4X1PU

The crystal structure of mupain-1-17 in complex with murinised human upa at ph4.6
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Distinctive binding modes and inhibitory mechanisms of two peptidic inhibitors of urokinase-type plasminogen activator with isomeric P1 residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1pU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1pU01
4J1YA 4B1TA 3B9FH 1GJDB 2Z9JA 3A7ZA 1BOQA 3EGKH 3ZVGA 3ZZ9A 5J4SA 3AASA 2QY0B 1AO5A 1FAKH 2RG3A 2ZQ1A 3PYHA 7KMEH 1V2JT 1ZPBA 1S6FA 2A4GA 3RP2A 3C1KA 1F0RA 1TGCA 2ODQA 1QY6A 3SO3A 1THRH 1L1JA 4X2YA 1O3NA 3BEFB 3MO6A 1YPGH 3E90B 2WYJA 3MO9A 1SI5H 1NESE 3BTEE 3S7HB 3QK1A 4I7YH 3LIWA 1HV7A 4HTCH 1ZR0A 1C5UA 1K1PA 2OINA 4FVDA 2BY7X 1HLTH 3T28A 4X1RU 1HJAB 3OY6U 2A7HA 4B73A 3IWMA 3OSYA 4Y7BA 2PTNA 3EA7A 4YTAA 1AE5A 1KXAA 1C5YB 9LPRA 4DCDA 2CHAC 5H4IB 3R0FA 3S0NA 5C2ZA 2FESH 2QXGA 4NGAH 2BQ6B 3SU3A 2PFEA 1AB9C 1WV7H 3LGVA 3SJIA 5EODA 1XKAC 1Z8JB 3PLKA 3JZ1B 1P2NA 1V2PT 2Y82A 1O3KA 3GCOA 1TA6A 2H5CA 3OU0A 5C5NA 1HAVB 2XTTB 1LMWB 3KQCA 5LH8A 1HAYB 1VITG 3SUDA 3KF2A 3WY8A 3LH3A 1A0HB 1W0YH 3RXMA 3STJA 1ZGIA 3BTKE 3SW2B 3TNTA 2Z9GA 3ODFA 1MCTA 1GI4A 1ELFA 2FS8A 1P01A 1EZXC 1MKXK 2VWOA 3E8LA 3L33A 2WUBA 2BZAA 3ZZ7A 3SNDA 5C3NA 1XUGA 1C5LH 3UFAA 3TITA 1ESBA 3ATMA 1QFKH 2ZGCA 3TJOA 2BLWA 1GCTC 2VH0A 1DVAH 1V2TT 3LPRA 4U32A 3SZNA 1NPMA 4FUBA 1O3HA 1PFXC 1DUAA 4NIYA 4ABDA 4NSYA 1OWDA 4Y8YA 1W10U 4X2WA 1EPTC 4UONA 2PKSC 2ZHQH 4QT8C 1TGNA 5FAHA 2UWOA 4X6NA 1QA0A 3PB1E 4NA8A 1HJ9A 5A2MH 1TPOA 2PUXB 2GZ7A 3CS7A 1SGFA 4NIXA 5C1YA 1C9TA 3GY8A 2XCNA 1O2MA 3ZZ8A 3A86A 1O3AA 1NM6A 1O3GA 3LGUA 1NFXA 4AFZA 3U8TH 2HPPH 2FOFA 5L6NH 2ZTXA 3QGNB 2BD5A 5DP6A 2HNTF 2VINA 2WINI 1LPGB 3ZZ6A 3A8DA 4ZAEA 3W94A 4ABBA 3EAJA 1RIWC 2VVCA 2BTCE 1KDQA 1ZGVA 1MTNC 1VR1H 1LTOA 2ZU5A 1AE8H 5B6OA 5GCHF 1KTSB 1SGEE 1C5OH 1SGNE 1VJ9U 4GHQA 4GLYA 2ZDAH 1BT7A 4MPWA 1OYQA 5HGGA 2Q6FA 4Q7ZA 2FYRA 3E0NB 1UVOA 1O33A 3VPKA 1CE5A 3A7YA 2QYIA 1HAPH 3SV7A 4GAWA 1NRNH 1PQ8A 1GHAG 1GMDG 1CU1A 1FPCH 2QXJA 1UTLM 3ZVEA 3P8GA 3ZZ5A 1P02A 2WV4A 1TBRH 2ZO3H 5I25A 1IHTH 3MU8A 1H4WA 1T8LA 3E16B 1Z8RA 1Y3UA 1BTYA 2NU3E 1BRUP 3NUMA 1C2DA 1BITA 3M5MA 5HMAA 3SJ9A 1TX6A 2A5IA 1EOLA 2R2WU 3DHKH 5EXLA 1UVUH 1A61H 4VGCC 1UVTH 3P8NA 4IN1A 1C1WH 1NTPA 2I6QA 1FAXA 1MAYA 4K8BA 3VB7A 2A2QH 2M5TA 5F8ZA 1QNJA 5T6DA 2FS9A 4A6LA 3GDUA 4ISOA 1E0FD 2BD4A 1LPKB 4BOHA 2ZEBA 1GBCA 1RS0A 1P12E 1A1RA 1EASA 2VIQA 1ID5H 1D3DB 1TNHA 1C2FA 1EAUA 1J16A 1UTOA 4X8VH 2Z3DA 2ZHFH 4YOIA 1BTUA 2GTBA 3VB3A 3Q3XA 2VGCB 1H9LB 1YPMH 2BDHA 3ZVAA 1D3TB 1AGJA 4CRDA 1C1TA 3HK3B 1ELTA 3K9XB 4I8GA 1S0RA 5AHGH 5GDSH 1GJ5H 1V2MT 1NRPH 4B2BA 1QJ7B 5FPTA 4Y71A 2OC7A 1ELDE 1DXPA 1O39A 1Y3WA 1Z71A 1GWAA 1IQJA 1IQFA 1QB6A 1GBAA 1TA2A 1W7XH 3AW0A 1OWIA 1GBLA 1P2MA 4MPUA 1HNEE 3KNXA 3ODDA 3TIUA 1P2KA 1AVXA 3GY7A 5DJ7A 1CT0E 1KXCA 2OC8A 2ZDVH 2GMTC 5GWZA 2ZWLH 1XM1A 1GJ6A 1EKBB 3S9BA 4WWYA 2V3HH 2DE9A 1YCPM 3SI3H 2ANWA 2B7DH 3M35A 1QBNA 3TGJE 3Q76A 2SNVA 2WYGA 3GY2A 2VWNA 6LPRA 1AKSB 2V0BA 4ABJA 8GCHF 3ZVFA 2FOEA 4FUHA 1XVMA 1O31A 4THNH 4OS2A 1EZSC 1ZSKA 1QRXA 1UHBB 1GI1A 2ANMH 1K21H 1YPKH 5EW1H 4Q7YA 1NFUA 4K5ZA 2ZPRA 1Y3YA 3NKKA 3OYPA 4YLUA 1C1RA 2A32A 4MNYA 1G3EA 4BXSA 4R0IA 1AHTH 3GICB 1C2MA 1GJ9B 3VB5A 1P0SH 2BX3A 4GHTA 4X8SH 1C1NA 1KXBA 1SGCA 3SQHE 1IQHA 2YNBA 2NU2E 1NN6A 3LJJA 1TABE 3BTQE 6GCHG 3LGTA 3TJNA 5EPNA 3RXBA 1O2WA 2BLVA 4NG9H 1XUHA 5FHTA 1CT2E 1O2QA 1TQ7B 5SGAE 1WBGB 5E2PA 1A7SA 4WXVA 1TONA 4SGBE 1HJAC 1O2ZA 1F0TA 1TNKA 1LVOA 1WAYB 3ZZDA 2BDBA 3UNSA 1P06A 3FP6E 1MCVA 1GBBA 2WPJS 4NFEA 1MH0A 8LPRA 1CHOF 3SU5A 1BRCE 1SHYA 1EPTB 5TJXA 2PKSB 1RJXB 4BAHB 1EB1H 1MTUA 2BLQA 1IQIA 1FMGA 1TNJA 8ESTE 1OX1A 1Q2WA 1C9PA 3A88A 1GHBG 3CENA 1AUTC 4MNVA 2HRVA 2IJOB 4ABEA 1GJ7B 3BEIB 1G2LA 1MQ6A 3MH7A 1MKWK 1CVWH 3BTWE 4MPXA 3ZVCA 2Z7FE 1DFPA 1TMBH 1FZZA 2F9OA 2ZFRH 1DSTA 1K1MA 3GY5A 1O3JA 3P17H 1SLWB 4R8TB 3ZV9A 4AGKA 1TNLA 3K6ZA 2KAIA 1CGJE 1MTNB 3P8FA 1OOKB 3BTGE 4Z6AH 4ABFA 3V3MA 5E0HA 4MVNA 1DLEA 4XBBA 3VXFH 4Y10E 3A81A 3M3VA 1AVWA 1O2TA 2FO9A 3BG4C 4RN6A 1UVPA 4Y7AA 1V3XA 4NSVA 2W26A 1S83A 3PWBA 1A3EH 2FX6A 2VH6A 3A84A 4TPIZ 5BPEA 4AFQA 3MU5A 2VU8E 3A80A 4CRBA 2QAAA 4ZKSU 1K22H 1O3IA 1VCPA 5E8EH 3MI4A 1KLIH 4NCYA 4FXGH 1DWCH 1AI8H 2ULLA 2PTCE 1HIAA 2OBOA 2ZGHA 5A8ZA 2H9EH 5JB9S 3F68H 1O3CA 2P94A 5EPYA 2FOGA 2JH6D 2ZGJA 5E2OA 1YKTA 1PPBH 1BJVA 4FU9A 1MTWA 2Y5FA 3BTTE 2QA9E 3M7QA 1FN6A 4CRGA 3CS0A 3EE0B 3UTUH 3GOVB 2GVFA 1SB1H 2W7SA 5GPIB 5EQSA 1QTFA 3UNRA 4XOJA 1MU8B 4H6SB 5E0JA 2OC0A 1GI8B 1D6WA 1ABIH 2ZCLP 4ISLA 2TBSA 3A82A 1GJAB 1MTVA 5CMXH 3SV9A 2FLBH 3LC3A 3SUGA 1BB0B 1G37A 4B74A 3S69A 1OKXA 1VITF 3M37A 3MU4A 1E35B 3RXKA 1HXFH 2H1UA 1V2RT 2AMQA 4B75A 1BTZA 1TWXB 2WUCA 4GCHG 1NU9A 4BTTB 2ANKH 1YP9A 1ZLRA 1H1BA 1TE0A 4CR5A 2B8OH 1W3CA 1O3LA 1YPLH 1F2SE 3KN2A 3L3TA 3IITA 1SQOA 5JPMH 3FZZA 1KLJH 1FIZA 1C2GA 2QIQA 2SGEE 5JBTA 3BG8A 1W8BH 3QTOH 4K3JA 1GI2A 3BIVH 1ELVA 1G3CA 1QURH 2HGTH 3OY5U 1W7GH 2DE8A 3NZIA 1C2EA 4BAOB 4ZMAH 1GGDB 3M5OA 4NFFA 1ACBE 4WVPE 2Q6DA 4JMYA 3MTYA 3NWUA 1O37A 4F4OC 2GMTB 2CN0H 4AGJA 3TK5A 2FTMA 1LHEH 1CBWB 2ZFTA 1Y5AT 4TPYA 3QO6A 3QDZB 3I78A 1C5WB 1O30A 2PWXA 4RKJB 1PQAA 2BY8X 1FY3A 4HI3A 2BY5X 2ZCKP 4ESTE 1ZHMA 2C4FH 3SQEE 3O8CA 1S81A 2J94A 3SJKA 4Q2KA 2XBVA 2WPHS 1SGTA 2BY9X 1F7ZA 1SVPA 4YOJA 2BY6X 3K2UA 3MO3A 9ESTA 1SGQE 2ZDKA 2ZA5A 4ZUHA 1D4PB 1O2JA 2O8WA 1DT2A 1L4ZA 2VGCC 1LKBA 2BB4A 2Y7XA 1O2OA 4ASHA 4TWWA 2ZNKH 3GYMA 1XXDA 2F91A 1H9IE 2C90B 3MHWU 5LPFA 1K1IA 4Y79A 1ETTH 1SSXA 1HAXB 1QQUA 2PKAA 1OWJA 1L4DA 2CV3A 3MH4A 1O2IA 3P95A 3PMHB 3SORA 5JBBS 4DY7B 3BV9B 1EATA 4ZH8A 1ZPCA 2A4RA 1KDQB 4BAMB 2GP9B 1CGIE 3A85A 3QZQA 1JBUH 3ZZ4A 1P57B 4X1QU 2FXRA 1LPZB 2ANYA 5A0CA 1ZHRA 1GI7B 1TGBA 3TH3H 4BTIB 5DKMA 2F83A 2HOBA 2ZC9H 2BMGB 1QRZA 4D9RA 1TX7A 1EOJA 2Q1JA 1YGCH 1ARBA 3T2NA 1KIGH 3A7WA 1NC6A 3SU1A 4Y6DA 1WCZA 2WV5A 1BHXF 2XC5A 1AD8H 5C1UA 1OXGA 2BDCA 3TGIE 3JZ2B 3SV8A 2F9UA 1JIMA 1SGRE 3ZVBA 4WMDA 2VIPA 2NU4E 2XC4A 1NFWA 4TY7A 4CH8B 3ENSB 2Z94A 2ZU2A 5L30H 4IW4E 1W13U 1LHFH 1TRYA 7GCHG 1E34B 4MNWA 4DIHH 1KY9A 1O2RA 4ZHMU 3VEQB 5C67A 5F6MA 1HAHH 1O2PA 4MQAA 5DP3A 5K0HA 1C5NH 3QX5H 4ZHAA 1K28D 2ZPSA 1AUJA 3ESTA 2ZHDA 3RXLA 1O0DH 3TGKE 1CO7E 5HM2A 3TK6A 1GHYH 4X6PA 3GDSA 4XSKU 5DP7A 3AVZA 1LQDB 2HWLB 4ABHA 5EOKA 4MNXA 1Z6JH 3BG4B 3PWCA 1O3FA 3T29A 1EXFA 4WF8A 1WQVH 4OS6A 1EB2A 2FOBA 5DP4A 1H9HE 3HKIB 3UQOA 1PPZA 4FUIA 2H5DA 4IS5A 1T8MA 2JKHA 4O3UA 4D8NA 3E6PH 2AYWA 3UREA 1INCA 1UJ1A 2SGDE 2VIVA 3RM2H 4FUDA 2GT7A 1GJ8B 3M3TA 1C2HA 4MG3A 4X6OA 1H8IH 1OP2A 1BMNH 2OUAA 2V6NA 4FUFA 1F5RA 2BX4A 2A5AA 3O8RA 4HZHA 1P3EA 3L6PA 2Y7ZA 4WMEA 1BTHH 1C1MA 2G81E 4XDEA 1NY22 4UFGH 2R2MB 1O2XA 2FOMB 4NIVA 1W11U 4ZHLU 2ZHEH 1ZSLA 2H6MA 3E3TA 1BZXE 2FM2A 4ABAA 4O03A 3RMLH 4FUJA 3AAVA 3SHAH 1D6RA 1C1OA 4B2CA 1NO9H 2VIWA 5LGOA 1Z8GA 1TMUH 2H9TH 1UVSH 4LZ4B 4Y0ZE 1FNIA 3PMBB 3HK6B 4YT6H 4B2AA 2FODA 1E38B 4O3TA 4E05H 4NZLA 3A7VA 1GDNA 2W3IA 4A7IB 3BTDE 1J15A 1JMOH 1CHGA 2J92A 4WY3A 3PROA 1FY8E 4JZFH 1TMTH 4UD9H 1TAWA 1QHRB 2JETB 1B0EA 1LHCH 2AGGX 4MPVA 2GCTC 2ODPA 1GBTA 1WOFA 1YF4A 3P70B 1TGTA 3BN9A 1MTSA 3SGAE 1SHHB 5E0GA 2JH5D 4NWKA 2GX4A 3DA9B 1HFDA 4JYUH 2A2XH 2XRCA 1LQEA 1HDTH 7LPRA 1SGFG 2F9PA 5IDKA 3SU6A 1SOTA 1MBMA 5ESBA 1JRSA 3SV2H 1EX3A 1NU7B 2HNTE 3EA9A 2BD7A 1FY4A 1XUKA 3DFJA 1AVGH 2A4QA 2UWLA 2UUYA 2J9NA 1XXFA 4RSPA 3U8RH 2RDLA 1GPZA 2XBXA 5A8YA 2DUCA 2WPIS 4Y8ZA 2PV9B 1ANEA 5DK1A 4IBLH 4IC5A 1SPJA 3MFJA 2BVRH 4CREA 1O5FH 1XMNB 3V0XA 3F1SB 2I6SA 2ZIQH 4I8JA 1C5MD 2UUKB 4D7FA 4U01A 1T32A 1O2LA 3RXSA 2GDEH 2VVVA 3D23A 2ZTYA 3ATWA 4DURA 2Y6TA 1TGSZ 1AZ8A 3RXIA 1EAIA 1CGHA 2OP9A 1OWHA 1ANBA 5EXMA 3KGPA 3SJ8A 1WSSH 3HPTB 1L2EA 2VWMA 3RU4D 1Y8TA 3T5FH 1TPAE 3VGCB 1NRQH 1GGDC 1GJ4H 3VFEA 1P2OA 3GCTG 2HALA 1IHSH 3VXEH 1P3CA 5DG6A 3TNSA 4SGAE 1Z1JA 4UDWH 1TOMH 1O3MA 3CP7A 1LVYA 2D1JA 1JOUB 3T26A 4M7GA 1CBWC 1GHZA 3TLOA 1FUJA 1TBZH 2NU1E 5F8TA 4K60A 3RXHA 4AZ2B 1OP8A 1F5KU 1TPPA 2GKVE 4Y8XA 3M7TA 1MMJN 4XFQA 3GCHC 1C5QA 3UOPA 4DJZB 1P8VC 4ZKOU 1C4Y2 1K1LA 1BIOA 2SNWA 2A1DB 2HPQH 2CJIA 3IG6B 2Y80A 1G32B 1YM0A 3A83A 4A5TS 1A4WH 4NIWA 2ZQ2A 2VIDA 3UNQA 4Y76A 2F9NA 1GI0A 1L1NA 1EAXA 3F9FA 2ILNA 1LKAA 4JK6A 1N8OC 4K1SA 2ZTZA 2AMDA 2XWBI 2FOCA 2HVXA 1MZDA 1RTFB 4B76A 1WUNH 1BJUA 2G52A 2THFB 8KME2 3D62A 5A8XA 2PHBA 2R0LA 2CXVA 1A5HA 2GT8A 4INLA 4ZKNU 1DWDH 2OXSA 1A3BH 1P04A 2TPIZ 4GCHF 1ZTKA 1VJAU 2ALVA 2C8XB 1PPHE 2QXHA 2VJ1A 1IQNA 5DP5A 4H6TA 3RXVA 3LGWA 5LPEA 1ZJDA 1BBRH 3QZRA 3Q00A 3GCNA 4WH6A 1PQ7A 3LDXH 4CHAC 3BEUA 2BDAA 2H9HA 4X6MA 1FDPA 2AGEX 2ZPQA 1A2CH 5FBIA 1C1SA 1V2QT 4YOGA 1LHGH 1BBRE 1BDAA 2PLXA 1P09A 1GHXH 1KXDA 3W95A 5CHAB 1THPB 1HXEH 1SBWA 2XNIA 4ABGA 2FOAA 3PTNA 1Z7KA 1G30B 4A1VA 1V2ST 2XBWA 2A0QB 2Y5HA 5JBCS 1MQ5A 1EUFA 4CBOA 3V13A 2GV6A 2XBYA 2W7UA 1THSH 4JZIA 1SFQB 3GY6A 1ELCA 1QL8A 2EA3A 1KYNA 1F5LA 1O3EA 2FYQA 3MWIU 2AIPA 1HPGA 3UR6A 3QTVH 2FIRH 1C4U2 5AFZH 3UUZA 1TRNA 2QF0A 2D26C 3U69H 4B71A 5FCRA 2OLGA 3RMMH 1X7AC 1C1VH 1AIXH 4WXIA 1HUTH 2J38A 2GCHF 4X0WU 2Y5GA 4I33A 1ZMNA 2BD9A 2VWLA 4AOQA 1IQKA 4K1EA 4KGAA 1ZPZA 1K1NA 1U6QA 1RRKA 1S84A 3G01A 1EJMA 2Z9IA 2RA0A 2RA3A 4K2YA 2ZFSA 3RXTA 1SLXB 1GL1A 4FUEA 1D3PB 1PPEE 2OD3B 1A0JA 1SFIA 1V2OT 3U98H 4YLQH 5FPYA 3UWJH 1HBTH 2BZ6H 3A7XA 3ZZ3A 3LGIA 1V6DA 1A46H 1QR3E 3SGBE 4I8LA 5EQQA 1UTQA 1T31A 1GBFA 1XVOA 4DOQA 3HKJB 1UK3A 1T4UH 1BMMH 2GCTB 1C2LA 2HNTC 2OTVA 4JYVH 2C93B 2A7JA 4H42U 2V3OH 4I8KA 1C2JA 1RFNA 2HLCA 1TOCB 2EC9H 4DT7B 2PKAB 1W0ZU 2P3UB 1YPEH 1XX9A 1ZSJA 2F9VA 1G2MA 2QXIA 5HYOA 4A1XA 4AG2A 3F9EA 2UUFB 2NWNA 2BVXH 1WTHD 1NROH 1SL3A 3RC5A 2B0FA 2FI4E 3E1XB 4FVBA 1MD8A 3SV6A 1C5PA 2A4OA 4O9VA 4X1NU 1BTXA 1XUFA 3SUFA 2XC0A 5EGMA 3RXEA 1WYKA 3OTJE 3OX7U 1LVBA 1O3DA 1HAOH 3ZZAA 4ISIH 3QUMP 7GCHF 1FJSA 2ZDNA 8GCHG 3U1JB 2OBQA 1UMAH 3MU1A 1BMAA 5T3HA 1CT4E 3ZYDA 5FX5A 1TX8A 3A7TA 4ZXXH 3RXPA 1DICA 2QC2A 2PSXA 2FTLE 1HAGE 2QV1A 3NCLA 1GMHG 1J14A 2JETC 1IQEA 2R0KA 1EZUC 4IMQA 1K1OA 1RTKA 1O2HA 1Q3XA 2CF8H 1BRBE 4DIIH 1JIRA 1QA7A 1S0QA 3T27A 2D8WA 2CF9H 2LPRA 3F9GA 4HFPB 3Q77A 3GY4A 2BD3A 3SNAA 1N6YA 1SGDE 2O9QA 1GBJA 4AFUA 1JWTA 3GYLB 5DPAA 4Z0KA 3ITIA 3S7KB 2ZF0H 4CRFA 4GPGA 1YCPH 3UWIA 3RXOA 2GGVB 1P05A 5FBEA 5DGJA 5T6GA 1SQAA 5EXNA 2FPZA 1EPTA 4J2YB 2Z9LA 2O8LA 5HXFA 4YM9A 5DO4H 1HAIH 1TNGA 1RTLA 4RKOB 2SGQE 3ZYEA 4AFSA 1VITH 3GDVA 6ESTA 1GBIA 4X1PU 3UOUA 3GCHB 1FY5A 2ZGBH 1CHOG 3RC4A 5GJ4B 1T8OA 2TGDA 1O5AB 1S5SA 2TGTA 3NPSA 1D9IA 1CQQA 2Z6BD 3M5NA 4F49A 1TBQH 1XKBC 1K1JA 4CR9A 1FI8A 1YPJH 2B5TB 1XUJA 1AU8A 2FDAA 5FXLA 3EYDA 3LT3A 3PV4A 1GMCG 1O38A 2EI7A 4MLFB 1FLEE 4FUCA 1N8OB 1ZRKA 3BSQA 1BCUH 1O5EH 1T7CA 3KCGH 1Y5BT 2BQWB 2VB0A 2P8OC 3SHCH 2QGRA 4TYDA 1V2VT 2ZFPH 2CMYA 3HATH 3SU0A 1DM4B 1ZHPA 4YO9A 1NZQH 1OPHB 3VGCC 1BHXB 1C5ZB 1QRWA 2ZDMA 1P2QA 3MNXA 4K1TA 1ZJKA 1ANDA 1O2NA 2ZHWH 3DUXH 4CHAB 1GHAF 3SNCA 1GMDF 4Y0YE 3SGQE 3D49H 2F9BH 1OYTH 2ZZUH 3TH2H 2FX4A 2G5NA 3RU4T 3TU7H 3RU4E 2VVUA 3U8OH 4AORA 1FQ3A 5GXPA 1NS3A 3H5CB 2PR3A 1DE7H 1UCYH 1V2UT 4I31A 3S9CA 3UPEA 2A7CA 1ZMLA 2ZU4A 4PROA 3RM0H 3TVJB 4GVUA 1QBVH 1UCYE 5JB8S 3Q3YA 5TCCA 3K65B 1Y3VA 1GHVH 1B0FA 5JYIA 1OSSA 2Z3CA 1EJAA 3M36A 4U30A 3MOCA 1F0SA 4UE7H 5F03A 2ZCHP 2Z3EA 1FN8A 3NK8A 4OS1A 5AVDA 2Y81A 4UFDH 1AWFH 3A8BA 1O2VA 3M5LA 3RXAA 3RLWH 1YYY1 1PPFE 4ZROA 1MD7A 4MDSA 2F3CE 4A92A 5JDUB 3LGYA 1V2LT 2GDDA 3D65E 1KSNA 3M7UA 1ZMJA 4A1TA 1C5SA 5AF9H 3KHVA 1TRMA 1DANH 2OQUA 5IYTA 4BAQB 1RGQA 4JZDH 4TY6A 2ZECA 1AFQC 3PM3A 2XXLA 2GV7A 4IN2A 1NT1A 5CHAC 2BVSH 1AWHB 3A8AA 5K7RA 2Z9KA 1GJBB 2FWWA 3BTME 2WPMS 4FU7A 1AFEH 1SLUB 4NZQA 1OWEA 3VB4A 1L1GA 3GCTF 1CA8B 1DWBH 3E0PB 1KXEA 2BDIA 3MYWA 3DD2H 3DT0H 4OS7A 2EEKA 4TWYA 2PGBB 4CH2B 2A31A 3TK9A 5A0BA 2IPHA 2AERH 1OP0A 1ZZZA 1C2IA 1B5GH 1QCPA 1O35A 1S82A 1QB9A 2GZ8A 1ARCA 1O32A 1LDTT 1ESTA 5EQRA 1HYLA 2IOTA 2BM2A 1LCYA 1QIXB 3NXPA 1DY9A 4JZ1A 4OGYA 3SOSA 1GI9B 2R3UA 1J17T 4KTUA 1N1LA 2IN2A 1KLTA 2Q6GA 3SU4A 1GDUA 4JCNA 1IOEA 2G4TA 1F0UA 1SGIB 4X8UH 1P2JA 2PSYA 1VGCC 2C3SA 2P3TB 3MH5A 4YZUA 4HGCA 1HGTH 1ZOMA 3PMJA 1GG6C 1LVMA 3SI4H 4BAKB 1TB6H 1ORFA 2FLRH 1BRAA 1GI3A 4D9QA 1G3DA 4AYYB 3RXQA 2STAE 4CBNA 1DS2E 1ETRH 1W2KH 3TH4H 2K1QA 3KQBA 1MKXH 2C8WB 4YT7H 1FONA 1QB1A 3SJOA 4DG4A 2FI5E 6GCHF 1SLVB 2BHGA 1N6XA 3MNBA 5PTPA 1PQ5A 3I29A 2O8MA 2GZ9A 2FZZA 4LZ1H 4Y11E 1ZTLA 1QJ6B 2ZU1A 5FX6A 3P8OA 6CHAC 3AW1A 1SOZA 1GBKA 2P3FH 2TGAA 3FANA 4BXWA 1GBDA 1OS8A 1DLKB 1GCDA 4Q7XA 1ELGA 2TIOA 3V12A 4LXBH 1UO6A 3TJVA 1W12U 1K9OE 1C1UH 1KTTB 4ZKRU 2AS9A 3SU2A 2O8TA 1O2YA 2QF3A 1CA0B 4Q80A 3M61U 1Z6EA 2AH4X 1SGPE 1DOJA 1UK4A 2AMPA 1C5VA 2EI6A 4AYVB 1LHDH 1FPHH 1GHBF 1DDJA 2BD8A 2AFQB 3RLYH 2GD4B 1P2IA 3O8DA 1HAVA 2OC1A 2XW9A 4FUGA 3F9HA 1UTPA 1YLDA 3LC5A 2BLOA 4WMFA 1MBQA 1O5BB 2FOHA 4XBCA 4E06H 2J2UA 1E37B 4I8HA 2P93A 1GL0E 2V35A 1Y5UT 1TFXA 1MZAA 1Y3XA 1GDQA 1FY1A 2G51A 1PJPA 1P9UA 1KXFA 5A09A 2BDGA 1P03A 2P8OB 1FIWA 2G00A 3URCA 1O2GH 1UTJA 4IGDA 1DY8A 4X1SU 3KQDA 1V2KT 3LH1A 1SGYE 1QBOA 1K2I1 2XWAA 1MUEB 4KP0A 2BDYA 2KAIB 3MNSA 1BBRK 1L0ZA 4XE4A 1PPCE 1J9CH 5L2ZH 1GBMA 1ELEE 3EQ0H 4NA7A 4DW2U 1GBHA 4BNRA 1DXWA 3O8BA 2EI8A 3PLBA 1DSUA 1YPHE 5ETXA 3ATIA 1BQYA 1OWKA 1AQ7A 1YBWA 2QCYA 3SUEA 5AFYH 1AMHA 3PO1C 4AX9H 1RXPA 4IC6A 1A0LA 1TALA 4E7RG 2AGIX 3RXUA 4NWLA 1O5GH 1DUEA 1IAUA 4AB9A 2CGAA 3PLPA 2FEQH 5EG4A 4FU8A 1HIAB 2W3KA 4U2WA 1GVLA 4UFFH 1O3OA 2XYAA 1AN1E 3B8JA 1FXYA 1GBEA 5BRRE 1ETSH 2C8ZB 1PPGE 3KL6A 4OS5A 4MTBA 3H7OA 1HRTH 2CHAB 3T25A 1W14U 4H4FA 5EU8A 1C5XB 1PYTC 4IMZA 5G4BA 2G8TA 2FMJA 1AB9B 5FCKA 1V2NT 1BTPA 4ISHH 1GMHF 3I77A 3MMGA 2STBE 2J34A 1A5GH 3F6UH 4KTSA 2P59A 5GCHG 3U1IB 1AFQB 1V2WT 3P92A 1JXPA 1AY6H 1BUIA 3SNEA 2W5EA 4X8TH 4OGXA 4JZEH 1TLDA 1GI5A 2XCFA 3ELAH 4AB8A 2BXUH 2LNCA 4BANB 3A89A 1PYTD 4D7GA 1P11E 5LPRA 3A87A 1UTKA 1TPSA 4CRCA 1O2SA 4D76A 1EP5A 2G5VA 4AG1A 1G9IE 1ANCA 7ESTE 2FP7B 5JBAS 2SFAA 2FI3E 2ZG0H 1O5DH 1VZQH 2JH0D 3ZZBA 1F92A 3RXJA 2J4IA 1T8NA 3ATKA 1QQ4A 1G3BA 2UWPA 4GSOA 5C5OA 1GCTB 2ALPA 1C4V2 3EDXB 4UFEH 5J4QA 4K8YA 3BIUH 3MH6A 1DITH 1HB0B 1JRTA 3ATLA 1BMLA 3QWCH 2OCVB 3LJOA 1Y59T 4KELA 3LONA 2H2ZA 2BXTH 2ZKSA 1ZYOA 5EW2H 3KIDU 2RCEA 1BTWA 3GY3A 3MNCA 5CE1A 2NU0E 2G55A 4ISNA 4AN7A 4X2VA 1NRSH 1IQMA 3TPIZ 2OQ5A 1VGCB 3A8CA 1GMCF 2ZDLA 3HGPA 2BD2A 5I46H 5GIBA 1SMFE 3C27B 5T6FA 1GG6B 1H8DH 1O3BA 1O2UA 1Z1IA 3PTBA 2ASUB 4KTCA 4UEHH 1P10A 2R3YA 1GVZA 3TJUA 1GVKB 2AEIH 1S85A 1TQ0B 1O3PB 1EJNA 1C5RA 2SGFE 2P16A 1VCQA 3RMOH 4INKA 1EZQA 1Q31A 1RIWB 3URDA 1RD3B 3FP8E 4ABIA 3M3SA 1YC0A 2YOLA 3ZZCA 1BA8B 3FZDA 2C8YB 5A0AE 4WJG2 1C2KA 1HJ8A 1YLCA 4DVAU 3Q3KA 2P95A 1QGFA 4K69A 3QGJA 3ZV8A 4XBDA 1O34A 3UR9A 3BTFE 1GJCB 2BQ7B 2SGAA 1GHWH 3RXCA 6CHAB 2VNTA 1GI6A 1WTGH 2A45B 1AKSA 1SG8B 2WPKS 3QN7A 3RXRA 1IQGA 1YCPK 2BYAX 1EQ9A 3P6ZB 4E7NA 4CRAA 1QL7A 1UHBA 4NA9H 3EA8A 5FPSA 4LK4A 3AAUA 4BTUB 1S6HA 4OS4A 3UY9A 2SGPE 1MAXA 1SQTA 5C1XA 1NRRH 1EAWA 1UK2A 5L2YH 1A5IA 1MKWH 1EP6A 1WU1A 1G36A 1P9SA 4X2XA 2PW8H 3LKWA 1Z8IB 2ZU3A 1C1PA 2BOKA 4LOYH 3UIRA 2D2DA 2ZFQH 1DPOA 2TGPZ 4VGCB 5DP8A 3DFLA 2R9PA 1XUIA 1NFYA 3FAOA 3PMAB 2TRMA 3E91A 4WH8A 3QLPH 3STIA 4DGJA 2B9LA 1DX5M 3FP7E 3VB6A 1ELBA 1YPHC 1J8AA 3B23B 2G4UA 1ELAA 1UTMA 3LU9B 3RUOA 1O36A 4JK5A 1ZTJA 2ZP0H 3HGNA 3H7TA 1O2KA 1HAZB 3BTHE 3KQEA 1HCGA 3SN8A 1C5TA 3FFGA 4INHA 2ODYB 3N7OA 2ZI2H 1CA0C 1E36B 4JYTA 2PGQB 1AZZA 1ABJH 2PUQH 3GISB 3RC6A 3T62A 1O5CB 3BF6H 1TNIA 2O8UA 1MU6B 1SC8U 4O97A 3UQVA 2VIOA 3MU0A 3PO1B 5F8XA 1UCYK 5C20A 3RDZA 4GUXA 1IQLA 2BOHB 2AIQA 1DWEH 2UUJB 3R3GB 2A5KA 1ZRBA 4KKDA 1ESAA 3RXGA 2YNAA 5DP9A 3RXFA 1UTNA 2ZGXH 2WPLS 1VCWA 3S9AA 5ABWA 4I32A 3K6YA 2ZFFH 1T4VH 1TIOA 1FV9A 3SBKA 1M9UA 3RMNH 1B7XB 3LOXA 3ZVDA 2GCHG 1LO6A 2QN5T 1CSOE 5HM9A 3U9AH 3V7TA 1D3QB 3RXDA 2ESTE 1QL9A 1C1QA 3FVFB 1WQSA 1TYNA 2J95A 4ZXYH 3SNBA 4YESB 1QJ1B 5ESTE 3KEEA 5TCAA 1SR5C
chains in the Genus database with same CATH superfamily
4J1YA 4B1TA 3B9FH 1GJDB 2Z9JA 3A7ZA 1BOQA 3EGKH 3ZVGA 3ZZ9A 5J4SA 3AASA 2QY0B 1AO5A 1FAKH 2RG3A 2ZQ1A 3PYHA 7KMEH 1V2JT 1ZPBA 1S6FA 2A4GA 3RP2A 3C1KA 1F0RA 1TGCA 2ODQA 1QY6A 3SO3A 1THRH 1L1JA 4X2YA 1O3NA 3BEFB 3MO6A 1YPGH 3E90B 2QF5A 2WYJA 3MO9A 1SI5H 1NESE 3BTEE 3S7HB 3QK1A 4I7YH 3LIWA 1HV7A 4HTCH 1ZR0A 1C5UA 1K1PA 2OINA 4FVDA 2BY7X 1HLTH 3T28A 4X1RU 1HJAB 3OY6U 2A7HA 4B73A 3IWMA 3OSYA 4Y7BA 2PTNA 2L6OA 3EA7A 4YTAA 1AE5A 1KXAA 1C5YB 9LPRA 4DCDA 2CHAC 5H4IB 3R0FA 3S0NA 5C2ZA 2FESH 2J98B 2QXGA 4NGAH 2BQ6B 3OEHD 3SU3A 2PFEA 1AB9C 1WV7H 3LGVA 3SJIA 5EODA 1XKAC 1Z8JB 3PLKA 3JZ1B 2RDEA 1P2NA 1V2PT 2Y82A 1O3KA 3GCOA 1TA6A 2H5CA 3OU0A 1WXRA 5C5NA 4XD7D 1HAVB 2XTTB 1LMWB 3KQCA 5LH8A 1HAYB 1VITG 3SUDA 3KF2A 3WY8A 2WZQA 3LH3A 1A0HB 1W0YH 3RXMA 3STJA 1ZGIA 1NBME 3BTKE 3SW2B 3TNTA 2Z9GA 3ODFA 1MCTA 1GI4A 1ELFA 2FS8A 1P01A 1EZXC 1MKXK 2VWOA 3E8LA 4OM9A 3L33A 2WUBA 2BZAA 3ZZ7A 3SNDA 5C3NA 1XUGA 1C5LH 3GS9A 3UFAA 3TITA 1ESBA 3ATMA 1QFKH 2ZGCA 3TJOA 2BLWA 1GCTC 2VH0A 1DVAH 1V2TT 3LPRA 4U32A 3SZNA 1NPMA 4FUBA 1O3HA 1PFXC 1DUAA 4NIYA 4ABDA 4NSYA 1QZ8A 1OWDA 4P02A 4Y8YA 1W10U 4X2WA 1EPTC 2WV9A 4UONA 2PKSC 2ZHQH 4QT8C 1TGNA 5FAHA 2UWOA 4X6NA 1QA0A 3PB1E 4NA8A 1HJ9A 5A2MH 1TPOA 2PUXB 2GZ7A 3CS7A 1SGFA 4NIXA 5C1YA 1C9TA 3GY8A 2XCNA 1O2MA 3ZZ8A 3A86A 1O3AA 1NM6A 1O3GA 3LGUA 1NFXA 4AFZA 3U8TH 2HPPH 2FOFA 5L6NH 2ZTXA 3QGNB 2BD5A 5DP6A 2HNTF 2VINA 2WINI 1LPGB 3ZZ6A 1H8HD 3A8DA 4ZAEA 3W94A 4ABBA 3EAJA 1RIWC 2EQNA 2VVCA 2BTCE 1KDQA 1ZGVA 1MTNC 1VR1H 1LTOA 2ZU5A 1AE8H 5B6OA 5GCHF 1KTSB 1SGEE 1C5OH 1SGNE 1VJ9U 4GHQA 4GLYA 2ZDAH 1BT7A 4MPWA 1OYQA 4ACBA 5HGGA 2Q6FA 4Q7ZA 2FYRA 3E0NB 1UVOA 1O33A 3VPKA 1CE5A 3A7YA 2QYIA 1HAPH 3SV7A 4GAWA 1NRNH 1PQ8A 1GHAG 1GMDG 3SZEA 1CU1A 1FPCH 2QXJA 1UTLM 3ZVEA 3P8GA 3ZZ5A 1P02A 2WV4A 1TBRH 2ZO3H 5I25A 1IHTH 3MU8A 1H4WA 1T8LA 3E16B 1Z8RA 1Y3UA 1BTYA 2JIZD 2NU3E 1BRUP 2VBCA 3NUMA 1E1RD 1C2DA 1BITA 3M5MA 5HMAA 3SJ9A 1TX6A 2A5IA 1EOLA 2R2WU 3DHKH 5EXLA 1UVUH 4RT1A 1A61H 4VGCC 1UVTH 3P8NA 4IN1A 1C1WH 1NTPA 2XOKD 2I6QA 1FAXA 1MAYA 4K8BA 3VB7A 2A2QH 2M5TA 5F8ZA 1QNJA 5T6DA 2FS9A 4A6LA 3GDUA 4ISOA 1E0FD 2BD4A 1LPKB 4BOHA 2ZEBA 1GBCA 1RS0A 1P12E 1A1RA 1EASA 2VIQA 1ID5H 1D3DB 1TNHA 1C2FA 1EAUA 1J16A 1UTOA 4X8VH 2Z3DA 2ZHFH 4YOIA 1BTUA 2GTBA 3VB3A 1COWD 3Q3XA 2VGCB 1H9LB 1YPMH 2BDHA 4TT3D 3ZVAA 1D3TB 1AGJA 4CRDA 1C1TA 3HK3B 3WW7A 1ELTA 3K9XB 4I8GA 1S0RA 5AHGH 5GDSH 1GJ5H 1V2MT 1NRPH 4B2BA 1QJ7B 5FPTA 4Y71A 2OC7A 3W1EA 1ELDE 1DXPA 1O39A 1Y3WA 1Z71A 1GWAA 5DN6D 1IQJA 1IQFA 1QB6A 1GBAA 1TA2A 1W7XH 3AW0A 1OWIA 1GBLA 1P2MA 4MPUA 1HNEE 3KNXA 3ODDA 3TIUA 1P2KA 1AVXA 3GY7A 4RI0A 1CT0E 1KXCA 5DJ7A 2OC8A 2ZDVH 2GMTC 5GWZA 2ZWLH 1XM1A 1GJ6A 1EKBB 3S9BA 4WWYA 2V3HH 2DE9A 1YCPM 3SI3H 2ANWA 2B7DH 3M35A 1QBNA 3TGJE 3Q76A 2SNVA 3F3BA 4Z1MD 2WYGA 3GY2A 2VWNA 6LPRA 1AKSB 2V0BA 5C17A 4ABJA 8GCHF 3ZVFA 2FOEA 4FUHA 1XVMA 1O31A 4THNH 4OS2A 2JDID 1EZSC 1ZSKA 1QRXA 1UHBB 1GI1A 2ANMH 1K21H 3F0PA 1YPKH 5EW1H 4Q7YA 1NFUA 4K5ZA 2ZPRA 1Y3YA 3NKKA 3OYPA 4YLUA 1C1RA 2A32A 4MNYA 1G3EA 4BXSA 4R0IA 5DSFA 1AHTH 3GICB 1C2MA 1GJ9B 3VB5A 1P0SH 2BX3A 4GHTA 4X8SH 1SQRA 1C1NA 1KXBA 1YLNA 1SGCA 3SQHE 1IQHA 2YNBA 2NU2E 1NN6A 3LJJA 1TABE 3BTQE 4F55A 6GCHG 3LGTA 3TJNA 5EPNA 3RXBA 1O2WA 2BLVA 4NG9H 1XUHA 5FHTA 1CT2E 1O2QA 1TQ7B 5SGAE 1WBGB 5E2PA 1A7SA 4WXVA 1TONA 4SGBE 1HJAC 4FOUC 1O2ZA 1F0TA 1TNKA 1LVOA 1WAYB 3ZZDA 2BDBA 3UNSA 1P06A 3FP6E 2JJ1D 1MCVA 1GBBA 2WPJS 4NFEA 1MH0A 8LPRA 1CHOF 3SU5A 1BRCE 1SHYA 1EPTB 5TJXA 2PKSB 1RJXB 4BAHB 1EB1H 1MTUA 2BLQA 1IQIA 1FMGA 1TNJA 8ESTE 1OX1A 1Q2WA 1C9PA 3A88A 1GHBG 3CENA 3F2FA 1AUTC 4MNVA 2HRVA 2IJOB 3DSGA 4ABEA 1GJ7B 3BEIB 1G2LA 1MQ6A 3MH7A 1MKWK 1CVWH 3BTWE 4MPXA 3ZVCA 2Z7FE 1DFPA 1TMBH 1FZZA 2F9OA 2ZFRH 1DSTA 1K1MA 3GY5A 1O3JA 3P17H 1SLWB 4R8TB 3ZV9A 4AGKA 1TNLA 3K6ZA 2KAIA 1CGJE 1MTNB 3P8FA 1OOKB 3BTGE 4Z6AH 4ABFA 3V3MA 5E0HA 4MVNA 1DLEA 2KCAA 4XBBA 3VXFH 4Y10E 3A81A 3M3VA 1AVWA 1O2TA 2FO9A 3BG4C 4RN6A 1UVPA 2KCYA 1V3XA 4Y7AA 4NSVA 2W26A 1S83A 3PWBA 1A3EH 2FX6A 2VH6A 3A84A 4TPIZ 5BPEA 4AFQA 3MU5A 2VU8E 3A80A 4CRBA 2QAAA 4ZKSU 1K22H 1O3IA 1VCPA 5E8EH 3MI4A 3FO8D 1KLIH 4NCYA 4FXGH 1DWCH 1AI8H 2ULLA 2PTCE 1HIAA 2OBOA 2ZGHA 5A8ZA 2H9EH 5JB9S 3F68H 1O3CA 2P94A 5EPYA 2FOGA 2JH6D 2ZGJA 5E2OA 1YKTA 1PPBH 1BJVA 4FU9A 1MTWA 5EIYA 2Y5FA 3BTTE 2QA9E 3M7QA 1FN6A 4CRGA 3CS0A 3EE0B 3UTUH 3GOVB 2GVFA 1SB1H 2W7SA 5GPIB 5EQSA 1QTFA 3UNRA 4XOJA 1MU8B 4H6SB 5E0JA 2OC0A 1GI8B 1D6WA 1ABIH 2ZCLP 4ISLA 2TBSA 3A82A 1GJAB 1MTVA 5CMXH 4P00A 3SV9A 2FLBH 3LC3A 3SUGA 1BB0B 1G37A 4B74A 3S69A 3FOAA 3OEED 1OKXA 1VITF 3M37A 3MU4A 1E35B 3RXKA 1HXFH 2H1UA 1V2RT 2AMQA 4B75A 1BTZA 1TWXB 2J5UA 2WUCA 4GCHG 1NU9A 4BTTB 2ANKH 1YP9A 1ZLRA 1H1BA 1TE0A 4CR5A 2B8OH 1W3CA 1O3LA 1YPLH 1F2SE 3KN2A 3L3TA 3IITA 1SQOA 5JPMH 3FZZA 1KLJH 1FIZA 1C2GA 2QIQA 2SGEE 5JBTA 3BG8A 1W8BH 3QTOH 4K3JA 1GI2A 3BIVH 1ELVA 1G3CA 1QURH 2HGTH 3OY5U 1W7GH 3VG8A 2DE8A 3NZIA 3FKSD 1C2EA 4BAOB 4ZMAH 1GGDB 3M5OA 4NFFA 1ACBE 4WVPE 5C0UA 2Q6DA 4JMYA 3MTYA 3NWUA 1O37A 4F4OC 2GMTB 2CN0H 4AGJA 3TK5A 2FTMA 1LHEH 1CBWB 2K8IA 1Y5AT 2ZFTA 4TPYA 2AHME 3QO6A 3QDZB 3I78A 1C5WB 1O30A 2PWXA 4RKJB 1PQAA 2BY8X 1FY3A 4HI3A 2BY5X 2ZCKP 4ESTE 1ZHMA 2C4FH 3SQEE 3O8CA 1S81A 2J94A 3SJKA 4Q2KA 2XBVA 2WPHS 1SGTA 2BY9X 1F7ZA 1SVPA 2JJ2D 4YOJA 2BY6X 3K2UA 3MO3A 9ESTA 1SGQE 2ZDKA 2ZA5A 4ZUHA 1D4PB 1W0KD 1O2JA 2O8WA 1DT2A 1L4ZA 2VGCC 2EY4C 1LKBA 3N7DA 2BB4A 2Y7XA 1O2OA 4ASHA 4TWWA 2ZNKH 3F2HA 3GYMA 1XXDA 2F91A 1H9IE 2C90B 3MHWU 5LPFA 1K1IA 4Y79A 1ETTH 1SSXA 1HAXB 1QQUA 2PKAA 1OWJA 1L4DA 2CV3A 3MH4A 1O2IA 3P95A 3PMHB 4M9FA 3SORA 5JBBS 4DY7B 3BV9B 1EATA 4ZH8A 1ZPCA 2A4RA 1KDQB 4BAMB 2GP9B 1CGIE 3A85A 3QZQA 1JBUH 3ZZ4A 1P57B 4X1QU 2FXRA 1LPZB 2ANYA 5A0CA 1ZHRA 1GI7B 1TGBA 3TH3H 4BTIB 5DKMA 2F83A 4AC9A 2HOBA 2ZC9H 2BMGB 1YY3A 1QRZA 4D9RA 1TX7A 1EOJA 2Q1JA 1YGCH 1ARBA 3T2NA 1KIGH 3A7WA 1NC6A 3SU1A 4Y6DA 1WCZA 2WV5A 1BHXF 2XC5A 1AD8H 5C1UA 1OXGA 2BDCA 3TGIE 3JZ2B 3SV8A 2F9UA 1JIMA 1SGRE 3ZVBA 4WMDA 2VIPA 2NU4E 2XC4A 1NFWA 4TY7A 4CH8B 3ENSB 2Z94A 2ZU2A 5L30H 4IW4E 1W13U 1LHFH 1TRYA 7GCHG 1E34B 4MNWA 4DIHH 1KY9A 1O2RA 4ZHMU 3VEQB 5C67A 5F6MA 1HAHH 1O2PA 4MQAA 5DP3A 5K0HA 1C5NH 3QX5H 4ZHAA 3F2GA 1K28D 2ZPSA 1AUJA 3ESTA 2ZHDA 3RXLA 1O0DH 3TGKE 1CO7E 2LELA 5HM2A 3TK6A 1GHYH 4X6PA 3GDSA 4XSKU 5DP7A 3AVZA 1LQDB 2HWLB 4ABHA 5EOKA 4MNXA 1Z6JH 3BG4B 3PWCA 1O3FA 3T29A 1EXFA 4WF8A 1WQVH 4OS6A 1EB2A 2FOBA 5DP4A 1H9HE 3HKIB 3UQOA 1PPZA 4FUIA 2H5DA 4IS5A 1T8MA 2JKHA 4O3UA 4D8NA 3E6PH 2AYWA 3UREA 1INCA 1UJ1A 2SGDE 2VIVA 3RM2H 4FUDA 2GT7A 1GJ8B 1WDIA 3M3TA 1C2HA 4MG3A 4X6OA 1H8IH 1OP2A 1BMNH 2OUAA 2V6NA 4FUFA 1F5RA 2BX4A 2A5AA 3O8RA 4HZHA 1P3EA 3L6PA 2Y7ZA 4WMEA 1BTHH 1C1MA 2G81E 4XDEA 1NY22 4UFGH 2R2MB 1O2XA 2FOMB 4NIVA 1W11U 4ZHLU 2ZHEH 1ZSLA 2H6MA 3E3TA 1BZXE 2FM2A 4ABAA 4O03A 3RMLH 4FUJA 3AAVA 3SHAH 1D6RA 1C1OA 4B2CA 1NO9H 2VIWA 5LGOA 2IPQX 1Z8GA 1TMUH 2H9TH 1UVSH 4LZ4B 4Y0ZE 1FNIA 3PMBB 3HK6B 4YT6H 4B2AA 2FODA 1E38B 4O3TA 4E05H 4NZLA 3A7VA 1GDNA 2W3IA 4A7IB 3BTDE 1J15A 1JMOH 1CHGA 2J92A 2YMSC 4WY3A 1OHHD 3PROA 1FY8E 4JZFH 1TMTH 4UD9H 1TAWA 1QHRB 2JETB 1B0EA 1LHCH 2AGGX 4MPVA 2GCTC 2ODPA 1GBTA 1WOFA 1YF4A 3P70B 1TGTA 3BN9A 1MTSA 3SGAE 1SHHB 5E0GA 2JH5D 2KFWA 2GJGA 4NWKA 2GX4A 5KECA 3KYFA 3DA9B 1HFDA 4JYUH 2A2XH 2XRCA 1LQEA 1HDTH 7LPRA 1SGFG 2F9PA 5IDKA 3SU6A 1SOTA 1MBMA 5ESBA 1JRSA 3SV2H 1EX3A 2J98A 1NU7B 2HNTE 3EA9A 2BD7A 1FY4A 1XUKA 3DFJA 1AVGH 2A4QA 2UWLA 2UUYA 2J9NA 1XXFA 4RSPA 3U8RH 2RDLA 1GPZA 2XBXA 5A8YA 2DUCA 2WPIS 4Y8ZA 2PV9B 1ANEA 5DK1A 4IBLH 4IC5A 1SPJA 3MFJA 2BVRH 4CREA 1O5FH 1XMNB 3V0XA 3F1SB 5T1VA 2I6SA 1SKYE 2ZIQH 4B6FA 4I8JA 1C5MD 2UUKB 4D7FA 4U01A 1T32A 1O2LA 3RXSA 2GDEH 2VVVA 3D23A 2ZTYA 3ATWA 4DURA 2Y6TA 1TGSZ 1AZ8A 3RXIA 1EAIA 1CGHA 2OP9A 1OWHA 1ANBA 5EXMA 3KGPA 3OTPA 3SJ8A 1WSSH 3HPTB 1L2EA 2VWMA 3RU4D 1Y8TA 3T5FH 2RFKC 1TPAE 3VGCB 1NRQH 3FN8A 1GGDC 1GJ4H 3VFEA 1P2OA 3GCTG 2HALA 1IHSH 2OK5A 1P3CA 1VKYA 3VXEH 2W6ID 5DG6A 3TNSA 4SGAE 1Z1JA 4UDWH 1TOMH 1O3MA 3CP7A 1LVYA 2D1JA 1JOUB 3T26A 4M7GA 1CBWC 1GHZA 3TLOA 1FUJA 1TBZH 2NU1E 5F8TA 2KCPA 4K60A 3RXHA 4AZ2B 1OP8A 1F5KU 1TPPA 2F4LA 2GKVE 4Y8XA 3M7TA 1MMJN 4XFQA 3GCHC 1C5QA 1KMHB 3UOPA 4DJZB 1S6LA 1P8VC 4ZKOU 1C4Y2 1K1LA 1BIOA 2SNWA 2A1DB 2HPQH 2CJIA 3IG6B 2Y80A 1G32B 1YM0A 3A83A 4A5TS 1A4WH 4NIWA 5HIZA 2ZQ2A 2VIDA 3UNQA 4Y76A 2F9NA 2PP6A 1GI0A 1L1NA 1EAXA 3F9FA 2ILNA 1LKAA 4JK6A 1N8OC 4K1SA 2ZTZA 2AMDA 5HKKD 2XWBI 2FOCA 2HVXA 2KZ4A 1MZDA 1RTFB 4B76A 1WUNH 1BJUA 2G52A 2THFB 8KME2 3D62A 5A8XA 2PHBA 2R0LA 2CXVA 1A5HA 2GT8A 4INLA 4ZKNU 1DWDH 2OXSA 1NBMD 1A3BH 1P04A 2TPIZ 4GCHF 1ZTKA 1VJAU 2ALVA 2C8XB 1PPHE 2QXHA 2VJ1A 1IQNA 5DP5A 4H6TA 3RXVA 3LGWA 5LPEA 1ZJDA 1BBRH 3QZRA 3Q00A 3GCNA 4WH6A 1PQ7A 3LDXH 3OFND 4CHAC 3BEUA 2BDAA 2H9HA 4X6MA 1FDPA 2AGEX 2ZPQA 1A2CH 5FBIA 1C1SA 1V2QT 4YOGA 1LHGH 1BBRE 1BDAA 2PLXA 1P09A 1GHXH 1KXDA 3W95A 5CHAB 1THPB 1HXEH 1SBWA 2XNIA 4ABGA 5C94A 2FOAA 3PTNA 1Z7KA 1G30B 4A1VA 2HVYB 1V2ST 2XBWA 2A0QB 2Y5HA 5JBCS 1MQ5A 1EUFA 4CBOA 3V13A 2GV6A 2XBYA 2W7UA 1THSH 4JZIA 1SFQB 3GY6A 1ELCA 1QL8A 2EA3A 1KYNA 1F5LA 1O3EA 2FYQA 3MWIU 2AIPA 1HPGA 3UR6A 3QTVH 4YXWD 2FIRH 1C4U2 5AFZH 3UUZA 1TRNA 2QF0A 2D26C 3U69H 4B71A 5FCRA 3WWBA 2OLGA 3RMMH 1X7AC 1C1VH 1AIXH 4WXIA 1HUTH 2J38A 2GCHF 4X0WU 2Y5GA 4I33A 1ZMNA 2BD9A 2VWLA 4AOQA 1IQKA 4K1EA 4KGAA 1ZPZA 1K1NA 1U6QA 1RRKA 1S84A 1E1QD 3G01A 1EJMA 2Z9IA 2RA0A 2RA3A 4K2YA 2ZFSA 3RXTA 1SLXB 3CNRA 1GL1A 4FUEA 3DSOA 1D3PB 1PPEE 2OD3B 1A0JA 1SFIA 2KCOA 1V2OT 3U98H 3KQ5A 4YLQH 5FPYA 3UWJH 1HBTH 2BZ6H 3A7XA 3ZZ3A 3LGIA 1V6DA 1A46H 1QR3E 4DT4A 2YMSB 3SGBE 4I8LA 5EQQA 1UTQA 1T31A 1GBFA 1XVOA 2KR7A 3HKJB 1UK3A 4DOQA 1T4UH 1BMMH 3N7EA 2GCTB 1C2LA 2HNTC 2OTVA 4JYVH 2C93B 2A7JA 4H42U 2V3OH 4I8KA 1C2JA 1RFNA 2HLCA 1TOCB 2EC9H 4DT7B 2PKAB 1W0ZU 2P3UB 1YPEH 1XX9A 1ZSJA 2F9VA 1G2MA 2QXIA 5HYOA 4A1XA 4AG2A 3F9EA 2UUFB 2NWNA 2BVXH 2QF4A 1WTHD 1NROH 1SL3A 5CHBA 3UAIC 3RC5A 2B0FA 2FI4E 3E1XB 4FVBA 1MD8A 4TSFD 1C5PA 2A4OA 3SV6A 4O9VA 4X1NU 1BTXA 1XUFA 3SUFA 2XC0A 5EGMA 3RXEA 5FL7D 1WYKA 3OTJE 3OX7U 1LVBA 1O3DA 1HAOH 3ZZAA 4ISIH 3QUMP 7GCHF 1FJSA 2ZDNA 8GCHG 3U1JB 2OBQA 1UMAH 3MU1A 1BMAA 5T3HA 1CT4E 5CDFE 3ZYDA 5FX5A 1TX8A 3A7TA 4ZXXH 3RXPA 1DICA 2QC2A 2PSXA 2FTLE 1HAGE 2QV1A 3NCLA 1GMHG 1J14A 2JETC 1IQEA 2R0KA 1EZUC 4IMQA 1K1OA 1RTKA 1O2HA 1E79D 1Q3XA 3KYGA 2CF8H 1BRBE 4DIIH 1JIRA 1QA7A 1S0QA 4I86A 3T27A 2D8WA 2CF9H 2LPRA 3F9GA 4HFPB 3Q77A 3GY4A 3DCLA 2BD3A 3SNAA 1N6YA 1YWUA 1SGDE 2O9QA 1GBJA 4AFUA 3MQKC 1JWTA 3GYLB 5DPAA 4Z0KA 3ITIA 3S7KB 2ZF0H 4CRFA 4GPGA 1YCPH 3UWIA 3RXOA 2GGVB 1P05A 5FBEA 5DGJA 5T6GA 1SQAA 5EXNA 2FPZA 1EPTA 4J2YB 2Z9LA 2O8LA 5HXFA 4YM9A 5DO4H 1HAIH 1TNGA 1RTLA 4RKOB 2SGQE 3ZYEA 4AFSA 1VITH 3GDVA 6ESTA 1GBIA 4X1PU 3UOUA 3GCHB 1FY5A 2ZGBH 1CHOG 3RC4A 5GJ4B 1T8OA 2TGDA 5KEDA 1O5AB 1S5SA 2TGTA 3NPSA 1D9IA 1CQQA 2M2AA 2Z6BD 3M5NA 4F49A 1TBQH 1XKBC 1K1JA 4CR9A 1FI8A 1YPJH 2B5TB 2HLDD 1XUJA 1AU8A 2FDAA 5FXLA 3EYDA 3LT3A 3PV4A 1GMCG 1O38A 2EI7A 4MLFB 1FLEE 4FUCA 1N8OB 1ZRKA 3BSQA 1BCUH 1O5EH 1T7CA 3KCGH 1Y5BT 2BQWB 2VB0A 2P8OC 3SHCH 2QGRA 4TYDA 1V2VT 2ZFPH 2CMYA 3HATH 3SU0A 1DM4B 1ZHPA 4YO9A 1NZQH 1OPHB 3VGCC 1BHXB 2J97A 1C5ZB 1QRWA 2ZDMA 1P2QA 3MNXA 4K1TA 1ZJKA 1ANDA 3NRLA 1O2NA 2ZHWH 3DUXH 4CHAB 1GHAF 3SNCA 1GMDF 4Y0YE 3SGQE 3D49H 2F9BH 1OYTH 2ZZUH 3TH2H 2FX4A 2G5NA 3RU4T 3TU7H 3RU4E 2VVUA 3U8OH 4AORA 1FQ3A 5GXPA 1NS3A 3H5CB 2PR3A 1DE7H 1UCYH 1V2UT 4I31A 3S9CA 3UPEA 2XNDD 2A7CA 1ZMLA 1H8ED 2ZU4A 4PROA 3RM0H 3TVJB 4GVUA 2WHXA 1QBVH 1UCYE 5JB8S 3Q3YA 5TCCA 3K65B 1Y3VA 1GHVH 1B0FA 5JYIA 1OSSA 2Z3CA 1EJAA 3M36A 4U30A 3MOCA 1F0SA 4UE7H 5F03A 2ZCHP 2Z3EA 1FN8A 3NK8A 4OS1A 5AVDA 2Y81A 4UFDH 1AWFH 3A8BA 1O2VA 3OAAD 3M5LA 3RXAA 3RLWH 1YYY1 4HG6A 1PPFE 4ZROA 1MD7A 4MDSA 2F3CE 4A92A 5JDUB 3LGYA 1V2LT 2GDDA 2F43B 3D65E 1KSNA 3M7UA 4Q63A 1ZMJA 4A1TA 1C5SA 5AF9H 3KHVA 1TRMA 1DANH 2OQUA 5IYTA 4BAQB 1RGQA 1UW7A 4JZDH 4TY6A 2ZECA 1AFQC 3PM3A 2XXLA 4FETA 2WPDD 2GV7A 4IN2A 1NT1A 5CHAC 2BVSH 1AWHB 3A8AA 5K7RA 2Z9KA 1GJBB 2FWWA 3BTME 2WPMS 3WWFA 5EJZA 4FU7A 1AFEH 1SLUB 4NZQA 1OWEA 3VB4A 1L1GA 3GCTF 1CA8B 1DWBH 3E0PB 1KXEA 2BDIA 3MYWA 3DD2H 3UB0A 3DT0H 4OS7A 2EEKA 4TWYA 2PGBB 4CH2B 2A31A 3TK9A 5A0BA 2IPHA 2AERH 1OP0A 1ZZZA 1C2IA 1B5GH 1QCPA 1O35A 1S82A 1QB9A 2GZ8A 1ARCA 1O32A 1LDTT 1ESTA 5EQRA 1HYLA 2IOTA 2BM2A 1LCYA 1QIXB 3NXPA 1DY9A 4JZ1A 4OGYA 3SOSA 1GI9B 2R3UA 1J17T 4KTUA 1N1LA 2IN2A 1KLTA 2Q6GA 3SU4A 1GDUA 4JCNA 1IOEA 2G4TA 1F0UA 1SGIB 4X8UH 1P2JA 2PSYA 1VGCC 2C3SA 2P3TB 3MH5A 4YZUA 4HGCA 1HGTH 1ZOMA 3PMJA 1GG6C 1LVMA 3SI4H 4BAKB 1TB6H 1ORFA 2FLRH 1BRAA 1GI3A 4D9QA 1G3DA 5C0TA 4AYYB 3RXQA 2STAE 4CBNA 1DS2E 1ETRH 1W2KH 3TH4H 2K1QA 3KQBA 1MKXH 2C8WB 4YT7H 1FONA 2QE7D 2CK3D 1QB1A 3SJOA 4DG4A 2FI5E 6GCHF 1SLVB 2BHGA 1N6XA 3MNBA 5PTPA 4XRNA 1PQ5A 3I29A 5GNDA 2O8MA 2GZ9A 2FZZA 4LZ1H 2KM0A 4Y11E 1ZTLA 1QJ6B 2ZU1A 5FX6A 3P8OA 6CHAC 3AW1A 1SOZA 1GBKA 2P3FH 2TGAA 3FANA 5F53A 4BXWA 1GBDA 1OS8A 1DLKB 2YMSD 4ZCNA 5KGOA 1GCDA 4Q7XA 1ELGA 2TIOA 3V12A 4LXBH 1UO6A 3TJVA 1W12U 1K9OE 1C1UH 1KTTB 4ZKRU 2AS9A 3SU2A 2O8TA 4ASUD 1O2YA 2QF3A 1CA0B 4Q80A 3M61U 1Z6EA 2AH4X 1SGPE 1DOJA 1UK4A 2AMPA 1C5VA 2EI6A 4AYVB 1LHDH 1FPHH 1GHBF 1DDJA 2BD8A 2AFQB 3RLYH 2GD4B 1P2IA 3O8DA 1HAVA 2OC1A 4RT0A 2XW9A 4FUGA 3F9HA 1UTPA 1W0JD 1YLDA 3LC5A 2BLOA 4WMFA 1MBQA 1O5BB 2FOHA 4XBCA 4E06H 2J2UA 1E37B 4I8HA 2P93A 3PV2A 1GL0E 2V35A 1Y5UT 1TFXA 1MZAA 1Y3XA 1GDQA 1FY1A 2G51A 1PJPA 1P9UA 1KXFA 5A09A 2BDGA 1P03A 2P8OB 1FIWA 2G00A 3URCA 1O2GH 1UTJA 4IGDA 1DY8A 4X1SU 3KQDA 1V2KT 3LH1A 1SGYE 1QBOA 1K2I1 2XWAA 1MUEB 4KP0A 2BDYA 2KAIB 3MNSA 1BBRK 1L0ZA 4XE4A 1PPCE 1J9CH 5L2ZH 1GBMA 1ELEE 3EQ0H 4NA7A 4DW2U 1GBHA 4BNRA 1DXWA 3O8BA 2EI8A 3PLBA 3F0OA 1DSUA 1YPHE 5ETXA 3ATIA 1BQYA 1OWKA 3PV5A 1AQ7A 1YBWA 2QCYA 3SUEA 5AFYH 1AMHA 3PO1C 4AX9H 1RXPA 4IC6A 1A0LA 1TALA 2V3MA 4E7RG 2AGIX 3RXUA 4NWLA 1O5GH 1DUEA 1IAUA 4AB9A 2IJD1 2CGAA 3PLPA 2FEQH 5EG4A 4FU8A 1HIAB 2W3KA 4U2WA 1GVLA 4UFFH 1O3OA 5EJLA 2XYAA 1AN1E 3B8JA 1FXYA 1GBEA 5BRRE 1ETSH 2C8ZB 1PPGE 3KL6A 4OS5A 4MTBA 3H7OA 1HRTH 2CHAB 2V7QD 3T25A 3N99A 1W14U 4H4FA 5EU8A 1C5XB 1PYTC 4IMZA 5G4BA 2G8TA 2FMJA 1AB9B 5FCKA 1V2NT 1BTPA 4ISHH 1GMHF 3I77A 2K0QA 3MMGA 2STBE 2J34A 1A5GH 3F6UH 4KTSA 2P59A 5GCHG 3U1IB 1AFQB 1V2WT 3P92A 1JXPA 1AY6H 1BUIA 3SNEA 3U28C 2W5EA 4X8TH 4OGXA 4JZEH 1TLDA 1GI5A 2XCFA 3ELAH 4AB8A 2BXUH 2LNCA 4BANB 3A89A 1PYTD 4D7GA 1P11E 5LPRA 3A87A 1UTKA 1TPSA 4CRCA 1O2SA 4D76A 1MABB 1EP5A 2G5VA 4AG1A 1G9IE 1ANCA 7ESTE 2FP7B 5JBAS 3SYJA 2SFAA 2FI3E 2ZG0H 1O5DH 1VZQH 2JH0D 3ZZBA 1F92A 3RXJA 2J4IA 1T8NA 3ATKA 1QQ4A 1G3BA 2UWPA 4GSOA 5C5OA 1GCTB 2ALPA 1C4V2 2L74A 3EDXB 5IK2D 4UFEH 5J4QA 1FX0B 4K8YA 3BIUH 3MH6A 1DITH 1HB0B 1JRTA 3ATLA 1BMLA 3QWCH 2OCVB 3LJOA 1Y59T 4KELA 3LONA 2H2ZA 2BXTH 2ZKSA 1ZYOA 5EW2H 3KIDU 2RCEA 1BTWA 3GY3A 3MNCA 5CE1A 2NU0E 2G55A 4ISNA 4AN7A 4X2VA 1NRSH 1IQMA 3TPIZ 2OQ5A 1VGCB 3A8CA 1GMCF 2ZDLA 3HGPA 2BD2A 5I46H 5EJ1A 5GIBA 1SMFE 3C27B 5T6FA 1GG6B 1H8DH 1O3BA 1O2UA 1Z1IA 3PTBA 2ASUB 4KTCA 4UEHH 1P10A 2R3YA 1GVZA 3TJUA 1GVKB 2AEIH 1S85A 1TQ0B 1O3PB 1EJNA 1C5RA 2SGFE 2P16A 1VCQA 3RMOH 4INKA 1EZQA 1Q31A 1RIWB 3URDA 1RD3B 3FP8E 4ABIA 3M3SA 1YC0A 2YOLA 5HIYA 3ZZCA 1BA8B 3FZDA 2C8YB 5A0AE 4WJG2 1C2KA 1HJ8A 1YLCA 4DVAU 3Q3KA 2P95A 1QGFA 4K69A 3QGJA 3ZV8A 4XBDA 1O34A 3UR9A 1EFRD 3BTFE 1GJCB 2BQ7B 2SGAA 3AK5A 1GHWH 3RXCA 6CHAB 2VNTA 1GI6A 1WTGH 2A45B 1AKSA 1SG8B 2WPKS 3QN7A 2LP6A 3RXRA 4ACAA 1IQGA 1YCPK 2BYAX 1EQ9A 3P6ZB 4E7NA 4CRAA 1QL7A 1UHBA 4NA9H 3EA8A 5FPSA 4LK4A 3AAUA 4BTUB 1S6HA 3PRDA 4OS4A 3UY9A 2SGPE 1MAXA 1SQTA 5C1XA 1NRRH 1EAWA 1UK2A 5L2YH 1A5IA 1MKWH 5B6LA 1EP6A 1WU1A 1G36A 1P9SA 4F48B 4X2XA 2PW8H 3LKWA 1Z8IB 2ZU3A 3EE7A 1C1PA 2BOKA 4LOYH 3UIRA 2D2DA 2ZFQH 1DPOA 2TGPZ 4VGCB 5DP8A 3DFLA 2R9PA 1XUIA 1NFYA 3FAOA 3PMAB 2TRMA 3E91A 4WH8A 3QLPH 3STIA 4DGJA 2B9LA 1DX5M 3FP7E 4B6EA 3VB6A 4Q4LA 1ELBA 1YPHC 1J8AA 3B23B 2G4UA 1ELAA 1UTMA 3LU9B 3RUOA 1O36A 4JK5A 1ZTJA 2WSSD 2ZP0H 3HGNA 3H7TA 1O2KA 1HAZB 3BTHE 3KQEA 1HCGA 3SN8A 1C5TA 3FFGA 4INHA 2ODYB 3N7OA 3H09A 2ZI2H 1BMFD 1K0HA 1CA0C 3DSPA 2KX4A 1E36B 4JYTA 2PGQB 1AZZA 1ABJH 2PUQH 3GISB 3RC6A 3T62A 1O5CB 3BF6H 1TNIA 2O8UA 1MU6B 1SC8U 3OE7D 4O97A 3UQVA 2VIOA 3ZIAD 3MU0A 3PO1B 5F8XA 1UCYK 5C20A 3RDZA 4GUXA 1IQLA 2BOHB 2AIQA 1DWEH 2UUJB 3R3GB 2A5KA 1ZRBA 4KKDA 1ESAA 3RXGA 2YNAA 5DP9A 3RXFA 1UTNA 2ZGXH 2W6JD 2WPLS 1VCWA 3S9AA 5ABWA 4I32A 3K6YA 2ZFFH 1T4VH 1TIOA 1FV9A 3PRBA 3SBKA 1M9UA 3RMNH 1B7XB 3LOXA 3ZVDA 2GCHG 1LO6A 2QN5T 1CSOE 5HM9A 3U9AH 3V7TA 1D3QB 3RXDA 2ESTE 1QL9A 1C1QA 3FVFB 1WQSA 1TYNA 2J95A 4ZXYH 3SNBA 4YESB 1QJ1B 5ESTE 3KEEA 5TCAA 1SR5C
chains in the Genus database with same CATH topology
4J1YA 4B1TA 3B9FH 1GJDB 2Z9JA 3A7ZA 1BOQA 3EGKH 3ZVGA 3ZZ9A 5J4SA 3AASA 2QY0B 1AO5A 1FAKH 2RG3A 2ZQ1A 3PYHA 7KMEH 1V2JT 1ZPBA 1S6FA 2A4GA 3RP2A 3C1KA 1F0RA 1TGCA 2ODQA 1QY6A 3SO3A 1THRH 1L1JA 4X2YA 1O3NA 3BEFB 3MO6A 1YPGH 3E90B 2WYJA 3MO9A 1SI5H 1NESE 3BTEE 3S7HB 3QK1A 4I7YH 3LIWA 1HV7A 4HTCH 1ZR0A 1C5UA 1K1PA 2OINA 4FVDA 2BY7X 1HLTH 3T28A 4X1RU 1HJAB 3OY6U 2A7HA 4B73A 3IWMA 3OSYA 4Y7BA 2PTNA 3EA7A 4YTAA 1AE5A 1KXAA 1C5YB 9LPRA 4DCDA 2CHAC 5H4IB 3R0FA 3S0NA 5C2ZA 2FESH 2QXGA 4NGAH 2BQ6B 3SU3A 2PFEA 1AB9C 1WV7H 3LGVA 3SJIA 5EODA 1XKAC 1Z8JB 3PLKA 3JZ1B 1P2NA 1V2PT 2Y82A 1O3KA 3GCOA 1TA6A 2H5CA 3OU0A 5C5NA 1HAVB 2XTTB 1LMWB 3KQCA 5LH8A 1HAYB 1VITG 3SUDA 3KF2A 3WY8A 3LH3A 1A0HB 1W0YH 3RXMA 3STJA 1ZGIA 3BTKE 3SW2B 3TNTA 2Z9GA 3ODFA 1MCTA 1GI4A 1ELFA 2FS8A 1P01A 1EZXC 1MKXK 2VWOA 3E8LA 3L33A 2WUBA 2BZAA 3ZZ7A 3SNDA 5C3NA 1XUGA 1C5LH 3UFAA 3TITA 1ESBA 3ATMA 1QFKH 2ZGCA 3TJOA 2BLWA 1GCTC 2VH0A 1DVAH 1V2TT 3LPRA 4U32A 3SZNA 1NPMA 4FUBA 1O3HA 1PFXC 1DUAA 4NIYA 4ABDA 4NSYA 1OWDA 4Y8YA 1W10U 4X2WA 1EPTC 4UONA 2PKSC 2ZHQH 4QT8C 1TGNA 5FAHA 2UWOA 4X6NA 1QA0A 3PB1E 4NA8A 1HJ9A 5A2MH 1TPOA 2PUXB 2GZ7A 3CS7A 1SGFA 4NIXA 5C1YA 1C9TA 3GY8A 2XCNA 1O2MA 3ZZ8A 3A86A 1O3AA 1NM6A 1O3GA 3LGUA 1NFXA 4AFZA 3U8TH 2HPPH 2FOFA 5L6NH 2ZTXA 3QGNB 2BD5A 5DP6A 2HNTF 2VINA 2WINI 1LPGB 3ZZ6A 3A8DA 4ZAEA 3W94A 4ABBA 3EAJA 1RIWC 2VVCA 2BTCE 1KDQA 1ZGVA 1MTNC 1VR1H 1LTOA 2ZU5A 1AE8H 5B6OA 5GCHF 1KTSB 1SGEE 1C5OH 1SGNE 1VJ9U 4GHQA 4GLYA 2ZDAH 1BT7A 4MPWA 1OYQA 5HGGA 2Q6FA 4Q7ZA 2FYRA 3E0NB 1UVOA 1O33A 3VPKA 1CE5A 3A7YA 2QYIA 1HAPH 3SV7A 4GAWA 1NRNH 1PQ8A 1GHAG 1GMDG 1CU1A 1FPCH 2QXJA 1UTLM 3ZVEA 3P8GA 3ZZ5A 1P02A 2WV4A 1TBRH 2ZO3H 5I25A 1IHTH 3MU8A 1H4WA 1T8LA 3E16B 1Z8RA 1Y3UA 1BTYA 2NU3E 1BRUP 3NUMA 1C2DA 1BITA 3M5MA 5HMAA 3SJ9A 1TX6A 2A5IA 1EOLA 2R2WU 3DHKH 5EXLA 1UVUH 1A61H 4VGCC 1UVTH 3P8NA 4IN1A 1C1WH 1NTPA 2I6QA 1FAXA 1MAYA 4K8BA 3VB7A 2A2QH 2M5TA 5F8ZA 1QNJA 5T6DA 2FS9A 4A6LA 3GDUA 4ISOA 1E0FD 2BD4A 1LPKB 4BOHA 2ZEBA 1GBCA 1RS0A 1P12E 1A1RA 1EASA 2VIQA 1ID5H 1D3DB 1TNHA 1C2FA 1EAUA 1J16A 1UTOA 4X8VH 2Z3DA 2ZHFH 4YOIA 1BTUA 2GTBA 3VB3A 3Q3XA 2VGCB 1H9LB 1YPMH 2BDHA 3ZVAA 1D3TB 1AGJA 4CRDA 1C1TA 3HK3B 1ELTA 3K9XB 4I8GA 1S0RA 5AHGH 5GDSH 1GJ5H 1V2MT 1NRPH 4B2BA 1QJ7B 5FPTA 4Y71A 2OC7A 1ELDE 1DXPA 1O39A 1Y3WA 1Z71A 1GWAA 1IQJA 1IQFA 1QB6A 1GBAA 1TA2A 1W7XH 3AW0A 1OWIA 1GBLA 1P2MA 4MPUA 1HNEE 3KNXA 3ODDA 3TIUA 1P2KA 1AVXA 3GY7A 5DJ7A 1CT0E 1KXCA 2OC8A 2ZDVH 2GMTC 5GWZA 2ZWLH 1XM1A 1GJ6A 1EKBB 3S9BA 4WWYA 2V3HH 2DE9A 1YCPM 3SI3H 2ANWA 2B7DH 3M35A 1QBNA 3TGJE 3Q76A 2SNVA 2WYGA 3GY2A 2VWNA 6LPRA 1AKSB 2V0BA 4ABJA 8GCHF 3ZVFA 2FOEA 4FUHA 1XVMA 1O31A 4THNH 4OS2A 1EZSC 1ZSKA 1QRXA 1UHBB 1GI1A 2ANMH 1K21H 1YPKH 5EW1H 4Q7YA 1NFUA 4K5ZA 2ZPRA 1Y3YA 3NKKA 3OYPA 4YLUA 1C1RA 2A32A 4MNYA 1G3EA 4BXSA 4R0IA 1AHTH 3GICB 1C2MA 1GJ9B 3VB5A 1P0SH 2BX3A 4GHTA 4X8SH 1C1NA 1KXBA 1SGCA 3SQHE 1IQHA 2YNBA 2NU2E 1NN6A 3LJJA 1TABE 3BTQE 6GCHG 3LGTA 3TJNA 5EPNA 3RXBA 1O2WA 2BLVA 4NG9H 1XUHA 5FHTA 1CT2E 1O2QA 1TQ7B 5SGAE 1WBGB 5E2PA 1A7SA 4WXVA 1TONA 4SGBE 1HJAC 1O2ZA 1F0TA 1TNKA 1LVOA 1WAYB 3ZZDA 2BDBA 3UNSA 1P06A 3FP6E 1MCVA 1GBBA 2WPJS 4NFEA 1MH0A 8LPRA 1CHOF 3SU5A 1BRCE 1SHYA 1EPTB 5TJXA 2PKSB 1RJXB 4BAHB 1EB1H 1MTUA 2BLQA 1IQIA 1FMGA 1TNJA 8ESTE 1OX1A 1Q2WA 1C9PA 3A88A 1GHBG 3CENA 1AUTC 4MNVA 2HRVA 2IJOB 4ABEA 1GJ7B 3BEIB 1G2LA 1MQ6A 3MH7A 1MKWK 1CVWH 3BTWE 4MPXA 3ZVCA 2Z7FE 1DFPA 1TMBH 1FZZA 2F9OA 2ZFRH 1DSTA 1K1MA 3GY5A 1O3JA 3P17H 1SLWB 4R8TB 3ZV9A 4AGKA 1TNLA 3K6ZA 2KAIA 1CGJE 1MTNB 3P8FA 1OOKB 3BTGE 4Z6AH 4ABFA 3V3MA 5E0HA 4MVNA 1DLEA 4XBBA 3VXFH 4Y10E 3A81A 3M3VA 1AVWA 1O2TA 2FO9A 3BG4C 4RN6A 1UVPA 4Y7AA 1V3XA 4NSVA 2W26A 1S83A 3PWBA 1A3EH 2FX6A 2VH6A 3A84A 4TPIZ 5BPEA 4AFQA 3MU5A 2VU8E 3A80A 4CRBA 2QAAA 4ZKSU 1K22H 1O3IA 1VCPA 5E8EH 3MI4A 1KLIH 4NCYA 4FXGH 1DWCH 1AI8H 2ULLA 2PTCE 1HIAA 2OBOA 2ZGHA 5A8ZA 2H9EH 5JB9S 3F68H 1O3CA 2P94A 5EPYA 2FOGA 2JH6D 2ZGJA 5E2OA 1YKTA 1PPBH 1BJVA 4FU9A 1MTWA 2Y5FA 3BTTE 2QA9E 3M7QA 1FN6A 4CRGA 3CS0A 3EE0B 3UTUH 3GOVB 2GVFA 1SB1H 2W7SA 5GPIB 5EQSA 1QTFA 3UNRA 4XOJA 1MU8B 4H6SB 5E0JA 2OC0A 1GI8B 1D6WA 1ABIH 2ZCLP 4ISLA 2TBSA 3A82A 1GJAB 1MTVA 5CMXH 3SV9A 2FLBH 3LC3A 3SUGA 1BB0B 1G37A 4B74A 3S69A 1OKXA 1VITF 3M37A 3MU4A 1E35B 3RXKA 1HXFH 2H1UA 1V2RT 2AMQA 4B75A 1BTZA 1TWXB 2WUCA 4GCHG 1NU9A 4BTTB 2ANKH 1YP9A 1ZLRA 1H1BA 1TE0A 4CR5A 2B8OH 1W3CA 1O3LA 1YPLH 1F2SE 3KN2A 3L3TA 3IITA 1SQOA 5JPMH 3FZZA 1KLJH 1FIZA 1C2GA 2QIQA 2SGEE 5JBTA 3BG8A 1W8BH 3QTOH 4K3JA 1GI2A 3BIVH 1ELVA 1G3CA 1QURH 2HGTH 3OY5U 1W7GH 2DE8A 3NZIA 1C2EA 4BAOB 4ZMAH 1GGDB 3M5OA 4NFFA 1ACBE 4WVPE 2Q6DA 4JMYA 3MTYA 3NWUA 1O37A 4F4OC 2GMTB 2CN0H 4AGJA 3TK5A 2FTMA 1LHEH 1CBWB 2ZFTA 1Y5AT 4TPYA 3QO6A 3QDZB 3I78A 1C5WB 1O30A 2PWXA 4RKJB 1PQAA 2BY8X 1FY3A 4HI3A 2BY5X 2ZCKP 4ESTE 1ZHMA 2C4FH 3SQEE 3O8CA 1S81A 2J94A 3SJKA 4Q2KA 2XBVA 2WPHS 1SGTA 2BY9X 1F7ZA 1SVPA 4YOJA 2BY6X 3K2UA 3MO3A 9ESTA 1SGQE 2ZDKA 2ZA5A 4ZUHA 1D4PB 1O2JA 2O8WA 1DT2A 1L4ZA 2VGCC 1LKBA 2BB4A 2Y7XA 1O2OA 4ASHA 4TWWA 2ZNKH 3GYMA 1XXDA 2F91A 1H9IE 2C90B 3MHWU 5LPFA 1K1IA 4Y79A 1ETTH 1SSXA 1HAXB 1QQUA 2PKAA 1OWJA 1L4DA 2CV3A 3MH4A 1O2IA 3P95A 3PMHB 3SORA 5JBBS 4DY7B 3BV9B 1EATA 4ZH8A 1ZPCA 2A4RA 1KDQB 4BAMB 2GP9B 1CGIE 3A85A 3QZQA 1JBUH 3ZZ4A 1P57B 4X1QU 2FXRA 1LPZB 2ANYA 5A0CA 1ZHRA 1GI7B 1TGBA 3TH3H 4BTIB 5DKMA 2F83A 2HOBA 2ZC9H 2BMGB 1QRZA 4D9RA 1TX7A 1EOJA 2Q1JA 1YGCH 1ARBA 3T2NA 1KIGH 3A7WA 1NC6A 3SU1A 4Y6DA 1WCZA 2WV5A 1BHXF 2XC5A 1AD8H 5C1UA 1OXGA 2BDCA 3TGIE 3JZ2B 3SV8A 2F9UA 1JIMA 1SGRE 3ZVBA 4WMDA 2VIPA 2NU4E 2XC4A 1NFWA 4TY7A 4CH8B 3ENSB 2Z94A 2ZU2A 5L30H 4IW4E 1W13U 1LHFH 1TRYA 7GCHG 1E34B 4MNWA 4DIHH 1KY9A 1O2RA 4ZHMU 3VEQB 5C67A 5F6MA 1HAHH 1O2PA 4MQAA 5DP3A 5K0HA 1C5NH 3QX5H 4ZHAA 1K28D 2ZPSA 1AUJA 3ESTA 2ZHDA 3RXLA 1O0DH 3TGKE 1CO7E 5HM2A 3TK6A 1GHYH 4X6PA 3GDSA 4XSKU 5DP7A 3AVZA 1LQDB 2HWLB 4ABHA 5EOKA 4MNXA 1Z6JH 3BG4B 3PWCA 1O3FA 3T29A 1EXFA 4WF8A 1WQVH 4OS6A 1EB2A 2FOBA 5DP4A 1H9HE 3HKIB 3UQOA 1PPZA 4FUIA 2H5DA 4IS5A 1T8MA 2JKHA 4O3UA 4D8NA 3E6PH 2AYWA 3UREA 1INCA 1UJ1A 2SGDE 2VIVA 3RM2H 4FUDA 2GT7A 1GJ8B 3M3TA 1C2HA 4MG3A 4X6OA 1H8IH 1OP2A 1BMNH 2OUAA 2V6NA 4FUFA 1F5RA 2BX4A 2A5AA 3O8RA 4HZHA 1P3EA 3L6PA 2Y7ZA 4WMEA 1BTHH 1C1MA 2G81E 4XDEA 1NY22 4UFGH 2R2MB 1O2XA 2FOMB 4NIVA 1W11U 4ZHLU 2ZHEH 1ZSLA 2H6MA 3E3TA 1BZXE 2FM2A 4ABAA 4O03A 3RMLH 4FUJA 3AAVA 3SHAH 1D6RA 1C1OA 4B2CA 1NO9H 2VIWA 5LGOA 1Z8GA 1TMUH 2H9TH 1UVSH 4LZ4B 4Y0ZE 1FNIA 3PMBB 3HK6B 4YT6H 4B2AA 2FODA 1E38B 4O3TA 4E05H 4NZLA 3A7VA 1GDNA 2W3IA 4A7IB 3BTDE 1J15A 1JMOH 1CHGA 2J92A 4WY3A 3PROA 1FY8E 4JZFH 1TMTH 4UD9H 1TAWA 1QHRB 2JETB 1B0EA 1LHCH 2AGGX 4MPVA 2GCTC 2ODPA 1GBTA 1WOFA 1YF4A 3P70B 1TGTA 3BN9A 1MTSA 3SGAE 1SHHB 5E0GA 2JH5D 4NWKA 2GX4A 3DA9B 1HFDA 4JYUH 2A2XH 2XRCA 1LQEA 1HDTH 7LPRA 1SGFG 2F9PA 5IDKA 3SU6A 1SOTA 1MBMA 5ESBA 1JRSA 3SV2H 1EX3A 1NU7B 2HNTE 3EA9A 2BD7A 1FY4A 1XUKA 3DFJA 1AVGH 2A4QA 2UWLA 2UUYA 2J9NA 1XXFA 4RSPA 3U8RH 2RDLA 1GPZA 2XBXA 5A8YA 2DUCA 2WPIS 4Y8ZA 2PV9B 1ANEA 5DK1A 4IBLH 4IC5A 1SPJA 3MFJA 2BVRH 4CREA 1O5FH 1XMNB 3V0XA 3F1SB 2I6SA 2ZIQH 4I8JA 1C5MD 2UUKB 4D7FA 4U01A 1T32A 1O2LA 3RXSA 2GDEH 2VVVA 3D23A 2ZTYA 3ATWA 4DURA 2Y6TA 1TGSZ 1AZ8A 3RXIA 1EAIA 1CGHA 2OP9A 1OWHA 1ANBA 5EXMA 3KGPA 3SJ8A 1WSSH 3HPTB 1L2EA 2VWMA 3RU4D 1Y8TA 3T5FH 1TPAE 3VGCB 1NRQH 1GGDC 1GJ4H 3VFEA 1P2OA 3GCTG 2HALA 1IHSH 3VXEH 1P3CA 5DG6A 3TNSA 4SGAE 1Z1JA 4UDWH 1TOMH 1O3MA 3CP7A 1LVYA 2D1JA 1JOUB 3T26A 4M7GA 1CBWC 1GHZA 3TLOA 1FUJA 1TBZH 2NU1E 5F8TA 4K60A 3RXHA 4AZ2B 1OP8A 1F5KU 1TPPA 2GKVE 4Y8XA 3M7TA 1MMJN 4XFQA 3GCHC 1C5QA 3UOPA 4DJZB 1P8VC 4ZKOU 1C4Y2 1K1LA 1BIOA 2SNWA 2A1DB 2HPQH 2CJIA 3IG6B 2Y80A 1G32B 1YM0A 3A83A 4A5TS 1A4WH 4NIWA 2ZQ2A 2VIDA 3UNQA 4Y76A 2F9NA 1GI0A 1L1NA 1EAXA 3F9FA 2ILNA 1LKAA 4JK6A 1N8OC 4K1SA 2ZTZA 2AMDA 2XWBI 2FOCA 2HVXA 1MZDA 1RTFB