1QA7A

Crystal complex of the 3c proteinase from hepatitis a virus with its inhibitor and implications for the polyprotein processing in hav
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGAQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HAV 3C PROTEINASE
publication title Crystal structure of an inhibitor complex of the 3C proteinase from hepatitis A virus (HAV) and implications for the polyprotein processing in HAV.
pubmed doi rcsb
source organism Hepatitis a virus
total genus 48
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qa7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qa7A02
1ZLRA 4THNH 1ZGVA 2FESH 1ZRKA 2R0LA 4FVDA 4Y10E 4MNYA 1F5LA 2DUCA 3E16B 3A7TA 2R2MB 1F0UA 4NFFA 3MO3A 2B7DH 3LC5A 1F0SA 1PPZA 1GDNA 1GBIA 4JZ1A 2WINI 1JBUH 1XUJA 3F9EA 4A7IB 4HI3A 3IG6B 4BAMB 3HKIB 4X8VH 1FY4A 2Q6FA 1D6WA 1B0EA 1G36A 3EYDA 4E06H 1BTYA 4CBNA 2CHAC 1UHBA 5IDKA 1TNIA 4ABAA 1NTPA 5JPMH 1K1LA 3AAUA 2FS8A 3T28A 5HXFA 1V2WT 4K1EA 4KKDA 4PROA 1VCWA 1HAVB 1Y5UT 3A80A 5A8YA 1C1RA 2ZPQA 1GHZA 1UCYE 2WV4A 3MH5A 1DFPA 3DFLA 2Z6BD 3TH2H 1YF4A 3KQDA 1C1TA 1EB2A 1O2JA 4DT7B 1ANBA 1GHBF 3M5LA 4KELA 2D26C 1A46H 1CGJE 1ID5H 4AFZA 1NS3A 1RTLA 2VIWA 4Q7YA 2ZHWH 5TJXA 4YLUA 3BTKE 1OWHA 4CR5A 1SLVB 5DK1A 2GGVB 3RXFA 1MBQA 3SV8A 4Q7XA 4AG1A 1C2EA 4AGJA 1SHHB 3TLOA 3MU5A 1YPGH 2TIOA 1EPTA 3ZVCA 3FZDA 4TPYA 1GHAF 3TJNA 4BNRA 1AZ8A 1A61H 2YNAA 5C20A 1JMOH 1O2OA 1O2PA 2STBE 3PTNA 1GPZA 3M3TA 2Y80A 3SNEA 2ZECA 1EASA 1Y5AT 4D9RA 3HKJB 3RXQA 2STAE 1SB1H 3AVZA 3TGIE 1GWAA 4Y8ZA 4NG9H 1EXFA 1SL3A 3TIUA 5CHAC 1NN6A 2QF3A 1IQHA 1KTSB 3W94A 4AZ2B 1D3DB 2ZG0H 3SU6A 1UCYH 4UDWH 1MTUA 2SGDE 1GBMA 4RKJB 2A5AA 2P8OC 2QY0B 1L1NA 3D62A 3ESTA 1SOZA 2AEIH 1EP5A 4XBBA 1CGHA 4NWKA 2F91A 1O32A 3SQEE 1O38A 4NFEA 1ZHRA 2A7JA 4YZUA 1O33A 2BB4A 2FODA 4YOGA 1SG8B 3ZVEA 3LGVA 1C2IA 4I8KA 3P8FA 1SSXA 2A5KA 3RXHA 4ABDA 1BTWA 1TWXB 3E3TA 1PPCE 2XCNA 2CJIA 3RMMH 1GJDB 4JYVH 1QQ4A 1KXAA 1O3OA 3BEIB 4BXWA 2ZF0H 1JRSA 1YPMH 2IOTA 1O35A 1GMHF 3GY8A 4ABIA 4O03A 5EW2H 1PPEE 2QXIA 1KXBA 4KTSA 1P01A 3UQVA 1E35B 3A8AA 1GMHG 2TGAA 3VB4A 1GI1A 3E1XB 1S6FA 2CMYA 4U30A 1K2I1 1A4WH 1UCYK 2ZZUH 4GAWA 4OS2A 3ITIA 1CHOF 3DA9B 1E36B 2ZWLH 1XXFA 4X6OA 1T8LA 4ABEA 3SQHE 3T27A 2BLQA 1IHTH 4YT6H 5ESTE 1O2QA 1FY5A 2C8YB 4X1PU 5AVDA 1C5MD 2OC0A 3BTEE 3LGTA 4FUGA 1TPPA 2SGAA 4WXIA 2GCHG 1UVSH 2G55A 3U8TH 1FAKH 1A2CH 2FTLE 3RMLH 7LPRA 1TA2A 3C27B 5IYTA 1YKTA 3FP6E 1TRYA 2AFQB 1SGFA 3VB7A 2HNTF 1UVPA 1FMGA 3STJA 4H6TA 1IQIA 1OWDA 1P8VC 5FHTA 1C2FA 1FONA 2O8UA 4AFQA 3GCHC 1EJMA 2VB0A 4H42U 1DLEA 1HAYB 4VGCC 5EGMA 4CH2B 2ANWA 2W3IA 2ZDNA 1ARCA 3SZNA 1YBWA 1S0QA 5DP4A 1HPGA 2QV1A 1QR3E 2A4QA 2ANMH 3E0NB 1SGRE 4ABGA 1V2TT 1MAYA 3OU0A 3SUGA 1AWHB 1QIXB 4ESTE 3RDZA 1KIGH 4ZHLU 1HLTH 1FDPA 1MCVA 4DOQA 1W2KH 1P3CA 1DDJA 3SN8A 1GVZA 4BAOB 8LPRA 1D6RA 1MTNB 1FIWA 3GCTG 1K1MA 1GMCF 1O3DA 2BZAA 4Y8YA 3RXTA 2KAIA 1BBRE 3A89A 1YC0A 2NU0E 3P8OA 3RXBA 1P02A 1N6YA 1O36A 2GCTC 2OD3B 2FOMB 2H2ZA 1HJ8A 1C1SA 3ATMA 3A85A 5I46H 2ALVA 1EAWA 3RC4A 1O3GA 2BD9A 4CHAB 2XBXA 1H9HE 4K1TA 1C2LA 3TPIZ 3GYMA 4JCNA 2RDLA 4NGAH 1AO5A 3OY6U 3ATKA 1BRBE 4CBOA 4IN2A 2OBQA 1ZR0A 2NWNA 2G5NA 1NRQH 1DY9A 4E05H 2V35A 4NSYA 1A5IA 4CRGA 4BTTB 7KMEH 1GBKA 3ZVAA 2B9LA 2BOHB 1YPLH 4LK4A 2Z94A 3FZZA 3N7OA 2JETB 4MLFB 2R9PA 6ESTA 3F6UH 1QURH 1OWEA 2ZHEH 1GDUA 4WVPE 3UWIA 4XBDA 3T62A 1BTHH 1XUFA 1T7CA 4XDEA 4Z0KA 6GCHF 1OWJA 1BZXE 3MH7A 1ELAA 3JZ2B 3A7YA 2Y5GA 1MU6B 1TAWA 1ABJH 5L2YH 2A45B 1CA8B 1ZPBA 4CRCA 2ZU4A 4BAHB 1MH0A 3SU5A 1YLCA 2PTCE 5FAHA 1AD8H 2FI4E 2FPZA 3RUOA 1HBTH 1SGYE 2SGQE 4U2WA 3M7QA 2XW9A 2JKHA 5ABWA 2HGTH 2FOBA 1MZDA 1FZZA 1BMAA 2VIVA 1LVMA 5FX6A 2ZU5A 2EEKA 1BRAA 5FPTA 5F6MA 3ZZBA 4OS7A 5BRRE 4NZLA 1TA6A 3QTVH 3GY7A 2PSYA 1BOQA 2B5TB 2PKAA 1CT0E 3PMBB 1PQ7A 4FUJA 3ENSB 4R0IA 3MHWU 1RS0A 5JBCS 2PV9B 2FWWA 1G37A 3NK8A 3QZQA 1GI8B 1O2HA 4JZEH 4BTUB 4GHTA 1MTVA 2VU8E 1PPBH 1EKBB 4B2AA 4WH6A 2HNTE 1WQVH 1A7SA 2UUFB 3D23A 4A1VA 2OBOA 3B8JA 1HDTH 1E34B 1EAIA 2RA3A 2IN2A 2WUCA 2SGPE 1SGIB 1SLWB 1MTSA 2GX4A 1THRH 1ZJDA 2QXJA 1V2JT 3ZZ7A 1L4ZA 1CT4E 2Z3CA 5DG6A 2C3SA 3LONA 3NXPA 1SI5H 3PLPA 2VWLA 5HYOA 1T4UH 2HWLB 1RFNA 3SU1A 1NU7B 1V3XA 3NZIA 1FPHH 4F49A 2OC1A 2BY8X 4ZXXH 2BLWA 4TYDA 1BHXB 2G5VA 3O8RA 3MU8A 1CHGA 1ELCA 1O2ZA 2A4GA 3MH6A 2V6NA 2WPMS 1G9IE 1BRUP 1EATA 2NU4E 1VCPA 4I33A 3T25A 1XUIA 1BT7A 5K7RA 1DM4B 1P10A 2W7SA 1WSSH 2UUJB 5GWZA 2FMJA 3M7UA 4I31A 4WMFA 3H5CB 3MH4A 3QUMP 1IQNA 1VGCB 2GDDA 1P09A 1SGEE 2WPKS 3SGAE 1FY1A 1O31A 1OPHB 3UNQA 3MNCA 1OSSA 5C1YA 3E90B 2B8OH 1CGIE 1P03A 1TBZH 2WPJS 1VR1H 2XXLA 1J9CH 1NO9H 3M5MA 1HAPH 1YCPH 5EODA 3RXEA 1QRZA 1TPOA 4DVAU 4IN1A 3RU4E 2PKSB 1XXDA 1CQQA 3A7ZA 2SGEE 1DSTA 5EQRA 1K22H 3EE0B 3MOCA 1NM6A 2GD4B 5K0HA 3ATLA 1P06A 1O2RA 3GY3A 3WY8A 2A2QH 3SU4A 4AYYB 1SLUB 4LZ4B 1FN8A 1C2KA 3P6ZB 1P0SH 1UTKA 2VIDA 1GHYH 3PROA 1O37A 1O2SA 5A8XA 3W95A 1Y3WA 1V6DA 2O9QA 4QT8C 2R2WU 1F0RA 1ZPZA 3MNSA 1Z8RA 3TH3H 1UTQA 2PUXB 7GCHG 4HZHA 3GICB 5DP5A 3KL6A 3ZVFA 1RGQA 1BITA 3RXGA 1KXFA 1O5CB 2FOCA 1JIMA 1KLJH 1S83A 1PFXC 1GHXH 2ANKH 2G81E 1HAXB 1W14U 4YO9A 4UFDH 2OXSA 3IWMA 1SQAA 2ZKSA 1MMJN 2P16A 3UR6A 3QTOH 1C5LH 1PPFE 1YM0A 2R3YA 2NU3E 3PTBA 2VH6A 3SNAA 1YCPK 3BTTE 1ZTKA 4FUEA 3UNSA 1GBFA 1AKSA 1Z6EA 8GCHF 4ZROA 5JB9S 3SNBA 2JH0D 5JB8S 3TJUA 2AIQA 2AMDA 1J16A 3A81A 1D3QB 1EUFA 1TOCB 2XRCA 1ZSJA 1LVYA 5C3NA 3QGJA 1BDAA 2RCEA 1RD3B 4D9QA 5GCHF 2VH0A 4AB9A 1DVAH 2FEQH 2LNCA 5DP8A 2WUBA 1HAHH 5LGOA 1FUJA 1HAZB 2F9BH 1C5WB 4AORA 1C5OH 2AGGX 2THFB 5E0HA 4NCYA 2BLVA 3UREA 3KGPA 2XCFA 2YNBA 3KHVA 2GT8A 4TPIZ 1MTNC 1GMDF 1XUGA 1C1WH 1CA0B 5PTPA 4WF8A 2AERH 2AS9A 1DUEA 4B76A 1BIOA 4TWWA 1L2EA 2BDCA 2ODPA 2ZCKP 1DICA 1V2OT 2OINA 5E2PA 3PO1B 2J38A 4ZKSU 1GJCB 3M61U 4B2CA 4MVNA 2FOEA 1BTPA 5F8TA 1D9IA 3GCNA 3PMHB 1T31A 4NWLA 3MO6A 4UEHH 1FN6A 1HGTH 4CHAC 2GV7A 3D49H 1QGFA 2FOAA 4J1YA 1GJ9B 4WJG2 1DXPA 2XBVA 1W7GH 4WXVA 1VITF 2FLRH 2ZGBH 3P70B 3TGKE 4ABFA 2FDAA 2XBYA 3PLBA 3VGCB 1QJ6B 1O3AA 4E7RG 2XC0A 1HV7A 3Q3KA 1HUTH 1OWIA 1VITG 2ZFSA 1LO6A 1AY6H 1ABIH 4K60A 3SJIA 5E0GA 1MD7A 2QXHA 2BVRH 2JETC 2BX4A 1IQMA 4NIVA 1KYNA 4AX9H 4NIWA 2QCYA 2Y5HA 2UWOA 3MU4A 3S7KB 3VXFH 5FCKA 3TNSA 1JIRA 1GBEA 2EC9H 2OC7A 3DT0H 1TALA 1LMWB 1Z7KA 2NU2E 2HVXA 3BG4B 1P2KA 1W12U 1ELEE 2GZ8A 1GHBG 3BTHE 3Q3YA 1VZQH 4DCDA 3M3VA 1YCPM 2UWLA 4ZUHA 1C9PA 2FOGA 1O3KA 2FI3E 2C90B 2VWNA 4Z6AH 5DGJA 1YPEH 3ATIA 2ZCLP 1C5SA 4FU8A 5L6NH 1V2ST 1TQ0B 5JBBS 2ESTE 2QF0A 4JZFH 1LHGH 1O34A 1ZMJA 1GHAG 4X0WU 3SV7A 2VWOA 2A32A 3PMAB 4ASHA 1QA7A 1O2IA 4BANB 2ZDAH 5ESBA 1BTZA 1CBWB 3MMGA 2ZDVH 1SVPA 5FPYA 5T6FA 2H6MA 1GJBB 1ZMLA 5CMXH 3RXLA 3U1JB 3E91A 1EX3A 2J92A 2WPIS 1F5RA 2JH6D 4JK5A 1FAXA 3HATH 1C4Y2 2ZFRH 1B0FA 4GHQA 2Q1JA 1MCTA 3UR9A 1GI7B 1V2LT 2SNWA 3CS7A 5EU8A 5FPSA 4NA7A 4ZMAH 1WUNH 2VGCB 5DP9A 4WMEA 2ZQ1A 3GYLB 5HMAA 3EAJA 1UMAH 3CENA 2OTVA 1SQTA 3BTWE 1P3EA 1P11E 2ZTZA 2J95A 3TITA 1IQLA 1S84A 1J14A 3TU7H 4AN7A 1MKXH 1AQ7A 3ODDA 1KXEA 2GKVE 2CF8H 5HGGA 1O39A 4AFUA 1AB9B 4Y11E 1OOKB 3KQEA 4XOJA 1BB0B 2BMGB 1FY3A 5EQSA 1IQJA 1UVUH 2CGAA 3BTQE 3SU3A 2CN0H 1O2XA 1UK2A 1MTWA 5AFZH 5A2MH 1DLKB 5E2OA 4MPUA 2XWAA 3SORA 3MNXA 3BIUH 1HAOH 1L1JA 1TGTA 1HRTH 1B7XB 3RLWH 3LT3A 2A7HA 3MNBA 1SGDE 3A87A 1GCTB 2D2DA 4X2WA 1Q31A 1EOLA 1KDQA 2BXUH 3LGWA 1G3CA 1GHWH 1CHOG 3V12A 3H7TA 1S6HA 1FV9A 1QBVH 4SGAE 2GV6A 4JMYA 4BAKB 2BDHA 1ZRBA 3U8OH 1VGCC 3F9FA 3URCA 3Q00A 4ZXYH 2SGFE 1QHRB 1AVXA 1LCYA 1MKXK 1DXWA 2QAAA 3GISB 2ZQ2A 4ABHA 1NZQH 2AGEX 4DY7B 1QBOA 1TRNA 1AVWA 2BD8A 2P94A 3A86A 3ATWA 1H8DH 4NIYA 3RU4D 4WH8A 2GTBA 1TGCA 3ZYDA 1HAVA 3LOXA 3ZZ3A 2PKSC 1K1OA 1C4V2 3L3TA 3A8BA 3M5OA 1ESBA 1OYTH 3HK3B 3HGPA 1LHEH 4IBLH 3SNCA 3PB1E 4A1XA 2ZFFH 2PGQB 4WY3A 1HIAB 1UTOA 2FX4A 1GJ4H 1G32B 2PGBB 1GJ8B 1RXPA 2J2UA 2JH5D 1PJPA 4BTIB 3KNXA 1C5ZB 4Y7AA 5FCRA 5AFYH 3BIVH 1ELFA 1HAIH 1C4U2 4FVBA 1MQ6A 3LJOA 1JXPA 5L2ZH 1ANDA 1V2RT 1FI8A 1K28D 4IMZA 1YPJH 4ZKRU 1GMCG 2BD5A 4Q80A 4LZ1H 3TNTA 3AASA 1KXDA 2HRVA 2H5DA 2ZA5A 4DGJA 4O9VA 1JRTA 1H1BA 4MNWA 1P2QA 1SGNE 1WTGH 1JWTA 3SW2B 3SBKA 1FXYA 1TX7A 4X2YA 3PYHA 2ZU1A 3ELAH 1ELGA 4AG2A 2P3FH 2BY5X 1AI8H 1SMFE 4GLYA 4NSVA 1DANH 3M35A 1EJNA 5GIBA 1IQFA 5JYIA 2FTMA 3ZV8A 1QJ1B 2H9EH 1F7ZA 2OQUA 3Q76A 3TK9A 3KCGH 4CRBA 4K8YA 1OP2A 1LTOA 2OC8A 7ESTE 4DG4A 1SBWA 1OKXA 1O2NA 1ETTH 1KXCA 4O3TA 2XC5A 2ZI2H 1DE7H 3VPKA 2QC2A 1C1VH 2ZGJA 2CHAB 1UTMA 3RXSA 4Y7BA 2CF9H 5LPEA 4X8SH 3ZZAA 2FLBH 2OCVB 1ESAA 1O2GH 3SV6A 1Z8JB 3ZZ8A 1CA0C 1N1LA 4ABBA 2OLGA 3T26A 2G4UA 9ESTA 1Z8GA 4ISOA 3UWJH 2ALPA 6GCHG 1CSOE 5EPNA 2ZP0H 3PO1C 1GI4A 4YOIA 3TH4H 3HGNA 1QL7A 1NT1A 1IAUA 5JBTA 4FUDA 1GI0A 4I8HA 4RKOB 4I7YH 1H9LB 3E8LA 1FY8E 1E0FD 4FUBA 3BTME 3F9GA 2OUAA 1EAXA 4TWYA 1C5TA 1J15A 2WPLS 2TBSA 3CS0A 2J9NA 1AFQB 4ISNA 4OS4A 3LPRA 1LHDH 1PPHE 1ZJKA 2AYWA 4BAQB 1SHYA 2BD2A 3MI4A 2W26A 3S0NA 1TMTH 1LVOA 1AGJA 2BX3A 3VXEH 1F92A 3A84A 1ORFA 3LH3A 3OX7U 3RXPA 1ETSH 2P3TB 1C2MA 1P9UA 1P2MA 4A92A 4MDSA 1Z71A 3FAOA 4GPGA 4HTCH 2D1JA 5J4QA 1O5GH 1O3CA 3BG4C 2Z3EA 1GG6B 1ANCA 2J94A 2PWXA 5HM2A 8ESTE 2PHBA 2V0BA 1XMNB 3FANA 3ODFA 1NC6A 2FOHA 2UWPA 2FYQA 1YP9A 1GBAA 1LPZB 1D4PB 1EZXC 1EB1H 1XKAC 1O2UA 1TPSA 2G52A 1ZZZA 3A8CA 1A5HA 3T5FH 1HIAA 1EJAA 3LGYA 2ZEBA 2TGPZ 3LDXH 5DPAA 4ZKOU 1TNKA 3A7WA 3VB6A 2A2XH 3ZYEA 2ODQA 1FQ3A 1CBWC 5TCCA 3ZVBA 1ZMNA 2I6SA 2WYJA 1W7XH 2H5CA 1AMHA 2BDGA 4DJZB 2FYRA 4B2BA 1KY9A 1J17T 3LU9B 3GY4A 4SGBE 1L0ZA 2SNVA 2I6QA 2G4TA 5LH8A 3MU1A 4F4OC 1DPOA 1NFYA 1XX9A 2ZCHP 4YESB 3SJ8A 2HALA 1HYLA 2ZC9H 1O5FH 4NA8A 4D76A 1WOFA 2VGCC 5LPFA 3QWCH 2V3HH 1W10U 1UHBB 4LOYH 4KTCA 1QB9A 2Z9KA 1GBJA 1NRRH 1GI2A 2ODYB 1GL1A 2BDAA 3LGUA 4XBCA 2BQWB 2ZGXH 2Z9GA 1HJ9A 5F03A 2B0FA 1SGFG 1X7AC 5DO4H 1C2GA 3R3GB 3SNDA 1ACBE 1AB9C 2VINA 1LHFH 1ESTA 1UTJA 1V2MT 1DWCH 1BTUA 1C5RA 4Q7ZA 5DJ7A 4X1SU 2GMTB 3T29A 4K8BA 4JZDH 2BDBA 2VIOA 1TONA 2DE8A 4CR9A 4J2YB 4MG3A 3RXJA 1TFXA 3ZV9A 1L4DA 1W3CA 2BDIA 2C4FH 2GVFA 1NY22 2GT7A 1NRNH 5T3HA 4Y71A 1EZSC 1SR5C 3QGNB 3RM0H 3S69A 2LPRA 3SU0A 1GCTC 4GUXA 2O8WA 5TCAA 3UY9A 1EPTB 5EPYA 3BN9A 4NA9H 3SHAH 1O5BB 3RXUA 2FP7B 2ILNA 1C9TA 3QDZB 1NU9A 4TY6A 1PYTC 3MWIU 3V0XA 1XUKA 5EXLA 3A7VA 3SUDA 3I29A 1Q2WA 3UIRA 1TMUH 4I8JA 1GDQA 4U32A 2BDYA 4DW2U 1AUTC 1QBNA 3AW1A 3RXVA 2H1UA 1QQUA 2H9HA 4X6MA 4Y0YE 2O8LA 1AU8A 2AIPA 1GJ6A 1W13U 2XNIA 3U69H 1IQGA 1PPGE 1LDTT 1INCA 1HB0B 3Q3XA 8GCHG 1QA0A 3EGKH 2G00A 3H7OA 5DP7A 2XWBI 2BYAX 3K2UA 5EOKA 5GCHG 3KEEA 2BD3A 3KN2A 3M5NA 3U98H 1A5GH 1ZYOA 2ANYA 2A31A 4K3JA 3KQBA 1BJVA 2Z9JA 2VVCA 5AF9H 1Y5BT 1NFWA 4K2YA 1O2WA 1GBDA 1UTNA 2TGDA 3ZVDA 4IC5A 1GMDG 1H4WA 3DHKH 1JOUB 3BV9B 3OSYA 1NPMA 1S82A 1C1OA 2UUYA 2R0KA 5EXNA 5AHGH 1AIXH 2ZHQH 4KTUA 4O3UA 1V2PT 4Y0ZE 2VNTA 2ULLA 3EQ0H 1GBHA 1P05A 2AGIX 2HPPH 2PSXA 1U6QA 3U9AH 1L1GA 3E0PB 1O3BA 2OQ5A 5A0BA 1EAUA 2W5EA 3BF6H 2ASUB 2ZHDA 4D7GA 1AE8H 5G4BA 4GCHF 1O2TA 4OGYA 1BCUH 2Z9LA 2QGRA 4GCHG 3GDVA 1F2SE 1NESE 1W0YH 4O97A 3RXOA 1GJ5H 5L30H 1DWDH 1OWKA 1ZTLA 2CXVA 1QRXA 5GDSH 4OS5A 1BMNH 4YM9A 5A0CA 1YYY1 1WTHD 3PMJA 3SU2A 4CRAA 3A7XA 4DIHH 1SPJA 4NZQA 1SGTA 1T8NA 5C1UA 3ZZCA 1SOTA 2F9PA 2ZDLA 3AAVA 4BXSA 1WCZA 4ISHH 3UUZA 3O8DA 4X8UH 3S7HB 5T6GA 3LIWA 1OP8A 3RXDA 2A4RA 4B1TA 1O5DH 1ZGIA 4HFPB 1MQ5A 3GDUA 1O5AB 4BOHA 1QFKH 1ZHMA 4RN6A 1MD8A 5A0AE 1GHVH 1BRCE 2ZPSA 3RU4T 3RM2H 1W11U 1ZPCA 1O3JA 3B9FH 1K21H 1AZZA 1AFQC 2KAIB 1ELDE 2W3KA 1GL0E 2BZ6H 2D8WA 2Y7XA 4TY7A 5EG4A 2P59A 1BTXA 1T8OA 2XYAA 1THPB 2Z3DA 3T2NA 1YGCH 3MTYA 2J4IA 2HLCA 1S81A 3RMNH 4ZH8A 2HNTC 2BQ7B 1UO6A 1Y3YA 3M3SA 4XFQA 5FX5A 1FIZA 1TRMA 4MPWA 1YLDA 5EW1H 1BQYA 2XBWA 4OS1A 1N8OB 3TK6A 1GG6C 1HJAB 5HM9A 1DWEH 1C5UA 3E6PH 1AFEH 1FNIA 1QJ7B 4MTBA 2BY6X 5C5OA 3A82A 2PFEA 5FBIA 1N6XA 1Z8IB 5I25A 1O3NA 3RXKA 1XM1A 2EA3A 3M36A 4AOQA 2F3CE 6LPRA 1TNLA 5DP3A 3SJ9A 1G30B 1TNGA 1O5EH 2VIPA 3QN7A 5DKMA 1PQAA 1GGDB 1QB6A 3QO6A 2ZFQH 2WV5A 3O8BA 3LC3A 3FP7E 4E7NA 3NWUA 4NIXA 1EZQA 3ZZ5A 3I77A 4IC6A 4AYVB 1C2HA 3PV4A 2AH4X 3F1SB 1WAYB 1MZAA 4CRFA 1Y3UA 1BMMH 2QN5T 2QIQA 2GZ9A 5CE1A 1DX5M 3SI4H 1AHTH 1V2NT 2Z7FE 3SUEA 2YOLA 4CH8B 1UK3A 2C8XB 1SGPE 3FFGA 1V2UT 1MUEB 3S9BA 4FU9A 1S0RA 1Q3XA 1SFIA 4I8LA 3AW0A 2F9VA 1ARBA 3A88A 5C2ZA 3RLYH 4INHA 1LKBA 1CU1A 1VCQA 3RP2A 1YPHC 3NKKA 1BJUA 1MKWH 3TGJE 1ANEA 2GCHF 5C5NA 2A7CA 3P17H 1FJSA 1S5SA 2EI6A 2V3OH 4X6NA 2PKAB 3DUXH 1J8AA 3F9HA 1DS2E 4ABJA 5JBAS 1XVMA 1RIWB 2C8ZB 1G3DA 2BM2A 2ZO3H 3UTUH 5A09A 3SGBE 1HFDA 5EQQA 3UNRA 2OP9A 4MNVA 4K5ZA 3BSQA 1LKAA 4X2VA 1XKBC 2GMTC 1O2LA 4A6LA 3I78A 1QY6A 1A0LA 2Y6TA 4AB8A 2GZ7A 2Y81A 2F9UA 3RMOH 4AFSA 1XVOA 5BPEA 1F5KU 3RXCA 2WPHS 2ZFPH 3ZZ9A 2O8MA 4ZHMU 1AN1E 4AGKA 1P04A 1GBLA 1ZOMA 2K1QA 1EQ9A 1O2MA 1CE5A 2PUQH 4JK6A 4UFFH 4UE7H 3RC6A 4INLA 2BVXH 1EPTC 3UOPA 4B74A 1QRWA 3PM3A 1THSH 3L33A 2VIQA 5GPIB 1TLDA 1TABE 1UTLM 3M7TA 1C5QA 3SV9A 3GCTF 3R0FA 4WMDA 2ZGCA 1EOJA 1MKWK 3LGIA 1MAXA 1A3BH 2ZPRA 2ZU3A 3A83A 3OYPA 3OY5U 1WYKA 2FI5E 6CHAB 2BVSH 4Q2KA 3SUFA 2BY9X 1BHXF 1Y3VA 3EDXB 1QL8A 2P93A 1BMLA 1DT2A 3UPEA 4B71A 2PW8H 1LPGB 1ELBA 3O8CA 2ZTXA 1G3EA 1A0JA 4XE4A 5B6OA 2GDEH 3V13A 3BG8A 1ZHPA 1DSUA 1VITH 1F0TA 2HPQH 4UD9H 1SC8U 2W7UA 4X1QU 1K1JA 1Z1JA 3GDSA 3HK6B 1RTKA 5H4IB 3LJJA 1O3EA 1O0DH 3UFAA 5F8ZA 1TNHA 3SGQE 3NUMA 1W8BH 1C1PA 2HOBA 2M5TA 1TX6A 1UVOA 1O2VA 1P12E 4K1SA 2XTTB 3K6YA 4KGAA 2ZHFH 4LXBH 2ZTYA 1GJ7B 1KLTA 1TBRH 3DFJA 4K69A 2J34A 3RXIA 2PR3A 4H4FA 2ZDMA 1O2YA 1T32A 1RRKA 3K65B 2ZGHA 3PWCA 4YT7H 5A8ZA 2ZU2A 4MQAA 4XSKU 1C1QA 2QA9E 1AE5A 2A5IA 1KLIH 3BTFE 3KIDU 1AVGH 3LKWA 1GBCA 3D65E 4FU7A 1SQOA 2BQ6B 2A4OA 2Y7ZA 1SFQB 3VB5A 3ZZDA 1O2KA 2FZZA 4B73A 3BEUA 3KF2A 4HGCA 3MU0A 4FUFA 1WV7H 3GOVB 1O3HA 3V3MA 4D8NA 3FVFB 1IOEA 1EZUC 2BLOA 1BBRH 3MYWA 3STIA 1P2NA 1A3EH 2FX6A 4UFGH 2O8TA 5E0JA 1SGCA 3SO3A 1PQ8A 3P92A 5T6DA 1A0HB 3VGCC 1GVLA 1BUIA 1E37B 1KTTB 4IGDA 1V2QT 2AMQA 5F8XA 3PWBA 5SGAE 3LH1A 1MU8B 3GCOA 4INKA 2Q6GA 2R3UA 4ZHAA 2A0QB 3UOUA 1IHSH 3HPTB 3K9XB 4GSOA 3EA8A 3ZZ4A 1ZTJA 2AMPA 1C1NA 2G51A 1Y59T 4DURA 2PLXA 1W0ZU 4X1NU 5CHAB 4Y6DA 1AKSB 5J4SA 4IS5A 4CRDA 1OP0A 1WU1A 1O3MA 1NFXA 2P8OB 1GI3A 4UONA 3A8DA 1C5PA 1ZSKA 3QK1A 3GY6A 4ZKNU 4X8TH 1GI9B 5LPRA 3QLPH 4DIIH 2FS9A 1UTPA 3S9AA 1V2VT 1CT2E 1GCDA 2FO9A 1TQ7B 1O30A 1HXFH 1TNJA 1AWFH 3MO9A 1OYQA 1BBRK 3KQCA 1C1UH 4M7GA 3RXRA 2SFAA 1H9IE 1CVWH 2GP9B 8KME2 4JYUH 4YOJA 5E8EH 1ELTA 1QNJA 1T4VH 4U01A 1PQ5A 2BD7A 1BA8B 1IQKA 3C1KA 3CP7A 3TK5A 4X2XA 2H9TH 2A1DB 3FP8E 1HAGE 3MFJA 3P8NA 2Z9IA 3B23B 1GJAB 2Y5FA 1HNEE 1TPAE 2ZIQH 1DOJA 4FUHA 4ISIH 4R8TB 5FXLA 1LVBA 2TGTA 1IQEA 4X1RU 1SGQE 3S9CA 2BOKA 1C2DA 3SI3H 5C67A 1WQSA 1TB6H 2TRMA 4KP0A 1K1PA 4CREA 1GBTA 2TPIZ 1O3FA 5GXPA 1M9UA 1RJXB 3TJOA 1N8OC 2VVVA 2G8TA 2Y82A 4D7FA 3VEQB 1CO7E 1HJAC 4FXGH 2VJ1A 1OXGA 3ZVGA 1P57B 3BTDE 2VWMA 3SOSA 2F9NA 1C5YB 4YTAA 9LPRA 4GVUA 1C5VA 5FBEA 1P9SA 2NU1E 3NCLA 1T8MA 1KSNA 2FIRH 2UUKB 1UK4A 1LPKB 1V2KT 3GY2A 1NRPH 4I8GA 1GGDC 1YPKH 1VJAU 2FOFA 4Y76A 1C5NH 5C1XA 4MNXA 1YPHE 1OX1A 2C8WB 3G01A 4B75A 3BEFB 3SJKA 3P95A 1C2JA 1O3LA 4ZAEA 3GCHB 1QCPA 5JDUB 4VGCB 1NROH 1QTFA 2QXGA 1DY8A 1Z6JH 1GI5A 2IPHA 3IITA 1H8IH 5DP6A 1P2IA 2Q6DA 4UFEH 1UJ1A 4H6SB 1GBBA 3OTJE 4JZIA 4ISLA 4A5TS 3VB3A 1NRSH 3TVJB 1TX8A 4YLQH 3V7TA 7GCHF 2QYIA 1HCGA 2EI8A 4Y8XA 2EI7A 1C5XB 1HXEH 4OGXA 2BHGA 1ZSLA 3URDA 4RSPA 3U1IB 3DD2H 1TOMH 3L6PA 4FUCA 1A1RA 3ZZ6A 1P2OA 2DE9A 2C93B 1G3BA 1O3PB 1XUHA 2RA0A 2CV3A 2XC4A 4I32A 3SV2H 1TBQH 3RXAA 1Z1IA 1ETRH 2PTNA 4IMQA 1FLEE 2ZFTA 3SJOA 1VJ9U 2P3UB 1G2LA 2GCTB 1QB1A 1RIWC 3U8RH 2F83A 1UVTH 2BXTH 3VFEA 1TMBH 4JYTA 1TGSZ 1AUJA 1PYTD 3EA7A 1TE0A 2BY7X 3QZRA 2P95A 4WWYA 2FXRA 3UQOA 1DITH 1NFUA 1S85A 1MBMA 2ZNKH 4MPVA 1LQDB 2BD4A 3Q77A 1B5GH 1OS8A 3F68H 1E38B 2VVUA 5GJ4B 4IW4E 3QX5H 1Y3XA 3GY5A 1DUAA 2ZDKA 3EA9A 3SHCH 1GI6A 4OS6A 3P8GA 1GVKB 4Y79A 1G2MA 1FPCH 3RXMA 2FM2A 1TIOA 1P2JA 3BTGE 1K9OE 1DWBH 1TGNA 1SLXB 1O3IA 1ELVA 1RTFB 4X6PA 1C1MA 4A1TA 3RC5A 1EP6A 2IJOB 1D3PB 4MPXA 1D3TB 5ETXA 3PLKA 2F9OA 1TYNA 1WBGB 1Y8TA 2WYGA 1K1NA 1TGBA 1LHCH 5EXMA 3TJVA 6CHAC 2BTCE 1LQEA 2RG3A 3K6ZA 3M37A 1K1IA 3JZ1B 3NPSA 1QL9A 1KDQB 4FUIA
chains in the Genus database with same CATH superfamily
1ZLRA 4THNH 1ZGVA 2FESH 3H09A 1ZRKA 2R0LA 4FVDA 4Y10E 4MNYA 1F5LA 2DUCA 3E16B 3A7TA 2R2MB 1F0UA 2M2AA 4NFFA 3MO3A 2B7DH 3LC5A 1F0SA 1PPZA 1GDNA 1GBIA 4JZ1A 2WINI 1JBUH 1XUJA 3F9EA 4A7IB 4HI3A 3IG6B 4BAMB 3HKIB 4X8VH 3NRLA 2WHXA 5KGOA 4AC9A 1FY4A 1S6LA 2Q6FA 1D6WA 1B0EA 1G36A 3EYDA 4E06H 1BTYA 4CBNA 2CHAC 1UHBA 5IDKA 1TNIA 4ABAA 1NTPA 5JPMH 1K1LA 3AAUA 2FS8A 3T28A 5HXFA 1V2WT 4K1EA 4KKDA 4PROA 1VCWA 1HAVB 1Y5UT 3A80A 5A8YA 1C1RA 2ZPQA 1GHZA 1UCYE 2WV4A 3MH5A 1DFPA 3DFLA 2Z6BD 3TH2H 1YF4A 3KQDA 1C1TA 1EB2A 1O2JA 4DT7B 1ANBA 1GHBF 3M5LA 4KELA 2D26C 1A46H 1CGJE 1ID5H 4AFZA 1NS3A 1RTLA 2VIWA 3PV2A 4Q7YA 2ZHWH 5TJXA 4YLUA 3BTKE 1OWHA 4CR5A 1SLVB 5DK1A 2GGVB 3RXFA 4XRNA 1MBQA 3SV8A 4Q7XA 4AG1A 1C2EA 4AGJA 1SHHB 3TLOA 3MU5A 1YPGH 2TIOA 1EPTA 3ZVCA 3FZDA 4TPYA 1GHAF 3TJNA 5GNDA 4BNRA 1AZ8A 1A61H 2YNAA 5C20A 1JMOH 1O2OA 5EJ1A 2RFKC 1O2PA 2STBE 3PTNA 1GPZA 3M3TA 2Y80A 3SNEA 2ZECA 1EASA 1Y5AT 4D9RA 3HKJB 3RXQA 2STAE 1SB1H 3AVZA 5EJLA 3TGIE 1GWAA 4Y8ZA 2V3MA 4NG9H 1EXFA 1SL3A 3TIUA 5CHAC 1NN6A 2QF3A 1IQHA 1KTSB 3W94A 4AZ2B 1D3DB 2ZG0H 3SU6A 1UCYH 4UDWH 1MTUA 2SGDE 1GBMA 4RKJB 2A5AA 2P8OC 2QY0B 1L1NA 3D62A 3ESTA 1SOZA 2AEIH 1EP5A 4XBBA 1CGHA 4NWKA 2F91A 1O32A 3SQEE 1O38A 4NFEA 1ZHRA 2A7JA 4YZUA 1O33A 2BB4A 2FODA 4YOGA 1SG8B 3WWBA 3ZVEA 4ACAA 3LGVA 1C2IA 4I8KA 3P8FA 1SSXA 2A5KA 3RXHA 4ABDA 1BTWA 1TWXB 3E3TA 1PPCE 2XCNA 2CJIA 3RMMH 1GJDB 1OHHD 4JYVH 1QQ4A 1KXAA 1O3OA 3BEIB 1BMFD 4BXWA 2ZF0H 1JRSA 1YPMH 2IOTA 1O35A 1GMHF 3GY8A 4ABIA 4O03A 5EW2H 1PPEE 2QXIA 1KXBA 4KTSA 1P01A 3UQVA 1E35B 2EY4C 3A8AA 1GMHG 2TGAA 3VB4A 1GI1A 3E1XB 1S6FA 2CMYA 4U30A 1K2I1 1A4WH 1UCYK 2ZZUH 4GAWA 4OS2A 3ITIA 1NBMD 1CHOF 3DA9B 1E36B 2ZWLH 1XXFA 4X6OA 1T8LA 4ABEA 3SQHE 3T27A 2BLQA 1IHTH 4YT6H 5ESTE 1O2QA 1FY5A 2C8YB 4X1PU 5AVDA 1C5MD 2OC0A 3BTEE 3LGTA 4FUGA 1TPPA 2SGAA 4WXIA 2GCHG 1UVSH 2G55A 3U8TH 1FAKH 1A2CH 2FTLE 3RMLH 7LPRA 1TA2A 3C27B 5IYTA 1YKTA 3FP6E 1TRYA 2AFQB 1SGFA 3VB7A 2HNTF 1UVPA 1FMGA 3STJA 4H6TA 1IQIA 1OWDA 1P8VC 5FHTA 1C2FA 1FONA 2O8UA 4AFQA 3GCHC 1EJMA 2VB0A 4H42U 1DLEA 1HAYB 4VGCC 5HIYA 5EGMA 4CH2B 4TSFD 2ANWA 2W3IA 2ZDNA 1ARCA 3SZNA 1YBWA 1S0QA 5DP4A 1HPGA 2QV1A 2YMSD 1QR3E 2A4QA 2ANMH 3E0NB 1SGRE 4ABGA 1V2TT 1MAYA 3OU0A 3SUGA 5KEDA 1AWHB 1QIXB 4ESTE 3RDZA 1KIGH 4ZHLU 4RT0A 1HLTH 1FDPA 1MCVA 4DOQA 1W2KH 1P3CA 1DDJA 3SN8A 1GVZA 3U28C 4BAOB 8LPRA 1D6RA 1FX0B 1MTNB 1FIWA 3GCTG 1K1MA 1GMCF 1O3DA 2BZAA 4Y8YA 3RXTA 2KAIA 1BBRE 3A89A 1YC0A 2NU0E 3P8OA 3RXBA 1P02A 1N6YA 1O36A 2GCTC 2OD3B 2FOMB 2H2ZA 1HJ8A 1C1SA 3ATMA 1SQRA 3A85A 5I46H 2ALVA 1EAWA 3RC4A 1O3GA 2V7QD 2BD9A 4CHAB 2XBXA 1H9HE 4K1TA 1C2LA 3TPIZ 3GYMA 4JCNA 2RDLA 4NGAH 1COWD 1AO5A 3OY6U 3ATKA 1BRBE 4CBOA 4IN2A 2OBQA 1ZR0A 2NWNA 2G5NA 1NRQH 1DY9A 4E05H 2V35A 4NSYA 1A5IA 4CRGA 4BTTB 2W6JD 7KMEH 1GBKA 3ZVAA 3OFND 2B9LA 2BOHB 1YPLH 4LK4A 2Z94A 3FZZA 3N7OA 2JETB 4MLFB 2R9PA 6ESTA 3F6UH 1QURH 1OWEA 2ZHEH 1GDUA 4WVPE 3UWIA 4XBDA 3T62A 1BTHH 1XUFA 3DSGA 1T7CA 4XDEA 4Z0KA 6GCHF 1OWJA 1BZXE 3MH7A 1ELAA 3JZ2B 3A7YA 2Y5GA 1MU6B 1TAWA 1ABJH 1W0KD 5L2YH 2A45B 1CA8B 1ZPBA 4CRCA 2ZU4A 4BAHB 1MH0A 3SU5A 1YLCA 2PTCE 5FAHA 1AD8H 2FI4E 2FPZA 3RUOA 1HBTH 1SGYE 2SGQE 4U2WA 3M7QA 2XW9A 2JKHA 5ABWA 2HGTH 2FOBA 1MZDA 1FZZA 1BMAA 2VIVA 1LVMA 5FX6A 2ZU5A 2EEKA 1BRAA 5FPTA 5F6MA 3ZZBA 1MABB 4OS7A 5BRRE 4NZLA 1TA6A 3QTVH 3GY7A 2PSYA 3KYFA 1BOQA 2B5TB 2PKAA 1CT0E 3PMBB 1PQ7A 4FUJA 3ENSB 4R0IA 3MHWU 1RS0A 5JBCS 2PV9B 2FWWA 1G37A 3NK8A 3QZQA 1GI8B 1O2HA 4JZEH 4BTUB 4GHTA 2F43B 1MTVA 2VU8E 1PPBH 1EKBB 4B2AA 4WH6A 2HNTE 1WQVH 1A7SA 2UUFB 3D23A 4A1VA 2WPDD 2OBOA 3B8JA 1HDTH 1E34B 1EAIA 2RA3A 2IN2A 2WUCA 2SGPE 1SGIB 1SLWB 1MTSA 2GX4A 1THRH 1ZJDA 2QXJA 1V2JT 3ZZ7A 1L4ZA 1CT4E 2Z3CA 5DG6A 2C3SA 3LONA 3NXPA 1SI5H 3PLPA 2VWLA 5HYOA 1T4UH 2QE7D 2LELA 2HWLB 1RFNA 3SU1A 1NU7B 1V3XA 3NZIA 1FPHH 4F49A 2EQNA 2OC1A 2BY8X 4ZXXH 2BLWA 4TYDA 2F4LA 1BHXB 2G5VA 3W1EA 3MU8A 3O8RA 1CHGA 1ELCA 1O2ZA 2A4GA 3MH6A 2V6NA 2WPMS 1G9IE 1BRUP 1EATA 2NU4E 1VCPA 4I33A 3T25A 1XUIA 1BT7A 5K7RA 1DM4B 1P10A 2W7SA 1WSSH 2UUJB 1E1QD 5C17A 5GWZA 2FMJA 3M7UA 4I31A 4WMFA 3H5CB 3MH4A 3QUMP 1IQNA 1VGCB 2GDDA 1P09A 1SGEE 2WPKS 3SGAE 1FY1A 1O31A 1OPHB 3UNQA 3MNCA 1OSSA 5C1YA 3E90B 2B8OH 1CGIE 1P03A 1TBZH 2WPJS 1VR1H 2XXLA 1J9CH 5HKKD 1NO9H 3M5MA 1HAPH 1YCPH 5EODA 3RXEA 1QRZA 1TPOA 4DVAU 4IN1A 3RU4E 5C0UA 2PKSB 1XXDA 1CQQA 3A7ZA 5C94A 2SGEE 4ASUD 1DSTA 2YMSB 2JJ2D 5EQRA 1K22H 3EE0B 3MOCA 1NM6A 2GD4B 5K0HA 3OEHD 3ATLA 1P06A 1O2RA 3GY3A 3WY8A 2A2QH 3SU4A 4AYYB 1SLUB 4LZ4B 1FN8A 1C2KA 3P6ZB 1P0SH 1UTKA 2VIDA 1GHYH 3PROA 1O37A 1O2SA 5A8XA 3W95A 1Y3WA 1V6DA 2O9QA 4QT8C 2R2WU 1F0RA 1ZPZA 3MNSA 1Z8RA 3TH3H 1UTQA 2PUXB 7GCHG 4HZHA 3GICB 5DP5A 3KL6A 3ZVFA 1RGQA 1BITA 3RXGA 1KXFA 1O5CB 2FOCA 1JIMA 1KLJH 1S83A 1PFXC 1GHXH 2ANKH 2G81E 1HAXB 1W14U 4YO9A 4UFDH 2OXSA 3IWMA 1SQAA 4DT4A 2J98A 2ZKSA 1MMJN 2P16A 3UR6A 3QTOH 1C5LH 1PPFE 1YM0A 2R3YA 2NU3E 3PTBA 2VH6A 3SNAA 1YCPK 3BTTE 1ZTKA 4FUEA 3UNSA 1GBFA 1AKSA 1Z6EA 8GCHF 4ZROA 5JB9S 3SNBA 2JH0D 5JB8S 3TJUA 2AIQA 2AMDA 1J16A 3A81A 1D3QB 1EUFA 1TOCB 2XRCA 1ZSJA 1LVYA 5C3NA 3QGJA 1BDAA 2RCEA 1RD3B 4D9QA 5GCHF 2VH0A 4AB9A 1DVAH 2KZ4A 2FEQH 2LNCA 5DP8A 2WUBA 1HAHH 5LGOA 1FUJA 1HAZB 2F9BH 1C5WB 4AORA 1C5OH 2AGGX 2THFB 5E0HA 4NCYA 2BLVA 3UREA 3KGPA 2XCFA 2YNBA 3KHVA 2GT8A 4TPIZ 1MTNC 1GMDF 2GJGA 1XUGA 1C1WH 1CA0B 5PTPA 4WF8A 2AERH 2AS9A 1DUEA 4B76A 1BIOA 4TWWA 1L2EA 2BDCA 2ODPA 2ZCKP 1DICA 1V2OT 2OINA 5E2PA 3PO1B 3PV5A 2J38A 4ZKSU 1GJCB 1YWUA 3M61U 4B2CA 4MVNA 2FOEA 1BTPA 5F8TA 1D9IA 3GCNA 5CHBA 3PMHB 1T31A 4NWLA 3MO6A 4UEHH 1FN6A 1HGTH 4CHAC 2GV7A 3D49H 1QGFA 2FOAA 4J1YA 1GJ9B 4WJG2 1DXPA 2XBVA 1W7GH 4WXVA 1VITF 2FLRH 2ZGBH 3P70B 3TGKE 4ABFA 2FDAA 2XBYA 3PLBA 3VGCB 1QJ6B 1O3AA 4E7RG 2J97A 2XC0A 1HV7A 3Q3KA 1HUTH 1OWIA 1VITG 2ZFSA 1E79D 1LO6A 1AY6H 1ABIH 4K60A 3SJIA 5E0GA 1MD7A 2QXHA 2BVRH 2JETC 2BX4A 1IQMA 2XNDD 4YXWD 4NIVA 1KYNA 4AX9H 4NIWA 2KX4A 2QCYA 2UWOA 2Y5HA 3MU4A 3S7KB 3VXFH 5FCKA 3TNSA 1JIRA 1GBEA 2EC9H 2OC7A 3DT0H 1TALA 1LMWB 1Z7KA 2NU2E 2HVXA 3BG4B 1P2KA 1W12U 1ELEE 2GZ8A 3FN8A 1GHBG 3BTHE 2HLDD 3Q3YA 1VZQH 4DCDA 3M3VA 1YCPM 3KQ5A 2UWLA 4ZUHA 1C9PA 2FOGA 2WV9A 1O3KA 2FI3E 2C90B 2VWNA 4Z6AH 5DGJA 1YPEH 3ATIA 2ZCLP 1C5SA 4FU8A 5L6NH 1V2ST 1TQ0B 5JBBS 2ESTE 3OAAD 2QF0A 4JZFH 1LHGH 1O34A 1ZMJA 1GHAG 4X0WU 3SV7A 2VWOA 2A32A 3PMAB 4ASHA 1QA7A 1O2IA 4BANB 2ZDAH 5ESBA 1BTZA 1CBWB 3MMGA 2ZDVH 1SVPA 5FPYA 5T6FA 2H6MA 1GJBB 1ZMLA 5CMXH 3RXLA 3U1JB 3E91A 1EX3A 2J92A 2WPIS 1F5RA 2JH6D 4JK5A 1FAXA 3HATH 1C4Y2 2ZFRH 1B0FA 4GHQA 2Q1JA 1MCTA 3UR9A 1GI7B 1V2LT 2K8IA 2SNWA 3CS7A 5EU8A 5FPSA 4NA7A 4ZMAH 1WUNH 2VGCB 5DP9A 4WMEA 2ZQ1A 3GYLB 5HMAA 3EAJA 1UMAH 3CENA 2OTVA 1SQTA 3BTWE 1P3EA 1P11E 2ZTZA 2J95A 3TITA 1IQLA 1S84A 1J14A 3TU7H 4AN7A 1MKXH 1AQ7A 3ODDA 1KXEA 2GKVE 2CF8H 5HGGA 3WWFA 1O39A 4AFUA 1AB9B 5T1VA 4Y11E 1OOKB 3KQEA 4XOJA 1BB0B 2BMGB 1FY3A 5EQSA 1IQJA 1UVUH 2CGAA 3BTQE 3SU3A 2CN0H 1O2XA 1UK2A 1MTWA 5AFZH 5A2MH 3F3BA 1DLKB 5E2OA 4MPUA 3CNRA 2XWAA 3SORA 3MNXA 3BIUH 1HAOH 1L1JA 1TGTA 1HRTH 1B7XB 3RLWH 2PP6A 3LT3A 2A7HA 3MNBA 1SGDE 3A87A 1GCTB 2D2DA 4X2WA 1Q31A 1EOLA 1KDQA 2BXUH 3LGWA 1G3CA 1GHWH 1CHOG 3V12A 3H7TA 1S6HA 1FV9A 1QBVH 4SGAE 2GV6A 4JMYA 4BAKB 2BDHA 1ZRBA 3U8OH 1VGCC 3F9FA 5HIZA 3URCA 3Q00A 4ZXYH 2SGFE 1QHRB 1AVXA 1LCYA 1MKXK 5KECA 1DXWA 2QAAA 3GISB 2ZQ2A 4ABHA 1NZQH 2AGEX 4DY7B 1QBOA 1TRNA 1AVWA 2BD8A 2P94A 3A86A 3ATWA 1H8DH 4NIYA 3RU4D 4WH8A 2GTBA 1TGCA 3ZYDA 1HAVA 3LOXA 3ZZ3A 2PKSC 1K1OA 1C4V2 3L3TA 3A8BA 3M5OA 1ESBA 2YMSC 1OYTH 3HK3B 3HGPA 1LHEH 4IBLH 3SNCA 3PB1E 4A1XA 2ZFFH 2PGQB 4WY3A 1W0JD 1HIAB 1UTOA 2FX4A 1GJ4H 1G32B 1GJ8B 2JH5D 1RXPA 2J2UA 2PGBB 1PJPA 4BTIB 3KNXA 1C5ZB 4Y7AA 2RDEA 5FCRA 5AFYH 3BIVH 1ELFA 1HAIH 1C4U2 4FVBA 1MQ6A 3LJOA 1JXPA 5L2ZH 1ANDA 1V2RT 3MQKC 1FI8A 1K28D 4IMZA 1YPJH 4ZKRU 1GMCG 2BD5A 4Q80A 3PRDA 4LZ1H 2CK3D 3TNTA 3AASA 1KXDA 2HRVA 2H5DA 2ZA5A 4DGJA 4O9VA 1JRTA 1H1BA 4MNWA 1P2QA 1SGNE 1WTGH 1JWTA 3SW2B 3SBKA 1FXYA 1TX7A 4X2YA 3PYHA 2ZU1A 3ELAH 1ELGA 4AG2A 2BY5X 2P3FH 1AI8H 1SMFE 4GLYA 4NSVA 1DANH 3M35A 1EJNA 5GIBA 1IQFA 5JYIA 1KMHB 2FTMA 3ZV8A 1QJ1B 2H9EH 1F7ZA 2AHME 2OQUA 3Q76A 3TK9A 3KCGH 4CRBA 4K8YA 1OP2A 1LTOA 2OC8A 7ESTE 4DG4A 1SBWA 1OKXA 1O2NA 2LP6A 1ETTH 1KXCA 4O3TA 2XC5A 2ZI2H 1DE7H 3VPKA 2QC2A 1C1VH 2ZGJA 2CHAB 1UTMA 3RXSA 4Y7BA 2CF9H 5LPEA 4X8SH 3ZZAA 2FLBH 2OCVB 1ESAA 1O2GH 3SV6A 1Z8JB 3ZZ8A 1CA0C 1N1LA 4ABBA 2OLGA 3T26A 2G4UA 3N7DA 9ESTA 1Z8GA 4ISOA 3UWJH 2ALPA 6GCHG 1CSOE 5EPNA 2ZP0H 3PO1C 1GI4A 4YOIA 3TH4H 1SKYE 3HGNA 1QL7A 1NT1A 5DSFA 2KCAA 1IAUA 5JBTA 4FUDA 1GI0A 4I8HA 4RKOB 4I7YH 1H9LB 2XOKD 3E8LA 1FY8E 1E0FD 4FUBA 3BTME 3F9GA 2OUAA 1EAXA 4TWYA 1C5TA 2L6OA 2WZQA 1J15A 2WPLS 2TBSA 3CS0A 2J9NA 1AFQB 4ISNA 4OS4A 3LPRA 1LHDH 1PPHE 1ZJKA 2AYWA 4BAQB 1SHYA 2KCOA 2BD2A 3MI4A 2W26A 3S0NA 1TMTH 1LVOA 1AGJA 2BX3A 3VXEH 1F92A 2QF4A 3A84A 1ORFA 3LH3A 3OX7U 3RXPA 1ETSH 5FL7D 2P3TB 3UAIC 1C2MA 1P9UA 1P2MA 4A92A 4B6FA 4MDSA 1Z71A 3FAOA 4F55A 4GPGA 4HTCH 2D1JA 5J4QA 1O5GH 1O3CA 1K0HA 3BG4C 2Z3EA 1GG6B 1ANCA 2J94A 2PWXA 5HM2A 8ESTE 2PHBA 3OE7D 2V0BA 1XMNB 3FANA 3ODFA 1NC6A 2FOHA 2UWPA 2FYQA 1YP9A 1GBAA 1LPZB 4RT1A 1D4PB 1EZXC 1EB1H 1XKAC 1O2UA 1TPSA 2G52A 1ZZZA 3A8CA 1A5HA 3T5FH 1HIAA 1EJAA 2HVYB 3LGYA 2ZEBA 4ACBA 2TGPZ 3LDXH 5DPAA 4ZKOU 1TNKA 3A7WA 3VB6A 2A2XH 3ZYEA 2ODQA 1FQ3A 1CBWC 5TCCA 3ZVBA 1ZMNA 4ZCNA 2I6SA 2WYJA 1W7XH 2H5CA 1AMHA 2BDGA 4DJZB 2FYRA 4B2BA 1KY9A 1J17T 3LU9B 3GY4A 4SGBE 1L0ZA 2SNVA 2I6QA 2G4TA 5LH8A 3MU1A 4F4OC 1DPOA 1NFYA 1XX9A 2ZCHP 4YESB 3OTPA 3SJ8A 2HALA 1HYLA 2ZC9H 1O5FH 4NA8A 4D76A 1WOFA 2VGCC 5LPFA 3QWCH 2V3HH 1W10U 1UHBB 4LOYH 4KTCA 1EFRD 1QB9A 2Z9KA 1GBJA 1NRRH 1GI2A 2ODYB 1GL1A 2BDAA 3LGUA 4XBCA 2BQWB 2ZGXH 2Z9GA 1HJ9A 5F03A 2B0FA 1SGFG 1X7AC 5DO4H 1C2GA 3R3GB 3SNDA 1ACBE 1VKYA 1AB9C 2VINA 1LHFH 1ESTA 1UTJA 1V2MT 1DWCH 1BTUA 1C5RA 4Q7ZA 3OEED 5DJ7A 4X1SU 2GMTB 3T29A 4K8BA 4JZDH 2BDBA 2VIOA 1TONA 2DE8A 4CR9A 4J2YB 2KCYA 4MG3A 3RXJA 1TFXA 3ZV9A 1L4DA 1W3CA 2BDIA 2C4FH 2GVFA 1NY22 3PRBA 2GT7A 1NRNH 5T3HA 4Y71A 1EZSC 1SR5C 3QGNB 3RM0H 3S69A 2LPRA 3SU0A 1GCTC 4GUXA 2O8WA 5TCAA 3UY9A 1EPTB 5EPYA 3BN9A 4NA9H 3SHAH 1O5BB 3RXUA 2FP7B 2ILNA 1C9TA 3QDZB 5F53A 1NU9A 4TY6A 1PYTC 3MWIU 3V0XA 1XUKA 5EXLA 3A7VA 3SUDA 3I29A 1Q2WA 3GS9A 3UIRA 1TMUH 4I8JA 3N99A 1GDQA 4U32A 2BDYA 4DW2U 1AUTC 1QBNA 3AW1A 3RXVA 2H1UA 1QQUA 2H9HA 4X6MA 4Y0YE 2O8LA 1AU8A 2AIPA 1GJ6A 1W13U 3KYGA 2XNIA 3U69H 1IQGA 4Q4LA 1PPGE 1LDTT 1INCA 1HB0B 3Q3XA 8GCHG 1QA0A 3EGKH 2G00A 3H7OA 5DP7A 2XWBI 2BYAX 3K2UA 5EOKA 5GCHG 3KEEA 5DN6D 2BD3A 5EJZA 3KN2A 3M5NA 3SYJA 3U98H 1A5GH 1ZYOA 2ANYA 2A31A 4K3JA 3KQBA 1BJVA 3F0OA 2Z9JA 2VVCA 5AF9H 1Y5BT 1NFWA 4K2YA 1O2WA 1GBDA 1UTNA 2TGDA 3ZVDA 4IC5A 1GMDG 1H4WA 3DHKH 1JOUB 3BV9B 3OSYA 1NPMA 1S82A 1C1OA 2UUYA 2R0KA 5EXNA 5AHGH 1AIXH 2ZHQH 4KTUA 4O3UA 1V2PT 4Y0ZE 2VNTA 2ULLA 3EQ0H 1GBHA 1P05A 2AGIX 5C0TA 2HPPH 2PSXA 1U6QA 3U9AH 4OM9A 1L1GA 3E0PB 1O3BA 2OQ5A 5A0BA 1EAUA 2W5EA 3BF6H 2ASUB 2ZHDA 4D7GA 1AE8H 5G4BA 2JJ1D 4GCHF 1O2TA 4OGYA 1BCUH 2Z9LA 2QGRA 4GCHG 3GDVA 1F2SE 1NESE 1W0YH 4O97A 3RXOA 1GJ5H 2JDID 5L30H 1DWDH 1OWKA 1ZTLA 2CXVA 1QRXA 5GDSH 4OS5A 1BMNH 4YM9A 5A0CA 1YYY1 1WTHD 3PMJA 2K0QA 3SU2A 4CRAA 3A7XA 4DIHH 1SPJA 4NZQA 1SGTA 1T8NA 5C1UA 3ZZCA 1SOTA 2F9PA 2ZDLA 3AAVA 4BXSA 1WCZA 4ISHH 3UUZA 3O8DA 4X8UH 3S7HB 1WDIA 5T6GA 3LIWA 1OP8A 3RXDA 3DSOA 2A4RA 4B1TA 3DCLA 1O5DH 1ZGIA 4HFPB 1MQ5A 3GDUA 1O5AB 4BOHA 1QFKH 1ZHMA 4RN6A 1MD8A 5A0AE 1GHVH 1BRCE 2ZPSA 3RU4T 3RM2H 1W11U 1ZPCA 1O3JA 3B9FH 1K21H 2W6ID 1AZZA 2IJD1 1AFQC 2KAIB 1ELDE 2W3KA 1GL0E 2BZ6H 2D8WA 2Y7XA 4TY7A 5EG4A 2P59A 1BTXA 1T8OA 2XYAA 1THPB 2Z3DA 3T2NA 2L74A 4I86A 1YGCH 3MTYA 2J4IA 2HLCA 1S81A 3RMNH 4ZH8A 2HNTC 2BQ7B 1UO6A 1Y3YA 3M3SA 4XFQA 5FX5A 1FIZA 1TRMA 4MPWA 2KM0A 1YLDA 4HG6A 5EW1H 1BQYA 2XBWA 4OS1A 1N8OB 3FO8D 3TK6A 1GG6C 1HJAB 5HM9A 1DWEH 1C5UA 3E6PH 1AFEH 1FNIA 1QJ7B 4MTBA 4Q63A 2BY6X 5C5OA 3A82A 2PFEA 5FBIA 1N6XA 1Z8IB 5I25A 1O3NA 3RXKA 1XM1A 1E1RD 2EA3A 3M36A 4AOQA 2F3CE 2VBCA 1TNLA 5DP3A 6LPRA 3SJ9A 1G30B 1TNGA 1O5EH 2VIPA 3QN7A 5DKMA 1PQAA 1GGDB 1QB6A 3QO6A 2ZFQH 2WV5A 3O8BA 2IPQX 3LC3A 3FP7E 4E7NA 3NWUA 4NIXA 1EZQA 3ZZ5A 3I77A 4IC6A 4AYVB 1C2HA 3PV4A 2AH4X 3F1SB 1WAYB 1MZAA 4CRFA 1Y3UA 1BMMH 3N7EA 2QN5T 2QIQA 1QZ8A 2GZ9A 5CE1A 1DX5M 3SI4H 1AHTH 1V2NT 2Z7FE 3SUEA 2YOLA 4CH8B 1UK3A 2C8XB 1SGPE 3FFGA 1V2UT 1MUEB 3S9BA 4FU9A 1S0RA 1Q3XA 1SFIA 4I8LA 3AW0A 3AK5A 2F9VA 1ARBA 3A88A 5C2ZA 3RLYH 4INHA 1LKBA 1CU1A 1YLNA 1VCQA 5B6LA 3RP2A 1YPHC 3NKKA 1BJUA 1MKWH 3TGJE 1ANEA 2GCHF 5C5NA 2A7CA 3P17H 1FJSA 1S5SA 2EI6A 2V3OH 4X6NA 2PKAB 3DUXH 1J8AA 3F9HA 1DS2E 4ABJA 4B6EA 5JBAS 3FKSD 1XVMA 1RIWB 2C8ZB 1G3DA 2BM2A 2ZO3H 3UTUH 5A09A 3SGBE 1HFDA 5EQQA 3UNRA 2OP9A 4MNVA 4K5ZA 3BSQA 1LKAA 4X2VA 1XKBC 2GMTC 1O2LA 4A6LA 3I78A 1QY6A 1A0LA 2Y6TA 4AB8A 2GZ7A 2Y81A 2F9UA 3RMOH 4AFSA 1XVOA 5BPEA 1F5KU 3RXCA 2WPHS 2ZFPH 3ZZ9A 2O8MA 4ZHMU 1AN1E 4AGKA 1P04A 1GBLA 1ZOMA 2K1QA 1EQ9A 1O2MA 1CE5A 1WXRA 2PUQH 4JK6A 4UFFH 4UE7H 3RC6A 4INLA 2BVXH 1EPTC 3ZIAD 3UOPA 4B74A 1QRWA 3PM3A 1THSH 1UW7A 3L33A 1H8HD 2VIQA 5GPIB 1TLDA 1TABE 1UTLM 3M7TA 1C5QA 3SV9A 3GCTF 3R0FA 4WMDA 2ZGCA 1EOJA 1MKWK 2QF5A 3LGIA 1MAXA 1A3BH 2ZPRA 2ZU3A 3A83A 3OYPA 3OY5U 5EIYA 1WYKA 2FI5E 6CHAB 2BVSH 4Q2KA 3SUFA 2BY9X 1BHXF 1Y3VA 3EDXB 1QL8A 2P93A 1BMLA 1DT2A 3UPEA 4B71A 2PW8H 1LPGB 1ELBA 3O8CA 2ZTXA 1G3EA 1A0JA 4XE4A 5B6OA 2GDEH 3V13A 3BG8A 1ZHPA 1DSUA 3WW7A 1VITH 1F0TA 2HPQH 4UD9H 1SC8U 2W7UA 4X1QU 1K1JA 1Z1JA 3GDSA 3HK6B 1RTKA 5H4IB 3LJJA 1O3EA 1O0DH 3UFAA 5F8ZA 1TNHA 3SGQE 3NUMA 1W8BH 1C1PA 2HOBA 2M5TA 1TX6A 1UVOA 1O2VA 1P12E 4K1SA 2XTTB 3K6YA 4KGAA 2ZHFH 4LXBH 2ZTYA 1GJ7B 1KLTA 1TBRH 3DFJA 4K69A 2J34A 3RXIA 2PR3A 4H4FA 2ZDMA 1O2YA 1T32A 1RRKA 3K65B 2ZGHA 3PWCA 4YT7H 5A8ZA 2ZU2A 4MQAA 4XSKU 1C1QA 2QA9E 1AE5A 2A5IA 1KLIH 3UB0A 1H8ED 3BTFE 1AVGH 3KIDU 3LKWA 1GBCA 3D65E 4FU7A 1SQOA 2BQ6B 2A4OA 2Y7ZA 1SFQB 3VB5A 3ZZDA 1O2KA 2FZZA 4B73A 3BEUA 3KF2A 3FOAA 4HGCA 3MU0A 4FUFA 1WV7H 3GOVB 1O3HA 3V3MA 4D8NA 3FVFB 1IOEA 1EZUC 2BLOA 2KFWA 1BBRH 3MYWA 3STIA 1P2NA 1A3EH 2FX6A 4UFGH 2O8TA 5E0JA 1SGCA 3SO3A 1PQ8A 3P92A 5T6DA 1A0HB 3VGCC 2KCPA 1GVLA 1BUIA 1E37B 1KTTB 4IGDA 1V2QT 2AMQA 5F8XA 3PWBA 5SGAE 3LH1A 1MU8B 3GCOA 4INKA 2Q6GA 2J98B 2R3UA 3SZEA 4ZHAA 2A0QB 3UOUA 1IHSH 3HPTB 3K9XB 4GSOA 3EA8A 3ZZ4A 1ZTJA 2AMPA 1C1NA 2G51A 1Y59T 4DURA 2PLXA 1W0ZU 4X1NU 5CHAB 4Y6DA 1AKSB 4RI0A 4M9FA 4P02A 5J4SA 4IS5A 4CRDA 1OP0A 1WU1A 1O3MA 1NFXA 4F48B 2P8OB 1GI3A 4UONA 3A8DA 1C5PA 1ZSKA 3QK1A 3EE7A 3F2FA 3GY6A 4ZKNU 4X8TH 1GI9B 5LPRA 3QLPH 5IK2D 4DIIH 2FS9A 1UTPA 3S9AA 1V2VT 1CT2E 1GCDA 2FO9A 1TQ7B 1O30A 1HXFH 1TNJA 1AWFH 3MO9A 1OYQA 1BBRK 3KQCA 1C1UH 4M7GA 3RXRA 2SFAA 1H9IE 1CVWH 2GP9B 8KME2 4JYUH 4YOJA 5E8EH 1ELTA 1QNJA 1T4VH 4U01A 1PQ5A 2BD7A 1BA8B 1IQKA 3C1KA 3CP7A 3TK5A 4X2XA 4XD7D 2H9TH 4FOUC 2A1DB 3FP8E 1HAGE 3MFJA 4FETA 3P8NA 2Z9IA 2OK5A 3B23B 1GJAB 2Y5FA 1HNEE 1TPAE 2ZIQH 1DOJA 4FUHA 4ISIH 4R8TB 5FXLA 1LVBA 2TGTA 1IQEA 4X1RU 1SGQE 3S9CA 2BOKA 1C2DA 3SI3H 5C67A 1WQSA 1TB6H 2TRMA 4KP0A 1K1PA 2WSSD 3F0PA 4CREA 1GBTA 4TT3D 2TPIZ 1O3FA 5GXPA 1M9UA 1RJXB 3TJOA 1N8OC 2VVVA 2G8TA 2Y82A 4D7FA 3VEQB 1CO7E 1HJAC 4FXGH 1NBME 2VJ1A 1OXGA 3ZVGA 1P57B 3BTDE 2VWMA 3SOSA 2F9NA 1C5YB 4YTAA 9LPRA 4GVUA 1C5VA 5FBEA 1P9SA 2NU1E 3NCLA 1T8MA 1KSNA 2FIRH 2UUKB 1UK4A 1LPKB 1V2KT 3GY2A 1NRPH 4I8GA 2JIZD 1GGDC 1YPKH 2J5UA 1YY3A 1VJAU 2FOFA 4Y76A 1C5NH 5C1XA 4MNXA 1YPHE 3F2GA 1OX1A 2C8WB 3G01A 4B75A 3BEFB 3SJKA 3P95A 1C2JA 1O3LA 4ZAEA 3GCHB 1QCPA 5JDUB 4VGCB 1NROH 1QTFA 2QXGA 1DY8A 1Z6JH 1GI5A 2IPHA 3IITA 1H8IH 5DP6A 1P2IA 2Q6DA 4UFEH 1UJ1A 4H6SB 1GBBA 3OTJE 4JZIA 4ISLA 4A5TS 3VB3A 1NRSH 3TVJB 1TX8A 4YLQH 3V7TA 7GCHF 2QYIA 1HCGA 2EI8A 4Y8XA 2EI7A 1C5XB 1HXEH 4OGXA 2BHGA 1ZSLA 3URDA 4RSPA 3U1IB 3DD2H 1TOMH 3L6PA 4FUCA 1A1RA 3ZZ6A 1P2OA 2DE9A 2C93B 1G3BA 1O3PB 1XUHA 2RA0A 2CV3A 2XC4A 4I32A 3SV2H 1TBQH 3RXAA 1Z1IA 1ETRH 2PTNA 4IMQA 1FLEE 2ZFTA 3SJOA 1VJ9U 2P3UB 1G2LA 2GCTB 1QB1A 1RIWC 3U8RH 2F83A 3DSPA 1UVTH 2BXTH 3VFEA 1TMBH 4JYTA 1TGSZ 1AUJA 1PYTD 3EA7A 1TE0A 2BY7X 3QZRA 2P95A 3F2HA 4WWYA 2FXRA 3UQOA 1DITH 1NFUA 1S85A 1MBMA 2ZNKH 4MPVA 1LQDB 2BD4A 3Q77A 1B5GH 1OS8A 3F68H 1E38B 2VVUA 5GJ4B 4IW4E 3QX5H 1Y3XA 3GY5A 3VG8A 1DUAA 2ZDKA 3EA9A 3SHCH 1GI6A 4OS6A 3P8GA 1GVKB 4Y79A 1G2MA 1FPCH 3RXMA 2FM2A 2KR7A 1TIOA 1P2JA 3BTGE 1K9OE 1DWBH 1TGNA 1SLXB 1O3IA 1ELVA 5CDFE 1RTFB 4X6PA 1C1MA 4A1TA 3RC5A 1EP6A 2IJOB 1D3PB 4MPXA 1D3TB 5ETXA 3PLKA 2F9OA 1TYNA 1WBGB 1Y8TA 4P00A 2WYGA 1K1NA 1TGBA 1LHCH 5EXMA 3TJVA 6CHAC 2BTCE 1LQEA 2RG3A 3K6ZA 4Z1MD 3M37A 1K1IA 3JZ1B 3NPSA 1QL9A 1KDQB 4FUIA
chains in the Genus database with same CATH topology
1ZLRA 4THNH 1ZGVA 2FESH 1ZRKA 2R0LA 4FVDA 4Y10E 4MNYA 1F5LA 2DUCA 3E16B 3A7TA 2R2MB 1F0UA 4NFFA 3MO3A 2B7DH 3LC5A 1F0SA 1PPZA 1GDNA 1GBIA 4JZ1A 2WINI 1JBUH 1XUJA 3F9EA 4A7IB 4HI3A 3IG6B 4BAMB 3HKIB 4X8VH 1FY4A 2Q6FA 1D6WA 1B0EA 1G36A 3EYDA 4E06H 1BTYA 4CBNA 2CHAC 1UHBA 5IDKA 1TNIA 4ABAA 1NTPA 5JPMH 1K1LA 3AAUA 2FS8A 3T28A 5HXFA 1V2WT 4K1EA 4KKDA 4PROA 1VCWA 1HAVB 1Y5UT 3A80A 5A8YA 1C1RA 2ZPQA 1GHZA 1UCYE 2WV4A 3MH5A 1DFPA 3DFLA 2Z6BD 3TH2H 1YF4A 3KQDA 1C1TA 1EB2A 1O2JA 4DT7B 1ANBA 1GHBF 3M5LA 4KELA 2D26C 1A46H 1CGJE 1ID5H 4AFZA 1NS3A 1RTLA 2VIWA 4Q7YA 2ZHWH 5TJXA 4YLUA 3BTKE 1OWHA 4CR5A 1SLVB 5DK1A 2GGVB 3RXFA 1MBQA 3SV8A 4Q7XA 4AG1A 1C2EA 4AGJA 1SHHB 3TLOA 3MU5A 1YPGH 2TIOA 1EPTA 3ZVCA 3FZDA 4TPYA 1GHAF 3TJNA 4BNRA 1AZ8A 1A61H 2YNAA 5C20A 1JMOH 1O2OA 1O2PA 2STBE 3PTNA 1GPZA 3M3TA 2Y80A 3SNEA 2ZECA 1EASA 1Y5AT 4D9RA 3HKJB 3RXQA 2STAE 1SB1H 3AVZA 3TGIE 1GWAA 4Y8ZA 4NG9H 1EXFA 1SL3A 3TIUA 5CHAC 1NN6A 2QF3A 1IQHA 1KTSB 3W94A 4AZ2B 1D3DB 2ZG0H 3SU6A 1UCYH 4UDWH 1MTUA 2SGDE 1GBMA 4RKJB 2A5AA 2P8OC 2QY0B 1L1NA 3D62A 3ESTA 1SOZA 2AEIH 1EP5A 4XBBA 1CGHA 4NWKA 2F91A 1O32A 3SQEE 1O38A 4NFEA 1ZHRA 2A7JA 4YZUA 1O33A 2BB4A 2FODA 4YOGA 1SG8B 3ZVEA 3LGVA 1C2IA 4I8KA 3P8FA 1SSXA 2A5KA 3RXHA 4ABDA 1BTWA 1TWXB 3E3TA 1PPCE 2XCNA 2CJIA 3RMMH 1GJDB 4JYVH 1QQ4A 1KXAA 1O3OA 3BEIB 4BXWA 2ZF0H 1JRSA 1YPMH 2IOTA 1O35A 1GMHF 3GY8A 4ABIA 4O03A 5EW2H 1PPEE 2QXIA 1KXBA 4KTSA 1P01A 3UQVA 1E35B 3A8AA 1GMHG 2TGAA 3VB4A 1GI1A 3E1XB 1S6FA 2CMYA 4U30A 1K2I1 1A4WH 1UCYK 2ZZUH 4GAWA 4OS2A 3ITIA 1CHOF 3DA9B 1E36B 2ZWLH 1XXFA 4X6OA 1T8LA 4ABEA 3SQHE 3T27A 2BLQA 1IHTH 4YT6H 5ESTE 1O2QA 1FY5A 2C8YB 4X1PU 5AVDA 1C5MD 2OC0A 3BTEE 3LGTA 4FUGA 1TPPA 2SGAA 4WXIA 2GCHG 1UVSH 2G55A 3U8TH 1FAKH 1A2CH 2FTLE 3RMLH 7LPRA 1TA2A 3C27B 5IYTA 1YKTA 3FP6E 1TRYA 2AFQB 1SGFA 3VB7A 2HNTF 1UVPA 1FMGA 3STJA 4H6TA 1IQIA 1OWDA 1P8VC 5FHTA 1C2FA 1FONA 2O8UA 4AFQA 3GCHC 1EJMA 2VB0A 4H42U 1DLEA 1HAYB 4VGCC 5EGMA 4CH2B 2ANWA 2W3IA 2ZDNA 1ARCA 3SZNA 1YBWA 1S0QA 5DP4A 1HPGA 2QV1A 1QR3E 2A4QA 2ANMH 3E0NB 1SGRE 4ABGA 1V2TT 1MAYA 3OU0A 3SUGA 1AWHB 1QIXB 4ESTE 3RDZA 1KIGH 4ZHLU 1HLTH 1FDPA 1MCVA 4DOQA 1W2KH 1P3CA 1DDJA 3SN8A 1GVZA 4BAOB 8LPRA 1D6RA 1MTNB 1FIWA 3GCTG 1K1MA 1GMCF 1O3DA 2BZAA 4Y8YA 3RXTA 2KAIA 1BBRE 3A89A 1YC0A 2NU0E 3P8OA 3RXBA 1P02A 1N6YA 1O36A 2GCTC 2OD3B 2FOMB 2H2ZA 1HJ8A 1C1SA 3ATMA 3A85A 5I46H 2ALVA 1EAWA 3RC4A 1O3GA 2BD9A 4CHAB 2XBXA 1H9HE 4K1TA 1C2LA 3TPIZ 3GYMA 4JCNA 2RDLA 4NGAH 1AO5A 3OY6U 3ATKA 1BRBE 4CBOA 4IN2A 2OBQA 1ZR0A 2NWNA 2G5NA 1NRQH 1DY9A 4E05H 2V35A 4NSYA 1A5IA 4CRGA 4BTTB 7KMEH 1GBKA 3ZVAA 2B9LA 2BOHB 1YPLH 4LK4A 2Z94A 3FZZA 3N7OA 2JETB 4MLFB 2R9PA 6ESTA 3F6UH 1QURH 1OWEA 2ZHEH 1GDUA 4WVPE 3UWIA 4XBDA 3T62A 1BTHH 1XUFA 1T7CA 4XDEA 4Z0KA 6GCHF 1OWJA 1BZXE 3MH7A 1ELAA 3JZ2B 3A7YA 2Y5GA 1MU6B 1TAWA 1ABJH 5L2YH 2A45B 1CA8B 1ZPBA 4CRCA 2ZU4A 4BAHB 1MH0A 3SU5A 1YLCA 2PTCE 5FAHA 1AD8H 2FI4E 2FPZA 3RUOA 1HBTH 1SGYE 2SGQE 4U2WA 3M7QA 2XW9A 2JKHA 5ABWA 2HGTH 2FOBA 1MZDA 1FZZA 1BMAA 2VIVA 1LVMA 5FX6A 2ZU5A 2EEKA 1BRAA 5FPTA 5F6MA 3ZZBA 4OS7A 5BRRE 4NZLA 1TA6A 3QTVH 3GY7A 2PSYA 1BOQA 2B5TB 2PKAA 1CT0E 3PMBB 1PQ7A 4FUJA 3ENSB 4R0IA 3MHWU 1RS0A 5JBCS 2PV9B 2FWWA 1G37A 3NK8A 3QZQA 1GI8B 1O2HA 4JZEH 4BTUB 4GHTA 1MTVA 2VU8E 1PPBH 1EKBB 4B2AA 4WH6A 2HNTE 1WQVH 1A7SA 2UUFB 3D23A 4A1VA 2OBOA 3B8JA 1HDTH 1E34B 1EAIA 2RA3A 2IN2A 2WUCA 2SGPE 1SGIB 1SLWB 1MTSA 2GX4A 1THRH 1ZJDA 2QXJA 1V2JT 3ZZ7A 1L4ZA 1CT4E 2Z3CA 5DG6A 2C3SA 3LONA 3NXPA 1SI5H 3PLPA 2VWLA 5HYOA 1T4UH 2HWLB 1RFNA 3SU1A 1NU7B 1V3XA 3NZIA 1FPHH 4F49A 2OC1A 2BY8X 4ZXXH 2BLWA 4TYDA 1BHXB 2G5VA 3O8RA 3MU8A 1CHGA 1ELCA 1O2ZA 2A4GA 3MH6A 2V6NA 2WPMS 1G9IE 1BRUP 1EATA 2NU4E 1VCPA 4I33A 3T25A 1XUIA 1BT7A 5K7RA 1DM4B 1P10A 2W7SA 1WSSH 2UUJB 5GWZA 2FMJA 3M7UA 4I31A 4WMFA 3H5CB 3MH4A 3QUMP 1IQNA 1VGCB 2GDDA 1P09A 1SGEE 2WPKS 3SGAE 1FY1A 1O31A 1OPHB 3UNQA 3MNCA 1OSSA 5C1YA 3E90B 2B8OH 1CGIE 1P03A 1TBZH 2WPJS 1VR1H 2XXLA 1J9CH 1NO9H 3M5MA 1HAPH 1YCPH 5EODA 3RXEA 1QRZA 1TPOA 4DVAU 4IN1A 3RU4E 2PKSB 1XXDA 1CQQA 3A7ZA 2SGEE 1DSTA 5EQRA 1K22H 3EE0B 3MOCA 1NM6A 2GD4B 5K0HA 3ATLA 1P06A 1O2RA 3GY3A 3WY8A 2A2QH 3SU4A 4AYYB 1SLUB 4LZ4B 1FN8A 1C2KA 3P6ZB 1P0SH 1UTKA 2VIDA 1GHYH 3PROA 1O37A 1O2SA 5A8XA 3W95A 1Y3WA 1V6DA 2O9QA 4QT8C 2R2WU 1F0RA 1ZPZA 3MNSA 1Z8RA 3TH3H 1UTQA 2PUXB 7GCHG 4HZHA 3GICB 5DP5A 3KL6A 3ZVFA 1RGQA 1BITA 3RXGA 1KXFA 1O5CB 2FOCA 1JIMA 1KLJH 1S83A 1PFXC 1GHXH 2ANKH 2G81E 1HAXB 1W14U 4YO9A 4UFDH 2OXSA 3IWMA 1SQAA 2ZKSA 1MMJN 2P16A 3UR6A 3QTOH 1C5LH 1PPFE 1YM0A 2R3YA 2NU3E 3PTBA 2VH6A 3SNAA 1YCPK 3BTTE 1ZTKA 4FUEA 3UNSA 1GBFA 1AKSA 1Z6EA 8GCHF 4ZROA 5JB9S 3SNBA 2JH0D 5JB8S 3TJUA 2AIQA 2AMDA 1J16A 3A81A 1D3QB 1EUFA 1TOCB 2XRCA 1ZSJA 1LVYA 5C3NA 3QGJA 1BDAA 2RCEA 1RD3B 4D9QA 5GCHF 2VH0A 4AB9A 1DVAH 2FEQH 2LNCA 5DP8A 2WUBA 1HAHH 5LGOA 1FUJA 1HAZB 2F9BH 1C5WB 4AORA 1C5OH 2AGGX 2THFB 5E0HA 4NCYA 2BLVA 3UREA 3KGPA 2XCFA 2YNBA 3KHVA 2GT8A 4TPIZ 1MTNC 1GMDF 1XUGA 1C1WH 1CA0B 5PTPA 4WF8A 2AERH 2AS9A 1DUEA 4B76A 1BIOA 4TWWA 1L2EA 2BDCA 2ODPA 2ZCKP 1DICA 1V2OT 2OINA 5E2PA 3PO1B 2J38A 4ZKSU 1GJCB 3M61U 4B2CA 4MVNA 2FOEA 1BTPA 5F8TA 1D9IA 3GCNA 3PMHB 1T31A 4NWLA 3MO6A 4UEHH 1FN6A 1HGTH 4CHAC 2GV7A 3D49H 1QGFA 2FOAA 4J1YA 1GJ9B 4WJG2 1DXPA 2XBVA 1W7GH 4WXVA 1VITF 2FLRH 2ZGBH 3P70B 3TGKE 4ABFA 2FDAA 2XBYA 3PLBA 3VGCB 1QJ6B 1O3AA 4E7RG 2XC0A 1HV7A 3Q3KA 1HUTH 1OWIA 1VITG 2ZFSA 1LO6A 1AY6H 1ABIH 4K60A 3SJIA 5E0GA 1MD7A 2QXHA 2BVRH 2JETC 2BX4A 1IQMA 4NIVA 1KYNA 4AX9H 4NIWA 2QCYA 2Y5HA 2UWOA 3MU4A 3S7KB 3VXFH 5FCKA 3TNSA 1JIRA 1GBEA 2EC9H 2OC7A 3DT0H 1TALA 1LMWB 1Z7KA 2NU2E 2HVXA 3BG4B 1P2KA 1W12U 1ELEE 2GZ8A 1GHBG 3BTHE 3Q3YA 1VZQH 4DCDA 3M3VA 1YCPM 2UWLA 4ZUHA 1C9PA 2FOGA 1O3KA 2FI3E 2C90B 2VWNA 4Z6AH 5DGJA 1YPEH 3ATIA 2ZCLP 1C5SA 4FU8A 5L6NH 1V2ST 1TQ0B 5JBBS 2ESTE 2QF0A 4JZFH 1LHGH 1O34A 1ZMJA 1GHAG 4X0WU 3SV7A 2VWOA 2A32A 3PMAB 4ASHA 1QA7A 1O2IA 4BANB 2ZDAH 5ESBA 1BTZA 1CBWB 3MMGA 2ZDVH 1SVPA 5FPYA 5T6FA 2H6MA 1GJBB 1ZMLA 5CMXH 3RXLA 3U1JB 3E91A 1EX3A 2J92A 2WPIS 1F5RA 2JH6D 4JK5A 1FAXA 3HATH 1C4Y2 2ZFRH 1B0FA 4GHQA 2Q1JA 1MCTA 3UR9A 1GI7B 1V2LT 2SNWA 3CS7A 5EU8A 5FPSA 4NA7A 4ZMAH 1WUNH 2VGCB 5DP9A 4WMEA 2ZQ1A 3GYLB 5HMAA 3EAJA 1UMAH 3CENA 2OTVA 1SQTA 3BTWE 1P3EA 1P11E 2ZTZA 2J95A 3TITA 1IQLA 1S84A 1J14A 3TU7H 4AN7A 1MKXH 1AQ7A 3ODDA 1KXEA 2GKVE 2CF8H 5HGGA 1O39A 4AFUA 1AB9B 4Y11E 1OOKB 3KQEA 4XOJA 1BB0B 2BMGB 1FY3A 5EQSA 1IQJA 1UVUH 2CGAA 3BTQE 3SU3A 2CN0H 1O2XA 1UK2A 1MTWA 5AFZH 5A2MH 1DLKB 5E2OA 4MPUA 2XWAA 3SORA 3MNXA 3BIUH 1HAOH 1L1JA 1TGTA 1HRTH 1B7XB 3RLWH 3LT3A 2A7HA 3MNBA 1SGDE 3A87A 1GCTB 2D2DA 4X2WA 1Q31A 1EOLA 1KDQA 2BXUH 3LGWA 1G3CA 1GHWH 1CHOG 3V12A 3H7TA 1S6HA 1FV9A 1QBVH 4SGAE 2GV6A 4JMYA 4BAKB 2BDHA 1ZRBA 3U8OH 1VGCC 3F9FA 3URCA 3Q00A 4ZXYH 2SGFE 1QHRB 1AVXA 1LCYA 1MKXK 1DXWA 2QAAA 3GISB 2ZQ2A 4ABHA 1NZQH 2AGEX 4DY7B 1QBOA 1TRNA 1AVWA 2BD8A 2P94A 3A86A 3ATWA 1H8DH 4NIYA 3RU4D 4WH8A 2GTBA 1TGCA 3ZYDA 1HAVA 3LOXA 3ZZ3A 2PKSC 1K1OA 1C4V2 3L3TA 3A8BA 3M5OA 1ESBA 1OYTH 3HK3B 3HGPA 1LHEH 4IBLH 3SNCA 3PB1E 4A1XA 2ZFFH 2PGQB 4WY3A 1HIAB 1UTOA 2FX4A 1GJ4H 1G32B 2PGBB 1GJ8B 1RXPA 2J2UA 2JH5D 1PJPA 4BTIB 3KNXA 1C5ZB 4Y7AA 5FCRA 5AFYH 3BIVH 1ELFA 1HAIH 1C4U2 4FVBA 1MQ6A 3LJOA 1JXPA 5L2ZH 1ANDA 1V2RT 1FI8A 1K28D 4IMZA 1YPJH 4ZKRU 1GMCG 2BD5A 4Q80A 4LZ1H 3TNTA 3AASA 1KXDA 2HRVA 2H5DA 2ZA5A 4DGJA 4O9VA 1JRTA 1H1BA 4MNWA 1P2QA 1SGNE 1WTGH 1JWTA 3SW2B 3SBKA 1FXYA 1TX7A 4X2YA 3PYHA 2ZU1A 3ELAH 1ELGA 4AG2A 2P3FH 2BY5X 1AI8H 1SMFE 4GLYA 4NSVA 1DANH 3M35A 1EJNA 5GIBA 1IQFA 5JYIA 2FTMA 3ZV8A 1QJ1B 2H9EH 1F7ZA 2OQUA 3Q76A 3TK9A 3KCGH 4CRBA 4K8YA 1OP2A 1LTOA 2OC8A 7ESTE 4DG4A 1SBWA 1OKXA 1O2NA 1ETTH 1KXCA 4O3TA 2XC5A 2ZI2H 1DE7H 3VPKA 2QC2A 1C1VH 2ZGJA 2CHAB 1UTMA 3RXSA 4Y7BA 2CF9H 5LPEA 4X8SH 3ZZAA 2FLBH 2OCVB 1ESAA 1O2GH 3SV6A 1Z8JB 3ZZ8A 1CA0C