 3M35A 1O2XA 4D9RA 3PM3A 2XXLA 1TWXB 3STJA 1UHBA 2O8UA 3ZVAA 5DP8A 1O31A 5PTPA 1AFEH 1O30A 3N7DA 4X1QU 1Z8RA 3M3TA 3MNSA 4I8LA 1YPEH 5L2ZH 1ELTA 2QIQA 1AB9C 3DA9B 2VNTA 1A46H 3A7XA 1P01A 1SQOA 1N6YA 4ABJA 3NUMA 1GBFA 4B6FA 2CF8H 4LXBH 4Q80A 1MZAA 1DSTA 1FV9A 5BPEA 3W94A 1PPFE 1GVZA 1FLEE 1QHRB 1EB2A 1K1PA 2FOCA 5HM2A 1BMMH 2NU0E 1HAOH 1SVPA 1XUJA 1O2HA 1A5GH 1P02A 2WUCA 1S85A 1BUIA 2FLRH 2KCYA 1EFRD 3VB4A 2BDIA 4ESTE 3RXSA 1O3LA 1BMNH 4B2AA 1EB1H 3A7YA 4OGXA 5FPSA 1GJ4H 3MU4A 3SNBA 2NU3E 1NPMA 4JZFH 3SJ8A 3RP2A 2FEQH 1CVWH 2V3HH 3LGWA 3SJOA 3UUZA 1B7XB 2VIWA 1C1NA 2B0FA 2ZCKP 3QGNB 1C5TA 1MUEB 2SGAA 3M7UA 3ZIAD 1BTUA 3RXMA 4JZDH 1TOMH 1H1BA 3KCGH 4FXGH 4XRNA 2BQ6B 1MAXA 3DFJA 3BTGE 2BYAX 3UNSA 3GDSA 1IQKA 1P3CA 1V2OT 1W14U 5EXNA 2FOBA 2Z3CA 1O3MA 3UY9A 1ELAA 4CRAA 2W7UA 1LTOA 2ZDVH 4LOYH 1NROH 1KXBA 3SZEA 2H1UA 1FPHH 3QDZB 2VVCA 4NIVA 2BZ6H 1YBWA 1P2QA 2UUJB 2QCYA 3LPRA 4AX9H 1SGIB 1ZZZA 3RLYH 2JJ2D 1GI9B 1C2JA 3MWIU 1TPOA 3PLBA 2HWLB 1SB1H 3MU8A 2XBYA 1K2I1 4ACBA 2EQNA 2FXRA 4AG1A 1IQFA 1BTPA 4B76A 2QN5T 3RC4A 2BHGA 4YESB 2ZHQH 1F0UA 2QGRA 3OX7U 4CR5A 2G5VA 1AVXA 3RC6A 5FX6A 1HCGA 1C5ZB 3UTUH 5FX5A 3SGAE 1ARBA 3GCTF 4ABEA 1YLCA 1ELBA 4FUDA 1PPHE 2ZU4A 2JDID 2BX4A 4I31A 1SQRA 1LHFH 3AASA 2HVYB 3PB1E 1OP2A 3DUXH 5AFYH 2Y82A 1W8BH 3A7VA 1GL1A 4MPXA 4ZKOU 1PPGE 3RU4T 4UDWH 2CK3D 3Q76A 2GMTB 1TQ0B 3GOVB 1AZ8A 1D3QB 2JH6D 8GCHG 3TJUA 1UCYE 2AIQA 1L4DA 4GCHG 1JOUB 3UWJH 4ZROA 3SZNA 5JBCS 3SNAA 2UWLA 5EJ1A 2PGQB 1C5LH 1BRCE 2Y5GA 4DOQA 2OC7A 1TMUH 3UWIA 1BOQA 3P6ZB 4K1TA 3SU0A 3FZDA 1SGYE 2AMPA 2ZFPH 4X1RU 2K0QA 3IWMA 1C2DA 5FBEA 1ZSLA 2P3UB 2ZP0H 4OS5A 1V3XA 1VJAU 3JZ1B 1SMFE 1D9IA 1HJAC 3CS7A 1PYTD 2BDCA 1F0SA 1BTXA 1UTKA 1SI5H 1FN8A 4GLYA 1AKSA 3PWCA 1PPBH 1AIXH 2BD3A 1OXGA 1CA0C 2PTNA 3SHCH 3RXFA 3O8DA 4DVAU 2J92A 4FUGA 1SLXB 1EPTB 1D3DB 1BRBE 2BDGA 1Q3XA 1MTVA 1ZHPA 1K1IA 1SGDE 3P95A 5ABWA 2UUYA 1TMTH 1DM4B 3SBKA 2Z9LA 5HIZA 4DG4A 1ETRH 2FYRA 4Y7AA 3UPEA 2SGFE 2DE9A 2EA3A 3SOSA 2F4LA 4X8SH 1HB0B 3A88A 2CMYA 2OBOA 5DP5A 2F9BH 3FN8A 3BTWE 1OWHA 1QTFA 1ESBA 2OP9A 1FMGA 1U6QA 2ZTYA 4CBOA 2GZ8A 1XMNB 1YCPH 3SUDA 2LELA 2ZTXA 1GBMA 2H9TH 1Y5AT 4I7YH 3M37A 2L6OA 3ATLA 2ILNA 1GGDC 2PLXA 1O35A 1QQUA 1TX7A 4B2BA 1OWKA 3TGJE 4X6PA 1Z1JA 4ZXYH 2NWNA 1SOZA 8ESTE 4F4OC 2HGTH 5C1YA 4BTUB 3RXTA 2Y5FA 4IC5A 2A4RA 3Q3KA 2JKHA 1GBIA 1C5MD 1FONA 2IN2A 4AN7A 4Z6AH 1ZRBA 3UREA 3NPSA 4MPWA 5L6NH 2GV7A 1P2JA 3U8TH 3FFGA 1N8OC 3G01A 3BTDE 2OUAA 4FUEA 4XBBA 1NM6A 1IHSH 1YPMH 3Q3YA 4IBLH 4I8KA 1H4WA 1QZ8A 4I8GA 3JZ2B 4RI0A 1G3EA 1EUFA 2ALPA 5DKMA 4KTCA 3LH1A 3VXEH 6CHAC 3TJOA 1NRSH 1P3EA 5E0HA 1O3NA 3HGNA 1HIAB 4OS7A 1ETSH 4FETA 6GCHF 2VIDA 3LJJA 1HAVB 1P04A 1RTKA 4DIIH 3B8JA 2WPKS 3VPKA 2BX3A 1Z8JB 1RTLA 2SNVA 4A6LA 3F0PA 3HK3B 2FOFA 4X6OA 3A84A 1BBRH 3RXHA 1E35B 4U2WA 5F8ZA 1CBWC 2YMSC 4AB9A 1GBJA 1AMHA 1FZZA 2QA9E 1CT4E 2P8OC 2OBQA 2QF3A 5FBIA 2I6SA 1A3EH 3M7QA 1X7AC 2ZFTA 3ATMA 3IG6B 5IK2D 1W0KD 4XSKU 4IN2A 1MTNB 2OQUA 2J98A 4BTTB 3VEQB 5A09A 2TBSA 4GPGA 1NFUA 2QAAA 2PTCE 1MKXK 1MKWK 1EATA 1CQQA 1EAIA 2I6QA 2V35A 1C1OA 4AC9A 3BF6H 1D4PB 5EW1H 1KDQA 5C1XA 1C1TA 1DVAH 3U69H 1UJ1A 2Y7ZA 1Z6JH 2Z9KA 1GJ7B 1FY8E 1VR1H 1G32B 2JETB 5DGJA 4ZXXH 2BVXH 3RXAA 4D7FA 4ZAEA 2RG3A 2R3YA 5A2MH 1EASA 3A7WA 2VWMA 4LK4A 5CDFE 3PTNA 5EU8A 4DJZB 1GI6A 1E37B 3HGPA 3A7ZA 2PW8H 5CHBA 1T8MA 3A8DA 4UFFH 2A2XH 1HAGE 5DG6A 3VB5A 2FOGA 1OP0A 3PV4A 3QZQA 4X0WU 4AYYB 1AQ7A 3BG4B 1EJNA 4RKOB 4AFQA 2ANKH 3PLKA 3RXLA 3T27A 4YO9A 3D49H 4I32A 3GY8A 3QO6A 3UR9A 1O2LA 5E8EH 3VGCC 4IGDA 1KTSB 5GNDA 1BTZA 3K6YA 3P92A 1L1JA 3LGTA 2ZKSA 4ABDA 5LPFA 3OY6U 2ZCLP 5C3NA 4I86A 4WH8A 1A0LA 2AS9A 4WXIA 3H09A 1GI4A 1KLTA 1KXCA 2JH5D 3BTEE 3SUEA 2NU4E 3TH2H 4ABAA 1UVPA 3GCHC 5DN6D 3A82A 3K6ZA 2R9PA 4OGYA 3WW7A 5J4SA 5FCRA 1ELCA 1GHZA 2IPHA 5BRRE 3PLPA 1DS2E 2FS8A 4WMDA 3LT3A 2W7SA 3ATWA 5I46H 1IOEA 1WSSH 1AHTH 1JBUH 5HMAA 3ZZDA 2FI5E 1NY22 1G3CA 1P9SA 1UMAH 1W13U 2ALVA 2ZEBA 4BAOB 3UQOA 3OU0A 1P8VC 4FU8A 4KKDA 2G8TA 1AWHB 2KX4A 1SLUB 1O3BA 2C8ZB 1UVOA 1ZPCA 4Y10E 5A8ZA 2BVRH 3N7OA 1PPEE 1Z8IB 1MU6B 2Z9GA 1LQEA 4INKA 3GY7A 3M61U 2SGEE 4LZ1H 2R2WU 3OTJE 1DSUA 2BB4A 4Y11E 1T8OA 3RM2H 3RU4D 2ULLA 1GI8B 3U9AH 4AORA 2TGPZ 1BMLA 1GWAA 1RIWB 1P10A 4CRBA 1O3DA 4QT8C 3FP6E 3VG8A 2BMGB 3BEUA 1GVLA 2IOTA 3ZVFA 4WH6A 1PFXC 2H6MA 1AN1E 4MQAA 1RTFB 1V2RT 1XXDA 2PKSB 7GCHG 1O5AB 4H42U 4Y0YE 2GD4B 3MH7A 2WYGA 1ZPZA 1LO6A 1QRXA 1O33A 2FTMA 2ZU3A 3TNSA 4AFSA 1SPJA 1K1OA 4KELA 3QK1A 2G51A 3CP7A 1WTHD 5TCAA 1IQNA 1HJ9A 3PMJA 1O5CB 1ID5H 1BB0B 2M5TA 4JCNA 4ASHA 3K2UA 3MI4A 1DUAA 3T26A 3L33A 2QF4A 4B74A 3ZVDA 7ESTE 4K8BA 1DFPA 1NRPH 1HAIH 2BD8A 2P95A 3SORA 3GYLB 4NA7A 5L2YH 4RT1A 3UOPA 2SFAA 3BTTE 1Z8GA 3SV7A 4AB8A 4ABHA 5TJXA 4YOJA 4ABBA 3F0OA 1THRH 1TGCA 5T3HA 1O2PA 1IHTH 1A0JA 2PKAA 3ATKA 3QZRA 4JK5A 4E05H 2A4OA 4XOJA 4NWKA 1FNIA 1SGTA 3O8CA 5T6FA 3A89A 2F9UA 2WZQA 2BDYA 2DUCA 2G81E 1XXFA 4KP0A 1C1UH 1THSH 1FJSA 4TWYA 3WWFA 3PO1C 2HNTE 2FYQA 3FVFB 3OTPA 5J4QA 4B2CA 1DXPA 3R0FA 3UAIC 1BRUP 4XBDA 2XCNA 3TJVA 1F5KU 2J4IA 1BHXB 1C5YB 2GX4A 3V3MA 4U32A 4JYTA 3SV9A 1DDJA 2EI6A 1AZZA 1IQHA 4GUXA 3AW1A 3ESTA 2A5IA 3EYDA 2PUQH 1WBGB 2V6NA 2BY6X 4MTBA 1JIRA 1GBTA 1TFXA 1O3OA 1XVOA 3BEIB 1HLTH 2F9PA 4FUFA 2Z9JA 1PQ5A 1WXRA 1WAYB 2PHBA 1LDTT 2Q1JA 4WF8A 5K7RA 4IMQA 2PWXA 1LMWB 1GHWH 3SNEA 3PROA 1S0RA 1A61H 2A5AA 1K22H 1C4U2 1O5GH 2ZPQA 1GPZA 3KHVA 1MZDA 3DHKH 1W0ZU 1VCWA 3BG8A 4WWYA 3C1KA 1ORFA 1HXEH 1EZSC 1WOFA 4ZHAA 1ZJDA 1ELDE 8KME2 4SGAE 1AI8H 1IQMA 1C1RA 3VXFH 5E2PA 3ZZ5A 3BN9A 1HDTH 1AFQB 5JBBS 1HAZB 1JRSA 2OK5A 1UO6A 1WU1A 2HNTF 1ZLRA 1WUNH 1COWD 5KECA 3LIWA 3T5FH 3OEHD 1NC6A 1C5QA 1W10U 4K1EA 5FL7D 1ZSJA 2D8WA 1DITH 2THFB 1BMFD 4CRCA 5GCHF 4HFPB 2AHME 4UFEH 1Y3VA 3RXVA 5AF9H 2C90B 5HIYA 2HOBA 5JB9S 4Y7BA 4OS1A 1P11E 2VU8E 4NIXA 1B0FA 1QRZA 1UTJA 1F0RA 2F43B 2XBWA 3SU1A 5DSFA 1TQ7B 1DOJA 5AHGH 1FAXA 3MU5A 2ZHDA 3V12A 3IITA 3ITIA 3ZZ8A 3M5NA 1QB1A 2V3MA 3TIUA 2JIZD 3NZIA 4DY7B 1ACBE 1F5RA 2YNAA 1Y3UA 3F2GA 3MU1A 2KAIA 1LPKB 4K1SA 1BRAA 4B73A 2ASUB 2VVVA 1O2VA 2VGCC 2XWBI 6LPRA 3LGUA 2G5NA 5IYTA 2VWLA 1E36B 1LVBA 1EX3A 1P2IA 5DJ7A 1HAYB 2GCHF 4X8TH 3TK5A 3PV2A 4D8NA 2HPPH 1TA6A 5DP7A 2J9NA 2FX4A 3LU9B 3ATIA 1HAXB 3F9EA 5F8XA 2J94A 4K60A 3MNXA 4XD7D 4BNRA 2ZDKA 2YNBA 2ODQA 1KXDA 1S84A 1O3PB 1MD7A 2WPIS 3U98H 5FPYA 1O2IA 1G3DA 4H6SB 1AU8A 1GL0E 1EP5A 1YPHE 2WPJS 5F8TA 3T62A 2BXTH 1GDQA 4WVPE 1ABJH 1EZXC 3EA8A 1H8ED 1HPGA 1V2UT 2BY7X 2JH0D 2ZGJA 4MNVA 1P03A 2XC0A 1VGCC 1RXPA 1AB9B 1ELFA 3D65E 3M36A 2FESH 5HGGA 3NRLA 1B5GH 1V2PT 5EXMA 1HFDA 3K65B 4YZUA 2QXJA 4ZKSU 3P8GA 3A86A 1O3GA 1MTWA 4D9QA 5FPTA 1N1LA 1MAYA 3TNTA 2EC9H 2Q6FA 4GVUA 2VJ1A 1BJVA 4YLQH 4GAWA 3TGKE 2O8MA 2ZPRA 1BCUH 1CA8B 5C1UA 1QBNA 4DURA 1NFYA 1GG6C 1K1LA 2ANMH 1MBQA 3AW0A 3SU3A 3LGIA 5B6LA 1SLVB 3AK5A 1V6DA 4YT7H 2H2ZA 2GCTC 4NG9H 1TRMA 3A8AA 4DW2U 2HLDD 4ISIH 3T2NA 1TAWA 2KFWA 1DWEH 3RMMH 5JDUB 2A45B 4ZMAH 2TPIZ 1P9UA 1RJXB 5GWZA 1BQYA 1GMCG 1WQSA 1V2TT 2AGGX 1QY6A 1MCTA 4CBNA 5C5NA 4THNH 2DE8A 2B8OH 1XUIA 8LPRA 1TX8A 1DICA 1UTPA 5CHAC 4ABGA 2ZTZA 4XDEA 1SGRE 1PQAA 2ZU1A 1AUJA 1C2IA 4BAHB 1L1GA 2W6JD 1W0YH 2RDEA 1W0JD 1O2GH 1VZQH 3I78A 2BLQA 3BEFB 4MNWA 2ZDMA 1C1WH 1IQJA 3UNRA 4AFUA 1YLNA 3M5OA 1ESAA 2FMJA 2ZU5A 1YM0A 3RXOA 1GI0A 1VITG 1QL8A 2J98B 2WV9A 1P57B 1XKAC 1DY9A 3BTFE 3BTKE 1GMDG 1O3HA 2R0LA 4B1TA 1TNKA 1DWCH 3P8FA 1P12E 3O8RA 5ESBA 1QJ6B 1KDQB 3D62A 1QBVH 1QR3E 2BD7A 1SL3A 1SHYA 2G00A 3H7OA 4VGCC 1SBWA 3BTQE 3TK9A 1GJ6A 4AGKA 1GBHA 3OAAD 1H8IH 1G9IE 1JIMA 1QIXB 1ZMJA 2ESTE 3P8OA 3QUMP 4TY6A 4A92A 1C5WB 1LQDB 2PSYA 4ISHH 5DK1A 2XW9A 3SV6A 5EPNA 4NA9H 4CR9A 1JRTA 1C5UA 1GJDB 1XVMA 1IQIA 2OCVB 2W26A 3SU4A 1QB9A 1WV7H 1EJAA 4BXWA 3AAUA 3MH4A 1MH0A 3E16B 2ZFFH 1TBQH 1G2MA 3RLWH 5HYOA 1BBRE 5A0BA 4WMFA 2CHAC 2GZ7A 1H9LB 5L30H 3BIUH 2BXUH 1C1SA 4Y8YA 1ABIH 3ZZ6A 3SHAH 3SJ9A 2GKVE 1TGBA 1TNIA 1ZHRA 3BG4C 4ISNA 1T31A 5EJLA 1BTWA 1G30B 1DE7H 3DD2H 1FQ3A 1EOJA 4IN1A 4CHAC 1QB6A 4JMYA 2C4FH 1LVOA 1RD3B 1KTTB 2ZECA 5JBAS 2Z6BD 3URCA 2AH4X 4U30A 1BDAA 4CH2B 1HJAB 3FZZA 8GCHF 4ZHMU 2K1QA 1M9UA 4GCHF 3MO3A 3DSGA 5JB8S 1WTGH 2KR7A 1TNLA 4HGCA 1MCVA 1V2MT 1V2KT 2CF9H 2H9EH 1CA0B 3SU2A 2BY9X 3V7TA 2QXGA 2BQWB 1G37A 5KEDA 1QRWA 1PQ8A 2D26C 1JXPA 1E1RD 1S81A 1FXYA 2G4TA 1BT7A 2P93A 3T25A 2VH0A 1CSOE 1SGQE 4BXSA 2XCFA 3HKJB 4YLUA 1T32A 3RXRA 3PMAB 4O3TA 2TRMA 4RN6A 2AIPA 1GJCB 1GMCF 1KXAA 1OSSA 4K5ZA 3ZYDA 5C0TA 2FPZA 4X6MA 1EPTA 1BMAA 3MTYA 3GICB 2FOHA 1VITH 3MYWA 3HATH 3A87A 3E8LA 3A85A 3ZVCA 4DCDA 2XTTB 3TGIE 4TPIZ 3GY3A 4BOHA 1AE5A 4IW4E 3OSYA 4X1SU 4K8YA 4NGAH 4NFFA 3SW2B 5F6MA 3AVZA 2OC8A 2VIOA 1A7SA 4FUHA 5C17A 1UCYK 5SGAE 2C93B 1GGDB 1L0ZA 2XBXA 2Y6TA 5DP9A 2FP7B 2WPMS 2BD4A 4JZ1A 5EG4A 3DSOA 3FAOA 1AO5A 3LONA 4TPYA 1D6WA 1MQ6A 1V2QT 1O3EA 2P94A 1INCA 1THPB 1XKBC 1ZMLA 4AG2A 1FY4A 4E7NA 1A5IA 1FAKH 4X2YA 4X2VA 2ZU2A 2XNDD 2XWAA 4J2YB 1AUTC 4Y76A 2PV9B 3GCNA 1N8OB 2W3KA 1LHCH 1OWDA 3ZVBA 1A5HA 5GPIB 5C67A 3M5LA 1C5PA 2WV5A 1HAHH 1JMOH 2GVFA 3SJIA 1GI7B 1P2MA 2FTLE 1AD8H 2VINA 1V2ST 6CHAB 3QN7A 1S6LA 1IQGA 3GY6A 7LPRA 2P3TB 1GI5A 1TLDA 1DX5M 4X6NA 4P02A 3UIRA 4AFZA 2Z3DA 4B75A 1KYNA 3HPTB 2J95A 1YPLH 1O2TA 4NIWA 1CHOG 4UEHH 1E34B 1UTMA 2L74A 4JZEH 4MNYA 1VCPA 2WHXA 2QXHA 2ZFQH 5DPAA 1GBEA 2BLOA 1C1VH 1EP6A 3LC5A 1GBDA 4NZQA 1GHBG 2H5DA 4SGBE 3LDXH 3F6UH 1P2OA 2QV1A 4TY7A 1BA8B 3FP8E 1LVYA 1YF4A 2ODPA 5ETXA 3CS0A 1WDIA 3E0NB 1HAVA 2Y80A 1CBWB 2YMSB 1E1QD 1SGEE 2PKAB 3KQDA 5LGOA 1DWDH 1O39A 1KLIH 2P8OB 1TYNA 1Z7KA 1QQ4A 2CN0H 1H8DH 1V2NT 1V2WT 1O2ZA 3DCLA 1QL9A 4NA8A 2ZHEH 3VB7A 4ZCNA 3BSQA 5H4IB 3RMNH 6ESTA 1YC0A 4X8VH 1F5LA 2EY4C 1IQEA 1HBTH 2SGDE 4YXWD 3LC3A 3SUFA 3UB0A 3BV9B 1PPCE 1AE8H 1ZTLA 1GBBA 2Z94A 3NKKA 2A4GA 5TCCA 3OYPA 3ZZ7A 3T29A 1UHBB 5A0AE 1SG8B 1DANH 1XX9A 4FVBA 5FAHA 2C8WB 1J9CH 1NFWA 1TGSZ 4X2XA 5FHTA 2GT8A 4WMEA 1NBMD 4Y8XA 2IJD1 3EA9A 3ZVGA 4A1VA 1EKBB 2R0KA 4MPUA 3SJKA 4DIHH 1O5EH 2VWOA 2C3SA 4E06H 3SQEE 2G4UA 3SGQE 4Q7XA 1V2VT 3QTOH 3EDXB 3TVJB 3UFAA 4MG3A 1QA7A 3SUGA 3VGCB 4CRFA 3B23B 2AERH 2PUXB 5T6DA 4UD9H 4R0IA 3Q77A 4UFGH 2YMSD 2H9HA 2UUKB 1MBMA 3E90B 1Z1IA 2ZIQH 3GCHB 1B0EA 2QYIA 1QL7A 1AFQC 3S0NA 4IC6A 2BDBA 3TK6A 3BTME 1T7CA 2WV4A 5E2OA 4KTSA 1E79D 1XUHA 4GHTA 3SYJA 1UK3A 4O3UA 3MO9A 4Y8ZA 1H9IE 3UQVA 1E0FD 1L1NA 1UTOA 2Z3EA 2W3IA 1YKTA 2VH6A 1O2NA 1T8LA 1TPPA 2ZC9H 4BAKB 4FUBA 1TNJA 4INLA 4Q7YA 1JWTA 2EI7A 2IJOB 1G36A 3MO6A 4YOIA 4I8HA 3SV8A 1ZHMA 2ANYA 2BQ7B 2V3OH 2ZFSA 3GY2A 5EIYA 3GCTG 2HALA 3EAJA 4TT3D 4DT7B 1DUEA 1EOLA 1GJBB 2XC4A 1N6XA 3NK8A 1D3TB 1WCZA 1DY8A 2AFQB 2ZGXH 1LHGH 1ZRKA 1V2LT 3LH3A 3GCOA 1SOTA 2FLBH 2FOAA 3NXPA 5JBTA 1YCPM 3MNCA 2OINA 4O9VA 1LVMA 1YPKH 2FM2A 1TBRH 1GI3A 5C2ZA 1PYTC 3KN2A 5GDSH 1LPGB 3SI4H 3ZV9A 3MNBA 1O37A 2AEIH 5EQSA 3QWCH 1P2NA 1YWUA 1SGCA 1GCTB 2BVSH 1XUKA 4FUIA 1ZTJA 3PV5A 2JJ1D 3MHWU 3F3BA 5F53A 2TIOA 1SKYE 4MVNA 2FS9A 3H7TA 2F9VA 5EQQA 1QFKH 4Z0KA 3KYFA 1KLJH 5EPYA 5T6GA 5C5OA 7KMEH 1GI1A 1OWJA 1CU1A 2FODA 1OWIA 3KQ5A 1FY3A 4MDSA 3U8RH 4O97A 1QA0A 2ZQ2A 3SQHE 2LP6A 2XNIA 1ANEA 4WJG2 1S6HA 1ZMNA 1HGTH 4ABIA 3V0XA 1ANCA 3VB6A 2AMQA 2XC5A 2GMTC 1L4ZA 1ZGVA 5ESTE 1F92A 3W95A 4ZHLU 2BOHB 1KXFA 1LKBA 3RMOH 2TGTA 3SV2H 1ELVA 1SGFG 1L2EA 3S69A 1EJMA 1Y3YA 2GDDA 3TITA 7GCHF 1TNGA 3EE0B 1ZOMA 4YT6H 1XUFA 3U1JB 1VJ9U 4FUCA 5AFZH 1O36A 4X2WA 1NO9H 2UWPA 1S82A 2HNTC 3ODDA 3PYHA 5HM9A 3KF2A 1NFXA 1C2FA 2BLVA 1S0QA 1GMHG 1UK4A 1O2RA 1ANBA 2CXVA 2BOKA 3SO3A 4I33A 1Y59T 1UVSH 5C94A 1EAWA 3ZZAA 1AKSB 3B9FH 5GIBA 3MOCA 2V0BA 2PR3A 1OX1A 2A1DB 1YLDA 2BD5A 3TLOA 1S5SA 2XBVA 4ACAA 3LJOA 3E1XB 1RGQA 4CH8B 3MMGA 2KZ4A 5G4BA 4A1XA 1NESE 1UVTH 3PO1B 3BIVH 2J2UA 3PMBB 4Q63A 1TPAE 2OLGA 3TH3H 1LCYA 1A1RA 1QCPA 1V2JT 3EQ0H 2ZDLA 3ZZBA 1EPTC 2O8TA 3F68H 1AVGH 2GDEH 3I77A 3P70B 3RC5A 2ZG0H 1C2LA 2K8IA 4PROA 3S7KB 2KCOA 3H5CB 2D1JA 4GSOA 2BY5X 1OYQA 3F9GA 1AWFH 1OKXA 1O5FH 4INHA 1C2EA 4M9FA 2LNCA 1GJAB 1LHEH 2ZGBH 1ZR0A 3LKWA 1K21H 5DP4A 1P0SH 2QF0A 1DPOA 3SGBE 1WYKA 2FOEA 3ZZ9A 2CJIA 3BTHE 1NRNH 4NFEA 4I8JA 3S7HB 2BY8X 1C5SA 2TGAA 5A0CA 4K69A 3SNCA 3DSPA 1EQ9A 1ELEE 2J5UA 1CGJE 1MD8A 2GT7A 3WY8A 1LKAA 1NTPA 3RXUA 2ODYB 6GCHG 2A7HA 4YOGA 3DT0H 2EI8A 1DT2A 1Q2WA 2Q6DA 3OEED 2LPRA 4WY3A 2HLCA 3RXKA 2QXIA 1C9PA 1QNJA 1TBZH 1SFQB 2BDAA 5AVDA 2O8LA 1UVUH 4ZKRU 5DP6A 3RXQA 2B9LA 2FI4E 3SI3H 2D2DA 4FUJA 4NWLA 2FZZA 3RXIA 4K2YA 2WPLS 2NU2E 1HYLA 3KL6A 2AMDA 2VWNA 1J15A 1DXWA 2ZNKH 4RKJB 3KQEA 2AGIX 3U8OH 2FWWA 2A32A 2VIQA 4IS5A 1TALA 2VIVA 1YGCH 3SU6A 1C5VA 3RU4E 1TE0A 1O2MA 3AAVA 1MKXH 1EXFA 1MKWH 4CRDA 3QLPH 1IQLA 3F2FA 1BTHH 4O03A 2PSXA 1J14A 1O3IA 4RSPA 1C2HA 2A7CA 1NS3A 3F2HA 4JYUH 5HXFA 1FUJA 3URDA 4RT0A 1F0TA 2AYWA 1GHVH 1P09A 2XYAA 4TSFD 3HK6B 4JZIA 4ZUHA 3TU7H 2GV6A 3ZZ3A 4GHQA 2B7DH 2PGBB 5EODA 1UCYH 1HV7A 4H6TA 1YPHC 5C20A 1C2GA 2Y7XA 1TA2A 3GDVA 1GBLA 3U28C 1NBME 2VGCB 1G3BA 1FN6A 2WUBA 2ZCHP 2ZGHA 3P17H 1SHHB 2Y5HA 1TONA 1GHAG 1P2KA 4AYVB 2ZDNA 1GMHF 1C1MA 1MU8B 3UOUA 1O2YA 1MTNC 1F2SE 2PFEA 3GS9A 1GBAA 4WXVA 4ASUD 3HKIB 1FIZA 5EJZA 5I25A 3RXGA 1NT1A 4Q7ZA 1VGCB 2WPDD 4NSYA 5HKKD 2ANWA 1C5NH 1H8HD 3GY5A 1CT0E 2WPHS 5FCKA 3K9XB 1O5DH 4F48B 2JETC 5K0HA 3MH5A 4X1NU 1SQTA 2ZZUH 4HI3A 4IMZA 3RXBA 3F1SB 3F9FA 4Y71A 4XE4A 3ZZCA 1HNEE 3SNDA 1E38B 1GJ8B 1NU7B 3KQCA 2RCEA 3Q3XA 2UWOA 1W7XH 3ELAH 2A0QB 1GG6B 1UW7A 2F91A 3Q00A 3GY4A 4MLFB 1K1MA 2GCTB 3ZVEA 1SGPE 1Z6EA 1FX0B 2GTBA 3DFLA 1YYY1 4Y0ZE 2BZAA 1F7ZA 2ZDAH 1WQVH 2AGEX 1RRKA 3RUOA 2FIRH 2WINI 2RA0A 4BTIB 3LGYA 4YTAA 1DLKB 1W12U 1CE5A 5A8YA 4OS4A 3N7EA 5E0GA 1ZSKA 1IAUA 5GJ4B 1DLEA 3A83A 3O8BA 1AGJA 1ZGIA 4FVDA 1ARCA 2EEKA 5A8XA 1O2UA 5CHAB 1CT2E 5LPRA 4UFDH 1CO7E 1QBOA 3ZYEA 4HTCH 1MTSA 4MPVA 1K28D 1W2KH 2GZ9A 2O9QA 1TMBH 1UK2A 1FY5A 5DP3A 1SGNE 3FP7E 5EGMA 2OXSA 1YPGH 3KGPA 4Z1MD 5KGOA 1T4VH 3F9HA 3RXCA 1O2SA 2A7JA 2ZA5A 1KXEA 3C27B 2VIPA 1A0HB 1VCQA 4OM9A 3KNXA 4KTUA 2FO9A 2GP9B 5T1VA 4YM9A 1HUTH 1Y5BT 3WWBA 1D3PB 4UONA 1LPZB 3M7TA 4X8UH 3V13A 2CGAA 1QURH 2QC2A 3OY5U 3GISB 1GI2A 3A8BA 3GDUA 2R3UA 1SR5C 2BD9A 2ZPSA 3ZV8A 4A1TA 3MFJA 3S9BA 3RXPA 1ZTKA 4M7GA 4AZ2B 5EXLA 1O34A 1S6FA 1GJ5H 4FU9A 2RFKC 1FPCH 1T4UH 1UTQA 4VGCB 1CHGA 1YY3A 1Y3WA 2XRCA 1OP8A 3KIDU 1O3JA 4FOUC 2R2MB 1QJ1B 1SFIA 2KCAA 1GDNA 3E0PB 2HVXA 1MMJN 2O8WA 1RFNA 2STAE 2FX6A 1EZQA 1Y8TA 1TNHA 1RIWC 1S83A 5JPMH 4ISOA 3TH4H 1K0HA 1TRNA 1OYTH 1VITF 1MABB 4B6EA 2C8YB 1T8NA 2KCPA 2W6ID 1DWBH 1GMDF 1YPJH 3PRBA 1MQ5A 1OPHB 1NRRH 1GHAF 2G52A 4KGAA 1C5XB 2PKSC 2WYJA 4Y6DA 1LHDH 2BTCE 1EAUA 4FU7A 2WSSD 3RM0H 1K1NA 1C5OH 1XM1A 2CHAB 2Z7FE 4JYVH 3M3SA 5EW2H 2SNWA 3CENA 1BTYA 1RS0A 1O3CA 1YCPK 4K3JA 4NCYA 4J1YA 3L3TA 4OS2A 3RXEA 1PQ7A 3I29A 1P06A 4NSVA 4CHAB 1TRYA 3W1EA 4OS6A 2GGVB 2F9NA 4DT4A 1HIAA 2QE7D 1FY1A 1C1QA 2FOMB 3LOXA 5CE1A 4AOQA 5EOKA 1OOKB 2M2AA 3MH6A 3TJNA 1SC8U 4BANB 3RDZA 1EAXA 4NZLA 2J97A 1NRQH 1H9HE 3STIA 3RXJA 1TX6A 1O3AA 4CREA 1UTLM 1O2JA 1J16A 3R3GB 5LPEA 4DGJA 1FI8A 5E0JA 4TYDA 2Q6GA 1O3FA 2QY0B 1VKYA 1PJPA 3E3TA 3N99A 2SGQE 4HZHA 4XBCA 2HPQH 1AVWA 3SN8A 1O2WA 3QGJA 4AGJA 1GDUA 1C1PA 3QTVH 3UNQA 2PP6A 1TGTA 1O5BB 5B6OA 1A4WH 3PTBA 1C2KA 2RA3A 1O32A 1BZXE 3KQBA 1GBCA 1O2QA 1SGFA 3CNRA 3E91A 1ZYOA 1BHXF 2ZWLH 4X1PU 1PPZA 1CGIE 2F9OA
chains in the Genus database with same CATH topology
3GYMA 9LPRA 1HAPH 2SGPE 2VB0A 3MU0A 2A31A 1TIOA 3E6PH 2FDAA 1GVKB 1NU9A 1O0DH 4BAMB 1MTUA 4LZ4B 3A81A 4B71A 1BBRK 2J38A 4E7RG 1O2OA 2W5EA 1Y3XA 4A5TS 3ODFA 4JK6A 1KSNA 2NU1E 4CRGA 1GJ9B 3T28A 3LGVA 2A5KA 1SQAA 3TPIZ 5DO4H 2YOLA 1GCDA 1C4Y2 2ZF0H 3A80A 1C4V2 2BD2A 1GHYH 3KEEA 1GCTC 1KIGH 2VVUA 1O2KA 2OD3B 1ZPBA 3S9AA 4BAQB 1AY6H 2F3CE 2G55A 2OC1A 1O38A 5GCHG 1G2LA 3VFEA 4A7IB 2OC0A 4UE7H 3SU5A 9ESTA 3M3VA 4TWWA 1BIOA 2H5CA 3D23A 1ELGA 1BJUA 5EQRA 1P05A 1ETTH 1K9OE 4MNXA 3FANA 4U01A 1EZUC 3PWBA 1HXFH 1J8AA 1O3KA 1Y5UT 4H4FA 2P59A 5F03A 1OS8A 2ZHWH 3UR6A 1FIWA 4XFQA 1A3BH 3NWUA 2FI3E 1KY9A 3NCLA 1QJ7B 4ABFA 1SSXA 2ZQ1A 1TGNA 2A4QA 2Y81A 3EA7A 3L6PA 4ISLA 2OTVA 5IDKA 5JYIA 3M5MA 1ESTA 1D6RA 2BM2A 2ZGCA 1HJ8A 2GCHG 5LH8A 5GXPA 1C5RA 4NIYA 3A7TA 1GHXH 2F83A 4ZKNU 2ZFRH 2ZO3H 3PMHB 4Y79A 5FXLA 2ZHFH 3RXDA 3ZZ4A 3EGKH 2ZI2H 3RMLH 3ENSB 2BDHA 1Q31A 2C8XB 4ZH8A 2CV3A 2KAIB 4R8TB 3S9CA 1CHOF 1TOCB 1TABE 4Q2KA 1FDPA 1TPSA 1C2MA 1Z71A 2P16A 1GHBF 2P3FH 2A2QH 2HRVA 2BLWA 1YP9A 1C9TA 4F49A 3A8CA 2J34A 1OWEA 2OQ5A 2RDLA 2Z9IA 3P8NA 1QGFA 1TB6H 1ZJKA 1HRTH 1K1JA 1CGHA 1J17T 1NZQH 4D7GA 1UTNA 1ANDA 3U1IB 3VB3A 5CMXH 4D76A 2STBE 1BITA 1A2CH 1W11U 1W3CA 1SLWB 3QX5H 2TGDA 1NN6A 2UUFB 2B5TB 1W7GH 1GBKA 1XUGA 3M35A 1O2XA 4D9RA 3PM3A 2XXLA 1TWXB 3STJA 1UHBA 2O8UA 3ZVAA 5DP8A 1O31A 5PTPA 1AFEH 1O30A 4X1QU 1Z8RA 3M3TA 3MNSA 4I8LA 1YPEH 5L2ZH 1ELTA 2QIQA 1AB9C 3DA9B 2VNTA 1A46H 3A7XA 1P01A 1SQOA 1N6YA 4ABJA 3NUMA 1GBFA 2CF8H 4LXBH 4Q80A 1MZAA 1DSTA 1FV9A 5BPEA 3W94A 1PPFE 1GVZA 1FLEE 1QHRB 1EB2A 1K1PA 2FOCA 5HM2A 1BMMH 2NU0E 1HAOH 1SVPA 1XUJA 1O2HA 1A5GH 1P02A 2WUCA 1S85A 1BUIA 2FLRH 3VB4A 2BDIA 4ESTE 3RXSA 1O3LA 1BMNH 4B2AA 1EB1H 3A7YA 4OGXA 5FPSA 1GJ4H 3MU4A 3SNBA 2NU3E 1NPMA 4JZFH 3SJ8A 3RP2A 2FEQH 1CVWH 2V3HH 3LGWA 3SJOA 3UUZA 1B7XB 2VIWA 1C1NA 2B0FA 2ZCKP 3QGNB 1C5TA 1MUEB 2SGAA 3M7UA 1BTUA 3RXMA 4JZDH 1TOMH 1H1BA 3KCGH 4FXGH 2BQ6B 1MAXA 3DFJA 3BTGE 2BYAX 3UNSA 3GDSA 1IQKA 1P3CA 1V2OT 1W14U 5EXNA 2FOBA 2Z3CA 1O3MA 3UY9A 1ELAA 4CRAA 2W7UA 1LTOA 2ZDVH 4LOYH 1NROH 1KXBA 2H1UA 1FPHH 3QDZB 2VVCA 4NIVA 2BZ6H 1YBWA 1P2QA 2UUJB 2QCYA 3LPRA 4AX9H 1SGIB 1ZZZA 3RLYH 1GI9B 1C2JA 3MWIU 1TPOA 3PLBA 2HWLB 1SB1H 3MU8A 2XBYA 1K2I1 2FXRA 4AG1A 1IQFA 1BTPA 4B76A 2QN5T 3RC4A 2BHGA 4YESB 2ZHQH 1F0UA 2QGRA 3OX7U 4CR5A 2G5VA 1AVXA 3RC6A 5FX6A 1HCGA 1C5ZB 3UTUH 5FX5A 3SGAE 1ARBA 3GCTF 4ABEA 1YLCA 1ELBA 4FUDA 1PPHE 2ZU4A 2BX4A 4I31A 1LHFH 3AASA 3PB1E 1OP2A 3DUXH 5AFYH 2Y82A 1W8BH 3A7VA 1GL1A 4MPXA 4ZKOU 1PPGE 3RU4T 4UDWH 3Q76A 2GMTB 1TQ0B 3GOVB 1AZ8A 1D3QB 2JH6D 8GCHG 3TJUA 1UCYE 2AIQA 1L4DA 4GCHG 1JOUB 3UWJH 4ZROA 3SZNA 5JBCS 3SNAA 2UWLA 2PGQB 1C5LH 1BRCE 2Y5GA 4DOQA 2OC7A 1TMUH 3UWIA 1BOQA 3P6ZB 4K1TA 3SU0A 3FZDA 1SGYE 2AMPA 2ZFPH 4X1RU 3IWMA 1C2DA 5FBEA 1ZSLA 2P3UB 2ZP0H 4OS5A 1V3XA 1VJAU 3JZ1B 1SMFE 1D9IA 1HJAC 3CS7A 1PYTD 2BDCA 1F0SA 1BTXA 1UTKA 1SI5H 1FN8A 4GLYA 1AKSA 3PWCA 1PPBH 1AIXH 2BD3A 1OXGA 1CA0C 2PTNA 3SHCH 3RXFA 3O8DA 4DVAU 2J92A 4FUGA 1SLXB 1EPTB 1D3DB 1BRBE 2BDGA 1Q3XA 1MTVA 1ZHPA 1K1IA 1SGDE 3P95A 5ABWA 2UUYA 1TMTH 1DM4B 3SBKA 2Z9LA 4DG4A 1ETRH 2FYRA 4Y7AA 3UPEA 2SGFE 2DE9A 2EA3A 3SOSA 4X8SH 1HB0B 3A88A 2CMYA 2OBOA 5DP5A 2F9BH 3BTWE 1OWHA 1QTFA 1ESBA 2OP9A 1FMGA 1U6QA 2ZTYA 4CBOA 2GZ8A 1XMNB 1YCPH 3SUDA 2ZTXA 1GBMA 2H9TH 1Y5AT 4I7YH 3M37A 3ATLA 2ILNA 1GGDC 2PLXA 1O35A 1QQUA 1TX7A 4B2BA 1OWKA 3TGJE 4X6PA 1Z1JA 4ZXYH 2NWNA 1SOZA 8ESTE 4F4OC 2HGTH 5C1YA 4BTUB 3RXTA 2Y5FA 4IC5A 2A4RA 3Q3KA 2JKHA 1GBIA 1C5MD 1FONA 2IN2A 4AN7A 4Z6AH 1ZRBA 3UREA 3NPSA 4MPWA 5L6NH 2GV7A 1P2JA 3U8TH 3FFGA 1N8OC 3G01A 3BTDE 2OUAA 4FUEA 4XBBA 1NM6A 1IHSH 1YPMH 3Q3YA 4IBLH 4I8KA 1H4WA 4I8GA 3JZ2B 1G3EA 1EUFA 2ALPA 5DKMA 4KTCA 3LH1A 3VXEH 6CHAC 3TJOA 1NRSH 1P3EA 5E0HA 1O3NA 3HGNA 1HIAB 4OS7A 1ETSH 6GCHF 2VIDA 3LJJA 1HAVB 1P04A 1RTKA 4DIIH 3B8JA 2WPKS 3VPKA 2BX3A 1Z8JB 1RTLA 2SNVA 4A6LA 3HK3B 2FOFA 4X6OA 3A84A 1BBRH 3RXHA 1E35B 4U2WA 5F8ZA 1CBWC 4AB9A 1GBJA 1AMHA 1FZZA 2QA9E 1CT4E 2P8OC 2OBQA 2QF3A 5FBIA 2I6SA 1A3EH 3M7QA 1X7AC 2ZFTA 3ATMA 3IG6B 4XSKU 4IN2A 1MTNB 2OQUA 5A09A 4BTTB 3VEQB 2TBSA 4GPGA 1NFUA 2QAAA 2PTCE 1MKXK 1MKWK 1EATA 1CQQA 1EAIA 2I6QA 2V35A 1C1OA 3BF6H 1D4PB 5EW1H 1KDQA 5C1XA 1C1TA 1DVAH 3U69H 1UJ1A 2Y7ZA 1Z6JH 2Z9KA 1GJ7B 1FY8E 1VR1H 1G32B 2JETB 5DGJA 4ZXXH 2BVXH 3RXAA 4D7FA 4ZAEA 2RG3A 2R3YA 5A2MH 1EASA 3A7WA 2VWMA 4LK4A 3PTNA 5EU8A 4DJZB 1GI6A 1E37B 3HGPA 3A7ZA 2PW8H 1T8MA 3A8DA 4UFFH 2A2XH 1HAGE 5DG6A 3VB5A 2FOGA 1OP0A 3PV4A 3QZQA 4X0WU 4AYYB 1AQ7A 3BG4B 1EJNA 4RKOB 4AFQA 2ANKH 3PLKA 3RXLA 3T27A 4YO9A 3D49H 4I32A 3GY8A 3QO6A 3UR9A 1O2LA 5E8EH 3VGCC 4IGDA 1KTSB 1BTZA 3K6YA 3P92A 1L1JA 3LGTA 2ZKSA 4ABDA 5LPFA 3OY6U 2ZCLP 5C3NA 4WH8A 1A0LA 2AS9A 4WXIA 1GI4A 1KLTA 1KXCA 2JH5D 3BTEE 3SUEA 2NU4E 3TH2H 4ABAA 1UVPA 3GCHC 3A82A 3K6ZA 2R9PA 4OGYA 5J4SA 5FCRA 1ELCA 1GHZA 2IPHA 5BRRE 3PLPA 1DS2E 2FS8A 4WMDA 3LT3A 2W7SA 3ATWA 5I46H 1IOEA 1WSSH 1AHTH 1JBUH 5HMAA 3ZZDA 2FI5E 1NY22 1G3CA 1P9SA 1UMAH 1W13U 2ALVA 2ZEBA 4BAOB 3UQOA 3OU0A 1P8VC 4FU8A 4KKDA 2G8TA 1AWHB 1SLUB 1O3BA 2C8ZB 1UVOA 1ZPCA 4Y10E 5A8ZA 2BVRH 3N7OA 1PPEE 1Z8IB 1MU6B 2Z9GA 1LQEA 4INKA 3GY7A 3M61U 2SGEE 4LZ1H 2R2WU 3OTJE 1DSUA 2BB4A 4Y11E 1T8OA 3RM2H 3RU4D 2ULLA 1GI8B 3U9AH 4AORA 2TGPZ 1BMLA 1GWAA 1RIWB 1P10A 4CRBA 1O3DA 4QT8C 3FP6E 2BMGB 3BEUA 1GVLA 2IOTA 3ZVFA 4WH6A 1PFXC 2H6MA 1AN1E 4MQAA 1RTFB 1V2RT 1XXDA 2PKSB 7GCHG 1O5AB 4H42U 4Y0YE 2GD4B 3MH7A 2WYGA 1ZPZA 1LO6A 1QRXA 1O33A 2FTMA 2ZU3A 3TNSA 4AFSA 1SPJA 1K1OA 4KELA 3QK1A 2G51A 3CP7A 1WTHD 5TCAA 1IQNA 1HJ9A 3PMJA 1O5CB 1ID5H 1BB0B 2M5TA 4JCNA 4ASHA 3K2UA 3MI4A 1DUAA 3T26A 3L33A 4B74A 3ZVDA 7ESTE 4K8BA 1DFPA 1NRPH 2P95A 1HAIH 2BD8A 3SORA 3GYLB 4NA7A 5L2YH 3UOPA 2SFAA 3BTTE 1Z8GA 3SV7A 4AB8A 4ABHA 5TJXA 4YOJA 4ABBA 1THRH 1TGCA 5T3HA 1O2PA 1IHTH 1A0JA 2PKAA 3ATKA 3QZRA 4JK5A 4E05H 2A4OA 4XOJA 4NWKA 1FNIA 1SGTA 3O8CA 5T6FA 3A89A 2F9UA 2BDYA 2DUCA 2G81E 1XXFA 4KP0A 1C1UH 1THSH 1FJSA 4TWYA 3PO1C 2HNTE 2FYQA 3FVFB 5J4QA 4B2CA 1DXPA 3R0FA 1BRUP 4XBDA 2XCNA 3TJVA 1F5KU 2J4IA 1BHXB 1C5YB 2GX4A 3V3MA 4U32A 4JYTA 3SV9A 1DDJA 2EI6A 1AZZA 1IQHA 4GUXA 3AW1A 3ESTA 2A5IA 3EYDA 2PUQH 1WBGB 2V6NA 2BY6X 4MTBA 1JIRA 1GBTA 1TFXA 1O3OA 1XVOA 3BEIB 1HLTH 2F9PA 4FUFA 2Z9JA 1PQ5A 1WAYB 2PHBA 1LDTT 2Q1JA 4WF8A 5K7RA 4IMQA 2PWXA 1LMWB 1GHWH 3SNEA 3PROA 1S0RA 1A61H 2A5AA 1K22H 1C4U2 1O5GH 2ZPQA 1GPZA 3KHVA 1MZDA 3DHKH 1W0ZU 1VCWA 3BG8A 4WWYA 3C1KA 1ORFA 1HXEH 1EZSC 1WOFA 4ZHAA 1ZJDA 1ELDE 8KME2 4SGAE 1AI8H 1IQMA 1C1RA 3VXFH 5E2PA 3ZZ5A 3BN9A 1HDTH 1AFQB 5JBBS 1HAZB 1JRSA 1UO6A 1WU1A 2HNTF 1ZLRA 1WUNH 3LIWA 3T5FH 1NC6A 1C5QA 1W10U 4K1EA 1ZSJA 2D8WA 1DITH 2THFB 4CRCA 5GCHF 4HFPB 4UFEH 1Y3VA 3RXVA 5AF9H 2C90B 2HOBA 5JB9S 4Y7BA 4OS1A 1P11E 2VU8E 4NIXA 1B0FA 1QRZA 1UTJA 1F0RA 2XBWA 3SU1A 1TQ7B 1DOJA 5AHGH 1FAXA 3MU5A 2ZHDA 3V12A 3IITA 3ITIA 3ZZ8A 3M5NA 1QB1A 3TIUA 3NZIA 4DY7B 1ACBE 1F5RA 2YNAA 1Y3UA 3MU1A 2KAIA 1LPKB 4K1SA 1BRAA 4B73A 2ASUB 2VVVA 1O2VA 2VGCC 2XWBI 6LPRA 3LGUA 2G5NA 5IYTA 2VWLA 1E36B 1LVBA 1EX3A 1P2IA 5DJ7A 1HAYB 2GCHF 4X8TH 3TK5A 4D8NA 2HPPH 1TA6A 5DP7A 2J9NA 2FX4A 3LU9B 3ATIA 1HAXB 3F9EA 5F8XA 2J94A 4K60A 3MNXA 4BNRA 2ZDKA 2YNBA 2ODQA 1KXDA 1S84A 1O3PB 1MD7A 2WPIS 3U98H 5FPYA 1O2IA 1G3DA 4H6SB 1AU8A 1GL0E 1EP5A 1YPHE 2WPJS 5F8TA 3T62A 2BXTH 1GDQA 4WVPE 1ABJH 1EZXC 3EA8A 1HPGA 1V2UT 2BY7X 2JH0D 2ZGJA 4MNVA 1P03A 2XC0A 1VGCC 1RXPA 1AB9B 1ELFA 3D65E 3M36A 2FESH 5HGGA 1B5GH 1V2PT 5EXMA 1HFDA 3K65B 4YZUA 2QXJA 4ZKSU 3P8GA 3A86A 1O3GA 1MTWA 4D9QA 5FPTA 1N1LA 1MAYA 3TNTA 2EC9H 2Q6FA 4GVUA 2VJ1A 1BJVA 4YLQH 4GAWA 3TGKE 2O8MA 2ZPRA 1BCUH 1CA8B 5C1UA 1QBNA 4DURA 1NFYA 1GG6C 1K1LA 2ANMH 1MBQA 3AW0A 3SU3A 3LGIA 1SLVB 1V6DA 4YT7H 2H2ZA 2GCTC 4NG9H 1TRMA 3A8AA 4DW2U 4ISIH 3T2NA 1TAWA 1DWEH 3RMMH 5JDUB 2A45B 4ZMAH 2TPIZ 1P9UA 1RJXB 5GWZA 1BQYA 1GMCG 1WQSA 1V2TT 2AGGX 1QY6A 1MCTA 4CBNA 5C5NA