4OGYA

Crystal structure of fab dx-2930 in complex with human plasma kallikrein at 2.1 angstrom resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
239
structure length
239
Chain Sequence
IVGGTESSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILELSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLEYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibody
molecule keywords Plasma kallikrein
publication title Inhibition of plasma kallikrein by a highly specific active site blocking antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature ec 3.4.21.34: Plasma kallikrein.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ogyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ogyA01
4KP0A 4XBBA 4YO9A 2OINA 1A3EH 1TB6H 1THPB 1Y3VA 1MZDA 1SBWA 2I6QA 3Q3XA 1PPGE 2C8WB 4XDEA 3U8TH 1GI9B 2BLQA 1TPSA 1TRMA 2UUFB 1JOUB 1ETTH 4DOQA 3GDVA 1SOTA 2BZAA 2QXHA 2D1JA 1C5QA 4NSYA 1AKSB 2OXSA 4KKDA 4MDSA 3LDXH 2HPPH 2ZFSA 1INCA 1T8OA 2A7HA 4K60A 2NU1E 1GHVH 3K9XB 1IQNA 4D9RA 1GBAA 2B5TB 1P2KA 1O3KA 1CA8B 2VIVA 2V6NA 5DP6A 2GZ9A 4LOYH 1BT7A 3MU5A 2QXJA 2BY8X 7GCHF 1GPZA 4J2YB 3E90B 1QBNA 2OC0A 2PSXA 4UEHH 1P01A 3RM0H 1EZUC 3GDUA 3E1XB 1GHAF 1QIXB 2ZHWH 4FUBA 4F4OC 4A1TA 1MKXK 4AFSA 3QTVH 1K1LA 1HGTH 1E38B 1GI0A 1O2UA 4DW2U 3BTFE 2A31A 1TGTA 1DY9A 2G51A 5E0HA 1PPHE 1RTKA 4AOQA 1Z8RA 4JK5A 3A7XA 3T62A 1B0EA 2P95A 2QY0B 3V3MA 3SJIA 1MMJN 5ESTE 2VIOA 4CH2B 4YT6H 3SV9A 1SGQE 1O2TA 1DWBH 4DCDA 5F03A 1EAUA 5G4BA 2Z9JA 4BAKB 1A0JA 2TGAA 1PYTD 2ZHEH 2SNVA 2SGEE 2WPJS 1W14U 3VFEA 4RKJB 1BTHH 3A89A 3A80A 5A8ZA 1ELGA 5AFYH 4MPUA 2R0LA 1UTJA 1ACBE 2OC8A 3TGJE 2VIWA 1TPPA 1P0SH 3K6YA 3V12A 1FN8A 4X6NA 1FDPA 3OTJE 3TVJB 3TITA 4ZHMU 1QJ7B 3M3TA 1ELEE 2PGBB 2UUJB 4DGJA 5E8EH 2SGDE 2ODYB 3LONA 3RXIA 2XC4A 2QAAA 4A5TS 4CREA 3ZV9A 3ELAH 1O2QA 5AFZH 4FUCA 2ESTE 2GVFA 5L2ZH 1C2LA 2BZ6H 2GP9B 4OS1A 1F2SE 4IC6A 1TA2A 5AVDA 1V2KT 4UE7H 2TPIZ 1W8BH 4ZROA 2ZDVH 1AUTC 1TNLA 2C8XB 1O5CB 4JYVH 1C2KA 2AYWA 2OP9A 2ZGXH 4K1SA 1EPTA 1Z7KA 2ZGHA 1JRSA 1EZQA 3A86A 2WPIS 1TRNA 2GKVE 1QJ6B 1ZTJA 1O2IA 4X2XA 3A7TA 5JDUB 1LMWB 1C9PA 5F6MA 1EASA 1FIWA 4X1RU 4B2CA 5A8XA 1BZXE 1YPLH 1HXFH 1TX6A 3MH5A 3DT0H 4Y8YA 3OY6U 2ODQA 3M5MA 1TNIA 2EA3A 4GSOA 3SV8A 2QGRA 2H9TH 2O8WA 3SJ9A 1GI4A 3LC5A 5C20A 1PPCE 1Z8GA 3BIUH 2FX4A 4X1QU 5FBIA 4U30A 1EAXA 4FVDA 1GMCG 4CRGA 3KIDU 3DHKH 2ZPRA 2K1QA 2BY6X 1O3NA 1O37A 1DUEA 1J8AA 4HTCH 1FIZA 2P3FH 1AWHB 3P17H 1D3TB 2HWLB 3S7KB 3BTEE 1HAXB 2RG3A 3O8RA 1H4WA 2BD3A 1SLXB 4WXIA 1BTXA 2OC1A 4X8VH 1GJ8B 3ZZBA 3M35A 1GHBF 2ZA5A 4BTIB 4XBDA 1UTOA 1O2GH 1SMFE 3M7UA 2Z9KA 2PTCE 4CBOA 2ZHFH 2OLGA 3RXTA 2WUBA 3F9GA 1EZSC 3RXCA 1Y59T 4CRDA 1K1JA 5AF9H 4NFEA 1ZHRA 1C1UH 2BOKA 1QTFA 4FU7A 1ELVA 2UUKB 3NPSA 3TNTA 1DANH 1GJCB 4INHA 4I8KA 1ZSJA 4MQAA 1SGFA 1HAGE 4QT8C 4FUEA 1PQ8A 3U69H 2XXLA 2HLCA 4AG1A 2HNTC 2ANWA 4X2VA 2TGDA 1QB9A 1LPKB 1GCDA 2FP7B 1AHTH 3P8NA 3SQHE 4Q80A 1ZJKA 1ANEA 2FM2A 4BNRA 3PWBA 1ZJDA 4U32A 1C1PA 3BF6H 3ZV8A 3BTDE 1O5GH 1MTWA 3ATKA 1OWKA 1UHBB 3ENSB 1P12E 1JXPA 3MU0A 2QIQA 3PWCA 1IQGA 1GBKA 3BV9B 4XFQA 2XCNA 2Q6FA 1RGQA 1ID5H 1XUHA 3UUZA 1H9HE 1WUNH 1O3PB 1FAXA 2ZCKP 4JMYA 1GHWH 4KTCA 1BJVA 3EYDA 1O2SA 2BD2A 2GCHF 2HOBA 1TQ0B 3NUMA 3KN2A 2EI6A 4AFZA 1GGDB 1SGCA 3SN8A 2ZO3H 5J4SA 1T8NA 2BHGA 3VB6A 1XUGA 5LPRA 4Y8ZA 1AO5A 5DO4H 1ESAA 2BOHB 2VH0A 1EOLA 3MTYA 3RC5A 5JB8S 2UWPA 3BG8A 2J4IA 4DIIH 1UVPA 7GCHG 2TIOA 1OWDA 1GJ6A 3GY5A 1DSTA 1TQ7B 2BY7X 1BBRH 4DURA 1GMHF 4D7GA 3HKIB 1CT2E 1MKWK 3SU4A 4NWLA 1PFXC 5GWZA 4FUGA 1P57B 1P10A 2FDAA 2JH5D 5ETXA 4Y10E 1TBQH 2VWMA 2FWWA 1B5GH 1EOJA 1MTSA 3B8JA 1C5XB 1S0RA 3SU2A 1WOFA 4WF8A 1A46H 2VIPA 3LGIA 3TJVA 2Z9IA 5JBTA 1OKXA 1MBMA 3P8FA 1QA0A 1D3DB 1ZHMA 3SNAA 3S7HB 1L4ZA 2G5VA 3IG6B 3U9AH 2ZDKA 1EUFA 1H9IE 3HPTB 4X6MA 2FXRA 2PV9B 3GY7A 1ZHPA 1W11U 3MOCA 1MD7A 2ANMH 1AKSA 1GBBA 3ESTA 5FX6A 1G9IE 1AVXA 1TIOA 3HGPA 4DVAU 3UTUH 1SOZA 4X2WA 3RXSA 2VVUA 1GI7B 2SGPE 1HDTH 3Q77A 2F3CE 4K5ZA 3FANA 3BTHE 4NG9H 1NU7B 1TLDA 1X7AC 4Y7BA 1O3DA 4MNXA 4NSVA 3LT3A 5GPIB 3PMHB 1ZTLA 1O2WA 4HZHA 4NIVA 1V2QT 1M9UA 3GCNA 1F0TA 4ISNA 1YLDA 3KL6A 2P3UB 3PMJA 3ATLA 2SGQE 3QGJA 3EDXB 1IQHA 1NPMA 3PB1E 1G2MA 1OWHA 2Z7FE 5L30H 4ABJA 1TPAE 1TNKA 3LKWA 5DKMA 2OBOA 4UFDH 1O34A 1UVSH 1P03A 2IPHA 2A7JA 3RXHA 1PJPA 1C1NA 1QCPA 2JKHA 1GHYH 3GOVB 4ZMAH 1TRYA 3RMOH 1NZQH 1WTGH 1RRKA 5HM9A 3A8AA 2ZC9H 4CBNA 2QYIA 2IOTA 3M7QA 3ODFA 2ZGJA 5HYOA 2PWXA 4NFFA 1E35B 2FOEA 4TY7A 1BHXB 5HGGA 2ZP0H 1AVWA 1TFXA 1UCYE 1NY22 3MH7A 4CHAB 5DG6A 2OUAA 2SFAA 3C27B 1LHCH 3RXMA 1F92A 2BQWB 5K0HA 4B75A 1C1RA 1V2LT 4MTBA 2PR3A 2ZCHP 2A4RA 3SGAE 1BMMH 2EC9H 2EI7A 4ABDA 1THRH 4DIHH 1HYLA 2FPZA 1DWDH 2WPLS 1BMAA 1GDQA 1ZSLA 4FU8A 1GHBG 1T8LA 1HAYB 1F0SA 3R0FA 2CF8H 1AVGH 1C1SA 5GIBA 2H5CA 2OTVA 1A61H 1FV9A 3SORA 1CHOG 3GY3A 1LTOA 1CE5A 1C5RA 1G2LA 2GT8A 1FXYA 1FUJA 1IQLA 2O8UA 1QJ1B 5LGOA 3RXAA 2WPMS 1J16A 1YPEH 2ZFFH 3FZDA 2QF0A 1KTSB 2PTNA 1HBTH 4B74A 4U01A 4I31A 2ZKSA 4DJZB 4D7FA 2KAIB 1NRPH 3PMAB 1HAIH 3ZZ8A 1V6DA 3ODDA 1VZQH 1HJAB 2ZU5A 3A8DA 1UVOA 4Z6AH 3FP8E 1P11E 2VWLA 4RN6A 1VITH 1VITF 4ABBA 3NZIA 2QXIA 3TK6A 1BUIA 1AY6H 1LVBA 3RP2A 1GJ4H 3BG4C 1Z6JH 1V2OT 2BLVA 2BMGB 3ZVBA 1C1OA 1W10U 1HAVB 1P06A 1A0HB 1Y3XA 4K3JA 1ZR0A 1A3BH 3TH2H 2XC5A 2WV5A 4CR9A 3ZVGA 1KDQA 1P3CA 2NU3E 1D6WA 2J92A 4AFUA 1GMCF 1V2JT 4AYVB 2J94A 4CH8B 3BTKE 1W13U 3R3GB 1DS2E 1TGCA 3QTOH 1ESTA 3M3SA 3NXPA 4IC5A 1C4V2 4Y8XA 1B7XB 2ZDMA 1HAZB 1SHHB 2AH4X 3PLPA 1G30B 4ZHAA 3VB4A 2GCHG 1O2YA 1GVZA 3A88A 5C5OA 2C8ZB 3AAVA 2R9PA 2FI5E 3SJOA 4IMQA 3QWCH 1AZZA 3GCTF 4ZKRU 4ZKOU 5A0CA 2XBXA 1N8OB 1LHGH 1FNIA 3UY9A 1ZMLA 1CSOE 4I8HA 3ATMA 3MYWA 4MLFB 3MNXA 2FS9A 4MG3A 1D6RA 2TGTA 1FI8A 1EQ9A 5EW2H 3OX7U 3G01A 4AYYB 1QFKH 1HJAC 2ALVA 3SOSA 2P59A 3P8GA 2LPRA 1O2LA 1QRZA 5C1XA 3S9BA 2Q6GA 1GMHG 3SNDA 5F8TA 1MU6B 1C2GA 1FPHH 5DP9A 4Z0KA 4B1TA 1C2MA 2FX6A 2PKAB 1ARCA 1S81A 2WYJA 2ZCLP 5LPFA 3VXEH 1G37A 4ABFA 3UNRA 1DFPA 4OS5A 1IHSH 2J38A 2J95A 3SV2H 4RKOB 1LHEH 4TWWA 2C4FH 1ZMJA 1V2UT 1MD8A 2QXGA 3KCGH 4NA8A 1C2EA 1DITH 4KGAA 1CGIE 2A1DB 3PV4A 1BQYA 4NGAH 2A5AA 3E0NB 4WMFA 3NCLA 1G32B 1CGHA 1ETRH 1S6FA 2BXTH 1TNGA 4GCHF 2LNCA 2QA9E 1QBOA 2HNTE 1XX9A 2C8YB 2XYAA 2Y80A 4BAQB 1N8OC 1HAPH 3O8DA 1MU8B 4ABGA 2O8LA 1HV7A 2ASUB 3DFJA 1FY4A 2FOMB 1GBIA 5EODA 3LGTA 3RU4T 5EXMA 5CE1A 3GICB 3SJ8A 2ZQ1A 1C5PA 1ZPCA 1RTFB 3H7TA 1Y5AT 2V0BA 4BAMB 1NRNH 1CA0B 1N6YA 3I77A 1LVYA 2NWNA 3F9HA 4LXBH 1S6HA 3T2NA 1EJMA 1C1WH 1UCYK 3SU0A 4ISHH 1AZ8A 5IYTA 5I25A 1YCPM 3SV7A 1LDTT 1LQDB 2XC0A 2ZPQA 2G81E 1CT4E 3BEIB 4HGCA 4BOHA 1XUIA 1FLEE 3UOPA 1NT1A 5L6NH 4E7RG 4DY7B 1GBJA 3DFLA 1YPGH 3M7TA 3N7OA 2BM2A 3MH4A 2VJ1A 1GI8B 4JZDH 1MCTA 2Y6TA 4AZ2B 3RXOA 1SGNE 4D76A 1DM4B 1E0FD 5H4IB 2FOAA 1DICA 4JK6A 3A7YA 2B0FA 1MKXH 1S83A 3UOUA 4B2AA 1W3CA 3P92A 4JZEH 1IQKA 1FY8E 3DD2H 2EEKA 2Q6DA 1QURH 2CXVA 4YOGA 3ZYDA 4NA7A 1GI6A 3RXVA 3QN7A 3RXJA 4NIYA 3FFGA 1CA0C 1E36B 4LZ1H 1Y3WA 7ESTE 3IITA 2ZNKH 1HIAB 2FO9A 1ZPZA 2ZWLH 3AW1A 3RDZA 1Z6EA 3OU0A 5T6FA 5EPNA 2W3IA 2R0KA 1VGCB 4WWYA 5E2OA 4MNYA 1GI3A 1MUEB 4IBLH 1ZGVA 3A8CA 1H8IH 1KYNA 2BVSH 3ZZ3A 5EXLA 4JCNA 4ASHA 3LU9B 4I33A 2BD8A 1K9OE 3VB5A 3TIUA 1ZOMA 1UTKA 3Q00A 5FXLA 4AB9A 2H9HA 2Y5HA 2Y81A 4AB8A 1GCTB 2AFQB 1NFWA 2XTTB 1O2JA 2VIQA 2XBWA 4FVBA 2STBE 3MNBA 5ESBA 1VITG 1JIRA 7KMEH 3SO3A 1RTLA 1DWEH 2BDIA 3MU4A 4O3TA 2PW8H 2B7DH 2BXUH 1QBVH 5ABWA 1ABIH 1GWAA 3RMMH 4CRCA 2VH6A 3SU1A 1J17T 3WY8A 3RC6A 1TX7A 1AU8A 3FP6E 1HPGA 4K1EA 2C3SA 4IS5A 5E0GA 1XUKA 3T26A 1SGTA 3SGBE 2AMQA 1JMOH 1O2PA 2FTMA 3SU5A 1UVUH 3A87A 1VGCC 2D26C 3UQVA 1ETSH 2A5IA 1OP2A 4NA9H 1ZPBA 1BA8B 3AASA 3GCTG 2QC2A 1SGYE 3AVZA 4WMDA 1U6QA 5FPYA 4JZ1A 1O2XA 4Y7AA 3RU4E 1CHOF 1UMAH 2F9VA 1IQFA 4O9VA 1SGPE 2A7CA 3T28A 4AN7A 4Y79A 1ZZZA 3M37A 1ORFA 1UTMA 1GCTC 2F9OA 1LHFH 1V2ST 1P8VC 1HAHH 5GJ4B 2KAIA 3RLYH 3EQ0H 1MTNB 4H4FA 1OS8A 4ISOA 5BRRE 1GJ5H 1O3JA 1D3QB 3SNEA 2XRCA 1AN1E 1TBRH 1TMUH 1AWFH 2QN5T 4KTSA 1O3IA 3TK5A 1P2MA 4BAHB 1DLEA 1CGJE 2A5KA 5A8YA 5T6DA 2XCFA 2ZECA 3RXLA 2W3KA 1SGFG 3ATIA 6GCHF 1NRSH 3F9EA 4Y71A 2AIQA 1A5HA 1MTUA 2RCEA 5A2MH 2TBSA 3VB3A 1ZRBA 2VB0A 1CQQA 1KLTA 1YC0A 1RJXB 1UJ1A 3GYLB 8ESTE 2AGGX 3A8BA 4GCHG 1K1IA 2C93B 4H42U 1VCPA 1ELAA 9ESTA 1W12U 3KQEA 5BPEA 2HRVA 3E6PH 1Q2WA 6ESTA 2PGQB 1EP6A 4MPWA 1C2JA 4IN1A 2HALA 1YCPH 1QGFA 1ANDA 3A82A 1NM6A 5FPTA 1O2RA 1HXEH 3UPEA 2OQ5A 1SGRE 4Y0YE 1K1MA 1QNJA 5PTPA 2SGFE 3BTQE 1MTNC 2ZTZA 1BBRK 1GJBB 2Y7ZA 1JRTA 1BJUA 3QGNB 1GBFA 3GISB 3TGIE 1SLVB 2A4QA 4O03A 1THSH 5C1YA 1OYQA 3ZZ4A 2H6MA 3SHAH 1BTYA 3E91A 3TJUA 5LPEA 2PKAA 2W5EA 1AIXH 2V3HH 4SGAE 4YTAA 3CENA 4FUFA 3RUOA 3HK3B 1YBWA 3MNCA 1PQ7A 4XE4A 1F5KU 3ITIA 1E34B 3K6ZA 2FOCA 2W7UA 1O3GA 1Q3XA 3P6ZB 1FY3A 1BMLA 1W7GH 3Q3KA 1ELCA 2OD3B 2F9PA 3QZQA 1FZZA 3UWJH 1O5EH 1WSSH 2Y82A 1HLTH 4AGKA 1GGDC 1HB0B 2UUYA 4TYDA 3SUGA 1NO9H 3CS7A 1C5NH 4UDWH 1P9SA 1KLIH 1MTVA 1LCYA 1O3HA 2PUXB 3GYMA 3RXRA 3SBKA 5A0AE 1NTPA 3PLBA 3QLPH 2BYAX 2H5DA 5JBAS 5A0BA 2A2QH 3BEUA 2AGIX 4WJG2 1EP5A 2YOLA 2Z3DA 1V2MT 1TMTH 1O2MA 1XMNB 2W26A 2BDAA 2ZF0H 3A7ZA 4FUHA 5HMAA 1TBZH 1WU1A 1FAKH 5JYIA 1C1TA 1Y5UT 1C1QA 2O9QA 3UR9A 1LHDH 1DDJA 1K28D 3Q76A 2Z3EA 2VNTA 1A5GH 4IN2A 3RLWH 1PPBH 1TGNA 1BITA 5CHAB 1TA6A 2V35A 1KXBA 3BTTE 1HUTH 1TGSZ 3KNXA 1AE5A 1YYY1 1OP0A 3VEQB 4FUIA 3F9FA 1C2FA 3UIRA 1SFQB 2THFB 1AB9B 1V2TT 2PFEA 2G4UA 2VU8E 1LO6A 4TY6A 3RMNH 4R0IA 3PROA 2F91A 3E0PB 2GZ7A 1GI1A 4YOIA 4Q7ZA 4D9QA 3HK6B 2HVXA 3ZYEA 4I32A 4B76A 1H8DH 1T31A 3MI4A 4YESB 4BTUB 3KGPA 1EPTB 3ZZ5A 1WTHD 1ELDE 5F8ZA 2GZ8A 8LPRA 2FI4E 2GX4A 4LK4A 2FMJA 1KIGH 4F49A 2CJIA 2FYRA 1O36A 2ULLA 3FAOA 2ZU4A 3U8OH 8GCHG 4RSPA 1HJ9A 3UREA 1QRWA 1CBWB 4X8TH 1P9UA 2JETB 2J9NA 4D8NA 1O3EA 5DP3A 3SUDA 1ELFA 1AUJA 1W0ZU 2O8MA 1O3OA 1KTTB 5CHAC 1PPEE 1UTPA 3S9AA 1KXCA 4ABEA 2VINA 1F0UA 2OCVB 3JZ1B 1UO6A 2HGTH 1C1MA 2ANYA 2CN0H 4X8SH 1D3PB 2H1UA 2F9BH 1AB9C 4ABAA 1HFDA 3RC4A 2Z3CA 4KELA 1GI2A 5JBCS 4WVPE 1O3FA 3H7OA 1AFEH 2ZZUH 3C1KA 4AFQA 1N6XA 1J15A 1YPHC 1L1NA 2FOHA 3RXBA 3W94A 2UWLA 4OGYA 5T6GA 1EPTC 2SNWA 2IJOB 2AEIH 2BDGA 5IDKA 4CHAC 4XSKU 4UFEH 1C9TA 1ZYOA 4CR5A 6GCHG 4ISLA 2H2ZA 3ZVDA 1AFQB 1VCWA 2BX3A 4ZXXH 2FESH 1O39A 1O30A 1CBWC 4FU9A 2XWBI 4I7YH 4A7IB 3KQDA 5C1UA 1S0QA 2JETC 4NZQA 1UTQA 2CMYA 4LZ4B 4XOJA 4XBCA 4E06H 2ZU1A 1GDUA 4HFPB 3M5LA 3D65E 1T7CA 3UNSA 4YOJA 1NC6A 4OGXA 1GDNA 1O2NA 3ZZDA 1L4DA 2BD4A 2BDCA 1H9LB 2XWAA 3V0XA 1EATA 1NS3A 2GMTB 3A84A 3F68H 3SI3H 2BD5A 2FI3E 3S0NA 1SQOA 1V2VT 3Q3YA 1N1LA 3OSYA 1AQ7A 2QV1A 4H6TA 4ZKSU 1RFNA 2VGCB 1EB2A 1A7SA 3B23B 1O5BB 1E37B 1PYTC 2J34A 3QUMP 2GTBA 1T4VH 1BRUP 2ZDNA 2HPQH 3SNBA 1MAYA 1YGCH 3UWIA 2P8OB 1OX1A 1UTNA 2BLOA 1ZLRA 4JYUH 1BTUA 4YLQH 1TABE 2ZEBA 6LPRA 2ZPSA 3JZ2B 4CRAA 2BDBA 5FX5A 4B73A 2FLRH 2F83A 3SZNA 1A5IA 4Y6DA 3QK1A 5JBBS 3K2UA 5EPYA 3BEFB 3RU4D 1OOKB 4A92A 1P2IA 1WQVH 5LH8A 3TGKE 3MNSA 3M5OA 1UHBA 3S9CA 1LKAA 4ISIH 5TCAA 1GBLA 2ILNA 3PYHA 3LC3A 1FY5A 1MAXA 1UVTH 5TCCA 2TGPZ 1FJSA 1Z8JB 2ZGBH 1OXGA 3SUFA 2ZGCA 1T4UH 1DXWA 1AGJA 3TJOA 5GDSH 2XW9A 1IOEA 3LPRA 4Y76A 1BRBE 3M36A 2A4OA 3K65B 3PO1B 3RXPA 5DJ7A 2GMTC 3LGWA 1IHTH 1QY6A 3TLOA 1O2OA 4X2YA 1XKAC 4ZH8A 4BANB 1NFYA 1G3EA 2G00A 4X6PA 4FUDA 2BDYA 2VGCC 3SHCH 2Y7XA 1P04A 1A2CH 4CRFA 1QRXA 3T29A 1GJDB 4WY3A 2P94A 3L33A 4U2WA 5CMXH 2P8OC 5EXNA 2RA0A 1Y3UA 3UQOA 1A0LA 5GXPA 1MCVA 1AMHA 1A1RA 3H5CB 4HI3A 5C2ZA 3LGVA 4K8YA 2FOBA 4X1NU 1O3AA 1O3CA 3MO9A 4X0WU 2PHBA 3BTWE 2A0QB 2OC7A 1WCZA 4TPIZ 1SGEE 3MU8A 5I46H 3T27A 1YLCA 1DT2A 2GCTB 3A7VA 2Z9LA 4A1XA 2R2MB 2VVVA 4ABIA 5EG4A 3U8RH 1S82A 4X8UH 1TOCB 1P09A 3BTME 4K2YA 1BBRE 3PO1C 4OS4A 2OBQA 5DPAA 1G3BA 1TNJA 3TH4H 1UCYH 1RS0A 1P2QA 2R3YA 1C4U2 2B8OH 1TAWA 5EQRA 5TJXA 4I8LA 1K1OA 2VIDA 2AS9A 3ZVCA 4WH8A 4INLA 4H6SB 2BDHA 3ZVAA 5K7RA 3U1JB 2ZTXA 3URCA 1EJAA 1EX3A 1FMGA 5B6OA 2BQ6B 2GV6A 4AG2A 1O2KA 1O5FH 3VPKA 2FEQH 3E8LA 1FONA 1BOQA 2FYQA 1SSXA 4TPYA 1FY1A 1NROH 1T8MA 1TGBA 2FOFA 5EQSA 3M3VA 1SGDE 3P8OA 3SNCA 5FCKA 1SG8B 1DOJA 3GY8A 5FAHA 1AD8H 3GY4A 1MH0A 3RMLH 5HXFA 5A09A 1SI5H 1YP9A 2P3TB 4GLYA 3L6PA 1OP8A 3EGKH 1GMDF 2GCTC 4GPGA 3ZZ7A 1KY9A 1IQIA 3STIA 1EB1H 4R8TB 2IN2A 4GAWA 1SLUB 1DWCH 2VWOA 1FN6A 3TJNA 1BTZA 1GL0E 3PTNA 1KXFA 4ZUHA 2J2UA 1JIMA 1GBHA 4UFFH 2GDEH 5EGMA 1HCGA 1CO7E 1V3XA 2BX4A 1JWTA 1SC8U 4AX9H 1SB1H 1O38A 2GD4B 4GHTA 2WINI 1D9IA 1PQ5A 1W2KH 3A81A 2XBYA 2ZQ2A 1EXFA 4MNWA 1ABJH 1D4PB 1SHYA 1IAUA 5E2PA 2NU0E 1BMNH 1NESE 1XXFA 1QR3E 1B0FA 8GCHF 1MBQA 1SLWB 1Y8TA 4YZUA 1F5LA 1JBUH 1LVOA 1YF4A 1QA7A 2WYGA 3P70B 2AGEX 1BB0B 3BN9A 3QX5H 3T5FH 5F8XA 5EW1H 3TK9A 1SQAA 1GJAB 4GUXA 3SUEA 1DLKB 1V2NT 1YKTA 5DK1A 3D49H 2G8TA 1KDQB 2D8WA 2F9NA 4IGDA 3SI4H 1IQJA 4X1SU 5EOKA 2BD7A 1UTLM 3FVFB 3RXUA 4DG4A 1RD3B 2ZHDA 3E16B 4K8BA 1Z1IA 2V3OH 2F9UA 2NU2E 2YNAA 1NRRH 1DX5M 4IMZA 1ANCA 2CF9H 1RIWB 5C3NA 4JZIA 2UWOA 3GCOA 6CHAB 1SQTA 1LKBA 1G3DA 4NZLA 2R2WU 3ZZ9A 1EZXC 1L2EA 1Q31A 5DP7A 1H1BA 1O3LA 1VJAU 1O31A 3HATH 1SPJA 2CGAA 2ZFTA 2BQ7B 1GG6B 3VGCB 3I29A 1DSUA 1SFIA 4YT7H 1HAVA 2BVRH 2BY5X 5JB9S 4X6OA 1ANBA 1Z71A 2EI8A 2ZHQH 1O3BA 1PPZA 1O5DH 1OWIA 1C5WB 1QB1A 3MFJA 5DP5A 1C5UA 1HAOH 1QL9A 3EA8A 1GVLA 2HNTF 1YCPK 1DY8A 1C5OH 2PKSB 1YPHE 1S5SA 1BTWA 1RXPA 1XM1A 5FCRA 1F0RA 2SGAA 1GBMA 1S84A 2XBVA 2ZFPH 3NKKA 2O8TA 3AAUA 1BDAA 1G36A 1SVPA 2BLWA 1CT0E 2BTCE 4JYTA 1J9CH 1YPMH 1O5AB 1T32A 2BB4A 4A1VA 3S69A 3U1IB 1RIWC 3U98H 1NFXA 6CHAC 3RM2H 2BD9A 2Z9GA 4BTTB 5SGAE 4ZHLU 1P3EA 1Z1JA 1C1VH 1XXDA 1UK3A 1YPKH 1SR5C 1GG6C 1GVKB 3VGCC 1C2IA 2ZI2H 3VXFH 1F5RA 1TWXB 3MWIU 1DXPA 3T25A 1C2DA 1IQEA 2A32A 2Z94A 3URDA 1TONA 4E05H 2G4TA 4MVNA 9LPRA 1NFUA 1TPOA 2FS8A 1CVWH 2VWNA 1QQ4A 3PMBB 3OYPA 5GCHF 1OYTH 3GY2A 4THNH 3KEEA 3SW2B 1AE8H 3EA7A 5EQQA 3QZRA 1C2HA 4NWKA 5C5NA 2Z6BD 5JPMH 1WAYB 3A7WA 2AMDA 1GHAG 2B9LA 1LQEA 5J4QA 3PM3A 1WBGB 2PKSC 5HM2A 1C5TA 3BSQA 3OY5U 4SGBE 1EAIA 1MKWH 3TH3H 3ZZ6A 1GL1A 1NN6A 3O8CA 4Y11E 4UONA 3NK8A 1ZSKA 2BVXH 1MZAA 3HGNA 2I6SA 1L1JA 4UD9H 3F6UH 3BTGE 4Q7YA 3RXEA 4E7NA 5FBEA 3KQCA 3PTBA 3GDSA 2DE8A 2FZZA 1S85A 2DE9A 3SQEE 4OS7A 2A4GA 4ZKNU 1EAWA 3L3TA 2PLXA 4TWYA 3ZVEA 1FQ3A 3EAJA 1BTPA 1GHXH 1TMBH 1HRTH 1SL3A 2FOGA 1G3CA 1PPFE 1GBDA 2M5TA 2QF3A 2ZIQH 4ZXYH 1GMDG 1GHZA 1V2RT 4I8JA 3QO6A 1HJ8A 2FODA 4MPXA 1KLJH 4UFGH 3BIVH 3TNSA 2JH6D 2PSYA 4O3UA 1NRQH 2AERH 4WXVA 3RXDA 1EJNA 3MO3A 3ZVFA 3GY6A 4YLUA 3QDZB 3UFAA 1MQ5A 4A6LA 2ZDLA 1K2I1 3EA9A 1KXEA 2A2XH 1YM0A 2WPHS 3CS0A 5DP8A 2W7SA 3GCHB 1KXDA 1O2HA 5T3HA 1ZGIA 1A4WH 1C5ZB 2ZG0H 3V7TA 2ANKH 3PLKA 1LVMA 1O35A 2WV4A 4YM9A 2OQUA 1KXAA 4K1TA 2R3UA 1LPGB 4AGJA 3LGYA 3LIWA 4Q7XA 1GJ7B 5DP4A 5FHTA 2CHAB 1OPHB 1CU1A 3SGQE 3A85A 4Q2KA 4VGCB 3RXGA 2BY9X 4B71A 1HNEE 2DUCA 4ZAEA 4WH6A 1TALA 4BAOB 2FIRH 2AIPA 1AI8H 4MNVA 1YPJH 3CP7A 1HIAA 1NU9A 3LH3A 1O32A 1Y3YA 4BXSA 3BG4B 1Y5BT 1K22H 1L0ZA 2ODPA 3I78A 1TYNA 4OS6A 1VJ9U 4BXWA 1C5MD 2STAE 5L2YH 1ZTKA 1ELBA 3STJA 2Y5FA 1W0YH 1C5VA 4NIWA 2P93A 1TX8A 1GBEA 3MO6A 1TNHA 2H9EH 1XKBC 3TU7H 4FUJA 3GCHC 1O2ZA 1DVAH 1P05A 2NU4E 5DGJA 1QB6A 4GHQA 8KME2 3ZZCA 2P16A 2G55A 1GBTA 3MU1A 3D62A 2YNBA 1P2OA 3FZZA 1F7ZA 1WYKA 1Z8IB 1GI5A 1O0DH 2Q1JA 3RXKA 2RDLA 1L1GA 1XVMA 4ABHA 5FPSA 1P2NA 1XUJA 4M7GA 4FXGH 3D23A 3FP7E 2XNIA 2CHAC 1FPCH 4NCYA 3MMGA 2TRMA 4VGCC 1OWEA 3MH6A 1C5YB 4I8GA 4JZFH 4B2BA 4DT7B 1KSNA 3MHWU 1BCUH 1QHRB 1XUFA 3M5NA 1UK4A 1BRAA 2CV3A 2AMPA 7LPRA 1K21H 3V13A 3LH1A 1V2WT 2VVCA 3SV6A 3NWUA 1PQAA 1BHXF 3HKJB 1K1NA 5EU8A 4PROA 4OS2A 1OWJA 2ZTYA 1P2JA 2ALPA 3KHVA 1ESBA 3LGUA 2G5NA 3ZZAA 1IQMA 1O33A 1LPZB 2A45B 5AHGH 4KTUA 3DA9B 1W7XH 2D2DA 1BIOA 1BRCE 2G52A 1DUAA 1O3MA 3RXFA 2PUQH 3LJOA 3VB7A 2GGVB 3TPIZ 2JH0D 1WQSA 3LJJA 3SU6A 1ZRKA 1QL8A 1K1PA 4K69A 3SU3A 4X1PU 3W95A 3LOXA 1QQUA 1DE7H 3B9FH 2FTLE 4MPVA 1C5SA 3SJKA 3EE0B 3UR6A 5C67A 1GBCA 3DUXH 5E0JA 2ZU2A 4CRBA 1ZMNA 2ZDAH 2ZFRH 1GJ9B 4GVUA 2C90B 1TOMH 2RA3A 4O97A 1OSSA 2GT7A 2GDDA 1CHGA 3RXQA 1ELTA 1SGIB 1WV7H 3A83A 5GCHG 4J1YA 1AFQC 4AORA 4Y0ZE 1TE0A 4IW4E 1VCQA 2Y5GA 4WMEA 1P02A 2FLBH 1MQ6A 1O2VA 1C4Y2 1J14A 1V2PT 3O8BA 3KF2A 3E3TA 4INKA 2QCYA 3M61U 1VR1H 4ESTE 2GV7A 3UNQA 2WPKS 1DPOA 2WUCA 3F1SB 3P95A 2ZFQH 1ARBA 4NIXA 1XVOA 2ZU3A 3AW0A 3IWMA 1UK2A 1QL7A 3ATWA 1C5LH 1EKBB 3KQBA
chains in the Genus database with same CATH superfamily
4KP0A 2V7QD 4XBBA 4YO9A 2OINA 1A3EH 1TB6H 1THPB 1Y3VA 1MZDA 1SBWA 5IK2D 2I6QA 3Q3XA 1PPGE 2C8WB 4XDEA 3U8TH 1GI9B 2BLQA 1TPSA 1TRMA 2UUFB 1JOUB 1ETTH 4DOQA 3GDVA 1SOTA 2BZAA 2QXHA 2D1JA 1C5QA 4NSYA 1AKSB 2OXSA 4KKDA 4MDSA 3LDXH 2HPPH 2QF5A 2ZFSA 1INCA 1T8OA 2A7HA 4K60A 2NU1E 1GHVH 3K9XB 1IQNA 4D9RA 1GBAA 2B5TB 1P2KA 1O3KA 1CA8B 2VIVA 2V6NA 5DP6A 2GZ9A 4LOYH 1BT7A 3MU5A 2QXJA 2BY8X 7GCHF 1GPZA 4J2YB 3E90B 1QBNA 2OC0A 2PSXA 4UEHH 4F48B 1P01A 3RM0H 1EZUC 3GDUA 3E1XB 1GHAF 4M9FA 1QIXB 2ZHWH 4FUBA 4F4OC 4A1TA 1MKXK 4AFSA 3QTVH 1K1LA 1HGTH 1E38B 1GI0A 1O2UA 4DW2U 3BTFE 2A31A 1TGTA 1DY9A 2G51A 5E0HA 1PPHE 1RTKA 4AOQA 1Z8RA 4JK5A 3A7XA 3T62A 1B0EA 2P95A 2QY0B 3V3MA 3SJIA 1MMJN 5ESTE 2VIOA 4CH2B 4YT6H 3SV9A 1SGQE 1O2TA 1DWBH 4DCDA 5F03A 1EAUA 5G4BA 2Z9JA 4BAKB 1A0JA 2TGAA 1PYTD 2ZHEH 2SNVA 2SGEE 2WPJS 1W14U 3VFEA 4RKJB 1BTHH 3A89A 2CK3D 3A80A 5A8ZA 1ELGA 5AFYH 4MPUA 2R0LA 1UTJA 1ACBE 3F0PA 2OC8A 4Q63A 3TGJE 2VIWA 1TPPA 1P0SH 3K6YA 3V12A 1FN8A 4X6NA 1FDPA 3OTJE 3F0OA 3TVJB 3TITA 4ZHMU 4OM9A 1QJ7B 3M3TA 1ELEE 2PGBB 2UUJB 4DGJA 5E8EH 2SGDE 2ODYB 3LONA 3RXIA 2XC4A 2QAAA 4A5TS 1WXRA 4CREA 3ZV9A 3ELAH 1O2QA 4B6EA 5AFZH 4FUCA 2ESTE 2GVFA 5L2ZH 1C2LA 2BZ6H 2GP9B 4OS1A 1F2SE 4IC6A 1TA2A 5AVDA 1V2KT 4UE7H 2TPIZ 1W8BH 4ZROA 2ZDVH 1AUTC 1TNLA 2C8XB 1O5CB 4JYVH 1C2KA 2AYWA 2OP9A 2ZGXH 4K1SA 1EPTA 1NBME 1Z7KA 1JRSA 2ZGHA 1EZQA 3A86A 2WPIS 1TRNA 2GKVE 1QJ6B 1ZTJA 1O2IA 4X2XA 3A7TA 5JDUB 1LMWB 1C9PA 5F6MA 1EASA 1FIWA 4X1RU 4B2CA 5A8XA 1BZXE 1YPLH 1HXFH 1TX6A 3MH5A 3DT0H 4Y8YA 3OY6U 2ODQA 3M5MA 1TNIA 2EA3A 4GSOA 3SV8A 2QGRA 2H9TH 2O8WA 3SJ9A 1GI4A 3LC5A 5C20A 1PPCE 1Z8GA 3BIUH 2KCOA 2FX4A 4X1QU 3H09A 5FBIA 4U30A 1EAXA 4FVDA 1GMCG 4CRGA 3KIDU 3DHKH 2ZPRA 2K1QA 2BY6X 1O3NA 1O37A 1DUEA 1J8AA 4HTCH 1FIZA 2P3FH 1AWHB 3P17H 1D3TB 2HWLB 3S7KB 3BTEE 1HAXB 2RG3A 3O8RA 1H4WA 2BD3A 1SLXB 4WXIA 3UB0A 1BTXA 2OC1A 4X8VH 1GJ8B 3ZZBA 3M35A 1GHBF 2ZA5A 4BTIB 4XBDA 1UTOA 1O2GH 1SMFE 3M7UA 2Z9KA 2PTCE 4CBOA 2ZHFH 2OLGA 3RXTA 2WUBA 3F9GA 1EZSC 3RXCA 1Y59T 4CRDA 1K1JA 5AF9H 4NFEA 2F43B 1ZHRA 1C1UH 2BOKA 1QTFA 4FU7A 1ELVA 2UUKB 3NPSA 3TNTA 1DANH 1GJCB 4INHA 3MQKC 4I8KA 1ZSJA 4MQAA 1SGFA 1HAGE 4QT8C 4FUEA 1PQ8A 3U69H 2XXLA 2HLCA 4AG1A 2HNTC 2ANWA 4X2VA 3EE7A 2TGDA 1QB9A 1LPKB 1GCDA 2FP7B 1AHTH 3P8NA 3SQHE 2J98A 1ZJKA 4Q80A 1ANEA 2FM2A 4BNRA 3PWBA 1ZJDA 4U32A 1C1PA 3BF6H 3ZV8A 3BTDE 1O5GH 1MTWA 4ASUD 3ATKA 1OWKA 1UHBB 3ENSB 1P12E 3N99A 1JXPA 3MU0A 2QIQA 3PWCA 1IQGA 1GBKA 3BV9B 4XFQA 2XCNA 2Q6FA 1RGQA 1ID5H 1XUHA 3UUZA 1H9HE 1WUNH 1O3PB 1FAXA 2ZCKP 4JMYA 1GHWH 4KTCA 1BJVA 3EYDA 1O2SA 2BD2A 2GCHF 2HOBA 1TQ0B 1WDIA 3NUMA 3KN2A 2EI6A 2K8IA 4AFZA 1GGDB 1SGCA 3SN8A 2ZO3H 5J4SA 1T8NA 2WSSD 2BHGA 3VB6A 1XUGA 5LPRA 4Y8ZA 1AO5A 5DO4H 1ESAA 2BOHB 2VH0A 1EOLA 3MTYA 3RC5A 5JB8S 2UWPA 3BG8A 2J4IA 4DIIH 1UVPA 7GCHG 2TIOA 1OWDA 1GJ6A 2QF4A 3GY5A 1DSTA 1TQ7B 2BY7X 1BBRH 4DURA 1GMHF 4D7GA 1YWUA 1CT2E 3HKIB 1MKWK 3SU4A 4NWLA 1PFXC 5GWZA 4FUGA 1P57B 1P10A 2FDAA 2JH5D 3DCLA 5ETXA 4Y10E 2LP6A 1TBQH 2VWMA 2KCPA 1H8HD 2FWWA 1B5GH 1EOJA 1MTSA 3B8JA 1C5XB 1MABB 1S0RA 3SU2A 1WOFA 4WF8A 1A46H 2VIPA 3LGIA 3TJVA 2Z9IA 5JBTA 1OKXA 1MBMA 3P8FA 1QA0A 1D3DB 1ZHMA 3SNAA 3S7HB 1L4ZA 2G5VA 3IG6B 3U9AH 2ZDKA 1EUFA 1H9IE 3HPTB 4X6MA 2FXRA 2PV9B 3GY7A 1ZHPA 1W11U 3MOCA 4P00A 1MD7A 2ANMH 1AKSA 1QZ8A 1GBBA 3ESTA 5FX6A 1G9IE 1AVXA 1TIOA 3HGPA 4DVAU 3UTUH 1SOZA 4X2WA 3RXSA 2VVUA 1GI7B 2SGPE 1HDTH 3Q77A 2F3CE 4K5ZA 3FANA 3BTHE 4NG9H 1NU7B 1TLDA 1X7AC 4Y7BA 1O3DA 4MNXA 4NSVA 3LT3A 2KX4A 3PMHB 5GPIB 1ZTLA 1O2WA 4HZHA 4NIVA 1V2QT 1M9UA 3GCNA 1F0TA 4ISNA 1YLDA 2W6ID 3KL6A 2P3UB 3PMJA 3ATLA 2SGQE 3QGJA 3EDXB 1IQHA 1NPMA 3PB1E 1G2MA 1OWHA 2Z7FE 3N7EA 5L30H 4ABJA 1TPAE 1TNKA 3LKWA 5DKMA 2OBOA 4UFDH 1O34A 1UVSH 1P03A 2IPHA 2A7JA 3RXHA 1PJPA 1C1NA 1QCPA 3FOAA 2JKHA 1GHYH 3GOVB 4ZMAH 1TRYA 3RMOH 1NZQH 1WTGH 1RRKA 5HM9A 3A8AA 2ZC9H 4CBNA 2QYIA 2IOTA 3M7QA 3ODFA 2ZGJA 5HYOA 2PWXA 4NFFA 1E35B 2FOEA 4TY7A 1BHXB 5HGGA 2ZP0H 1AVWA 1TFXA 1UCYE 1NY22 3MH7A 4CHAB 3FO8D 5DG6A 2OUAA 2SFAA 3C27B 1LHCH 3RXMA 1F92A 2BQWB 5K0HA 4B75A 1C1RA 1V2LT 2KFWA 4MTBA 2PR3A 2ZCHP 2A4RA 3SGAE 1BMMH 2EC9H 3SYJA 2EI7A 4ABDA 1THRH 4DIHH 1HYLA 2FPZA 1DWDH 2WPLS 1BMAA 1GDQA 1ZSLA 1FX0B 4FU8A 1GHBG 1T8LA 5GNDA 1HAYB 1F0SA 3R0FA 2CF8H 1AVGH 1C1SA 5GIBA 2H5CA 2OTVA 1A61H 1FV9A 3SORA 3OAAD 1CHOG 3GY3A 1LTOA 1CE5A 1C5RA 1G2LA 2GT8A 1FXYA 1FUJA 1IQLA 2O8UA 1QJ1B 5LGOA 3RXAA 2WPMS 1J16A 1YPEH 2GJGA 2ZFFH 3FZDA 2QF0A 1KTSB 2PTNA 1HBTH 4B74A 4U01A 4I31A 2ZKSA 4DJZB 4D7FA 2KAIB 1NRPH 3PMAB 1HAIH 3ZZ8A 1V6DA 3ODDA 1VZQH 1HJAB 2ZU5A 3A8DA 1UVOA 4Z6AH 3FP8E 1P11E 2VWLA 4RN6A 1VITH 1VITF 4ABBA 5HIZA 3NZIA 2QXIA 3TK6A 1BUIA 1AY6H 1LVBA 3RP2A 1GJ4H 3BG4C 1Z6JH 1V2OT 2BLVA 2BMGB 3ZVBA 1C1OA 1W10U 1HAVB 1P06A 1A0HB 1Y3XA 4K3JA 1ZR0A 1A3BH 3TH2H 2XC5A 2WV5A 4CR9A 3ZVGA 1KDQA 1P3CA 2NU3E 2JJ2D 1D6WA 2J92A 4AFUA 1GMCF 1V2JT 4AYVB 1NBMD 2J94A 4CH8B 3BTKE 1W13U 3R3GB 1DS2E 1TGCA 3QTOH 1ESTA 3M3SA 3NXPA 4IC5A 1C4V2 4Y8XA 1B7XB 2ZDMA 1HAZB 1SHHB 2AH4X 3PLPA 5F53A 1G30B 4ZHAA 3VB4A 2GCHG 1O2YA 1GVZA 3A88A 5C5OA 2C8ZB 3AAVA 2R9PA 5HKKD 2FI5E 3DSOA 3SJOA 4IMQA 3QWCH 1AZZA 3GCTF 4ZKRU 4ZKOU 5A0CA 2XBXA 1N8OB 1LHGH 1FNIA 3UY9A 1ZMLA 1CSOE 4I8HA 3ATMA 3MYWA 4MLFB 3MNXA 2FS9A 4MG3A 1D6RA 2TGTA 1FI8A 4FOUC 1EQ9A 5EW2H 3OX7U 3G01A 4AYYB 1QFKH 1HJAC 2ALVA 3SOSA 2P59A 3P8GA 2LPRA 1O2LA 1QRZA 5C1XA 3S9BA 2Q6GA 1GMHG 3SNDA 5F8TA 1MU6B 1C2GA 1FPHH 5DP9A 4Z0KA 4B1TA 2HLDD 1C2MA 2FX6A 2PKAB 1ARCA 1S81A 2WYJA 2ZCLP 5LPFA 3VXEH 1G37A 4ABFA 3UNRA 1DFPA 4OS5A 1IHSH 2J38A 2J95A 4ZCNA 3SV2H 4RKOB 1LHEH 4TWWA 2C4FH 1ZMJA 1V2UT 1MD8A 2QXGA 3KCGH 4NA8A 1C2EA 1DITH 4KGAA 1CGIE 2A1DB 3PV4A 1BQYA 4NGAH 2A5AA 3E0NB 4WMFA 3NCLA 1G32B 1CGHA 1ETRH 1S6FA 2BXTH 1TNGA 4GCHF 2LNCA 2IJD1 2QA9E 1QBOA 2HNTE 1XX9A 2C8YB 2XYAA 2Y80A 4BAQB 1N8OC 1HAPH 3O8DA 1MU8B 4ABGA 2O8LA 1HV7A 2ASUB 3DFJA 3PRDA 1FY4A 2FOMB 1GBIA 5EODA 3LGTA 3RU4T 5EXMA 5CE1A 3GICB 3SJ8A 2ZQ1A 1C5PA 1ZPCA 1RTFB 3H7TA 1Y5AT 5KGOA 2V0BA 4BAMB 5T1VA 1NRNH 1CA0B 1N6YA 3I77A 3OTPA 1LVYA 1S6LA 2NWNA 3F9HA 4LXBH 1S6HA 3T2NA 1EJMA 1C1WH 1UCYK 3DSGA 3SU0A 4ISHH 1AZ8A 5IYTA 5I25A 1YCPM 3SV7A 5C94A 1LDTT 1LQDB 2XC0A 2EQNA 2ZPQA 2G81E 1CT4E 3BEIB 2IPQX 4HGCA 4BOHA 1XUIA 1FLEE 3UOPA 1NT1A 5L6NH 4E7RG 4DY7B 1GBJA 3DFLA 1YPGH 3M7TA 2VBCA 3N7OA 2BM2A 3MH4A 2VJ1A 1GI8B 4JZDH 1MCTA 2Y6TA 4AZ2B 3RXOA 1SGNE 4D76A 1DM4B 1E0FD 5H4IB 2FOAA 1DICA 4JK6A 3A7YA 2B0FA 1MKXH 1S83A 3UOUA 4B2AA 1W3CA 3P92A 4JZEH 1IQKA 1FY8E 3DD2H 2EEKA 2Q6DA 1QURH 2CXVA 4YOGA 3ZYDA 4NA7A 1GI6A 3RXVA 3QN7A 4HG6A 3RXJA 4NIYA 3FFGA 1CA0C 1E36B 4LZ1H 1Y3WA 7ESTE 3IITA 2KZ4A 2ZNKH 1HIAB 2FO9A 1ZPZA 2ZWLH 3AW1A 3RDZA 1Z6EA 3OU0A 5T6FA 5EPNA 2W3IA 2R0KA 1VGCB 4WWYA 5E2OA 4MNYA 1GI3A 1MUEB 4IBLH 2W6JD 1ZGVA 3A8CA 1H8IH 1KYNA 2BVSH 3ZZ3A 5EXLA 4JCNA 4ASHA 3LU9B 4I33A 1W0KD 2BD8A 1K9OE 3VB5A 3TIUA 1ZOMA 1E1QD 1UTKA 3Q00A 5FXLA 2H9HA 1COWD 4AB9A 2Y5HA 2Y81A 4AB8A 2OK5A 1GCTB 2AFQB 1NFWA 2XTTB 1O2JA 2VIQA 2XBWA 4FVBA 2STBE 3MNBA 5ESBA 1VITG 3CNRA 2WV9A 1JIRA 7KMEH 3SO3A 1RTLA 1DWEH 2BDIA 3MU4A 4O3TA 2PW8H 2B7DH 2BXUH 1QBVH 5ABWA 1ABIH 1GWAA 3RMMH 4CRCA 2VH6A 2YMSB 3SU1A 1J17T 3WY8A 3RC6A 1TX7A 1AU8A 3FP6E 1HPGA 4K1EA 2C3SA 4IS5A 5E0GA 2PP6A 1XUKA 3T26A 1SGTA 3SGBE 2AMQA 1JMOH 1O2PA 2FTMA 3SU5A 1UVUH 3A87A 1VGCC 2D26C 3UQVA 1ETSH 2A5IA 3KYFA 1OP2A 4NA9H 1ZPBA 1BA8B 3AASA 3GCTG 2QC2A 1SGYE 3AVZA 4WMDA 1U6QA 5FPYA 4JZ1A 1O2XA 4Y7AA 3RU4E 1CHOF 1UMAH 2F9VA 1IQFA 4O9VA 1SGPE 2A7CA 3T28A 4AN7A 4Y79A 1ZZZA 3M37A 1ORFA 1UTMA 4XRNA 1GCTC 2F9OA 1LHFH 1V2ST 1P8VC 1HAHH 5GJ4B 2KAIA 3RLYH 3EQ0H 1MTNB 4H4FA 1OS8A 4ISOA 5BRRE 1EFRD 1GJ5H 1O3JA 1D3QB 3SNEA 2XRCA 1SQRA 1AN1E 1TBRH 4ACBA 1SKYE 3SZEA 1TMUH 1AWFH 4XD7D 2QN5T 4KTSA 1O3IA 2YMSC 3TK5A 1P2MA 4BAHB 1DLEA 1CGJE 2A5KA 5A8YA 5T6DA 2XCFA 2ZECA 3RXLA 2W3KA 1SGFG 3ATIA 6GCHF 1NRSH 3F9EA 4Y71A 2AIQA 4Q4LA 1A5HA 1MTUA 2RCEA 5A2MH 2TBSA 3VB3A 1ZRBA 2VB0A 1CQQA 1KLTA 1YC0A 1RJXB 1UJ1A 3GYLB 8ESTE 2AGGX 3A8BA 4GCHG 1K1IA 2C93B 4H42U 1VCPA 1ELAA 9ESTA 1W12U 3KQEA 5BPEA 2HRVA 3E6PH 1Q2WA 2EY4C 6ESTA 2PGQB 1EP6A 4MPWA 1C2JA 4IN1A 2HALA 1YCPH 2K0QA 1QGFA 1ANDA 3A82A 1NM6A 5FPTA 1O2RA 1HXEH 3UPEA 2OQ5A 1SGRE 3N7DA 4Y0YE 1K1MA 1QNJA 5PTPA 2SGFE 3BTQE 1MTNC 2ZTZA 1BBRK 1GJBB 2Y7ZA 1JRTA 1BJUA 3QGNB 1GBFA 3GISB 3TGIE 1SLVB 2A4QA 4O03A 1THSH 5C1YA 1OYQA 3ZZ4A 3OE7D 2H6MA 3SHAH 1BTYA 3E91A 3TJUA 5LPEA 2PKAA 2XOKD 2W5EA 1AIXH 2V3HH 4SGAE 4YTAA 3CENA 5B6LA 4FUFA 3RUOA 3HK3B 1YBWA 3MNCA 1PQ7A 4XE4A 1F5KU 3ITIA 1E34B 3K6ZA 2FOCA 1E79D 2W7UA 1O3GA 1Q3XA 1YY3A 3P6ZB 1FY3A 1BMLA 1W7GH 2J5UA 5EJ1A 3Q3KA 1ELCA 2OD3B 2F9PA 3QZQA 1FZZA 3UWJH 1O5EH 1WSSH 2Y82A 1HLTH 4AGKA 1GGDC 1HB0B 2UUYA 4TYDA 3SUGA 1NO9H 3CS7A 1C5NH 4UDWH 1P9SA 1KLIH 1MTVA 1LCYA 1O3HA 2PUXB 3GYMA 3RXRA 3SBKA 5A0AE 1NTPA 3PLBA 3QLPH 2BYAX 2H5DA 5JBAS 5A0BA 2A2QH 3BEUA 2AGIX 4WJG2 1EP5A 2YOLA 2Z3DA 1V2MT 1TMTH 1O2MA 1XMNB 2W26A 2BDAA 2ZF0H 3A7ZA 4FUHA 5HMAA 1TBZH 1WU1A 1FAKH 4RI0A 5JYIA 1C1TA 1Y5UT 1C1QA 2O9QA 3UR9A 1LHDH 1DDJA 1K28D 3Q76A 2Z3EA 2VNTA 1A5GH 4IN2A 3RLWH 1PPBH 1TGNA 1BITA 5CHAB 1TA6A 2V35A 1KXBA 3BTTE 1HUTH 1TGSZ 3KNXA 1AE5A 3WW7A 1YYY1 1OP0A 3VEQB 4FUIA 3F9FA 1C2FA 3UIRA 1SFQB 2THFB 1AB9B 1V2TT 2PFEA 2G4UA 2VU8E 1LO6A 4TY6A 3RMNH 4R0IA 1W0JD 3PROA 2F91A 3E0PB 2GZ7A 1GI1A 4YOIA 4Q7ZA 4D9QA 3HK6B 2HVXA 3ZYEA 4I32A 4B76A 3W1EA 1H8DH 1T31A 3MI4A 2JIZD 4YESB 4BTUB 3KGPA 1EPTB 3ZZ5A 1WTHD 1ELDE 5F8ZA 2GZ8A 8LPRA 2FI4E 2GX4A 4LK4A 2FMJA 1KIGH 4F49A 2CJIA 2FYRA 1O36A 2ULLA 3FAOA 2ZU4A 3U8OH 8GCHG 4RSPA 1HJ9A 3UREA 1QRWA 1CBWB 4X8TH 2KM0A 1P9UA 2JETB 2J9NA 4D8NA 1O3EA 5DP3A 3SUDA 1ELFA 1AUJA 1W0ZU 2O8MA 1O3OA 1KTTB 5CHAC 1PPEE 1UTPA 3S9AA 1KXCA 4ABEA 2VINA 1F0UA 2OCVB 3JZ1B 1UO6A 2HGTH 1C1MA 2ANYA 2CN0H 4X8SH 1D3PB 2KR7A 2H1UA 2F9BH 1AB9C 4ABAA 1HFDA 3RC4A 2Z3CA 4KELA 1GI2A 5JBCS 4WVPE 1O3FA 3H7OA 1AFEH 2ZZUH 3C1KA 4AFQA 4I86A 1N6XA 1J15A 1YPHC 1L1NA 2FOHA 4FETA 3RXBA 3W94A 2UWLA 4OGYA 3OEED 5T6GA 1EPTC 2SNWA 2IJOB 2AEIH 2BDGA 3F2HA 5IDKA 4CHAC 2XNDD 4XSKU 4UFEH 1C9TA 1ZYOA 4CR5A 6GCHG 4ISLA 1K0HA 2H2ZA 3ZVDA 1AFQB 1VCWA 2BX3A 4ZXXH 3FN8A 2FESH 1O39A 1O30A 1CBWC 4FU9A 4Z1MD 2XWBI 4I7YH 4A7IB 3KQDA 2J98B 3KQ5A 5C1UA 1S0QA 2JETC 4NZQA 1UTQA 2CMYA 4LZ4B 4XOJA 4XBCA 4E06H 2ZU1A 1GDUA 4HFPB 3M5LA 3D65E 1T7CA 3UNSA 4YOJA 1NC6A 3OFND 4OGXA 1GDNA 1O2NA 3ZZDA 1L4DA 2BD4A 2BDCA 1H9LB 2XWAA 3V0XA 1EATA 1NS3A 2GMTB 3A84A 3F68H 3SI3H 2BD5A 2FI3E 5CDFE 3S0NA 1SQOA 1V2VT 3Q3YA 1N1LA 3OSYA 1AQ7A 2QV1A 4H6TA 4ZKSU 1RFNA 2VGCB 1EB2A 1A7SA 3B23B 1O5BB 1E37B 1UW7A 1PYTC 2J34A 3QUMP 2GTBA 1T4VH 1BRUP 1BMFD 2ZDNA 2HPQH 3SNBA 1MAYA 1YGCH 3UWIA 2P8OB 1OX1A 1UTNA 2BLOA 1ZLRA 4JYUH 1BTUA 4YLQH 1TABE 2ZEBA 6LPRA 2ZPSA 3JZ2B 4CRAA 2BDBA 5FX5A 2L6OA 4B73A 2FLRH 2F83A 3SZNA 1A5IA 4Y6DA 3QK1A 5JBBS 3K2UA 5EPYA 3BEFB 3NRLA 3RU4D 1OOKB 4A92A 1P2IA 1WQVH 5LH8A 3TGKE 3MNSA 3M5OA 5C17A 1UHBA 3S9CA 1LKAA 4ISIH 5TCAA 1GBLA 2ILNA 3PYHA 1OHHD 3LC3A 2V3MA 1FY5A 1MAXA 1UVTH 5TCCA 2TGPZ 1FJSA 1Z8JB 2ZGBH 1OXGA 3SUFA 2ZGCA 1T4UH 1DXWA 1AGJA 3TJOA 4P02A 5GDSH 2XW9A 1IOEA 3LPRA 4Y76A 1BRBE 3M36A 2A4OA 3K65B 3PO1B 3RXPA 5DJ7A 2JJ1D 2GMTC 3LGWA 1IHTH 1QY6A 3TLOA 1O2OA 4X2YA 1XKAC 4ZH8A 4BANB 1NFYA 1G3EA 2G00A 4X6PA 4FUDA 2BDYA 2VGCC 3SHCH 2Y7XA 1P04A 1A2CH 4CRFA 1QRXA 3T29A 1GJDB 4WY3A 2P94A 3L33A 4U2WA 5CMXH 2P8OC 5EXNA 2RA0A 1Y3UA 3UQOA 1A0LA 5GXPA 1MCVA 1AMHA 1A1RA 3H5CB 4HI3A 5C2ZA 3LGVA 4K8YA 2FOBA 1YLNA 4X1NU 1O3AA 1O3CA 3MO9A 4X0WU 2PHBA 3BTWE 2A0QB 2OC7A 1WCZA 4TPIZ 1SGEE 3MU8A 5I46H 3T27A 1YLCA 1DT2A 2GCTB 3A7VA 2Z9LA 4A1XA 2R2MB 2VVVA 4ABIA 5EG4A 3U8RH 2RFKC 1S82A 4X8UH 1TOCB 1P09A 5EJLA 3BTME 4K2YA 1BBRE 3PO1C 4OS4A 2OBQA 5DPAA 1G3BA 1TNJA 3TH4H 1UCYH 4YXWD 1RS0A 1P2QA 2R3YA 1C4U2 2B8OH 1TAWA 2M2AA 5EQRA 5TJXA 4I8LA 1K1OA 2VIDA 2AS9A 3ZVCA 4WH8A 4INLA 4H6SB 2BDHA 3ZVAA 5C0TA 5K7RA 3U1JB 2ZTXA 3URCA 1EJAA 2QE7D 1EX3A 1FMGA 5B6OA 2BQ6B 2GV6A 4AG2A 1O2KA 1O5FH 3VPKA 2FEQH 3E8LA 1FONA 1BOQA 2FYQA 1SSXA 4TPYA 1FY1A 1NROH 1T8MA 1TGBA 2FOFA 5EQSA 3M3VA 1SGDE 3P8OA 3SNCA 5FCKA 1SG8B 1DOJA 3GY8A 5FAHA 1AD8H 3GY4A 4AC9A 1MH0A 3RMLH 5HXFA 5A09A 1SI5H 1YP9A 2P3TB 4GLYA 3L6PA 1OP8A 3EGKH 1GMDF 2GCTC 4GPGA 3ZZ7A 1KY9A 1IQIA 3STIA 1EB1H 4R8TB 2IN2A 4GAWA 1SLUB 1DWCH 2VWOA 1FN6A 3TJNA 3F3BA 5EIYA 1BTZA 1GL0E 3PTNA 1KXFA 4ZUHA 2J2UA 1JIMA 1GBHA 4UFFH 2GDEH 5EGMA 1HCGA 1CO7E 1V3XA 2BX4A 1JWTA 1SC8U 4AX9H 1SB1H 1O38A 2GD4B 4GHTA 2WINI 3U28C 1D9IA 1PQ5A 1W2KH 3A81A 2XBYA 2ZQ2A 1EXFA 4MNWA 1ABJH 1D4PB 1SHYA 1IAUA 5E2PA 2NU0E 1BMNH 1NESE 1XXFA 1QR3E 2WPDD 1B0FA 8GCHF 1MBQA 1SLWB 2RDEA 1Y8TA 4YZUA 1F5LA 1JBUH 1LVOA 1YF4A 1QA7A 2WYGA 3P70B 2AGEX 1BB0B 3BN9A 3PV2A 3QX5H 3T5FH 5F8XA 5EW1H 3TK9A 1SQAA 1GJAB 4GUXA 3SUEA 1DLKB 1V2NT 1YKTA 5DK1A 3D49H 2G8TA 3F2GA 1KDQB 2D8WA 2F9NA 4IGDA 3SI4H 3UAIC 1IQJA 4X1SU 5EOKA 2BD7A 1UTLM 3FVFB 3RXUA 4DG4A 1RD3B 2ZHDA 3DSPA 3E16B 4K8BA 1Z1IA 2V3OH 2F9UA 2NU2E 2YNAA 1NRRH 3PRBA 1DX5M 4IMZA 1ANCA 2CF9H 1RIWB 5C3NA 4JZIA 2UWOA 3GCOA 6CHAB 1SQTA 1LKBA 1G3DA 4NZLA 2KCAA 2R2WU 3ZZ9A 1EZXC 1L2EA 1Q31A 5DP7A 5KEDA 1H1BA 1O3LA 1VJAU 4TT3D 1O31A 3HATH 1SPJA 2CGAA 2ZFTA 3F2FA 2BQ7B 1GG6B 3VGCB 3I29A 1DSUA 1SFIA 4YT7H 5C0UA 3GS9A 1HAVA 2BVRH 2BY5X 5JB9S 4X6OA 1ANBA 1Z71A 2EI8A 2ZHQH 1O3BA 1PPZA 1O5DH 1OWIA 1C5WB 1QB1A 3MFJA 5DP5A 3VG8A 1C5UA 1HAOH 3FKSD 1QL9A 3EA8A 1GVLA 2HNTF 1YCPK 1DY8A 1C5OH 2PKSB 1YPHE 1S5SA 1BTWA 1RXPA 1XM1A 5FCRA 1F0RA 5CHBA 2SGAA 1GBMA 1S84A 2XBVA 2ZFPH 3NKKA 2O8TA 3AAUA 1BDAA 1G36A 1SVPA 2BLWA 1CT0E 2BTCE 4JYTA 1J9CH 1YPMH 1O5AB 1T32A 2BB4A 4A1VA 3S69A 3U1IB 1RIWC 3U98H 1NFXA 6CHAC 3RM2H 2BD9A 2Z9GA 4BTTB 5SGAE 4F55A 4ZHLU 1P3EA 1Z1JA 1C1VH 1XXDA 1UK3A 1YPKH 1SR5C 1GG6C 1GVKB 3VGCC 1C2IA 2ZI2H 3VXFH 1F5RA 1TWXB 3MWIU 1DXPA 3T25A 1C2DA 1IQEA 2A32A 2Z94A 3URDA 1TONA 4E05H 2G4TA 4MVNA 9LPRA 1NFUA 1TPOA 2FS8A 1CVWH 2VWNA 1QQ4A 3PMBB 3OYPA 5GCHF 1OYTH 3GY2A 4THNH 3KEEA 3SW2B 1AE8H 3EA7A 5EQQA 3QZRA 1C2HA 4NWKA 2HVYB 5C5NA 2Z6BD 5JPMH 1WAYB 3A7WA 2AMDA 1GHAG 2B9LA 1LQEA 5J4QA 3PM3A 1WBGB 2PKSC 5HM2A 1C5TA 3BSQA 3OY5U 4SGBE 1EAIA 1MKWH 3TH3H 3ZZ6A 5DN6D 1GL1A 1NN6A 3O8CA 4Y11E 4UONA 2L74A 3NK8A 1ZSKA 1KMHB 2BVXH 1MZAA 3HGNA 2I6SA 1L1JA 4UD9H 3F6UH 5EJZA 3BTGE 4Q7YA 5DSFA 3RXEA 4E7NA 5FBEA 3KQCA 4ACAA 3PTBA 2WHXA 3GDSA 2DE8A 2FZZA 1S85A 2DE9A 3SQEE 4OS7A 2A4GA 4ZKNU 1EAWA 2AHME 3L3TA 2PLXA 4TWYA 3ZVEA 1FQ3A 3EAJA 1BTPA 1GHXH 1TMBH 1HRTH 1SL3A 2FOGA 1G3CA 1PPFE 1GBDA 2LELA 2M5TA 2QF3A 2ZIQH 4ZXYH 1GMDG 1GHZA 1V2RT 4I8JA 3QO6A 1HJ8A 2FODA 4MPXA 1KLJH 4UFGH 3BIVH 3TNSA 2JH6D 2PSYA 4O3UA 1NRQH 2AERH 4WXVA 3RXDA 1EJNA 3MO3A 3ZVFA 2YMSD 3GY6A 4YLUA 3PV5A 3QDZB 3UFAA 1MQ5A 4A6LA 2ZDLA 1K2I1 3EA9A 1H8ED 1KXEA 2A2XH 1YM0A 2WPHS 5KECA 3CS0A 5DP8A 2W7SA 3GCHB 1KXDA 1O2HA 5T3HA 1ZGIA 1A4WH 1C5ZB 2ZG0H 3WWBA 3V7TA 2ANKH 3PLKA 1LVMA 1O35A 2WV4A 4YM9A 2OQUA 1KXAA 4K1TA 2R3UA 1LPGB 4AGJA 3LGYA 3LIWA 4Q7XA 1GJ7B 5DP4A 5FHTA 2CHAB 1OPHB 1CU1A 3SGQE 3A85A 4Q2KA 4VGCB 3RXGA 2BY9X 4B71A 1HNEE 2DUCA 4ZAEA 4WH6A 1TALA 4BAOB 2FIRH 2AIPA 1AI8H 4MNVA 1YPJH 3CP7A 1HIAA 1NU9A 3LH3A 1O32A 1Y3YA 4BXSA 3BG4B 1Y5BT 1K22H 1L0ZA 2ODPA 3I78A 1TYNA 4OS6A 1VJ9U 4BXWA 1C5MD 2STAE 2JDID 5L2YH 1ZTKA 1ELBA 3STJA 2Y5FA 1W0YH 1C5VA 4NIWA 2P93A 1TX8A 1GBEA 3MO6A 1TNHA 2H9EH 1XKBC 3OEHD 4FUJA 3TU7H 3GCHC 1O2ZA 1DVAH 1P05A 2NU4E 5DGJA 2J97A 1QB6A 4GHQA 8KME2 3ZZCA 2P16A 2G55A 1GBTA 3MU1A 3D62A 2YNBA 1P2OA 3FZZA 1F7ZA 1WYKA 1Z8IB 1GI5A 1O0DH 2Q1JA 3RXKA 2RDLA 1L1GA 1XVMA 4ABHA 5FPSA 5FL7D 1P2NA 1XUJA 4M7GA 4FXGH 4TSFD 3D23A 3FP7E 2XNIA 2CHAC 1FPCH 4NCYA 3MMGA 2TRMA 4VGCC 1OWEA 3MH6A 1C5YB 4I8GA 4JZFH 4B2BA 4DT7B 1KSNA 3MHWU 1BCUH 1QHRB 1XUFA 3M5NA 1UK4A 1BRAA 2CV3A 2AMPA 7LPRA 1K21H 3V13A 3LH1A 1V2WT 2VVCA 3SV6A 3NWUA 1PQAA 1BHXF 3HKJB 1K1NA 5EU8A 4PROA 4RT0A 4OS2A 1OWJA 2ZTYA 1P2JA 2ALPA 3AK5A 3KHVA 1ESBA 3LGUA 2G5NA 3ZZAA 1IQMA 1O33A 1LPZB 2A45B 5AHGH 2KCYA 4KTUA 3ZIAD 3DA9B 1W7XH 2D2DA 1BIOA 1BRCE 2G52A 1DUAA 1O3MA 3RXFA 2PUQH 3LJOA 3VB7A 2GGVB 3TPIZ 2JH0D 1WQSA 3LJJA 5HIYA 3SU6A 1ZRKA 1QL8A 1K1PA 4K69A 3SU3A 4B6FA 4X1PU 3W95A 3LOXA 1VKYA 1QQUA 1DE7H 3KYGA 3B9FH 2FTLE 4MPVA 1C5SA 3SJKA 2F4LA 3EE0B 3UR6A 5C67A 1GBCA 3DUXH 5E0JA 2ZU2A 4CRBA 1ZMNA 2ZDAH 2ZFRH 1GJ9B 4GVUA 2C90B 1TOMH 2RA3A 4O97A 1OSSA 2GT7A 2GDDA 1CHGA 3RXQA 1ELTA 1SGIB 1WV7H 3A83A 5GCHG 4J1YA 1AFQC 4AORA 4Y0ZE 1TE0A 4IW4E 1VCQA 2Y5GA 4WMEA 1P02A 4RT1A 2FLBH 1MQ6A 1O2VA 1C4Y2 1J14A 1V2PT 3O8BA 3KF2A 3WWFA 1E1RD 3E3TA 4INKA 2QCYA 3M61U 1VR1H 4ESTE 2GV7A 3UNQA 2WPKS 1DPOA 2WUCA 3F1SB 3P95A 2ZFQH 1ARBA 4NIXA 1XVOA 4DT4A 2ZU3A 2WZQA 3AW0A 3IWMA 1UK2A 1QL7A 3ATWA 1C5LH 1EKBB 3KQBA
chains in the Genus database with same CATH topology
4KP0A 4XBBA 4YO9A 2OINA 1A3EH 1TB6H 1THPB 1Y3VA 1MZDA 1SBWA 2I6QA 3Q3XA 1PPGE 2C8WB 4XDEA 3U8TH 1GI9B 2BLQA 1TPSA 1TRMA 2UUFB 1JOUB 1ETTH 4DOQA 3GDVA 1SOTA 2BZAA 2QXHA 2D1JA 1C5QA 4NSYA 1AKSB 2OXSA 4KKDA 4MDSA 3LDXH 2HPPH 2ZFSA 1INCA 1T8OA 2A7HA 4K60A 2NU1E 1GHVH 3K9XB 1IQNA 4D9RA 1GBAA 2B5TB 1P2KA 1O3KA 1CA8B 2VIVA 2V6NA 5DP6A 2GZ9A 4LOYH 1BT7A 3MU5A 2QXJA 2BY8X 7GCHF 1GPZA 4J2YB 3E90B 1QBNA 2OC0A 2PSXA 4UEHH 1P01A 3RM0H 1EZUC 3GDUA 3E1XB 1GHAF 1QIXB 2ZHWH 4FUBA 4F4OC 4A1TA 1MKXK 4AFSA 3QTVH 1K1LA 1HGTH 1E38B 1GI0A 1O2UA 4DW2U 3BTFE 2A31A 1TGTA 1DY9A 2G51A 5E0HA 1PPHE 1RTKA 4AOQA 1Z8RA 4JK5A 3A7XA 3T62A 1B0EA 2P95A 2QY0B 3V3MA 3SJIA 1MMJN 5ESTE 2VIOA 4CH2B 4YT6H 3SV9A 1SGQE 1O2TA 1DWBH 4DCDA 5F03A 1EAUA 5G4BA 2Z9JA 4BAKB 1A0JA 2TGAA 1PYTD 2ZHEH 2SNVA 2SGEE 2WPJS 1W14U 3VFEA 4RKJB 1BTHH 3A89A 3A80A 5A8ZA 1ELGA 5AFYH 4MPUA 2R0LA 1UTJA 1ACBE 2OC8A 3TGJE 2VIWA 1TPPA 1P0SH 3K6YA 3V12A 1FN8A 4X6NA 1FDPA 3OTJE 3TVJB 3TITA 4ZHMU 1QJ7B 3M3TA 1ELEE 2PGBB 2UUJB 4DGJA 5E8EH 2SGDE 2ODYB 3LONA 3RXIA 2XC4A 2QAAA 4A5TS 4CREA 3ZV9A 3ELAH 1O2QA 5AFZH 4FUCA 2ESTE 2GVFA 5L2ZH 1C2LA 2BZ6H 2GP9B 4OS1A 1F2SE 4IC6A 1TA2A 5AVDA 1V2KT 4UE7H 2TPIZ 1W8BH 4ZROA 2ZDVH 1AUTC 1TNLA 2C8XB 1O5CB 4JYVH 1C2KA 2AYWA 2OP9A 2ZGXH 4K1SA 1EPTA 1Z7KA 2ZGHA 1JRSA 1EZQA 3A86A 2WPIS 1TRNA 2GKVE 1QJ6B 1ZTJA 1O2IA 4X2XA 3A7TA 5JDUB 1LMWB 1C9PA 5F6MA 1EASA 1FIWA 4X1RU 4B2CA 5A8XA 1BZXE 1YPLH 1HXFH 1TX6A 3MH5A 3DT0H 4Y8YA 3OY6U 2ODQA 3M5MA 1TNIA 2EA3A 4GSOA 3SV8A 2QGRA 2H9TH 2O8WA 3SJ9A 1GI4A 3LC5A 5C20A 1PPCE 1Z8GA 3BIUH 2FX4A 4X1QU 5FBIA 4U30A 1EAXA 4FVDA 1GMCG 4CRGA 3KIDU 3DHKH 2ZPRA 2K1QA 2BY6X 1O3NA 1O37A 1DUEA 1J8AA 4HTCH 1FIZA 2P3FH 1AWHB 3P17H 1D3TB 2HWLB 3S7KB 3BTEE 1HAXB 2RG3A 3O8RA 1H4WA 2BD3A 1SLXB 4WXIA 1BTXA 2OC1A 4X8VH 1GJ8B 3ZZBA 3M35A 1GHBF 2ZA5A 4BTIB 4XBDA 1UTOA 1O2GH 1SMFE 3M7UA 2Z9KA 2PTCE 4CBOA 2ZHFH 2OLGA 3RXTA 2WUBA 3F9GA 1EZSC 3RXCA 1Y59T 4CRDA 1K1JA 5AF9H 4NFEA 1ZHRA 1C1UH 2BOKA 1QTFA 4FU7A 1ELVA 2UUKB 3NPSA 3TNTA 1DANH 1GJCB 4INHA 4I8KA 1ZSJA 4MQAA 1SGFA 1HAGE 4QT8C 4FUEA 1PQ8A 3U69H 2XXLA 2HLCA 4AG1A 2HNTC 2ANWA 4X2VA 2TGDA 1QB9A 1LPKB 1GCDA 2FP7B 1AHTH 3P8NA 3SQHE 4Q80A 1ZJKA 1ANEA 2FM2A 4BNRA 3PWBA 1ZJDA 4U32A 1C1PA 3BF6H 3ZV8A 3BTDE 1O5GH 1MTWA 3ATKA 1OWKA 1UHBB 3ENSB 1P12E 1JXPA 3MU0A 2QIQA 3PWCA 1IQGA 1GBKA 3BV9B 4XFQA 2XCNA 2Q6FA 1RGQA 1ID5H 1XUHA 3UUZA 1H9HE 1WUNH 1O3PB 1FAXA 2ZCKP 4JMYA 1GHWH 4KTCA 1BJVA 3EYDA 1O2SA 2BD2A 2GCHF 2HOBA 1TQ0B 3NUMA 3KN2A 2EI6A 4AFZA 1GGDB 1SGCA 3SN8A 2ZO3H 5J4SA 1T8NA 2BHGA 3VB6A 1XUGA 5LPRA 4Y8ZA 1AO5A 5DO4H 1ESAA 2BOHB 2VH0A 1EOLA 3MTYA 3RC5A 5JB8S 2UWPA 3BG8A 2J4IA 4DIIH 1UVPA 7GCHG 2TIOA 1OWDA 1GJ6A 3GY5A 1DSTA 1TQ7B 2BY7X 1BBRH 4DURA 1GMHF 4D7GA 3HKIB 1CT2E 1MKWK 3SU4A 4NWLA 1PFXC 5GWZA 4FUGA 1P57B 1P10A 2FDAA 2JH5D 5ETXA 4Y10E 1TBQH 2VWMA 2FWWA 1B5GH 1EOJA 1MTSA 3B8JA 1C5XB 1S0RA 3SU2A 1WOFA 4WF8A 1A46H 2VIPA 3LGIA 3TJVA 2Z9IA 5JBTA 1OKXA 1MBMA 3P8FA 1QA0A 1D3DB 1ZHMA 3SNAA 3S7HB 1L4ZA 2G5VA 3IG6B 3U9AH 2ZDKA 1EUFA 1H9IE 3HPTB 4X6MA 2FXRA 2PV9B 3GY7A 1ZHPA 1W11U 3MOCA 1MD7A 2ANMH 1AKSA 1GBBA 3ESTA 5FX6A 1G9IE 1AVXA 1TIOA 3HGPA 4DVAU 3UTUH 1SOZA 4X2WA 3RXSA 2VVUA 1GI7B 2SGPE 1HDTH 3Q77A 2F3CE 4K5ZA 3FANA 3BTHE 4NG9H 1NU7B 1TLDA 1X7AC 4Y7BA 1O3DA 4MNXA 4NSVA 3LT3A 5GPIB 3PMHB 1ZTLA 1O2WA 4HZHA 4NIVA 1V2QT 1M9UA 3GCNA 1F0TA 4ISNA 1YLDA 3KL6A 2P3UB 3PMJA 3ATLA 2SGQE 3QGJA 3EDXB 1IQHA 1NPMA 3PB1E 1G2MA 1OWHA 2Z7FE 5L30H 4ABJA 1TPAE 1TNKA 3LKWA 5DKMA 2OBOA 4UFDH 1O34A 1UVSH 1P03A 2IPHA 2A7JA 3RXHA 1PJPA 1C1NA 1QCPA 2JKHA 1GHYH 3GOVB 4ZMAH 1TRYA 3RMOH 1NZQH 1WTGH 1RRKA 5HM9A 3A8AA 2ZC9H 4CBNA 2QYIA 2IOTA 3M7QA 3ODFA 2ZGJA 5HYOA 2PWXA 4NFFA 1E35B 2FOEA 4TY7A 1BHXB 5HGGA 2ZP0H 1AVWA 1TFXA 1UCYE 1NY22 3MH7A 4CHAB 5DG6A 2OUAA 2SFAA 3C27B 1LHCH 3RXMA 1F92A 2BQWB 5K0HA 4B75A 1C1RA 1V2LT 4MTBA 2PR3A 2ZCHP 2A4RA 3SGAE 1BMMH 2EC9H 2EI7A 4ABDA 1THRH 4DIHH 1HYLA 2FPZA 1DWDH 2WPLS 1BMAA 1GDQA 1ZSLA 4FU8A 1GHBG 1T8LA 1HAYB 1F0SA 3R0FA 2CF8H 1AVGH 1C1SA 5GIBA 2H5CA 2OTVA 1A61H 1FV9A 3SORA 1CHOG 3GY3A 1LTOA 1CE5A 1C5RA 1G2LA 2GT8A 1FXYA 1FUJA 1IQLA 2O8UA 1QJ1B 5LGOA 3RXAA 2WPMS 1J16A 1YPEH 2ZFFH 3FZDA 2QF0A 1KTSB 2PTNA 1HBTH 4B74A 4U01A 4I31A 2ZKSA 4DJZB 4D7FA 2KAIB 1NRPH 3PMAB 1HAIH 3ZZ8A 1V6DA 3ODDA 1VZQH 1HJAB 2ZU5A 3A8DA 1UVOA 4Z6AH 3FP8E 1P11E 2VWLA 4RN6A 1VITH 1VITF 4ABBA 3NZIA 2QXIA 3TK6A 1BUIA 1AY6H 1LVBA 3RP2A 1GJ4H 3BG4C 1Z6JH 1V2OT 2BLVA 2BMGB 3ZVBA 1C1OA 1W10U 1HAVB 1P06A 1A0HB 1Y3XA 4K3JA 1ZR0A 1A3BH 3TH2H 2XC5A 2WV5A 4CR9A 3ZVGA 1KDQA 1P3CA 2NU3E 1D6WA 2J92A 4AFUA 1GMCF 1V2JT 4AYVB 2J94A 4CH8B 3BTKE 1W13U 3R3GB 1DS2E 1TGCA 3QTOH 1ESTA 3M3SA 3NXPA 4IC5A 1C4V2 4Y8XA 1B7XB 2ZDMA 1HAZB 1SHHB 2AH4X 3PLPA 1G30B 4ZHAA 3VB4A 2GCHG 1O2YA 1GVZA 3A88A 5C5OA 2C8ZB 3AAVA 2R9PA 2FI5E 3SJOA 4IMQA 3QWCH 1AZZA 3GCTF 4ZKRU 4ZKOU 5A0CA 2XBXA 1N8OB 1LHGH 1FNIA 3UY9A 1ZMLA 1CSOE 4I8HA 3ATMA 3MYWA 4MLFB 3MNXA 2FS9A 4MG3A 1D6RA 2TGTA 1FI8A 1EQ9A 5EW2H 3OX7U 3G01A 4AYYB 1QFKH 1HJAC 2ALVA 3SOSA 2P59A 3P8GA 2LPRA 1O2LA 1QRZA 5C1XA 3S9BA 2Q6GA 1GMHG 3SNDA 5F8TA 1MU6B 1C2GA 1FPHH 5DP9A 4Z0KA 4B1TA 1C2MA 2FX6A 2PKAB 1ARCA 1S81A 2WYJA 2ZCLP 5LPFA 3VXEH 1G37A 4ABFA 3UNRA 1DFPA 4OS5A 1IHSH 2J38A 2J95A 3SV2H 4RKOB 1LHEH 4TWWA 2C4FH 1ZMJA 1V2UT 1MD8A 2QXGA 3KCGH 4NA8A 1C2EA 1DITH 4KGAA 1CGIE 2A1DB 3PV4A 1BQYA 4NGAH 2A5AA 3E0NB 4WMFA 3NCLA 1G32B 1CGHA 1ETRH 1S6FA 2BXTH 1TNGA 4GCHF 2LNCA 2QA9E 1QBOA 2HNTE 1XX9A 2C8YB 2XYAA 2Y80A 4BAQB 1N8OC 1HAPH 3O8DA 1MU8B 4ABGA 2O8LA 1HV7A 2ASUB 3DFJA 1FY4A 2FOMB 1GBIA 5EODA 3LGTA 3RU4T 5EXMA 5CE1A 3GICB 3SJ8A 2ZQ1A 1C5PA 1ZPCA 1RTFB 3H7TA 1Y5AT 2V0BA 4BAMB 1NRNH 1CA0B 1N6YA 3I77A 1LVYA 2NWNA 3F9HA 4LXBH 1S6HA 3T2NA 1EJMA 1C1WH 1UCYK 3SU0A 4ISHH 1AZ8A 5IYTA 5I25A 1YCPM 3SV7A 1LDTT 1LQDB 2XC0A 2ZPQA 2G81E 1CT4E 3BEIB 4HGCA 4BOHA 1XUIA 1FLEE 3UOPA 1NT1A 5L6NH 4E7RG 4DY7B 1GBJA 3DFLA 1YPGH 3M7TA 3N7OA 2BM2A 3MH4A 2VJ1A 1GI8B 4JZDH 1MCTA 2Y6TA 4AZ2B 3RXOA 1SGNE 4D76A 1DM4B 1E0FD 5H4IB 2FOAA 1DICA 4JK6A 3A7YA 2B0FA 1MKXH 1S83A 3UOUA 4B2AA 1W3CA 3P92A 4JZEH 1IQKA 1FY8E 3DD2H 2EEKA 2Q6DA 1QURH 2CXVA 4YOGA 3ZYDA 4NA7A 1GI6A 3RXVA 3QN7A 3RXJA 4NIYA 3FFGA 1CA0C 1E36B 4LZ1H 1Y3WA 7ESTE 3IITA 2ZNKH 1HIAB 2FO9A 1ZPZA 2ZWLH 3AW1A 3RDZA 1Z6EA 3OU0A 5T6FA 5EPNA 2W3IA 2R0KA 1VGCB 4WWYA 5E2OA 4MNYA 1GI3A 1MUEB 4IBLH 1ZGVA 3A8CA 1H8IH 1KYNA 2BVSH 3ZZ3A 5EXLA 4JCNA 4ASHA 3LU9B 4I33A 2BD8A 1K9OE 3VB5A 3TIUA 1ZOMA 1UTKA 3Q00A 5FXLA 4AB9A 2H9HA 2Y5HA 2Y81A 4AB8A 1GCTB 2AFQB 1NFWA 2XTTB 1O2JA 2VIQA 2XBWA 4FVBA 2STBE 3MNBA 5ESBA 1VITG 1JIRA 7KMEH 3SO3A 1RTLA 1DWEH 2BDIA 3MU4A 4O3TA 2PW8H 2B7DH 2BXUH 1QBVH 5ABWA 1ABIH 1GWAA 3RMMH 4CRCA 2VH6A 3SU1A 1J17T 3WY8A 3RC6A 1TX7A 1AU8A 3FP6E 1HPGA 4K1EA 2C3SA 4IS5A 5E0GA 1XUKA 3T26A 1SGTA 3SGBE 2AMQA 1JMOH 1O2PA 2FTMA 3SU5A 1UVUH 3A87A 1VGCC 2D26C 3UQVA 1ETSH 2A5IA 1OP2A 4NA9H 1ZPBA 1BA8B 3AASA 3GCTG 2QC2A 1SGYE 3AVZA 4WMDA 1U6QA 5FPYA 4JZ1A 1O2XA 4Y7AA 3RU4E 1CHOF 1UMAH 2F9VA 1IQFA 4O9VA 1SGPE 2A7CA 3T28A 4AN7A 4Y79A 1ZZZA 3M37A 1ORFA 1UTMA 1GCTC 2F9OA 1LHFH 1V2ST 1P8VC 1HAHH 5GJ4B 2KAIA 3RLYH 3EQ0H 1MTNB 4H4FA 1OS8A 4ISOA 5BRRE 1GJ5H 1O3JA 1D3QB 3SNEA 2XRCA 1AN1E 1TBRH 1TMUH 1AWFH 2QN5T 4KTSA 1O3IA 3TK5A 1P2MA 4BAHB 1DLEA 1CGJE 2A5KA 5A8YA 5T6DA 2XCFA 2ZECA 3RXLA 2W3KA 1SGFG 3ATIA 6GCHF 1NRSH 3F9EA 4Y71A 2AIQA 1A5HA 1MTUA 2RCEA 5A2MH 2TBSA 3VB3A 1ZRBA 2VB0A 1CQQA 1KLTA 1YC0A 1RJXB 1UJ1A 3GYLB 8ESTE 2AGGX 3A8BA 4GCHG 1K1IA 2C93B 4H42U 1VCPA 1ELAA 9ESTA 1W12U 3KQEA 5BPEA 2HRVA 3E6PH 1Q2WA 6ESTA 2PGQB 1EP6A 4MPWA 1C2JA 4IN1A 2HALA 1YCPH 1QGFA 1ANDA 3A82A 1NM6A 5FPTA 1O2RA 1HXEH 3UPEA 2OQ5A 1SGRE 4Y0YE 1K1MA 1QNJA 5PTPA 2SGFE 3BTQE 1MTNC 2ZTZA 1BBRK 1GJBB 2Y7ZA 1JRTA 1BJUA 3QGNB 1GBFA 3GISB 3TGIE 1SLVB 2A4QA 4O03A 1THSH 5C1YA 1OYQA 3ZZ4A 2H6MA 3SHAH 1BTYA 3E91A 3TJUA 5LPEA 2PKAA 2W5EA 1AIXH 2V3HH