4ZKNU

The crystal structure of upain-1-w3a in complex with upa at ph5.5
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
246
structure length
245
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 245
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zknU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zknU01
3FVFB 1H8IH 3EA9A 2R3YA 5DG6A 2FM2A 3MHWU 5ESTE 3A88A 3M3SA 3V0XA 1FY1A 1GBHA 2ZGXH 1O0DH 4LOYH 1NRPH 1TNLA 4A7IB 1O39A 2XYAA 1O5BB 1WBGB 1ZMNA 1GDQA 5C5OA 1WTHD 1LTOA 3HKIB 1VITF 3MU0A 3R3GB 4I8GA 1AFEH 1KXBA 4MNWA 1O3PB 1GGDC 4XFQA 1HB0B 2Y6TA 3BTFE 3BTKE 3KCGH 1BJUA 1AQ7A 1VITH 3TPIZ 1GJ7B 3E90B 1XUGA 4F4OC 1XVMA 4UD9H 4GPGA 3RXCA 1A3EH 3M61U 1BTYA 5AVDA 3SGBE 1FONA 4D8NA 1LHCH 1P04A 3SGAE 1THPB 3GY2A 2HPPH 3V3MA 3T62A 1O3IA 5E2OA 1TPOA 3S9CA 5EOKA 3HKJB 4B2CA 2ZHFH 1Y5BT 1JOUB 1AY6H 1XKBC 1CHOG 2GZ7A 3IWMA 5AFYH 1ZOMA 3ZVFA 6GCHG 3DUXH 2ZWLH 3SU0A 2BDCA 4FVBA 1ESBA 1SGIB 1XMNB 3PLBA 1ZHPA 1Z8RA 3K6ZA 1LHEH 1AVWA 5T6GA 2Y5FA 2G4UA 3M35A 4OS6A 1W7GH 3PM3A 5HXFA 1YLDA 2GCHG 1SGDE 1GHVH 2D1JA 3AAVA 2OBOA 1EAIA 3BTDE 3M7QA 3TK6A 3K9XB 1GBTA 4K8BA 2VVUA 2XWBI 3PMBB 4YZUA 2ASUB 3DHKH 3T26A 3M3VA 1ELCA 1AN1E 5LGOA 1Y3VA 4MPUA 4NCYA 1F0RA 3MH5A 3TVJB 1S6HA 1GI8B 4UFEH 1BTPA 5IDKA 1K1MA 1O2IA 2A1DB 1JBUH 2VH0A 1V2TT 4NIWA 8GCHF 4JZDH 1GHZA 2A4OA 3EE0B 1K1JA 4TPYA 3W94A 2FZZA 1O3KA 2PSXA 4K69A 2R9PA 3HGPA 1C5MD 2STBE 1F5LA 5FBIA 2GCTB 2LNCA 2BDGA 1OWJA 1UTPA 2A31A 2P8OC 3OY5U 3VGCC 4ISOA 4THNH 1VZQH 1NTPA 1CT4E 2BZAA 1GBEA 4ABDA 5L2YH 4YESB 2OINA 2Z9JA 4E06H 1AE8H 1B0EA 3RMOH 1ZSKA 1PPZA 1LVOA 2XRCA 3RXIA 7GCHG 1DLKB 1TABE 4Y79A 4MPXA 1ZYOA 3SOSA 1YKTA 4E7NA 1G9IE 3KGPA 3MOCA 1A5HA 2ZQ1A 4OGYA 5DPAA 6CHAC 4X6PA 1FI8A 1J14A 2ALVA 4WWYA 1VCWA 4Q7ZA 9ESTA 3L33A 3PTNA 1KTSB 4R8TB 1NT1A 2UWOA 1C1MA 5EODA 4IW4E 2UUKB 5EPNA 2GMTB 1C5UA 3A7VA 4WH8A 1BUIA 1ELFA 2A4GA 3EGKH 1IQEA 1OXGA 5GIBA 1CE5A 2R3UA 4FUEA 3GDUA 3CENA 2JH0D 3RLWH 1QURH 4YLUA 4ISHH 1O30A 4D9RA 4J1YA 4MPVA 4DY7B 1DY8A 1YBWA 3A7WA 1PQ7A 2G00A 1OS8A 4YT6H 4WXIA 1N8OC 2BD8A 4CH8B 1TONA 1WCZA 1C5VA 5A2MH 1LPZB 1O3EA 2A5IA 4WMEA 1GVKB 2F9VA 1AU8A 3ZV9A 3LJOA 4ABEA 1PPHE 1QCPA 4MNVA 1C2FA 1AUJA 1VCPA 3TK9A 4Y0YE 2J95A 4M7GA 4AB8A 1TGTA 1W0YH 2FOCA 2IOTA 1AVXA 1HAVB 3RXLA 1GBJA 2UWPA 1YGCH 1G32B 2H1UA 5EW1H 2V6NA 3M37A 5C3NA 3WY8A 3FAOA 1YPHC 1QBVH 1H1BA 1ZHRA 2ZO3H 2XCNA 1O35A 4Q7XA 1ETRH 2ANYA 2FOAA 3NK8A 1C4V2 3PMJA 1CHOF 1P0SH 2G51A 1UTKA 5SGAE 4AFSA 4DCDA 1HJAB 2OCVB 1UVTH 2A4RA 1T8MA 3EA7A 6GCHF 4IN2A 1TBRH 1CGHA 3A87A 1GMHG 5E2PA 1IQNA 1FAXA 4K1EA 4AOQA 2BY7X 3S9BA 2VU8E 1TAWA 4CREA 5FPTA 2BLVA 1CO7E 1HCGA 1C5PA 1J9CH 2ZTYA 3TGKE 3CS7A 3URCA 3A80A 2ZP0H 4AYVB 1GBLA 2GCHF 2M5TA 2DE8A 4AYYB 1G3CA 1DICA 1NROH 1GPZA 1JRSA 3DD2H 4JZ1A 2J34A 4JYUH 3SU1A 3RUOA 2OUAA 1ZTKA 2OBQA 5DP7A 1T4VH 3SI4H 3B8JA 3LC3A 3KQBA 2Q6FA 4WJG2 2QXIA 1O5AB 4YOJA 1A7SA 2ZCKP 5T6DA 2CF8H 1AHTH 2F9UA 1WYKA 2AYWA 2FO9A 1K28D 3GYMA 5EXNA 1GJ6A 5HM9A 4NIXA 1F2SE 1U6QA 2ZFSA 1D3QB 2ZHEH 2FTLE 4NZLA 4RN6A 2GV6A 4X0WU 1TX7A 1JMOH 4XDEA 1AWFH 2CV3A 1GI9B 3MNBA 2BD9A 4FUFA 1MAYA 3MNSA 3SZNA 2Q6GA 1BITA 1P06A 4X8TH 1GJAB 1K9OE 1SGRE 1GGDB 1T4UH 2H6MA 5EXLA 1PQ5A 1DS2E 1BBRE 2ZNKH 3LKWA 3LU9B 1AZ8A 4DT7B 1OWKA 5A09A 4IC6A 1K1NA 2J4IA 1LPGB 2A7HA 1TGSZ 3L6PA 2BY5X 5F8XA 4AG1A 1LVMA 1PPEE 5JB8S 1UK2A 1ZRBA 2VIPA 4OS5A 1AVGH 3Q3KA 1B0FA 3B9FH 4BANB 2O9QA 2BLOA 1SQAA 1QB1A 1QR3E 1W13U 3R0FA 4DVAU 2ZHWH 3SV9A 1GI5A 1IHSH 3L3TA 2GDEH 1EPTB 3U98H 1MTNC 4CRBA 2P3FH 3GY6A 1YCPH 1VCQA 3ZZ9A 2Z9IA 2A7JA 4YTAA 2PTCE 1P10A 4XE4A 2AIQA 4X1SU 2AH4X 2F9OA 2TIOA 1A5GH 3T28A 4I8JA 2C3SA 1WU1A 1WAYB 2PUQH 4INLA 5TJXA 4U2WA 4JK6A 1QRZA 2XBVA 3UPEA 5LH8A 1C9TA 1BMAA 1XM1A 3GY5A 2B8OH 4AFUA 1SG8B 2FX6A 1HAGE 1SFQB 2WPMS 3IITA 1C5NH 2W7SA 5JPMH 3LIWA 1A61H 4ZKRU 2PV9B 2BX3A 3UOPA 2WPJS 1EOLA 4BAQB 3ODFA 3O8RA 4LXBH 4AORA 2H9TH 2BD5A 3M7TA 2G81E 3RM2H 2PGQB 1FDPA 4KELA 4MLFB 2LPRA 5LPRA 3A8DA 1NU7B 4Z6AH 4U30A 1F0UA 4X6OA 3ESTA 3UNRA 5GXPA 3QGJA 2P8OB 3VGCB 1XUIA 1GBKA 3VB6A 1JIMA 5HM2A 2FS8A 1UVSH 4ABFA 2J94A 3KQDA 2HRVA 4HGCA 2QY0B 3W95A 2ANKH 3PLPA 4NA8A 2FLBH 4K8YA 1NS3A 3U8RH 2PGBB 1TNGA 4I31A 5EG4A 2Y82A 3Q3YA 1H4WA 1ABJH 1SQTA 3F9FA 3RLYH 3RXEA 3RXBA 1TIOA 3MU5A 5TCCA 3TJNA 4AG2A 1ABIH 5DO4H 2ZDKA 2ZKSA 3U1IB 2FIRH 4AFZA 1MTSA 3BTHE 2VIDA 1HNEE 3RXDA 1CQQA 3U1JB 1V2PT 1SLXB 4YOGA 1PYTC 4ASHA 2EI6A 2GP9B 1EJMA 3PYHA 4IC5A 2QCYA 3EQ0H 1SHYA 1DFPA 4FUBA 3RP2A 5AHGH 2SNVA 6ESTA 2A4QA 4AX9H 1D6RA 2G55A 2Z9LA 2ZF0H 3LGTA 1FAKH 1S85A 1W8BH 1VJAU 1D3DB 3LH3A 2G5VA 1C5TA 1W14U 1IAUA 1P2IA 4TPIZ 2ZQ2A 4X2YA 3EAJA 1GJ5H 3I77A 2Z7FE 2FXRA 1P12E 2A45B 4ABBA 2RCEA 3T25A 3VB3A 3UY9A 1BOQA 3A84A 1Q3XA 1FN8A 4MNXA 2R0KA 1QJ7B 3DT0H 1YF4A 3SUGA 1FY4A 1O36A 3RMNH 4H4FA 4OS2A 5A0BA 1IOEA 3MH4A 2BD7A 1AIXH 3LGWA 2ZECA 3BG8A 1MKXK 3SHAH 2BQ6B 1EAWA 1GCDA 2VINA 3A7ZA 1KLTA 1FPCH 3NUMA 2F91A 1G2LA 2AEIH 1OYTH 1E35B 3BV9B 1FLEE 1L1NA 2OLGA 5FXLA 1HLTH 3TH4H 5LPEA 3PLKA 2DUCA 1C1UH 2SGDE 2BXUH 1PPCE 2AFQB 1RXPA 5HGGA 2Y5HA 1K1OA 1S83A 1KSNA 2ZGBH 5F6MA 1NFWA 1ZMLA 1P8VC 3RXKA 4YT7H 4CRGA 1S0RA 2AGEX 4BAMB 4ZAEA 2FWWA 2ZIQH 1C5QA 4O03A 3M7UA 4PROA 3SJ9A 1G36A 1OKXA 3BIVH 2TBSA 4WY3A 3QO6A 2ZGJA 1WV7H 2ZU3A 3LGVA 1TYNA 1TX8A 3NKKA 3KN2A 1DSUA 2PUXB 3QK1A 5DP5A 1L4DA 1QA0A 3M5MA 1VR1H 2F9NA 1TRNA 3TJVA 4Y7BA 3MO3A 1SMFE 3NZIA 5EQRA 3QN7A 3FZDA 3OYPA 3E6PH 4K5ZA 1DVAH 2BDAA 4MQAA 2XBXA 3AW0A 2KAIA 1S0QA 1P05A 4DURA 3M5NA 4JMYA 1KDQB 1O2OA 4OGXA 4WH6A 1Y3WA 1K1LA 1V2UT 1TPPA 3GY8A 4CR9A 2VIWA 4HI3A 1L2EA 2OD3B 5CHAC 4B74A 1Z1IA 3D49H 3BIUH 1QL8A 1ORFA 3BG4B 1A2CH 2PFEA 7KMEH 2VVCA 2Q1JA 3DFJA 3U8TH 1SGEE 2D2DA 1A46H 2FI4E 2VGCB 4Y0ZE 3E8LA 1AWHB 3O8DA 1L0ZA 1WQVH 4FXGH 1GI0A 1PPBH 3NPSA 1GBCA 4O3TA 3LONA 2FP7B 2WPKS 1QQ4A 4UEHH 3UFAA 1Y5AT 3S69A 2Z9GA 3H7OA 3H5CB 2ZCHP 1EPTC 6LPRA 2QN5T 1O2JA 2XTTB 4JK5A 4DJZB 2GD4B 1GJBB 3MYWA 1GVLA 4YLQH 1FQ3A 1NRRH 5JBCS 1AB9B 2H9HA 1P2JA 3VB7A 2ODPA 2FOMB 1ZLRA 1MTNB 1O3GA 1SGQE 4GUXA 1CGJE 3SU6A 4NSYA 1BHXB 4JYVH 1LVYA 3SU3A 2HWLB 1BTZA 4AB9A 4UFFH 1F5KU 1T31A 2EC9H 4BNRA 3I78A 2PKAB 5ABWA 2ZDAH 5JBAS 2CJIA 1ZSJA 1HAIH 5A8XA 3SQEE 1JIRA 1ELAA 1H9LB 3RXJA 1AO5A 3S9AA 1BMLA 1KXAA 4TWWA 2Z94A 1QTFA 1DXWA 2WV4A 1AUTC 2WYJA 3QGNB 5HYOA 1E36B 1C1PA 1GJ9B 3D62A 3VPKA 1LVBA 1E38B 2ANMH 3M5OA 1TNHA 2UUFB 1MZDA 4HTCH 1TRYA 3SORA 2D8WA 3O8CA 1ELVA 1NRQH 1J17T 3T27A 5ETXA 3ZVDA 1RD3B 3ZVGA 3AASA 1UTOA 1IQIA 1ARCA 1UHBB 1Z8JB 3STIA 2XC5A 1ANCA 1L4ZA 3RMMH 3SI3H 3GCNA 1AE5A 1P11E 3ZZAA 1CU1A 4WF8A 2B5TB 2VWOA 1EB1H 1PQAA 2Y7ZA 2GZ9A 1O2HA 2G4TA 2SGEE 1V2ST 1DE7H 2ZPSA 4VGCC 5JB9S 5DP3A 3ZZBA 1B7XB 1AKSB 1BMNH 1P02A 5EW2H 1SLVB 1HAYB 1DT2A 2HNTC 4TY6A 1C2LA 5EGMA 3RM0H 1CT2E 2SGFE 3RXGA 3K65B 3AVZA 1TA6A 5C5NA 1UTMA 1KY9A 3A82A 1ANEA 2BTCE 1G30B 3F68H 4D9QA 1YYY1 1TB6H 1C1NA 1GI7B 4A92A 5C1YA 3T29A 5C2ZA 2GT7A 4JZIA 1XKAC 1Z1JA 3QDZB 2CXVA 1GDUA 4JCNA 8KME2 1O2ZA 2QXJA 1VGCB 4JYTA 1ID5H 4FUCA 1BRAA 1Q31A 1EP6A 1H8DH 2W26A 2WUBA 3LJJA 2P16A 2IJOB 2ESTE 4I7YH 1GBMA 2VWLA 3SQHE 4IS5A 3S7KB 1O3FA 2W3IA 1AKSA 1LKBA 3OU0A 1RRKA 2P3TB 4ISNA 5A0CA 2OQ5A 3ZYEA 4NFEA 4Y8XA 1GI2A 2XNIA 4X2VA 1IQFA 2NU0E 3TK5A 3SU4A 5GWZA 4K3JA 5DP9A 2AGIX 1LKAA 2GVFA 3F1SB 1KIGH 2FTMA 2QC2A 3OX7U 4X2WA 5JDUB 2J9NA 1Z71A 1TNKA 1GHXH 4FU9A 2A5AA 1QGFA 1T32A 2ANWA 1MCVA 3M36A 3UTUH 1FPHH 2CGAA 5GJ4B 2ZU5A 1RIWC 2ZU1A 2OXSA 1HAXB 1BRCE 2VIVA 1C2EA 1HBTH 3RC4A 5I46H 1QIXB 1UTJA 2RDLA 3SNCA 1FMGA 3ZV8A 3RXFA 1KLIH 1V2QT 3MU4A 1WTGH 1PPFE 3PROA 2UUYA 1O3CA 2FOBA 3GISB 5K7RA 1A3BH 1NFYA 1XUHA 1BRUP 1SOTA 2B9LA 3OTJE 5JYIA 2ZHDA 4FUDA 1ZMJA 1SGFA 1UCYK 3MU1A 1D3TB 3TH3H 1UTQA 3BTME 4X8VH 1C1TA 3STJA 3LC5A 3P8GA 3QTVH 4SGAE 1T7CA 1K1IA 4ZHLU 2AMPA 4IN1A 1ESAA 4ABIA 1YCPM 1HAVA 1W2KH 1Z6JH 2G8TA 4K2YA 3TITA 4NGAH 9LPRA 1EAUA 3ODDA 1J8AA 2FYQA 1MU8B 2THFB 4XOJA 5GDSH 4IBLH 2FYRA 1D4PB 1KTTB 4BTUB 1G37A 3BG4C 2BY9X 4ZROA 3RXTA 5A8YA 2ZFTA 4GLYA 2VGCC 1HGTH 1MKWK 3VFEA 5CHAB 1TNIA 2NU1E 2XC0A 5J4QA 5FX5A 1S81A 4B71A 1MKXH 1O2MA 4NSVA 4FUGA 4H6SB 1DSTA 2AMDA 2O8MA 2ODYB 3UWJH 1BZXE 2QGRA 3TGIE 3UQOA 1GMDG 1O2XA 1V6DA 4FUIA 2Z3CA 3RXQA 1GMCG 2EI8A 3KQEA 2P95A 4BAOB 1MBMA 3NXPA 3AAUA 2XWAA 1YPMH 1UVPA 3KNXA 4OS1A 3IG6B 4B76A 1OP8A 4AZ2B 3LT3A 1SFIA 1AB9C 4H6TA 1MAXA 1EZQA 1X7AC 1WUNH 3K2UA 1NO9H 1O3DA 1ELEE 3RXMA 2WINI 1C5SA 2VNTA 3A8AA 4NFFA 1FIWA 4ZKSU 1C5OH 2HALA 3SV2H 4JZEH 2A2QH 3V7TA 3PO1C 1O34A 2VB0A 1P09A 1ZPZA 2IN2A 1JXPA 3Q77A 3E91A 1C4U2 3I29A 2BXTH 1LQDB 2GZ8A 7ESTE 4CRDA 8ESTE 1H9HE 4ABHA 1QY6A 2A7CA 1CBWC 3SJOA 1HAPH 1O3OA 1TGCA 1FN6A 2BM2A 1K1PA 2P59A 1C1WH 2ZPRA 2C90B 3C27B 5BRRE 1SGYE 1QB9A 1CVWH 5T3HA 3SGQE 3PTBA 5C1XA 1H9IE 1LPKB 3GCHC 2J92A 5F8ZA 2GGVB 1FXYA 1C2IA 1HAZB 2C8ZB 3SJIA 2ZDMA 1BCUH 2V0BA 3E1XB 4D76A 1EPTA 1P2OA 1P2QA 4NZQA 2AERH 2OC8A 2ZFPH 1DOJA 3A81A 2TPIZ 2P94A 1OWIA 4DG4A 1Q2WA 5GCHG 1HV7A 4Y10E 4B2AA 1OWEA 1MMJN 1O2KA 2CN0H 4GAWA 2FS9A 2BY8X 3N7OA 1TBZH 2XCFA 4VGCB 3A89A 8LPRA 1MBQA 1C2JA 4UE7H 1O2UA 5L6NH 1P3EA 1HJ8A 1W10U 1YPHE 1GG6B 1GI4A 1MQ6A 1C1SA 4NA9H 4NWLA 1LHFH 5EQSA 1NU9A 2UWLA 3TLOA 3BEIB 5EQQA 3SJKA 4XBDA 4NWKA 1KXEA 4E7RG 2OC7A 1C9PA 2ZGHA 1V2RT 3ZZ5A 4H42U 3KEEA 4DGJA 3KIDU 1VGCC 1AFQC 4NA7A 1SVPA 1ZR0A 2BDBA 1C1RA 1Z8IB 3FANA 3ZZ8A 5J4SA 3EDXB 2VWNA 2AGGX 1IQGA 1C1QA 3RC5A 2GDDA 1THRH 4CR5A 3CP7A 1TFXA 2WUCA 4FVDA 3F9GA 2P3UB 2XC4A 1AGJA 3VEQB 1PQ8A 1TWXB 2O8WA 1EJAA 1MH0A 4A5TS 1EQ9A 1ZZZA 4E05H 3MU8A 1LCYA 1MZAA 1NFXA 1V2VT 1C5LH 1K22H 4KTUA 3M3TA 1S5SA 4Q80A 1OWHA 4WMDA 2ZC9H 1ESTA 2Y81A 3F6UH 4KKDA 1SGFG 3ATMA 4NG9H 1O38A 2ZGCA 2Z3EA 1DWCH 1SGNE 2OTVA 1SI5H 1C5YB 2ZEBA 5LPFA 4INHA 1GI3A 1HAHH 1XUKA 2PR3A 1SB1H 1TNJA 2V3OH 4YOIA 4ESTE 1BTHH 1CT0E 4Q7YA 1HDTH 1UK3A 1TRMA 4ABGA 1JRTA 3SBKA 3CS0A 4D7FA 3BF6H 3RU4E 4MDSA 1TMUH 3F9EA 1EASA 1YPGH 3SUEA 1TPSA 2OQUA 1GMDF 4ZHAA 1Y3UA 1EATA 3SJ8A 5DP6A 1GMCF 1OPHB 2Y7XA 3SNBA 3RXUA 1C2MA 2WV5A 1RIWB 3FFGA 1C1VH 3MNXA 1UO6A 1ZTLA 5JBTA 5E0GA 4MNYA 1EB2A 3TJUA 1TBQH 2ZFQH 3ZYDA 3BTTE 3P95A 1P2NA 2XW9A 1BBRK 2A0QB 1NPMA 2SGPE 3BN9A 1SOZA 1BHXF 3UOUA 1XXFA 5K0HA 3B23B 1HUTH 5DKMA 1CSOE 1O2VA 1PJPA 2BQ7B 5H4IB 3Q00A 5TCAA 1ANDA 1W7XH 3ZVBA 1YPJH 4OS7A 3ZVCA 2FEQH 5FX6A 3UR6A 4LK4A 4A1VA 1GJCB 2O8LA 1AMHA 3LDXH 1EOJA 5A0AE 2FX4A 4K1SA 1O3LA 2NU3E 2RA3A 2R2WU 4U01A 4B1TA 1N1LA 1QJ1B 1A1RA 2H2ZA 1J16A 3FP7E 1W12U 2AMQA 1NM6A 4A1TA 2PHBA 1RS0A 3ELAH 3RXVA 4BTIB 3MFJA 1DUAA 2TGDA 3TNSA 2G5NA 2CMYA 3A7YA 1XUJA 1CA8B 2I6QA 2PLXA 2HLCA 1MQ5A 1NZQH 1O2WA 1EJNA 1V2KT 1YPKH 3RU4T 3Q3XA 1EKBB 2B0FA 2F9PA 1UTLM 1ZSLA 5CE1A 2PW8H 1ZJKA 1Y59T 5GCHF 1T8OA 5E0JA 5PTPA 2BVRH 4ZUHA 4Q2KA 1OP0A 1UJ1A 2CHAB 2EEKA 2I6SA 3GOVB 3T5FH 1OSSA 4ZH8A 3P70B 2NU2E 3QTOH 1W11U 3RXHA 2BVXH 3SNAA 3UREA 1O2TA 2FOGA 4FU8A 1O3MA 3P92A 1C2GA 1DDJA 4UFDH 4TWYA 3M5LA 3FZZA 3C1KA 4INKA 3VXFH 2FPZA 1E34B 1RJXB 3V13A 2BYAX 3HGNA 3NWUA 4RKOB 5FHTA 3KL6A 4I8KA 1SLUB 4YO9A 5G4BA 4AGJA 4ZMAH 1XX9A 1KDQA 2BZ6H 1MUEB 2ZZUH 2GKVE 1LHDH 2C8YB 2YNAA 4GSOA 1LHGH 1HXFH 2A5KA 1C2HA 3RC6A 1UCYE 1GBDA 1OOKB 1DITH 2QIQA 3QZRA 2TGAA 5AF9H 3S0NA 3PO1B 3PWCA 1GJ8B 4MTBA 3HATH 1UCYH 1GBFA 1RTLA 2H5DA 1V2WT 1Y8TA 3OY6U 2ULLA 2O8TA 5ESBA 3P8FA 5A8ZA 1HXEH 2R0LA 3BSQA 5AFZH 4DW2U 3HK3B 4GHQA 5I25A 1CBWB 3ZZ7A 3D23A 3TIUA 2G52A 1UVOA 1DWBH 2F83A 1SPJA 1ZGIA 2FMJA 1K21H 3PV4A 4Y71A 2YNBA 2Y5GA 4MG3A 2OC0A 1P03A 3GCHB 3P6ZB 2QA9E 1CA0C 3SV6A 2BVSH 1O5FH 1O3NA 1IQKA 3E0PB 1K2I1 4CRFA 1FY8E 1TGBA 1O2YA 1EXFA 2JETB 1NRSH 2H9EH 3LGIA 2C93B 1KLJH 3OSYA 1HYLA 1RTFB 1MKWH 1O2LA 1TA2A 2TGTA 2XBWA 1GJDB 3ENSB 1QL7A 1CHGA 2PKAA 1THSH 3F9HA 1HPGA 3GY3A 2Q6DA 3PMAB 3LGYA 1P01A 1GG6C 1GI6A 2SFAA 3NCLA 1O3BA 3KHVA 1HFDA 4Z0KA 2XXLA 1TQ0B 3ZZ4A 1A5IA 4CHAC 1SSXA 2ZU4A 2R2MB 3U9AH 3TU7H 1YM0A 2J38A 4OS4A 1IHTH 2VH6A 2ZI2H 1MU6B 1ZJDA 1GBAA 3RXSA 1HAOH 1EAXA 4HZHA 1SR5C 2H5CA 4XSKU 3U8OH 1QL9A 2PKSC 2WPLS 1G2MA 1Z6EA 3UIRA 3ZZCA 2BLWA 2WPIS 4Y6DA 4ZHMU 1SHHB 4BOHA 1UHBA 3LH1A 2P93A 1O2NA 1OX1A 1UK4A 1ZPCA 4UFGH 1Y3XA 1O37A 1AFQB 2RG3A 1C4Y2 1SLWB 4NIYA 2BQWB 3GCTG 3P8NA 1ZRKA 4UONA 4GVUA 1DY9A 1QRWA 2Z6BD 4QT8C 3KF2A 4I8HA 1C5WB 1N6XA 1V2JT 3P8OA 3HK6B 1N6YA 4X2XA 5L30H 1F0TA 2BHGA 2AS9A 1O3JA 1WSSH 3A85A 5JBBS 4J2YB 1FNIA 1A4WH 4TY7A 3RXOA 2CF9H 2YOLA 4GCHF 3RDZA 1RTKA 4NIVA 2WPHS 1GJ4H 1UVUH 1FY5A 1ELTA 2QXHA 1UMAH 1W0ZU 5DP8A 3JZ1B 1EZUC 1O5GH 2Y80A 1JWTA 4DIHH 1P2MA 2GV7A 5E0HA 2DE9A 3LOXA 2W5EA 1LO6A 3PWBA 3ZZ6A 1MD7A 3SV7A 2BD3A 3RMLH 4D7GA 2QV1A 1HRTH 4FUHA 2ZFFH 1IQMA 4Y8YA 5F03A 4B73A 2PSYA 4GHTA 3ATIA 3BEUA 1DXPA 1QNJA 2ZA5A 3U69H 2HVXA 1QJ6B 3TGJE 2FI5E 3BTGE 2VIQA 1NRNH 3EA8A 3SW2B 1L1GA 1DM4B 1RGQA 1O32A 3PB1E 1IQJA 1INCA 1F92A 2FLRH 3BTQE 5HMAA 1P9SA 2B7DH 4HFPB 3LPRA 3E16B 4CH2B 1FIZA 1GL1A 2FODA 5E8EH 1A0LA 3ATKA 1XUFA 1MD8A 2QF0A 2ZTZA 1BTUA 5DK1A 1Y3YA 1BDAA 5EXMA 2ILNA 3A8CA 1TLDA 1O5EH 2FOFA 1GCTB 1C5XB 1P57B 3V12A 3DFLA 1GBBA 1G3DA 2HGTH 1FUJA 2K1QA 4ZXYH 4ABJA 3O8BA 5CMXH 1GI1A 1YLCA 1C2KA 1GHAG 2C8WB 1V2LT 3KQCA 1PPGE 1TMBH 2GT8A 2D26C 1YC0A 1QRXA 4I8LA 1FZZA 2A2XH 1ZGVA 2FDAA 2NU4E 2ZU2A 5C20A 4Y76A 4WMFA 1TPAE 1LQEA 2ZPQA 1SBWA 1T8LA 2FOEA 1QQUA 1KXFA 2BDHA 5FPYA 1A0HB 3FP8E 1EP5A 5DJ7A 2CHAC 3GCOA 3GY4A 1OP2A 3QLPH 1OYQA 3UR9A 2BX4A 4I33A 3A7XA 4MPWA 4O97A 1WQSA 4ISLA 2OC1A 3S7HB 2QXGA 3SN8A 3SO3A 1BB0B 1EZXC 1HIAB 2TRMA 3A83A 1O2PA 1AD8H 1Z7KA 4X6MA 5EU8A 2FI3E 2HNTE 1S84A 4YM9A 1C2DA 2HNTF 2ZDLA 4CBOA 1BTWA 2FOHA 1P2KA 2A32A 1O3HA 3TH2H 1FJSA 3ATLA 3GDVA 2F3CE 3LGUA 1GL0E 2ZCLP 4SGBE 2ZTXA 5FCKA 1NFUA 1ELGA 3A8BA 2Z3DA 3MMGA 7GCHF 1S82A 3D65E 1LMWB 1O2QA 1YPEH 1BBRH 1G3EA 3VB4A 4CBNA 1MTUA 4MVNA 1S6FA 1MTVA 4WXVA 1O5CB 1SC8U 1PFXC 7LPRA 4AN7A 1BIOA 4O9VA 2BDIA 3RU4D 3UNSA 3GCTF 4IMQA 2ZHQH 4JZFH 3H7TA 1QB6A 1TX6A 2BD4A 1C5RA 1FY3A 5L2ZH 1TOMH 3UQVA 4KTSA 2STAE 2FESH 1DX5M 2VWMA 2J2UA 2EA3A 1TQ7B 3URDA 4AGKA 1ACBE 1V3XA 1HIAA 1V2NT 1MTWA 4ABAA 4X6NA 2ALPA 1RFNA 4U32A 1P3CA 1YPLH 2BDYA 1E0FD 1C5ZB 2V3HH 3SNDA 1KXDA 1NESE 4FUJA 2BD2A 1DWEH 2BOHB 3A7TA 1GHBG 3ITIA 1G3BA 3SUDA 5EPYA 1O2SA 2JETC 5C67A 1SQOA 1BJVA 1CA0B 4K60A 1ZPBA 1DPOA 4A1XA 1EZSC 3BTWE 4BTTB 3GY7A 1D3PB 1O5DH 1DWDH 3GYLB 5FBEA 1P9UA 3UNQA 1BA8B 1NY22 2GCTC 1VITG 3QZQA 4ZKNU 1QFKH 3G01A 1YP9A 2SNWA 2JH5D 2HPQH 3MO6A 2GX4A 4X8UH 3VB5A 2XBYA 3GDSA 1GDNA 2ZG0H 3EYDA 4A6LA 4AFQA 4Y7AA 3BTEE 5B6OA 4BXWA 1HJ9A 2BMGB 1GBIA 4CHAB 1XXDA 1QBOA 4KP0A 1F7ZA 4LZ4B 3ATWA 4RSPA 4IMZA 2EI7A 4CRCA 2IPHA 2W3KA 2ZDVH 1SGPE 2SGQE 5T6FA 1M9UA 4XBCA 3RXAA 1KXCA 1GHYH 4ISIH 2GTBA 2AIPA 3SUFA 1SL3A 3MTYA 2PKSB 4KGAA 3MH6A 5BPEA 3ZVEA 3ZZ3A 2BLQA 1XVOA 4UDWH 1V2OT 1SGCA 1QBNA 2QYIA 4KTCA 6CHAB 1GMHF 4R0IA 4I32A 1ELDE 1EUFA 1QHRB 4X1PU 2C8XB 3VXEH 1ARBA 1L1JA 1Y5UT 3JZ2B 3SHCH 2HOBA 2WYGA 1Z8GA 1D9IA 2Z9KA 3BEFB 2PWXA 4O3UA 2GMTC 2BY6X 1QA7A 1MCTA 4DOQA 2F9BH 1GHAF 3AW1A 5F8TA 2W7UA 1F5RA 1B5GH 5FCRA 1ETSH 2JKHA 1UTNA 1BTXA 3K6YA 1NN6A 3MWIU 3MO9A 3A86A 5DP4A 1ETTH 2VIOA 3E0NB 4XBBA 2ZFRH 3QUMP 4BAKB 1O31A 1LDTT 1GVZA 1ZHMA 4LZ1H 4WVPE 3SU5A 1PYTD 2PTNA 1BQYA 1F0SA 1AZZA 4X1NU 5IYTA 1BRBE 5DGJA 1IQLA 8GCHG 4F49A 2O8UA 1O33A 4FU7A 1N8OB 1DLEA 3PMHB 1E37B 2TGPZ 1DANH 1J15A 4ZKOU 3MH7A 3MNCA 3TNTA 1DUEA 2BOKA 2SGAA 1VJ9U 3E3TA 1TMTH 3T2NA 1ELBA 2QF3A 3RXPA 1NC6A 3MI4A 2KAIB 1SGTA 4K1TA 3FP6E 2BB4A 3SNEA 4CRAA 2UUJB 4TYDA 2ODQA 2C4FH 3HPTB 1OWDA 1FV9A 1CGIE 4DIIH 2V35A 1T8NA 2JH6D 3QWCH 2VVVA 1D6WA 4Y8ZA 1ZTJA 1HJAC 3TJOA 2QAAA 3GICB 1O2GH 4X8SH 5C1UA 1YCPK 3ZZDA 1GCTC 3UUZA 1BMMH 2VJ1A 1EX3A 3SU2A 3QX5H 1O2RA 2OP9A 4X1RU 3Q76A 2ZDNA 3DA9B 4Y11E 1KYNA 4IGDA 1TALA 5FPSA 4X1QU 5FAHA 4BAHB 2NWNA 3SV8A 1GHWH 4RKJB 4GCHG 1TOCB 1W3CA 3P17H 4BXSA 1V2MT 4B75A 3ZVAA 3UWIA 4B2BA 1GWAA 1O3AA 1TE0A 1A0JA 1WOFA 4ZXXH 1GHBF 1IQHA 3RXRA 5GPIB 1AI8H 1BT7A 1C1OA 1ANBA 2RA0A 1TGNA
chains in the Genus database with same CATH superfamily
3FVFB 1H8IH 3EA9A 2R3YA 5DG6A 2FM2A 3MHWU 5ESTE 3A88A 3M3SA 3V0XA 1FY1A 1GBHA 2ZGXH 1O0DH 4LOYH 1NRPH 1TNLA 4A7IB 1O39A 2XYAA 1O5BB 1WBGB 1ZMNA 1GDQA 5C5OA 1WTHD 1LTOA 3UAIC 3HKIB 1VITF 3MU0A 3R3GB 4I8GA 1AFEH 1KXBA 4MNWA 1O3PB 1GGDC 4XFQA 1HB0B 2Y6TA 3BTFE 3BTKE 3KCGH 1BJUA 1AQ7A 1VITH 3TPIZ 1GJ7B 3E90B 1XUGA 4F4OC 1XVMA 4UD9H 4GPGA 3RXCA 5IK2D 1A3EH 3M61U 1BTYA 5AVDA 3SGBE 1FONA 4D8NA 1LHCH 1P04A 3SGAE 1THPB 3GY2A 2HPPH 3V3MA 3T62A 1O3IA 5E2OA 1TPOA 3S9CA 5EOKA 3HKJB 3AK5A 4B2CA 2ZHFH 1Y5BT 1JOUB 3F0OA 1AY6H 1XKBC 1CHOG 2GZ7A 3IWMA 5AFYH 1ZOMA 3ZVFA 6GCHG 3DUXH 2ZWLH 3SU0A 2BDCA 4FVBA 1ESBA 1SGIB 1XMNB 3PLBA 1ZHPA 1Z8RA 3K6ZA 1LHEH 1AVWA 5T6GA 2Y5FA 2G4UA 3M35A 4OS6A 1W7GH 3PM3A 5HXFA 1YLDA 2GCHG 1SGDE 3DSOA 1GHVH 2D1JA 3AAVA 2OBOA 1EAIA 3BTDE 3M7QA 3TK6A 3K9XB 1GBTA 4K8BA 2VVUA 2XWBI 3PMBB 4YZUA 5EJ1A 2ASUB 3DHKH 3T26A 3M3VA 1ELCA 1AN1E 5LGOA 1Y3VA 4MPUA 4NCYA 1F0RA 3MH5A 3TVJB 1S6HA 1GI8B 4UFEH 1BTPA 5IDKA 1K1MA 1O2IA 2A1DB 1JBUH 2KCAA 2VH0A 1V2TT 4NIWA 8GCHF 4JZDH 1GHZA 2A4OA 3EE0B 1K1JA 4TPYA 3W94A 2FZZA 2HLDD 1O3KA 2PSXA 4K69A 4YXWD 2R9PA 3HGPA 1C5MD 3OAAD 2STBE 1F5LA 5FBIA 2GCTB 2LNCA 2BDGA 1OWJA 1UTPA 2A31A 2P8OC 3OY5U 3VGCC 4ISOA 4THNH 3KQ5A 1VZQH 3UB0A 1NTPA 1CT4E 2BZAA 1GBEA 4ABDA 5L2YH 4YESB 2OINA 2Z9JA 4E06H 1AE8H 1B0EA 3RMOH 1ZSKA 1PPZA 1LVOA 2XRCA 3RXIA 7GCHG 1DLKB 1TABE 4Y79A 4MPXA 1ZYOA 3SOSA 1YKTA 1OHHD 4E7NA 1G9IE 3KGPA 3MOCA 1A5HA 2ZQ1A 4OGYA 5DPAA 6CHAC 4X6PA 4F48B 1FI8A 4Q63A 1J14A 3SZEA 2ALVA 4WWYA 1VCWA 4Q7ZA 9ESTA 3L33A 3PTNA 1BMFD 1KTSB 4R8TB 2L74A 1NT1A 2UWOA 1C1MA 5EODA 4IW4E 2UUKB 4RT0A 5EPNA 2GMTB 1C5UA 3A7VA 4WH8A 1BUIA 1ELFA 2A4GA 3EGKH 5C0UA 1IQEA 1OXGA 5GIBA 1CE5A 2R3UA 4FUEA 3KYGA 3GDUA 3CENA 2JH0D 3RLWH 1QURH 4YLUA 4ISHH 1O30A 4D9RA 4J1YA 4MPVA 4DY7B 1DY8A 1YBWA 4AC9A 3A7WA 5DN6D 1PQ7A 2G00A 1OS8A 4YT6H 4WXIA 1N8OC 2BD8A 4CH8B 1TONA 1WCZA 1C5VA 5A2MH 1LPZB 1O3EA 2A5IA 4WMEA 1GVKB 2F9VA 2KFWA 1AU8A 3ZV9A 3LJOA 4ABEA 1PPHE 4P02A 1QCPA 4MNVA 1C2FA 1AUJA 1VCPA 3TK9A 4Y0YE 2J95A 4M7GA 4AB8A 1TGTA 1W0YH 2FOCA 2IOTA 1AVXA 1HAVB 3RXLA 1GBJA 2UWPA 1YGCH 1G32B 2H1UA 5EW1H 2V6NA 3M37A 5C3NA 3WY8A 3FAOA 1YPHC 1QBVH 1H1BA 1ZHRA 2ZO3H 2XCNA 2VBCA 1O35A 4Q7XA 1ETRH 2ANYA 2FOAA 3NK8A 1C4V2 3PMJA 1CHOF 1P0SH 2G51A 1UTKA 5SGAE 4AFSA 4DCDA 1HJAB 2OCVB 1UVTH 2A4RA 1T8MA 3EA7A 6GCHF 4IN2A 1TBRH 1CGHA 3A87A 1GMHG 5E2PA 1IQNA 1FAXA 4K1EA 4AOQA 2BY7X 3S9BA 2VU8E 1TAWA 3FOAA 4CREA 5FPTA 3N7EA 2BLVA 1CO7E 1HCGA 1C5PA 1J9CH 2ZTYA 3TGKE 3CS7A 3URCA 3A80A 2ZP0H 4AYVB 1GBLA 2GCHF 2M5TA 2DE8A 4AYYB 1YWUA 1G3CA 1DICA 1NROH 1GPZA 2YMSB 1JRSA 3DD2H 4JZ1A 5EIYA 4B6FA 2J34A 4JYUH 3SU1A 3RUOA 2OUAA 1ZTKA 2OBQA 4P00A 5DP7A 1T4VH 3SI4H 3B8JA 3LC3A 4TT3D 3KQBA 2AHME 2Q6FA 4WJG2 2QXIA 1O5AB 4YOJA 1A7SA 2ZCKP 5T6DA 2CF8H 1AHTH 2F9UA 1WYKA 2AYWA 2FO9A 1K28D 3GYMA 5EXNA 1GJ6A 5HM9A 4NIXA 1F2SE 1U6QA 2ZFSA 1D3QB 2ZHEH 2FTLE 4NZLA 4RN6A 2GV6A 4X0WU 1TX7A 1JMOH 4XDEA 1AWFH 2CV3A 1GI9B 3MNBA 2BD9A 4FUFA 1MAYA 3MNSA 3SZNA 2Q6GA 1BITA 1P06A 4X8TH 1GJAB 1K9OE 1SGRE 1GGDB 1T4UH 2H6MA 5EXLA 1PQ5A 1DS2E 1BBRE 2ZNKH 3LKWA 3LU9B 1AZ8A 4DT7B 1OWKA 5A09A 4IC6A 1K1NA 2J4IA 1LPGB 2A7HA 3OEHD 1TGSZ 3L6PA 1W0JD 2BY5X 5F8XA 4AG1A 1LVMA 1PPEE 5JB8S 1UK2A 1ZRBA 2VIPA 4OS5A 1AVGH 3Q3KA 1B0FA 3B9FH 4BANB 2O9QA 2BLOA 1SQAA 1QB1A 1QR3E 1W13U 3R0FA 5KEDA 4DVAU 2ZHWH 3SV9A 1GI5A 1IHSH 3L3TA 2GDEH 1EPTB 3U98H 1MTNC 4CRBA 2P3FH 3WWBA 3GY6A 1YCPH 1VCQA 3ZZ9A 2Z9IA 2A7JA 4YTAA 2PTCE 1P10A 4XE4A 2PP6A 2AIQA 2IPQX 4X1SU 2AH4X 2F9OA 2TIOA 1A5GH 3T28A 4I8JA 2C3SA 4I86A 1WU1A 2QF5A 1WAYB 2PUQH 4INLA 5TJXA 4U2WA 4JK6A 1QRZA 2XBVA 3UPEA 5LH8A 1C9TA 1BMAA 1XM1A 3GY5A 2B8OH 4AFUA 1SG8B 2FX6A 1HAGE 1SFQB 2WPMS 3IITA 1C5NH 2W7SA 2QF4A 5JPMH 3LIWA 1A61H 4ZKRU 2PV9B 2BX3A 3UOPA 2WPJS 1EOLA 5KGOA 4BAQB 3ODFA 3O8RA 4LXBH 4AORA 2H9TH 2BD5A 3M7TA 2G81E 3RM2H 2PGQB 1FDPA 2EY4C 3PRDA 4KELA 4MLFB 2LPRA 5LPRA 3A8DA 1NU7B 4Z6AH 4U30A 1F0UA 4X6OA 3ESTA 3UNRA 5GXPA 3QGJA 2P8OB 3VGCB 1XUIA 1GBKA 3VB6A 1JIMA 5HM2A 2FS8A 1UVSH 4ABFA 2J94A 3KQDA 2HRVA 4HGCA 2QY0B 3W95A 2ANKH 3PLPA 4NA8A 2FLBH 4K8YA 1NS3A 3U8RH 2PGBB 3SYJA 1TNGA 4I31A 5EG4A 2Y82A 3Q3YA 1H4WA 1ABJH 3OE7D 1SQTA 3F9FA 3RLYH 3RXEA 3RXBA 1TIOA 3MU5A 1H8ED 5TCCA 3TJNA 4AG2A 1ABIH 5DO4H 2ZDKA 2ZKSA 3U1IB 2FIRH 4AFZA 1MTSA 3BTHE 2VIDA 1HNEE 1YY3A 3RXDA 1CQQA 3U1JB 1V2PT 1SLXB 4YOGA 1PYTC 4ASHA 2EI6A 2GP9B 1EJMA 3PYHA 4IC5A 2QCYA 3EQ0H 1SHYA 1DFPA 4FUBA 3RP2A 5AHGH 2SNVA 6ESTA 2A4QA 4AX9H 1K0HA 1D6RA 2G55A 2Z9LA 2ZF0H 3LGTA 1FAKH 1S85A 1W8BH 1VJAU 1D3DB 3LH3A 2G5VA 1C5TA 1W14U 1IAUA 1P2IA 4TPIZ 2ZQ2A 4X2YA 3EAJA 1GJ5H 3I77A 2Z7FE 2FXRA 1P12E 2A45B 4ABBA 2RCEA 3T25A 3VB3A 3UY9A 1BOQA 3A84A 1Q3XA 1FN8A 4MNXA 2R0KA 1QJ7B 3DT0H 1YF4A 3SUGA 1FY4A 1O36A 3RMNH 4H4FA 2LP6A 4OS2A 5A0BA 1IOEA 3MH4A 2BD7A 1AIXH 3LGWA 2ZECA 3BG8A 1MKXK 3SHAH 2BQ6B 1EAWA 1GCDA 2VINA 3A7ZA 1KLTA 1FPCH 3NUMA 2F91A 1G2LA 2AEIH 1OYTH 1E35B 3BV9B 1FLEE 1L1NA 2OLGA 5FXLA 1HLTH 3TH4H 5LPEA 3PLKA 2DUCA 1C1UH 2SGDE 2BXUH 1PPCE 2AFQB 1RXPA 5HGGA 2Y5HA 1K1OA 1S83A 1KSNA 2ZGBH 5F6MA 1NFWA 1ZMLA 1P8VC 3RXKA 4YT7H 4CRGA 1S0RA 2AGEX 4BAMB 4ZAEA 2FWWA 2ZIQH 1C5QA 4O03A 3M7UA 4PROA 3SJ9A 1G36A 1OKXA 3BIVH 2TBSA 4WY3A 3QO6A 2ZGJA 1MABB 1WV7H 2ZU3A 3LGVA 1TYNA 1TX8A 3NKKA 2WSSD 3KN2A 1DSUA 2PUXB 3QK1A 5DP5A 1L4DA 1QA0A 3M5MA 1VR1H 2F9NA 1TRNA 3TJVA 1WDIA 4Y7BA 3MO3A 1SMFE 3NZIA 5EQRA 3QN7A 3DCLA 2V7QD 3FZDA 3E6PH 3OYPA 4K5ZA 3EE7A 1DVAH 2BDAA 4MQAA 2XBXA 3AW0A 2KAIA 1S0QA 1P05A 4DURA 3M5NA 4JMYA 1KDQB 1H8HD 1O2OA 4OGXA 3CNRA 4WH6A 1Y3WA 1K1LA 1V2UT 1WXRA 1TPPA 3GY8A 4CR9A 2VIWA 4HI3A 1L2EA 2OD3B 5CHAC 4B74A 1Z1IA 3D49H 3BIUH 1QL8A 1ORFA 3BG4B 1A2CH 2PFEA 7KMEH 2VVCA 2Q1JA 3DFJA 3U8TH 1SGEE 2D2DA 1A46H 2FI4E 2VGCB 4Y0ZE 3E8LA 1AWHB 3O8DA 1L0ZA 1WQVH 1NBME 2J5UA 4FXGH 1GI0A 1PPBH 3NPSA 1GBCA 4O3TA 3LONA 2FP7B 2WPKS 1QQ4A 4UEHH 3UFAA 1Y5AT 3S69A 2Z9GA 3H7OA 3H5CB 2ZCHP 1EPTC 6LPRA 2QN5T 1O2JA 2XTTB 4JK5A 4DJZB 2GD4B 1GJBB 3MYWA 1GVLA 4YLQH 1FQ3A 1NRRH 5JBCS 1AB9B 2H9HA 1P2JA 3VB7A 2ODPA 2FOMB 1ZLRA 1MTNB 1O3GA 1SGQE 4GUXA 1CGJE 3SU6A 4NSYA 1BHXB 4JYVH 1LVYA 3SU3A 2HWLB 1BTZA 4AB9A 4UFFH 1F5KU 1T31A 2EC9H 4BNRA 3I78A 2PKAB 4M9FA 5ABWA 2ZDAH 5JBAS 2CJIA 1ZSJA 1HAIH 5A8XA 4RI0A 3SQEE 1JIRA 1ELAA 1H9LB 3RXJA 1AO5A 3S9AA 1BMLA 1KXAA 4TWWA 2Z94A 1QTFA 3OTPA 1DXWA 2WV4A 1AUTC 2WYJA 3QGNB 5HYOA 1E36B 1C1PA 1GJ9B 3D62A 3VPKA 1LVBA 1E38B 2RFKC 2ANMH 3M5OA 1TNHA 2UUFB 1MZDA 4HTCH 1TRYA 3SORA 2D8WA 3O8CA 1ELVA 1NRQH 1J17T 3T27A 5ETXA 3ZVDA 1RD3B 3ZVGA 3AASA 1UTOA 1IQIA 1ARCA 1UHBB 1Z8JB 3STIA 2XC5A 1ANCA 5FL7D 1L4ZA 3RMMH 3SI3H 3GCNA 1AE5A 1P11E 3ZZAA 1CU1A 4WF8A 2B5TB 2VWOA 1EB1H 1PQAA 3WWFA 2Y7ZA 1KMHB 2GZ9A 1O2HA 1YLNA 2G4TA 2SGEE 1V2ST 1DE7H 2ZPSA 4VGCC 5JB9S 5DP3A 3ZZBA 1B7XB 1AKSB 1BMNH 1COWD 1P02A 5EW2H 1SLVB 1HAYB 1DT2A 2HNTC 4TY6A 1C2LA 5EGMA 3RM0H 1CT2E 2SGFE 3RXGA 3K65B 3AVZA 1TA6A 5C5NA 1UTMA 1KY9A 3A82A 1ANEA 2BTCE 1G30B 3F68H 3W1EA 4D9QA 1YYY1 1TB6H 1C1NA 2WHXA 1GI7B 4A92A 5C1YA 3T29A 5C2ZA 2GT7A 4JZIA 1XKAC 1Z1JA 3QDZB 2CXVA 4B6EA 1GDUA 4JCNA 8KME2 1O2ZA 2QXJA 1VGCB 4JYTA 1ID5H 4FUCA 1BRAA 1Q31A 1EP6A 1H8DH 2W26A 2WUBA 3LJJA 2P16A 2IJOB 2ESTE 4I7YH 1GBMA 2VWLA 3SQHE 4IS5A 3S7KB 1O3FA 2W3IA 2RDEA 1AKSA 1LKBA 3OU0A 1RRKA 2P3TB 4ISNA 5A0CA 2OQ5A 3ZYEA 2IJD1 4NFEA 4Y8XA 1GI2A 2XNIA 4X2VA 1IQFA 2NU0E 3FO8D 3TK5A 3SU4A 2WV9A 5GWZA 4K3JA 5DP9A 2AGIX 4FOUC 1LKAA 2GVFA 3F1SB 2CK3D 1KIGH 2FTMA 2QC2A 3OX7U 4X2WA 5JDUB 2J9NA 1Z71A 1TNKA 1GHXH 4FU9A 2A5AA 3PV5A 1QGFA 1T32A 2ANWA 4ACAA 1MCVA 3M36A 3UTUH 1FPHH 1SQRA 2CGAA 5GJ4B 2ZU5A 1RIWC 2ZU1A 5EJZA 2OXSA 1HAXB 1BRCE 2VIVA 1C2EA 1HBTH 5B6LA 3RC4A 5I46H 1QIXB 1UTJA 2RDLA 3SNCA 1FMGA 3ZV8A 3RXFA 1KLIH 1V2QT 3MU4A 2XNDD 1WTGH 1PPFE 3PROA 5C94A 2UUYA 1O3CA 2FOBA 3GISB 5K7RA 1A3BH 1NFYA 1XUHA 1BRUP 1SOTA 2B9LA 3OTJE 5JYIA 2ZHDA 4FUDA 1ZMJA 1SGFA 1UCYK 3MU1A 1D3TB 3TH3H 1UTQA 3BTME 4X8VH 1C1TA 3STJA 3LC5A 3P8GA 3QTVH 4SGAE 1T7CA 1K1IA 4ZHLU 2AMPA 4IN1A 1ESAA 4ABIA 1YCPM 1HAVA 1W2KH 1Z6JH 2G8TA 4K2YA 3TITA 4NGAH 2JIZD 9LPRA 1EAUA 3ODDA 1J8AA 2FYQA 1MU8B 2THFB 4XOJA 5GDSH 4IBLH 2FYRA 1D4PB 1KTTB 4BTUB 1G37A 3BG4C 2BY9X 4ZROA 4F55A 2J97A 3RXTA 1SKYE 5A8YA 2ZFTA 4GLYA 2VGCC 1HGTH 1MKWK 3VFEA 5CHAB 1TNIA 2NU1E 2XC0A 5J4QA 5FX5A 1S81A 4B71A 1MKXH 1O2MA 4NSVA 4FUGA 4H6SB 1DSTA 2AMDA 2O8MA 2ODYB 3UWJH 1BZXE 2QGRA 5CHBA 3WW7A 3TGIE 3UQOA 1GMDG 1O2XA 1V6DA 4FUIA 2Z3CA 3RXQA 1GMCG 2EI8A 3KQEA 2P95A 4BAOB 1MBMA 3NXPA 3AAUA 2XWAA 1YPMH 1UVPA 3KNXA 4OS1A 3IG6B 4B76A 1OP8A 4AZ2B 3LT3A 1SFIA 1AB9C 4H6TA 1MAXA 1EZQA 1X7AC 1WUNH 3K2UA 1NO9H 1O3DA 1ELEE 3RXMA 2WINI 1C5SA 1FX0B 3F0PA 2VNTA 3A8AA 4NFFA 1FIWA 4ZKSU 1C5OH 2HALA 3SV2H 4JZEH 2A2QH 3V7TA 3PO1C 1O34A 2VB0A 1P09A 1ZPZA 2IN2A 1JXPA 3Q77A 3E91A 1EFRD 1C4U2 3I29A 2BXTH 1LQDB 2GZ8A 7ESTE 4XD7D 4CRDA 8ESTE 1H9HE 4ABHA 1QY6A 2A7CA 1CBWC 3SJOA 1HAPH 1O3OA 1TGCA 1FN6A 4Q4LA 5EJLA 2BM2A 1K1PA 2P59A 1C1WH 2ZPRA 2C90B 3C27B 5T1VA 5BRRE 1SGYE 1QB9A 1CVWH 5T3HA 3SGQE 3PTBA 5C1XA 1H9IE 1LPKB 3GCHC 2J92A 5F8ZA 2GGVB 1FXYA 1C2IA 1HAZB 2C8ZB 3SJIA 2ZDMA 1BCUH 2V0BA 3E1XB 4D76A 3F2FA 1EPTA 1P2OA 1P2QA 4NZQA 2AERH 2OC8A 2ZFPH 1DOJA 3A81A 2TPIZ 2P94A 1OWIA 4DG4A 1Q2WA 4RT1A 5GCHG 1HV7A 4Y10E 4B2AA 4Z1MD 1OWEA 1MMJN 1O2KA 2CN0H 5C17A 4GAWA 2FS9A 2BY8X 3N7OA 4HG6A 1TBZH 2XCFA 4VGCB 3A89A 8LPRA 1MBQA 1C2JA 4UE7H 1O2UA 5L6NH 1P3EA 2W6ID 1HJ8A 1W10U 1YPHE 1GG6B 1GI4A 1MQ6A 1C1SA 4NA9H 4NWLA 1LHFH 5EQSA 1NU9A 2UWLA 3TLOA 3BEIB 5EQQA 3SJKA 4XBDA 4NWKA 2JDID 2J98B 1KXEA 4E7RG 2OC7A 1C9PA 2ZGHA 1V2RT 3ZZ5A 4H42U 3KEEA 4DGJA 3KIDU 1VGCC 1AFQC 4NA7A 1SVPA 1ZR0A 2BDBA 1C1RA 1Z8IB 3FANA 3ZZ8A 5J4SA 2XOKD 2VWNA 3EDXB 2AGGX 1IQGA 4ACBA 1C1QA 3RC5A 2GDDA 1THRH 4CR5A 2V3MA 3U28C 3CP7A 1TFXA 2WUCA 2LELA 4FVDA 3F9GA 2P3UB 2XC4A 1AGJA 3VEQB 1PQ8A 1TWXB 2O8WA 1EJAA 1MH0A 4A5TS 5KECA 1EQ9A 1ZZZA 4E05H 3MU8A 3VG8A 1LCYA 1MZAA 1NFXA 1V2VT 1C5LH 1K22H 4KTUA 3M3TA 1S5SA 4Q80A 1OWHA 4WMDA 2ZC9H 1ESTA 2Y81A 3F6UH 4KKDA 1SGFG 3ATMA 4NG9H 1O38A 2ZGCA 2Z3EA 1DWCH 1SGNE 2OTVA 1SI5H 1C5YB 2ZEBA 5LPFA 4INHA 1GI3A 1HAHH 1XUKA 2PR3A 1SB1H 1TNJA 2V3OH 4YOIA 4ESTE 1BTHH 1CT0E 4Q7YA 1HDTH 1UK3A 1TRMA 4ABGA 1JRTA 3SBKA 3CS0A 4D7FA 3BF6H 3RU4E 4MDSA 1TMUH 3F9EA 1EASA 1YPGH 3SUEA 1TPSA 2QE7D 2OQUA 1GMDF 2JJ1D 1Y3UA 4ZHAA 1EATA 3SJ8A 5DP6A 1GMCF 1OPHB 2Y7XA 3SNBA 3RXUA 1C2MA 2WV5A 1RIWB 3FFGA 1C1VH 3MNXA 1UO6A 1ZTLA 5JBTA 5E0GA 4MNYA 1EB2A 3TJUA 1TBQH 2ZFQH 3ZYDA 2KCYA 3BTTE 3P95A 1P2NA 2XW9A 1BBRK 2A0QB 1NPMA 2SGPE 3BN9A 1SOZA 1BHXF 3UOUA 1XXFA 5K0HA 3B23B 1HUTH 5DKMA 1CSOE 1O2VA 1PJPA 2BQ7B 5H4IB 3Q00A 5TCAA 1ANDA 1W7XH 3ZVBA 1YPJH 4OS7A 3ZVCA 2FEQH 3N99A 5FX6A 3UR6A 4LK4A 4A1VA 1GJCB 2O8LA 1AMHA 3LDXH 1EOJA 5A0AE 4FETA 2FX4A 4K1SA 1O3LA 2NU3E 2RA3A 2R2WU 4U01A 4B1TA 1N1LA 2EQNA 1QJ1B 1A1RA 2H2ZA 3DSGA 1J16A 3FP7E 1W12U 2AMQA 1NM6A 4A1TA 2PHBA 1RS0A 3ELAH 3RXVA 3GS9A 4BTIB 3MFJA 1DUAA 2TGDA 3TNSA 3F3BA 2G5NA 2F4LA 2CMYA 3A7YA 1XUJA 1CA8B 2I6QA 2PLXA 2HLCA 1MQ5A 1NZQH 1O2WA 1EJNA 1V2KT 1YPKH 3RU4T 3OFND 3Q3XA 1EKBB 2B0FA 2F9PA 2L6OA 1UTLM 1ZSLA 5CE1A 2PW8H 1ZJKA 1Y59T 5GCHF 1T8OA 2HVYB 5E0JA 5PTPA 2BVRH 4ZUHA 4Q2KA 1OP0A 1UJ1A 2CHAB 2EEKA 2I6SA 2YMSD 3GOVB 5HIYA 3T5FH 1OSSA 4ZH8A 3P70B 2NU2E 3QTOH 1W11U 3RXHA 2BVXH 3SNAA 3UREA 1O2TA 2FOGA 4FU8A 1O3MA 3P92A 1C2GA 1DDJA 4UFDH 4TWYA 3M5LA 3FZZA 3C1KA 4INKA 3VXFH 2FPZA 1E34B 1RJXB 3V13A 2BYAX 3HGNA 3NWUA 4RKOB 5FHTA 3KL6A 4I8KA 1SLUB 4YO9A 5G4BA 4AGJA 4ZMAH 1XX9A 3N7DA 1KDQA 2BZ6H 1MUEB 2ZZUH 2GKVE 3MQKC 1LHDH 2C8YB 2YNAA 4GSOA 1LHGH 1HXFH 2A5KA 1C2HA 3RC6A 1UCYE 1GBDA 1OOKB 1DITH 4DT4A 2QIQA 3QZRA 2TGAA 5AF9H 3S0NA 3PO1B 3PWCA 1GJ8B 4MTBA 3HATH 1UCYH 1GBFA 1RTLA 2H5DA 1V2WT 1Y8TA 3OY6U 2ULLA 2O8TA 5ESBA 3P8FA 5A8ZA 1HXEH 2R0LA 3BSQA 5AFZH 4DW2U 3HK3B 2KX4A 4GHQA 1CBWB 3ZZ7A 3D23A 5I25A 3TIUA 2G52A 1UVOA 1DWBH 2F83A 1SPJA 1ZGIA 2KCPA 2FMJA 1K21H 3PV4A 4Y71A 2YNBA 2Y5GA 4MG3A 2OC0A 1P03A 2KZ4A 3GCHB 3P6ZB 2QA9E 1CA0C 3SV6A 2BVSH 1O5FH 1O3NA 1IQKA 3E0PB 1K2I1 4CRFA 1FY8E 1TGBA 1O2YA 1EXFA 2JETB 1NRSH 2H9EH 3LGIA 2C93B 1KLJH 3OSYA 1HYLA 1RTFB 1MKWH 1O2LA 1TA2A 2JJ2D 2TGTA 2XBWA 1GJDB 3ENSB 1QL7A 1CHGA 2PKAA 1THSH 3F9HA 1HPGA 3GY3A 2Q6DA 3PMAB 3LGYA 1E79D 1P01A 1GG6C 1GI6A 1UW7A 2SFAA 1O3BA 3NCLA 3KHVA 1HFDA 4Z0KA 2XXLA 1TQ0B 3ZZ4A 1A5IA 4CHAC 1SSXA 4ZCNA 2ZU4A 2R2MB 3U9AH 3TU7H 1YM0A 2J38A 2WZQA 4OS4A 1IHTH 2VH6A 2ZI2H 1MU6B 1ZJDA 1GBAA 3RXSA 1HAOH 1EAXA 4HZHA 1SR5C 2H5CA 4XSKU 3U8OH 3ZIAD 1QL9A 2PKSC 2WPLS 1G2MA 1Z6EA 3UIRA 3ZZCA 2BLWA 2WPIS 4Y6DA 4ZHMU 1SHHB 4BOHA 1UHBA 3LH1A 2P93A 1O2NA 1OX1A 1UK4A 1ZPCA 4UFGH 1Y3XA 1O37A 1AFQB 2RG3A 1C4Y2 1SLWB 2KM0A 4NIYA 2BQWB 3GCTG 3P8NA 1ZRKA 4UONA 4GVUA 1DY9A 1QRWA 2Z6BD 4QT8C 3KF2A 1QZ8A 4I8HA 1C5WB 1N6XA 3H09A 1V2JT 3P8OA 3HK6B 1N6YA 4X2XA 5L30H 1F0TA 2BHGA 2AS9A 1O3JA 1WSSH 3A85A 5JBBS 4J2YB 1FNIA 1A4WH 4TY7A 3RXOA 2CF9H 2YOLA 4GCHF 3RDZA 3KYFA 1RTKA 3PRBA 4NIVA 2WPHS 1GJ4H 1UVUH 1FY5A 1ELTA 2QXHA 1UMAH 1W0ZU 2WPDD 5DP8A 5CDFE 3JZ1B 1EZUC 1O5GH 2Y80A 1JWTA 2KCOA 4DIHH 1P2MA 2GV7A 5E0HA 2DE9A 3LOXA 2W5EA 1LO6A 3PWBA 3ZZ6A 1MD7A 3SV7A 2BD3A 3RMLH 4D7GA 2QV1A 1HRTH 4FUHA 2ZFFH 1IQMA 4Y8YA 5F03A 4B73A 2PSYA 4OM9A 4GHTA 3ATIA 3BEUA 1DXPA 1QNJA 2ZA5A 3U69H 2HVXA 1QJ6B 3TGJE 2FI5E 3BTGE 2VIQA 1NRNH 3EA8A 3SW2B 1L1GA 1DM4B 1VKYA 1RGQA 1O32A 3PB1E 1IQJA 1INCA 1F92A 2FLRH 3BTQE 5HMAA 1P9SA 2B7DH 4HFPB 3LPRA 3E16B 4CH2B 1FIZA 1GL1A 2FODA 5E8EH 1A0LA 3ATKA 1XUFA 1MD8A 2QF0A 2ZTZA 1BTUA 5DK1A 1Y3YA 1BDAA 5EXMA 2ILNA 3A8CA 1TLDA 1O5EH 2FOFA 1GCTB 1C5XB 1P57B 3V12A 3DFLA 1GBBA 1S6LA 1G3DA 2HGTH 1FUJA 2K1QA 4ZXYH 4ABJA 3O8BA 5CMXH 1GI1A 1YLCA 1C2KA 1GHAG 2C8WB 1V2LT 3KQCA 1PPGE 1TMBH 2GT8A 2D26C 1YC0A 1QRXA 4I8LA 1FZZA 2A2XH 1ZGVA 2M2AA 2FDAA 2NU4E 2ZU2A 5C20A 4Y76A 4WMFA 1TPAE 1LQEA 2ZPQA 1SBWA 1T8LA 2FOEA 1QQUA 1KXFA 2BDHA 5FPYA 1A0HB 3FP8E 1EP5A 5DJ7A 2CHAC 3GCOA 3GY4A 1OP2A 3QLPH 1OYQA 3UR9A 2BX4A 4I33A 3A7XA 4MPWA 4O97A 1WQSA 4ISLA 2OC1A 3S7HB 2QXGA 3SN8A 3SO3A 1BB0B 1EZXC 1HIAB 2TRMA 3A83A 1O2PA 1AD8H 1Z7KA 3F2GA 4X6MA 5EU8A 2FI3E 2HNTE 1S84A 2F43B 4YM9A 1C2DA 2HNTF 5HKKD 2ZDLA 4CBOA 1BTWA 2FOHA 1P2KA 2A32A 1O3HA 3TH2H 1FJSA 3ATLA 3GDVA 2F3CE 3LGUA 1GL0E 2ZCLP 4SGBE 2ZTXA 5FCKA 1NFUA 1ELGA 3A8BA 2Z3DA 3MMGA 7GCHF 1S82A 3D65E 3FKSD 1LMWB 1O2QA 1YPEH 1BBRH 1G3EA 3VB4A 4CBNA 1W0KD 1MTUA 4MVNA 1S6FA 1MTVA 4WXVA 1O5CB 1SC8U 1PFXC 7LPRA 4AN7A 1BIOA 4O9VA 2BDIA 3RU4D 3UNSA 3GCTF 4IMQA 2ZHQH 4JZFH 3H7TA 1QB6A 1TX6A 2BD4A 1C5RA 1FY3A 5L2ZH 1TOMH 3UQVA 4KTSA 2STAE 2FESH 1DX5M 2VWMA 2J2UA 2EA3A 1TQ7B 3URDA 4AGKA 1ACBE 1V3XA 2K8IA 1HIAA 1V2NT 1MTWA 4ABAA 4X6NA 2ALPA 1RFNA 4U32A 1P3CA 1YPLH 2BDYA 1E0FD 1C5ZB 2V3HH 3SNDA 2K0QA 1KXDA 1NESE 4FUJA 2BD2A 1DWEH 2BOHB 3A7TA 4XRNA 1GHBG 3ITIA 1G3BA 3SUDA 5EPYA 1O2SA 2JETC 5C67A 1SQOA 1BJVA 1CA0B 1E1RD 4K60A 1ZPBA 1DPOA 4A1XA 1EZSC 3BTWE 4BTTB 3NRLA 3GY7A 1D3PB 2GJGA 1O5DH 1DWDH 3GYLB 5FBEA 1P9UA 3UNQA 1BA8B 1NY22 2GCTC 1VITG 3QZQA 4ZKNU 1QFKH 3G01A 1YP9A 2SNWA 2JH5D 2HPQH 3MO6A 2GX4A 4X8UH 3VB5A 2XBYA 3GDSA 1GDNA 2ZG0H 3EYDA 4A6LA 4AFQA 4Y7AA 3BTEE 1E1QD 4BXWA 1HJ9A 2BMGB 1GBIA 4CHAB 5B6OA 1XXDA 1QBOA 4KP0A 1F7ZA 4LZ4B 3ATWA 4RSPA 4IMZA 2EI7A 5HIZA 2IPHA 2W3KA 2ZDVH 1SGPE 4CRCA 2SGQE 5T6FA 1M9UA 4XBCA 3RXAA 2KR7A 1KXCA 1GHYH 4ISIH 2GTBA 2AIPA 3SUFA 1SL3A 3MTYA 2PKSB 4KGAA 3MH6A 5BPEA 3ZVEA 3ZZ3A 2BLQA 1XVOA 5F53A 4UDWH 1V2OT 1SGCA 1QBNA 1NBMD 2QYIA 4KTCA 6CHAB 1GMHF 4R0IA 4I32A 1ELDE 1EUFA 1QHRB 4X1PU 2C8XB 3VXEH 1ARBA 1L1JA 1Y5UT 3JZ2B 3SHCH 2HOBA 2WYGA 1Z8GA 1D9IA 2Z9KA 3BEFB 2PWXA 4O3UA 2GMTC 2BY6X 1QA7A 1MCTA 4DOQA 2F9BH 1GHAF 3AW1A 3OEED 5F8TA 2W7UA 1F5RA 1B5GH 5FCRA 1ETSH 2JKHA 1UTNA 1BTXA 3K6YA 1NN6A 3MWIU 3MO9A 3A86A 5DP4A 1ETTH 2VIOA 3E0NB 4XBBA 2ZFRH 3QUMP 4BAKB 1O31A 1LDTT 1GVZA 1ZHMA 2J98A 3FN8A 4LZ1H 4WVPE 3SU5A 1PYTD 2PTNA 1BQYA 1F0SA 1AZZA 4X1NU 5IYTA 1BRBE 5DGJA 1IQLA 8GCHG 4F49A 2O8UA 1O33A 4FU7A 1N8OB 1DLEA 3PMHB 1E37B 2TGPZ 1DANH 1J15A 4ZKOU 3MH7A 3MNCA 2W6JD 3TNTA 1DUEA 2BOKA 2SGAA 1VJ9U 3E3TA 1TMTH 3T2NA 1ELBA 2QF3A 3RXPA 1NC6A 4ASUD 3MI4A 2KAIB 1SGTA 4K1TA 5GNDA 3FP6E 2BB4A 3SNEA 3PV2A 4CRAA 2UUJB 4TYDA 2ODQA 2C4FH 3HPTB 1OWDA 1FV9A 1CGIE 4DIIH 2V35A 1T8NA 2JH6D 3QWCH 2VVVA 1D6WA 5DSFA 4Y8ZA 1ZTJA 1HJAC 3TJOA 2QAAA 3GICB 1O2GH 4X8SH 5C1UA 1YCPK 3ZZDA 1GCTC 3UUZA 1BMMH 2VJ1A 1EX3A 3SU2A 3QX5H 1O2RA 2OP9A 4X1RU 3Q76A 3F2HA 2ZDNA 3DA9B 4Y11E 1KYNA 4IGDA 3DSPA 1TALA 5FPSA 4X1QU 5FAHA 4BAHB 2NWNA 3SV8A 1GHWH 4RKJB 2YMSC 4GCHG 1TOCB 1W3CA 3P17H 4BXSA 1V2MT 4B75A 2OK5A 3ZVAA 4TSFD 3UWIA 4B2BA 1GWAA 1O3AA 1TE0A 1A0JA 1WOFA 4ZXXH 1GHBF 1IQHA 3RXRA 5GPIB 1AI8H 1BT7A 5C0TA 1C1OA 1ANBA 2RA0A 1TGNA
chains in the Genus database with same CATH topology
3FVFB 1H8IH 3EA9A 2R3YA 5DG6A 2FM2A 3MHWU 5ESTE 3A88A 3M3SA 3V0XA 1FY1A 1GBHA 2ZGXH 1O0DH 4LOYH 1NRPH 1TNLA 4A7IB 1O39A 2XYAA 1O5BB 1WBGB 1ZMNA 1GDQA 5C5OA 1WTHD 1LTOA 3HKIB 1VITF 3MU0A 3R3GB 4I8GA 1AFEH 1KXBA 4MNWA 1O3PB 1GGDC 4XFQA 1HB0B 2Y6TA 3BTFE 3BTKE 3KCGH 1BJUA 1AQ7A 1VITH 3TPIZ 1GJ7B 3E90B 1XUGA 4F4OC 1XVMA 4UD9H 4GPGA 3RXCA 1A3EH 3M61U 1BTYA 5AVDA 3SGBE 1FONA 4D8NA 1LHCH 1P04A 3SGAE 1THPB 3GY2A 2HPPH 3V3MA 3T62A 1O3IA 5E2OA 1TPOA 3S9CA 5EOKA 3HKJB 4B2CA 2ZHFH 1Y5BT 1JOUB 1AY6H 1XKBC 1CHOG 2GZ7A 3IWMA 5AFYH 1ZOMA 3ZVFA 6GCHG 3DUXH 2ZWLH 3SU0A 2BDCA 4FVBA 1ESBA 1SGIB 1XMNB 3PLBA 1ZHPA 1Z8RA 3K6ZA 1LHEH 1AVWA 5T6GA 2Y5FA 2G4UA 3M35A 4OS6A 1W7GH 3PM3A 5HXFA 1YLDA 2GCHG 1SGDE 1GHVH 2D1JA 3AAVA 2OBOA 1EAIA 3BTDE 3M7QA 3TK6A 3K9XB 1GBTA 4K8BA 2VVUA 2XWBI 3PMBB 4YZUA 2ASUB 3DHKH 3T26A 3M3VA 1ELCA 1AN1E 5LGOA 1Y3VA 4MPUA 4NCYA 1F0RA 3MH5A 3TVJB 1S6HA 1GI8B 4UFEH 1BTPA 5IDKA 1K1MA 1O2IA 2A1DB 1JBUH 2VH0A 1V2TT 4NIWA 8GCHF 4JZDH 1GHZA 2A4OA 3EE0B 1K1JA 4TPYA 3W94A 2FZZA 1O3KA 2PSXA 4K69A 2R9PA 3HGPA 1C5MD 2STBE 1F5LA 5FBIA 2GCTB 2LNCA 2BDGA 1OWJA 1UTPA 2A31A 2P8OC 3OY5U 3VGCC 4ISOA 4THNH 1VZQH 1NTPA 1CT4E 2BZAA 1GBEA 4ABDA 5L2YH 4YESB 2OINA 2Z9JA 4E06H 1AE8H 1B0EA 3RMOH 1ZSKA 1PPZA 1LVOA 2XRCA 3RXIA 7GCHG 1DLKB 1TABE 4Y79A 4MPXA 1ZYOA 3SOSA 1YKTA 4E7NA 1G9IE 3KGPA 3MOCA 1A5HA 2ZQ1A 4OGYA 5DPAA 6CHAC 4X6PA 1FI8A 1J14A 2ALVA 4WWYA 1VCWA 4Q7ZA 9ESTA 3L33A 3PTNA 1KTSB 4R8TB 1NT1A 2UWOA 1C1MA 5EODA 4IW4E 2UUKB 5EPNA 2GMTB 1C5UA 3A7VA 4WH8A 1BUIA 1ELFA 2A4GA 3EGKH 1IQEA 1OXGA 5GIBA 1CE5A 2R3UA 4FUEA 3GDUA 3CENA 2JH0D 3RLWH 1QURH 4YLUA 4ISHH 1O30A 4D9RA 4J1YA 4MPVA 4DY7B 1DY8A 1YBWA 3A7WA 1PQ7A 2G00A 1OS8A 4YT6H 4WXIA 1N8OC 2BD8A 4CH8B 1TONA 1WCZA 1C5VA 5A2MH 1LPZB 1O3EA 2A5IA 4WMEA 1GVKB 2F9VA 1AU8A 3ZV9A 3LJOA 4ABEA 1PPHE 1QCPA 4MNVA 1C2FA 1AUJA 1VCPA 3TK9A 4Y0YE 2J95A 4M7GA 4AB8A 1TGTA 1W0YH 2FOCA 2IOTA 1AVXA 1HAVB 3RXLA 1GBJA 2UWPA 1YGCH 1G32B 2H1UA 5EW1H 2V6NA 3M37A 5C3NA 3WY8A 3FAOA 1YPHC 1QBVH 1H1BA 1ZHRA 2ZO3H 2XCNA 1O35A 4Q7XA 1ETRH 2ANYA 2FOAA 3NK8A 1C4V2 3PMJA 1CHOF 1P0SH 2G51A 1UTKA 5SGAE 4AFSA 4DCDA 1HJAB 2OCVB 1UVTH 2A4RA 1T8MA 3EA7A 6GCHF 4IN2A 1TBRH 1CGHA 3A87A 1GMHG 5E2PA 1IQNA 1FAXA 4K1EA 4AOQA 2BY7X 3S9BA 2VU8E 1TAWA 4CREA 5FPTA 2BLVA 1CO7E 1HCGA 1C5PA 1J9CH 2ZTYA 3TGKE 3CS7A 3URCA 3A80A 2ZP0H 4AYVB 1GBLA 2GCHF 2M5TA 2DE8A 4AYYB 1G3CA 1DICA 1NROH 1GPZA 1JRSA 3DD2H 4JZ1A 2J34A 4JYUH 3SU1A 3RUOA 2OUAA 1ZTKA 2OBQA 5DP7A 1T4VH 3SI4H 3B8JA 3LC3A 3KQBA 2Q6FA 4WJG2 2QXIA 1O5AB 4YOJA 1A7SA 2ZCKP 5T6DA 2CF8H 1AHTH 2F9UA 1WYKA 2AYWA 2FO9A 1K28D 3GYMA 5EXNA 1GJ6A 5HM9A 4NIXA 1F2SE 1U6QA 2ZFSA 1D3QB 2ZHEH 2FTLE 4NZLA 4RN6A 2GV6A 4X0WU 1TX7A 1JMOH 4XDEA 1AWFH 2CV3A 1GI9B 3MNBA 2BD9A 4FUFA 1MAYA 3MNSA 3SZNA 2Q6GA 1BITA 1P06A 4X8TH 1GJAB 1K9OE 1SGRE 1GGDB 1T4UH 2H6MA 5EXLA 1PQ5A 1DS2E 1BBRE 2ZNKH 3LKWA 3LU9B 1AZ8A 4DT7B 1OWKA 5A09A 4IC6A 1K1NA 2J4IA 1LPGB 2A7HA 1TGSZ 3L6PA 2BY5X 5F8XA 4AG1A 1LVMA 1PPEE 5JB8S 1UK2A 1ZRBA 2VIPA 4OS5A 1AVGH 3Q3KA 1B0FA 3B9FH 4BANB 2O9QA 2BLOA 1SQAA 1QB1A 1QR3E 1W13U 3R0FA 4DVAU 2ZHWH 3SV9A 1GI5A 1IHSH 3L3TA 2GDEH 1EPTB 3U98H 1MTNC 4CRBA 2P3FH 3GY6A 1YCPH 1VCQA 3ZZ9A 2Z9IA 2A7JA 4YTAA 2PTCE 1P10A 4XE4A 2AIQA 4X1SU 2AH4X 2F9OA 2TIOA 1A5GH 3T28A 4I8JA 2C3SA 1WU1A 1WAYB 2PUQH 4INLA 5TJXA 4U2WA 4JK6A 1QRZA 2XBVA 3UPEA 5LH8A 1C9TA 1BMAA 1XM1A 3GY5A 2B8OH 4AFUA 1SG8B 2FX6A 1HAGE 1SFQB 2WPMS 3IITA 1C5NH 2W7SA 5JPMH 3LIWA 1A61H 4ZKRU 2PV9B 2BX3A 3UOPA 2WPJS 1EOLA 4BAQB 3ODFA 3O8RA 4LXBH 4AORA 2H9TH 2BD5A 3M7TA 2G81E 3RM2H 2PGQB 1FDPA 4KELA 4MLFB 2LPRA 5LPRA 3A8DA 1NU7B 4Z6AH 4U30A 1F0UA 4X6OA 3ESTA 3UNRA 5GXPA 3QGJA 2P8OB 3VGCB 1XUIA 1GBKA 3VB6A 1JIMA 5HM2A 2FS8A 1UVSH 4ABFA 2J94A 3KQDA 2HRVA 4HGCA 2QY0B 3W95A 2ANKH 3PLPA 4NA8A 2FLBH 4K8YA 1NS3A 3U8RH 2PGBB 1TNGA 4I31A 5EG4A 2Y82A 3Q3YA 1H4WA 1ABJH 1SQTA 3F9FA 3RLYH 3RXEA 3RXBA 1TIOA 3MU5A 5TCCA 3TJNA 4AG2A 1ABIH 5DO4H 2ZDKA 2ZKSA 3U1IB 2FIRH 4AFZA 1MTSA 3BTHE 2VIDA 1HNEE 3RXDA 1CQQA 3U1JB 1V2PT 1SLXB 4YOGA 1PYTC 4ASHA 2EI6A 2GP9B 1EJMA 3PYHA 4IC5A 2QCYA 3EQ0H 1SHYA 1DFPA 4FUBA 3RP2A 5AHGH 2SNVA 6ESTA 2A4QA 4AX9H 1D6RA 2G55A 2Z9LA 2ZF0H 3LGTA 1FAKH 1S85A 1W8BH 1VJAU 1D3DB 3LH3A 2G5VA 1C5TA 1W14U 1IAUA 1P2IA 4TPIZ 2ZQ2A 4X2YA 3EAJA 1GJ5H 3I77A 2Z7FE 2FXRA 1P12E 2A45B 4ABBA 2RCEA 3T25A 3VB3A 3UY9A 1BOQA 3A84A 1Q3XA 1FN8A 4MNXA 2R0KA 1QJ7B 3DT0H 1YF4A 3SUGA 1FY4A 1O36A 3RMNH 4H4FA 4OS2A 5A0BA 1IOEA 3MH4A 2BD7A 1AIXH 3LGWA 2ZECA 3BG8A 1MKXK 3SHAH 2BQ6B 1EAWA 1GCDA 2VINA 3A7ZA 1KLTA 1FPCH 3NUMA 2F91A 1G2LA 2AEIH 1OYTH 1E35B 3BV9B 1FLEE 1L1NA 2OLGA 5FXLA 1HLTH 3TH4H 5LPEA 3PLKA 2DUCA 1C1UH 2SGDE 2BXUH 1PPCE 2AFQB 1RXPA 5HGGA 2Y5HA 1K1OA 1S83A 1KSNA 2ZGBH 5F6MA 1NFWA 1ZMLA 1P8VC 3RXKA 4YT7H 4CRGA 1S0RA 2AGEX 4BAMB 4ZAEA 2FWWA 2ZIQH 1C5QA 4O03A 3M7UA 4PROA 3SJ9A 1G36A 1OKXA 3BIVH 2TBSA 4WY3A 3QO6A 2ZGJA 1WV7H 2ZU3A 3LGVA 1TYNA 1TX8A 3NKKA 3KN2A 1DSUA 2PUXB 3QK1A 5DP5A 1L4DA 1QA0A 3M5MA 1VR1H 2F9NA 1TRNA 3TJVA 4Y7BA 3MO3A 1SMFE 3NZIA 5EQRA 3QN7A 3FZDA 3OYPA 3E6PH 4K5ZA 1DVAH 2BDAA 4MQAA 2XBXA 3AW0A 2KAIA 1S0QA 1P05A 4DURA 3M5NA 4JMYA 1KDQB 1O2OA 4OGXA 4WH6A 1Y3WA 1K1LA 1V2UT 1TPPA 3GY8A 4CR9A 2VIWA 4HI3A 1L2EA 2OD3B 5CHAC 4B74A 1Z1IA 3D49H 3BIUH 1QL8A 1ORFA 3BG4B 1A2CH 2PFEA 7KMEH 2VVCA 2Q1JA 3DFJA 3U8TH 1SGEE 2D2DA 1A46H 2FI4E 2VGCB 4Y0ZE 3E8LA 1AWHB 3O8DA 1L0ZA 1WQVH 4FXGH 1GI0A 1PPBH 3NPSA 1GBCA 4O3TA 3LONA 2FP7B 2WPKS 1QQ4A 4UEHH 3UFAA 1Y5AT 3S69A 2Z9GA 3H7OA 3H5CB 2ZCHP 1EPTC 6LPRA 2QN5T 1O2JA 2XTTB 4JK5A 4DJZB 2GD4B 1GJBB 3MYWA 1GVLA 4YLQH 1FQ3A 1NRRH 5JBCS 1AB9B 2H9HA 1P2JA 3VB7A 2ODPA 2FOMB 1ZLRA 1MTNB 1O3GA 1SGQE 4GUXA 1CGJE 3SU6A 4NSYA 1BHXB 4JYVH 1LVYA 3SU3A 2HWLB 1BTZA 4AB9A 4UFFH 1F5KU 1T31A 2EC9H 4BNRA 3I78A 2PKAB 5ABWA 2ZDAH 5JBAS 2CJIA 1ZSJA 1HAIH 5A8XA 3SQEE 1JIRA 1ELAA 1H9LB 3RXJA 1AO5A 3S9AA 1BMLA 1KXAA 4TWWA 2Z94A 1QTFA 1DXWA 2WV4A 1AUTC 2WYJA 3QGNB 5HYOA 1E36B 1C1PA 1GJ9B 3D62A 3VPKA 1LVBA 1E38B 2ANMH 3M5OA 1TNHA 2UUFB 1MZDA 4HTCH 1TRYA 3SORA 2D8WA 3O8CA 1ELVA 1NRQH 1J17T 3T27A 5ETXA 3ZVDA 1RD3B 3ZVGA 3AASA 1UTOA 1IQIA 1ARCA 1UHBB 1Z8JB 3STIA 2XC5A 1ANCA 1L4ZA 3RMMH 3SI3H 3GCNA 1AE5A 1P11E 3ZZAA 1CU1A 4WF8A 2B5TB 2VWOA 1EB1H 1PQAA 2Y7ZA 2GZ9A 1O2HA 2G4TA 2SGEE 1V2ST 1DE7H 2ZPSA 4VGCC 5JB9S 5DP3A 3ZZBA 1B7XB 1AKSB 1BMNH 1P02A 5EW2H 1SLVB 1HAYB 1DT2A 2HNTC 4TY6A 1C2LA 5EGMA 3RM0H 1CT2E 2SGFE 3RXGA 3K65B 3AVZA 1TA6A 5C5NA 1UTMA 1KY9A 3A82A 1ANEA 2BTCE 1G30B 3F68H 4D9QA 1YYY1 1TB6H 1C1NA 1GI7B 4A92A 5C1YA 3T29A 5C2ZA 2GT7A 4JZIA 1XKAC 1Z1JA 3QDZB 2CXVA 1GDUA 4JCNA 8KME2 1O2ZA 2QXJA 1VGCB 4JYTA 1ID5H 4FUCA 1BRAA 1Q31A 1EP6A 1H8DH 2W26A 2WUBA 3LJJA 2P16A 2IJOB 2ESTE 4I7YH 1GBMA 2VWLA 3SQHE 4IS5A 3S7KB 1O3FA 2W3IA 1AKSA 1LKBA 3OU0A 1RRKA 2P3TB 4ISNA 5A0CA 2OQ5A 3ZYEA 4NFEA 4Y8XA 1GI2A 2XNIA 4X2VA 1IQFA 2NU0E 3TK5A 3SU4A 5GWZA 4K3JA 5DP9A 2AGIX 1LKAA 2GVFA 3F1SB 1KIGH 2FTMA 2QC2A 3OX7U 4X2WA 5JDUB 2J9NA 1Z71A 1TNKA 1GHXH 4FU9A 2A5AA 1QGFA 1T32A 2ANWA 1MCVA 3M36A 3UTUH 1FPHH 2CGAA 5GJ4B 2ZU5A 1RIWC 2ZU1A 2OXSA 1HAXB 1BRCE 2VIVA 1C2EA 1HBTH 3RC4A 5I46H 1QIXB 1UTJA 2RDLA 3SNCA 1FMGA 3ZV8A 3RXFA 1KLIH 1V2QT 3MU4A 1WTGH 1PPFE 3PROA 2UUYA 1O3CA 2FOBA 3GISB 5K7RA 1A3BH 1NFYA 1XUHA 1BRUP 1SOTA 2B9LA 3OTJE 5JYIA 2ZHDA 4FUDA 1ZMJA 1SGFA 1UCYK 3MU1A 1D3TB 3TH3H 1UTQA 3BTME 4X8VH 1C1TA 3STJA 3LC5A 3P8GA 3QTVH 4SGAE 1T7CA 1K1IA 4ZHLU 2AMPA 4IN1A 1ESAA 4ABIA 1YCPM 1HAVA 1W2KH 1Z6JH 2G8TA 4K2YA 3TITA 4NGAH 9LPRA 1EAUA 3ODDA 1J8AA 2FYQA 1MU8B 2THFB 4XOJA 5GDSH 4IBLH 2FYRA 1D4PB 1KTTB 4BTUB 1G37A 3BG4C 2BY9X 4ZROA 3RXTA 5A8YA 2ZFTA 4GLYA 2VGCC 1HGTH 1MKWK 3VFEA 5CHAB 1TNIA 2NU1E 2XC0A 5J4QA 5FX5A 1S81A 4B71A 1MKXH 1O2MA 4NSVA 4FUGA 4H6SB 1DSTA 2AMDA 2O8MA 2ODYB 3UWJH 1BZXE 2QGRA 3TGIE 3UQOA 1GMDG 1O2XA 1V6DA 4FUIA 2Z3CA 3RXQA 1GMCG 2EI8A 3KQEA 2P95A 4BAOB 1MBMA 3NXPA 3AAUA 2XWAA 1YPMH 1UVPA 3KNXA 4OS1A 3IG6B