4ZKNU

The crystal structure of upain-1-w3a in complex with upa at ph5.5
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
246
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 245
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zknU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zknU01
1L4DA 1FN8A 1DFPA 2GKVE 1WYKA 2FM2A 2C8ZB 2GDEH 4Y8YA 2ZO3H 2EI6A 1NM6A 5GIBA 2VWMA 4XBCA 4YOGA 3SJ9A 2A4QA 3JZ1B 4D7FA 1HAYB 2O9QA 3M5LA 2HRVA 3IG6B 4CR9A 2DE8A 2BXTH 2ZTXA 2CGAA 3C1KA 1FPCH 5EODA 2OINA 1EKBB 1V2OT 2G4TA 2WPLS 1TE0A 1PJPA 2O8MA 3GICB 1LHGH 2OCVB 2RCEA 4UE7H 2D1JA 1HJ9A 4AFQA 3ZYEA 5TCCA 3DT0H 3LGUA 4B2BA 1Y5AT 2GV7A 1KLIH 3K6ZA 1HXFH 3BEUA 4FVDA 5EW1H 1DS2E 1JRTA 4MLFB 5DP5A 1MKWK 3GDSA 1IQFA 2ZFRH 4GSOA 2PTCE 4CREA 1CBWC 5TJXA 3T25A 1A3BH 2VIQA 2FLRH 3M37A 4O03A 3ZVAA 5H4IB 3SJOA 1QGFA 3AW1A 1UTQA 1BTYA 4F4OC 1SQOA 4AYVB 1F5LA 5HXFA 3KQDA 5FXLA 1O2ZA 1VCQA 2PWXA 3HK3B 1TPPA 1K1NA 1O30A 1C2KA 4KTCA 3M5NA 1QIXB 3B9FH 2ANWA 3M5MA 2BQ6B 2ZU1A 4B2AA 4MNXA 4AB8A 1A3EH 1OWJA 3MU8A 4Y76A 3VB7A 1TPAE 4MPWA 1SLWB 1SVPA 4DW2U 1SGCA 2BVXH 4YO9A 1EZSC 1O33A 2EI7A 4K1TA 4ABHA 1F7ZA 2A4GA 4BANB 1UCYE 3BN9A 3A7WA 3SO3A 3U8OH 2FOAA 1W3CA 1MKXH 1NFWA 4JK6A 4WMEA 1GWAA 2HNTF 1GHVH 1ELEE 1YPEH 1TQ7B 1TNGA 3L3TA 2ZU5A 2BTCE 4YZUA 4TY6A 2ODPA 2PKAA 3GYMA 5JPMH 5ABWA 3LDXH 2SFAA 2BLWA 2Y80A 1HAVB 3U98H 3UNRA 1SSXA 1AI8H 1SQTA 3RC5A 4U30A 4WXIA 1ZOMA 1V2LT 3AAUA 3U8TH 4X8TH 1QCPA 2FS9A 3RC6A 1YM0A 4FXGH 1Z71A 4FU9A 1ZR0A 3BSQA 3T29A 3P8FA 4R0IA 1BMLA 1BRCE 2EEKA 1BOQA 1CVWH 1TX7A 1BMAA 2GP9B 4A1TA 1A5GH 4NCYA 1VITG 4B73A 4ABJA 2GX4A 2ZPSA 1F0TA 1WQVH 2FESH 3TVJB 1GJBB 1AZ8A 1P12E 1O5FH 1GL0E 5C1XA 2A7JA 5JYIA 1EPTB 3ATWA 1GHXH 2FOMB 3DA9B 1O2TA 3OU0A 4Y71A 4ZKRU 4Y6DA 1XXFA 1D4PB 4QT8C 1O2OA 1O3AA 2PUQH 5C1YA 1HIAB 1SOZA 5CHAB 1C4U2 1S5SA 2TGDA 1TQ0B 3F9GA 3LH3A 1UTKA 1XUIA 2H6MA 1QURH 3M7QA 4KELA 3HGPA 3ODFA 2CJIA 1L1JA 2QV1A 3SQHE 3TNTA 1G37A 3P8NA 4HZHA 1GVLA 3VPKA 2ZI2H 3QN7A 5DJ7A 1D9IA 1FJSA 1N1LA 1DOJA 1FDPA 1IQGA 1O2VA 4NIYA 1HYLA 4GHTA 4NWKA 6LPRA 1FAKH 3P95A 3BIUH 2Y5HA 3A8DA 1AMHA 3K2UA 1DICA 1A0LA 3SUEA 4BXWA 1PPFE 1GBCA 1FONA 2OBOA 2XNIA 4FUIA 3VGCB 2C8WB 4IS5A 1QL8A 1MZAA 4B74A 3U1IB 1Z8GA 3MU4A 1TYNA 2TIOA 3RXQA 3AASA 1IHSH 1FNIA 2R3UA 2Z94A 3FAOA 1C5QA 1O31A 1Z1JA 3EA9A 3ZZ9A 2PKSC 5EPYA 1OP2A 2ULLA 3S7HB 1C2GA 4X6PA 1MTNC 1O36A 3HPTB 3I77A 1T8MA 1KXDA 1HAPH 1NU9A 3RXJA 3SQEE 5F8TA 1C2HA 4D9QA 3ATIA 4OGYA 4AFUA 1SFQB 1TNIA 1B0FA 2VWNA 1BBRE 2HPQH 3FP6E 2ZHFH 4MVNA 2XW9A 3ZVBA 4U32A 5AHGH 3A7VA 5DP7A 1UTNA 4Y8ZA 4BXSA 1DM4B 2D8WA 1C2LA 5DKMA 2BDCA 4I33A 1TFXA 2M5TA 3S9CA 2O8WA 3A7XA 1TWXB 1X7AC 2AYWA 4FUJA 1WOFA 1P04A 1KXFA 2JH0D 1TBZH 4IBLH 2GGVB 2OUAA 5BRRE 2GD4B 1GDQA 4PROA 1WUNH 2BLVA 4GHQA 3MYWA 1HAVA 4WH8A 4B75A 2XBXA 1MQ6A 1C1OA 2AERH 2Y82A 2HWLB 1CBWB 1HB0B 3KEEA 1EZUC 1RTKA 1GJ7B 1Q2WA 2PFEA 4H6SB 1GDNA 2ZPRA 1O2QA 1GBEA 1PPEE 4KGAA 1Z7KA 5T3HA 4F49A 5FHTA 4TWYA 4RKJB 1RJXB 1P02A 1LQEA 4NFFA 1C1MA 4O3UA 1BRAA 1GMDF 1BQYA 1O35A 1V2ST 1ANBA 1SLVB 1DWDH 1A0JA 4A92A 2WUBA 3NWUA 1EATA 1UHBB 1P2OA 1AD8H 2AMQA 9ESTA 1Y5BT 2RDLA 1EPTA 1GBAA 2XXLA 3F9FA 3RMNH 5DP3A 1HCGA 2PTNA 3HKJB 2JKHA 1QL9A 1UVOA 1O3FA 5AF9H 1IHTH 1LTOA 3BTHE 2RA0A 1HIAA 1ID5H 1HRTH 1PQ5A 1XKAC 1XX9A 1FY8E 1ZYOA 2HPPH 4UDWH 1QJ1B 2XWBI 1EXFA 1TIOA 3LGIA 1QRZA 4UFEH 1B5GH 1O3GA 1GGDC 1GI6A 3RXPA 4JZIA 5EW2H 3LGTA 3K9XB 2PLXA 3FFGA 3P8GA 4I8LA 4R8TB 3VB4A 1SGQE 3LONA 1C5WB 1FN6A 1IOEA 1GI7B 1NN6A 3LC5A 3SU2A 3LGVA 1EQ9A 3E91A 4U2WA 3NCLA 3GCNA 1L0ZA 1PPGE 4MNYA 4ABFA 4XDEA 2VH0A 3SV2H 2H1UA 2ZHDA 3UTUH 2XTTB 2ZCHP 1NFXA 4NZQA 4CHAC 1GJ5H 1T4UH 1ZSKA 3RXBA 3V12A 2D2DA 2OTVA 3ZVGA 1OS8A 3A87A 2FS8A 2A7HA 1BMNH 4YLUA 3EYDA 2Y6TA 1W13U 2H2ZA 1TPSA 1V2JT 1G32B 3RXCA 3ZZBA 1V2WT 1A4WH 4FU8A 2BD9A 1ACBE 1AFEH 2QXGA 1RGQA 4FUHA 1FXYA 4E7NA 4DURA 1QRWA 1Z8JB 5E8EH 1GBHA 3GOVB 1GI4A 4IC5A 1LPKB 3QUMP 4INLA 3ZZ7A 3ZVCA 2VWOA 2ZWLH 3A8AA 1CA8B 2ZU2A 2PV9B 5FPYA 1CT4E 4SGAE 3ELAH 1UVTH 1GHBF 1EX3A 1RTLA 3RXRA 1OSSA 2HALA 3Q3YA 1K1MA 1TPOA 1TNHA 3UWJH 1SC8U 1BTUA 2J95A 1TNJA 2Z6BD 1O2JA 1MH0A 2ZFSA 3FANA 1B7XB 1W10U 2BD3A 1GBKA 1GJ4H 3LJJA 2C8YB 4AFSA 1FUJA 2A2QH 2QCYA 3EA7A 3UUZA 3UR6A 4OS7A 5EGMA 1V2RT 3LH1A 2P3FH 3M61U 1MD7A 2G5NA 1UO6A 2P8OC 5A0AE 2GCHF 2AMPA 2FP7B 2GT7A 3QZRA 3ZZ3A 4WXVA 3SZNA 1AUJA 2NU1E 2PKSB 1ELGA 1IQLA 3SJ8A 2PUXB 3SW2B 4WY3A 1DXWA 2G4UA 1MTNB 4K3JA 1TBRH 1UHBA 1O39A 4CBNA 4THNH 1F0SA 4INKA 1EP5A 3SV7A 2QYIA 1XVMA 2GT8A 4LZ1H 2ZDAH 1GMDG 4Y0ZE 4OS1A 1D3PB 3IWMA 1LHDH 1WQSA 1CO7E 1S82A 4FUEA 4I8HA 6ESTA 5SGAE 1O3LA 2V6NA 3BV9B 2ZQ2A 1UTPA 1PPCE 1J8AA 3E0NB 4OS6A 2BM2A 4DVAU 1G9IE 4KTSA 3UWIA 2BD7A 3O8CA 4ZH8A 4AG1A 4K69A 1ZTLA 5LPFA 4LXBH 2Y7XA 1A46H 2G51A 1O3HA 2FI3E 1N8OC 3ZYDA 3IITA 3OX7U 3SUDA 3A83A 1HJAC 1EOJA 4BOHA 4X1QU 1O2LA 2A4RA 4RN6A 2B0FA 2QY0B 3V0XA 1P10A 2VB0A 3CENA 5FAHA 1LHFH 5FX5A 1AVWA 1C5MD 1EAXA 1MTUA 1QA7A 1S83A 3LKWA 2F9NA 1C4V2 1C9PA 1C5ZB 2ZGJA 1RS0A 3GY5A 1YGCH 2RA3A 2AEIH 2UUJB 1O32A 5EOKA 2B7DH 2OC7A 3T5FH 4Y7AA 2KAIB 1O3NA 1GI2A 1D3QB 2OC1A 4LOYH 3NXPA 3GY6A 1A1RA 4CBOA 1O37A 1MKXK 3ZZ6A 3ATKA 3NKKA 4X2WA 4DG4A 2ANMH 1SGIB 1PYTD 2PSYA 5LH8A 2ZF0H 1ZGIA 4BTUB 2BDYA 1MMJN 4ISLA 5FBEA 4MTBA 3TIUA 1TGBA 1YCPH 1MTWA 2F9OA 1CU1A 4XBBA 1F2SE 3P8OA 3A84A 5A2MH 1CGIE 2WYJA 3M7TA 3SNCA 2W7UA 1J9CH 9LPRA 2IJOB 1H1BA 1N6YA 3PROA 2WV5A 3BEIB 4Y8XA 3PM3A 1THSH 3GYLB 3SBKA 4A7IB 3MO9A 4X0WU 2JH6D 3MFJA 1HFDA 1E34B 1P05A 3K65B 4NGAH 1JIRA 1C1NA 1O5GH 1D3DB 2WPMS 4AZ2B 5JBCS 2CV3A 4B2CA 2H5CA 4OGXA 1GGDB 4J2YB 1FIZA 2WPHS 2FXRA 1EP6A 1O2RA 1NU7B 1E36B 1P2NA 4JCNA 1CT0E 1DX5M 1AE5A 3QWCH 4O97A 4OS4A 1FPHH 3PMJA 1BTXA 1GHBG 3VB6A 3STIA 1RXPA 1P9SA 3SORA 3UQVA 3CS0A 3TJNA 1IQIA 2ANYA 1A2CH 4XFQA 3SN8A 3KGPA 1SB1H 4Y0YE 4CHAB 1S0QA 2Z7FE 1HAIH 1NS3A 1ESTA 3RXTA 2BX3A 2A32A 2RG3A 4WJG2 1A61H 1GJAB 4IW4E 2XRCA 2GTBA 1SHHB 1C5SA 2A31A 4MPVA 1ZTJA 2G52A 4M7GA 3F1SB 1FIWA 1MCTA 1O3DA 1DWCH 5F6MA 3JZ2B 1MUEB 2H5DA 3DFJA 1TONA 5AVDA 2BY6X 2JETC 3EQ0H 2UUFB 2J4IA 4WMFA 1SGPE 2BD5A 2FWWA 4XE4A 2GCHG 2J92A 3F9HA 4IMZA 1PQAA 2LPRA 3BF6H 1BTPA 1G2MA 1A5HA 5DP4A 2VINA 5CMXH 2W5EA 1MZDA 3OYPA 1YPHE 4GUXA 1NTPA 1K22H 1SLUB 4X8UH 1AE8H 1XXDA 3RXAA 1VCWA 1O3CA 1O38A 2A1DB 3PLKA 4DY7B 4K8YA 5FPTA 1ZSJA 2ILNA 1UVUH 4UD9H 4J1YA 3AW0A 1BHXF 2DE9A 4JMYA 1H9HE 4XBDA 5ETXA 2Y7ZA 3PV4A 2HLCA 2J34A 1NRQH 3RM0H 1MAXA 4IC6A 2XCFA 4FUBA 4JZEH 2J38A 4ZAEA 1TGCA 2GVFA 5I25A 1ORFA 1EUFA 1O2YA 4I8KA 2ZTYA 3MH7A 3AAVA 1NO9H 3QGJA 2WYGA 1NC6A 1SG8B 5C5NA 3SGBE 1C1RA 1G2LA 3ZZ8A 1KSNA 2F91A 1UTOA 2OQUA 3BTWE 8ESTE 1BRUP 3T26A 1UTMA 2P8OB 2BX4A 5DPAA 1C5OH 2FOCA 1OP0A 1AHTH 2B9LA 2FTMA 5JBTA 2PGBB 2HOBA 3BG4C 1PQ8A 1HDTH 1J15A 3QTVH 4ZKNU 4ABAA 2F9PA 1K9OE 1C5VA 1L1GA 1A5IA 5EXNA 3RDZA 1QY6A 2BHGA 4AYYB 1ETRH 1YYY1 2Q6DA 3GDUA 2ZP0H 3QLPH 4ZROA 3Q3KA 5DP8A 1JOUB 2BY8X 1GMCF 2H9TH 3PB1E 1TABE 4Q80A 1AWHB 2FOBA 1N8OB 1XUJA 2TPIZ 1GI5A 1O2MA 4YOJA 5G4BA 3HKIB 4ZKOU 2EI8A 3SU5A 1GHWH 1HJAB 1QBVH 3LU9B 3MH4A 3LC3A 2AS9A 1SQAA 3S7KB 2ANKH 1KXEA 4O3TA 3Q00A 3A89A 4Q7ZA 2VU8E 1GHYH 1EOLA 2ZCLP 2CHAC 3M3TA 3VFEA 3UY9A 1LPGB 1UVSH 1A7SA 4TPIZ 4CRDA 1C1TA 1GHAF 1Z1IA 3URCA 3SGAE 1BMMH 4ISIH 1KLTA 1ABJH 5LGOA 1OP8A 1GBFA 1QB9A 1GVKB 4AGJA 4A1VA 1QBOA 3M7UA 2BDAA 2VVVA 4X2YA 1GCTC 3ZV9A 1C2EA 1Y3WA 1TA6A 4NZLA 1WV7H 3PMHB 2OLGA 3R0FA 3DD2H 5FCKA 4Q2KA 1ANDA 1IQKA 3SU6A 3TH3H 4UFDH 1FI8A 2ZZUH 4BAHB 5E2PA 2HNTC 2STAE 4X2VA 1W7XH 4Y7BA 4ABEA 2VGCC 1C1VH 3E0PB 3ZZ5A 4MG3A 3D65E 4A1XA 1AVXA 1QQ4A 1K2I1 1NFUA 5FCRA 4AOQA 2QXIA 3RMMH 1K1OA 2FI4E 1ARBA 4YTAA 2FDAA 1KXBA 1DWEH 1UK2A 3T27A 4DIHH 2BZAA 1DUAA 3MHWU 3VXFH 3TJOA 1Z6JH 4X1SU 3OSYA 3SUFA 1TAWA 3UOUA 1D6WA 1GVZA 3MH6A 1H8IH 2HVXA 1P3EA 5FX6A 1UCYH 1SGFA 1QRXA 3MI4A 1TOMH 1NRRH 3QGNB 1D3TB 2WPKS 2BVRH 3A81A 3EA8A 2P59A 3SJKA 4KP0A 1N6XA 1LVMA 2QF3A 1K21H 1GBJA 3PWBA 1C4Y2 1BJVA 1WBGB 1HV7A 3SNAA 1BDAA 3Q77A 3LT3A 3QX5H 2SGDE 2VIPA 5EQRA 2R2MB 3BG8A 2ZDNA 1DY9A 5DK1A 1JWTA 3E1XB 2ASUB 3SUGA 3MOCA 2FODA 1KIGH 3ZZDA 3KQBA 1GI0A 2Z9LA 1QNJA 1PPHE 3DHKH 5I46H 1EB1H 1THPB 4ABBA 2C93B 2VVCA 3UOPA 1QFKH 3EAJA 1ETTH 4XSKU 3T2NA 3WY8A 3RXHA 1SGEE 2JETB 2XBWA 3UNSA 2C90B 3KF2A 1BZXE 1PPZA 1RIWC 1GI1A 2EC9H 2NU0E 2F9BH 1ETSH 3TGJE 5DP6A 2GMTC 4TYDA 5EU8A 1FY5A 1AU8A 3H5CB 2G8TA 1AQ7A 2NU3E 1OYQA 4NA8A 1KXAA 2V0BA 1DLEA 1U6QA 1M9UA 1V2PT 1UMAH 2I6QA 1EAWA 1YF4A 3M3SA 1XMNB 1C2IA 1MTSA 3LJOA 4JZDH 4BTIB 1AKSB 3MNSA 4ZXYH 5C5OA 1ABIH 2AIQA 1GI8B 1GMCG 3RLYH 1VITH 2Q6FA 1YPGH 1ZHRA 3RM2H 2OXSA 2P16A 5EQSA 5JBAS 1Y59T 3V13A 1QBNA 1AB9C 2R9PA 3TPIZ 4NIVA 3ESTA 5C20A 2GCTC 3R3GB 3UFAA 4A5TS 3H7OA 4ABGA 2ZFTA 1C5UA 3RXEA 2ZECA 1P3CA 2AFQB 1S6HA 3PTBA 2BB4A 1TMTH 1S84A 1GHAG 1LKAA 5JBBS 1HAZB 5E0HA 3HK6B 5F8XA 1C2FA 1BB0B 2FIRH 1TALA 1ZHPA 3D49H 4Q7XA 5K7RA 1ZHMA 4YT7H 3EE0B 3A7TA 1G3CA 3BG4B 4AB9A 3ZVFA 3TK6A 1ELAA 1SR5C 1TMBH 4YESB 2FO9A 1SGTA 2A45B 5GPIB 5J4QA 3TJVA 1H4WA 3SV6A 1TNLA 1GJ6A 1DE7H 1JRSA 7LPRA 4LZ4B 1NRNH 8LPRA 4WF8A 1D6RA 1O0DH 1P57B 4FUFA 3FVFB 4UEHH 1GBTA 3BTQE 3MH5A 5DP9A 3RU4T 2BD8A 1C1UH 1GJCB 5FPSA 1V2TT 4FVBA 1AN1E 1ELDE 3SHCH 1AZZA 5DGJA 2FLBH 1BBRH 2QAAA 8GCHF 1O2SA 1VGCC 1H9IE 1P2MA 3OTJE 3RXMA 4AG2A 1ANCA 4CH8B 1DT2A 3FZDA 2BQ7B 1ZLRA 1YCPK 4CR5A 2ALVA 2CHAB 1QHRB 2ODYB 1GJDB 1HGTH 1GMHF 3ZZCA 3CS7A 1MU8B 1UJ1A 2CMYA 1IQJA 1BA8B 1V2UT 2YOLA 2PR3A 2OQ5A 3PO1C 1O2UA 1WTHD 2ZEBA 4Y11E 3E8LA 1FZZA 2WPIS 1O2XA 1KLJH 1E35B 5E2OA 3O8DA 4HFPB 2ALPA 4IN1A 2TBSA 4MNVA 5GDSH 1GCTB 1ESBA 3S69A 2QXJA 2ZTZA 2ZU4A 3ODDA 1G30B 1ZZZA 2BYAX 8KME2 2CXVA 3NUMA 5A0BA 2VIOA 3KQCA 3P17H 1HAXB 4X1RU 4NIWA 2A2XH 1O2NA 1AFQC 2ZDMA 3M36A 3QK1A 1Z8IB 2BZ6H 1C9TA 1DANH 1C5PA 2VGCB 3GY3A 5A8YA 4OS2A 2ZDLA 3LGYA 1W14U 3QO6A 4X6MA 1NPMA 2QA9E 3GY8A 4K8BA 3ZVEA 5JDUB 3S9BA 3TH2H 3BTFE 2P93A 2WV4A 1O2PA 5GXPA 3BTGE 1ELTA 1ZMNA 4Y10E 1P2KA 3DUXH 1W0ZU 3SU4A 1OXGA 1CHGA 4I7YH 5AFYH 4BTTB 4AGKA 1SGFG 4D8NA 4Y79A 1OYTH 4ZHMU 5J4SA 1L2EA 4H4FA 5HM2A 2UUKB 2BXUH 1TMUH 4H6TA 4I31A 1ZMLA 3UPEA 1QB1A 3KL6A 1ZMJA 1TRNA 1GI3A 3U1JB 1TBQH 1SHYA 2BY5X 2R3YA 7GCHF 2GDDA 3KNXA 3NZIA 2C3SA 1YKTA 4K1EA 5CHAC 1HJ8A 2BLOA 3QZQA 4JYTA 4ZMAH 2W3IA 1VZQH 5A8XA 1QB6A 4JYVH 1GHZA 1P8VC 2R2WU 1DSUA 1TGSZ 1HLTH 1PYTC 3G01A 1P01A 1GBMA 2V35A 3SOSA 1BJUA 1BITA 1Q31A 1K1IA 1XUGA 1YPJH 4INHA 1JIMA 2XBVA 1LPZB 2PKAB 3RXLA 4E7RG 2DUCA 3ATMA 4K60A 2VVUA 3BIVH 2OP9A 1P11E 3EGKH 1WSSH 3B23B 1WU1A 1RIWB 3TITA 1Y3YA 2C8XB 1OWEA 2GMTB 1MAYA 5ESBA 1RTFB 1P2JA 2G81E 2ZGCA 1C5LH 2QXHA 4MNWA 2P3TB 3PMBB 1TA2A 2C4FH 3SV9A 1TX6A 1DWBH 2TGTA 5AFZH 1QJ6B 1TLDA 3BEFB 1C1WH 1LHEH 1ELBA 2F3CE 3ZZAA 1P2IA 1FV9A 3C27B 3GY4A 3STJA 4ABIA 4CRFA 5C1UA 1V2MT 1S6FA 2FPZA 2FTLE 1KYNA 1K1JA 1NESE 2YNBA 5K0HA 1EASA 2XWAA 4X8SH 3GCTF 2W26A 3SNEA 1UTJA 1TB6H 2ZA5A 3RXUA 1OPHB 8GCHG 3TH4H 1FAXA 1AB9B 4KKDA 2BOHB 1AIXH 2GCTB 1Z8RA 4DJZB 3I29A 3PWCA 1XUFA 3RXIA 1ANEA 4ISOA 3V3MA 1TGNA 4NSYA 2BY7X 5EXMA 4NA9H 1SL3A 2IPHA 1GMHG 5GCHF 3SV8A 2ZCKP 1GJ9B 3RXVA 4B71A 2A7CA 4CRCA 1IQNA 3UIRA 3RMOH 1LO6A 1ESAA 5C67A 5LPEA 4NSVA 1K28D 1GBBA 2EA3A 2J94A 1NRSH 1O2WA 3KIDU 1ELVA 3M3VA 3EDXB 4WVPE 3RLWH 2R0LA 5HM9A 5IDKA 4E05H 1HAOH 1WAYB 1CSOE 5T6DA 4IGDA 5JB9S 3KCGH 1GBDA 1Y8TA 1AVGH 3MU0A 1JMOH 1LMWB 1YLCA 3A88A 3E6PH 2QC2A 3GDVA 4ZKSU 1KDQB 4IMQA 3VB3A 3SJIA 3GY7A 1OWHA 3Q3XA 3URDA 4Z0KA 1AY6H 1O5DH 2QF0A 3BTME 2JH5D 2UWLA 3S0NA 1VGCB 4LK4A 4NFEA 1FQ3A 2Z9JA 4VGCC 3L33A 1NRPH 3DFLA 4ASHA 1H8DH 1YLDA 2ZHEH 1C2MA 1EB2A 1S85A 3E90B 3GISB 4NG9H 2ZU3A 3PO1B 1PPBH 1XM1A 3TU7H 2AMDA 1SI5H 1DY8A 1YPKH 1E37B 1DSTA 1O2IA 3AVZA 3VXEH 1TNKA 3O8BA 2XCNA 1Z6EA 1CHOF 7GCHG 2O8UA 4WWYA 2CN0H 1V6DA 1HXEH 2FOFA 4ZHAA 1BRBE 4YM9A 2ZKSA 2KAIA 1SMFE 1UCYK 4CRAA 2Y5GA 4MDSA 3L6PA 3TK9A 5C2ZA 1MCVA 3SNBA 2Z9KA 4FU7A 4YOIA 1AFQB 1P0SH 2XC5A 3SU3A 1P2QA 2W7SA 1YCPM 2YNAA 3MO6A 3MTYA 4A6LA 2QN5T 4TPYA 3ZV8A 4GCHF 1GBIA 2OBQA 3FP7E 3W94A 3RXOA 1CA0C 3RC4A 2H9EH 1F0UA 3Q76A 1NZQH 1O3BA 2Z3CA 3OY6U 1L1NA 1VR1H 2I6SA 4JZFH 1DPOA 2VIDA 1Y5UT 2SGEE 1MU6B 3BTKE 4I32A 5PTPA 1CGHA 2VWLA 3UNQA 2G5VA 5GWZA 4YT6H 1GCDA 2P95A 1O3IA 1MKWH 1ZJDA 1FY4A 2BVSH 4GAWA 2Y81A 1G3EA 3PLBA 2XYAA 4WMDA 1J16A 1GJ8B 1THRH 2NU4E 3ITIA 3LPRA 1O3OA 3GCTG 4MPXA 1QA0A 3UQOA 3A85A 3SI3H 5E0GA 1OOKB 1Y3XA 5L30H 3GY2A 3ATLA 1BT7A 5DG6A 2WINI 3K6YA 4HTCH 1ZPCA 1LCYA 2Z3DA 1W11U 1HUTH 4JZ1A 1IQEA 2Q6GA 5T6GA 4WH6A 1GDUA 2J9NA 1SPJA 4K2YA 4E06H 5GCHG 1T32A 1VJAU 3PTNA 1BIOA 5F8ZA 1RD3B 4CH2B 1B0EA 1YP9A 1J14A 1FY3A 2BDHA 1CT2E 2J2UA 4DCDA 4DIIH 1XUHA 1YPLH 3UREA 2IOTA 2ZDKA 3H7TA 1ELFA 4UONA 1XUKA 3D62A 2BLQA 4JYUH 2AIPA 3MNXA 3A7YA 1HAGE 1EAIA 4X6OA 1E38B 4NWLA 3V7TA 2K1QA 1CGJE 1KDQA 3SI4H 1DXPA 1E0FD 3GCOA 2D26C 3A7ZA 1SGDE 7KMEH 1C1PA 1SFIA 2PW8H 2A4OA 1QQUA 2IN2A 4U01A 4BAKB 5A09A 1O5EH 5EQQA 2SNVA 4DT7B 2F83A 3W95A 1OWIA 1ZPBA 2F9UA 4D76A 1QJ7B 1QL7A 2FI5E 2FMJA 2A5KA 2ZPQA 3SNDA 1ZRKA 4GLYA 1UK3A 3F6UH 7ESTE 1HBTH 4CRBA 5HMAA 5DO4H 3TK5A 1UTLM 2Z9GA 3D23A 4ISHH 1BTHH 3GCHC 3A80A 1OX1A 2GZ8A 2FOHA 2FEQH 2AGIX 1KTTB 3SGQE 1ARCA 2BMGB 3RXKA 2ZIQH 1KY9A 2VH6A 1BBRK 3TJUA 3A8CA 5E0JA 3MO3A 3RU4D 1CE5A 1L4ZA 1O5BB 3F9EA 1BTWA 1HAHH 2TGAA 1HNEE 1CHOG 1Y3UA 3SU1A 1NROH 2P94A 1C5TA 2V3HH 3E3TA 3E16B 3N7OA 1J17T 1TGTA 3HGNA 1A0HB 3NK8A 4ESTE 1GPZA 2FYQA 3QDZB 2XC4A 1JXPA 4HI3A 1W12U 1F5KU 1MBMA 2ZFPH 1UVPA 5HYOA 1FLEE 5T6FA 3PYHA 4I8GA 1W0YH 1F0RA 1DDJA 6GCHF 4GCHG 3O8RA 3T62A 2BD4A 1TOCB 5CE1A 3U69H 1T31A 4DGJA 1O5CB 2HNTE 2AGEX 1GG6C 2ODQA 2THFB 1O3JA 5FBIA 3TNSA 2CF9H 4UFGH 1GBLA 4VGCB 4X1NU 4FUDA 3BTTE 6CHAC 1ZGVA 4Q7YA 1INCA 2BQWB 3UR9A 3RP2A 2ZFQH 1IAUA 2B5TB 3BTDE 4FUGA 2QIQA 1O3MA 1F5RA 4ZUHA 3RU4E 1W7GH 3S9AA 3BTEE 1W8BH 2ZDVH 4GPGA 1ZSLA 1C5RA 1H9LB 5GJ4B 3TGKE 1O2KA 1SGNE 2SGPE 1NFYA 2TGPZ 4KTUA 1ZTKA 4XOJA 1LVBA 4FUCA 4JK5A 3A8BA 2Y5FA 2O8TA 3MU5A 4NA7A 5JB8S 1P09A 1YC0A 2STBE 4H42U 3RXDA 3HATH 3QTOH 3VEQB 1KTSB 4O9VA 2H9HA 4D9RA 3KQEA 2SGQE 1V2KT 2FX4A 1EZQA 3RXFA 4AN7A 1IQHA 1BUIA 2A5AA 4NIXA 1AGJA 2GZ9A 1G3BA 2PGQB 1EZXC 1O2GH 3SU0A 1MD8A 3B8JA 1DUEA 1CA0B 4B76A 3MNBA 1WCZA 2UWOA 1F92A 1SGRE 1W2KH 2WUCA 2ZGBH 5HGGA 2G00A 2LNCA 4BAQB 5IYTA 1C5XB 4K5ZA 2FZZA 4Z6AH 1VJ9U 1O34A 5B6OA 5EPNA 1DLKB 1IQMA 2A5IA 2QGRA 5A8ZA 4K1SA 4UFFH 1TRYA 3LOXA 4X8VH 2AGGX 1ZPZA 1RRKA 1C1SA 1C5NH 3RXGA 1UK4A 1SGYE 2XBYA 2FOEA 3I78A 2FX6A 1O3PB 1T8OA 1EJNA 2HGTH 1AWFH 1MQ5A 1FY1A 3A86A 1JBUH 1T7CA 3CP7A 2OD3B 4BAOB 1QTFA 4AORA 1LVOA 1OKXA 2OC8A 1V2VT 2PHBA 4D7GA 5L2ZH 1SOTA 3MU1A 4CRGA 1EJMA 1EJAA 1TRMA 4TY7A 4BNRA 3TGIE 2GZ7A 1P06A 4DOQA 3P6ZB 2SGFE 4I8JA 5EXLA 1O3EA 3RXSA 2G55A 4YLQH 2ZFFH 3KN2A 1VCPA 2NU2E 2P3UB 1LDTT 5C3NA 1BHXB 3PLPA 5F03A 3PMAB 1C1QA 2ZG0H 5LPRA 1QR3E 2O8LA 3FZZA 1K1LA 5L6NH 2BDBA 2Z9IA 2BOKA 1LHCH 4B1TA 5L2YH 3KHVA 1O5AB 1RFNA 1PQ7A 2BD2A 1DITH 1Y3VA 1AUTC 1S81A 1C2JA 3P92A 1P9UA 4ISNA 2BY9X 1V2QT 1DVAH 2XC0A 2UUYA 3FP8E 4HGCA 1XKBC 2WPJS 1NT1A 4RKOB 3P70B 1HPGA 5A0CA 1YBWA 4TWWA 2FYRA 2NWNA 2F9VA 1AKSA 3A82A 3LGWA 6GCHG 2Z3EA 3F68H 2ZGHA 2SGAA 1EPTC 2CF8H 1BTZA 3NPSA 5EG4A 1O2HA 1MTVA 2ZHQH 1LQDB 2UWPA 2ZQ1A 3OY5U 5BPEA 3SHAH 3GCHB 2BDIA 4SGBE 4ZXXH 1WTGH 4GVUA 1G3DA 4IN2A 1BCUH 2OC0A 1PFXC 1LKBA 1SLXB 3TLOA 2ZHWH 4X2XA 4RSPA 1V3XA 2PSXA 3ZVDA 4X6NA 4OS5A 4BAMB 5TCAA 3ZZ4A 1K1PA 3T28A 3M35A 1CQQA 4X1PU 1GI9B 1T8LA 2GV6A 2AH4X 2V3OH 3U8RH 2SNWA 2TRMA 1EAUA 1P03A 1ZJKA 1Q3XA 1KXCA 5ESTE 3M5OA 2Q1JA 2BDGA 3LIWA 2ZC9H 2VIWA 1MBQA 1GL1A 1G36A 2VNTA 4AX9H 2R0KA 1SBWA 3VB5A 4AFZA 2B8OH 2ESTE 1VITF 4MPUA 3RMLH 3RUOA 1OWDA 3VGCC 1C2DA 1S0RA 1XVOA 4MQAA 2VIVA 1FMGA 1O3KA 1TX8A 1AO5A 3MNCA 1ZRBA 1YPHC 3ENSB 1ELCA 4ABDA 2FOGA 1T8NA 3MMGA 3MWIU 2A0QB 1YPMH 2ZGXH 1LVYA 2W3KA 1GG6B 2VJ1A 4ZHLU 1NY22 1C5YB 1V2NT 2ZNKH 1T4VH 6CHAB 3U9AH 1OWKA
chains in the Genus database with same CATH superfamily
1L4DA 1FN8A 1DFPA 2GKVE 1WYKA 2FM2A 2C8ZB 2GDEH 4Y8YA 2ZO3H 2EI6A 1NM6A 5GIBA 2VWMA 4XBCA 4YOGA 3SJ9A 2A4QA 3JZ1B 3PRBA 4D7FA 1HAYB 2O9QA 3M5LA 1WDIA 2HRVA 3IG6B 4B6FA 4CR9A 2DE8A 2BXTH 2ZTXA 2CGAA 3C1KA 1FPCH 5EODA 2OINA 1EKBB 1V2OT 2G4TA 2WPLS 1TE0A 1PJPA 2O8MA 3GICB 1LHGH 2OCVB 2RCEA 4UE7H 2D1JA 1HJ9A 4AFQA 3ZYEA 3EE7A 3DT0H 5TCCA 3LGUA 2IPQX 4B2BA 1Y5AT 2GV7A 1KLIH 3K6ZA 1HXFH 3BEUA 4FVDA 5EW1H 1DS2E 1JRTA 4MLFB 5DP5A 1MKWK 3GDSA 1IQFA 2ZFRH 4GSOA 2PTCE 4CREA 1CBWC 5TJXA 3T25A 1A3BH 2VIQA 2FLRH 3M37A 4O03A 3ZVAA 5H4IB 3SJOA 1QGFA 3MQKC 3AW1A 4FETA 1UTQA 2RFKC 1BTYA 4F4OC 1SQOA 4AYVB 1F5LA 4XRNA 5HXFA 3KQDA 5FXLA 1O2ZA 1VCQA 2PWXA 3HK3B 4OM9A 1TPPA 1K1NA 1O30A 1C2KA 4KTCA 3M5NA 1QIXB 3B9FH 2ANWA 3M5MA 2BQ6B 2ZU1A 4B2AA 4MNXA 4AB8A 1A3EH 1OWJA 3MU8A 4Y76A 3VB7A 1TPAE 4MPWA 1SLWB 1SVPA 4DW2U 1SGCA 2BVXH 4YO9A 1EZSC 1O33A 2EI7A 4K1TA 4ABHA 1F7ZA 2A4GA 4BANB 1UCYE 3BN9A 3A7WA 3SO3A 3U8OH 2FOAA 1W3CA 1MKXH 2J97A 1NFWA 4JK6A 4WMEA 1GWAA 2HNTF 1GHVH 1ELEE 1YPEH 1TQ7B 1TNGA 3L3TA 2ZU5A 2K8IA 2BTCE 4YZUA 4TY6A 2ODPA 2PKAA 3GYMA 2KCOA 5JPMH 5ABWA 3LDXH 2SFAA 2BLWA 2Y80A 1HAVB 3U98H 3UNRA 1SSXA 4P00A 1AI8H 1YWUA 1SQTA 3RC5A 4U30A 4WXIA 1ZOMA 1V2LT 3AAUA 3U8TH 4X8TH 1QCPA 2FS9A 3RC6A 1YM0A 4FXGH 1Z71A 5C17A 4FU9A 2J98A 1ZR0A 3BSQA 3T29A 3P8FA 4R0IA 1BMLA 1BRCE 2EEKA 1BOQA 1CVWH 1TX7A 1BMAA 2GP9B 4A1TA 1A5GH 4NCYA 1VITG 4B73A 4ABJA 2GX4A 2ZPSA 1F0TA 1WQVH 2FESH 3TVJB 1GJBB 1AZ8A 1P12E 1O5FH 1GL0E 3N99A 2A7JA 5C1XA 5JYIA 1EPTB 3ATWA 1GHXH 2FOMB 3DSPA 3DA9B 1O2TA 3OU0A 4Y71A 3AK5A 4ZKRU 4Y6DA 1XXFA 1D4PB 4QT8C 1O2OA 1O3AA 2PUQH 5C1YA 1HIAB 1SOZA 5CHAB 1C4U2 1S5SA 2TGDA 2L6OA 1TQ0B 3F9GA 3LH3A 1UTKA 1XUIA 2H6MA 1QURH 3M7QA 4KELA 3HGPA 3ODFA 2CJIA 5KECA 1L1JA 2QV1A 3SQHE 3TNTA 1G37A 3P8NA 4HZHA 1GVLA 3VPKA 2ZI2H 3QN7A 5DJ7A 1D9IA 1FJSA 1N1LA 1DOJA 1FDPA 1IQGA 1O2VA 4NIYA 1HYLA 4GHTA 4NWKA 6LPRA 1FAKH 3P95A 3BIUH 2Y5HA 3A8DA 1AMHA 3K2UA 1DICA 1A0LA 3SUEA 4BXWA 1PPFE 1GBCA 1FONA 2OBOA 2XNIA 4FUIA 3VGCB 2C8WB 4IS5A 1QL8A 1MZAA 4B74A 3U1IB 1Z8GA 3MU4A 1TYNA 2TIOA 3RXQA 3AASA 1IHSH 1FNIA 2R3UA 2Z94A 3FAOA 3F0OA 1C5QA 1O31A 1Z1JA 3EA9A 3ZZ9A 2PKSC 5EPYA 1OP2A 2ULLA 3S7HB 1C2GA 4X6PA 1MTNC 1O36A 3HPTB 3I77A 1T8MA 1KXDA 1HAPH 1NU9A 3RXJA 3SQEE 5F8TA 1C2HA 4D9QA 3ATIA 4OGYA 4AFUA 1SFQB 1TNIA 1B0FA 2VWNA 1BBRE 2HPQH 3FP6E 2ZHFH 4MVNA 2XW9A 3ZVBA 4U32A 4TSFD 5AHGH 3A7VA 5DP7A 1UTNA 4Y8ZA 4BXSA 1DM4B 2D8WA 5KGOA 1C2LA 5DKMA 4ZCNA 2BDCA 4RT0A 4I33A 1TFXA 2M5TA 3S9CA 2O8WA 3A7XA 1TWXB 1X7AC 2AYWA 4FUJA 2HVYB 1WOFA 1P04A 1KXFA 2JH0D 1TBZH 3F2FA 4IBLH 2GGVB 2OUAA 5BRRE 2GD4B 1GDQA 4PROA 5F53A 1WUNH 2BLVA 4GHQA 3MYWA 1HAVA 4WH8A 3SYJA 4B75A 2XBXA 1MQ6A 1C1OA 2AERH 2Y82A 2HWLB 1CBWB 1HB0B 3KEEA 1EZUC 1RTKA 1GJ7B 1Q2WA 2PFEA 4H6SB 1GDNA 2ZPRA 1O2QA 1GBEA 1PPEE 4KGAA 1Z7KA 5T3HA 4F49A 5FHTA 4TWYA 4RKJB 1RJXB 5C0UA 3SZEA 2KCYA 1P02A 1LQEA 4NFFA 1C1MA 4O3UA 1BRAA 1GMDF 1BQYA 1O35A 1V2ST 1ANBA 1SLVB 1DWDH 1A0JA 4A92A 2WUBA 3NWUA 3OE7D 1EATA 1UHBB 1P2OA 1AD8H 2AMQA 9ESTA 1Y5BT 2RDLA 1EPTA 1GBAA 2XXLA 3F9FA 3RMNH 5DP3A 1HCGA 2PTNA 3HKJB 2JKHA 1QL9A 1UVOA 1O3FA 5AF9H 1IHTH 3KYFA 1LTOA 3BTHE 2RA0A 1HIAA 1ID5H 1HRTH 1PQ5A 1XKAC 1XX9A 4F55A 1FY8E 1ZYOA 2HPPH 4UDWH 1QJ1B 2XWBI 1EXFA 1TIOA 3UB0A 3LGIA 1QRZA 4UFEH 1B5GH 1O3GA 1GGDC 1GI6A 3RXPA 4JZIA 5EW2H 3LGTA 3K9XB 2PLXA 3FFGA 3P8GA 1OHHD 4I8LA 4R8TB 5C94A 3VB4A 1SGQE 3LONA 1C5WB 1FN6A 1IOEA 1GI7B 1NN6A 3LC5A 3SU2A 3LGVA 3DSOA 1EQ9A 3E91A 4U2WA 3NCLA 3GCNA 1L0ZA 1PPGE 4MNYA 4ABFA 4XDEA 2VH0A 3SV2H 4TT3D 2H1UA 2ZHDA 3UTUH 2XTTB 2ZCHP 1NFXA 4NZQA 4CHAC 1GJ5H 1T4UH 1ZSKA 3RXBA 3V12A 2D2DA 2OTVA 3ZVGA 1OS8A 3A87A 2FS8A 2A7HA 1BMNH 4YLUA 3EYDA 2Y6TA 1W13U 2H2ZA 1TPSA 1V2JT 1G32B 5EJ1A 5KEDA 3RXCA 3ZZBA 1V2WT 1A4WH 4FU8A 2BD9A 1ACBE 1AFEH 2QXGA 1RGQA 4FUHA 1FXYA 4E7NA 4DURA 1QRWA 2WSSD 1Z8JB 5E8EH 2W6ID 1GBHA 3GOVB 1GI4A 4IC5A 1LPKB 3QUMP 4INLA 3ZZ7A 3ZVCA 2VWOA 2ZWLH 3A8AA 1CA8B 2ZU2A 2PV9B 5FPYA 1CT4E 4M9FA 4SGAE 3ELAH 2WHXA 1UVTH 1GHBF 1EX3A 1RTLA 3RXRA 1OSSA 2HALA 3Q3YA 1K1MA 1TPOA 1TNHA 3GS9A 3UWJH 1SC8U 1BTUA 2J95A 1TNJA 2Z6BD 1O2JA 1MH0A 2ZFSA 3FANA 1B7XB 1W10U 2BD3A 1GBKA 1GJ4H 3LJJA 2C8YB 4AFSA 1FUJA 2A2QH 2QCYA 3EA7A 3UUZA 3UR6A 4OS7A 5EGMA 1V2RT 3LH1A 2P3FH 3M61U 1MD7A 2G5NA 2YMSC 1UO6A 2P8OC 5A0AE 2GCHF 2AMPA 2FP7B 2GT7A 3QZRA 3ZZ3A 4WXVA 3SZNA 1AUJA 2NU1E 2PKSB 1ELGA 1IQLA 3SJ8A 2PUXB 3SW2B 4WY3A 1DXWA 2G4UA 1MTNB 1NBMD 4K3JA 1TBRH 1UHBA 4Z1MD 1O39A 4CBNA 4THNH 1F0SA 4INKA 1EP5A 3SV7A 2QYIA 1XVMA 2CK3D 2GT8A 4LZ1H 2ZDAH 1GMDG 4Y0ZE 4OS1A 1D3PB 3IWMA 1LHDH 1WQSA 1CO7E 1S82A 4FUEA 4I8HA 6ESTA 5SGAE 1O3LA 2V6NA 3BV9B 2ZQ2A 1UTPA 1PPCE 1J8AA 3E0NB 4OS6A 2BM2A 4DVAU 1G9IE 4KTSA 3UWIA 2BD7A 3O8CA 4ZH8A 4AG1A 4K69A 1ZTLA 5LPFA 4LXBH 2Y7XA 1A46H 2G51A 1YLNA 1O3HA 2FI3E 1N8OC 3ZYDA 3IITA 3OX7U 3SUDA 3A83A 1HJAC 1EOJA 4BOHA 4X1QU 1O2LA 2A4RA 4RN6A 2B0FA 2QY0B 3V0XA 1P10A 4ASUD 2VB0A 3CENA 5FAHA 1LHFH 5FX5A 1AVWA 1C5MD 1EAXA 1MTUA 1QA7A 1S83A 3LKWA 2F9NA 1C4V2 1C9PA 1C5ZB 2ZGJA 1RS0A 3GY5A 1YGCH 2RA3A 1QZ8A 2AEIH 2UUJB 1O32A 5EOKA 2B7DH 2OC7A 3T5FH 4Y7AA 2KAIB 1O3NA 4ACBA 1GI2A 1D3QB 1NBME 2OC1A 4LOYH 3NXPA 3GY6A 1A1RA 4CBOA 1O37A 1MKXK 3ZZ6A 3ATKA 3NKKA 4X2WA 4DG4A 2ANMH 1SGIB 1PYTD 2PSYA 5LH8A 2ZF0H 1ZGIA 4BTUB 2BDYA 1MMJN 4ISLA 5FBEA 4MTBA 3TIUA 1TGBA 1YCPH 1MTWA 2F9OA 1CU1A 4XBBA 1F2SE 3P8OA 3A84A 5A2MH 1CGIE 2WYJA 3M7TA 3SNCA 3NRLA 2W7UA 1J9CH 9LPRA 2EY4C 1H1BA 2IJOB 1N6YA 2JJ2D 3PROA 2WV5A 3BEIB 4Y8XA 3PM3A 1THSH 3GYLB 3SBKA 2F4LA 4A7IB 3MO9A 4X0WU 2JH6D 3MFJA 1HFDA 1E34B 1P05A 3K65B 4NGAH 1JIRA 1C1NA 1O5GH 1D3DB 2WPMS 4AZ2B 5JBCS 2CV3A 4B2CA 2H5CA 4OGXA 1GGDB 4J2YB 1FIZA 2WPHS 2FXRA 1EP6A 1O2RA 5EIYA 1EFRD 1NU7B 1E36B 1P2NA 4JCNA 1CT0E 1DX5M 1AE5A 3QWCH 4O97A 4OS4A 1FPHH 3PMJA 1BTXA 1GHBG 3VB6A 3STIA 1RXPA 2GJGA 1P9SA 1W0KD 3SORA 3UQVA 3CS0A 3TJNA 1IQIA 2ANYA 1A2CH 4XFQA 3SN8A 3KGPA 1SB1H 4Y0YE 4CHAB 1S0QA 2Z7FE 1KMHB 1HAIH 1NS3A 1ESTA 3RXTA 5IK2D 2BX3A 2A32A 2RG3A 4WJG2 1A61H 1GJAB 3DCLA 4IW4E 2XRCA 2GTBA 1SHHB 1C5SA 2A31A 4MPVA 1ZTJA 2G52A 4M7GA 3F1SB 1FIWA 1MCTA 1O3DA 1DWCH 5F6MA 3JZ2B 1MUEB 2H5DA 3DFJA 1TONA 5AVDA 2BY6X 2JETC 3EQ0H 2UUFB 2J4IA 4WMFA 1SGPE 2BD5A 2FWWA 4XE4A 2GCHG 2J92A 3F9HA 4IMZA 1PQAA 2LPRA 3BF6H 1BTPA 1G2MA 1A5HA 5DP4A 1UW7A 2VINA 5CMXH 2W5EA 1MZDA 3OYPA 1YPHE 4GUXA 1NTPA 1K22H 1SLUB 4X8UH 1AE8H 1XXDA 1SQRA 4Q63A 3RXAA 1VCWA 1O3CA 1O38A 2A1DB 3PLKA 4DY7B 4K8YA 5FPTA 1ZSJA 2ILNA 1UVUH 4UD9H 4J1YA 3AW0A 1BHXF 2DE9A 4JMYA 1H9HE 4XBDA 5ETXA 2Y7ZA 3PV4A 2HLCA 2J34A 1NRQH 3RM0H 1MAXA 4IC6A 2XCFA 4FUBA 4JZEH 2J38A 4ZAEA 1TGCA 2GVFA 5I25A 1ORFA 1EUFA 1O2YA 4I8KA 2ZTYA 3MH7A 3AAVA 1NO9H 3QGJA 2WYGA 1NC6A 1SG8B 5C5NA 3SGBE 1C1RA 1G2LA 3ZZ8A 1KSNA 1BMFD 2F91A 1UTOA 2OQUA 3BTWE 8ESTE 1BRUP 3T26A 2YMSB 1UTMA 2P8OB 2BX4A 5DPAA 1C5OH 2FOCA 1OP0A 1AHTH 2B9LA 2FTMA 5JBTA 2PGBB 2M2AA 2HOBA 3BG4C 1PQ8A 1HDTH 1J15A 3QTVH 4ZKNU 4ABAA 2F9PA 1K9OE 1C5VA 1L1GA 1A5IA 5EXNA 3RDZA 1QY6A 2BHGA 4AYYB 1ETRH 1YYY1 2Q6DA 3GDUA 2ZP0H 3QLPH 4ZROA 3Q3KA 5DP8A 1JOUB 2BY8X 1GMCF 2H9TH 3PB1E 1TABE 2HLDD 4Q80A 1AWHB 2FOBA 1N8OB 1XUJA 2TPIZ 1GI5A 1O2MA 4YOJA 5G4BA 3HKIB 4ZKOU 2EI8A 3SU5A 1GHWH 1HJAB 1QBVH 3LU9B 3MH4A 3LC3A 2AS9A 1SQAA 3S7KB 2ANKH 1KXEA 4O3TA 3Q00A 3A89A 4Q7ZA 2VU8E 1GHYH 1EOLA 2ZCLP 2CHAC 2WZQA 3M3TA 3VFEA 3UY9A 1LPGB 1UVSH 1A7SA 4TPIZ 4CRDA 1C1TA 1GHAF 1Z1IA 3URCA 3SGAE 1BMMH 4ISIH 1KLTA 1ABJH 5LGOA 1OP8A 1GBFA 1QB9A 1GVKB 4AGJA 5DSFA 4A1VA 1QBOA 3M7UA 2BDAA 2VVVA 4X2YA 1GCTC 3ZV9A 3ZIAD 1C2EA 1Y3WA 1TA6A 3PV2A 4NZLA 1WV7H 3PMHB 2OLGA 3R0FA 3DD2H 5FCKA 4Q2KA 1ANDA 1IQKA 3SU6A 3TH3H 4UFDH 1FI8A 2ZZUH 4BAHB 5E2PA 2HNTC 2STAE 4X2VA 1W7XH 4Y7BA 4ABEA 2VGCC 1C1VH 3E0PB 3ZZ5A 4MG3A 3D65E 4A1XA 1AVXA 1QQ4A 1K2I1 1NFUA 3PRDA 5FCRA 2KZ4A 4AOQA 2QXIA 3RMMH 1K1OA 5T1VA 2FI4E 1ARBA 4YTAA 2FDAA 1KXBA 1DWEH 1UK2A 3T27A 4DIHH 2BZAA 1DUAA 3MHWU 3VXFH 3TJOA 1Z6JH 4X1SU 3OSYA 3SUFA 1TAWA 3UOUA 1D6WA 1GVZA 3MH6A 1H8IH 2HVXA 1P3EA 5FX6A 1UCYH 1SGFA 1QRXA 3MI4A 1TOMH 1NRRH 3QGNB 1D3TB 2WPKS 2BVRH 3A81A 3EA8A 2P59A 3SJKA 4KP0A 1N6XA 5HIYA 1LVMA 2QF3A 2W6JD 1K21H 1GBJA 3PWBA 1C4Y2 2L74A 1BJVA 1WBGB 1HV7A 3SNAA 5B6LA 1BDAA 3Q77A 3LT3A 3QX5H 2SGDE 2VIPA 5EQRA 2R2MB 3BG8A 4FOUC 2ZDNA 1DY9A 5DK1A 1JWTA 2QF4A 3E1XB 2ASUB 3SUGA 3MOCA 2FODA 1KIGH 3ZZDA 3KQBA 1GI0A 1E79D 2Z9LA 1QNJA 3FOAA 1PPHE 3DHKH 5I46H 1EB1H 1THPB 4ABBA 2C93B 2VVCA 3UOPA 1QFKH 3EAJA 1ETTH 4XSKU 5HIZA 3T2NA 3WY8A 3RXHA 1SGEE 2JETB 2XBWA 3UNSA 2C90B 3KF2A 1BZXE 1PPZA 1RIWC 1GI1A 2EC9H 2NU0E 2F9BH 1ETSH 3TGJE 5DP6A 2GMTC 4TYDA 5EU8A 1FY5A 1AU8A 3H5CB 2G8TA 1AQ7A 2NU3E 1OYQA 4NA8A 4RI0A 1VKYA 1KXAA 2V0BA 1DLEA 1U6QA 3F0PA 1M9UA 1V2PT 1UMAH 2I6QA 1EAWA 1YF4A 3M3SA 1XMNB 1C2IA 1MTSA 3LJOA 4JZDH 4BTIB 1AKSB 3MNSA 4ZXYH 5C5OA 1ABIH 2AIQA 1GI8B 1GMCG 3RLYH 5DN6D 1VITH 3OAAD 2Q6FA 1YPGH 1ZHRA 1FX0B 3RM2H 2OXSA 2P16A 5EQSA 5JBAS 1Y59T 3V13A 1QBNA 1AB9C 2R9PA 3TPIZ 4NIVA 3ESTA 5C20A 2GCTC 3R3GB 3UFAA 4A5TS 3H7OA 4ABGA 2ZFTA 1C5UA 3RXEA 2ZECA 1P3CA 2V3MA 2AFQB 1S6HA 3PTBA 2BB4A 1TMTH 1S84A 1GHAG 1LKAA 5JBBS 1HAZB 5E0HA 3HK6B 5F8XA 1C2FA 1BB0B 2FIRH 1TALA 1ZHPA 2LELA 3D49H 4Q7XA 5K7RA 1ZHMA 4YT7H 3EE0B 3A7TA 1G3CA 3BG4B 4AB9A 3ZVFA 3TK6A 1ELAA 1SR5C 1TMBH 4YESB 2JJ1D 2FO9A 1SGTA 2A45B 5GPIB 5J4QA 3TJVA 1H4WA 3SV6A 1TNLA 1GJ6A 1DE7H 1JRSA 7LPRA 4LZ4B 1NRNH 8LPRA 3N7EA 4WF8A 1D6RA 1O0DH 1P57B 4FUFA 2J5UA 3FVFB 4UEHH 1GBTA 3BTQE 3MH5A 5DP9A 3RU4T 2BD8A 1C1UH 1GJCB 5FPSA 1V2TT 4FVBA 1AN1E 1ELDE 3SHCH 1AZZA 5DGJA 2FLBH 1BBRH 2QAAA 8GCHF 1O2SA 1VGCC 4F48B 3OFND 1H9IE 1P2MA 3OTJE 3RXMA 4AG2A 1ANCA 4CH8B 1DT2A 3VG8A 3FZDA 2OK5A 2BQ7B 1ZLRA 1YCPK 4CR5A 2ALVA 2CHAB 1QHRB 2ODYB 1GJDB 1HGTH 1GMHF 3ZZCA 3CS7A 1MU8B 1UJ1A 2CMYA 1IQJA 1BA8B 1V2UT 2YOLA 2PR3A 1W0JD 2OQ5A 3PO1C 1O2UA 1WTHD 2WV9A 2ZEBA 4Y11E 3E8LA 1FZZA 2WPIS 1O2XA 1KLJH 1E35B 1E1RD 5E2OA 3O8DA 4HFPB 2ALPA 4IN1A 2TBSA 4MNVA 5GDSH 1GCTB 1ESBA 3S69A 2QXJA 2ZTZA 2ZU4A 3ODDA 1G30B 1ZZZA 2BYAX 5FL7D 2CXVA 3NUMA 8KME2 2IJD1 5A0BA 2VIOA 3KQCA 3P17H 1HAXB 4X1RU 4NIWA 2A2XH 1O2NA 1AFQC 2ZDMA 3M36A 3QK1A 1Z8IB 2BZ6H 1C9TA 1DANH 1C5PA 2VGCB 3GY3A 5A8YA 4OS2A 2ZDLA 3LGYA 1W14U 3QO6A 4X6MA 1NPMA 2QA9E 3GY8A 4K8BA 3ZVEA 5JDUB 3S9BA 3TH2H 3BTFE 2P93A 2WV4A 5EJZA 1O2PA 5GXPA 3BTGE 1ELTA 1ZMNA 4Y10E 1P2KA 3DUXH 1W0ZU 3SU4A 1OXGA 1CHGA 4HG6A 4I7YH 5AFYH 4BTTB 4AGKA 1SGFG 4D8NA 3DSGA 4Y79A 1OYTH 4ZHMU 5J4SA 1L2EA 4H4FA 5HM2A 2UUKB 2BXUH 1TMUH 4H6TA 4I31A 1ZMLA 3UPEA 1QB1A 3KL6A 1SKYE 1ZMJA 1TRNA 1GI3A 3U1JB 1TBQH 1SHYA 2BY5X 2R3YA 3UAIC 7GCHF 2GDDA 3KNXA 3NZIA 2C3SA 1YKTA 4K1EA 5CHAC 1HJ8A 2QE7D 2BLOA 3QZQA 4JYTA 4ZMAH 2W3IA 1VZQH 5A8XA 1QB6A 4JYVH 1GHZA 1P8VC 2R2WU 1DSUA 1TGSZ 1HLTH 1PYTC 3G01A 1P01A 1GBMA 2V35A 3SOSA 1BJUA 1BITA 1Q31A 1K1IA 1XUGA 1YPJH 4INHA 1JIMA 2XBVA 1LPZB 2PKAB 3RXLA 4E7RG 2DUCA 3ATMA 4K60A 2VVUA 5C0TA 3BIVH 2OP9A 1P11E 3EGKH 5CDFE 1WSSH 3B23B 1WU1A 1RIWB 3TITA 1Y3YA 2C8XB 1OWEA 2GMTB 1MAYA 2KFWA 1RTFB 5ESBA 1P2JA 2G81E 2ZGCA 1C5LH 2QXHA 4MNWA 2P3TB 3PMBB 1TA2A 2C4FH 3SV9A 1TX6A 2J98B 2JIZD 1DWBH 4DT4A 2TGTA 5AFZH 1QJ6B 1TLDA 3BEFB 1C1WH 1LHEH 1ELBA 2F3CE 3ZZAA 1P2IA 1FV9A 3C27B 3GY4A 3KYGA 3STJA 4ABIA 4CRFA 5C1UA 1V2MT 1S6FA 3F3BA 2FPZA 2FTLE 1KYNA 1K1JA 1NESE 2YNBA 5K0HA 1EASA 2XWAA 4X8SH 3GCTF 2W26A 3SNEA 1UTJA 1TB6H 2ZA5A 3RXUA 1OPHB 8GCHG 3TH4H 1FAXA 1AB9B 4KKDA 2BOHB 1AIXH 2GCTB 1Z8RA 4DJZB 3I29A 3PWCA 1XUFA 3RXIA 1ANEA 4ISOA 3V3MA 1TGNA 4NSYA 2BY7X 5EXMA 4NA9H 1SL3A 2IPHA 1GMHG 5HKKD 5GCHF 2KCAA 3SV8A 2ZCKP 1GJ9B 3RXVA 4B71A 2KR7A 3WWFA 2A7CA 4CRCA 1IQNA 3UIRA 3RMOH 1LO6A 1ESAA 5C67A 5LPEA 4NSVA 1K28D 1GBBA 2EA3A 2J94A 1NRSH 3CNRA 1O2WA 3KIDU 1ELVA 3M3VA 3EDXB 4WVPE 3RLWH 2R0LA 5HM9A 5IDKA 4E05H 1HAOH 1WAYB 1CSOE 5T6DA 4IGDA 5JB9S 3KCGH 1GBDA 1Y8TA 1AVGH 3MU0A 1JMOH 1LMWB 1YLCA 3A88A 3E6PH 2QC2A 3GDVA 4ZKSU 1KDQB 4IMQA 3VB3A 3SJIA 3GY7A 1OWHA 3Q3XA 3URDA 4Z0KA 1AY6H 1O5DH 2QF0A 3BTME 2JH5D 2UWLA 3S0NA 1VGCB 4LK4A 4NFEA 3W1EA 1FQ3A 2Z9JA 4VGCC 3L33A 1NRPH 3DFLA 4ASHA 1H8DH 1YLDA 2ZHEH 1C2MA 1EB2A 1S85A 3E90B 3GISB 4NG9H 2ZU3A 3PO1B 1PPBH 1XM1A 3TU7H 2AMDA 1SI5H 1DY8A 1YPKH 1E37B 1DSTA 1O2IA 3AVZA 3VXEH 1TNKA 3O8BA 2XCNA 1Z6EA 1CHOF 7GCHG 2O8UA 4WWYA 2CN0H 1V6DA 1HXEH 2FOFA 4ZHAA 1BRBE 4YM9A 2ZKSA 2KAIA 2WPDD 1SMFE 1UCYK 4CRAA 2Y5GA 4MDSA 3L6PA 3TK9A 5C2ZA 1MCVA 3SNBA 2Z9KA 3FKSD 4FU7A 4YOIA 1AFQB 1P0SH 2XC5A 3SU3A 2V7QD 1P2QA 2W7SA 1YCPM 2YNAA 2K0QA 3MO6A 3MTYA 4A6LA 2QN5T 4TPYA 3ZV8A 4GCHF 1GBIA 2OBQA 3FP7E 3W94A 3RXOA 1CA0C 3RC4A 4P02A 2H9EH 4RT1A 2EQNA 1F0UA 3Q76A 1NZQH 1O3BA 2Z3CA 3OY6U 1L1NA 1VR1H 2I6SA 4JZFH 1DPOA 2VIDA 2KX4A 1Y5UT 2SGEE 1MU6B 3BTKE 4I32A 5PTPA 1CGHA 2VWLA 3UNQA 2G5VA 5GWZA 3H09A 4YT6H 1GCDA 2P95A 1O3IA 1MKWH 1ZJDA 1H8HD 1FY4A 2BVSH 4GAWA 2Y81A 1G3EA 3PLBA 2XYAA 5CHBA 4WMDA 1J16A 1GJ8B 1THRH 2NU4E 3ITIA 3LPRA 1O3OA 3GCTG 4MPXA 1QA0A 3UQOA 3A85A 3SI3H 5E0GA 1OOKB 1Y3XA 5L30H 3GY2A 3ATLA 1BT7A 5DG6A 2WINI 2XNDD 1COWD 3K6YA 4HTCH 1ZPCA 1LCYA 2Z3DA 1W11U 1HUTH 4JZ1A 1IQEA 2Q6GA 5T6GA 4WH6A 2KCPA 1GDUA 2J9NA 1SPJA 4K2YA 4E06H 5GCHG 1T32A 1VJAU 3PTNA 1BIOA 5F8ZA 1RD3B 4CH2B 1B0EA 1YP9A 1J14A 1FY3A 2BDHA 1CT2E 2J2UA 4DCDA 4DIIH 1XUHA 1YPLH 3UREA 2IOTA 3U28C 2ZDKA 3H7TA 1ELFA 3PV5A 4UONA 1XUKA 3D62A 2BLQA 4JYUH 2AIPA 3MNXA 3OEED 3A7YA 1HAGE 1EAIA 4X6OA 4AC9A 1E38B 4NWLA 3WW7A 3V7TA 2K1QA 1CGJE 1KDQA 3SI4H 1DXPA 1E0FD 3GCOA 2D26C 3A7ZA 1SGDE 7KMEH 1C1PA 1SFIA 2PW8H 2A4OA 1QQUA 2IN2A 4U01A 4BAKB 5A09A 1O5EH 5EQQA 2SNVA 4DT7B 2F83A 3W95A 1OWIA 1ZPBA 2F9UA 4D76A 1QJ7B 1QL7A 2FI5E 2FMJA 2A5KA 2ZPQA 3SNDA 1ZRKA 4GLYA 1UK3A 3F6UH 1S6LA 7ESTE 1HBTH 4CRBA 5HMAA 5DO4H 3TK5A 4XD7D 1UTLM 2Z9GA 3D23A 4ISHH 1BTHH 3GCHC 3A80A 1OX1A 2GZ8A 2FOHA 2FEQH 2AGIX 1KTTB 3SGQE 1ARCA 2BMGB 3RXKA 2ZIQH 1KY9A 2LP6A 2VH6A 1BBRK 3TJUA 3A8CA 5E0JA 3MO3A 3RU4D 1CE5A 1L4ZA 1O5BB 3F9EA 2RDEA 1BTWA 1HAHH 2TGAA 1HNEE 1CHOG 1Y3UA 3SU1A 1NROH 2P94A 1C5TA 2VBCA 2V3HH 3E3TA 3E16B 3N7OA 1J17T 1TGTA 3HGNA 1A0HB 3NK8A 1K0HA 4ESTE 1GPZA 4Q4LA 2FYQA 3QDZB 2XC4A 1JXPA 4HI3A 1H8ED 1W12U 1F5KU 1MBMA 2ZFPH 1UVPA 5HYOA 1FLEE 5T6FA 3PYHA 4I8GA 1W0YH 1F0RA 1DDJA 6GCHF 4GCHG 3O8RA 3T62A 2BD4A 1TOCB 2AHME 5CE1A 3U69H 1T31A 4DGJA 1O5CB 2HNTE 2AGEX 1GG6C 2ODQA 2THFB 1O3JA 5FBIA 3TNSA 2CF9H 4UFGH 1GBLA 4VGCB 4X1NU 4FUDA 3BTTE 6CHAC 1ZGVA 4Q7YA 1INCA 2BQWB 3UR9A 3RP2A 3F2HA 1E1QD 2ZFQH 1IAUA 2B5TB 3BTDE 4FUGA 2QIQA 1O3MA 1F5RA 4ZUHA 3RU4E 1W7GH 3S9AA 3BTEE 1W8BH 2ZDVH 4GPGA 1ZSLA 1C5RA 1H9LB 2JDID 5GJ4B 3TGKE 1O2KA 1SGNE 2SGPE 1NFYA 2TGPZ 4KTUA 1ZTKA 4XOJA 1LVBA 4FUCA 4JK5A 3A8BA 2Y5FA 2O8TA 3MU5A 4NA7A 5JB8S 1P09A 1YC0A 2STBE 4H42U 3RXDA 3HATH 3QTOH 3VEQB 1KTSB 4O9VA 2H9HA 4D9RA 3KQEA 2F43B 2SGQE 1V2KT 2FX4A 1EZQA 2PP6A 3RXFA 4AN7A 1IQHA 4ACAA 1BUIA 2A5AA 4NIXA 1AGJA 2GZ9A 4B6EA 1G3BA 4I86A 2PGQB 1EZXC 1O2GH 3SU0A 1MD8A 3B8JA 1DUEA 1CA0B 4B76A 3MNBA 1WCZA 2UWOA 1F92A 1SGRE 1W2KH 2WUCA 2ZGBH 5HGGA 2G00A 2LNCA 4BAQB 5IYTA 1C5XB 4K5ZA 2FZZA 4Z6AH 1VJ9U 1O34A 5B6OA 5EPNA 1DLKB 1IQMA 2A5IA 2QGRA 5A8ZA 4K1SA 4UFFH 1TRYA 3LOXA 4X8VH 2AGGX 1ZPZA 1RRKA 1C1SA 1C5NH 3RXGA 1UK4A 1SGYE 2XBYA 2FOEA 3I78A 2XOKD 2FX6A 1O3PB 1T8OA 1EJNA 2HGTH 1AWFH 1MQ5A 1FY1A 3A86A 1JBUH 5GNDA 1T7CA 3CP7A 2OD3B 4BAOB 1QTFA 4AORA 1LVOA 1OKXA 2OC8A 1V2VT 2PHBA 4D7GA 5L2ZH 1SOTA 3MU1A 4CRGA 1EJMA 1EJAA 1TRMA 4TY7A 4BNRA 3TGIE 2GZ7A 1P06A 4DOQA 3P6ZB 1YY3A 2SGFE 4I8JA 5EXLA 1WXRA 1O3EA 3RXSA 2G55A 4YLQH 2ZFFH 3KN2A 1VCPA 2NU2E 2P3UB 1LDTT 5C3NA 1BHXB 3PLPA 5F03A 3PMAB 1C1QA 2ZG0H 5LPRA 1QR3E 2O8LA 3FZZA 1K1LA 5L6NH 2BDBA 2Z9IA 2BOKA 3N7DA 1LHCH 1MABB 4B1TA 5L2YH 3KHVA 1O5AB 1RFNA 1PQ7A 2BD2A 1DITH 1Y3VA 1AUTC 1S81A 1C2JA 3P92A 1P9UA 4ISNA 2BY9X 1V2QT 1DVAH 2XC0A 2UUYA 5EJLA 3FN8A 3F2GA 3FP8E 1XKBC 2WPJS 1NT1A 4HGCA 4RKOB 3P70B 2YMSD 1HPGA 5A0CA 1YBWA 4TWWA 2FYRA 2NWNA 2F9VA 1AKSA 3A82A 3LGWA 6GCHG 2Z3EA 3F68H 2ZGHA 2SGAA 1EPTC 2CF8H 1BTZA 3NPSA 5EG4A 3WWBA 3OTPA 1O2HA 1MTVA 2ZHQH 1LQDB 2UWPA 2ZQ1A 3OY5U 5BPEA 3SHAH 3GCHB 2BDIA 4SGBE 4ZXXH 1WTGH 4YXWD 4GVUA 1G3DA 4IN2A 1BCUH 2OC0A 1PFXC 1LKBA 1SLXB 3TLOA 2ZHWH 4X2XA 4RSPA 1V3XA 2PSXA 3ZVDA 4X6NA 4OS5A 4BAMB 5TCAA 3ZZ4A 1K1PA 3T28A 3OEHD 3M35A 1CQQA 4X1PU 1GI9B 1T8LA 2GV6A 2AH4X 2V3OH 3U8RH 2SNWA 2TRMA 1EAUA 1P03A 1ZJKA 1Q3XA 1KXCA 5ESTE 3M5OA 2Q1JA 2BDGA 3LIWA 2ZC9H 2VIWA 1MBQA 1GL1A 1G36A 2VNTA 4AX9H 2R0KA 1SBWA 3VB5A 4AFZA 2B8OH 2ESTE 1VITF 4MPUA 3RMLH 3RUOA 1OWDA 3VGCC 1C2DA 1S0RA 1XVOA 4MQAA 3FO8D 2VIVA 1FMGA 1O3KA 1TX8A 1AO5A 3MNCA 1ZRBA 1YPHC 3ENSB 1ELCA 4ABDA 2FOGA 1T8NA 3MMGA 3MWIU 2A0QB 2KM0A 1YPMH 2ZGXH 1LVYA 2W3KA 1GG6B 2VJ1A 4ZHLU 1NY22 2QF5A 1C5YB 1V2NT 2ZNKH 3KQ5A 1T4VH 6CHAB 3U9AH 1OWKA
chains in the Genus database with same CATH topology
1L4DA 1FN8A 1DFPA 2GKVE 1WYKA 2FM2A 2C8ZB 2GDEH 4Y8YA 2ZO3H 2EI6A 1NM6A 5GIBA 2VWMA 4XBCA 4YOGA 3SJ9A 2A4QA 3JZ1B 4D7FA 1HAYB 2O9QA 3M5LA 2HRVA 3IG6B 4CR9A 2DE8A 2BXTH 2ZTXA 2CGAA 3C1KA 1FPCH 5EODA 2OINA 1EKBB 1V2OT 2G4TA 2WPLS 1TE0A 1PJPA 2O8MA 3GICB 1LHGH 2OCVB 2RCEA 4UE7H 2D1JA 1HJ9A 4AFQA 3ZYEA 5TCCA 3DT0H 3LGUA 4B2BA 1Y5AT 2GV7A 1KLIH 3K6ZA 1HXFH 3BEUA 4FVDA 5EW1H 1DS2E 1JRTA 4MLFB 5DP5A 1MKWK 3GDSA 1IQFA 2ZFRH 4GSOA 2PTCE 4CREA 1CBWC 5TJXA 3T25A 1A3BH 2VIQA 2FLRH 3M37A 4O03A 3ZVAA 5H4IB 3SJOA 1QGFA 3AW1A 1UTQA 1BTYA 4F4OC 1SQOA 4AYVB 1F5LA 5HXFA 3KQDA 5FXLA 1O2ZA 1VCQA 2PWXA 3HK3B 1TPPA 1K1NA 1O30A 1C2KA 4KTCA 3M5NA 1QIXB 3B9FH 2ANWA 3M5MA 2BQ6B 2ZU1A 4B2AA 4MNXA 4AB8A 1A3EH 1OWJA 3MU8A 4Y76A 3VB7A 1TPAE 4MPWA 1SLWB 1SVPA 4DW2U 1SGCA 2BVXH 4YO9A 1EZSC 1O33A 2EI7A 4K1TA 4ABHA 1F7ZA 2A4GA 4BANB 1UCYE 3BN9A 3A7WA 3SO3A 3U8OH 2FOAA 1W3CA 1MKXH 1NFWA 4JK6A 4WMEA 1GWAA 2HNTF 1GHVH 1ELEE 1YPEH 1TQ7B 1TNGA 3L3TA 2ZU5A 2BTCE 4YZUA 4TY6A 2ODPA 2PKAA 3GYMA 5JPMH 5ABWA 3LDXH 2SFAA 2BLWA 2Y80A 1HAVB 3U98H 3UNRA 1SSXA 1AI8H 1SQTA 3RC5A 4U30A 4WXIA 1ZOMA 1V2LT 3AAUA 3U8TH 4X8TH 1QCPA 2FS9A 3RC6A 1YM0A 4FXGH 1Z71A 4FU9A 1ZR0A 3BSQA 3T29A 3P8FA 4R0IA 1BMLA 1BRCE 2EEKA 1BOQA 1CVWH 1TX7A 1BMAA 2GP9B 4A1TA 1A5GH 4NCYA 1VITG 4B73A 4ABJA 2GX4A 2ZPSA 1F0TA 1WQVH 2FESH 3TVJB 1GJBB 1AZ8A 1P12E 1O5FH 1GL0E 5C1XA 2A7JA 5JYIA 1EPTB 3ATWA 1GHXH 2FOMB 3DA9B 1O2TA 3OU0A 4Y71A 4ZKRU 4Y6DA 1XXFA 1D4PB 4QT8C 1O2OA 1O3AA 2PUQH 5C1YA 1HIAB 1SOZA 5CHAB 1C4U2 1S5SA 2TGDA 1TQ0B 3F9GA 3LH3A 1UTKA 1XUIA 2H6MA 1QURH 3M7QA 4KELA 3HGPA 3ODFA 2CJIA 1L1JA 2QV1A 3SQHE 3TNTA 1G37A 3P8NA 4HZHA 1GVLA 3VPKA 2ZI2H 3QN7A 5DJ7A 1D9IA 1FJSA 1N1LA 1DOJA 1FDPA 1IQGA 1O2VA 4NIYA 1HYLA 4GHTA 4NWKA 6LPRA 1FAKH 3P95A 3BIUH 2Y5HA 3A8DA 1AMHA 3K2UA 1DICA 1A0LA 3SUEA 4BXWA 1PPFE 1GBCA 1FONA 2OBOA 2XNIA 4FUIA 3VGCB 2C8WB 4IS5A 1QL8A 1MZAA 4B74A 3U1IB 1Z8GA 3MU4A 1TYNA 2TIOA 3RXQA 3AASA 1IHSH 1FNIA 2R3UA 2Z94A 3FAOA 1C5QA 1O31A 1Z1JA 3EA9A 3ZZ9A 2PKSC 5EPYA 1OP2A 2ULLA 3S7HB 1C2GA 4X6PA 1MTNC 1O36A 3HPTB 3I77A 1T8MA 1KXDA 1HAPH 1NU9A 3RXJA 3SQEE 5F8TA 1C2HA 4D9QA 3ATIA 4OGYA 4AFUA 1SFQB 1TNIA 1B0FA 2VWNA 1BBRE 2HPQH 3FP6E 2ZHFH 4MVNA 2XW9A 3ZVBA 4U32A 5AHGH 3A7VA 5DP7A 1UTNA 4Y8ZA 4BXSA 1DM4B 2D8WA 1C2LA 5DKMA 2BDCA 4I33A 1TFXA 2M5TA 3S9CA 2O8WA 3A7XA 1TWXB 1X7AC 2AYWA 4FUJA 1WOFA 1P04A 1KXFA 2JH0D 1TBZH 4IBLH 2GGVB 2OUAA 5BRRE 2GD4B 1GDQA 4PROA 1WUNH 2BLVA 4GHQA 3MYWA 1HAVA 4WH8A 4B75A 2XBXA 1MQ6A 1C1OA 2AERH 2Y82A 2HWLB 1CBWB 1HB0B 3KEEA 1EZUC 1RTKA 1GJ7B 1Q2WA 2PFEA 4H6SB 1GDNA 2ZPRA 1O2QA 1GBEA 1PPEE 4KGAA 1Z7KA 5T3HA 4F49A 5FHTA 4TWYA 4RKJB 1RJXB 1P02A 1LQEA 4NFFA 1C1MA 4O3UA 1BRAA 1GMDF 1BQYA 1O35A 1V2ST 1ANBA 1SLVB 1DWDH 1A0JA 4A92A 2WUBA 3NWUA 1EATA 1UHBB 1P2OA 1AD8H 2AMQA 9ESTA 1Y5BT 2RDLA 1EPTA 1GBAA 2XXLA 3F9FA 3RMNH 5DP3A 1HCGA 2PTNA 3HKJB 2JKHA 1QL9A 1UVOA 1O3FA 5AF9H 1IHTH 1LTOA 3BTHE 2RA0A 1HIAA 1ID5H 1HRTH 1PQ5A 1XKAC 1XX9A 1FY8E 1ZYOA 2HPPH 4UDWH 1QJ1B 2XWBI 1EXFA 1TIOA 3LGIA 1QRZA 4UFEH 1B5GH 1O3GA 1GGDC 1GI6A 3RXPA 4JZIA 5EW2H 3LGTA 3K9XB 2PLXA 3FFGA 3P8GA 4I8LA 4R8TB 3VB4A 1SGQE 3LONA 1C5WB 1FN6A 1IOEA 1GI7B 1NN6A 3LC5A 3SU2A 3LGVA 1EQ9A 3E91A 4U2WA 3NCLA 3GCNA 1L0ZA 1PPGE 4MNYA 4ABFA 4XDEA 2VH0A 3SV2H 2H1UA 2ZHDA 3UTUH 2XTTB 2ZCHP 1NFXA 4NZQA 4CHAC 1GJ5H 1T4UH 1ZSKA 3RXBA 3V12A 2D2DA 2OTVA 3ZVGA 1OS8A 3A87A 2FS8A 2A7HA 1BMNH 4YLUA 3EYDA 2Y6TA 1W13U 2H2ZA 1TPSA 1V2JT 1G32B 3RXCA 3ZZBA 1V2WT 1A4WH 4FU8A 2BD9A 1ACBE 1AFEH 2QXGA 1RGQA 4FUHA 1FXYA 4E7NA 4DURA 1QRWA 1Z8JB 5E8EH 1GBHA 3GOVB 1GI4A 4IC5A 1LPKB 3QUMP 4INLA 3ZZ7A 3ZVCA 2VWOA 2ZWLH 3A8AA 1CA8B 2ZU2A 2PV9B 5FPYA 1CT4E 4SGAE 3ELAH 1UVTH 1GHBF 1EX3A 1RTLA 3RXRA 1OSSA 2HALA 3Q3YA 1K1MA 1TPOA 1TNHA 3UWJH 1SC8U 1BTUA 2J95A 1TNJA 2Z6BD 1O2JA 1MH0A 2ZFSA 3FANA 1B7XB 1W10U 2BD3A 1GBKA 1GJ4H 3LJJA 2C8YB 4AFSA 1FUJA 2A2QH 2QCYA 3EA7A 3UUZA 3UR6A 4OS7A 5EGMA 1V2RT 3LH1A 2P3FH 3M61U 1MD7A 2G5NA 1UO6A 2P8OC 5A0AE 2GCHF 2AMPA 2FP7B 2GT7A 3QZRA 3ZZ3A 4WXVA 3SZNA 1AUJA 2NU1E 2PKSB 1ELGA 1IQLA 3SJ8A 2PUXB 3SW2B 4WY3A 1DXWA 2G4UA 1MTNB 4K3JA 1TBRH 1UHBA 1O39A 4CBNA 4THNH 1F0SA 4INKA 1EP5A 3SV7A 2QYIA 1XVMA 2GT8A 4LZ1H 2ZDAH 1GMDG 4Y0ZE 4OS1A 1D3PB 3IWMA 1LHDH 1WQSA 1CO7E 1S82A 4FUEA 4I8HA 6ESTA 5SGAE 1O3LA 2V6NA 3BV9B 2ZQ2A 1UTPA 1PPCE 1J8AA 3E0NB 4OS6A 2BM2A 4DVAU 1G9IE 4KTSA 3UWIA 2BD7A 3O8CA 4ZH8A 4AG1A 4K69A 1ZTLA 5LPFA 4LXBH 2Y7XA 1A46H 2G51A 1O3HA 2FI3E 1N8OC 3ZYDA 3IITA 3OX7U 3SUDA 3A83A 1HJAC 1EOJA 4BOHA 4X1QU 1O2LA 2A4RA 4RN6A 2B0FA 2QY0B 3V0XA 1P10A 2VB0A 3CENA 5FAHA 1LHFH 5FX5A 1AVWA 1C5MD 1EAXA 1MTUA 1QA7A 1S83A 3LKWA 2F9NA 1C4V2 1C9PA 1C5ZB 2ZGJA 1RS0A 3GY5A 1YGCH 2RA3A 2AEIH 2UUJB 1O32A 5EOKA 2B7DH 2OC7A 3T5FH 4Y7AA 2KAIB 1O3NA 1GI2A 1D3QB 2OC1A 4LOYH 3NXPA 3GY6A 1A1RA 4CBOA 1O37A 1MKXK 3ZZ6A 3ATKA 3NKKA 4X2WA 4DG4A 2ANMH 1SGIB 1PYTD 2PSYA 5LH8A 2ZF0H 1ZGIA 4BTUB 2BDYA 1MMJN 4ISLA 5FBEA 4MTBA 3TIUA 1TGBA 1YCPH 1MTWA 2F9OA 1CU1A 4XBBA 1F2SE 3P8OA 3A84A 5A2MH 1CGIE 2WYJA 3M7TA 3SNCA 2W7UA 1J9CH 9LPRA 2IJOB 1H1BA 1N6YA 3PROA 2WV5A 3BEIB 4Y8XA 3PM3A 1THSH 3GYLB 3SBKA 4A7IB 3MO9A 4X0WU 2JH6D 3MFJA 1HFDA 1E34B 1P05A 3K65B 4NGAH 1JIRA 1C1NA 1O5GH 1D3DB 2WPMS 4AZ2B 5JBCS 2CV3A 4B2CA 2H5CA 4OGXA 1GGDB 4J2YB 1FIZA 2WPHS 2FXRA 1EP6A 1O2RA 1NU7B 1E36B 1P2NA 4JCNA 1CT0E 1DX5M 1AE5A 3QWCH 4O97A 4OS4A 1FPHH 3PMJA 1BTXA 1GHBG 3VB6A 3STIA 1RXPA 1P9SA 3SORA 3UQVA 3CS0A 3TJNA 1IQIA 2ANYA 1A2CH 4XFQA 3SN8A 3KGPA 1SB1H 4Y0YE 4CHAB 1S0QA 2Z7FE 1HAIH 1NS3A 1ESTA 3RXTA 2BX3A 2A32A 2RG3A 4WJG2 1A61H 1GJAB 4IW4E 2XRCA 2GTBA 1SHHB 1C5SA 2A31A 4MPVA 1ZTJA 2G52A 4M7GA 3F1SB 1FIWA 1MCTA 1O3DA 1DWCH 5F6MA 3JZ2B 1MUEB 2H5DA 3DFJA 1TONA 5AVDA 2BY6X 2JETC 3EQ0H 2UUFB 2J4IA 4WMFA 1SGPE 2BD5A 2FWWA 4XE4A 2GCHG 2J92A 3F9HA 4IMZA 1PQAA 2LPRA 3BF6H 1BTPA 1G2MA 1A5HA 5DP4A 2VINA 5CMXH 2W5EA 1MZDA 3OYPA 1YPHE 4GUXA 1NTPA 1K22H 1SLUB 4X8UH 1AE8H 1XXDA 3RXAA 1VCWA 1O3CA 1O38A 2A1DB 3PLKA 4DY7B 4K8YA 5FPTA 1ZSJA 2ILNA 1UVUH 4UD9H 4J1YA 3AW0A 1BHXF 2DE9A 4JMYA 1H9HE 4XBDA 5ETXA 2Y7ZA 3PV4A 2HLCA 2J34A 1NRQH 3RM0H 1MAXA 4IC6A 2XCFA 4FUBA 4JZEH 2J38A 4ZAEA 1TGCA 2GVFA 5I25A 1ORFA 1EUFA 1O2YA 4I8KA 2ZTYA 3MH7A 3AAVA 1NO9H 3QGJA 2WYGA 1NC6A 1SG8B 5C5NA 3SGBE 1C1RA 1G2LA 3ZZ8A 1KSNA 2F91A 1UTOA 2OQUA 3BTWE 8ESTE 1BRUP 3T26A 1UTMA 2P8OB 2BX4A 5DPAA 1C5OH 2FOCA 1OP0A 1AHTH 2B9LA 2FTMA 5JBTA 2PGBB 2HOBA 3BG4C 1PQ8A 1HDTH 1J15A 3QTVH 4ZKNU 4ABAA 2F9PA 1K9OE 1C5VA 1L1GA 1A5IA 5EXNA 3RDZA 1QY6A 2BHGA 4AYYB 1ETRH 1YYY1 2Q6DA 3GDUA 2ZP0H 3QLPH 4ZROA 3Q3KA 5DP8A 1JOUB 2BY8X 1GMCF 2H9TH 3PB1E 1TABE 4Q80A 1AWHB 2FOBA 1N8OB 1XUJA 2TPIZ 1GI5A 1O2MA 4YOJA 5G4BA 3HKIB 4ZKOU 2EI8A 3SU5A 1GHWH 1HJAB 1QBVH 3LU9B 3MH4A 3LC3A 2AS9A 1SQAA 3S7KB 2ANKH 1KXEA 4O3TA 3Q00A 3A89A 4Q7ZA 2VU8E 1GHYH 1EOLA 2ZCLP 2CHAC 3M3TA 3VFEA 3UY9A 1LPGB 1UVSH 1A7SA 4TPIZ 4CRDA 1C1TA 1GHAF 1Z1IA 3URCA 3SGAE 1BMMH 4ISIH 1KLTA 1ABJH 5LGOA 1OP8A 1GBFA 1QB9A 1GVKB 4AGJA 4A1VA 1QBOA 3M7UA 2BDAA 2VVVA 4X2YA 1GCTC 3ZV9A 1C2EA 1Y3WA 1TA6A 4NZLA 1WV7H 3PMHB 2OLGA 3R0FA 3DD2H 5FCKA 4Q2KA 1ANDA 1IQKA 3SU6A 3TH3H 4UFDH 1FI8A 2ZZUH 4BAHB 5E2PA 2HNTC 2STAE 4X2VA 1W7XH 4Y7BA 4ABEA 2VGCC 1C1VH 3E0PB 3ZZ5A 4MG3A 3D65E 4A1XA 1AVXA 1QQ4A 1K2I1 1NFUA 5FCRA 4AOQA 2QXIA 3RMMH 1K1OA 2FI4E 1ARBA 4YTAA 2FDAA 1KXBA 1DWEH 1UK2A 3T27A 4DIHH 2BZAA 1DUAA 3MHWU 3VXFH 3TJOA 1Z6JH 4X1SU 3OSYA 3SUFA 1TAWA 3UOUA 1D6WA 1GVZA 3MH6A 1H8IH 2HVXA 1P3EA 5FX6A 1UCYH 1SGFA 1QRXA 3MI4A 1TOMH 1NRRH 3QGNB 1D3TB 2WPKS 2BVRH 3A81A 3EA8A 2P59A 3SJKA 4KP0A 1N6XA 1LVMA 2QF3A 1K21H 1GBJA 3PWBA 1C4Y2 1BJVA 1WBGB 1HV7A 3SNAA 1BDAA 3Q77A 3LT3A 3QX5H 2SGDE 2VIPA 5EQRA 2R2MB 3BG8A 2ZDNA 1DY9A 5DK1A 1JWTA 3E1XB 2ASUB 3SUGA 3MOCA 2FODA 1KIGH 3ZZDA 3KQBA 1GI0A 2Z9LA 1QNJA 1PPHE 3DHKH 5I46H 1EB1H 1THPB 4ABBA 2C93B 2VVCA 3UOPA 1QFKH 3EAJA 1ETTH 4XSKU 3T2NA 3WY8A 3RXHA 1SGEE 2JETB 2XBWA 3UNSA 2C90B 3KF2A