3A8CA

Crystal structure of trypsin complexed with (e)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid (soaking with mixture of [(e)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid] and [(e)-2-(4-carbamimidoylbenzylideneaminooxy)-2-methylpropanoic acid])
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8cA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8cA02
1FY8E 1MMJN 4XDEA 1FXYA 2RA0A 1AVGH 1PPBH 1BRCE 1CGJE 3BEUA 4YTAA 3SUEA 3UOUA 2Q6DA 1BUIA 4BAQB 4BTIB 2BD2A 6LPRA 2VIPA 2J4IA 1NESE 1YPKH 3M3TA 1BJVA 1O3PB 2CXVA 6GCHF 1PPCE 1F7ZA 3STIA 1GHBF 4X6NA 1O3HA 5C2ZA 1C2KA 3G01A 1A7SA 1OP0A 3ZZCA 3RC6A 1GBDA 1O3OA 5I46H 2UWLA 1OPHB 3SJKA 1PYTD 1A1RA 1IQMA 1IQLA 1ZJKA 1H9LB 2BX3A 4A5TS 2EA3A 3F9HA 5JDUB 4GUXA 1A0LA 1OX1A 2AMPA 1EAXA 2GZ8A 1HNEE 4UFEH 2AMQA 3M5OA 3TNSA 1Z8RA 5EW1H 5GDSH 2BOHB 3LIWA 4K60A 1LPGB 4ABFA 1O3BA 1GBMA 3SUGA 1BIOA 1YLDA 5EQSA 2P3TB 2AIQA 4DG4A 2WPIS 1RTLA 3SNCA 3FZDA 5L2YH 1AB9C 1W11U 3D62A 2VWNA 1M9UA 1MD8A 2P95A 2H2ZA 2P94A 1FMGA 2Y5FA 1CA0B 4GHQA 1F0TA 3ZZDA 2FMJA 3EE0B 3BF6H 2VH6A 3TK6A 2A7HA 2G4UA 1UVTH 1SLVB 2W7UA 2ZHEH 2FX6A 2GV7A 1TNJA 2P59A 2PTCE 3A88A 4CRDA 5C5NA 4HI3A 2THFB 2ZU5A 4GSOA 1EATA 4U30A 2O8MA 2CJIA 1RD3B 3M3SA 1GCTC 5AF9H 1GVKB 1W2KH 1Z7KA 1AMHA 1SGTA 3HK6B 3Q3KA 2Z9KA 2GVFA 2B9LA 4AFUA 1MU8B 2JETC 1L0ZA 2QYIA 5C3NA 3R0FA 4X6OA 1S6FA 1SFQB 4CR9A 1OXGA 1SLXB 1KXBA 3SU0A 1IQEA 3SV8A 4WH8A 2GX4A 3SW2B 1GI4A 5DPAA 4FUIA 2FXRA 2ZU3A 3UOPA 2FEQH 2Z3DA 1QB9A 4ZXYH 3U8TH 1T4UH 2BX4A 2PKSB 3BTFE 2AFQB 2Y7ZA 1QRXA 1ZTLA 4FVDA 2YNBA 3ZZAA 2W5EA 4IC6A 3ZVFA 1GJCB 3KF2A 1GI3A 4NIVA 1F92A 2ZG0H 1BMAA 5FCRA 1C2HA 2B7DH 1ANCA 1YKTA 2D8WA 3TJVA 4NA7A 2ESTE 1DICA 4WF8A 3RU4T 2XBYA 3A87A 1DSTA 5FPTA 3GOVB 3GY4A 3CS7A 3ATMA 1C1WH 3SBKA 2AGIX 1EAUA 1V2MT 1G2LA 2HOBA 3ZYEA 1B0FA 1ELEE 2VGCC 1SL3A 1P03A 3AAVA 4MVNA 1CT0E 1O3EA 1CT4E 4OS2A 1XUKA 2ODYB 1QBNA 4SGAE 4A1XA 1OS8A 4X1QU 4X6PA 4TPIZ 2G5NA 2FZZA 1UMAH 1C2FA 1PQ8A 3UFAA 1ESAA 1GGDB 2O8WA 4XBCA 3CP7A 3KCGH 5GCHG 1TMUH 4JCNA 1GBBA 4NG9H 4U01A 1ETRH 4CH2B 3BTQE 1O36A 1V2OT 1G3EA 4ZKOU 2WINI 1EP5A 1SGQE 1ZPCA 2FOBA 4DW2U 2P8OC 4I31A 3K2UA 2H9HA 1C1RA 2JH6D 1C2EA 1P57B 1YPJH 4B1TA 4BAOB 2C3SA 2F9BH 1YPEH 1NU7B 1TGCA 5A0CA 4A92A 3SU5A 1TRMA 1HAYB 4ASHA 2PW8H 4DY7B 2A4QA 3EYDA 1RIWB 5LPFA 2ZFQH 1Q31A 3U9AH 1HXEH 3VEQB 3FFGA 5A8XA 2UUKB 1TPSA 3UUZA 5EQRA 2EI7A 2HGTH 4B74A 1E35B 4D9QA 4DGJA 1FZZA 4MG3A 1FV9A 4FUFA 1C5TA 3PTBA 4X6MA 2A5IA 2YOLA 3U1IB 7ESTE 1DOJA 2ZPSA 1GDNA 4LXBH 1V2VT 1NU9A 3SI3H 3SV6A 1GBJA 2XBVA 4AGJA 5JBCS 3A81A 1EXFA 2JH5D 1DS2E 2ODPA 2GKVE 2AEIH 3BV9B 3PLKA 1OWEA 5JBTA 3DFLA 1KYNA 3NK8A 4I8LA 1TQ0B 1C5ZB 4I8GA 1AZZA 1UTPA 5A8ZA 2ILNA 3LT3A 2G52A 5C5OA 3PV4A 4I8JA 2ZECA 1MZDA 2FYQA 3PMBB 3MO6A 4YZUA 2DE8A 2AMDA 1JOUB 2ZFTA 2QCYA 1C1OA 3A89A 1C5UA 1UK2A 1KLJH 2W26A 1FQ3A 3LGUA 1XVMA 1CVWH 1PPHE 2QF3A 1QFKH 3A7WA 3ODFA 1AU8A 2XC4A 1MKXK 3LOXA 1Y3UA 4ZKNU 3TH2H 1HBTH 1GI8B 1Y3VA 3GDSA 3RXCA 1D6RA 1ESTA 1XXDA 1EZUC 5E2OA 1AQ7A 5C20A 3AVZA 3F9EA 3RXDA 5DP8A 4JZDH 1GHAF 1LHFH 1ZJDA 3F9FA 1ACBE 1Z8IB 1DXWA 1GMHG 2BD7A 1GI9B 1FN6A 4NA9H 2BD3A 1TA2A 3P95A 2OC7A 1NS3A 1DM4B 4UFGH 2G55A 3D23A 4TWYA 1THRH 1JRTA 2A7JA 4X1SU 2WUBA 3OTJE 1MTWA 2XYAA 2ZP0H 3ENSB 1L4DA 1V2RT 5AFZH 5A0BA 1CU1A 3VB7A 1JMOH 2J2UA 1MBMA 1CO7E 1V2JT 1HPGA 3LH3A 2A4RA 1O5CB 4VGCC 1P2JA 2C8WB 1O2TA 2CN0H 1O3NA 4MNYA 1TABE 1H8IH 3Q3XA 3RM2H 1YPGH 2BVRH 1N8OB 2VVVA 3ATLA 1D3TB 1MD7A 4KTUA 2R3UA 3VB4A 2BDYA 2ZFFH 1SLUB 3EQ0H 5L2ZH 1AHTH 1P2KA 4YO9A 5J4SA 4R0IA 4ABGA 1SQOA 2FYRA 2XC0A 2BB4A 1AVXA 5G4BA 1C2GA 5HM2A 1WUNH 1YPHC 2YNAA 1T8LA 1TMTH 2WYJA 1V3XA 1TGBA 3F68H 1VITF 4OGXA 1C5NH 3ZV8A 1YCPH 1E34B 3MH4A 4YOGA 3U69H 7KMEH 4AOQA 4E06H 2A31A 3UQOA 2DE9A 1RTFB 4X2XA 3KN2A 4AX9H 5DP5A 2BDIA 2LNCA 1KSNA 4TWWA 1W0ZU 2CGAA 3BEIB 1GI7B 1O30A 2SGPE 3ZZBA 2FS8A 2BHGA 3NPSA 1YLCA 2W3KA 2ZCKP 4R8TB 1Z1IA 1AZ8A 1X7AC 2XCNA 1HYLA 1YBWA 2BD9A 4YT7H 3A8DA 1SOTA 1GG6C 1K1LA 1VGCB 2Y6TA 3ZZ9A 2ZGJA 1A5HA 1T31A 3AW0A 1AWFH 2G5VA 3UWIA 3H7OA 1BHXB 3GY8A 4ISOA 2AYWA 1DPOA 1ZHPA 2CF9H 2CHAC 5EPYA 4HFPB 5A8YA 4WVPE 1TB6H 3SGBE 3QO6A 1LHGH 3E91A 3GCTG 3T29A 4YESB 1C5RA 3B8JA 4ISLA 3GCOA 3SUFA 7GCHG 1QB6A 1TONA 2VINA 3F9GA 4KP0A 1K1IA 2WPHS 1WTHD 1TIOA 2PKAB 1EPTC 3IG6B 2BLVA 1LHDH 2VB0A 1O5FH 2BOKA 2STBE 4H6TA 1BMNH 3NUMA 3A7ZA 4XSKU 2Z9GA 1GHYH 1UO6A 3TJNA 1XM1A 1ZYOA 1F0RA 1C2LA 1HV7A 5T6GA 1OWKA 1SGCA 1TBRH 1C5MD 2A4GA 4YLUA 1PQ7A 3MU1A 1QL8A 1D4PB 3RMNH 4FU9A 1ELFA 3LH1A 1BCUH 1C5QA 1G2MA 3ZVDA 1MKWK 2Z7FE 4CH8B 4K1EA 1UCYE 3TGKE 1AY6H 2PTNA 5FXLA 3QGNB 4MLFB 3MTYA 1MTUA 1LVOA 1V2UT 1P9SA 1DSUA 2ZIQH 3IITA 1WSSH 5ESTE 3VGCB 4UEHH 3K9XB 1YPHE 5DJ7A 5B6OA 5JYIA 1WBGB 5E0GA 4SGBE 2C8YB 3LU9B 3RXGA 2WPKS 2TGAA 1SOZA 5F8TA 3V3MA 4AORA 1BTPA 3S69A 3FP7E 3V13A 1O2WA 2G81E 3BG4B 1AE8H 4YOIA 1O2OA 1SPJA 5FHTA 2UWOA 1P02A 1HDTH 4NZLA 4X1RU 3ZZ7A 3S7KB 4NWLA 1HLTH 1O2NA 1UJ1A 2ANYA 1IQIA 2UWPA 2Y5GA 4FUEA 1CGHA 1LVYA 5EQQA 3SNEA 4BXSA 4WWYA 4ZMAH 1QL7A 2VJ1A 4Y7AA 1EAIA 1S5SA 1SSXA 3MNXA 4NA8A 4RKJB 2VVUA 3UPEA 3E1XB 2ZGCA 4CREA 4TYDA 2AERH 3U98H 2Z9LA 1FAKH 1K28D 2PR3A 4K1TA 3WY8A 1GCDA 3P8FA 4MTBA 1HCGA 1IQNA 1QB1A 4ZROA 3M5LA 2OD3B 4FU7A 2FTLE 2O8UA 5EPNA 3BTWE 4ZHAA 5CMXH 1FJSA 4JZEH 1Y3WA 4LK4A 3T26A 3AASA 3RUOA 1CA0C 4ISNA 3ZVCA 1O3JA 1CHOF 4A1TA 3RU4D 1FY3A 1QL9A 1Z1JA 3SHCH 1ESBA 4Y0YE 2PUXB 5GCHF 1BB0B 1AIXH 1UCYH 5EXLA 3U8RH 3LC5A 2FESH 1OOKB 3DFJA 1UHBB 2ZU4A 2IOTA 1GI0A 4K2YA 4X8UH 2QA9E 2A5KA 5DP9A 1HB0B 1GDQA 3KQCA 1HAVA 1O2GH 3HK3B 3ZV9A 4OS7A 3LC3A 2ZEBA 1JBUH 4E7RG 2VIOA 3DD2H 4PROA 5CHAB 2SFAA 2VWMA 3QTOH 3ZZ5A 1DWEH 1LQDB 5HM9A 1MTNB 1HUTH 1U6QA 2ZDAH 3S0NA 1FY1A 5HGGA 3PM3A 1Q2WA 1NRRH 2R9PA 3M36A 1GI1A 1HXFH 4DOQA 3FANA 3L6PA 1Y59T 2BLWA 1GJDB 2AH4X 5DGJA 1XUHA 1HAHH 3N7OA 2PKSC 4MQAA 1YYY1 1IHTH 1KXCA 4ABEA 1FPHH 2H1UA 4FUDA 1UVOA 5FX6A 1D3PB 1O0DH 3HKJB 3M7QA 4DURA 1UTNA 1CT2E 3QTVH 4JYTA 1J16A 4KGAA 1G3BA 4XFQA 3C1KA 1N6XA 2ZHDA 3S7HB 2V6NA 4D8NA 1MCTA 5T3HA 1HGTH 4IN1A 2GGVB 1L2EA 2V35A 4E7NA 1VJ9U 2ANKH 4CRBA 1ZTKA 1O2UA 4IBLH 2AGGX 4CBNA 3E90B 4LZ1H 1DLKB 1SGPE 3VB5A 1SMFE 4WMFA 4AG1A 2PGQB 1EPTA 1FY4A 1O3AA 1TYNA 2R3YA 4UD9H 1Z6EA 1A0JA 3SUDA 1D3QB 1TLDA 1XKBC 2BDBA 1DVAH 1A3BH 1Z6JH 1GBTA 1LVMA 2BQWB 2GD4B 2PFEA 2G51A 4AFZA 5LPEA 1C1NA 4O3TA 1PPGE 2J95A 2ZFSA 2SNWA 4BAKB 4AN7A 1TNIA 1VITH 1KLTA 2BY8X 2D1JA 5ESBA 4DVAU 2GP9B 1C4Y2 1QRZA 4THNH 2BQ6B 1SGDE 1ZMLA 1BMMH 1TALA 4MNWA 3RMLH 1GGDC 4ZXXH 3TIUA 1P11E 1A46H 2RCEA 4X2VA 3RXKA 3W94A 2VIQA 4CRFA 1TX7A 1WU1A 1UVSH 1GBEA 3EA9A 4X1NU 4Q7ZA 3ZYDA 1O35A 2A7CA 4AB9A 1B7XB 1NN6A 3MU4A 2NU2E 2Q1JA 3SU3A 4FUHA 1W12U 2D26C 8ESTE 4A1VA 2Z3CA 1V2KT 1MBQA 1DITH 1HAGE 4DIHH 1QQUA 1QCPA 1AGJA 3RXSA 2BTCE 5C67A 4DIIH 1Y5BT 1ABJH 1AN1E 3MH5A 1F5RA 1SG8B 4WY3A 2C4FH 1RIWC 1GMCF 3PMJA 4ZHLU 1H8DH 3O8CA 1RXPA 2RA3A 3S9AA 1UHBA 1BOQA 4JK6A 2Q6GA 1P8VC 1TA6A 3D65E 1ABIH 4GHTA 4ZUHA 1G37A 3UNRA 1ZSLA 3ZVAA 3LKWA 1O2RA 2GCHG 2QXJA 4CRAA 1XUGA 3P8OA 3QDZB 2ZGXH 1XKAC 3ODDA 1O3LA 3ZZ8A 2EEKA 8GCHF 4X2YA 3KQDA 1SHHB 3H5CB 2FODA 3RMMH 4ABAA 2V0BA 1C5WB 1UVUH 3GY3A 1IHSH 3MNSA 5C1YA 4LZ4B 1GHZA 1RTKA 3HATH 4CRCA 5A0AE 4CR5A 1YPMH 1O2IA 3SGAE 2ZC9H 2ZDVH 1QTFA 1A5IA 1BTWA 5H4IB 2QF0A 1BTUA 2V3HH 1O2PA 1NFUA 3Q00A 3LGYA 1TPOA 3SV2H 1QY6A 1JWTA 4HTCH 2QGRA 1QJ6B 1TX6A 1CBWB 2FOGA 2W7SA 2WPJS 3M3VA 2ALVA 2XTTB 1YM0A 2SGDE 2ODQA 3E16B 4TPYA 5L6NH 4JZIA 2BY9X 3OY5U 5A2MH 2A1DB 1G30B 3T2NA 6GCHG 1W13U 2P93A 4JK5A 2A32A 4FUBA 2BDHA 4U32A 4WH6A 1GHBG 1H4WA 3RP2A 4AFSA 4MPVA 3SU6A 1O2JA 5GIBA 2J38A 3PYHA 1W0YH 1N1LA 1DE7H 2R0KA 4NWKA 1V2TT 2PSYA 5DK1A 4UFDH 6CHAB 1GBIA 2GT8A 1NPMA 1BRBE 4F4OC 1KDQB 2ZDLA 3RLYH 1P05A 1PPEE 3PLBA 3T28A 2XCFA 4XOJA 2TGDA 1SGFG 1WCZA 3V0XA 3P8GA 1DX5M 1C1UH 1A0HB 1GL0E 1O5BB 1S83A 1VCPA 4ZAEA 3A84A 3KNXA 2AIPA 2F9UA 1EQ9A 2ZHWH 2GZ9A 5C1XA 2CMYA 5DO4H 4FUCA 1LQEA 3BTDE 3PLPA 3UR9A 1MCVA 1YPLH 3QK1A 1T8OA 2ZF0H 3AAUA 3FVFB 3TK5A 3URCA 3GCTF 4B75A 3DA9B 1G32B 3V7TA 1N8OC 7GCHF 1TMBH 1C4V2 4CHAB 1P2OA 2ULLA 5AHGH 4DT7B 1V2LT 1XXFA 2VWOA 5GJ4B 3A83A 3E6PH 1O34A 4INKA 1OWJA 4Y6DA 1GMDF 3SV7A 1T7CA 3K65B 3BTHE 1BHXF 3TVJB 3E3TA 2HALA 1DWDH 2C8XB 3BTKE 5FBEA 2NWNA 3Q76A 4Z6AH 1QJ1B 1ETSH 3VXFH 2QXHA 1HJ9A 2FO9A 2FLRH 2WV5A 2HPPH 1G3CA 1VR1H 2FI5E 5ETXA 4ZKSU 1ZSKA 2GV6A 2H6MA 4YOJA 1ZRKA 3MI4A 2Y82A 3LGIA 1K1OA 1ELBA 1QNJA 3SNBA 1GPZA 3OYPA 1MKXH 2ZQ2A 2F83A 2PUQH 3D49H 2GMTB 1ELGA 1W10U 1KXDA 4YM9A 3QZRA 1IQFA 3A8BA 1PQAA 2FM2A 3ITIA 3UQVA 1A5GH 4AG2A 4ABIA 5T6FA 2QAAA 2OC8A 3A85A 4ZH8A 2BDGA 3EA8A 3SQEE 2BM2A 2EC9H 2VWLA 2AGEX 4H42U 1P3CA 5I25A 4KTSA 1T32A 1A61H 1VGCC 1TNKA 1ZMJA 3LGTA 1P09A 1OWHA 8KME2 1FONA 1GWAA 1W7XH 1NRSH 2ZU2A 1GI6A 1CE5A 3RXIA 4FXGH 3M7UA 1EASA 2ZKSA 2HNTF 3NKKA 1B0EA 3SOSA 2QC2A 1ZHMA 3H7TA 1IOEA 2F9OA 1P10A 1ZMNA 2ZCHP 3RXTA 5FPSA 3ZVGA 1KDQA 1H9IE 1XUIA 4Y7BA 4Y10E 2TBSA 4Y71A 1KXAA 1ARBA 4X1PU 5TJXA 2ZFPH 4ABBA 3O8DA 2C8ZB 4OGYA 5SGAE 1DANH 2ZGHA 1B5GH 2SGEE 3T25A 5F03A 1ZOMA 2ZTXA 2ZGBH 2FWWA 3NWUA 1LVBA 1G3DA 2BMGB 4B2CA 1DWCH 1QRWA 3TK9A 1TNHA 5BPEA 3A7YA 2XXLA 2WYGA 2HLCA 3MHWU 1EX3A 1P9UA 2H5CA 3BSQA 3PMHB 3LONA 2BYAX 2GCTB 3DT0H 3EDXB 4NFEA 4D7FA 1P3EA 1TE0A 1HIAB 5E8EH 2FLBH 3RXAA 1S82A 1MTSA 3STJA 4WMDA 5FAHA 3VGCC 3K6YA 1J14A 5FCKA 4XBDA 2HNTC 3EGKH 1GJAB 3MH7A 2NU3E 5AVDA 1UTMA 1D6WA 3EAJA 2PSXA 4YT6H 1ELTA 2K1QA 1SQAA 3RXRA 1O5DH 4I7YH 4ZHMU 1LMWB 1C1SA 2ZCLP 1S81A 4FUGA 2A45B 1AVWA 4GCHG 2G4TA 3RXFA 3BG4C 1MQ6A 1QR3E 4O97A 1P01A 1INCA 3LGVA 4NSVA 1EZQA 3W95A 1J17T 2OINA 3BTGE 1ZZZA 1AUJA 1Z8GA 1W7GH 3P92A 1ZLRA 3E8LA 1EKBB 4GVUA 3PTNA 4Y8XA 1SBWA 1LPZB 4D76A 3TGIE 1GJ5H 4A6LA 3Q3YA 1HJAB 1KXFA 5HXFA 3NXPA 3U8OH 4WJG2 1FIWA 4BXWA 3LJJA 2WPLS 1TRYA 2FTMA 2TGTA 3SHAH 3GY2A 2WPMS 5DP7A 1P06A 3TJUA 4RN6A 3SV9A 1C2IA 2OUAA 3RXBA 1BBRK 1OSSA 4JZFH 1MQ5A 2PGBB 2ZFRH 1TBZH 2FI4E 4E05H 1F5KU 1F0UA 1QA0A 4MNXA 3KHVA 1O2QA 1SB1H 1NC6A 1ANBA 1UK3A 2JH0D 3TGJE 3FZZA 1C5PA 1MZAA 1MKWH 4Z0KA 1NM6A 3PWBA 1XVOA 3P17H 1BTXA 4WXVA 5DG6A 1IAUA 2FDAA 3RM0H 1PYTC 1TQ7B 4ISIH 2H5DA 1QBVH 1FY5A 1LHCH 1SC8U 2ZTZA 1L4ZA 1UTKA 1W3CA 1O2ZA 3M37A 7LPRA 1NFYA 5CHAC 1WQVH 4U2WA 1O3DA 1MTNC 2PWXA 3ZVBA 2F3CE 1EJAA 3HGNA 3I29A 1DXPA 3MNBA 1HIAA 1BT7A 1W8BH 2ZU1A 1ELDE 3TLOA 3BN9A 4NGAH 3ZZ3A 2H9TH 3S9BA 5EW2H 1TPPA 1O2YA 2HVXA 3I77A 1PQ5A 2HNTE 1S0RA 3BTTE 3OSYA 1ARCA 1DUEA 4B71A 1O37A 1EJMA 1C1VH 1VCQA 4HZHA 1AKSB 2D2DA 2Z6BD 4ESTE 1S0QA 1K2I1 2A4OA 4ABHA 3BIVH 1V2PT 2LPRA 1HRTH 1EZXC 5EGMA 4JYUH 2GCHF 1JIRA 1ZGIA 3ELAH 1Y8TA 2FOMB 2R0LA 1BTYA 3ATWA 3RXOA 1THSH 3GY5A 4INLA 4J2YB 1TOCB 5DKMA 1UTLM 1P2QA 4OS4A 1ELCA 5F6MA 3MMGA 2GZ7A 1J8AA 2UUFB 1O2MA 4AB8A 2ZNKH 1BRAA 2PKAA 4ABDA 4X8SH 8LPRA 1BITA 3TNTA 2BVXH 5GXPA 2IN2A 3B9FH 1Z71A 3GCHB 1HJ8A 1NTPA 1MUEB 1JIMA 3PWCA 3FP6E 2O8TA 5EODA 1E36B 1LCYA 4Q80A 4NIYA 1DUAA 4TY6A 4K5ZA 1C2JA 4O3UA 1EZSC 4FVBA 4HGCA 1Y5UT 1FDPA 1BMLA 3A82A 3RU4E 2VVCA 1LDTT 2F9PA 1TNGA 1G36A 3QX5H 1OWIA 2O8LA 1K21H 3F1SB 4ISHH 4A7IB 2XW9A 4B76A 1TGTA 4Y76A 1GI2A 1G9IE 2ALPA 2PHBA 3SQHE 3MO3A 1GBFA 2OTVA 3SNAA 4NIWA 2VU8E 1C9TA 2BD8A 3MOCA 2OC1A 2BQ7B 2OP9A 2ZDMA 3SNDA 1N6YA 1UTOA 1HAXB 4NFFA 4Y8YA 1HAPH 1Y3XA 2WV4A 2BDCA 4K3JA 1GDUA 2ASUB 1SFIA 1GBLA 1Z8JB 4Y8ZA 3QN7A 3GYMA 4I8HA 2Z3EA 3ZVEA 4WMEA 1PJPA 1O2LA 1BQYA 5JBAS 1K1JA 2GT7A 3F6UH 3L33A 1EJNA 3NCLA 4IS5A 1MAYA 5JPMH 2CF8H 1EUFA 3JZ1B 3PO1B 1O2SA 4KKDA 4B2AA 4AYVB 1BZXE 1AUTC 2FX4A 1QIXB 4X8TH 1FI8A 1K1MA 2C93B 3QLPH 3OY6U 3TPIZ 3RXLA 3RXUA 1OP2A 1DY8A 2SGQE 3DHKH 1AKSA 1J9CH 3MWIU 4B73A 5IDKA 4INHA 4NCYA 2NU0E 4QT8C 2EI6A 2V3OH 1KIGH 2VNTA 4O9VA 1K9OE 3MYWA 1CBWC 2EI8A 1O2HA 3M5MA 4MNVA 3K6ZA 2R2MB 1O2KA 2Y5HA 1DWBH 1SLWB 4B2BA 1C4U2 1S85A 3A7XA 3MH6A 1WTGH 1D9IA 4AYYB 1OKXA 2WUCA 1GVLA 1NRQH 1QBOA 1YGCH 2XNIA 4BAHB 4Y79A 1ANEA 2XWBI 1RFNA 2VIWA 4BTTB 1TRNA 1GMHF 3RXEA 4FU8A 1C5YB 1TBQH 2TPIZ 4MDSA 3L3TA 6CHAC 3QZQA 1BTHH 2ZPRA 1A2CH 2H9EH 1WYKA 2GTBA 1AB9B 2ZDNA 1IQGA 1GL1A 2M5TA 2I6QA 1NT1A 2P16A 1DDJA 2XRCA 2XWAA 5AFYH 1O39A 1GBAA 3IWMA 1C1TA 2BY6X 1ZSJA 1SQTA 3SJ8A 3TITA 2F9VA 3P70B 4CBOA 1AI8H 1TGSZ 2FOHA 1H9HE 1CQQA 1PPFE 3A8AA 1AE5A 1ZPBA 3GICB 1LPKB 3KGPA 1EB2A 2C90B 3UY9A 3UNQA 2QXIA 1RJXB 1P2IA 4ABJA 1J15A 1OYTH 1GCTB 1GJ7B 3TH3H 1OWDA 1CHOG 1F0SA 5LH8A 1O5EH 2JETB 1BDAA 1F5LA 4TY7A 2J92A 5E0JA 3MU8A 1FPCH 4CHAC 2Z9JA 4KTCA 2RDLA 2QY0B 3T62A 1C5LH 3KQEA 1UK4A 5IYTA 3UR6A 2FPZA 2ANWA 3MU5A 1O32A 2VIDA 4RKOB 1SHYA 3LJOA 1VZQH 2F91A 2FS9A 2QV1A 2OBOA 1V2ST 5PTPA 1AWHB 4X8VH 1K22H 1DT2A 3A86A 4X0WU 3MO9A 1O5GH 1SR5C 4MPXA 4OS6A 2UUJB 3M7TA 5GWZA 2BD4A 2Y81A 1ZR0A 1NO9H 2A2XH 6ESTA 3KEEA 4OS1A 5CE1A 3SI4H 3TJOA 2GMTC 4XBBA 2BLQA 2OLGA 1GJ4H 2OQ5A 1P2NA 1KY9A 4UE7H 2BXUH 1EOLA 1FIZA 3VFEA 1LHEH 2PV9B 2VGCB 3CS0A 1V6DA 3O8RA 1IQKA 1K1NA 3CENA 4O03A 3FP8E 3SO3A 4FUJA 1O5AB 2IJOB 2OQUA 3OU0A 2FIRH 1ZPZA 3MU0A 1TNLA 4GCHF 1O31A 1TAWA 3BIUH 1FUJA 1MU6B 2Z9IA 4K8BA 1TPAE 1AO5A 1DY9A 5E2PA 1GHXH 1QHRB 1SGRE 2ZDKA 1RGQA 5T6DA 1DLEA 4NSYA 3S9CA 2BDAA 1OP8A 3BTME 1XMNB 2B5TB 5EXNA 5FBIA 1ETTH 1T8NA 1GJ8B 3EA7A 4H4FA 5EOKA 1C5SA 3DUXH 3LDXH 5EU8A 4BAMB 2P8OB 1KTSB 1P04A 1HAIH 1MAXA 2J94A 1AD8H 3UNSA 1SGYE 1BTZA 1CA8B 1ELVA 4AGKA 1XUFA 4GPGA 2F9NA 2Z94A 4IGDA 1WOFA 4F49A 4K69A 4Q7XA 2Y80A 2OC0A 1LKBA 1C5XB 2A0QB 1YC0A 3QGJA 3KL6A 1C1MA 2TGPZ 3Q77A 1XUJA 1L1NA 4AZ2B 2FOCA 1GVZA 2R2WU 3ESTA 3RXMA 2GCTC 2SGFE 2G00A 5TCCA 3LPRA 4UDWH 3T27A 1GMCG 1O2VA 1XX9A 1YCPM 2I6SA 3M61U 5LGOA 2IPHA 1SGFA 3RC4A 1P0SH 2TIOA 4I33A 1D3DB 1KXEA 1SGEE 2BZ6H 3KQBA 3O8BA 1GJ6A 1SGNE 4NIXA 4I8KA 2FOAA 3GDVA 3ZZ4A 2ZTYA 5C1UA 1AFQC 2HPQH 5DP3A 2JKHA 8GCHG 1F2SE 2GDEH 1JRSA 3ATIA 1FAXA 5TCAA 2QXGA 3GY7A 5BRRE 3SN8A 3SJOA 4JYVH 3ATKA 4IW4E 4IMZA 1HAOH 4H6SB 3LGWA 1NFWA 1TWXB 5A09A 1L1GA 3P6ZB 3M5NA 3GY6A 2OCVB 5GPIB 2FOFA 3E0PB 1K1PA 1T4VH 1YCPK 5LPRA 1O38A 3T5FH 3E0NB 5EXMA 4DCDA 1UTJA 2ZQ1A 3RXVA 3ZZ6A 2ZHFH 3I78A 4K8YA 2Q6FA 9LPRA 4MPUA 1HJAC 9ESTA 1P2MA 1P12E 1C5OH 5F8XA 1H1BA 3SJ9A 2BXTH 3PB1E 1O33A 1DFPA 3A8CA 1BBRE 3SU2A 4WXIA 2P3UB 1PPZA 1LTOA 3RXHA 2SGAA 3SZNA 2G8TA 5FPYA 2FI3E 2J34A 1SVPA 1IQJA 3SGQE 3R3GB 3VB6A 3BG8A 1C5VA 4BANB 3TH4H 5ABWA 4KELA 3HGPA 1W14U 3MFJA 1UVPA 1ORFA 1TGNA 1EOJA 1YF4A 3BEFB 2KAIB 1Y5AT 1AFQB 4JMYA 2FP7B 4IMQA 1V2WT 3U1JB 3GYLB 2STAE 4VGCB 1KTTB 3UTUH 4J1YA 5JBBS 3SORA 3QUMP 4K1SA 2ZI2H 1NRPH 2OXSA 1RS0A 4AFQA 3RXPA 3GDUA 1NROH 1WV7H 1ZHRA 2Y7XA 3KIDU 1HFDA 1E38B 3FAOA 1A4WH 3TU7H 1QURH 4BNRA 2B0FA 1BA8B 1ANDA 2SNVA 1NFXA 5FX5A 4Y11E 1Q3XA 3OX7U 2GDDA 1V2QT 3A7VA 1O3FA 2XBXA 5JB9S 1BRUP 3MNCA 1QQ4A 4Q7YA 2A5AA 1EAWA 2BY5X 1VCWA 1GBHA 3RMOH 2J9NA 2VIVA 3C27B 4XE4A 2ZHQH 4ZKRU 5EG4A 1LO6A 1GMDG 5K7RA 1CGIE 4UFFH 1E0FD 3SU4A 1PFXC 1GHWH 1RRKA 2ZA5A 3QWCH 1MH0A 2XBWA 1A3EH 1E37B 4YLQH 1GJBB 3UIRA 2NU4E 1GBCA 5L30H 1C1PA 1O3GA 1BJUA 1TOMH 1SI5H 2A2QH 2TRMA 1CHGA 1QA7A 3B23B 2RG3A 1TX8A 1HAVB 1O3CA 1TFXA 5K0HA 1O3KA 2PLXA 2ZPQA 2CV3A 2HRVA 3A7TA 5E0HA 1C9PA 1HAZB 2QIQA 4X2WA 1O3MA 2HWLB 1O2XA 1GHAG 1BBRH 5HMAA 3UWJH 2BD5A 3URDA 3GCHC 4Y0ZE 2BY7X 3SJIA 1NZQH 2DUCA 1ZGVA 1EB1H 1QJ7B 4NZQA 3RC5A 1ZTJA 1GG6B 3VB3A 3BTEE 3JZ2B 1AFEH 5F8ZA 2P3FH 5DP4A 4DJZB 3V12A 1S84A 2CHAB 1Y3YA 1OYQA 3M35A 3RXJA 1FNIA 2ZZUH 2FOEA 3SU1A 1JXPA 3PMAB 3GCNA 4LOYH 1ID5H 1T8MA 2AS9A 4OS5A 1L1JA 1SGIB 1VJAU 1IQHA 1UTQA 4I32A 4RSPA 5JB8S 2BZAA 4IN2A 1LKAA 2ZO3H 4D9RA 3RXQA 1C1QA 1EPTB 1WQSA 2OBQA 2W3IA 2XC5A 4BOHA 1MTVA 4Q2KA 3AW1A 3VXEH 3GISB 1GHVH 2KAIA 2BVSH 2VH0A 1EP6A 3NZIA 3RLWH 4UONA 3HPTB 4GLYA 1YP9A 3PROA 1NY22 1GJ9B 1VITG 5DP6A 4JZ1A 3UREA 4M7GA 1KLIH 2B8OH 4IC5A 3HKIB 1O3IA 1THPB 1ZRBA 4GAWA 1FN8A 4BTUB 1FLEE 1NRNH 3P8NA 4D7GA 2ZWLH 2ANMH 1GBKA 1GI5A 1ELAA 5HYOA 5J4QA 3PO1C 2UUYA 3RDZA 3VPKA 2NU1E 1V2NT 1WAYB 1QGFA 1S6HA 2O9QA 1UCYK 2QN5T 4CRGA 1C2MA 1CSOE 1C2DA 2BLOA 3A80A 4MPWA
chains in the Genus database with same CATH superfamily
1FY8E 1MMJN 4XDEA 1FXYA 2RA0A 1AVGH 1PPBH 1BRCE 1CGJE 3BEUA 4YTAA 3SUEA 3UOUA 2Q6DA 1BUIA 4BAQB 4BTIB 2BD2A 6LPRA 2VIPA 2J4IA 4YXWD 1NESE 1YPKH 3M3TA 1BJVA 1O3PB 2CXVA 6GCHF 1PPCE 1F7ZA 3STIA 1GHBF 4X6NA 1O3HA 5C2ZA 1C2KA 3G01A 1A7SA 1OP0A 3ZZCA 3RC6A 1GBDA 1O3OA 5I46H 2UWLA 1OPHB 3SJKA 1PYTD 1A1RA 1IQMA 1IQLA 1ZJKA 1H9LB 2BX3A 4A5TS 2EA3A 3F9HA 5JDUB 4GUXA 1A0LA 1OX1A 1S6LA 2AMPA 1EAXA 2GZ8A 1HNEE 4UFEH 2AMQA 3M5OA 3TNSA 1Z8RA 5EW1H 1WDIA 2BOHB 5GDSH 3LIWA 2KM0A 4K60A 3MQKC 5KGOA 1LPGB 4ABFA 1O3BA 1GBMA 3SUGA 1BIOA 1YLDA 5EQSA 2P3TB 2AIQA 4DG4A 2WPIS 1RTLA 2KR7A 3FZDA 3SNCA 5L2YH 1AB9C 1W11U 3D62A 2VWNA 1M9UA 1MD8A 2P95A 2H2ZA 2P94A 1FMGA 2Y5FA 1CA0B 4GHQA 1F0TA 3ZZDA 2FMJA 3EE0B 3BF6H 2GJGA 2VH6A 3TK6A 2A7HA 4RT1A 2G4UA 1UVTH 1SLVB 2W7UA 2ZHEH 2FX6A 2GV7A 1TNJA 2P59A 2PTCE 3A88A 4CRDA 5C5NA 4HI3A 2THFB 2ZU5A 4GSOA 1EATA 4U30A 2O8MA 2CJIA 1RD3B 3M3SA 1GCTC 5AF9H 1GVKB 1W2KH 1Z7KA 4FOUC 1AMHA 1SGTA 3HK6B 3Q3KA 2Z9KA 2GVFA 2B9LA 4AFUA 1MU8B 2JETC 1L0ZA 2QYIA 5C3NA 3R0FA 4X6OA 1S6FA 1SFQB 4CR9A 1OXGA 1SLXB 1KXBA 3SU0A 1IQEA 3SV8A 4WH8A 2GX4A 3SW2B 1GI4A 5DPAA 4FUIA 2FXRA 2ZU3A 3UOPA 2FEQH 2Z3DA 1QB9A 4ZXYH 3U8TH 1T4UH 2BX4A 2KFWA 2PKSB 3BTFE 2AFQB 5C0UA 2Y7ZA 1QRXA 1ZTLA 4FVDA 2YNBA 3ZZAA 2W5EA 4IC6A 3ZVFA 1GJCB 3KF2A 1GI3A 4NIVA 1F92A 2ZG0H 1BMAA 5FCRA 1C2HA 2B7DH 1ANCA 1YKTA 2D8WA 3TJVA 4NA7A 2ESTE 1DICA 4WF8A 3RU4T 2XBYA 3A87A 1DSTA 5FPTA 3GOVB 3GY4A 3CS7A 3ATMA 1C1WH 3SBKA 2AGIX 1EAUA 1V2MT 1G2LA 2HOBA 3ZYEA 1B0FA 1ELEE 3PRBA 2VGCC 1SL3A 1P03A 3AAVA 4MVNA 1CT0E 1O3EA 1CT4E 4OS2A 1XUKA 2ODYB 1QBNA 4SGAE 4A1XA 2M2AA 1OS8A 4X1QU 4X6PA 4TPIZ 2G5NA 2FZZA 1UMAH 1C2FA 1PQ8A 3UFAA 1ESAA 1GGDB 2O8WA 4XBCA 3CP7A 3KCGH 5GCHG 1TMUH 4JCNA 1GBBA 4NG9H 4U01A 1ETRH 2F4LA 4CH2B 3BTQE 1O36A 1V2OT 1G3EA 4ZKOU 2WINI 1EP5A 1SGQE 1ZPCA 2FOBA 4DW2U 2P8OC 4I31A 3K2UA 2H9HA 1C1RA 2JH6D 1C2EA 1P57B 1YPJH 4B1TA 4BAOB 2C3SA 2F9BH 1YPEH 1NU7B 1TGCA 5A0CA 4A92A 3SU5A 1TRMA 1HAYB 4ASHA 2PW8H 4DY7B 2A4QA 3EYDA 1RIWB 5LPFA 2ZFQH 3W1EA 1Q31A 3U9AH 2J97A 1HXEH 3VEQB 3FFGA 5A8XA 2UUKB 1TPSA 3UUZA 1E1RD 2QF4A 5EQRA 2EI7A 2HGTH 4B74A 1E35B 4D9QA 4DGJA 1FZZA 4MG3A 1FV9A 2CK3D 4FUFA 1C5TA 3PTBA 4X6MA 2A5IA 2YOLA 3U1IB 7ESTE 1DOJA 2ZPSA 1GDNA 4LXBH 1V2VT 1NU9A 3SI3H 3SV6A 1GBJA 2XBVA 4AGJA 5JBCS 3A81A 1EXFA 2JH5D 1DS2E 2ODPA 2GKVE 2AEIH 3BV9B 3PLKA 1OWEA 5JBTA 3DFLA 1KYNA 3NK8A 4I8LA 1TQ0B 1C5ZB 4I8GA 1AZZA 1UTPA 1NBME 5A8ZA 2ILNA 3LT3A 2G52A 5C5OA 3PV4A 3ZIAD 4I8JA 2ZECA 1MZDA 2FYQA 3PMBB 3MO6A 4YZUA 2DE8A 2AMDA 1JOUB 2ZFTA 2QCYA 1C1OA 3A89A 1C5UA 1UK2A 1KLJH 2W26A 1FQ3A 3LGUA 1XVMA 3FO8D 1CVWH 1PPHE 2QF3A 1QFKH 4B6EA 3A7WA 3ODFA 1AU8A 2XC4A 1MKXK 3LOXA 1Y3UA 4ZKNU 3TH2H 1HBTH 1GI8B 1Y3VA 3GDSA 3RXCA 1D6RA 1ESTA 1XXDA 1EZUC 5E2OA 1AQ7A 5C20A 3AVZA 3F9EA 3RXDA 5DP8A 4JZDH 1GHAF 1LHFH 1ZJDA 3F9FA 1ACBE 1Z8IB 1DXWA 1GMHG 2BD7A 1GI9B 1FN6A 2QF5A 2BD3A 4NA9H 1TA2A 3P95A 2OC7A 1NS3A 1DM4B 4UFGH 2G55A 3D23A 4TWYA 1THRH 1JRTA 2A7JA 5IK2D 4X1SU 2WUBA 3OTJE 1MTWA 2XYAA 4HG6A 2ZP0H 3ENSB 1L4DA 1V2RT 5AFZH 5A0BA 1CU1A 3VB7A 1JMOH 2J2UA 1MBMA 1CO7E 1V2JT 1HPGA 3LH3A 2A4RA 1O5CB 4VGCC 1P2JA 2C8WB 1O2TA 2CN0H 1O3NA 4MNYA 1TABE 1H8IH 3Q3XA 3RM2H 1YPGH 2BVRH 1N8OB 2VVVA 3ATLA 1D3TB 1MD7A 4KTUA 2R3UA 3VB4A 2BDYA 4Z1MD 2ZFFH 1SLUB 3EQ0H 5L2ZH 1AHTH 1P2KA 4YO9A 5J4SA 4R0IA 4ABGA 1SQOA 2FYRA 2XC0A 2BB4A 1AVXA 5G4BA 1C2GA 5HM2A 1WUNH 1YPHC 2YNAA 1T8LA 1TMTH 2WYJA 1V3XA 1TGBA 3F68H 1VITF 4OGXA 1C5NH 3ZV8A 2KCPA 1YCPH 1E34B 3MH4A 4YOGA 3PV2A 3U69H 7KMEH 4AOQA 4E06H 2WZQA 2A31A 3UQOA 2DE9A 1RTFB 4X2XA 3KN2A 4AX9H 5DP5A 2BDIA 2LNCA 1KSNA 4TWWA 1W0ZU 2CGAA 5FL7D 3BEIB 1GI7B 1O30A 2SGPE 3ZZBA 2FS8A 2BHGA 3NPSA 1YLCA 2W3KA 2ZCKP 4R8TB 1Z1IA 1AZ8A 1X7AC 3OE7D 2XCNA 1HYLA 1YBWA 2BD9A 4YT7H 3A8DA 1SOTA 1GG6C 1K1LA 1VGCB 2Y6TA 3ZZ9A 2ZGJA 1A5HA 1T31A 3AW0A 1AWFH 2G5VA 3UWIA 3H7OA 1BHXB 3GY8A 4ISOA 2AYWA 1DPOA 1ZHPA 2CF9H 2CHAC 5EPYA 4HFPB 5A8YA 4WVPE 1TB6H 3SGBE 3QO6A 1LHGH 3E91A 3GCTG 3T29A 4YESB 1C5RA 3B8JA 4ISLA 3GCOA 3SUFA 7GCHG 1QB6A 1TONA 2VINA 2WV9A 3F9GA 4KP0A 1K1IA 2WPHS 1WTHD 1TIOA 2PKAB 1EPTC 3IG6B 2BLVA 1LHDH 2VB0A 1O5FH 2BOKA 2STBE 4H6TA 4TSFD 1BMNH 3NUMA 3A7ZA 4XSKU 1UW7A 2Z9GA 1GHYH 3NRLA 1UO6A 3TJNA 1XM1A 3WWBA 1ZYOA 1F0RA 1C2LA 1HV7A 5T6GA 1OWKA 1SGCA 1TBRH 1C5MD 2A4GA 4YLUA 1PQ7A 3MU1A 1QL8A 1D4PB 3RMNH 4FU9A 1ELFA 3LH1A 1BCUH 1C5QA 1G2MA 3ZVDA 1MKWK 2Z7FE 4CH8B 4K1EA 1UCYE 3TGKE 1AY6H 2PTNA 5FXLA 3QGNB 4MLFB 3FOAA 3MTYA 1MTUA 1LVOA 1V2UT 1P9SA 1DSUA 2ZIQH 3IITA 1WSSH 5ESTE 3VGCB 4UEHH 3K9XB 1YPHE 5DJ7A 5B6OA 5JYIA 1WBGB 5E0GA 4SGBE 2C8YB 3LU9B 3RXGA 1KMHB 2WPKS 2TGAA 1SOZA 4ZCNA 5F8TA 3V3MA 4AORA 1BTPA 3S69A 3FP7E 3V13A 3DSGA 1O2WA 2G81E 3BG4B 5F53A 1AE8H 4YOIA 1O2OA 1SPJA 5FHTA 2UWOA 1P02A 1HDTH 4NZLA 4X1RU 3ZZ7A 3S7KB 4NWLA 1HLTH 1O2NA 1UJ1A 2ANYA 2K8IA 1IQIA 2UWPA 2Y5GA 4FUEA 1CGHA 1LVYA 5EQQA 3SNEA 4BXSA 4WWYA 4ZMAH 2V3MA 1QL7A 2VJ1A 4Y7AA 1EAIA 1S5SA 3AK5A 1SSXA 3MNXA 4NA8A 4RKJB 2VVUA 3UPEA 3E1XB 2ZGCA 4CREA 4TYDA 2AERH 3U98H 2Z9LA 1FAKH 1K28D 1BMFD 2PR3A 4K1TA 3WY8A 1GCDA 3P8FA 4MTBA 1HCGA 1IQNA 1QB1A 4ZROA 3M5LA 2OD3B 4FU7A 2FTLE 2O8UA 5EPNA 3BTWE 4ZHAA 5CMXH 4B6FA 1FJSA 4JZEH 1Y3WA 4LK4A 3T26A 3AASA 3RUOA 1CA0C 4ISNA 3ZVCA 1O3JA 1CHOF 4A1TA 3RU4D 1FY3A 2RFKC 1QL9A 1Z1JA 3SHCH 1ESBA 2KCYA 4Y0YE 2PUXB 5GCHF 1BB0B 1AIXH 1UCYH 5EXLA 3U8RH 3LC5A 2FESH 1OOKB 3DFJA 1UHBB 2ZU4A 2IOTA 1GI0A 4K2YA 4X8UH 2QA9E 3PV5A 2A5KA 5DP9A 1HB0B 1GDQA 3KQCA 1HAVA 1O2GH 3HK3B 5GNDA 4OS7A 3ZV9A 3LC3A 2ZEBA 1JBUH 4E7RG 2VIOA 3DD2H 4PROA 5CHAB 2SFAA 2VWMA 3QTOH 3ZZ5A 1DWEH 1LQDB 5HM9A 1MTNB 1HUTH 1U6QA 2ZDAH 3S0NA 1FY1A 5HGGA 3PM3A 1Q2WA 1NRRH 2R9PA 3M36A 1GI1A 1HXFH 4DOQA 3FANA 3L6PA 1Y59T 2BLWA 1GJDB 2AH4X 5DGJA 1XUHA 1HAHH 3N7OA 2PKSC 4MQAA 1YYY1 1IHTH 1KXCA 4ABEA 1FPHH 2H1UA 4FUDA 1UVOA 5FX6A 1D3PB 1O0DH 2LP6A 3UB0A 3HKJB 3M7QA 4DURA 1UTNA 1CT2E 3QTVH 4JYTA 1J16A 2JIZD 4KGAA 1G3BA 4XFQA 3C1KA 1N6XA 2ZHDA 3S7HB 2V6NA 4D8NA 1MCTA 5T3HA 1HGTH 3SYJA 4IN1A 2GGVB 1L2EA 2V35A 4E7NA 1VJ9U 2ANKH 4CRBA 1ZTKA 1O2UA 4IBLH 1W0KD 2AGGX 4CBNA 3E90B 4LZ1H 1DLKB 1SGPE 3VB5A 1SMFE 4WMFA 4AG1A 2PGQB 1EPTA 1FY4A 1O3AA 1TYNA 2R3YA 4UD9H 1Z6EA 1A0JA 3SUDA 1D3QB 1TLDA 1XKBC 2BDBA 1DVAH 1A3BH 1YLNA 1GBTA 1LVMA 1Z6JH 2BQWB 2GD4B 2PFEA 2G51A 4AFZA 5LPEA 1C1NA 4O3TA 1PPGE 2J95A 2ZFSA 2SNWA 4BAKB 4AN7A 1TNIA 1VITH 1E1QD 1KLTA 2D1JA 2BY8X 5ESBA 4DVAU 2GP9B 1C4Y2 1QRZA 4THNH 2BQ6B 1SGDE 1ZMLA 1BMMH 1TALA 4MNWA 3RMLH 1GGDC 4ZXXH 3TIUA 1P11E 1A46H 2RCEA 4X2VA 3RXKA 3DCLA 5EJ1A 3W94A 2VIQA 4CRFA 1TX7A 1WU1A 1UVSH 1SKYE 1GBEA 3EA9A 4X1NU 4Q7ZA 3ZYDA 1O35A 2A7CA 4AB9A 1B7XB 1NN6A 3MU4A 2NU2E 2Q1JA 3SU3A 4FUHA 1W12U 2D26C 8ESTE 3KYFA 4A1VA 3GS9A 3OAAD 2Z3CA 1V2KT 1MBQA 1DITH 1HAGE 4DIHH 1QQUA 1QCPA 1AGJA 3RXSA 2BTCE 5C67A 4DIIH 1Y5BT 1ABJH 1AN1E 3MH5A 1F5RA 1SG8B 4WY3A 2C4FH 1RIWC 1GMCF 3PMJA 4ZHLU 1H8DH 3O8CA 1RXPA 2RA3A 3S9AA 1UHBA 1BOQA 4JK6A 2Q6GA 1P8VC 1TA6A 3D65E 2WPDD 1ABIH 4GHTA 4ZUHA 1G37A 3UNRA 1ZSLA 3ZVAA 3LKWA 1O2RA 2GCHG 2QXJA 4CRAA 1XUGA 3P8OA 3QDZB 2ZGXH 1XKAC 3ODDA 1O3LA 3ZZ8A 2EEKA 8GCHF 4X2YA 3KQDA 1SHHB 3H5CB 2FODA 3RMMH 4ABAA 2V0BA 4I86A 2OK5A 1C5WB 1UVUH 3GY3A 1IHSH 3MNSA 5C1YA 4LZ4B 1GHZA 1RTKA 3HATH 4CRCA 5A0AE 4CR5A 1YPMH 3KQ5A 1O2IA 3SGAE 2ZC9H 2ZDVH 1QTFA 1A5IA 1BTWA 5H4IB 2QF0A 1BTUA 2V3HH 1O2PA 1NFUA 3Q00A 3LGYA 1TPOA 3SV2H 1QY6A 1JWTA 4HTCH 2QGRA 1QJ6B 1TX6A 1CBWB 2FOGA 2W7SA 2WPJS 3M3VA 2ALVA 2XTTB 1YM0A 2SGDE 2ODQA 3E16B 4TPYA 5HKKD 5L6NH 4JZIA 2BY9X 3OY5U 1K0HA 5A2MH 2A1DB 1G30B 3T2NA 5CDFE 6GCHG 1W13U 2P93A 4JK5A 1SQRA 1WXRA 2A32A 4FUBA 2BDHA 4U32A 4WH6A 1GHBG 1H4WA 3RP2A 4AFSA 4MPVA 3SU6A 1O2JA 5GIBA 2J38A 3PYHA 1W0YH 1N1LA 1DE7H 2R0KA 4NWKA 1V2TT 2PSYA 5DK1A 4UFDH 6CHAB 1GBIA 2GT8A 1NPMA 1BRBE 4F4OC 1KDQB 2ZDLA 3RLYH 1P05A 1PPEE 3PLBA 3T28A 2XCFA 4XOJA 4AC9A 2TGDA 1SGFG 1WCZA 3V0XA 3P8GA 2K0QA 1DX5M 1C1UH 1A0HB 1GL0E 1O5BB 1S83A 1VCPA 4ZAEA 3A84A 3KNXA 2AIPA 2F9UA 1EQ9A 2ZHWH 2GZ9A 5C1XA 2CMYA 5DO4H 4FUCA 1LQEA 3BTDE 3PLPA 3UR9A 1MCVA 1YPLH 5EJZA 3QK1A 1T8OA 2ZF0H 3AAUA 3FVFB 3TK5A 3URCA 3GCTF 4Q4LA 4RI0A 4B75A 3DA9B 1OHHD 1G32B 3V7TA 1N8OC 4XRNA 7GCHF 1TMBH 1C4V2 4CHAB 1P2OA 2ULLA 5AHGH 4DT7B 1V2LT 1XXFA 2VWOA 5GJ4B 3A83A 2RDEA 3E6PH 1O34A 4INKA 1OWJA 4Y6DA 1GMDF 3SV7A 1T7CA 3K65B 3WWFA 3BTHE 1BHXF 3TVJB 3E3TA 2HALA 1DWDH 3OEHD 2C8XB 3BTKE 5FBEA 2NWNA 3Q76A 4Z6AH 1QJ1B 1ETSH 3VXFH 2QXHA 1HJ9A 2FO9A 2FLRH 2WV5A 2HPPH 1G3CA 1VR1H 2FI5E 5ETXA 4ZKSU 1ZSKA 2GV6A 2H6MA 4YOJA 1ZRKA 3MI4A 2Y82A 2KX4A 3LGIA 1K1OA 1ELBA 2J98B 1QNJA 2L74A 3FKSD 3SNBA 1GPZA 3OYPA 1MKXH 2ZQ2A 2J5UA 2F83A 2PUQH 1YWUA 3D49H 2GMTB 1ELGA 1W10U 1KXDA 4YM9A 3QZRA 1IQFA 3A8BA 1PQAA 2FM2A 3ITIA 3UQVA 1A5GH 4M9FA 4AG2A 4ABIA 1E79D 5T6FA 2QAAA 2OC8A 3A85A 4OM9A 4ZH8A 2BDGA 3EA8A 3SQEE 2BM2A 2EC9H 2VWLA 2AGEX 4H42U 1P3CA 5I25A 4KTSA 1T32A 1A61H 1VGCC 1TNKA 1ZMJA 5B6LA 3LGTA 1P09A 1OWHA 8KME2 1FONA 1GWAA 1W7XH 1NRSH 2ZU2A 1GI6A 1CE5A 3RXIA 4FXGH 3M7UA 1EASA 2ZKSA 2HNTF 3NKKA 1B0EA 3SOSA 2QC2A 1ZHMA 3H7TA 1IOEA 2F9OA 1P10A 1ZMNA 2ZCHP 3RXTA 5FPSA 3ZVGA 1KDQA 1H9IE 1XUIA 4Y7BA 4Y10E 1H8ED 2TBSA 4Y71A 1KXAA 1ARBA 4X1PU 5TJXA 2ZFPH 4ABBA 3O8DA 3F3BA 2C8ZB 1EFRD 4OGYA 5SGAE 1DANH 2ZGHA 1B5GH 2SGEE 3T25A 5F03A 1ZOMA 2ZTXA 1COWD 2ZGBH 2FWWA 3NWUA 1LVBA 1G3DA 2BMGB 4B2CA 1DWCH 1QRWA 3TK9A 1TNHA 2IJD1 3A7YA 4Q63A 5BPEA 2XXLA 2WYGA 2HLCA 3MHWU 1EX3A 1P9UA 2H5CA 3BSQA 3PMHB 3LONA 2BYAX 2GCTB 3DT0H 3EDXB 4NFEA 4D7FA 1P3EA 1TE0A 1HIAB 5E8EH 2FLBH 3RXAA 1S82A 1MTSA 3STJA 4WMDA 5FAHA 3VGCC 3K6YA 1J14A 5FCKA 4XBDA 2HNTC 3EGKH 5HIZA 1GJAB 3MH7A 2NU3E 5AVDA 1UTMA 1D6WA 3EAJA 2PSXA 4YT6H 1ELTA 2K1QA 1SQAA 3RXRA 1O5DH 4I7YH 4ZHMU 1LMWB 1C1SA 2ZCLP 2JJ1D 1S81A 4FUGA 2A45B 1AVWA 4GCHG 2YMSB 2G4TA 3RXFA 3BG4C 1MQ6A 1QR3E 4O97A 1P01A 1INCA 3LGVA 4NSVA 1EZQA 3W95A 1J17T 2OINA 3BTGE 1ZZZA 1AUJA 1Z8GA 1W7GH 3P92A 1ZLRA 3FN8A 3E8LA 1EKBB 4GVUA 3PTNA 4Y8XA 1SBWA 1LPZB 4D76A 3TGIE 1GJ5H 4A6LA 2YMSD 3Q3YA 1HJAB 1KXFA 5HXFA 3NXPA 3U8OH 4WJG2 1FIWA 4BXWA 3LJJA 2WPLS 1TRYA 2FTMA 2TGTA 3SHAH 3GY2A 2WPMS 5DP7A 1P06A 3TJUA 4RN6A 3SV9A 1C2IA 2OUAA 3RXBA 1BBRK 1OSSA 4JZFH 1MQ5A 2PGBB 2ZFRH 1TBZH 2FI4E 4ASUD 4E05H 1F5KU 1F0UA 1QA0A 4MNXA 3KHVA 1O2QA 1SB1H 1NC6A 1ANBA 1UK3A 2JH0D 3TGJE 3FZZA 1C5PA 1MZAA 1MKWH 4Z0KA 4F55A 1H8HD 1NM6A 2KZ4A 3PWBA 1XVOA 3P17H 1BTXA 4WXVA 5DG6A 1IAUA 2EQNA 2FDAA 3RM0H 1PYTC 1TQ7B 4ISIH 2H5DA 4RT0A 1QBVH 1FY5A 1LHCH 1SC8U 2ZTZA 1L4ZA 1UTKA 1W3CA 1O2ZA 3M37A 7LPRA 1NFYA 5CHAC 1WQVH 4U2WA 2HVYB 2L6OA 1O3DA 1W0JD 1MTNC 2PWXA 3ZVBA 2F3CE 1EJAA 3HGNA 3I29A 1DXPA 3MNBA 1HIAA 1BT7A 1W8BH 2ZU1A 1ELDE 3TLOA 3BN9A 3OTPA 4NGAH 3ZZ3A 2H9TH 3S9BA 5EW2H 1TPPA 1O2YA 2W6ID 2HVXA 3I77A 1PQ5A 2HNTE 1S0RA 3BTTE 3OSYA 1ARCA 1DUEA 4B71A 1O37A 1EJMA 1C1VH 1VCQA 4HZHA 1AKSB 2LELA 2D2DA 2Z6BD 3CNRA 1S0QA 1K2I1 2A4OA 4ESTE 4ABHA 3BIVH 1V2PT 2LPRA 1HRTH 1EZXC 5EGMA 4JYUH 2GCHF 1JIRA 1ZGIA 3ELAH 1Y8TA 2FOMB 2JJ2D 2R0LA 1BTYA 3ATWA 3RXOA 1THSH 3GY5A 4INLA 3N99A 4J2YB 1TOCB 5DKMA 1UTLM 1P2QA 4OS4A 1ELCA 5F6MA 3MMGA 2GZ7A 1J8AA 2UUFB 1O2MA 4AB8A 2ZNKH 1BRAA 2PKAA 2VBCA 3N7DA 4ABDA 4X8SH 4XD7D 8LPRA 1BITA 3TNTA 2BVXH 5GXPA 2IN2A 3B9FH 1Z71A 3GCHB 1HJ8A 1NTPA 1MUEB 1JIMA 3PWCA 3FP6E 2O8TA 5EODA 1E36B 1LCYA 4Q80A 4NIYA 1DUAA 5KEDA 4TY6A 4K5ZA 1C2JA 4O3UA 1EZSC 4FVBA 4HGCA 1Y5UT 1FDPA 1BMLA 3A82A 3RU4E 2VVCA 1LDTT 2F9PA 1TNGA 1G36A 3OEED 3QX5H 1OWIA 2O8LA 1K21H 3F1SB 4ISHH 4A7IB 2XW9A 4B76A 1TGTA 4Y76A 1GI2A 3F0PA 1G9IE 2ALPA 2PHBA 3SQHE 3MO3A 1GBFA 2OTVA 3SNAA 4NIWA 2VU8E 1C9TA 2BD8A 3MOCA 3F2FA 2OC1A 2BQ7B 2OP9A 2ZDMA 3SNDA 5T1VA 1N6YA 1UTOA 1HAXB 4NFFA 4Y8YA 1HAPH 1Y3XA 2WV4A 2BDCA 4K3JA 1GDUA 2ASUB 1SFIA 1GBLA 1Z8JB 4Y8ZA 3QN7A 3UAIC 3GYMA 4I8HA 2Z3EA 3ZVEA 4WMEA 1PJPA 1O2LA 3PRDA 1BQYA 3N7EA 5JBAS 1K1JA 2GT7A 3F6UH 3L33A 1EJNA 3NCLA 4IS5A 1MAYA 5JPMH 2CF8H 1EUFA 3JZ1B 3PO1B 1O2SA 3H09A 4KKDA 2KCOA 4B2AA 4AYVB 1BZXE 1AUTC 2FX4A 1QIXB 4X8TH 1FI8A 1K1MA 2C93B 3QLPH 3F2GA 3OY6U 3TPIZ 3RXLA 3RXUA 1OP2A 2IPQX 1DY8A 2SGQE 3DHKH 1AKSA 1J9CH 3MWIU 4B73A 5IDKA 4INHA 4NCYA 2NU0E 4QT8C 2EI6A 2V3OH 1KIGH 2VNTA 4O9VA 5KECA 1K9OE 3MYWA 1CBWC 2EI8A 1O2HA 3M5MA 4MNVA 3K6ZA 2R2MB 1O2KA 2Y5HA 1DWBH 1SLWB 4B2BA 1C4U2 1S85A 3A7XA 3MH6A 1WTGH 1D9IA 4AYYB 1OKXA 2WUCA 1GVLA 1NRQH 1QBOA 1YGCH 2XNIA 4BAHB 4Y79A 1ANEA 2XWBI 1RFNA 2VIWA 4BTTB 1TRNA 3EE7A 1GMHF 3RXEA 4FU8A 1C5YB 1TBQH 3DSOA 2TPIZ 4MDSA 3L3TA 1FX0B 3QZQA 6CHAC 1BTHH 2ZPRA 1A2CH 2H9EH 1WYKA 2GTBA 1AB9B 2QE7D 2ZDNA 1IQGA 1GL1A 2I6QA 2M5TA 1NT1A 2P16A 1DDJA 2XRCA 2XWAA 5AFYH 1O39A 1GBAA 3IWMA 1C1TA 2BY6X 1ZSJA 1SQTA 3SJ8A 3TITA 2F9VA 3P70B 4CBOA 1AI8H 1TGSZ 2FOHA 1H9HE 1CQQA 1PPFE 3A8AA 1AE5A 1ZPBA 3GICB 1LPKB 4ACAA 3KGPA 1EB2A 2C90B 3UY9A 1MABB 2QXIA 1RJXB 3UNQA 1P2IA 4FETA 4ABJA 1J15A 1OYTH 1GCTB 1GJ7B 3TH3H 1OWDA 1CHOG 1F0SA 5LH8A 1O5EH 2JETB 1BDAA 1F5LA 4TY7A 2J92A 5E0JA 3MU8A 1FPCH 4CHAC 2Z9JA 4KTCA 2RDLA 2QY0B 3T62A 1C5LH 3OFND 3KQEA 1UK4A 5IYTA 3UR6A 2FPZA 2ANWA 3MU5A 1O32A 2VIDA 4RKOB 1SHYA 3LJOA 1VZQH 2F91A 2FS9A 2QV1A 2OBOA 1V2ST 5PTPA 1AWHB 4X8VH 1K22H 1DT2A 3A86A 4X0WU 3VG8A 3MO9A 1O5GH 1SR5C 4MPXA 4OS6A 2UUJB 3M7TA 5GWZA 2BD4A 4P02A 2Y81A 1ZR0A 1NO9H 2A2XH 6ESTA 3KEEA 4OS1A 3SZEA 5CE1A 3SI4H 3TJOA 2GMTC 4XBBA 2BLQA 2OLGA 1GJ4H 2OQ5A 1P2NA 1KY9A 4UE7H 2BXUH 1EOLA 1FIZA 1NBMD 3VFEA 1LHEH 2PV9B 2VGCB 3CS0A 1V6DA 3O8RA 1IQKA 1K1NA 3CENA 4O03A 3FP8E 3SO3A 4FUJA 1O5AB 2IJOB 2OQUA 3OU0A 2FIRH 1ZPZA 3MU0A 1TNLA 4GCHF 1O31A 1TAWA 3BIUH 1FUJA 1MU6B 2Z9IA 4K8BA 3F0OA 1TPAE 2F43B 1AO5A 1DY9A 5E2PA 1GHXH 1QHRB 1SGRE 2ZDKA 1RGQA 5T6DA 1DLEA 4NSYA 3S9CA 2BDAA 1OP8A 2KCAA 3BTME 1XMNB 2B5TB 5EXNA 5FBIA 1ETTH 1T8NA 1GJ8B 3EA7A 4H4FA 5EOKA 1C5SA 3DUXH 3LDXH 5EU8A 4BAMB 2P8OB 1KTSB 1P04A 1HAIH 1MAXA 2J94A 1AD8H 3UNSA 1SGYE 1BTZA 1CA8B 1ELVA 4AGKA 1XUFA 4GPGA 2W6JD 2F9NA 2Z94A 4IGDA 1WOFA 4F49A 4K69A 4Q7XA 2Y80A 2OC0A 1LKBA 1C5XB 2A0QB 1YY3A 1YC0A 2V7QD 3QGJA 3KL6A 4P00A 1C1MA 2TGPZ 2WSSD 3Q77A 1XUJA 1L1NA 4AZ2B 2FOCA 1GVZA 2R2WU 3ESTA 3RXMA 2GCTC 2SGFE 2G00A 2EY4C 5TCCA 3LPRA 4UDWH 3T27A 1GMCG 1O2VA 1QZ8A 1XX9A 1YCPM 2I6SA 3M61U 5LGOA 2IPHA 1SGFA 3RC4A 1P0SH 3U28C 2TIOA 4I33A 1D3DB 1KXEA 1SGEE 2BZ6H 2PP6A 5C0TA 3KQBA 3O8BA 1GJ6A 1SGNE 4NIXA 4I8KA 2FOAA 3GDVA 3ZZ4A 2ZTYA 5C1UA 1AFQC 2HPQH 5DP3A 2JKHA 8GCHG 1F2SE 2GDEH 1JRSA 3ATIA 1FAXA 5TCAA 2QXGA 3GY7A 5BRRE 3SN8A 2YMSC 3SJOA 4JYVH 3ATKA 4IW4E 4IMZA 1HAOH 4H6SB 3LGWA 1NFWA 1TWXB 3DSPA 5A09A 1L1GA 3P6ZB 3M5NA 3GY6A 2OCVB 5GPIB 2FOFA 3E0PB 1K1PA 1T4VH 1YCPK 5EIYA 1O38A 5LPRA 3T5FH 3E0NB 5EXMA 4DCDA 1UTJA 2ZQ1A 3RXVA 3ZZ6A 2ZHFH 3I78A 4K8YA 2Q6FA 9LPRA 4MPUA 1HJAC 3WW7A 9ESTA 1P2MA 1P12E 1C5OH 5F8XA 1H1BA 3SJ9A 2BXTH 3PB1E 4F48B 1O33A 1DFPA 3A8CA 1BBRE 3SU2A 5HIYA 4WXIA 2P3UB 1PPZA 1LTOA 5C17A 3RXHA 2SGAA 3SZNA 2G8TA 5FPYA 2FI3E 2J34A 1SVPA 1IQJA 3SGQE 3R3GB 3VB6A 3BG8A 1C5VA 4BANB 3TH4H 5ABWA 2WHXA 4KELA 3HGPA 1W14U 2JDID 3MFJA 1UVPA 1ORFA 1TGNA 1EOJA 1YF4A 3BEFB 2KAIB 1VKYA 1Y5AT 1AFQB 4JMYA 5C94A 2FP7B 4IMQA 1V2WT 3U1JB 3GYLB 2STAE 3F2HA 4VGCB 1KTTB 3UTUH 4J1YA 5JBBS 3SORA 3QUMP 4K1SA 2ZI2H 2J98A 1NRPH 2OXSA 1RS0A 4AFQA 3RXPA 3GDUA 1NROH 1WV7H 1ZHRA 2Y7XA 3KIDU 1HFDA 1E38B 3FAOA 1A4WH 3TU7H 1QURH 4BNRA 2B0FA 1BA8B 1ANDA 2SNVA 1NFXA 5FX5A 4Y11E 1Q3XA 3OX7U 2GDDA 1V2QT 3A7VA 1O3FA 2XBXA 5JB9S 1BRUP 3MNCA 1QQ4A 4Q7YA 2A5AA 1EAWA 2AHME 1VCWA 2BY5X 1GBHA 3RMOH 2J9NA 2VIVA 3C27B 4XE4A 2ZHQH 4ZKRU 5EG4A 1LO6A 1GMDG 5K7RA 1CGIE 4UFFH 1E0FD 3KYGA 3SU4A 4ACBA 1PFXC 1GHWH 1RRKA 2ZA5A 3QWCH 1MH0A 5CHBA 2XBWA 1A3EH 1E37B 4YLQH 1GJBB 3UIRA 2NU4E 1GBCA 5L30H 1C1PA 1O3GA 1BJUA 1TOMH 1SI5H 2A2QH 2TRMA 1CHGA 1QA7A 3B23B 2RG3A 1TX8A 1HAVB 1O3CA 1TFXA 5K0HA 1O3KA 2PLXA 2ZPQA 2CV3A 2HRVA 3A7TA 5E0HA 1C9PA 1HAZB 2QIQA 4X2WA 1O3MA 2HWLB 1O2XA 1GHAG 1BBRH 5HMAA 3UWJH 2BD5A 3URDA 3GCHC 4Y0ZE 5DSFA 2BY7X 3SJIA 1NZQH 2DUCA 4DT4A 1ZGVA 1EB1H 1QJ7B 5EJLA 2XNDD 4NZQA 3RC5A 1ZTJA 1GG6B 3VB3A 3BTEE 3JZ2B 1AFEH 5F8ZA 2P3FH 5DP4A 4DJZB 3V12A 1S84A 2CHAB 1Y3YA 1OYQA 3M35A 3RXJA 1FNIA 2ZZUH 2FOEA 3SU1A 1JXPA 3PMAB 3GCNA 4LOYH 1ID5H 1T8MA 2AS9A 4OS5A 4TT3D 1L1JA 1SGIB 1VJAU 1IQHA 1UTQA 4I32A 4RSPA 5JB8S 2BZAA 4IN2A 1LKAA 2ZO3H 4D9RA 3RXQA 1C1QA 5DN6D 1EPTB 1WQSA 2OBQA 2W3IA 2XC5A 4BOHA 1MTVA 4Q2KA 3AW1A 3VXEH 3GISB 1GHVH 2KAIA 2BVSH 2VH0A 1EP6A 3NZIA 3RLWH 4UONA 3HPTB 4GLYA 1YP9A 3PROA 1NY22 1GJ9B 1VITG 5DP6A 4JZ1A 3UREA 4M7GA 1KLIH 2B8OH 4IC5A 3HKIB 1O3IA 1ZRBA 1THPB 4GAWA 1FN8A 4BTUB 1FLEE 1NRNH 2HLDD 3P8NA 4D7GA 2ZWLH 2ANMH 1GBKA 1GI5A 1ELAA 5HYOA 5J4QA 3PO1C 2UUYA 2XOKD 3RDZA 3VPKA 2NU1E 1V2NT 1WAYB 1QGFA 1S6HA 2O9QA 1UCYK 2QN5T 4CRGA 1C2MA 1CSOE 1C2DA 2BLOA 3A80A 4MPWA
chains in the Genus database with same CATH topology
1FY8E 1MMJN 4XDEA 1FXYA 2RA0A 1AVGH 1PPBH 1BRCE 1CGJE 3BEUA 4YTAA 3SUEA 3UOUA 2Q6DA 1BUIA 4BAQB 4BTIB 2BD2A 6LPRA 2VIPA 2J4IA 1NESE 1YPKH 3M3TA 1BJVA 1O3PB 2CXVA 6GCHF 1PPCE 1F7ZA 3STIA 1GHBF 4X6NA 1O3HA 5C2ZA 1C2KA 3G01A 1A7SA 1OP0A 3ZZCA 3RC6A 1GBDA 1O3OA 5I46H 2UWLA 1OPHB 3SJKA 1PYTD 1A1RA 1IQMA 1IQLA 1ZJKA 1H9LB 2BX3A 4A5TS 2EA3A 3F9HA 5JDUB 4GUXA 1A0LA 1OX1A 2AMPA 1EAXA 2GZ8A 1HNEE 4UFEH 2AMQA 3M5OA 3TNSA 1Z8RA 5EW1H 5GDSH 2BOHB 3LIWA 4K60A 1LPGB 4ABFA 1O3BA 1GBMA 3SUGA 1BIOA 1YLDA 5EQSA 2P3TB 2AIQA 4DG4A 2WPIS 1RTLA 3SNCA 3FZDA 5L2YH 1AB9C 1W11U 3D62A 2VWNA 1M9UA 1MD8A 2P95A 2H2ZA 2P94A 1FMGA 2Y5FA 1CA0B 4GHQA 1F0TA 3ZZDA 2FMJA 3EE0B 3BF6H 2VH6A 3TK6A 2A7HA 2G4UA 1UVTH 1SLVB 2W7UA 2ZHEH 2FX6A 2GV7A 1TNJA 2P59A 2PTCE 3A88A 4CRDA 5C5NA 4HI3A 2THFB 2ZU5A 4GSOA 1EATA 4U30A 2O8MA 2CJIA 1RD3B 3M3SA 1GCTC 5AF9H 1GVKB 1W2KH 1Z7KA 1AMHA 1SGTA 3HK6B 3Q3KA 2Z9KA 2GVFA 2B9LA 4AFUA 1MU8B 2JETC 1L0ZA 2QYIA 5C3NA 3R0FA 4X6OA 1S6FA 1SFQB 4CR9A 1OXGA 1SLXB 1KXBA 3SU0A 1IQEA 3SV8A 4WH8A 2GX4A 3SW2B 1GI4A 5DPAA 4FUIA 2FXRA 2ZU3A 3UOPA 2FEQH 2Z3DA 1QB9A 4ZXYH 3U8TH 1T4UH 2BX4A 2PKSB 3BTFE 2AFQB 2Y7ZA 1QRXA 1ZTLA 4FVDA 2YNBA 3ZZAA 2W5EA 4IC6A 3ZVFA 1GJCB 3KF2A 1GI3A 4NIVA 1F92A 2ZG0H 1BMAA 5FCRA 1C2HA 2B7DH 1ANCA 1YKTA 2D8WA 3TJVA 4NA7A 2ESTE 1DICA 4WF8A 3RU4T 2XBYA 3A87A 1DSTA 5FPTA 3GOVB 3GY4A 3CS7A 3ATMA 1C1WH 3SBKA 2AGIX 1EAUA 1V2MT 1G2LA 2HOBA 3ZYEA 1B0FA 1ELEE 2VGCC 1SL3A 1P03A 3AAVA 4MVNA 1CT0E 1O3EA 1CT4E 4OS2A 1XUKA 2ODYB 1QBNA 4SGAE 4A1XA 1OS8A 4X1QU 4X6PA 4TPIZ 2G5NA 2FZZA 1UMAH 1C2FA 1PQ8A 3UFAA 1ESAA 1GGDB 2O8WA 4XBCA 3CP7A 3KCGH 5GCHG 1TMUH 4JCNA 1GBBA 4NG9H 4U01A 1ETRH 4CH2B 3BTQE 1O36A 1V2OT 1G3EA 4ZKOU 2WINI 1EP5A 1SGQE 1ZPCA 2FOBA 4DW2U 2P8OC 4I31A 3K2UA 2H9HA 1C1RA 2JH6D 1C2EA 1P57B 1YPJH 4B1TA 4BAOB 2C3SA 2F9BH 1YPEH 1NU7B 1TGCA 5A0CA 4A92A 3SU5A 1TRMA 1HAYB 4ASHA 2PW8H 4DY7B 2A4QA 3EYDA 1RIWB 5LPFA 2ZFQH 1Q31A 3U9AH 1HXEH 3VEQB 3FFGA 5A8XA 2UUKB 1TPSA 3UUZA 5EQRA 2EI7A 2HGTH 4B74A 1E35B 4D9QA 4DGJA 1FZZA 4MG3A 1FV9A 4FUFA 1C5TA 3PTBA 4X6MA 2A5IA 2YOLA 3U1IB 7ESTE 1DOJA 2ZPSA 1GDNA 4LXBH 1V2VT 1NU9A 3SI3H 3SV6A 1GBJA 2XBVA 4AGJA 5JBCS 3A81A 1EXFA 2JH5D 1DS2E 2ODPA 2GKVE 2AEIH 3BV9B 3PLKA 1OWEA 5JBTA 3DFLA 1KYNA 3NK8A 4I8LA 1TQ0B 1C5ZB 4I8GA 1AZZA 1UTPA 5A8ZA 2ILNA 3LT3A 2G52A 5C5OA 3PV4A 4I8JA 2ZECA 1MZDA 2FYQA 3PMBB 3MO6A 4YZUA 2DE8A 2AMDA 1JOUB 2ZFTA 2QCYA 1C1OA 3A89A 1C5UA 1UK2A 1KLJH 2W26A 1FQ3A 3LGUA 1XVMA 1CVWH 1PPHE 2QF3A 1QFKH 3A7WA 3ODFA 1AU8A 2XC4A 1MKXK 3LOXA 1Y3UA 4ZKNU 3TH2H 1HBTH 1GI8B 1Y3VA 3GDSA 3RXCA 1D6RA 1ESTA 1XXDA 1EZUC 5E2OA 1AQ7A 5C20A 3AVZA 3F9EA 3RXDA 5DP8A 4JZDH 1GHAF 1LHFH 1ZJDA 3F9FA 1ACBE 1Z8IB 1DXWA 1GMHG 2BD7A 1GI9B 1FN6A 4NA9H 2BD3A 1TA2A 3P95A 2OC7A 1NS3A 1DM4B 4UFGH 2G55A 3D23A 4TWYA 1THRH 1JRTA 2A7JA 4X1SU 2WUBA 3OTJE 1MTWA 2XYAA 2ZP0H 3ENSB 1L4DA 1V2RT 5AFZH 5A0BA 1CU1A 3VB7A 1JMOH 2J2UA 1MBMA 1CO7E 1V2JT 1HPGA 3LH3A 2A4RA 1O5CB 4VGCC 1P2JA 2C8WB 1O2TA 2CN0H 1O3NA 4MNYA 1TABE 1H8IH 3Q3XA 3RM2H 1YPGH 2BVRH 1N8OB 2VVVA 3ATLA 1D3TB 1MD7A 4KTUA 2R3UA 3VB4A 2BDYA 2ZFFH 1SLUB 3EQ0H 5L2ZH 1AHTH 1P2KA 4YO9A 5J4SA 4R0IA 4ABGA 1SQOA 2FYRA 2XC0A 2BB4A 1AVXA 5G4BA 1C2GA 5HM2A 1WUNH 1YPHC 2YNAA 1T8LA 1TMTH 2WYJA 1V3XA 1TGBA 3F68H 1VITF 4OGXA 1C5NH 3ZV8A 1YCPH 1E34B 3MH4A 4YOGA 3U69H 7KMEH 4AOQA 4E06H 2A31A 3UQOA 2DE9A 1RTFB 4X2XA 3KN2A 4AX9H 5DP5A 2BDIA 2LNCA 1KSNA 4TWWA 1W0ZU 2CGAA 3BEIB 1GI7B 1O30A 2SGPE 3ZZBA 2FS8A 2BHGA 3NPSA 1YLCA 2W3KA 2ZCKP 4R8TB 1Z1IA 1AZ8A 1X7AC 2XCNA 1HYLA 1YBWA 2BD9A 4YT7H 3A8DA 1SOTA 1GG6C 1K1LA 1VGCB 2Y6TA 3ZZ9A 2ZGJA 1A5HA 1T31A 3AW0A 1AWFH 2G5VA 3UWIA 3H7OA 1BHXB 3GY8A 4ISOA 2AYWA 1DPOA 1ZHPA 2CF9H 2CHAC 5EPYA 4HFPB 5A8YA 4WVPE 1TB6H 3SGBE 3QO6A 1LHGH 3E91A 3GCTG 3T29A 4YESB 1C5RA 3B8JA 4ISLA 3GCOA 3SUFA 7GCHG 1QB6A 1TONA 2VINA 3F9GA 4KP0A 1K1IA 2WPHS 1WTHD 1TIOA 2PKAB 1EPTC 3IG6B 2BLVA 1LHDH 2VB0A 1O5FH 2BOKA 2STBE 4H6TA 1BMNH 3NUMA 3A7ZA 4XSKU 2Z9GA 1GHYH 1UO6A 3TJNA 1XM1A 1ZYOA 1F0RA 1C2LA 1HV7A 5T6GA 1OWKA 1SGCA 1TBRH 1C5MD 2A4GA 4YLUA 1PQ7A 3MU1A 1QL8A 1D4PB 3RMNH 4FU9A 1ELFA 3LH1A 1BCUH 1C5QA 1G2MA 3ZVDA 1MKWK 2Z7FE 4CH8B 4K1EA 1UCYE 3TGKE 1AY6H 2PTNA 5FXLA 3QGNB 4MLFB 3MTYA 1MTUA 1LVOA 1V2UT 1P9SA 1DSUA 2ZIQH 3IITA 1WSSH 5ESTE 3VGCB 4UEHH 3K9XB 1YPHE 5DJ7A 5B6OA 5JYIA 1WBGB 5E0GA 4SGBE 2C8YB 3LU9B 3RXGA 2WPKS 2TGAA 1SOZA 5F8TA 3V3MA 4AORA 1BTPA 3S69A 3FP7E 3V13A 1O2WA 2G81E 3BG4B 1AE8H 4YOIA 1O2OA 1SPJA 5FHTA 2UWOA 1P02A 1HDTH 4NZLA 4X1RU 3ZZ7A 3S7KB 4NWLA 1HLTH 1O2NA 1UJ1A 2ANYA 1IQIA 2UWPA 2Y5GA 4FUEA 1CGHA 1LVYA 5EQQA 3SNEA 4BXSA 4WWYA 4ZMAH 1QL7A 2VJ1A 4Y7AA 1EAIA 1S5SA 1SSXA 3MNXA 4NA8A 4RKJB 2VVUA 3UPEA 3E1XB 2ZGCA 4CREA 4TYDA 2AERH 3U98H 2Z9LA 1FAKH 1K28D 2PR3A 4K1TA 3WY8A 1GCDA 3P8FA 4MTBA 1HCGA 1IQNA 1QB1A 4ZROA 3M5LA 2OD3B 4FU7A 2FTLE 2O8UA 5EPNA 3BTWE 4ZHAA 5CMXH 1FJSA 4JZEH 1Y3WA 4LK4A 3T26A 3AASA 3RUOA 1CA0C 4ISNA 3ZVCA 1O3JA 1CHOF 4A1TA 3RU4D 1FY3A 1QL9A 1Z1JA 3SHCH 1ESBA 4Y0YE 2PUXB 5GCHF 1BB0B 1AIXH 1UCYH 5EXLA 3U8RH 3LC5A 2FESH 1OOKB 3DFJA 1UHBB 2ZU4A 2IOTA 1GI0A 4K2YA 4X8UH 2QA9E 2A5KA 5DP9A 1HB0B 1GDQA 3KQCA 1HAVA 1O2GH 3HK3B 3ZV9A 4OS7A 3LC3A 2ZEBA 1JBUH 4E7RG 2VIOA 3DD2H 4PROA 5CHAB 2SFAA 2VWMA 3QTOH 3ZZ5A 1DWEH 1LQDB 5HM9A 1MTNB 1HUTH 1U6QA 2ZDAH 3S0NA 1FY1A 5HGGA 3PM3A 1Q2WA 1NRRH 2R9PA 3M36A 1GI1A 1HXFH 4DOQA 3FANA 3L6PA 1Y59T 2BLWA 1GJDB 2AH4X 5DGJA 1XUHA 1HAHH 3N7OA 2PKSC 4MQAA 1YYY1 1IHTH 1KXCA 4ABEA 1FPHH 2H1UA 4FUDA 1UVOA 5FX6A 1D3PB 1O0DH 3HKJB 3M7QA 4DURA 1UTNA 1CT2E 3QTVH 4JYTA 1J16A 4KGAA 1G3BA 4XFQA 3C1KA 1N6XA 2ZHDA 3S7HB 2V6NA 4D8NA 1MCTA 5T3HA 1HGTH 4IN1A 2GGVB 1L2EA 2V35A 4E7NA 1VJ9U 2ANKH 4CRBA 1ZTKA 1O2UA 4IBLH 2AGGX 4CBNA 3E90B 4LZ1H 1DLKB 1SGPE 3VB5A 1SMFE 4WMFA 4AG1A 2PGQB 1EPTA 1FY4A 1O3AA 1TYNA 2R3YA 4UD9H 1Z6EA 1A0JA 3SUDA 1D3QB 1TLDA 1XKBC 2BDBA 1DVAH 1A3BH 1Z6JH 1GBTA 1LVMA 2BQWB 2GD4B 2PFEA 2G51A 4AFZA 5LPEA 1C1NA 4O3TA 1PPGE 2J95A 2ZFSA 2SNWA 4BAKB 4AN7A 1TNIA 1VITH 1KLTA 2BY8X 2D1JA 5ESBA 4DVAU 2GP9B 1C4Y2 1QRZA 4THNH 2BQ6B 1SGDE 1ZMLA 1BMMH 1TALA 4MNWA 3RMLH 1GGDC 4ZXXH 3TIUA 1P11E 1A46H 2RCEA 4X2VA 3RXKA 3W94A 2VIQA 4CRFA 1TX7A 1WU1A 1UVSH 1GBEA 3EA9A 4X1NU 4Q7ZA 3ZYDA 1O35A 2A7CA 4AB9A 1B7XB 1NN6A 3MU4A 2NU2E 2Q1JA 3SU3A 4FUHA 1W12U 2D26C 8ESTE 4A1VA 2Z3CA 1V2KT 1MBQA 1DITH 1HAGE 4DIHH 1QQUA 1QCPA 1AGJA 3RXSA 2BTCE 5C67A 4DIIH 1Y5BT 1ABJH 1AN1E 3MH5A 1F5RA 1SG8B 4WY3A 2C4FH 1RIWC 1GMCF 3PMJA 4ZHLU 1H8DH 3O8CA 1RXPA 2RA3A 3S9AA 1UHBA 1BOQA 4JK6A 2Q6GA 1P8VC 1TA6A 3D65E 1ABIH 4GHTA 4ZUHA 1G37A 3UNRA 1ZSLA 3ZVAA 3LKWA 1O2RA 2GCHG 2QXJA 4CRAA 1XUGA 3P8OA 3QDZB 2ZGXH 1XKAC 3ODDA 1O3LA 3ZZ8A 2EEKA 8GCHF 4X2YA 3KQDA 1SHHB 3H5CB 2FODA 3RMMH 4ABAA 2V0BA 1C5WB 1UVUH 3GY3A 1IHSH 3MNSA 5C1YA 4LZ4B 1GHZA 1RTKA 3HATH 4CRCA 5A0AE 4CR5A 1YPMH 1O2IA 3SGAE 2ZC9H 2ZDVH 1QTFA 1A5IA 1BTWA 5H4IB 2QF0A 1BTUA 2V3HH 1O2PA 1NFUA 3Q00A 3LGYA 1TPOA 3SV2H 1QY6A 1JWTA 4HTCH 2QGRA 1QJ6B 1TX6A 1CBWB 2FOGA 2W7SA 2WPJS 3M3VA 2ALVA 2XTTB 1YM0A 2SGDE 2ODQA 3E16B 4TPYA 5L6NH 4JZIA 2BY9X 3OY5U 5A2MH 2A1DB 1G30B 3T2NA 6GCHG 1W13U 2P93A 4JK5A 2A32A 4FUBA 2BDHA 4U32A 4WH6A 1GHBG 1H4WA 3RP2A 4AFSA 4MPVA 3SU6A 1O2JA 5GIBA 2J38A 3PYHA 1W0YH 1N1LA 1DE7H 2R0KA 4NWKA 1V2TT 2PSYA 5DK1A 4UFDH 6CHAB 1GBIA 2GT8A 1NPMA 1BRBE 4F4OC 1KDQB 2ZDLA 3RLYH 1P05A 1PPEE 3PLBA 3T28A 2XCFA 4XOJA 2TGDA 1SGFG 1WCZA 3V0XA 3P8GA 1DX5M 1C1UH 1A0HB 1GL0E 1O5BB 1S83A 1VCPA 4ZAEA 3A84A 3KNXA 2AIPA 2F9UA 1EQ9A 2ZHWH 2GZ9A 5C1XA 2CMYA 5DO4H 4FUCA 1LQEA 3BTDE 3PLPA 3UR9A 1MCVA 1YPLH 3QK1A 1T8OA 2ZF0H 3AAUA 3FVFB 3TK5A 3URCA 3GCTF 4B75A 3DA9B 1G32B 3V7TA 1N8OC 7GCHF 1TMBH 1C4V2 4CHAB 1P2OA 2ULLA 5AHGH 4DT7B 1V2LT 1XXFA 2VWOA 5GJ4B 3A83A 3E6PH 1O34A 4INKA 1OWJA 4Y6DA 1GMDF 3SV7A 1T7CA 3K65B 3BTHE 1BHXF 3TVJB 3E3TA 2HALA 1DWDH 2C8XB 3BTKE 5FBEA 2NWNA 3Q76A 4Z6AH 1QJ1B 1ETSH 3VXFH 2QXHA 1HJ9A 2FO9A 2FLRH 2WV5A 2HPPH 1G3CA 1VR1H 2FI5E