4X1PU

The crystal structure of mupain-1-17 in complex with murinised human upa at ph4.6
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Distinctive binding modes and inhibitory mechanisms of two peptidic inhibitors of urokinase-type plasminogen activator with isomeric P1 residues.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1pU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1pU01
1QURH 1TRYA 3URDA 2ZPQA 5JB9S 3H5CB 1RIWC 1B0FA 1CBWC 3RMMH 4WH8A 5GCHG 5FX5A 2BZAA 3V12A 2GMTB 2HNTE 2HOBA 2SNWA 4WMDA 1O2ZA 2F91A 5FXLA 1GI9B 3QGJA 3A7VA 3RU4T 3A83A 2VIVA 4YLUA 4RKJB 2ZCKP 1PPBH 1AVGH 1G2MA 2ZI2H 1O2XA 1OYTH 3SW2B 5CHAC 1A2CH 1SGYE 3GDUA 3HKIB 3VGCC 2BLVA 3SUFA 4AFUA 2FYQA 4I8LA 1SLVB 4NA9H 1YPHE 4B71A 1L2EA 1TALA 2NWNA 1CVWH 1C4V2 2RDLA 1O3NA 5FCKA 1IQGA 3SZNA 6GCHF 2HNTC 4FUIA 3ZVEA 1O3JA 4NCYA 1O2LA 4X1SU 2WPIS 2VIDA 2Y80A 3GDSA 1H9LB 3K65B 3OY5U 1AZ8A 3FANA 3QLPH 1DSTA 3E3TA 3S9AA 5F8XA 1DE7H 3V0XA 3SNBA 2ZP0H 3RMOH 1DY9A 2BHGA 5FBIA 4MLFB 1GJ9B 3MYWA 5FHTA 4FUJA 1CGJE 2OINA 2Z9LA 3EGKH 1ZSKA 2VWOA 2BVSH 2J2UA 1YPHC 1LQDB 3K2UA 1OP8A 1HDTH 1G32B 3NZIA 4FVBA 2AYWA 3EA9A 1EPTA 1VCWA 3QTOH 1GG6B 4O3UA 2WINI 4D76A 2VINA 3P6ZB 2QCYA 2ZA5A 1C2MA 4B1TA 4LZ4B 1KIGH 3SU2A 5GWZA 1O3IA 3HKJB 1ZTJA 4CREA 3ZYDA 2FX6A 2CXVA 1NS3A 4WF8A 4B76A 3A7TA 4AX9H 2ZF0H 1EUFA 3QWCH 1YCPM 3M7UA 7LPRA 3PM3A 3SJOA 1BTWA 4ABBA 1ZPBA 1ZR0A 4E7RG 3LH1A 3S69A 2WV5A 2G51A 4F49A 1J17T 1NO9H 2WPMS 4GHTA 2I6SA 3ZVFA 3MNBA 2FOFA 4K1EA 3P8FA 2AFQB 1FPCH 3K6YA 2H6MA 2PHBA 3AAUA 1XUIA 1DICA 2FOGA 1O2VA 1BMLA 2BQ6B 2XNIA 4CR5A 5K7RA 2BD8A 1O31A 1JXPA 4YZUA 2G52A 1AFQB 1C5PA 1TX7A 1CA0C 3CP7A 3LT3A 2F9VA 2JKHA 3BEFB 5AF9H 1UVOA 5DJ7A 4GLYA 1GHYH 1TNGA 1ESBA 1D4PB 1L0ZA 3MU1A 3R0FA 4IN2A 1LTOA 2FI3E 5A8ZA 1O2MA 4X2XA 1TBQH 1FY8E 3ATLA 5E8EH 1PYTD 2FMJA 1AFEH 3T25A 2Q1JA 1GHAF 1HAYB 3DA9B 1CSOE 2Z7FE 4DY7B 3IWMA 3UIRA 1GBLA 1O37A 1FY5A 1TPAE 2ZCHP 2G81E 2QA9E 2VIOA 5JBCS 1PPHE 1TOMH 4INLA 2QAAA 3V3MA 1ZMJA 1HAHH 3TVJB 3ZV9A 3M37A 5T6GA 1C1SA 4ABIA 1QNJA 1T7CA 1GCTC 1ANDA 2TGAA 1Y5UT 2FI5E 1K1OA 3UNRA 2BOHB 1XX9A 2ZU4A 3CENA 3ZVBA 1ZOMA 2AMDA 3M61U 4UFDH 5EQQA 2ZO3H 1VJ9U 1NRNH 4DG4A 1OWHA 3I29A 4LXBH 4UEHH 2RA3A 2WPJS 2BM2A 4AB8A 4XE4A 2OD3B 1QL8A 1V2KT 1K1IA 1MCVA 1ACBE 1O2NA 3MU8A 1LO6A 1F5KU 2R9PA 3MMGA 3F9GA 1KXBA 2W3KA 1UK3A 3SNDA 3UR9A 1J16A 1DLKB 4CRBA 1QFKH 2PTNA 2PW8H 3HK6B 2OCVB 3HPTB 2VGCC 2IOTA 3LGWA 1HBTH 2SGFE 4DURA 4ABHA 4KTUA 2BYAX 3M35A 1NFYA 1UK4A 4MG3A 2FOMB 1P11E 4YOIA 6CHAC 2FS9A 4BTIB 1FDPA 2TGTA 2P8OB 4LOYH 2XC5A 4WMEA 4J2YB 1A5IA 2C8ZB 1D6WA 1MTUA 2H5CA 3L3TA 4A1VA 1BDAA 8GCHG 3SGBE 1GMCG 1G36A 5HMAA 4GHQA 3PTBA 5FX6A 2AGIX 2CHAB 1LDTT 1DXWA 1JBUH 2Z94A 3UY9A 1A0JA 2C8XB 1BBRK 2FP7B 1H4WA 1QBNA 3RP2A 1IQHA 1GBFA 4ZMAH 3ZVGA 1QBOA 1P3CA 2V3OH 1AWHB 4NSYA 2GKVE 1YGCH 5DG6A 1J15A 2ULLA 1GI1A 1EB2A 1KLJH 1NFWA 1MMJN 2NU4E 1GVZA 1RFNA 2GCHG 1FXYA 5EW2H 5FPTA 1WUNH 4HTCH 5FPSA 1BTYA 1PPCE 1UTKA 2JETB 3ATIA 1GGDC 1EASA 1XMNB 4YTAA 1SG8B 1SFIA 3KNXA 3EDXB 3QK1A 4Y71A 5F03A 2BVRH 2BB4A 1VGCB 2W7SA 1G3DA 3P8GA 1UTNA 1ZPZA 1CT2E 2GGVB 1ELGA 2ZQ2A 1OYQA 1RTLA 3KQCA 1FONA 1ZZZA 3U8TH 1QRZA 2VH6A 3F68H 1MCTA 1QJ6B 2OLGA 4ISNA 3RXJA 1QHRB 1C1UH 2P3UB 1KDQA 1O3MA 3NK8A 4ZXYH 3BTKE 4GUXA 1SVPA 1J9CH 2FX4A 1O32A 4MQAA 4Y0ZE 2PKSB 1V2VT 5IYTA 2D8WA 3HK3B 5C20A 1GI6A 4X2WA 1FI8A 1W0YH 2KAIA 4BAHB 1AIXH 1NN6A 3P92A 4H6TA 1MD7A 1BTPA 1NU7B 2GCHF 1A5GH 1JRTA 1O3HA 2PUQH 2AS9A 2EEKA 3LDXH 4D7FA 4U2WA 1RXPA 1C5QA 3FP7E 3SV6A 1LHFH 1UHBA 3M5OA 1FMGA 2FTLE 1FIZA 3ESTA 4JCNA 1MKWH 2BZ6H 4DGJA 2C93B 2VIQA 3JZ1B 4B2AA 4H6SB 1HIAB 1MQ6A 4UFGH 3LU9B 3RM0H 2ALPA 1GBKA 1INCA 3JZ2B 2BD7A 3RXDA 4JZIA 4JZ1A 2D26C 4CRFA 3SBKA 3SUGA 1LPGB 1GBEA 3SU3A 3GCOA 3A7YA 1S82A 1YYY1 9ESTA 1P3EA 2GT8A 4AFZA 3Q3XA 1UTOA 2ZDLA 3E91A 2VNTA 2O8TA 1DFPA 3NKKA 2HPQH 4B74A 1WTHD 3LC3A 1CQQA 1GJ7B 4A1TA 2RA0A 1TMUH 4MPUA 1M9UA 2TPIZ 1S83A 5SGAE 1V2NT 2J92A 1O5FH 1YLCA 2QC2A 1C2IA 1TPOA 1O33A 3RMLH 4BTTB 2STAE 4OS7A 1EB1H 2WUBA 1P57B 1P2NA 4HI3A 3TH2H 2XWBI 1OOKB 5HM2A 3M36A 1K22H 2JH6D 3UFAA 1HJAC 2GX4A 4TPYA 1MD8A 3A7ZA 3SV2H 3FP6E 3OSYA 1NT1A 1DUAA 4GCHF 1Z7KA 2ZGJA 1T8NA 3STJA 1GBBA 2ZTXA 1TFXA 3M3TA 4IBLH 2QXGA 1O5AB 1SPJA 1GVKB 2BDHA 2FYRA 2AEIH 1GBTA 3ZZBA 1Z1IA 2Y81A 1WQVH 4TPIZ 1BJUA 4BAKB 1PPZA 2PV9B 3GY6A 3BIUH 1LHCH 1SGFG 5C2ZA 1O5GH 3MH4A 3MNCA 1SGFA 2F83A 1C1RA 3GISB 1LPZB 5C1XA 1GDNA 4IMQA 1DOJA 3SQEE 3L33A 3M7QA 1DDJA 3RXBA 3ZZ7A 2ZDKA 3S0NA 4RKOB 4OS4A 3ZV8A 3A82A 1G3EA 1KYNA 1FV9A 1FNIA 2G55A 3PO1C 4XBDA 1ANBA 1UCYK 2K1QA 2AH4X 3VXEH 1ZPCA 2BMGB 1DWEH 2OUAA 3LKWA 1GJAB 1ANEA 1FY4A 4VGCB 2P93A 3UOUA 1C2GA 3T27A 1UK2A 1BCUH 1GDUA 1MAYA 4Z6AH 1MKXH 1ZRBA 1ZSJA 3OYPA 5T3HA 4CRDA 1ZGVA 4Y8YA 1F0SA 2C90B 2PWXA 4U01A 6ESTA 4ABJA 2R3YA 2ASUB 5DKMA 3BTGE 3VB7A 2VWNA 2VU8E 3SJ8A 1YPGH 1HAXB 4BTUB 2GP9B 2FPZA 1RIWB 1ELVA 2A2QH 2FLRH 3M7TA 1O2TA 1T4VH 1TNHA 1Z1JA 2XC0A 3P8OA 2WV4A 5F8ZA 3BG4C 3F9EA 4B75A 4MPWA 4BXSA 3QUMP 2SGEE 1OXGA 4AG1A 3TJOA 1YKTA 2GVFA 4THNH 3ZZ9A 3GY8A 1ZMLA 1GCDA 3TITA 1VITG 1TGNA 4NGAH 2TRMA 3OY6U 1VR1H 4X8VH 4Y8XA 1AHTH 2O8WA 3V7TA 4D7GA 3BTWE 1O34A 1O2PA 2FOHA 2FI4E 5A8YA 1UTMA 1SGIB 1ETTH 1DM4B 1QQ4A 2P95A 4WVPE 2BLWA 1TAWA 4K8YA 2Z9KA 4NZQA 4Q7XA 1NRSH 2ZU2A 1AO5A 2ZFFH 5FPYA 2C8YB 2V35A 1F5LA 2GZ8A 2C4FH 2UUFB 1OKXA 1O3EA 1G37A 1P9UA 1SI5H 1O2IA 1GJDB 1V2OT 1UVPA 5E0HA 1OWDA 1PYTC 2HNTF 1ZTLA 2RG3A 5DP8A 1QL9A 2A4QA 1TQ7B 3M3VA 1WAYB 5TCAA 2QGRA 3PTNA 3IITA 3TPIZ 5CE1A 1Z6JH 1C1QA 1D3DB 1GJCB 1JRSA 2F9NA 5F8TA 1AUJA 1UTPA 1EATA 1O2QA 2ZDNA 1L1NA 1QTFA 1HAVB 4NZLA 1HLTH 1HYLA 2OQUA 3BTEE 2B0FA 1PPFE 3RXPA 3O8DA 1Q2WA 2ZU3A 4AFSA 3NPSA 4FUHA 4KGAA 4ZH8A 7KMEH 2XWAA 3NCLA 5F6MA 3MO6A 4DT7B 5BRRE 1V2TT 4DOQA 3F1SB 1AE5A 4CH8B 1QRWA 2QN5T 1RGQA 3QX5H 5T6DA 1MTWA 3QZQA 2G5VA 3M3SA 2FOCA 3PWBA 3GCHC 1P09A 3RXEA 3RXFA 1ZRKA 3DT0H 5LGOA 2ZQ1A 3D49H 3RLYH 3A8DA 1AD8H 4MNWA 3UQOA 7GCHF 3UUZA 4I8JA 1TBRH 2QXIA 1GI5A 1TQ0B 1D6RA 3PROA 1AUTC 1SQAA 1O2HA 1S0RA 3RMNH 1HJ8A 3A87A 5GCHF 1T32A 1D9IA 1LVOA 1IQLA 3GY7A 4KTSA 3ZZ6A 1YPEH 4PROA 2HWLB 4ABEA 5C5OA 1PPEE 1P02A 2GMTC 2FS8A 3PMJA 1SMFE 1CHOG 3E0NB 2ZC9H 1ZHMA 1IQEA 1E37B 4WXVA 3BV9B 2GZ7A 4IMZA 4NFFA 2SGPE 4JZDH 3F9HA 1ZLRA 6LPRA 2BQWB 2BQ7B 4JYTA 2XBVA 1J8AA 4K1TA 2O9QA 1HAZB 1Z6EA 3GDVA 4X2VA 1LPKB 4UDWH 1O2OA 5C67A 2GV6A 3RXMA 3PLKA 4AN7A 4U32A 3SU1A 3GICB 5HM9A 4JYUH 1EPTB 5L6NH 1ESAA 2BDGA 2H5DA 3FFGA 4MVNA 1O2GH 2OC0A 1JWTA 1ABJH 1O35A 4JYVH 4X6NA 2XBXA 1ELAA 3H7TA 3TGIE 1FN8A 2BLQA 3BG8A 2ZPSA 1IQIA 3G01A 4ISLA 1IQKA 2BY5X 1GI0A 4K3JA 3U9AH 1GHVH 2Y7XA 3FVFB 2W7UA 1BHXB 4ZHMU 1MTNB 4FUGA 5JBBS 1OS8A 1F7ZA 1ZTKA 5ESBA 1WU1A 3TLOA 2FESH 4Y11E 1S6HA 2CJIA 3Q00A 4HFPB 2R3UA 4Y7AA 1O3GA 5B6OA 2FODA 2UUKB 3RXRA 1BHXF 1GG6C 2UUYA 1XUGA 1BJVA 4RSPA 3HGPA 1BMNH 1SOZA 1O3LA 2PR3A 3SUEA 5C3NA 5DP9A 4Y7BA 1NC6A 2UWOA 1A7SA 1EXFA 2ZGXH 2BXUH 2PSXA 1G9IE 5J4SA 1UVSH 1GHWH 1MQ5A 2PKAA 3ATMA 2V3HH 2VGCB 4Y0YE 2OTVA 4AGJA 1K1JA 1THSH 2Z3CA 1GJ8B 2ZHQH 1EKBB 1AKSA 1SSXA 3BTTE 3EQ0H 1QRXA 3RC4A 4A92A 3V13A 2Z9JA 5G4BA 3ZZDA 1SLUB 1UTLM 4ZKSU 1RRKA 1TGTA 4UFFH 2A4RA 1AWFH 4FUDA 3LOXA 1A3BH 4X1NU 2F9PA 1XUKA 3TK9A 4ZKOU 4O97A 4QT8C 1WQSA 2R0LA 1LKAA 3I77A 1DPOA 3KN2A 3A7XA 1PQAA 1TGCA 2HPPH 5E2OA 3RXVA 1P2MA 1TABE 1EOJA 3SGQE 1C5YB 3GCNA 4ISOA 3MU4A 5EXNA 1O2KA 5L30H 1C5TA 4AOQA 3MHWU 2FTMA 1IAUA 2OBQA 2G5NA 5LH8A 2IPHA 1O0DH 3MH7A 1E34B 2Z9GA 4Y6DA 4D9RA 5J4QA 1SGCA 1RTKA 1V2UT 4Y10E 2QV1A 3SU0A 1GBJA 1O3FA 2HLCA 2QF0A 1E35B 1HAOH 3ZYEA 4D9QA 1KXEA 3OTJE 1DLEA 1GMHG 1X7AC 1QJ1B 3AASA 1FZZA 1C5XB 3BSQA 3A86A 5ESTE 3E90B 4IS5A 1SC8U 3SJKA 1HGTH 1LVBA 1O3KA 4YLQH 1D3QB 3KEEA 1LHGH 2G8TA 1TGBA 3D62A 3A85A 1QJ7B 4X6MA 1BB0B 1DSUA 2ANKH 1BOQA 1EZXC 3SO3A 3SQHE 4DCDA 4A7IB 1B7XB 4UONA 1TMTH 1TRNA 4WXIA 3PB1E 3MTYA 3RXAA 3LJJA 1ZJKA 1ARCA 3BEIB 1HV7A 3RUOA 2O8LA 2ODQA 1V2ST 1G3CA 2F9OA 2ZTYA 1AE8H 3CS0A 3P17H 2BLOA 1QR3E 1S84A 1IQMA 1EOLA 1L1JA 1O3CA 3A88A 5EU8A 5JYIA 1A61H 2BY7X 2BX3A 1UJ1A 3D23A 4FU9A 1LQEA 2THFB 4NSVA 1ABIH 3UTUH 2BTCE 2ZIQH 2ZZUH 1E0FD 2GCTC 4CRCA 2BDBA 1B5GH 1V2WT 3MO9A 2HRVA 1BMMH 2FM2A 4AG2A 3MI4A 2BY6X 3SORA 8GCHF 1GMCF 2O8MA 4AYYB 1BBRE 5EG4A 3RXKA 1SL3A 1SHHB 2CGAA 2ZDAH 1DVAH 2GDEH 4Q7ZA 1JMOH 4A5TS 4JK5A 1EAIA 1O2UA 2WPHS 3GY4A 2CHAC 1VJAU 5DPAA 3D65E 1TRMA 5GJ4B 4ZKNU 3RM2H 3A84A 4X6PA 8LPRA 2J95A 5EXLA 1ANCA 1MU6B 2BD3A 4JZFH 1C1WH 1AN1E 1O39A 3TH3H 2ODYB 2A45B 1AQ7A 2BXTH 3SNEA 1C4U2 2AGGX 3TNTA 2Y5HA 3LH3A 1QIXB 1O30A 1HPGA 4ZXXH 1O3OA 4GSOA 3A89A 2ZFTA 2ZPRA 5ABWA 2ZDMA 4FUBA 4WY3A 1TWXB 5GIBA 5EOKA 2VB0A 2Y5FA 4Q2KA 3RXOA 2D1JA 4XOJA 4ABFA 1VZQH 2FDAA 1KDQB 3KGPA 4OS1A 4OS5A 2ALVA 1HXEH 5TJXA 3SHCH 4HGCA 1SLXB 3N7OA 1VGCC 2AIPA 3AW0A 5GXPA 1P2JA 1SR5C 2XXLA 1TONA 5DP4A 1W0ZU 3BTDE 1EAXA 3PWCA 2KAIB 1MUEB 3A8CA 3W95A 4A6LA 3SOSA 4CH2B 4K1SA 2BY8X 3B9FH 3SNAA 1ELTA 3VXFH 4Q80A 1PJPA 4AYVB 1XVOA 4TY7A 1HJAB 2ZDVH 3SHAH 1UHBB 3O8RA 2F9UA 2A31A 1KXFA 1THRH 3O8BA 1Y59T 2A7JA 1A0HB 3I78A 1ESTA 2G4TA 2IJOB 1XUJA 1Y3VA 2PKSC 4RN6A 1HB0B 2A5IA 2CN0H 2HGTH 8ESTE 4ZHLU 3K6ZA 4XBCA 3S9BA 1QB9A 5E0JA 1MTVA 3TNSA 5AFZH 4YM9A 3SU5A 3LJOA 2ZNKH 3VEQB 3E16B 4CHAB 1Z8JB 1DWBH 1BUIA 3E0PB 1NFXA 3LIWA 5EPYA 1YC0A 3VB4A 3BTFE 3P70B 2XW9A 2PLXA 3K9XB 4O3TA 1ELBA 1Z71A 1WBGB 1W14U 1VITH 1DX5M 2UWPA 1HAIH 3PO1B 4INHA 2G4UA 3MFJA 1O5DH 1OWEA 2A32A 4SGBE 1C1PA 3DUXH 3MU0A 1Y3WA 4DIHH 1O3AA 2B8OH 3SJIA 5DP3A 1IOEA 3BTME 4BAOB 1KLIH 4HZHA 1L4DA 3H7OA 3RU4E 1VCPA 4MNXA 2ZFPH 2BDYA 2YOLA 1GVLA 2F9BH 1O2YA 3U98H 3EYDA 1GBHA 1P2IA 3DFLA 1C5NH 1FY1A 4BAMB 1MZDA 1XXFA 1FUJA 2B5TB 4NWKA 9LPRA 3BEUA 1P10A 2JH5D 1UMAH 5A09A 1C2EA 3KHVA 1H1BA 2JH0D 1TE0A 2XTTB 3FAOA 3IG6B 3HGNA 2ZCLP 3RLWH 1VCQA 1EAWA 1H9IE 1C5LH 2PTCE 1H8IH 1Y8TA 3F9FA 4NIWA 4I31A 1QGFA 5A0AE 1S5SA 4OGYA 1LMWB 1PPGE 5JBAS 1JIMA 1UVUH 1FAXA 2GD4B 3L6PA 1MKWK 2ZKSA 1P2QA 1UTQA 1BQYA 1BTHH 1EAUA 3TK6A 3ZZCA 4AZ2B 4WWYA 1YF4A 2WYJA 8KME2 1FIWA 3KQBA 1P8VC 3BIVH 1C1TA 2WYGA 2ANYA 1IHTH 3O8CA 1TA2A 3AVZA 3MNSA 1HFDA 4X8SH 3AW1A 2ZEBA 1O2RA 4ABDA 5E0GA 1CBWB 1YPJH 1ID5H 1GI8B 3UR6A 4DJZB 1YLDA 2W3IA 4X1RU 1BTXA 1P04A 3LGUA 1C5VA 2DE9A 3T26A 3FZDA 3ELAH 1JIRA 1MAXA 1T8LA 2H9EH 1UCYE 1UTJA 1Q31A 1YBWA 1W11U 5CHAB 1O2WA 1C2JA 1HJ9A 4H42U 2VJ1A 3UOPA 1C5OH 3VGCB 4I8KA 3VPKA 3NUMA 1Y3UA 3U1IB 2B9LA 1LHDH 4KELA 1CT0E 2AERH 4ASHA 2NU2E 2GDDA 2J94A 3ZZ5A 1YPMH 4OS2A 5GPIB 1QB1A 1Z8GA 1RJXB 2A7CA 3AAVA 1O3DA 1TPPA 4X6OA 2FOBA 4VGCC 4NA7A 3TGJE 2UUJB 4FU7A 3C1KA 5A8XA 1EZSC 5AVDA 5DP7A 6GCHG 4H4FA 1T4UH 1GI3A 3SV8A 3DHKH 1A4WH 4JMYA 4KKDA 1W10U 3ZZ3A 5H4IB 1CO7E 3DFJA 3RXCA 4J1YA 2BOKA 1N8OC 2A1DB 1C1NA 1B0EA 3GYMA 4X8TH 3U1JB 2VWMA 2ZHWH 5FBEA 3T62A 1P05A 1PQ5A 1RS0A 4I7YH 1K2I1 3NWUA 1GHZA 2Z9IA 2J38A 4O9VA 3W94A 1VITF 2VWLA 4ZAEA 1C5MD 3MH5A 1SBWA 1ZGIA 4R0IA 1W7XH 1ELEE 2AGEX 2W26A 1T8MA 1WV7H 2QIQA 2ANMH 2ZGBH 1K21H 1AZZA 3RXIA 4JK6A 4UD9H 1TA6A 4AB9A 1O5EH 4MDSA 2FXRA 2Z3DA 1H9HE 1C5WB 2P16A 1V6DA 1GHBG 1AB9C 4Y79A 2P3FH 2FEQH 1UVTH 1GBAA 2A7HA 1GI2A 1SLWB 2RCEA 3MU5A 4XSKU 4OS6A 3UPEA 1BTZA 1ELFA 2TGDA 3P8NA 3MWIU 5EGMA 4ISHH 1SQTA 1Q3XA 1ELDE 1Z8RA 2ZECA 2C3SA 4I8GA 3U69H 4GAWA 3RU4D 1QL7A 1V2JT 3A8BA 4Q7YA 3T28A 5EQSA 5TCCA 1OX1A 1WCZA 2PGBB 1GJBB 4ZKRU 1KTTB 3PV4A 1AVWA 1HAGE 2AMQA 1QY6A 2BY9X 4CBNA 1NRQH 2PFEA 4CBOA 1FPHH 5A2MH 1CGHA 1MKXK 1C5ZB 5C1UA 1TNIA 2VVUA 1SGPE 1O3PB 2H2ZA 1ZHPA 1NY22 1CA0B 4JZEH 1NRRH 1TYNA 1NROH 4MPXA 5GDSH 1QBVH 3LGYA 1SGQE 1GBIA 3KQDA 2ZGHA 1EX3A 1AGJA 1W2KH 1K1MA 2AIQA 2BDIA 3SJ9A 5C1YA 2EA3A 3KCGH 2V6NA 2H9TH 3VFEA 3EA8A 4IW4E 4DW2U 1QQUA 4WH6A 1GHBF 3SNCA 1BZXE 1H8DH 1ARBA 1GJ4H 3UNSA 1O2JA 4NFEA 1GI7B 5C5NA 1KXAA 3RC6A 2GV7A 3QO6A 1DITH 2CF8H 1GBDA 3LPRA 1GHAG 2BD4A 5ETXA 1TNJA 1BMAA 5JBTA 1FAKH 3GY3A 3Q3KA 2BDAA 5HGGA 3Q77A 2WUCA 4DIIH 1P06A 1NFUA 2FWWA 1KXDA 3F6UH 3QTVH 1NESE 2ZFSA 3A81A 1MU8B 1GCTB 4BXWA 1BITA 1IHSH 5EXMA 1EP5A 1GJ5H 1BBRH 1KTSB 2ANWA 1LHEH 2XRCA 4NA8A 1DANH 1D3PB 1BRAA 1BRUP 1CHOF 2F3CE 1SGTA 1IQJA 1W13U 4LK4A 1P12E 4K60A 1XVMA 4OGXA 1EJMA 1F0RA 1A1RA 1L4ZA 2WPLS 1HXFH 5AHGH 2A2XH 2BX4A 3LGVA 2CV3A 1C5SA 1OP2A 2EC9H 5DP5A 4YT6H 5L2YH 1SFQB 1AMHA 3SV7A 2OQ5A 3ZZ8A 1TX8A 4INKA 1ORFA 1BIOA 3GCTG 1EZQA 5LPFA 2ZHEH 1XUHA 1XXDA 2OBOA 2DUCA 2OC8A 2V0BA 4B2CA 5IDKA 1C2KA 3UQVA 1CU1A 1GMDG 1DXPA 2YNAA 4FXGH 2D2DA 3QZRA 5DK1A 3BF6H 1W7GH 6CHAB 1EJAA 1GWAA 1EPTC 2BDCA 1FQ3A 2B7DH 2W5EA 2XBWA 3EAJA 1LVMA 1FN6A 3RXUA 4Y76A 2SGDE 1BRCE 3VB3A 3LGTA 3PLBA 3GYLB 2P3TB 2O8UA 1AFQC 1WOFA 4K8BA 3KQEA 1Y3YA 1DT2A 2STBE 1SGNE 3B23B 1MTNC 1N6YA 1QA0A 2XC4A 2NU1E 1GPZA 4BANB 2PKAB 2ZGCA 1PQ8A 1NZQH 4NWLA 1SQOA 1AKSB 3KL6A 4FVDA 2R2MB 1HNEE 1EP6A 1P01A 4IN1A 3SU6A 4GPGA 3LC5A 1QA7A 1V2MT 2TIOA 3GCTF 3TH4H 1P9SA 1T31A 4ZROA 1K9OE 2OXSA 1GMDF 1KLTA 2J9NA 3M5NA 1SHYA 2A5AA 2HALA 1PQ7A 5AFYH 2LNCA 3A80A 1SGDE 2OC1A 2SFAA 1GGDB 1QB6A 1FJSA 4GVUA 1E38B 3EE0B 5LPRA 3TK5A 3TGKE 1TNLA 1ETSH 1TOCB 2GCTB 2GT7A 4YOGA 4XDEA 3RXGA 4CRAA 5JDUB 4X1QU 4X1PU 1C1OA 1TPSA 1A46H 2ESTE 3BN9A 3S7HB 2OC7A 4NIVA 2ZWLH 4TWWA 2VIWA 2BVXH 5FCRA 1G30B 2NU3E 2XCFA 1OPHB 4TY6A 4MNVA 1O38A 3U8RH 4A1XA 2GZ9A 3M5MA 1P03A 1S81A 1V2PT 4UFEH 3E6PH 1NRPH 3ENSB 2VVCA 2HVXA 1HRTH 1WSSH 2ILNA 3KIDU 1PFXC 4KP0A 3RDZA 1HAPH 4ABGA 1LCYA 1CE5A 1WTGH 1P2KA 4ZUHA 1NTPA 1GBMA 2FOEA 2LPRA 4CR9A 2VH0A 1SGRE 5CMXH 1BTUA 2FOAA 3STIA 1XUFA 1IQNA 2C8WB 3Q3YA 3ODDA 1WYKA 1XKAC 1K1NA 1GMHF 2Y82A 2EI6A 1K28D 1MBQA 1C2HA 2FLBH 2SGAA 1C4Y2 7ESTE 1IQFA 3CS7A 4CRGA 4YO9A 1Y5BT 3UWIA 1XKBC 1DUEA 1AI8H 3TJVA 5T6FA 2VIPA 2P8OC 2ZG0H 2IN2A 5K0HA 4AGKA 3ODFA 1C5RA 2Q6FA 1LKBA 1ELCA 4X8UH 1HUTH 3MNXA 4B2BA 1O3BA 1SOTA 1K1LA 1JOUB 5E2PA 2SNVA 1QCPA 1U6QA 1MH0A 2QF3A 2XYAA 3MOCA 4BNRA 1AVXA 2J34A 1S0QA 1YM0A 3BTHE 4Y8ZA 1GDQA 3FZZA 3GY5A 5HXFA 2FO9A 4YOJA 2G00A 4FUCA 3OU0A 4NIYA 4MPVA 1S85A 4TYDA 1GJ6A 3ATKA 3E8LA 2SGQE 3DD2H 1HIAA 1NU9A 3UNQA 1OWKA 2PGQB 2ZFRH 3WY8A 1EQ9A 1ZSLA 4YT7H 3ZVCA 3MH6A 1C2LA 2H1UA 3TJUA 2JETC 2WPKS 2QY0B 1OWJA 4K2YA 2TBSA 1F2SE 2EI8A 1S6FA 1NPMA 4TWYA 1F0UA 2R2WU 4I33A 1TMBH 5L2ZH 2J4IA 1ZYOA 1CGIE 3TU7H 3SUDA 1UCYH 1UO6A 1P0SH 4XFQA 2VVVA 4XBBA 2GTBA 1EJNA 1V2LT 2Q6DA 2ZFQH 3RXLA 2Y5GA 1G2LA 4BOHA 1TBZH 4FU8A 1ZJDA 3ZZAA 1ZHRA 3M5LA 3OX7U 2CMYA 1TX6A 2FZZA 5FAHA 4X0WU 3B8JA 4K5ZA 2NU0E 1Y5AT 5PTPA 4GCHG 2Y7ZA 3P95A 3TIUA 4MNYA 1N1LA 3R3GB 4WJG2 4LZ1H 4B73A 1O5CB 1T8OA 2YNBA 4YESB 4K69A 1F5RA 2Q6GA 1FLEE 3PMAB 2A4OA 3ZVDA 1W12U 3SV9A 5DP6A 2AMPA 4M7GA 3VB6A 2CF9H 3T29A 1BA8B 4FUEA 2H9HA 3HATH 2FIRH 1DWCH 2EI7A 1Z8IB 3T2NA 4AFQA 1BT7A 2A0QB 2R0KA 1DY8A 1YCPH 2A4GA 1J14A 2ZHFH 1TNKA 5EODA 5EPNA 1CT4E 1A3EH 2M5TA 2OP9A 4IC6A 3ATWA 3PMBB 4O03A 1AU8A 3FP8E 3EA7A 1C9PA 2ZU1A 2ZU5A 4AORA 1GL1A 3U8OH 4SGAE 2P59A 1A5HA 2A5KA 1GHXH 4KTCA 5A0BA 1G3BA 1CA8B 1C2FA 3ITIA 1SGEE 2BD5A 1C1VH 2QXJA 3RXHA 3UWJH 2ZHDA 1CHGA 1SB1H 3RXSA 1RTFB 4ISIH 3T5FH 3GY2A 4E7NA 3LGIA 1MZAA 1P2OA 3BTQE 3BG4B 1W3CA 4X2YA 4DVAU 3SU4A 4CHAC 1Y3XA 1O2SA 1HCGA 3URCA 2XCNA 1L1GA 3A7WA 5EQRA 1F92A 2ODPA 4I8HA 1KXCA 3LONA 4NIXA 1C9TA 4MTBA 2BD2A 1D3TB 4U30A 1AY6H 3NXPA 1GL0E 1YPKH 1TIOA 3KF2A 3A8AA 1KSNA 3SGAE 2TGPZ 1THPB 4NG9H 2XBYA 1OWIA 1GBCA 2QYIA 1LVYA 1MBMA 1RD3B 3VB5A 4Z0KA 4R8TB 4I32A 1KY9A 2Z3EA 4E05H 4ZHAA 3QN7A 4UE7H 1O5BB 2PSYA 3RXTA 2Y6TA 2I6QA 3PYHA 1V3XA 3QGNB 2DE8A 3RC5A 3TJNA 1K1PA 1C1MA 3QDZB 2QXHA 3Q76A 1XM1A 4IC5A 5DGJA 3SN8A 1N8OB 5JB8S 5I25A 1W8BH 1E36B 1ZMNA 2ZTZA 1C2DA 3S9CA 5DO4H 3SI3H 1FY3A 1DWDH 4D8NA 1A0LA 3MO3A 1YPLH 1GI4A 4BAQB 4ABAA 1F0TA 3E1XB 1BRBE 3S7KB 1V2RT 1TGSZ 5JPMH 3PMHB 5BPEA 1ETRH 4IGDA 4WMFA 3RXQA 3ZVAA 2UWLA 5HYOA 4ESTE 1YP9A 5LPEA 3GCHB 1V2QT 3ZZ4A 1NM6A 3C27B 1TLDA 4F4OC 5EW1H 2Z6BD 2BD9A 1O36A 1AB9B 1HAVA 1TB6H 1EZUC 3PLPA 4E06H 3GOVB 4FUFA 1C5UA 1YCPK 5I46H 1N6XA 3UREA 1OSSA 1DS2E 3SI4H 5A0CA 2PUXB 2P94A 7GCHG 1MTSA 1OP0A
chains in the Genus database with same CATH superfamily
1QURH 1TRYA 3URDA 2ZPQA 5JB9S 4B6FA 3H5CB 1RIWC 2M2AA 1B0FA 1CBWC 3RMMH 4WH8A 5GCHG 5FX5A 2BZAA 3V12A 2GMTB 2HNTE 2HOBA 2SNWA 4WMDA 1O2ZA 2F91A 5FXLA 1GI9B 3OTPA 3QGJA 3A7VA 3RU4T 3A83A 2VIVA 4YLUA 4RKJB 2ZCKP 1PPBH 1AVGH 1G2MA 2ZI2H 1O2XA 1OYTH 3SW2B 5CHAC 3VG8A 1A2CH 1SGYE 3GDUA 3HKIB 3VGCC 2BLVA 3SUFA 4AFUA 2FYQA 4I8LA 1SLVB 4NA9H 1YPHE 4B71A 1L2EA 1TALA 2NWNA 1CVWH 1C4V2 2RDLA 1O3NA 5FCKA 1IQGA 3SZNA 6GCHF 2HNTC 4FUIA 3ZVEA 1O3JA 4NCYA 1O2LA 4X1SU 2WPIS 2VIDA 2Y80A 3GDSA 1H9LB 3K65B 3OY5U 1AZ8A 3FANA 3QLPH 1DSTA 3E3TA 3S9AA 5F8XA 1DE7H 3V0XA 3SNBA 2ZP0H 3RMOH 1DY9A 2BHGA 5FBIA 4MLFB 1GJ9B 3MYWA 5FHTA 4FUJA 1CGJE 1BMFD 2OINA 2Z9LA 3EGKH 2KR7A 1ZSKA 2VWOA 1H8HD 2BVSH 2J2UA 1YPHC 1LQDB 3K2UA 1OP8A 1HDTH 1G32B 3NZIA 4FVBA 2AYWA 3EA9A 1EPTA 1VCWA 3QTOH 1GG6B 4O3UA 2WINI 4D76A 2VINA 3P6ZB 2QCYA 2ZA5A 1C2MA 4B1TA 4LZ4B 1KIGH 3SU2A 5GWZA 1O3IA 3HKJB 1ZTJA 4CREA 3ZYDA 2FX6A 2CXVA 1WDIA 1NS3A 3DSPA 4WF8A 4B76A 3A7TA 4AX9H 2ZF0H 1EUFA 1COWD 3QWCH 1YCPM 3M7UA 7LPRA 3PM3A 3SJOA 1BTWA 4ABBA 1ZPBA 1ZR0A 4E7RG 3LH1A 3S69A 2WV5A 2G51A 4F49A 1J17T 1NO9H 2V7QD 2WPMS 4GHTA 2I6SA 3ZVFA 3MNBA 2FOFA 4K1EA 3P8FA 2AFQB 1FPCH 3K6YA 2H6MA 2PHBA 3AAUA 1XUIA 3F0OA 1DICA 2FOGA 1O2VA 1BMLA 2BQ6B 2XNIA 4CR5A 5K7RA 2BD8A 1O31A 1JXPA 4YZUA 2G52A 1AFQB 1C5PA 1TX7A 1CA0C 3CP7A 3LT3A 2F9VA 2JKHA 3BEFB 5AF9H 1UVOA 5DJ7A 4GLYA 1GHYH 1TNGA 1ESBA 1D4PB 1L0ZA 3MU1A 3R0FA 4IN2A 1LTOA 5HIZA 2FI3E 5A8ZA 1O2MA 4X2XA 1TBQH 1FY8E 3ATLA 5E8EH 1PYTD 2FMJA 1AFEH 3F3BA 3T25A 2Q1JA 1GHAF 1HAYB 3DA9B 1CSOE 2Z7FE 4DY7B 3IWMA 2OK5A 4FOUC 3UIRA 3OE7D 1GBLA 1O37A 1FY5A 3SZEA 1TPAE 2ZCHP 2G81E 2QA9E 2VIOA 3EE7A 3GS9A 5JBCS 5EJZA 1PPHE 1TOMH 4INLA 2QAAA 3V3MA 1ZMJA 1HAHH 3TVJB 3ZV9A 3M37A 5T6GA 1C1SA 4ABIA 2HVYB 1QNJA 1T7CA 1GCTC 1ANDA 2TGAA 1Y5UT 2FI5E 1K1OA 3UNRA 2BOHB 1XX9A 2ZU4A 3CENA 3ZVBA 1ZOMA 2AMDA 3M61U 4UFDH 5EQQA 2ZO3H 1VJ9U 1NRNH 1OHHD 4DG4A 1OWHA 3I29A 4LXBH 4UEHH 2RA3A 2WPJS 2BM2A 4AB8A 4XE4A 2OD3B 1QL8A 1V2KT 1K1IA 1E79D 1ACBE 1MCVA 1O2NA 3MU8A 1LO6A 4P02A 1F5KU 2R9PA 3MMGA 3F9GA 1KXBA 2W3KA 1UK3A 3SNDA 3UR9A 1J16A 1DLKB 4CRBA 1QFKH 2PTNA 2PW8H 1S6LA 3HK6B 2OCVB 3HPTB 2VGCC 2IOTA 3LGWA 1HBTH 5C0UA 2SGFE 4DURA 4ABHA 4KTUA 2BYAX 3M35A 1NFYA 1UK4A 4MG3A 2FOMB 1P11E 4YOIA 6CHAC 1SQRA 2FS9A 4BTIB 1FDPA 2TGTA 2P8OB 4LOYH 2XC5A 4WMEA 4J2YB 1A5IA 2C8ZB 1D6WA 1MTUA 2H5CA 3L3TA 4A1VA 1BDAA 8GCHG 3SGBE 1GMCG 1G36A 5HMAA 4GHQA 3PTBA 5FX6A 2AGIX 2CHAB 1LDTT 1DXWA 1JBUH 2Z94A 3UY9A 1A0JA 2C8XB 1BBRK 2FP7B 1H4WA 1QBNA 3RP2A 1IQHA 1GBFA 4ZMAH 3ZVGA 1QBOA 1P3CA 2V3OH 1AWHB 4NSYA 2GKVE 1YGCH 5DG6A 1J15A 2ULLA 1GI1A 1EB2A 1KLJH 1NFWA 1MMJN 2NU4E 1GVZA 1RFNA 2GCHG 1FXYA 1QZ8A 5EW2H 5FPTA 1WUNH 4HTCH 5FPSA 3OAAD 1BTYA 1PPCE 1UTKA 2JETB 3ATIA 1GGDC 2JJ1D 1EASA 1XMNB 4YTAA 1SG8B 1SFIA 3KNXA 3EDXB 3QK1A 4Y71A 5F03A 4AC9A 2BVRH 2BB4A 1VGCB 2WPDD 2W7SA 1G3DA 3P8GA 1UTNA 1ZPZA 1CT2E 2GGVB 1ELGA 2ZQ2A 5C0TA 1OYQA 1RTLA 3KQCA 1FONA 1ZZZA 3U8TH 1QRZA 2VH6A 3F68H 1MCTA 5F53A 1QJ6B 2OLGA 4ISNA 3RXJA 1QHRB 1C1UH 2P3UB 1KDQA 3KQ5A 1O3MA 3NK8A 4ZXYH 3BTKE 4GUXA 1SVPA 1J9CH 2W6JD 2FX4A 1O32A 4MQAA 4Y0ZE 2PKSB 1V2VT 2K8IA 5IYTA 2D8WA 3HK3B 5C20A 1GI6A 4X2WA 1FI8A 1W0YH 2KAIA 4BAHB 1AIXH 1NN6A 3P92A 4H6TA 1MD7A 1BTPA 1NU7B 2GCHF 1A5GH 1H8ED 1JRTA 1O3HA 2PUQH 2AS9A 2EEKA 3LDXH 4D7FA 4U2WA 1RXPA 1C5QA 3FP7E 3SV6A 1LHFH 1UHBA 3M5OA 1FMGA 2FTLE 1FIZA 3ESTA 3OEED 1MKWH 2BZ6H 4JCNA 4DGJA 2C93B 2VIQA 3JZ1B 4B2AA 4H6SB 1HIAB 1MQ6A 4UFGH 3LU9B 3RM0H 2ALPA 1GBKA 1INCA 3JZ2B 2BD7A 3RXDA 4JZIA 4JZ1A 3F2FA 2D26C 4CRFA 3SBKA 3SUGA 1LPGB 1GBEA 3F0PA 3SU3A 3GCOA 3A7YA 1S82A 1YYY1 9ESTA 1P3EA 2GT8A 4AFZA 3Q3XA 1UTOA 2ZDLA 3E91A 2VNTA 2O8TA 1DFPA 3NKKA 2HPQH 4B74A 1WTHD 3LC3A 1CQQA 4ZCNA 1GJ7B 4A1TA 2RA0A 4I86A 1TMUH 4MPUA 1M9UA 2TPIZ 1S83A 5SGAE 1V2NT 2J92A 1O5FH 1YLCA 1FX0B 2QC2A 1C2IA 1TPOA 1O33A 3RMLH 4BTTB 2STAE 4OS7A 1EB1H 2WUBA 1P57B 1P2NA 4HI3A 3TH2H 2XWBI 3UAIC 1OOKB 5HM2A 3M36A 1K22H 2JH6D 3UFAA 1HJAC 2GX4A 4TPYA 1MD8A 3A7ZA 3SV2H 3FP6E 3OSYA 1NT1A 1DUAA 4GCHF 1Z7KA 2ZGJA 1T8NA 3STJA 1UW7A 1GBBA 2ZTXA 3WW7A 1TFXA 3M3TA 4IBLH 2QXGA 1O5AB 1SPJA 1GVKB 2BDHA 5FL7D 2FYRA 2AEIH 1GBTA 3ZZBA 1Z1IA 2Y81A 1WQVH 4TPIZ 1BJUA 4BAKB 1PPZA 2PV9B 3GY6A 3BIUH 1LHCH 1SGFG 5C2ZA 1O5GH 3MH4A 3MNCA 1SGFA 2F83A 1C1RA 3GISB 1LPZB 5C1XA 1GDNA 4IMQA 1DOJA 3SQEE 3L33A 3M7QA 1DDJA 3RXBA 3ZZ7A 2ZDKA 3S0NA 4RKOB 4OS4A 3ZV8A 3A82A 1G3EA 1KYNA 1FV9A 1FNIA 2G55A 3PO1C 4XBDA 1ANBA 1UCYK 2K1QA 2AH4X 3VXEH 1ZPCA 2BMGB 1DWEH 2OUAA 3LKWA 1GJAB 1ANEA 1FY4A 4VGCB 2P93A 3UOUA 1C2GA 3T27A 1UK2A 1BCUH 1GDUA 1MAYA 4Z6AH 1MKXH 1ZRBA 1ZSJA 3OYPA 5T3HA 4CRDA 1ZGVA 4Y8YA 1F0SA 2C90B 2PWXA 3KYGA 4U01A 6ESTA 4ABJA 2R3YA 2ASUB 5DKMA 3BTGE 3VB7A 2VWNA 2VU8E 3SJ8A 1YPGH 1HAXB 4BTUB 2GP9B 2FPZA 1RIWB 1ELVA 2A2QH 2FLRH 3M7TA 1O2TA 1T4VH 1TNHA 1Z1JA 2XC0A 3P8OA 2LELA 2WV4A 3NRLA 5F8ZA 3BG4C 3F9EA 4B75A 4MPWA 4BXSA 3QUMP 2SGEE 1OXGA 4AG1A 3TJOA 1YKTA 2GVFA 4THNH 3ZZ9A 3GY8A 1ZMLA 1GCDA 3TITA 1VITG 1TGNA 4NGAH 2TRMA 2IJD1 1VR1H 3OY6U 4X8VH 4Y8XA 1AHTH 2O8WA 3V7TA 4D7GA 3BTWE 1O34A 1O2PA 2FOHA 2FI4E 5A8YA 1UTMA 1SGIB 2J98B 1ETTH 1DM4B 1QQ4A 2P95A 2HLDD 4WVPE 2BLWA 1TAWA 4K8YA 2Z9KA 4NZQA 4Q7XA 1NRSH 2ZU2A 1AO5A 2ZFFH 5FPYA 2C8YB 2V35A 1F5LA 3FOAA 2GZ8A 2C4FH 2UUFB 3U28C 1OKXA 1O3EA 2KCAA 1G37A 1P9UA 1SI5H 1O2IA 1GJDB 3OFND 1V2OT 1UVPA 5E0HA 1OWDA 5DN6D 1PYTC 2HNTF 1ZTLA 2RG3A 5DP8A 1QL9A 2A4QA 1TQ7B 3M3VA 2YMSC 1WAYB 5TCAA 2QGRA 3PTNA 3IITA 3TPIZ 5CE1A 1Z6JH 1C1QA 1D3DB 1GJCB 1JRSA 2F9NA 5F8TA 1AUJA 1UTPA 1EATA 1O2QA 2ZDNA 1L1NA 1QTFA 1HAVB 4NZLA 1HLTH 1HYLA 2OQUA 3BTEE 2B0FA 4DT4A 2QE7D 1SKYE 1PPFE 3RXPA 3O8DA 1Q2WA 2ZU3A 4AFSA 3NPSA 4FUHA 4KGAA 4ZH8A 7KMEH 2XWAA 3NCLA 5F6MA 3MO6A 4DT7B 5BRRE 2V3MA 1V2TT 4DOQA 3F1SB 1AE5A 2L74A 4CH8B 1QRWA 2QN5T 1RGQA 3QX5H 5T6DA 1MTWA 3QZQA 2G5VA 3M3SA 2FOCA 3PWBA 3GCHC 1NBMD 1P09A 3RXEA 3RXFA 1ZRKA 3DT0H 5LGOA 2ZQ1A 3D49H 3RLYH 3A8DA 1AD8H 4MNWA 3UQOA 7GCHF 3UUZA 4I8JA 1TBRH 2QXIA 1EFRD 1GI5A 1TQ0B 1D6RA 3PROA 1AUTC 1SQAA 1O2HA 2EY4C 1S0RA 3RMNH 1HJ8A 3A87A 3SYJA 5GCHF 1T32A 1D9IA 1LVOA 1IQLA 3GY7A 4KTSA 3ZZ6A 1YPEH 4PROA 2HWLB 4ABEA 5C5OA 1PPEE 1P02A 2GMTC 2FS8A 3PMJA 1SMFE 1CHOG 3E0NB 2ZC9H 1ZHMA 1IQEA 1E37B 4WXVA 3AK5A 3BV9B 2GZ7A 3FKSD 4IMZA 3F2GA 4NFFA 2SGPE 4JZDH 3F9HA 1ZLRA 6LPRA 2BQWB 4F48B 2BQ7B 4JYTA 4ACBA 2XBVA 1J8AA 4K1TA 2O9QA 1HAZB 1Z6EA 3GDVA 4X2VA 1LPKB 4UDWH 1O2OA 5C67A 2GV6A 3RXMA 3PLKA 4AN7A 3PRDA 4U32A 5EJLA 3SU1A 3GICB 5HM9A 1MABB 4JYUH 1EPTB 5L6NH 1ESAA 2BDGA 2H5DA 3FFGA 4MVNA 1O2GH 2OC0A 1JWTA 1ABJH 1O35A 4JYVH 4X6NA 2XBXA 1ELAA 3H7TA 3TGIE 1FN8A 2BLQA 3BG8A 2ZPSA 1IQIA 3G01A 4ISLA 1IQKA 2BY5X 1GI0A 4K3JA 3U9AH 1GHVH 2Y7XA 3FVFB 2W7UA 1BHXB 4ZHMU 1MTNB 4FUGA 5JBBS 1OS8A 1F7ZA 1ZTKA 5ESBA 1WU1A 3TLOA 2FESH 2JJ2D 4Y11E 1S6HA 2CJIA 3Q00A 4HFPB 2R3UA 4Y7AA 1O3GA 5B6OA 2FODA 2UUKB 3RXRA 1BHXF 1GG6C 2UUYA 1XUGA 1BJVA 4RSPA 3HGPA 4TT3D 1BMNH 1SOZA 3DSOA 1O3LA 2PR3A 3SUEA 4RT1A 5C3NA 5DP9A 4Y7BA 2YMSD 1NC6A 1WXRA 2UWOA 1A7SA 1EXFA 2ZGXH 2BXUH 2PSXA 1G9IE 5J4SA 1UVSH 1GHWH 1MQ5A 2PKAA 3ATMA 2V3HH 2VGCB 4Y0YE 3F2HA 2OTVA 4AGJA 1K1JA 1THSH 2Z3CA 1GJ8B 2ZHQH 1EKBB 1AKSA 1SSXA 3N7DA 3BTTE 3EQ0H 1QRXA 3RC4A 4A92A 3V13A 2Z9JA 5G4BA 3ZZDA 1SLUB 1UTLM 4ZKSU 1RRKA 1TGTA 4UFFH 2A4RA 1AWFH 4FUDA 3LOXA 1A3BH 4X1NU 2F9PA 1XUKA 3TK9A 4ZKOU 4O97A 4QT8C 1WQSA 2R0LA 1LKAA 3I77A 1DPOA 3KN2A 3A7XA 1PQAA 1TGCA 2HPPH 5E2OA 3RXVA 1P2MA 1TABE 2GJGA 1EOJA 3SGQE 1C5YB 3GCNA 4ISOA 3MU4A 5EXNA 1O2KA 5L30H 1C5TA 4AOQA 3MHWU 2FTMA 1IAUA 2OBQA 2G5NA 5LH8A 2IPHA 1O0DH 3MH7A 1E34B 2Z9GA 4Y6DA 4D9RA 5J4QA 1SGCA 1RTKA 2K0QA 1V2UT 4Y10E 2QV1A 3SU0A 1GBJA 1O3FA 2HLCA 2QF0A 1E35B 1HAOH 3ZYEA 4D9QA 1KXEA 3OTJE 1DLEA 1GMHG 4RI0A 1X7AC 1QJ1B 3AASA 1FZZA 1C5XB 3BSQA 3A86A 5ESTE 3E90B 4IS5A 1SC8U 3SJKA 1HGTH 1LVBA 1O3KA 4YLQH 3MQKC 1D3QB 3KEEA 1LHGH 2G8TA 1TGBA 3D62A 3A85A 1QJ7B 3PV5A 4X6MA 1BB0B 1DSUA 2ANKH 1BOQA 1EZXC 3SO3A 3SQHE 4DCDA 4A7IB 1B7XB 4UONA 1TMTH 1TRNA 4WXIA 3PB1E 3MTYA 3RXAA 3LJJA 1ZJKA 1ARCA 3BEIB 1HV7A 3RUOA 2O8LA 2ODQA 1V2ST 1G3CA 2F9OA 2ZTYA 1AE8H 3CS0A 3P17H 2BLOA 1QR3E 1S84A 3PV2A 1IQMA 1EOLA 1L1JA 1O3CA 3A88A 5EU8A 5JYIA 1A61H 2BY7X 2BX3A 1UJ1A 3D23A 3N7EA 4FU9A 1LQEA 2THFB 4NSVA 1ABIH 3UTUH 2BTCE 2ZIQH 3UB0A 2ZZUH 4M9FA 1E0FD 2GCTC 4CRCA 2BDBA 1B5GH 1V2WT 3MO9A 2HRVA 1BMMH 2FM2A 4AG2A 3MI4A 2BY6X 3SORA 8GCHF 1GMCF 2RDEA 2O8MA 5CDFE 4AYYB 1BBRE 5EG4A 3RXKA 2QF5A 1SL3A 1SHHB 2CGAA 2ZDAH 1DVAH 2GDEH 4Q7ZA 1JMOH 4A5TS 4JK5A 1EAIA 1O2UA 2WPHS 3GY4A 2CHAC 1VJAU 5DPAA 3D65E 1TRMA 5GJ4B 4ZKNU 3RM2H 3A84A 4X6PA 8LPRA 2J95A 5EXLA 1ANCA 1MU6B 2BD3A 4JZFH 1C1WH 1AN1E 1O39A 3TH3H 2WSSD 2ODYB 2A45B 1AQ7A 2BXTH 3SNEA 1C4U2 2AGGX 3TNTA 2Y5HA 1VKYA 3LH3A 1QIXB 1O30A 1HPGA 4ZXXH 1O3OA 4GSOA 3A89A 2ZFTA 2ZPRA 5ABWA 5HKKD 2ZDMA 4FUBA 4WY3A 2JIZD 1TWXB 5GIBA 5EOKA 2VB0A 2Y5FA 4Q2KA 3RXOA 2D1JA 4XOJA 3WWFA 4ABFA 1VZQH 2FDAA 1KDQB 3KGPA 4OS1A 1KMHB 2ALVA 1HXEH 4OS5A 5TJXA 3SHCH 4HGCA 5B6LA 1SLXB 3N7OA 1VGCC 2AIPA 2KM0A 2L6OA 3AW0A 5GXPA 1P2JA 1SR5C 2XXLA 1TONA 5DP4A 1W0ZU 3BTDE 1EAXA 3PWCA 2KAIB 1MUEB 3A8CA 3W95A 4A6LA 3SOSA 4CH2B 4K1SA 2BY8X 3B9FH 3SNAA 1ELTA 3VXFH 4Q80A 1PJPA 4AYVB 1XVOA 1W0KD 4TY7A 1HJAB 2ZDVH 3SHAH 1UHBB 3O8RA 2F9UA 2A31A 1KXFA 2PP6A 1THRH 3O8BA 1Y59T 1YY3A 2A7JA 1A0HB 3I78A 1ESTA 2G4TA 2IJOB 4Z1MD 1XUJA 1Y3VA 2PKSC 4RN6A 3W1EA 1HB0B 2A5IA 2CN0H 2HGTH 8ESTE 4ZHLU 3K6ZA 3FO8D 4XBCA 3S9BA 1QB9A 5E0JA 1MTVA 3TNSA 5AFZH 4YM9A 3SU5A 3LJOA 2ZNKH 3VEQB 3E16B 4CHAB 1Z8JB 1DWBH 1BUIA 3E0PB 1NFXA 3LIWA 5EPYA 1YC0A 3VB4A 3BTFE 3P70B 2XW9A 2PLXA 3K9XB 4O3TA 1ELBA 1Z71A 1NBME 1W14U 1WBGB 1VITH 1DX5M 2UWPA 1HAIH 3PO1B 4INHA 2G4UA 3MFJA 1O5DH 1OWEA 2A32A 4SGBE 1C1PA 3DUXH 3MU0A 1Y3WA 4DIHH 1O3AA 2B8OH 3SJIA 5DP3A 1IOEA 3BTME 5DSFA 4BAOB 1KLIH 4HZHA 2XNDD 1L4DA 3H7OA 3RU4E 1VCPA 4MNXA 2ZFPH 2BDYA 2YOLA 1GVLA 2F9BH 1O2YA 3U98H 3EYDA 1GBHA 1P2IA 3DFLA 1C5NH 1FY1A 4BAMB 1MZDA 1XXFA 1FUJA 2B5TB 4NWKA 9LPRA 3BEUA 1P10A 2JH5D 1UMAH 5A09A 1C2EA 3KHVA 1H1BA 2JH0D 1TE0A 2XTTB 3FAOA 3IG6B 3HGNA 2ZCLP 3RLWH 1VCQA 1EAWA 1H9IE 1C5LH 2PTCE 1H8IH 1Y8TA 2F4LA 3F9FA 4NIWA 4I31A 1QGFA 5A0AE 1S5SA 4OGYA 1LMWB 1PPGE 5JBAS 1JIMA 1K0HA 1UVUH 1FAXA 2GD4B 3L6PA 1MKWK 2ZKSA 1P2QA 1UTQA 1BQYA 1BTHH 1EAUA 3TK6A 4ACAA 2F43B 3ZZCA 4AZ2B 4WWYA 1YF4A 2WYJA 8KME2 1FIWA 3KQBA 3PRBA 1P8VC 3BIVH 4HG6A 1C1TA 2WYGA 2ANYA 1IHTH 1YLNA 3O8CA 1TA2A 3AVZA 3MNSA 1HFDA 4OM9A 4X8SH 3AW1A 5IK2D 2ZEBA 1O2RA 4ABDA 1W0JD 5E0GA 1CBWB 1YPJH 1ID5H 1GI8B 3UR6A 4DJZB 1YLDA 2W3IA 4X1RU 1BTXA 1P04A 3LGUA 1C5VA 1E1QD 2DE9A 3T26A 3FZDA 3ELAH 1JIRA 1MAXA 1T8LA 2H9EH 1UCYE 1UTJA 1Q31A 1YBWA 1W11U 3CNRA 5CHAB 1O2WA 1C2JA 1HJ9A 4H42U 2VJ1A 3UOPA 1C5OH 3VGCB 4I8KA 3VPKA 3NUMA 1Y3UA 3U1IB 2B9LA 1LHDH 4KELA 5KGOA 1CT0E 2AERH 4ASHA 2NU2E 2GDDA 2J5UA 2J94A 3ZZ5A 1YPMH 4OS2A 5GPIB 1QB1A 1Z8GA 1RJXB 2A7CA 3AAVA 1O3DA 1TPPA 4X6OA 2FOBA 4VGCC 4NA7A 3TGJE 2UUJB 4FU7A 3C1KA 5A8XA 1EZSC 5AVDA 5DP7A 6GCHG 4H4FA 1T4UH 1GI3A 3SV8A 3DHKH 1A4WH 4JMYA 4KKDA 1W10U 3ZZ3A 5H4IB 1CO7E 3DFJA 3RXCA 3KYFA 4J1YA 2BOKA 1N8OC 2A1DB 1C1NA 1B0EA 3GYMA 4X8TH 3U1JB 2VWMA 2ZHWH 5FBEA 3T62A 1P05A 1PQ5A 1RS0A 4I7YH 4Q63A 1K2I1 3ZIAD 3NWUA 1GHZA 2Z9IA 2J38A 4O9VA 3W94A 1VITF 2LP6A 2VWLA 4ZAEA 1C5MD 3MH5A 1SBWA 1ZGIA 4R0IA 1W7XH 1ELEE 2AGEX 2W26A 1T8MA 1WV7H 2QIQA 2ANMH 2ZGBH 1K21H 1AZZA 3RXIA 4JK6A 4UD9H 1TA6A 4AB9A 1O5EH 4MDSA 2FXRA 2Z3DA 4ASUD 1H9HE 1C5WB 2P16A 1V6DA 1GHBG 1AB9C 4Y79A 2P3FH 2FEQH 1UVTH 1GBAA 2A7HA 1GI2A 1SLWB 2RCEA 3MU5A 4XSKU 4OS6A 3UPEA 1BTZA 1ELFA 2TGDA 3P8NA 3MWIU 5EGMA 4ISHH 2KFWA 4P00A 1SQTA 1Q3XA 1ELDE 1Z8RA 2ZECA 2C3SA 4I8GA 3U69H 4GAWA 4TSFD 1QL7A 1V2JT 3A8BA 3RU4D 4Q7YA 3T28A 5EQSA 5TCCA 1OX1A 1WCZA 2PGBB 1GJBB 4ZKRU 1KTTB 3PV4A 1AVWA 1HAGE 2AMQA 1QY6A 2BY9X 4CBNA 1NRQH 2PFEA 4CBOA 1FPHH 5A2MH 1CGHA 1MKXK 1C5ZB 5C1UA 1TNIA 2VVUA 1SGPE 1O3PB 2H2ZA 1ZHPA 1NY22 1CA0B 4JZEH 1NRRH 1TYNA 1NROH 4MPXA 5GDSH 1QBVH 3LGYA 5CHBA 1SGQE 1GBIA 3KQDA 2IPQX 2ZGHA 1EX3A 1AGJA 1W2KH 1K1MA 2AIQA 2BDIA 3SJ9A 5C1YA 2EA3A 3KCGH 2V6NA 2H9TH 1E1RD 3VFEA 3EA8A 4IW4E 4DW2U 1QQUA 4WH6A 1GHBF 2CK3D 3SNCA 2J97A 1BZXE 1H8DH 1ARBA 1GJ4H 3UNSA 1O2JA 4NFEA 1GI7B 5C5NA 1KXAA 3RC6A 2GV7A 3QO6A 1DITH 2CF8H 1GBDA 3LPRA 1GHAG 2BD4A 5ETXA 1TNJA 1BMAA 5JBTA 1FAKH 3GY3A 3Q3KA 2BDAA 5HGGA 3Q77A 2WUCA 4DIIH 1P06A 1NFUA 2FWWA 1KXDA 3F6UH 3QTVH 1NESE 2ZFSA 3A81A 2AHME 1MU8B 1GCTB 4BXWA 1BITA 1IHSH 5EXMA 1EP5A 1GJ5H 1BBRH 1KTSB 2ANWA 1LHEH 2XRCA 4NA8A 1DANH 1D3PB 1BRAA 1BRUP 1CHOF 2F3CE 1SGTA 1IQJA 1W13U 4LK4A 1P12E 4K60A 1XVMA 4OGXA 1EJMA 1F0RA 1A1RA 1L4ZA 2WPLS 1HXFH 5AHGH 2A2XH 2BX4A 3LGVA 2CV3A 1C5SA 1OP2A 2EC9H 5DP5A 4YT6H 5L2YH 1SFQB 1AMHA 3SV7A 2OQ5A 3ZZ8A 1TX8A 4INKA 2KX4A 1ORFA 1BIOA 3GCTG 1EZQA 5LPFA 2ZHEH 1XUHA 1XXDA 2OBOA 2DUCA 2OC8A 2V0BA 3DSGA 4B2CA 5IDKA 1C2KA 3UQVA 1CU1A 1GMDG 1DXPA 2YNAA 4FXGH 2D2DA 3QZRA 5DK1A 3BF6H 1W7GH 6CHAB 1EJAA 1GWAA 1EPTC 2BDCA 1FQ3A 2B7DH 2W5EA 2XBWA 3EAJA 1LVMA 1FN6A 3RXUA 4Y76A 2SGDE 1BRCE 3VB3A 3LGTA 3PLBA 3GYLB 2P3TB 2O8UA 1AFQC 1WOFA 4K8BA 3KQEA 1Y3YA 1DT2A 2STBE 1SGNE 3B23B 1MTNC 1N6YA 1QA0A 2XC4A 2NU1E 1GPZA 4BANB 2PKAB 2ZGCA 1PQ8A 1NZQH 4NWLA 1SQOA 1AKSB 3KL6A 4FVDA 2R2MB 1HNEE 1EP6A 1P01A 4IN1A 3SU6A 4GPGA 3LC5A 1QA7A 1V2MT 2TIOA 3GCTF 3TH4H 1P9SA 1T31A 3FN8A 1K9OE 2OXSA 4ZROA 1GMDF 1KLTA 2J9NA 3M5NA 1SHYA 2A5AA 2HALA 4Q4LA 1PQ7A 5AFYH 2LNCA 3A80A 1SGDE 2OC1A 2SFAA 1GGDB 3N99A 1QB6A 1FJSA 4GVUA 1E38B 3EE0B 5LPRA 3TK5A 3TGKE 1TNLA 1ETSH 1TOCB 2GCTB 2GT7A 2QF4A 4XDEA 4YOGA 3RXGA 4CRAA 4X1QU 5JDUB 5KEDA 4X1PU 1C1OA 1TPSA 1A46H 2ESTE 3BN9A 3S7HB 1YWUA 2OC7A 4NIVA 2ZWLH 4TWWA 2VIWA 2BVXH 5FCRA 1G30B 2NU3E 2XCFA 1OPHB 2WZQA 4TY6A 4MNVA 1O38A 3U8RH 4A1XA 2GZ9A 3M5MA 1P03A 1S81A 1V2PT 4UFEH 4B6EA 2W6ID 3E6PH 1NRPH 3ENSB 2VVCA 2HVXA 1HRTH 1WSSH 2ILNA 3KIDU 1PFXC 4KP0A 3RDZA 1HAPH 4ABGA 1LCYA 1CE5A 1WTGH 1P2KA 4ZUHA 1NTPA 1GBMA 2FOEA 2LPRA 4CR9A 2VH0A 1SGRE 5CMXH 1BTUA 2FOAA 3STIA 1XUFA 1IQNA 2C8WB 3Q3YA 3ODDA 1WYKA 3DCLA 5C17A 1XKAC 1K1NA 1GMHF 2Y82A 2EI6A 1K28D 5GNDA 1MBQA 1C2HA 2FLBH 2SGAA 1C4Y2 7ESTE 1IQFA 3CS7A 4CRGA 4YO9A 1Y5BT 3UWIA 1XKBC 1DUEA 1AI8H 3TJVA 5T6FA 2VIPA 2P8OC 2ZG0H 2IN2A 5K0HA 4AGKA 3ODFA 1C5RA 2Q6FA 2VBCA 1LKBA 1ELCA 4X8UH 1HUTH 3MNXA 4B2BA 1O3BA 4XD7D 1SOTA 1K1LA 1JOUB 5E2PA 2SNVA 4F55A 1QCPA 1U6QA 1MH0A 2QF3A 2XYAA 3MOCA 4BNRA 2KCOA 1AVXA 2J34A 1S0QA 1YM0A 3BTHE 4Y8ZA 1GDQA 3FZZA 3GY5A 5HXFA 2FO9A 4YOJA 2G00A 4FUCA 3OU0A 5T1VA 4NIYA 4MPVA 1S85A 4TYDA 1GJ6A 3ATKA 3E8LA 2SGQE 3DD2H 1HIAA 1NU9A 3UNQA 1OWKA 2PGQB 2ZFRH 3WY8A 1EQ9A 3WWBA 1ZSLA 4YT7H 3ZVCA 3MH6A 1C2LA 2H1UA 2JDID 3TJUA 2JETC 2WPKS 2QY0B 1OWJA 4K2YA 2TBSA 1F2SE 2EI8A 1S6FA 1NPMA 4TWYA 1F0UA 2R2WU 4I33A 1TMBH 5L2ZH 2J4IA 1ZYOA 1CGIE 3TU7H 3SUDA 1UCYH 4FETA 1UO6A 1P0SH 4XFQA 2VVVA 4XBBA 2GTBA 1EJNA 1V2LT 2Q6DA 2ZFQH 3RXLA 2Y5GA 1G2LA 4BOHA 1TBZH 4FU8A 1ZJDA 5EJ1A 3ZZAA 1ZHRA 3M5LA 3OX7U 2CMYA 1TX6A 2FZZA 2WHXA 5FAHA 4X0WU 3B8JA 4K5ZA 2NU0E 1Y5AT 5PTPA 4GCHG 2Y7ZA 3P95A 2RFKC 3TIUA 4MNYA 1N1LA 3R3GB 4WJG2 4LZ1H 4B73A 1O5CB 1T8OA 2YNBA 4YESB 4K69A 1F5RA 2Q6GA 1FLEE 3PMAB 2A4OA 3ZVDA 1W12U 3SV9A 5DP6A 4YXWD 5EIYA 2AMPA 4M7GA 5KECA 3VB6A 2CF9H 3T29A 1BA8B 4FUEA 2H9HA 3HATH 2FIRH 1DWCH 2EI7A 1Z8IB 3T2NA 4AFQA 1BT7A 4RT0A 2KZ4A 2A0QB 2R0KA 1DY8A 1YCPH 2A4GA 1J14A 2ZHFH 1TNKA 5EODA 5C94A 5EPNA 1CT4E 1A3EH 2M5TA 2OP9A 4IC6A 3ATWA 3PMBB 4O03A 1AU8A 3FP8E 3EA7A 1C9PA 2ZU1A 2ZU5A 4AORA 1GL1A 3U8OH 4SGAE 2P59A 1A5HA 2A5KA 1GHXH 4KTCA 5A0BA 1G3BA 1CA8B 1C2FA 3ITIA 1SGEE 2BD5A 1C1VH 2QXJA 3RXHA 3UWJH 2ZHDA 1CHGA 1SB1H 3RXSA 1RTFB 4ISIH 3T5FH 3GY2A 4E7NA 3LGIA 1MZAA 1P2OA 3BTQE 3BG4B 1W3CA 4X2YA 4DVAU 4XRNA 3SU4A 4CHAC 1Y3XA 1O2SA 1HCGA 3URCA 2XCNA 1L1GA 3A7WA 5EQRA 1F92A 2ODPA 4I8HA 1KXCA 3LONA 4NIXA 1C9TA 4MTBA 2BD2A 1D3TB 4U30A 3H09A 1AY6H 3NXPA 2XOKD 1GL0E 1YPKH 1TIOA 3KF2A 3A8AA 1KSNA 3SGAE 2TGPZ 1THPB 4NG9H 2XBYA 1OWIA 1GBCA 2QYIA 1LVYA 1MBMA 1RD3B 3VB5A 4Z0KA 4R8TB 4I32A 1KY9A 2Z3EA 4E05H 4ZHAA 2KCPA 3QN7A 4UE7H 1O5BB 5HIYA 2PSYA 3RXTA 2WV9A 2Y6TA 2I6QA 3PYHA 1V3XA 3QGNB 2DE8A 3RC5A 3TJNA 1K1PA 1C1MA 3QDZB 2QXHA 2J98A 3Q76A 2YMSB 1XM1A 2EQNA 4IC5A 5DGJA 3SN8A 1N8OB 5JB8S 5I25A 1W8BH 1E36B 1ZMNA 2ZTZA 1C2DA 3S9CA 5DO4H 3SI3H 1FY3A 1DWDH 4D8NA 1A0LA 3MO3A 1YPLH 1GI4A 4BAQB 4ABAA 1F0TA 3E1XB 1BRBE 3S7KB 1V2RT 1TGSZ 5JPMH 3PMHB 2KCYA 3OEHD 5BPEA 1ETRH 4IGDA 4WMFA 3RXQA 3ZVAA 2UWLA 5HYOA 4ESTE 1YP9A 5LPEA 3GCHB 1V2QT 3ZZ4A 1NM6A 3C27B 1TLDA 4F4OC 5EW1H 2Z6BD 2BD9A 1O36A 1AB9B 1HAVA 1TB6H 1EZUC 3PLPA 4E06H 3GOVB 4FUFA 1C5UA 1YCPK 5I46H 1N6XA 3UREA 1OSSA 1DS2E 3SI4H 5A0CA 2PUXB 2P94A 7GCHG 1MTSA 1OP0A
chains in the Genus database with same CATH topology
1QURH 1TRYA 3URDA 2ZPQA 5JB9S 3H5CB 1RIWC 1B0FA 1CBWC 3RMMH 4WH8A 5GCHG 5FX5A 2BZAA 3V12A 2GMTB 2HNTE 2HOBA 2SNWA 4WMDA 1O2ZA 2F91A 5FXLA 1GI9B 3QGJA 3A7VA 3RU4T 3A83A 2VIVA 4YLUA 4RKJB 2ZCKP 1PPBH 1AVGH 1G2MA 2ZI2H 1O2XA 1OYTH 3SW2B 5CHAC 1A2CH 1SGYE 3GDUA 3HKIB 3VGCC 2BLVA 3SUFA 4AFUA 2FYQA 4I8LA 1SLVB 4NA9H 1YPHE 4B71A 1L2EA 1TALA 2NWNA 1CVWH 1C4V2 2RDLA 1O3NA 5FCKA 1IQGA 3SZNA 6GCHF 2HNTC 4FUIA 3ZVEA 1O3JA 4NCYA 1O2LA 4X1SU 2WPIS 2VIDA 2Y80A 3GDSA 1H9LB 3K65B 3OY5U 1AZ8A 3FANA 3QLPH 1DSTA 3E3TA 3S9AA 5F8XA 1DE7H 3V0XA 3SNBA 2ZP0H 3RMOH 1DY9A 2BHGA 5FBIA 4MLFB 1GJ9B 3MYWA 5FHTA 4FUJA 1CGJE 2OINA 2Z9LA 3EGKH 1ZSKA 2VWOA 2BVSH 2J2UA 1YPHC 1LQDB 3K2UA 1OP8A 1HDTH 1G32B 3NZIA 4FVBA 2AYWA 3EA9A 1EPTA 1VCWA 3QTOH 1GG6B 4O3UA 2WINI 4D76A 2VINA 3P6ZB 2QCYA 2ZA5A 1C2MA 4B1TA 4LZ4B 1KIGH 3SU2A 5GWZA 1O3IA 3HKJB 1ZTJA 4CREA 3ZYDA 2FX6A 2CXVA 1NS3A 4WF8A 4B76A 3A7TA 4AX9H 2ZF0H 1EUFA 3QWCH 1YCPM 3M7UA 7LPRA 3PM3A 3SJOA 1BTWA 4ABBA 1ZPBA 1ZR0A 4E7RG 3LH1A 3S69A 2WV5A 2G51A 4F49A 1J17T 1NO9H 2WPMS 4GHTA 2I6SA 3ZVFA 3MNBA 2FOFA 4K1EA 3P8FA 2AFQB 1FPCH 3K6YA 2H6MA 2PHBA 3AAUA 1XUIA 1DICA 2FOGA 1O2VA 1BMLA 2BQ6B 2XNIA 4CR5A 5K7RA 2BD8A 1O31A 1JXPA 4YZUA 2G52A 1AFQB 1C5PA 1TX7A 1CA0C 3CP7A 3LT3A 2F9VA 2JKHA 3BEFB 5AF9H 1UVOA 5DJ7A 4GLYA 1GHYH 1TNGA 1ESBA 1D4PB 1L0ZA 3MU1A 3R0FA 4IN2A 1LTOA 2FI3E 5A8ZA 1O2MA 4X2XA 1TBQH 1FY8E 3ATLA 5E8EH 1PYTD 2FMJA 1AFEH 3T25A 2Q1JA 1GHAF 1HAYB 3DA9B 1CSOE 2Z7FE 4DY7B 3IWMA 3UIRA 1GBLA 1O37A 1FY5A 1TPAE 2ZCHP 2G81E 2QA9E 2VIOA 5JBCS 1PPHE 1TOMH 4INLA 2QAAA 3V3MA 1ZMJA 1HAHH 3TVJB 3ZV9A 3M37A 5T6GA 1C1SA 4ABIA 1QNJA 1T7CA 1GCTC 1ANDA 2TGAA 1Y5UT 2FI5E 1K1OA 3UNRA 2BOHB 1XX9A 2ZU4A 3CENA 3ZVBA 1ZOMA 2AMDA 3M61U 4UFDH 5EQQA 2ZO3H 1VJ9U 1NRNH 4DG4A 1OWHA 3I29A 4LXBH 4UEHH 2RA3A 2WPJS 2BM2A 4AB8A 4XE4A 2OD3B 1QL8A 1V2KT 1K1IA 1MCVA 1ACBE 1O2NA 3MU8A 1LO6A 1F5KU 2R9PA 3MMGA 3F9GA 1KXBA 2W3KA 1UK3A 3SNDA 3UR9A 1J16A 1DLKB 4CRBA 1QFKH 2PTNA 2PW8H 3HK6B 2OCVB 3HPTB 2VGCC 2IOTA 3LGWA 1HBTH 2SGFE 4DURA 4ABHA 4KTUA 2BYAX 3M35A 1NFYA 1UK4A 4MG3A 2FOMB 1P11E 4YOIA 6CHAC 2FS9A 4BTIB 1FDPA 2TGTA 2P8OB 4LOYH 2XC5A 4WMEA 4J2YB 1A5IA 2C8ZB 1D6WA 1MTUA 2H5CA 3L3TA 4A1VA 1BDAA 8GCHG 3SGBE 1GMCG 1G36A 5HMAA 4GHQA 3PTBA 5FX6A 2AGIX 2CHAB 1LDTT 1DXWA 1JBUH 2Z94A 3UY9A 1A0JA 2C8XB 1BBRK 2FP7B 1H4WA 1QBNA 3RP2A 1IQHA 1GBFA 4ZMAH 3ZVGA 1QBOA 1P3CA 2V3OH 1AWHB 4NSYA 2GKVE 1YGCH 5DG6A 1J15A 2ULLA 1GI1A 1EB2A 1KLJH 1NFWA 1MMJN 2NU4E 1GVZA 1RFNA 2GCHG 1FXYA 5EW2H 5FPTA 1WUNH 4HTCH 5FPSA 1BTYA 1PPCE 1UTKA 2JETB 3ATIA 1GGDC 1EASA 1XMNB 4YTAA 1SG8B 1SFIA 3KNXA 3EDXB 3QK1A 4Y71A 5F03A 2BVRH 2BB4A 1VGCB 2W7SA 1G3DA 3P8GA 1UTNA 1ZPZA 1CT2E 2GGVB 1ELGA 2ZQ2A 1OYQA 1RTLA 3KQCA 1FONA 1ZZZA 3U8TH 1QRZA 2VH6A 3F68H 1MCTA 1QJ6B 2OLGA 4ISNA 3RXJA 1QHRB 1C1UH 2P3UB 1KDQA 1O3MA 3NK8A 4ZXYH 3BTKE 4GUXA 1SVPA 1J9CH 2FX4A 1O32A 4MQAA 4Y0ZE 2PKSB 1V2VT 5IYTA 2D8WA 3HK3B 5C20A 1GI6A 4X2WA 1FI8A 1W0YH 2KAIA 4BAHB 1AIXH 1NN6A 3P92A 4H6TA 1MD7A 1BTPA 1NU7B 2GCHF 1A5GH 1JRTA 1O3HA 2PUQH 2AS9A 2EEKA 3LDXH 4D7FA 4U2WA 1RXPA 1C5QA 3FP7E 3SV6A 1LHFH 1UHBA 3M5OA 1FMGA 2FTLE 1FIZA 3ESTA 4JCNA 1MKWH 2BZ6H 4DGJA 2C93B 2VIQA 3JZ1B 4B2AA 4H6SB 1HIAB 1MQ6A 4UFGH 3LU9B 3RM0H 2ALPA 1GBKA 1INCA 3JZ2B 2BD7A 3RXDA 4JZIA 4JZ1A 2D26C 4CRFA 3SBKA 3SUGA 1LPGB 1GBEA 3SU3A 3GCOA 3A7YA 1S82A 1YYY1 9ESTA 1P3EA 2GT8A 4AFZA 3Q3XA 1UTOA 2ZDLA 3E91A 2VNTA 2O8TA 1DFPA 3NKKA 2HPQH 4B74A 1WTHD 3LC3A 1CQQA 1GJ7B 4A1TA 2RA0A 1TMUH 4MPUA 1M9UA 2TPIZ 1S83A 5SGAE 1V2NT 2J92A 1O5FH 1YLCA 2QC2A 1C2IA 1TPOA 1O33A 3RMLH 4BTTB 2STAE 4OS7A 1EB1H 2WUBA 1P57B 1P2NA 4HI3A 3TH2H 2XWBI 1OOKB 5HM2A 3M36A 1K22H 2JH6D 3UFAA 1HJAC 2GX4A 4TPYA 1MD8A 3A7ZA 3SV2H 3FP6E 3OSYA 1NT1A 1DUAA 4GCHF 1Z7KA 2ZGJA 1T8NA 3STJA 1GBBA 2ZTXA 1TFXA 3M3TA 4IBLH 2QXGA 1O5AB 1SPJA 1GVKB 2BDHA 2FYRA 2AEIH 1GBTA 3ZZBA 1Z1IA 2Y81A 1WQVH 4TPIZ 1BJUA 4BAKB 1PPZA 2PV9B 3GY6A 3BIUH 1LHCH 1SGFG 5C2ZA 1O5GH 3MH4A 3MNCA 1SGFA 2F83A 1C1RA 3GISB 1LPZB 5C1XA 1GDNA 4IMQA 1DOJA 3SQEE 3L33A 3M7QA 1DDJA 3RXBA 3ZZ7A 2ZDKA 3S0NA 4RKOB 4OS4A 3ZV8A 3A82A 1G3EA 1KYNA 1FV9A 1FNIA 2G55A 3PO1C 4XBDA 1ANBA 1UCYK 2K1QA 2AH4X 3VXEH 1ZPCA 2BMGB 1DWEH 2OUAA 3LKWA 1GJAB 1ANEA 1FY4A 4VGCB 2P93A 3UOUA 1C2GA 3T27A 1UK2A 1BCUH 1GDUA 1MAYA 4Z6AH 1MKXH 1ZRBA 1ZSJA 3OYPA 5T3HA 4CRDA 1ZGVA 4Y8YA 1F0SA 2C90B 2PWXA 4U01A 6ESTA 4ABJA 2R3YA 2ASUB 5DKMA 3BTGE 3VB7A 2VWNA 2VU8E 3SJ8A 1YPGH 1HAXB 4BTUB 2GP9B 2FPZA 1RIWB 1ELVA 2A2QH 2FLRH 3M7TA 1O2TA 1T4VH 1TNHA 1Z1JA 2XC0A 3P8OA 2WV4A 5F8ZA 3BG4C 3F9EA 4B75A 4MPWA 4BXSA 3QUMP 2SGEE 1OXGA 4AG1A 3TJOA 1YKTA 2GVFA 4THNH 3ZZ9A 3GY8A 1ZMLA 1GCDA 3TITA 1VITG 1TGNA 4NGAH 2TRMA 3OY6U 1VR1H 4X8VH 4Y8XA 1AHTH 2O8WA 3V7TA 4D7GA 3BTWE 1O34A 1O2PA 2FOHA 2FI4E 5A8YA 1UTMA 1SGIB 1ETTH 1DM4B 1QQ4A 2P95A 4WVPE 2BLWA 1TAWA 4K8YA 2Z9KA 4NZQA 4Q7XA 1NRSH 2ZU2A 1AO5A 2ZFFH 5FPYA 2C8YB 2V35A 1F5LA 2GZ8A 2C4FH 2UUFB 1OKXA 1O3EA 1G37A 1P9UA 1SI5H 1O2IA 1GJDB 1V2OT 1UVPA 5E0HA 1OWDA 1PYTC 2HNTF 1ZTLA 2RG3A 5DP8A 1QL9A 2A4QA 1TQ7B 3M3VA 1WAYB 5TCAA 2QGRA 3PTNA 3IITA 3TPIZ 5CE1A 1Z6JH 1C1QA 1D3DB 1GJCB 1JRSA 2F9NA 5F8TA 1AUJA 1UTPA 1EATA 1O2QA 2ZDNA 1L1NA 1QTFA 1HAVB 4NZLA 1HLTH 1HYLA 2OQUA 3BTEE 2B0FA 1PPFE 3RXPA 3O8DA 1Q2WA 2ZU3A 4AFSA 3NPSA 4FUHA 4KGAA 4ZH8A 7KMEH 2XWAA 3NCLA 5F6MA 3MO6A 4DT7B 5BRRE 1V2TT 4DOQA 3F1SB 1AE5A 4CH8B 1QRWA 2QN5T 1RGQA 3QX5H 5T6DA 1MTWA 3QZQA 2G5VA 3M3SA 2FOCA 3PWBA 3GCHC 1P09A 3RXEA 3RXFA 1ZRKA 3DT0H 5LGOA 2ZQ1A 3D49H 3RLYH 3A8DA 1AD8H 4MNWA 3UQOA 7GCHF 3UUZA 4I8JA 1TBRH 2QXIA 1GI5A 1TQ0B 1D6RA 3PROA 1AUTC 1SQAA 1O2HA 1S0RA 3RMNH 1HJ8A 3A87A 5GCHF 1T32A 1D9IA 1LVOA 1IQLA 3GY7A 4KTSA 3ZZ6A 1YPEH 4PROA 2HWLB 4ABEA 5C5OA 1PPEE 1P02A 2GMTC 2FS8A 3PMJA 1SMFE 1CHOG 3E0NB 2ZC9H 1ZHMA 1IQEA 1E37B 4WXVA 3BV9B 2GZ7A 4IMZA 4NFFA 2SGPE 4JZDH 3F9HA 1ZLRA 6LPRA 2BQWB 2BQ7B 4JYTA 2XBVA 1J8AA 4K1TA 2O9QA 1HAZB 1Z6EA 3GDVA 4X2VA 1LPKB 4UDWH 1O2OA 5C67A 2GV6A 3RXMA 3PLKA 4AN7A 4U32A 3SU1A 3GICB 5HM9A 4JYUH 1EPTB 5L6NH 1ESAA 2BDGA 2H5DA 3FFGA 4MVNA 1O2GH 2OC0A 1JWTA 1ABJH 1O35A 4JYVH 4X6NA 2XBXA 1ELAA 3H7TA 3TGIE 1FN8A 2BLQA 3BG8A 2ZPSA 1IQIA 3G01A 4ISLA 1IQKA 2BY5X 1GI0A 4K3JA 3U9AH 1GHVH 2Y7XA 3FVFB 2W7UA 1BHXB 4ZHMU 1MTNB 4FUGA 5JBBS 1OS8A 1F7ZA 1ZTKA 5ESBA 1WU1A 3TLOA 2FESH 4Y11E 1S6HA 2CJIA 3Q00A 4HFPB 2R3UA 4Y7AA 1O3GA 5B6OA 2FODA 2UUKB 3RXRA 1BHXF 1GG6C 2UUYA 1XUGA 1BJVA 4RSPA 3HGPA 1BMNH 1SOZA 1O3LA 2PR3A 3SUEA 5C3NA 5DP9A 4Y7BA 1NC6A 2UWOA 1A7SA 1EXFA 2ZGXH 2BXUH 2PSXA 1G9IE 5J4SA 1UVSH 1GHWH 1MQ5A 2PKAA 3ATMA 2V3HH 2VGCB 4Y0YE 2OTVA 4AGJA 1K1JA 1THSH 2Z3CA 1GJ8B 2ZHQH 1EKBB 1AKSA 1SSXA 3BTTE 3EQ0H 1QRXA 3RC4A 4A92A 3V13A 2Z9JA 5G4BA 3ZZDA 1SLUB 1UTLM 4ZKSU 1RRKA 1TGTA 4UFFH 2A4RA 1AWFH 4FUDA 3LOXA 1A3BH 4X1NU 2F9PA 1XUKA 3TK9A 4ZKOU 4O97A 4QT8C 1WQSA 2R0LA 1LKAA 3I77A 1DPOA 3KN2A 3A7XA 1PQAA 1TGCA 2HPPH 5E2OA 3RXVA 1P2MA 1TABE 1EOJA 3SGQE 1C5YB 3GCNA 4ISOA 3MU4A 5EXNA 1O2KA 5L30H 1C5TA 4AOQA 3MHWU 2FTMA 1IAUA 2OBQA 2G5NA 5LH8A 2IPHA 1O0DH 3MH7A 1E34B 2Z9GA 4Y6DA 4D9RA 5J4QA 1SGCA 1RTKA 1V2UT 4Y10E 2QV1A 3SU0A 1GBJA 1O3FA 2HLCA 2QF0A 1E35B 1HAOH 3ZYEA 4D9QA 1KXEA 3OTJE 1DLEA 1GMHG 1X7AC 1QJ1B 3AASA 1FZZA 1C5XB 3BSQA 3A86A 5ESTE 3E90B 4IS5A 1SC8U 3SJKA 1HGTH 1LVBA 1O3KA 4YLQH 1D3QB 3KEEA 1LHGH 2G8TA 1TGBA 3D62A 3A85A 1QJ7B 4X6MA 1BB0B 1DSUA 2ANKH 1BOQA 1EZXC 3SO3A 3SQHE 4DCDA 4A7IB 1B7XB 4UONA 1TMTH 1TRNA 4WXIA 3PB1E 3MTYA 3RXAA 3LJJA 1ZJKA 1ARCA 3BEIB 1HV7A 3RUOA 2O8LA 2ODQA 1V2ST 1G3CA 2F9OA 2ZTYA 1AE8H 3CS0A 3P17H 2BLOA 1QR3E 1S84A 1IQMA 1EOLA 1L1JA 1O3CA 3A88A 5EU8A 5JYIA 1A61H 2BY7X 2BX3A 1UJ1A 3D23A 4FU9A 1LQEA 2THFB 4NSVA 1ABIH 3UTUH 2BTCE 2ZIQH 2ZZUH 1E0FD 2GCTC 4CRCA 2BDBA 1B5GH 1V2WT 3MO9A 2HRVA 1BMMH 2FM2A 4AG2A 3MI4A 2BY6X 3SORA 8GCHF 1GMCF 2O8MA 4AYYB 1BBRE 5EG4A 3RXKA 1SL3A 1SHHB 2CGAA 2ZDAH 1DVAH 2GDEH 4Q7ZA 1JMOH 4A5TS 4JK5A 1EAIA 1O2UA<