4ZKNU

The crystal structure of upain-1-w3a in complex with upa at ph5.5
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
246
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
total genus 59
structure length 245
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zknU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zknU01
2Z7FE 1XM1A 3TK5A 1P0SH 1TQ7B 2RG3A 3BEUA 4NZQA 4X6OA 3Q76A 5C3NA 1HFDA 1ZRKA 1D6RA 2QXJA 1C1QA 1D9IA 2XBVA 2ZHWH 3GISB 2VJ1A 3TGJE 1NRNH 1MU8B 2C8YB 4XDEA 1Y3UA 1GBDA 1V2QT 2SGEE 1W10U 2Q6DA 3SU1A 1MQ6A 5K0HA 1ORFA 5EODA 3SNCA 1ETRH 1ZSKA 1WQVH 1P11E 1O3LA 2ZDVH 1IHSH 1O5EH 2FS8A 1C2JA 1NFUA 3ITIA 1LVYA 1D3DB 3F9GA 1O3BA 2QCYA 4ZKSU 1FNIA 5IYTA 3NXPA 2ILNA 1AD8H 5A8YA 1YPEH 5SGAE 2P3TB 1QRZA 1DOJA 3M5NA 1O3EA 1A5GH 1GVKB 1GJ8B 2BDIA 2V3HH 2IOTA 1C1SA 5DP4A 2M5TA 7GCHG 4IBLH 1W14U 2Z3DA 1SLUB 1V2UT 3A7ZA 4X0WU 1ABJH 2C90B 2GCTB 3RMMH 5BPEA 3NPSA 1P05A 3A83A 4I32A 1O2OA 1GI3A 1AE8H 4DT7B 1WTGH 1GG6C 1ZTJA 2XW9A 5TCCA 4K8BA 1J16A 1ELFA 3A7WA 4CR9A 5GIBA 3SJ9A 2CXVA 1NU7B 3S7HB 3QGNB 2GZ7A 1KXDA 4ISNA 1C2FA 1PJPA 4B2CA 5E8EH 3ATKA 1UVUH 8KME2 1IQKA 1GJCB 1YPLH 5LPEA 4YM9A 2EI7A 4PROA 2P95A 4HI3A 5EW1H 3WY8A 2QF3A 3SJKA 2A4RA 5A0CA 2XCFA 1C5QA 3U69H 1YC0A 2ZHDA 3UQOA 2O8TA 4A5TS 4FUJA 4K1TA 5GWZA 3M7UA 3MYWA 3SBKA 2PWXA 2NWNA 1TGSZ 1Z7KA 1EB2A 3EA7A 4UFDH 2FPZA 3ZVFA 1AVWA 3MU0A 4JZEH 1KTTB 1GCTB 1ESBA 3V12A 1L2EA 2FOAA 4FUHA 2GCTC 3SV7A 1GMCF 1GI5A 2ULLA 2FOCA 1UMAH 4HGCA 1LQDB 2AIPA 2BY7X 1BMLA 3B9FH 4BAQB 3Q00A 3GYMA 5EPYA 3RXEA 2GDEH 1P2IA 3LGUA 2CJIA 1CSOE 3RXFA 2QXHA 3T26A 2BX3A 1LVOA 1O3GA 4KGAA 3SHAH 4JCNA 1DICA 3OY5U 2BDYA 1CA8B 3TH4H 4K60A 1E0FD 1J14A 1JBUH 1DUAA 1RGQA 2GVFA 1K1PA 2XBXA 3P8FA 1K1MA 4YLUA 1PPGE 1O0DH 5J4QA 3CS7A 2NU3E 1E38B 5FPTA 1O34A 1A61H 1C5TA 2Z3EA 1EJNA 1QA0A 3A7VA 3TLOA 3NCLA 1QY6A 2ZHQH 3CP7A 1QRWA 5EXNA 1HDTH 1N1LA 2GTBA 1MH0A 3QZRA 4WXVA 1O2UA 4AYVB 3GOVB 1GBKA 1GBFA 5DP8A 3VXEH 5JYIA 2VWOA 2DE9A 2TPIZ 3NWUA 2ZTYA 4MNYA 1NO9H 1A3EH 2FO9A 4FUGA 1E37B 1TBRH 2W5EA 4MQAA 1GCTC 1GJ7B 1ID5H 1V2JT 1HCGA 2ANWA 2PR3A 1OX1A 1O3AA 1T4UH 3L6PA 1A3BH 2ANYA 1NS3A 1ANBA 1O36A 3L33A 1XVMA 3QDZB 1SB1H 2FLRH 1HPGA 4GLYA 4WF8A 3AVZA 2O8MA 4YTAA 1NPMA 3EQ0H 4NCYA 1BTPA 1CO7E 3ELAH 5A2MH 2G4UA 5FXLA 5BRRE 3P92A 1FY3A 4SGAE 1MKXK 4AB9A 1CT2E 1KXCA 5JDUB 1BRAA 1IQHA 3RLWH 2QIQA 3GDUA 3MU1A 3UY9A 1HJAB 2BLVA 2H9EH 4AN7A 2ZIQH 2XTTB 3HKIB 1AVXA 3GY2A 3PMHB 2BDAA 2AFQB 4AFSA 3T2NA 6CHAB 4ABBA 2PTCE 1XUJA 3N7OA 2GMTB 1O2RA 1TQ0B 3QK1A 5T3HA 1WBGB 5JB9S 1WU1A 4Q7ZA 1HAZB 1SHYA 1YPMH 2A7JA 3E0NB 3C27B 4B74A 2B7DH 3P6ZB 3VB5A 6ESTA 5GPIB 3BV9B 1GDNA 3OY6U 3DD2H 1FV9A 3T62A 1O2JA 2G4TA 1DVAH 1HYLA 3RXUA 3KEEA 1FLEE 3RXTA 1O35A 4F4OC 1C2GA 1L0ZA 1QIXB 1PPEE 3TK6A 1AHTH 1MCTA 1NFWA 4OS2A 3QLPH 5F8TA 2WYJA 1V2PT 1L1NA 4CRBA 4Y8XA 4NFEA 4ZROA 4AFQA 3OYPA 2K1QA 4D9QA 3RU4T 3K2UA 1OWKA 2VIWA 2P16A 2BMGB 1PPZA 1NRPH 1S83A 2SNVA 3PROA 3SU2A 5GXPA 1ZLRA 3MU8A 3SV6A 1DLKB 2GT7A 1V2LT 1GJAB 1TX7A 4H4FA 2VB0A 1IQJA 4K3JA 1HJAC 1INCA 3AAUA 1S6HA 3SUFA 1LPGB 4ZHLU 3SV2H 3MO9A 1UVTH 2YNBA 1O2YA 1BTUA 3GCHB 1NZQH 2Z9LA 3UFAA 1O5GH 2BOHB 1O33A 1XXFA 2EI8A 1JIRA 4ISHH 6CHAC 1QA7A 5DJ7A 2F9UA 2G55A 2GMTC 1NROH 1QJ1B 2OLGA 1PQAA 1ELBA 1LKBA 1AZZA 1GCDA 2GCHG 3RLYH 4X8UH 3D23A 4NIXA 1ZGVA 2P93A 1LHDH 5AF9H 2A2XH 3RXRA 4ZKRU 5JBBS 3MFJA 3MOCA 1YPGH 4NIWA 2BM2A 2ZGBH 3M3SA 2CN0H 1BDAA 3D62A 4QT8C 2FOGA 3P8GA 3RXLA 4GSOA 4INHA 1AMHA 1D3QB 1AFEH 4RKOB 3H5CB 1FN8A 4ISLA 2H9TH 2D8WA 4TY6A 4X2WA 1UCYK 2SNWA 5AFYH 4U01A 3RXPA 2ZKSA 1FONA 3LH1A 4CRGA 3KHVA 1MTUA 4X6NA 1THSH 1A2CH 3LDXH 4CRDA 2OBQA 1TLDA 4MPVA 1T4VH 1MTSA 4BNRA 4AYYB 3TVJB 3STIA 2ZP0H 7GCHF 2BD3A 1DITH 1O3IA 3E8LA 1AZ8A 2FP7B 2GV6A 5DP7A 1NRRH 2QN5T 3M5MA 1OKXA 4ZAEA 1AB9B 2D26C 2ZG0H 1V2RT 4X1QU 1LQEA 4ISIH 1G2MA 1ZPCA 1C2IA 4Y7AA 1DXWA 2EC9H 1YCPH 1UHBA 2JKHA 1SGFA 2ZWLH 4OS1A 4AX9H 3TJUA 3RP2A 5FCKA 2ZDKA 1FIZA 4GVUA 1LTOA 2WPMS 4ABFA 2BVXH 5A09A 5F8XA 1Z1IA 1AE5A 3T29A 2HWLB 2OD3B 3MWIU 5ESTE 5B6OA 1W7GH 1K1NA 1HAVB 5C1XA 3KNXA 1UTOA 3BTHE 3LONA 1C5SA 5HYOA 3RXMA 1UTKA 2XWAA 3SN8A 2AS9A 2R2WU 3SNAA 1FY4A 1WV7H 1C4U2 3ENSB 2AGEX 1UTMA 1CU1A 1K22H 4ZXXH 2KAIB 1CHOG 1C5UA 3BTDE 2OCVB 1A7SA 1CGIE 1NRQH 5GCHG 2W26A 1DX5M 2ZEBA 4IGDA 1HAHH 2YNAA 2ZECA 5CMXH 1AN1E 2FOHA 2UUKB 2AERH 4IMZA 3M7TA 1M9UA 1TGCA 1NTPA 1GBEA 2ZFSA 1C5OH 5A0AE 1EP5A 1D4PB 2A5KA 2XWBI 1DY8A 1O2PA 5C5NA 4NFFA 1YPKH 1H4WA 4KP0A 1RFNA 1AI8H 2W7SA 3SGBE 5DGJA 1TGNA 7KMEH 1UCYH 3A8AA 4ZUHA 4WVPE 1Y5UT 3F68H 1QJ7B 1JRSA 1P2OA 2Z94A 4ZKNU 1IQFA 1JMOH 3HGNA 3SU5A 1OWDA 1RS0A 2TRMA 3LIWA 1YYY1 1N6XA 1OWIA 4R0IA 1EOLA 3VPKA 1DANH 1EZSC 3EAJA 3UWJH 1SLXB 1A46H 3LC5A 1SL3A 1Y3XA 1F0SA 3HK3B 2JH6D 1SGFG 3BTTE 4D7FA 2ZDLA 1LHEH 3AW1A 3I78A 4MNXA 1SOTA 2VVVA 2SGFE 3B8JA 1YPJH 4IN1A 2QA9E 4I8HA 2FYRA 1IQMA 1VITH 1ESTA 1KLTA 2BDCA 4UFEH 1QL8A 3A8CA 1BTWA 3O8RA 1GI6A 3UWIA 1AKSA 1RD3B 4CH8B 2ZHEH 1EATA 1FUJA 1HLTH 1GBTA 3GDVA 1V2VT 3ZZ5A 3MNSA 1K9OE 4OS6A 4RN6A 4JMYA 1T8LA 2ZDNA 1WTHD 3SNBA 3ZZ3A 2XBYA 1L1GA 2BDBA 2VWMA 3PTBA 1ZMJA 1BBRE 1CT4E 1BTXA 4ABAA 3BEFB 3IWMA 4TPYA 2OQUA 1J8AA 3AASA 1HB0B 1C2MA 1TGBA 2XC5A 3VB6A 1BUIA 4CR5A 3NK8A 1DM4B 2WV4A 4MLFB 1O2KA 2GDDA 1BHXB 1WAYB 1LVBA 1Y5BT 3RXHA 4A92A 2R9PA 2Z6BD 3KF2A 4ZH8A 2EA3A 3BTWE 1HGTH 2UUJB 2AMPA 3SUDA 4XBCA 4E7RG 3S9CA 3TGIE 1OWEA 4GAWA 1UVPA 2HOBA 4O3UA 3FVFB 3UR6A 2G5NA 1B0EA 5EOKA 5CHAB 2J9NA 1UK3A 1O3HA 3LGWA 3SJ8A 1GBBA 1DDJA 1C4V2 1S85A 2WUBA 1HBTH 1GGDB 1YLCA 3DA9B 4Q2KA 3MH5A 1BRCE 4B71A 1G3EA 1AUTC 1ELDE 2ZNKH 5AHGH 1SLVB 1TIOA 3ZZ8A 1GDUA 9ESTA 3HATH 5E0JA 4H6SB 1ELAA 5GDSH 2ZDMA 2BQWB 2G51A 2ZA5A 2QC2A 2BY5X 2HNTF 1K21H 3ZVEA 1TA6A 2FTMA 4XFQA 4LZ4B 4WMFA 5T6DA 4AFUA 1C5VA 1S5SA 2IJOB 3MH4A 4E7NA 1EJMA 1DXPA 1JWTA 5FHTA 2BYAX 3ESTA 2ZF0H 2VIPA 2Y5FA 3M61U 2OP9A 2VH6A 2ZGJA 4JYUH 1NFYA 2CHAB 1L4ZA 1EX3A 1P2QA 2OQ5A 1XUHA 5C1UA 1GL1A 3ZVCA 1LO6A 5J4SA 5EQSA 3ATLA 1NT1A 2GCHF 5DP9A 1H1BA 1ELVA 1MBQA 2ZGHA 3OX7U 5CHAC 3E90B 3VXFH 1PPHE 5L2YH 3A87A 3IITA 1UVOA 1XUIA 1Z8GA 1IQGA 3RU4D 4IMQA 3MNBA 1MTNC 1V3XA 4FUEA 1GGDC 4RKJB 5L6NH 2BX4A 2Y5HA 2I6SA 5L2ZH 4GHTA 3MNXA 1UTJA 2Y5GA 1HV7A 1P2JA 1AFQB 3PLBA 1OYQA 3ZYEA 4HZHA 2V35A 2HNTE 2FZZA 3MHWU 4AZ2B 4B73A 5JBAS 3U8OH 1GVZA 1W8BH 1BITA 2P8OB 1ZSJA 2OC7A 1T8MA 1O30A 1BA8B 5C5OA 1SFIA 4JZIA 3RXOA 1GPZA 1EAIA 2JH5D 1K2I1 2A0QB 3V0XA 1SGYE 1XKAC 1SSXA 1UTNA 2Z9JA 4THNH 2J4IA 4YOIA 1B0FA 2HPQH 2CHAC 4X1NU 4DG4A 2QYIA 1G3DA 1P01A 5E2PA 1F5LA 3GY6A 5T6FA 3LGTA 2RA0A 2OBOA 1SGDE 1SOZA 4Y0ZE 1EAUA 2G52A 4NZLA 2VIVA 1D3PB 1EZUC 3TJNA 1EPTA 3BTGE 3O8BA 2P3FH 1GI4A 1TNJA 1C5WB 3MI4A 3KQCA 2PSXA 1MQ5A 3TPIZ 2HALA 3P17H 1O3FA 1AWHB 3QWCH 3ZZBA 4TPIZ 3ZZAA 3R3GB 3TJOA 1GWAA 1ZTKA 4R8TB 4YT6H 1MU6B 1AFQC 1AVGH 1KDQA 3ZV9A 4DY7B 1ZMNA 1HJ9A 3LU9B 4UDWH 2BD5A 2BZAA 1F0UA 1LKAA 1OPHB 2ZDAH 2F9PA 3EYDA 3UREA 3BIVH 2FOMB 4BXWA 2VWNA 2P8OC 2Y7ZA 4BOHA 1CHOF 4CH2B 1EOJA 1F92A 1XUFA 1O2LA 1HRTH 4AFZA 5GCHF 1C4Y2 3GY3A 1KIGH 1N6YA 1ZGIA 1C1NA 2THFB 4MPUA 1SGTA 1ZHMA 3KIDU 4WWYA 3E0PB 2VIOA 3FZDA 1AIXH 1W0YH 2TGTA 3URDA 4ABEA 4DIIH 3ZVBA 3RXSA 2SGAA 1HAIH 2ZPSA 4IC5A 4JYVH 1V6DA 4FUIA 1YPHE 2GD4B 1SPJA 1GMHG 2ZFQH 1H8DH 4Y71A 1QB6A 2J92A 4UFGH 4XE4A 5A0BA 2OUAA 1FPCH 1TMBH 1HAGE 1FXYA 3PLKA 3NZIA 2ODYB 4NIYA 3Q3YA 2IN2A 4DCDA 1P10A 1YLDA 1QHRB 2ESTE 4INKA 4A1XA 1S6FA 3SI3H 3LGYA 1MCVA 3SU6A 1W12U 2BD7A 1GHBG 5HM2A 3UTUH 3A8DA 3E16B 2BQ6B 2BY9X 6LPRA 2R2MB 1HIAA 2C4FH 3RM0H 5ESBA 5FAHA 1NN6A 3SJOA 1AGJA 4NSVA 3KCGH 2F83A 5C2ZA 1HAOH 3MO6A 2ZFFH 4GUXA 5EG4A 1SVPA 3EDXB 4KTCA 4UE7H 2QXGA 4NSYA 3F1SB 3BN9A 1S84A 1TGTA 3S0NA 1WSSH 1SR5C 4Y8YA 1THRH 1OP0A 2PKAB 1SI5H 2Z9KA 2W7UA 4K2YA 1AY6H 2WINI 2W3IA 1W2KH 2FX4A 1XX9A 2NU4E 1C5ZB 1ARBA 1DY9A 3P8NA 4Y7BA 1TOMH 4JZFH 1TNIA 1SQTA 2ZU5A 4YZUA 4B76A 1QJ6B 2WV5A 1EAXA 3BIUH 1FPHH 1EB1H 1O2ZA 5T6GA 1OP2A 4M7GA 3S7KB 4AGKA 1ZMLA 1FZZA 1KXFA 4RSPA 5GJ4B 3DT0H 3RDZA 4AGJA 3PV4A 3SORA 1HXEH 1DLEA 3Q3XA 3BF6H 4ZHAA 4B75A 1GMDG 3GICB 1Z8JB 2A4OA 2H6MA 3BTEE 1FY5A 2TGAA 1P04A 3RXCA 4FU9A 2ODQA 3RC6A 4DW2U 4IN2A 2GKVE 4B1TA 4A1TA 5C67A 1C5RA 1P09A 1A5HA 4MDSA 2F3CE 2A7CA 4X2VA 2ZO3H 1C1TA 1F0TA 4NGAH 4I8KA 5DKMA 1VCWA 3H7TA 1RTKA 1A0HB 1LVMA 1P2NA 1T31A 1ACBE 1AQ7A 1DE7H 3EE0B 2XNIA 5EXMA 4BAKB 2ZTZA 2BY8X 1VCQA 2R0KA 2J34A 2IPHA 4MNWA 3QZQA 4MPXA 1F7ZA 1Q3XA 1ANDA 5HGGA 1PYTD 2B5TB 1E34B 2Y82A 2GV7A 1O2HA 2TIOA 3QN7A 1XKBC 4D8NA 1O31A 2WPKS 1SGRE 1VCPA 2H5CA 8GCHG 2OTVA 1O5CB 3ODFA 3GYLB 1TBQH 1ELGA 1UTLM 3RXQA 1BJUA 4AB8A 1TNHA 1MKXH 1P03A 4IS5A 3ZVAA 2AEIH 1TA2A 1BIOA 4ABIA 1G30B 2QGRA 4FUFA 2ZCHP 2VIQA 3LJJA 3P8OA 2PSYA 4X2YA 1NFXA 2FOEA 1GJ4H 3KGPA 2XRCA 1DSUA 2H2ZA 4DVAU 2Y80A 1J9CH 1HXFH 3M36A 3MU4A 5IDKA 1GBJA 1Q2WA 2VNTA 5E0GA 1H9LB 2Y7XA 3A84A 3VFEA 1B7XB 1G32B 1P3CA 3I77A 1TX6A 1GHWH 1IOEA 2A1DB 3M7QA 4MVNA 1BMAA 1QL7A 4Q7XA 3VB4A 2B0FA 2CF8H 4HFPB 4D7GA 2FI3E 3DFJA 4NWLA 3ZZ6A 3BG4B 3BTFE 2FTLE 2ASUB 4LXBH 1G9IE 2QAAA 1RTFB 4VGCB 1OP8A 2EI6A 5DP6A 2EEKA 3LPRA 4E06H 5HM9A 1ELCA 3BTME 3EGKH 3F9EA 3UNSA 2ODPA 4O97A 1HAXB 3TU7H 1O3CA 3CENA 3RMLH 2QF0A 1NY22 1MUEB 3STJA 4OGXA 2FOBA 1GJ6A 2A45B 2PUXB 1DWDH 2PHBA 2YOLA 3M5LA 1O3JA 4JZDH 2ZFRH 2BD2A 2ZFPH 3TJVA 3E91A 4Z0KA 2F9OA 2TGDA 3SO3A 2C8WB 3FP6E 1K1JA 1J17T 3LT3A 2ZCLP 4ABHA 3UOPA 1Y3YA 2ANKH 1E36B 2PTNA 2NU0E 1QCPA 3RXAA 3KQBA 1OSSA 1S0QA 3PMAB 3KQDA 1TYNA 1D3TB 4WJG2 4ESTE 4FVBA 4FUCA 3MTYA 2WYGA 4KTSA 1EPTC 3FP8E 1WYKA 2Z9IA 1H9IE 1LPKB 1UTQA 1V2MT 1XUKA 3BG4C 2A5IA 1CQQA 3RMOH 2GX4A 2ZQ2A 4VGCC 4BANB 5AVDA 3V7TA 2UWLA 3RM2H 1T7CA 3MH7A 2BDGA 2J94A 1AWFH 1C2LA 1C5LH 1GI8B 3SGAE 2ZU3A 2OINA 8LPRA 4NWKA 1BBRK 1DPOA 1W3CA 3MNCA 3T25A 3E3TA 4AG1A 1BJVA 3JZ2B 1C1MA 6GCHG 3ATIA 1C1PA 1EZXC 1RRKA 1LHFH 4ASHA 4ZXYH 1UK4A 1G2LA 1QL9A 1GJBB 1HJ8A 3RMNH 2UWPA 4ABJA 3T27A 3HK6B 1GDQA 3SGQE 1L1JA 2BHGA 1EJAA 1GMHF 1IHTH 3MH6A 3UR9A 1BRUP 2A5AA 5DG6A 4X8TH 5A8XA 3SW2B 1V2OT 1IQLA 1FY1A 3LKWA 1RJXB 3F9HA 4AG2A 4NA9H 3AW0A 3A80A 5DP5A 1BOQA 3QTVH 1RTLA 1KSNA 1C5YB 1G36A 2HNTC 3A7TA 4Y10E 2LNCA 3RXVA 1SBWA 2F9BH 2WPLS 3OSYA 1JRTA 1MTWA 1GHBF 2PGQB 1DWBH 3SOSA 5K7RA 1ZJKA 1LMWB 2BQ7B 2A4GA 1FN6A 1GBAA 2Q1JA 1PFXC 4CBNA 4DURA 1AU8A 1TX8A 2D1JA 1FMGA 3BSQA 4WH6A 1GI1A 1W0ZU 3ZVDA 2D2DA 5I46H 2O9QA 3FP7E 4JZ1A 3MMGA 4KKDA 2FDAA 3RC5A 1IQNA 1F5RA 1MZAA 4OS4A 2Q6FA 1SFQB 2Y6TA 3T5FH 3TH3H 4BXSA 3ODDA 1O2GH 2BY6X 3GCTG 1YM0A 3B23B 2ZGXH 3QO6A 5DP3A 3LOXA 2WPHS 1O3DA 3S69A 2ZPQA 2FWWA 1BMMH 2ZGCA 1Z8RA 1NRSH 3G01A 1MTNB 3RXIA 1C1WH 1C5PA 1LDTT 5I25A 1YF4A 5EXLA 5H4IB 3E1XB 1LHGH 1PYTC 1C2EA 1G3BA 3GY5A 1ZZZA 2SFAA 5AFZH 4JYTA 3M5OA 2VU8E 1BZXE 1CBWB 3PWBA 1A4WH 4NIVA 1GMDF 1O5DH 4X2XA 4IW4E 4BAHB 3RXGA 3R0FA 1O3PB 2FIRH 4A7IB 1BBRH 4FUDA 1VGCB 1BT7A 1K28D 1FY8E 3I29A 3NKKA 1MD7A 1VZQH 1C5MD 2FXRA 4ABGA 5G4BA 1ZTLA 3QGJA 1TRYA 2NU1E 1O2IA 4Z6AH 3P95A 1KLJH 1ELEE 1GL0E 2FMJA 4YLQH 3RC4A 1KXAA 1GHYH 1O3NA 1QTFA 1PPBH 1O2WA 5JBCS 3ATMA 4ZKOU 1T8NA 2C8ZB 1YPHC 1NM6A 2BXTH 3GY4A 2FM2A 1PQ8A 4B2AA 1IQEA 4I31A 1CA0B 1DFPA 1TPAE 3O8CA 3FZZA 1HAPH 4YOGA 1O2TA 2VVCA 4O03A 1C2HA 2R3UA 8ESTE 2ZFTA 3HPTB 8GCHF 3BTKE 1TNKA 5FCRA 4WMDA 1UHBB 3K9XB 1SMFE 4K1SA 4U32A 2BTCE 2QXIA 1QQUA 3M3TA 2SGQE 1FDPA 1TONA 3W95A 1SGCA 3A89A 4GCHG 1FQ3A 1BMNH 1VITG 3GDSA 1CBWC 3U8TH 2J2UA 2ZPRA 1P3EA 2H9HA 2RDLA 3BTQE 4J2YB 2G8TA 1F5KU 2B8OH 4TWWA 1P9UA 1F2SE 2AH4X 1VGCC 2J38A 3SU4A 1GHAG 2QV1A 3PO1C 3ZZ4A 3F9FA 2STAE 1Z71A 1ZYOA 2H1UA 1XUGA 3RXBA 2VGCB 5C1YA 2PW8H 1THPB 1C9PA 2UUFB 3SV9A 3GY7A 3UIRA 3D65E 4HTCH 1TAWA 2BXUH 4MNVA 3VGCB 1XVOA 3TH2H 3ZYDA 4X8SH 4CBOA 2I6QA 2O8UA 2DUCA 1A0JA 2OC1A 1TWXB 3URCA 4A1VA 4WMEA 3TK9A 3DUXH 4ZMAH 1CA0C 1A5IA 3DFLA 4X6PA 4D76A 2SGDE 3CS0A 1TOCB 5FX5A 1O38A 1MD8A 3EA9A 1GHVH 4Y79A 2JETB 1KYNA 1BHXF 3BG8A 2Q6GA 4H6TA 7ESTE 3TGKE 1WUNH 1Y8TA 4BTUB 5L30H 1FI8A 3HKJB 1X7AC 4Y6DA 1Z6EA 1C1UH 2TBSA 1S82A 1ZOMA 4E05H 1AO5A 1MTVA 2GT8A 1FJSA 1O2XA 1SHHB 3A81A 1EXFA 1YBWA 3A8BA 1EASA 1J15A 1QQ4A 2QY0B 3RUOA 3PM3A 3PYHA 2Z9GA 2HLCA 3SNDA 2GZ9A 1B5GH 1HAVA 2VGCC 1MBMA 3ZZ7A 2HGTH 2UWOA 2LPRA 1QBVH 1ETSH 1ETTH 1ZPZA 1ZRBA 5LPFA 5FPYA 1PQ7A 3A86A 3VGCC 5F03A 3U1IB 2BLWA 1MKWK 3SI4H 3SJIA 1GI2A 1P06A 3UUZA 1AKSB 3RXDA 1Z8IB 2XXLA 5ABWA 1U6QA 3D49H 1SQAA 2FEQH 3PMBB 2KAIA 3L3TA 3LGIA 1O2MA 2GZ8A 2BD9A 1KXBA 2VINA 3BEIB 4K1EA 1V2KT 4TY7A 1G37A 4JK5A 2A4QA 1ELTA 1O2VA 5F8ZA 3SU0A 2JETC 1GI9B 3QUMP 3MU5A 3GCOA 1SGNE 3KQEA 1FAKH 4MPWA 6GCHF 1TNLA 3U98H 1SGEE 2VH0A 1IQIA 1K1IA 1PPFE 1TPPA 2SGPE 2AYWA 3K6YA 1P2KA 4I8GA 1EKBB 2P3UB 3M3VA 4TWYA 1DT2A 4UONA 3GCNA 1GJ5H 1SC8U 4OS7A 2OXSA 1ANEA 2AMDA 2XC0A 2PFEA 1MMJN 3FANA 2ZCKP 2ZU4A 2WPJS 3EA8A 1N8OB 4I8LA 2HRVA 1RIWB 1H8IH 2FESH 3ZV8A 1PQ5A 9LPRA 2BB4A 5DO4H 1SQOA 3A7XA 2PV9B 2FLBH 3SNEA 2ZU2A 1MAYA 4CRAA 1GBIA 1TB6H 4INLA 4NA7A 1ABIH 3UNQA 2WPIS 1EP6A 1QURH 1DS2E 2VWLA 5TCAA 4Q80A 4XBBA 1TPOA 2A32A 2ZTXA 3S9AA 1O32A 5LGOA 1W7XH 3KN2A 3S9BA 1S81A 1NU9A 3A82A 3GCTF 1Y59T 5EU8A 1YCPK 2TGPZ 1HNEE 1NC6A 2Y81A 2O8LA 2ZC9H 1V2ST 4DIHH 1P2MA 2DE8A 5FBEA 1DWCH 1BRBE 1MKWH 3A88A 1V2NT 2BD4A 1WCZA 1C2KA 4FXGH 2ZI2H 1P8VC 2CV3A 1V2TT 4ZHMU 3FFGA 4BTTB 5DK1A 1HAYB 3PTNA 4J1YA 4X1PU 4CRFA 1TNGA 2F9NA 1N8OC 3RXKA 3U1JB 1S0RA 1EUFA 5EGMA 1OYTH 1SLWB 4KTUA 4Y11E 1HUTH 1RIWC 4Q7YA 3E6PH 1F0RA 3C1KA 1G3CA 1NESE 3AAVA 3ATWA 4O9VA 1QRXA 3SQEE 1O3OA 1P9SA 1SGPE 3SUGA 3SHCH 3U8RH 4UD9H 3FAOA 3SU3A 1KTSB 1A1RA 2F91A 2VVUA 2ALVA 4GPGA 4Y0YE 2WUCA 1K1LA 1TBZH 2P59A 4CRCA 3QX5H 1BTYA 3KL6A 1C1VH 4H42U 4YOJA 4U2WA 2R3YA 3K65B 3ZVGA 4O3TA 1T32A 3M35A 5C20A 2BZ6H 3TNTA 1JIMA 2PLXA 3P70B 4LK4A 3VB3A 1WQSA 1C1RA 4Y76A 2BDHA 5ETXA 2R0LA 4BAOB 1VJ9U 1ZPBA 3LC3A 4XBDA 1LHCH 2C93B 1FIWA 1SG8B 5F6MA 5EQRA 2FI5E 1GJ9B 4X1RU 2H5DA 2FODA 4X1SU 4XSKU 2B9LA 2G81E 2RCEA 1Z6JH 1BTHH 5PTPA 2A31A 2C3SA 3UOUA 1O2QA 1O3MA 3VB7A 5LH8A 2FS9A 2AMQA 1EPTB 1EZQA 5JBTA 4A6LA 1OWHA 1EAWA 2XC4A 4CREA 3ZZDA 4GCHF 1VITF 4MG3A 4X6MA 1XMNB 2Z3CA 2C8XB 1ARCA 3QTOH 2OC0A 1SGIB 3NUMA 3JZ1B 4NA8A 1O5AB 3TNSA 3GCHC 4FVDA 1GHAF 2F9VA 1CT0E 1LCYA 1Q31A 4MTBA 3PLPA 4WH8A 1ZSLA 1KDQB 2RA3A 4LOYH 4AORA 1XXDA 2A2QH 1Y3WA 1TRNA 1L4DA 2BLOA 2UUYA 1UCYE 1UVSH 3TIUA 1TRMA 3H7OA 3LJOA 1GMCG 2VIDA 4F49A 3Q77A 1TABE 1C5XB 3UPEA 1CGJE 3A7YA 1QB1A 1E35B 2G00A 2FYQA 4ABDA 1WOFA 1GVLA 1CE5A 1BCUH 4U30A 3A85A 4OGYA 1P57B 1Y3VA 1YCPM 1LPZB 1OOKB 4FUBA 2OC8A 2V3OH 2PKSB 2BOKA 4D9RA 1C9TA 1GHZA 2HVXA 3OTJE 1Y5AT 3U9AH 5HMAA 1VR1H 1DSTA 1YGCH 4GHQA 1MAXA 2A7HA 1JOUB 5HXFA 2FX6A 3K6ZA 1C2DA 1GBLA 5EPNA 1YKTA 1QB9A 1VJAU 1KY9A 2STBE 4TYDA 2ZQ1A 3SZNA 1FAXA 1GBHA 2J95A 2XCNA 3DHKH 7LPRA 1KLIH 2XYAA 1K1OA 4LZ1H 4FU8A 4K8YA 1AB9C 2V0BA 1TMUH 1GHXH 1UJ1A 1PPCE 3PMJA 4K69A 1AUJA 1HIAB 3T28A 1GBCA 2ANMH 2JH0D 5TJXA 4DOQA 1TMTH 3Q3KA 4B2BA 1BQYA 3RU4E 1OS8A 5A8ZA 4OS5A 3M37A 3TITA 5FPSA 1UTPA 4CHAB 2AGIX 4YO9A 3UQVA 5LPRA 2BVRH 3O8DA 2PGBB 1TALA 2P94A 4WXIA 1JXPA 1W11U 3LGVA 3GY8A 4SGBE 1ANCA 3ZZCA 1DUEA 1TFXA 1RXPA 5FX6A 2PKSC 4UEHH 1TPSA 1C1OA 3SUEA 1O2SA 1A0LA 1OXGA 1UK2A 4I8JA 2XBWA 2CMYA 1W13U 3UNRA 3ZZ9A 4XOJA 1ESAA 1Z1JA 2ZZUH 1GBMA 4YT7H 1SGQE 1BB0B 2PUQH 2W3KA 3VEQB 4K5ZA 1OWJA 5JB8S 4DJZB 3PWCA 1GI0A 2BLQA 2GGVB 5E2OA 4DGJA 1QBOA 1V2WT 4YESB 5E0HA 2BD8A 3F6UH 5CE1A 3W94A 2GP9B 1O2NA 1QFKH 2G5VA 3SQHE 4ISOA 5FBIA 1H9HE 2AIQA 2ZHFH 2CGAA 2ZU1A 1QBNA 1IAUA 2CF9H 4BAMB 1O5BB 3V13A 1ZHRA 2BVSH 1CHGA 3SV8A 4CHAC 3RXJA 1GJDB 2AGGX 2FOFA 1ZHPA 4JK6A 4KELA 1O5FH 4AOQA 4IC6A 1C5NH 1O3KA 4X8VH 1ZJDA 2HPPH 1P12E 2ALPA 3LH3A 1CGHA 1CVWH 1P02A 1MZDA 4I33A 4NG9H 1O39A 1ZR0A 5EQQA 2FI4E 2PKAA 1GI7B 4Y8ZA 4I7YH 3IG6B 3OU0A 5JPMH 2V6NA 1O37A 1QGFA 5EW2H 5DPAA 1QNJA 3PB1E 2NU2E 1DWEH 2O8WA 3MO3A 4FU7A 4WY3A 1QR3E 1KXEA 1BTZA 1UO6A 4BTIB 1T8OA 3HGPA 3PO1B 1YP9A 3V3MA 1D6WA 1GG6B 1TE0A 4UFFH 1EQ9A
chains in the Genus database with same CATH superfamily
2Z7FE 1XM1A 4P02A 3TK5A 4XRNA 1P0SH 1TQ7B 2RG3A 3BEUA 4NZQA 4X6OA 4Z1MD 3Q76A 5C3NA 1HFDA 1ZRKA 1D6RA 2QXJA 1C1QA 1D9IA 2XBVA 2ZHWH 3GISB 2VJ1A 3TGJE 1NRNH 1MU8B 2C8YB 4XDEA 1Y3UA 1GBDA 1V2QT 2SGEE 1W10U 2Q6DA 3SU1A 1MQ6A 2KZ4A 5K0HA 1ORFA 5EODA 3SNCA 1ETRH 1ZSKA 1WQVH 1P11E 1O3LA 2ZDVH 1IHSH 1O5EH 2FS8A 3KYGA 2YMSB 1C2JA 1NFUA 3ITIA 1LVYA 1D3DB 3F9GA 5DSFA 1O3BA 2QCYA 4ZKSU 1FNIA 5IYTA 3NXPA 2ILNA 1AD8H 1H8ED 5A8YA 1YPEH 5SGAE 2P3TB 1QRZA 1DOJA 3M5NA 1O3EA 1A5GH 1GVKB 1GJ8B 2BDIA 2W6ID 2V3HH 2IOTA 1C1SA 5DP4A 2M5TA 7GCHG 4IBLH 1W14U 2Z3DA 1SLUB 1V2UT 3A7ZA 2HVYB 4X0WU 1ABJH 2C90B 2GCTB 3RMMH 5BPEA 3NPSA 1P05A 3A83A 3F2FA 1O2OA 3N99A 4I32A 1GI3A 1AE8H 4DT7B 1WTGH 1GG6C 1ZTJA 2XW9A 5TCCA 4K8BA 1J16A 1ELFA 3A7WA 4CR9A 5GIBA 3SJ9A 2CXVA 1NU7B 3S7HB 5GNDA 3QGNB 2GZ7A 1KXDA 4ISNA 1C2FA 1PJPA 4B2CA 5E8EH 3ATKA 3WWBA 1UVUH 8KME2 1IQKA 1GJCB 1YPLH 3SYJA 5LPEA 4YM9A 2EI7A 4PROA 2P95A 4HI3A 5EW1H 3KYFA 3WY8A 2QF3A 2YMSC 3SJKA 2A4RA 5A0CA 2XCFA 1C5QA 3U69H 1YC0A 2ZHDA 3UQOA 2O8TA 4A5TS 4FUJA 4K1TA 3PV5A 5GWZA 3M7UA 3MYWA 3SBKA 2PWXA 2NWNA 1TGSZ 1Z7KA 1EB2A 3EA7A 3OEHD 4UFDH 2FPZA 2HLDD 1AVWA 3ZVFA 3MU0A 4JZEH 1KTTB 1GCTB 1ESBA 3V12A 1L2EA 4RI0A 2FOAA 4FUHA 2GCTC 3SV7A 1GMCF 1GI5A 2ULLA 2FOCA 1UMAH 4HGCA 1LQDB 2AIPA 2BY7X 1BMLA 3B9FH 4BAQB 3Q00A 3GYMA 5EPYA 3RXEA 2GDEH 1P2IA 3LGUA 2CJIA 1CSOE 3RXFA 2QXHA 3T26A 2BX3A 1LVOA 1O3GA 4KGAA 3SHAH 4JCNA 2WPDD 1DICA 3OY5U 2BDYA 1WDIA 1CA8B 3TH4H 4K60A 1E0FD 1J14A 5B6LA 1JBUH 1DUAA 5EJZA 1RGQA 2GVFA 1K1PA 2XBXA 3P8FA 1K1MA 4YLUA 1PPGE 1O0DH 1YWUA 5J4QA 3CS7A 2WSSD 2NU3E 1E38B 5FPTA 1O34A 3OFND 1A61H 1C5TA 3F0PA 2Z3EA 1EJNA 1QA0A 3A7VA 3TLOA 3NCLA 1QY6A 2ZHQH 3CP7A 1QRWA 5EXNA 1HDTH 1N1LA 2GTBA 1MH0A 3QZRA 4WXVA 1O2UA 4AYVB 3GOVB 1GBKA 1GBFA 5DP8A 3VXEH 5JYIA 2VWOA 2DE9A 2TPIZ 3NWUA 2ZTYA 4MNYA 1NO9H 1A3EH 2FO9A 4FUGA 1E37B 1TBRH 2W5EA 4ACAA 4MQAA 1GCTC 1GJ7B 1ID5H 1V2JT 4ACBA 1HCGA 2ANWA 2PR3A 1OX1A 1O3AA 1T4UH 3L6PA 1E79D 1A3BH 2ANYA 1NS3A 1ANBA 1O36A 3L33A 1XVMA 3QDZB 1SB1H 2FLRH 1HPGA 4GLYA 4WF8A 3AVZA 2O8MA 4YTAA 1NPMA 3EQ0H 4NCYA 1BTPA 1CO7E 3ELAH 4HG6A 2G4UA 5FXLA 5A2MH 5BRRE 3P92A 1FY3A 3OEED 4SGAE 1MKXK 4AB9A 1CT2E 1KXCA 5JDUB 1BRAA 1IQHA 3RLWH 2QIQA 3GDUA 3MU1A 3UY9A 1HJAB 2BLVA 2H9EH 4AN7A 2ZIQH 2XTTB 3HKIB 1AVXA 3GY2A 3PMHB 2BDAA 2AFQB 5F53A 4AFSA 3T2NA 6CHAB 4ABBA 2PTCE 1XUJA 3N7OA 2GMTB 1O2RA 1TQ0B 2KFWA 3QK1A 5T3HA 1WBGB 5JB9S 1WU1A 4Q7ZA 1HAZB 1SHYA 1YPMH 2A7JA 3E0NB 3C27B 4B74A 2B7DH 3P6ZB 3VB5A 6ESTA 5GPIB 3BV9B 1GDNA 3OY6U 1KMHB 1FV9A 3DD2H 3T62A 1O2JA 2G4TA 1DVAH 1HYLA 3RXUA 3KEEA 1FLEE 3RXTA 1O35A 4F4OC 1C2GA 1L0ZA 1QIXB 1PPEE 3TK6A 1AHTH 1MCTA 1NFWA 4OS2A 1YY3A 3QLPH 5F8TA 2WYJA 1V2PT 1L1NA 4CRBA 4Y8XA 4NFEA 4ZROA 4AFQA 3OYPA 2K1QA 4D9QA 3RU4T 3K2UA 1OWKA 2VIWA 2P16A 2BMGB 1PPZA 1NRPH 1S83A 2SNVA 3PROA 3SU2A 5GXPA 1ZLRA 3MU8A 3SV6A 1DLKB 2GT7A 1V2LT 1GJAB 1TX7A 4H4FA 2VB0A 1IQJA 4K3JA 1HJAC 1INCA 3AAUA 1S6HA 3SUFA 1LPGB 4ZHLU 3SV2H 3MO9A 1UVTH 2YNBA 1O2YA 1BTUA 3GCHB 1NZQH 2Z9LA 3UFAA 1O5GH 2BOHB 1O33A 1XXFA 2EI8A 1JIRA 4ISHH 6CHAC 1QA7A 5DJ7A 2F9UA 2G55A 2GMTC 1NROH 1QJ1B 2OLGA 1PQAA 1ELBA 1LKBA 1AZZA 1GCDA 2GCHG 3RLYH 5C17A 4X8UH 1SKYE 3D23A 4NIXA 1ZGVA 2P93A 1LHDH 5AF9H 2A2XH 3RXRA 4ZKRU 5JBBS 3MFJA 3MOCA 1YPGH 3WW7A 4NIWA 2BM2A 2ZGBH 3M3SA 2CN0H 1BDAA 3D62A 4QT8C 2FOGA 3P8GA 2J5UA 3RXLA 4GSOA 4INHA 1AMHA 1D3QB 1AFEH 4RKOB 3H5CB 1FN8A 4ISLA 2H9TH 2D8WA 4TY6A 4X2WA 1UCYK 2SNWA 5AFYH 3KQ5A 4U01A 3RXPA 2ZKSA 1FONA 3LH1A 4CRGA 3KHVA 1MTUA 4X6NA 1THSH 1A2CH 3LDXH 4CRDA 2OBQA 1TLDA 4MPVA 1T4VH 1MTSA 4BNRA 4AYYB 3TVJB 3STIA 2ZP0H 7GCHF 2BD3A 1DITH 1O3IA 3E8LA 1AZ8A 2FP7B 2GV6A 5DP7A 1MABB 1NRRH 2QN5T 3DSGA 1OKXA 3M5MA 4ZAEA 1AB9B 2D26C 2ZG0H 1V2RT 4X1QU 1LQEA 4ISIH 1G2MA 1ZPCA 1C2IA 4Y7AA 1DXWA 2EC9H 1YCPH 1UHBA 2JKHA 1SGFA 2ZWLH 4OS1A 4AX9H 3TJUA 3RP2A 5FCKA 2ZDKA 2IPQX 1FIZA 4GVUA 1LTOA 2WPMS 4ABFA 2BVXH 5A09A 5F8XA 1Z1IA 1AE5A 3T29A 2HWLB 2OD3B 3MWIU 5ESTE 5B6OA 1W7GH 1K1NA 1HAVB 5C1XA 3KNXA 1UTOA 3BTHE 3LONA 1C5SA 5HYOA 1SQRA 3RXMA 1UTKA 4YXWD 2XWAA 3SN8A 2YMSD 2AS9A 2R2WU 3SNAA 1FY4A 1WV7H 1C4U2 2KCAA 3ENSB 2AGEX 1UTMA 1CU1A 1K22H 4ZXXH 2KAIB 1CHOG 1C5UA 3BTDE 2OCVB 1A7SA 1CGIE 1NRQH 5GCHG 2W26A 1DX5M 2ZEBA 4IGDA 1HAHH 2YNAA 2ZECA 5CMXH 1AN1E 2FOHA 1W0KD 2UUKB 2AERH 4IMZA 3M7TA 1M9UA 2XNDD 1TGCA 1NTPA 1GBEA 2ZFSA 1C5OH 5A0AE 1EP5A 1D4PB 2A5KA 2XWBI 1DY8A 1O2PA 5C5NA 4NFFA 1YPKH 1H4WA 4KP0A 1RFNA 1AI8H 2W7SA 3SGBE 5DGJA 1TGNA 7KMEH 1UCYH 3A8AA 4ZUHA 4WVPE 1Y5UT 3F68H 1QJ7B 1JRSA 4XD7D 1P2OA 2Z94A 4ZKNU 1IQFA 1JMOH 3HGNA 3SU5A 1OWDA 5DN6D 1RS0A 2TRMA 3LIWA 1YYY1 1N6XA 1OWIA 4R0IA 1EOLA 3VPKA 1DANH 1EZSC 3EAJA 3UWJH 1SLXB 1A46H 3LC5A 1SL3A 1Y3XA 1F0SA 3NRLA 3HK3B 2JH6D 1SGFG 3BTTE 4D7FA 2ZDLA 1LHEH 3AW1A 3I78A 4MNXA 1SOTA 2VVVA 3FN8A 2SGFE 3B8JA 1YPJH 4IN1A 2QA9E 4I8HA 2FYRA 1IQMA 5EIYA 1VITH 1ESTA 1KLTA 2BDCA 4UFEH 1QL8A 3A8CA 1BTWA 3O8RA 1GI6A 3UWIA 1AKSA 1RD3B 4CH8B 2ZHEH 1EATA 1FUJA 1HLTH 1GBTA 3GDVA 1V2VT 3ZZ5A 3MNSA 1K9OE 4OS6A 4RN6A 4JMYA 1T8LA 2ZDNA 1WTHD 3SNBA 3ZZ3A 2XBYA 1L1GA 2BDBA 2VWMA 3PTBA 1ZMJA 1BBRE 1CT4E 1QZ8A 1BTXA 4ABAA 3BEFB 3SZEA 3IWMA 4TPYA 2OQUA 1J8AA 3AASA 1HB0B 1C2MA 1TGBA 2XC5A 3VB6A 1BUIA 4CR5A 3NK8A 1DM4B 2WV4A 4MLFB 1O2KA 2GDDA 1BHXB 1WAYB 1LVBA 1Y5BT 3RXHA 4A92A 2R9PA 2Z6BD 3KF2A 4ZH8A 2EA3A 3BTWE 1HGTH 2UUJB 2AMPA 3SUDA 4XBCA 4E7RG 3S9CA 3TGIE 4ZCNA 1OWEA 4GAWA 1UVPA 2XOKD 2HOBA 4O3UA 3FVFB 3UR6A 2G5NA 1B0EA 5EOKA 5CHAB 2J9NA 1UK3A 1O3HA 3LGWA 3SJ8A 1GBBA 1DDJA 4TSFD 1C4V2 1S85A 2WUBA 1HBTH 1GGDB 1YLCA 5CHBA 3DA9B 4Q2KA 3MH5A 1BRCE 4B71A 1G3EA 1AUTC 1ELDE 2ZNKH 5AHGH 1SLVB 1TIOA 3ZZ8A 1GDUA 5HIZA 9ESTA 3HATH 5E0JA 4H6SB 1ELAA 5GDSH 2ZDMA 2BQWB 2G51A 2ZA5A 2QC2A 2BY5X 2HNTF 1K21H 3ZVEA 1TA6A 2FTMA 4XFQA 4LZ4B 4WMFA 5T6DA 4AFUA 1C5VA 1S5SA 2IJOB 3MH4A 4E7NA 1EJMA 1DXPA 1JWTA 5FHTA 2BYAX 3ESTA 2ZF0H 2VIPA 2Y5FA 3M61U 1S6LA 2OP9A 2VH6A 2ZGJA 4JYUH 1NFYA 2CHAB 1L4ZA 1EX3A 1P2QA 2OQ5A 1XUHA 5C1UA 1GL1A 3ZVCA 1LO6A 5J4SA 5EQSA 3ATLA 1NT1A 2GCHF 5DP9A 1H1BA 1ELVA 1MBQA 2ZGHA 3OX7U 5CHAC 2OK5A 3E90B 3VXFH 1PPHE 5L2YH 3A87A 3IITA 1UVOA 1XUIA 1Z8GA 2CK3D 1IQGA 3RU4D 4IMQA 3MNBA 1MTNC 1V3XA 4FUEA 1GGDC 4RKJB 5L6NH 2BX4A 2Y5HA 2I6SA 5L2ZH 4GHTA 3MNXA 1UTJA 2Y5GA 1HV7A 1P2JA 1AFQB 3PLBA 1OYQA 3ZYEA 4HZHA 2V35A 2HNTE 2FZZA 3MHWU 4AZ2B 4B73A 5JBAS 3U8OH 1GVZA 1W8BH 1BITA 2P8OB 1ZSJA 2OC7A 1T8MA 1O30A 1BA8B 5C5OA 1SFIA 4JZIA 3RXOA 1GPZA 3F0OA 1EAIA 2JH5D 1K2I1 2A0QB 3V0XA 2RDEA 1SGYE 1XKAC 1SSXA 1UTNA 2Z9JA 4THNH 2J4IA 4YOIA 1B0FA 2HPQH 2CHAC 4X1NU 4DG4A 2QYIA 1G3DA 2JIZD 1P01A 5E2PA 1F5LA 3GY6A 5T6FA 3LGTA 2RA0A 2OBOA 1SGDE 1SOZA 2EY4C 2LP6A 4Y0ZE 1EAUA 2G52A 2IJD1 4NZLA 2VIVA 1D3PB 1EZUC 3TJNA 1EPTA 3BTGE 3O8BA 2P3FH 1GI4A 1TNJA 1C5WB 3MI4A 3KQCA 2PSXA 1MQ5A 3TPIZ 2HALA 3P17H 1O3FA 1AWHB 3QWCH 3ZZBA 4TPIZ 3ZZAA 3R3GB 3TJOA 1GWAA 1ZTKA 4R8TB 4YT6H 1MU6B 1AFQC 1AVGH 1KDQA 3ZV9A 4DY7B 1ZMNA 1HJ9A 3LU9B 4UDWH 2BD5A 2BZAA 1F0UA 1LKAA 1OPHB 2RFKC 2ZDAH 2F9PA 3EYDA 3UREA 3BIVH 2FOMB 4BXWA 2VWNA 2P8OC 2Y7ZA 4BOHA 1CHOF 4CH2B 1EOJA 1F92A 1XUFA 4ASUD 1O2LA 1HRTH 4AFZA 5GCHF 1C4Y2 3GY3A 1KIGH 1N6YA 2JDID 1ZGIA 1C1NA 2THFB 4MPUA 1SGTA 1ZHMA 3KIDU 4WWYA 3E0PB 2VIOA 1YLNA 3FZDA 1AIXH 1W0YH 2TGTA 3URDA 4ABEA 4DIIH 1BMFD 3ZVBA 3RXSA 2SGAA 1HAIH 2ZPSA 4P00A 4IC5A 4JYVH 1V6DA 4FUIA 1YPHE 2GD4B 1SPJA 1GMHG 2ZFQH 1H8DH 4Y71A 1QB6A 2J92A 4UFGH 4XE4A 5C0UA 5A0BA 2OUAA 1FPCH 1TMBH 1HAGE 1FXYA 3PLKA 3NZIA 2ODYB 4NIYA 3Q3YA 2IN2A 4DCDA 1P10A 1YLDA 1QHRB 2ESTE 2QF4A 4INKA 4A1XA 1S6FA 3SI3H 3LGYA 3OTPA 1MCVA 3SU6A 1W12U 2BD7A 1W0JD 1GHBG 5HM2A 3UTUH 3A8DA 3E16B 2BQ6B 2BY9X 6LPRA 2R2MB 1HIAA 2C4FH 3RM0H 5ESBA 5FAHA 1NN6A 3SJOA 1AGJA 4NSVA 3KCGH 2F83A 5C2ZA 1HAOH 3MO6A 2ZFFH 4GUXA 5EG4A 1SVPA 3N7DA 3EDXB 4KTCA 4UE7H 2QXGA 4NSYA 3F1SB 3BN9A 1S84A 1TGTA 3S0NA 1WSSH 1SR5C 1FX0B 4Y8YA 1THRH 1OP0A 2PKAB 1SI5H 2Z9KA 2W7UA 4K2YA 1AY6H 2WINI 2W3IA 1W2KH 2FX4A 1XX9A 3FKSD 2NU4E 1C5ZB 1ARBA 1DY9A 3P8NA 4Y7BA 1TOMH 4JZFH 1TNIA 4I86A 5IK2D 1SQTA 2ZU5A 1WXRA 4YZUA 4B76A 1QJ6B 2WV5A 1EAXA 3BIUH 1FPHH 1EB1H 1O2ZA 5T6GA 5EJ1A 1OP2A 2WHXA 4M7GA 3S7KB 4AGKA 1ZMLA 1FZZA 1KXFA 4RSPA 5GJ4B 3DT0H 3RDZA 4AGJA 3PV4A 3SORA 1HXEH 1DLEA 3Q3XA 4FETA 3BF6H 4Q4LA 4ZHAA 4B75A 1GMDG 3GICB 1Z8JB 2A4OA 2H6MA 2M2AA 3BTEE 2F43B 1FY5A 2TGAA 1P04A 3RXCA 3DSOA 4FU9A 2ODQA 3RC6A 4DW2U 4IN2A 2GKVE 4B1TA 4A1TA 5T1VA 5C67A 1C5RA 1P09A 1A5HA 4MDSA 3EE7A 2F3CE 2A7CA 4X2VA 2ZO3H 1C1TA 1F0TA 4NGAH 4I8KA 5DKMA 1VCWA 3H7TA 2J98A 1RTKA 1A0HB 1LVMA 1P2NA 1T31A 1ACBE 1AQ7A 1DE7H 3EE0B 2XNIA 5EXMA 4BAKB 2ZTZA 2BY8X 1VCQA 2R0KA 2J34A 2IPHA 4MNWA 3QZQA 4MPXA 1F7ZA 1Q3XA 1ANDA 5HGGA 1PYTD 2B5TB 1E34B 2Y82A 2GV7A 1O2HA 2TIOA 3QN7A 1XKBC 4D8NA 1O31A 2WPKS 1SGRE 1VCPA 2H5CA 8GCHG 2OTVA 1O5CB 3ODFA 3GYLB 1TBQH 1ELGA 1UTLM 3RXQA 1BJUA 4AB8A 1TNHA 1MKXH 1P03A 4IS5A 3ZVAA 2AEIH 1TA2A 1BIOA 4ABIA 1G30B 2QGRA 4FUFA 4B6FA 2ZCHP 2VIQA 3LJJA 3P8OA 2PSYA 4X2YA 1NFXA 2FOEA 1GJ4H 2KM0A 3PV2A 3KGPA 2XRCA 1DSUA 2H2ZA 4DVAU 2Y80A 1J9CH 1HXFH 3M36A 3MU4A 5IDKA 1GBJA 4RT0A 1Q2WA 2VNTA 5E0GA 1H9LB 2Y7XA 3A84A 3VFEA 1B7XB 1G32B 1P3CA 3I77A 1TX6A 1GHWH 2KCYA 1IOEA 3AK5A 2A1DB 3M7QA 4MVNA 1BMAA 1QL7A 4Q7XA 3VB4A 2B0FA 2CF8H 4HFPB 4D7GA 2FI3E 3DFJA 4NWLA 3ZZ6A 3BG4B 3BTFE 2FTLE 2ASUB 4LXBH 1G9IE 2QAAA 1RTFB 4VGCB 1OP8A 2EI6A 5DP6A 2EEKA 3LPRA 4E06H 5HM9A 1ELCA 3BTME 3EGKH 3F9EA 3UNSA 2ODPA 4O97A 1HAXB 3TU7H 1O3CA 3CENA 3RMLH 2QF0A 1NY22 1MUEB 3STJA 4OGXA 2FOBA 1GJ6A 2A45B 2PUXB 1DWDH 2PHBA 2YOLA 3M5LA 1O3JA 4JZDH 2ZFRH 2BD2A 2ZFPH 3TJVA 3E91A 4Z0KA 2F9OA 2TGDA 3SO3A 2C8WB 3FP6E 1K1JA 1J17T 3LT3A 2V7QD 2ZCLP 4ABHA 3UOPA 1Y3YA 2ANKH 1E36B 2PTNA 2L6OA 1QCPA 2NU0E 3RXAA 3KQBA 2JJ2D 1OSSA 1S0QA 3PMAB 3KQDA 1TYNA 1D3TB 4WJG2 1NBME 4ESTE 4FVBA 4FUCA 2PP6A 3MTYA 2WYGA 4KTSA 1EPTC 3FP8E 1WYKA 2Z9IA 1H9IE 2EQNA 1LPKB 1UTQA 1V2MT 1XUKA 3BG4C 2A5IA 1CQQA 3RMOH 2GX4A 2ZQ2A 4VGCC 4BANB 5AVDA 2JJ1D 3V7TA 2UWLA 3H09A 3RM2H 1T7CA 3MH7A 2BDGA 2J94A 1AWFH 1C2LA 1C5LH 1GI8B 3SGAE 2ZU3A 2OINA 8LPRA 4NWKA 1BBRK 1DPOA 1W3CA 3MNCA 3T25A 3E3TA 4AG1A 1BJVA 3JZ2B 1C1MA 6GCHG 3ATIA 1C1PA 1EZXC 1RRKA 1LHFH 2V3MA 4ASHA 4ZXYH 1UK4A 1G2LA 1QL9A 1GJBB 1HJ8A 3RMNH 2UWPA 4ABJA 3T27A 3HK6B 1GDQA 3SGQE 3VG8A 1L1JA 2BHGA 1EJAA 1GMHF 1IHTH 3MH6A 3UR9A 1BRUP 2A5AA 5DG6A 4X8TH 5A8XA 1VKYA 3SW2B 1V2OT 1IQLA 1FY1A 3LKWA 1RJXB 3F9HA 4AG2A 4NA9H 3AW0A 3A80A 5DP5A 1BOQA 3QTVH 1RTLA 1KSNA 1C5YB 1G36A 2HNTC 3A7TA 4Y10E 2LNCA 3RXVA 1SBWA 2F9BH 2WPLS 3OSYA 1JRTA 2WZQA 1MTWA 5KGOA 1GHBF 2PGQB 1DWBH 3SOSA 5K7RA 1ZJKA 1LMWB 2BQ7B 2A4GA 1FN6A 1GBAA 2Q1JA 1PFXC 4OM9A 4CBNA 4DURA 4FOUC 1AU8A 1TX8A 2D1JA 1FMGA 3BSQA 4WH6A 1GI1A 1W0ZU 3ZVDA 2D2DA 5I46H 2O9QA 3FP7E 4JZ1A 3MMGA 4KKDA 2FDAA 3RC5A 1IQNA 1F5RA 1MZAA 4OS4A 2Q6FA 1SFQB 2Y6TA 3T5FH 3TH3H 4BXSA 3ODDA 1O2GH 2BY6X 3GCTG 3PRDA 1YM0A 3B23B 2ZGXH 3QO6A 5DP3A 3LOXA 2WPHS 1O3DA 3S69A 2ZPQA 2FWWA 1BMMH 2ZGCA 1Z8RA 1NRSH 3G01A 1MTNB 3RXIA 1C1WH 3U28C 1C5PA 1LDTT 5I25A 1YF4A 5EXLA 4F48B 1OHHD 3E1XB 1LHGH 5H4IB 1PYTC 1C2EA 1G3BA 3GY5A 1ZZZA 2SFAA 5AFZH 5HIYA 4JYTA 3M5OA 2VU8E 1BZXE 1CBWB 3PWBA 1A4WH 4NIVA 1GMDF 1O5DH 3N7EA 4X2XA 4IW4E 4BAHB 3RXGA 3R0FA 2W6JD 1O3PB 2FIRH 4A7IB 1BBRH 4FUDA 1VGCB 1BT7A 1K28D 1FY8E 3FOAA 3I29A 3NKKA 1MD7A 1VZQH 1C5MD 2FXRA 4ABGA 5G4BA 2KCPA 1ZTLA 3QGJA 1TRYA 2NU1E 1O2IA 4Z6AH 3P95A 1KLJH 1ELEE 2FMJA 1GL0E 4YLQH 3RC4A 1KXAA 1GHYH 1O3NA 1QTFA 1PPBH 1O2WA 5JBCS 3ATMA 4ZKOU 1T8NA 2C8ZB 3PRBA 1YPHC 1NM6A 2BXTH 3GY4A 1NBMD 2FM2A 1PQ8A 4B2AA 1IQEA 4TT3D 4I31A 1CA0B 1DFPA 1TPAE 3O8CA 3FZZA 1HAPH 3GS9A 4YOGA 1O2TA 2VVCA 4O03A 1C2HA 2R3UA 8ESTE 2ZFTA 3HPTB 8GCHF 3BTKE 1TNKA 5FCRA 4WMDA 1UHBB 3K9XB 1SMFE 2QF5A 4K1SA 4U32A 2BTCE 2QXIA 1QQUA 3M3TA 2SGQE 1FDPA 1TONA 3W95A 1SGCA 3A89A 4GCHG 1FQ3A 1BMNH 1VITG 3GDSA 1CBWC 3U8TH 2J2UA 2ZPRA 1UW7A 1P3EA 2H9HA 2RDLA 3BTQE 4J2YB 2G8TA 1F5KU 2B8OH 4TWWA 1P9UA 1F2SE 2AH4X 1VGCC 2J38A 3SU4A 1GHAG 2QV1A 3PO1C 3ZZ4A 3F9FA 2STAE 1Z71A 1ZYOA 2H1UA 1XUGA 3RXBA 2VGCB 5C1YA 2PW8H 1THPB 1C9PA 2UUFB 3SV9A 3GY7A 3UIRA 3D65E 4HTCH 1TAWA 2BXUH 4MNVA 3VGCB 1XVOA 3TH2H 3ZYDA 4X8SH 4CBOA 2I6QA 2O8UA 2DUCA 1A0JA 2OC1A 1TWXB 3URCA 4A1VA 4WMEA 3TK9A 3DUXH 4ZMAH 1CA0C 1A5IA 3DFLA 4X6PA 4D76A 2SGDE 3CS0A 1TOCB 5FX5A 1O38A 1MD8A 3EA9A 1GHVH 4Y79A 2JETB 1KYNA 1BHXF 3BG8A 2Q6GA 4H6TA 7ESTE 3TGKE 1WUNH 1Y8TA 4BTUB 5L30H 1FI8A 3HKJB 1X7AC 4Y6DA 1Z6EA 1C1UH 2TBSA 1S82A 1ZOMA 4E05H 1H8HD 1AO5A 1MTVA 2GT8A 1FJSA 1O2XA 1SHHB 3A81A 1EXFA 1YBWA 3A8BA 1EASA 1J15A 1QQ4A 2K8IA 2QY0B 3RUOA 3PM3A 3PYHA 2Z9GA 2HLCA 3SNDA 2GZ9A 1B5GH 1COWD 1HAVA 2VGCC 1MBMA 3ZZ7A 2HGTH 2UWOA 2LPRA 1QBVH 1ETSH 1ETTH 1ZPZA 1ZRBA 5LPFA 5FPYA 1PQ7A 3A86A 3UB0A 3VGCC 5F03A 3U1IB 2BLWA 1MKWK 3SI4H 3SJIA 1GI2A 1P06A 3UUZA 1AKSB 3RXDA 1Z8IB 2XXLA 5ABWA 1U6QA 2KX4A 1SQAA 3D49H 2FEQH 3PMBB 2KAIA 3L3TA 3LGIA 1O2MA 2GZ8A 2BD9A 1EFRD 1KXBA 2VINA 3BEIB 4K1EA 1V2KT 4TY7A 1G37A 4JK5A 2A4QA 1ELTA 1O2VA 5F8ZA 3SU0A 2JETC 4RT1A 1GI9B 3QUMP 3MU5A 3GCOA 1SGNE 3KQEA 1FAKH 4MPWA 5C0TA 6GCHF 1TNLA 3U98H 1SGEE 2VH0A 1IQIA 1K1IA 1PPFE 1TPPA 2SGPE 2AYWA 3K6YA 1P2KA 4I8GA 1EKBB 2P3UB 3M3VA 4TWYA 5EJLA 1DT2A 4UONA 3GCNA 1GJ5H 1SC8U 5C94A 4OS7A 2OXSA 1ANEA 2AMDA 2XC0A 2PFEA 1MMJN 3FANA 2ZCKP 2ZU4A 2WPJS 3EA8A 1N8OB 4I8LA 2HRVA 2QE7D 1RIWB 1H8IH 2KR7A 2FESH 2L74A 3ZV8A 1PQ5A 9LPRA 2BB4A 5DO4H 1SQOA 3A7XA 2PV9B 2FLBH 3SNEA 2ZU2A 1MAYA 4CRAA 1E1RD 1GBIA 1TB6H 4INLA 4NA7A 1ABIH 3UNQA 2WPIS 1EP6A 1QURH 1DS2E 2VWLA 5TCAA 4Q80A 4XBBA 1TPOA 2A32A 2ZTXA 3S9AA 1O32A 5LGOA 1W7XH 3KN2A 3FO8D 3S9BA 1S81A 1NU9A 3A82A 3GCTF 1Y59T 5EU8A 1YCPK 2TGPZ 1HNEE 3ZIAD 1NC6A 2Y81A 2O8LA 5HKKD 2ZC9H 1V2ST 4DIHH 1P2MA 3F2GA 2DE8A 5FBEA 1DWCH 1BRBE 1MKWH 3A88A 1V2NT 2BD4A 1WCZA 1C2KA 4FXGH 2ZI2H 1P8VC 2CV3A 1V2TT 4ZHMU 3FFGA 4BTTB 5DK1A 1HAYB 3PTNA 4J1YA 3OE7D 4X1PU 4CRFA 1TNGA 2F9NA 1N8OC 3RXKA 3U1JB 1S0RA 3W1EA 1EUFA 5EGMA 1OYTH 4Q63A 1SLWB 4KTUA 4Y11E 1HUTH 1RIWC 4Q7YA 3E6PH 1F0RA 3C1KA 1G3CA 1NESE 3AAVA 3ATWA 4O9VA 1QRXA 3SQEE 1O3OA 1P9SA 1SGPE 3OAAD 3SUGA 3SHCH 3U8RH 4UD9H 3FAOA 3SU3A 1KTSB 1A1RA 2F91A 2F4LA 2ALVA 2VVUA 4GPGA 4Y0YE 2WUCA 1K1LA 1TBZH 2P59A 2AHME 4CRCA 3QX5H 1BTYA 3KL6A 1C1VH 4H42U 4YOJA 4U2WA 2R3YA 3K65B 4B6EA 3ZVGA 4O3TA 1T32A 3M35A 5C20A 2BZ6H 3TNTA 1JIMA 2PLXA 3P70B 4LK4A 3VB3A 1WQSA 1C1RA 4Y76A 2BDHA 2KCOA 5ETXA 2R0LA 4BAOB 1VJ9U 1ZPBA 3LC3A 4XBDA 1LHCH 2C93B 1FIWA 1SG8B 5F6MA 5EQRA 2FI5E 1GJ9B 4X1RU 2H5DA 1E1QD 2FODA 4X1SU 4XSKU 2B9LA 2G81E 2RCEA 1Z6JH 1BTHH 5PTPA 2A31A 2C3SA 3UOUA 1O2QA 1O3MA 3VB7A 3DCLA 5LH8A 2FS9A 2AMQA 1EPTB 1EZQA 5JBTA 4A6LA 1OWHA 1EAWA 2XC4A 4CREA 3ZZDA 4GCHF 1VITF 4MG3A 4X6MA 1XMNB 2Z3CA 2C8XB 1ARCA 3CNRA 3QTOH 1K0HA 2OC0A 1SGIB 3NUMA 2VBCA 3JZ1B 4NA8A 1O5AB 3TNSA 3GCHC 4FVDA 1GHAF 2F9VA 1CT0E 1LCYA 2K0QA 1Q31A 4MTBA 3PLPA 4WH8A 1ZSLA 1KDQB 2RA3A 4LOYH 4AORA 1XXDA 2A2QH 1Y3WA 1TRNA 1L4DA 2BLOA 2UUYA 1UCYE 1UVSH 3TIUA 5CDFE 1TRMA 3H7OA 3LJOA 1GMCG 2VIDA 4F49A 3Q77A 1TABE 1C5XB 3UPEA 1CGJE 3WWFA 3A7YA 1QB1A 1E35B 2G00A 2FYQA 4ABDA 1WOFA 3DSPA 1GVLA 1CE5A 1BCUH 4U30A 3A85A 4OGYA 1P57B 1Y3VA 1YCPM 4DT4A 1LPZB 1OOKB 4FUBA 2OC8A 2V3OH 2PKSB 2BOKA 4D9RA 5KEDA 1C9TA 1GHZA 2HVXA 3OTJE 1Y5AT 3U9AH 5HMAA 1VR1H 1DSTA 1YGCH 4GHQA 1MAXA 2A7HA 1JOUB 5HXFA 2FX6A 3K6ZA 1C2DA 1GBLA 5EPNA 1YKTA 1QB9A 1VJAU 1KY9A 2STBE 4TYDA 2ZQ1A 3SZNA 1FAXA 1GBHA 2J95A 2XCNA 3DHKH 7LPRA 1KLIH 2XYAA 1K1OA 4LZ1H 4FU8A 4K8YA 1AB9C 2V0BA 1TMUH 1GHXH 2WV9A 1UJ1A 1PPCE 3PMJA 4K69A 1AUJA 1HIAB 3T28A 1GBCA 2ANMH 2JH0D 5TJXA 4DOQA 1TMTH 3Q3KA 3F3BA 1BQYA 3RU4E 4B2BA 4F55A 1OS8A 5FL7D 5A8ZA 4OS5A 3MQKC 3M37A 3TITA 5FPSA 1UTPA 4CHAB 4AC9A 2AGIX 4YO9A 3UQVA 5LPRA 2BVRH 3O8DA 2PGBB 1TALA 2P94A 4WXIA 1JXPA 1W11U 3LGVA 3GY8A 4M9FA 4SGBE 1ANCA 3ZZCA 1DUEA 1TFXA 1RXPA 5FX6A 2PKSC 4UEHH 1TPSA 1C1OA 3SUEA 1O2SA 1A0LA 1OXGA 1UK2A 4I8JA 2XBWA 2GJGA 2CMYA 1W13U 3UNRA 3ZZ9A 4XOJA 1ESAA 1Z1JA 2ZZUH 1GBMA 4YT7H 1SGQE 1BB0B 2PUQH 3F2HA 2W3KA 3VEQB 4K5ZA 1OWJA 5JB8S 4DJZB 3PWCA 1GI0A 2BLQA 2GGVB 5E2OA 4DGJA 1QBOA 5KECA 1V2WT 4YESB 5E0HA 2BD8A 3F6UH 5CE1A 3W94A 2GP9B 1O2NA 1QFKH 2G5VA 3SQHE 4ISOA 5FBIA 1H9HE 2AIQA 2ZHFH 2CGAA 2ZU1A 1QBNA 2J98B 1IAUA 2CF9H 4BAMB 1O5BB 3V13A 1ZHRA 2BVSH 1CHGA 3SV8A 4CHAC 3RXJA 1GJDB 2AGGX 2FOFA 1ZHPA 4JK6A 4KELA 1O5FH 4AOQA 4IC6A 1C5NH 1O3KA 4X8VH 1ZJDA 2HPPH 1P12E 2ALPA 3LH3A 1CGHA 1CVWH 1P02A 1MZDA 4I33A 4NG9H 1O39A 1ZR0A 5EQQA 2FI4E 2PKAA 1GI7B 2LELA 4Y8ZA 4I7YH 3IG6B 3OU0A 5JPMH 2V6NA 1O37A 1QGFA 5EW2H 5DPAA 1QNJA 3PB1E 2NU2E 1DWEH 2O8WA 3MO3A 4FU7A 4WY3A 1QR3E 3UAIC 1KXEA 1BTZA 2J97A 1UO6A 4BTIB 1T8OA 3HGPA 3PO1B 1YP9A 3V3MA 1D6WA 1GG6B 1TE0A 4UFFH 1EQ9A
chains in the Genus database with same CATH topology
2Z7FE 1XM1A 3TK5A 1P0SH 1TQ7B 2RG3A 3BEUA 4NZQA 4X6OA 3Q76A 5C3NA 1HFDA 1ZRKA 1D6RA 2QXJA 1C1QA 1D9IA 2XBVA 2ZHWH 3GISB 2VJ1A 3TGJE 1NRNH 1MU8B 2C8YB 4XDEA 1Y3UA 1GBDA 1V2QT 2SGEE 1W10U 2Q6DA 3SU1A 1MQ6A 5K0HA 1ORFA 5EODA 3SNCA 1ETRH 1ZSKA 1WQVH 1P11E 1O3LA 2ZDVH 1IHSH 1O5EH 2FS8A 1C2JA 1NFUA 3ITIA 1LVYA 1D3DB 3F9GA 1O3BA 2QCYA 4ZKSU 1FNIA 5IYTA 3NXPA 2ILNA 1AD8H 5A8YA 1YPEH 5SGAE 2P3TB 1QRZA 1DOJA 3M5NA 1O3EA 1A5GH 1GVKB 1GJ8B 2BDIA 2V3HH 2IOTA 1C1SA 5DP4A 2M5TA 7GCHG 4IBLH 1W14U 2Z3DA 1SLUB 1V2UT 3A7ZA 4X0WU 1ABJH 2C90B 2GCTB 3RMMH 5BPEA 3NPSA 1P05A 3A83A 4I32A 1O2OA 1GI3A 1AE8H 4DT7B 1WTGH 1GG6C 1ZTJA 2XW9A 5TCCA 4K8BA 1J16A 1ELFA 3A7WA 4CR9A 5GIBA 3SJ9A 2CXVA 1NU7B 3S7HB 3QGNB 2GZ7A 1KXDA 4ISNA 1C2FA 1PJPA 4B2CA 5E8EH 3ATKA 1UVUH 8KME2 1IQKA 1GJCB 1YPLH 5LPEA 4YM9A 2EI7A 4PROA 2P95A 4HI3A 5EW1H 3WY8A 2QF3A 3SJKA 2A4RA 5A0CA 2XCFA 1C5QA 3U69H 1YC0A 2ZHDA 3UQOA 2O8TA 4A5TS 4FUJA 4K1TA 5GWZA 3M7UA 3MYWA 3SBKA 2PWXA 2NWNA 1TGSZ 1Z7KA 1EB2A 3EA7A 4UFDH 2FPZA 3ZVFA 1AVWA 3MU0A 4JZEH 1KTTB 1GCTB 1ESBA 3V12A 1L2EA 2FOAA 4FUHA 2GCTC 3SV7A 1GMCF 1GI5A 2ULLA 2FOCA 1UMAH 4HGCA 1LQDB 2AIPA 2BY7X 1BMLA 3B9FH 4BAQB 3Q00A 3GYMA 5EPYA 3RXEA 2GDEH 1P2IA 3LGUA 2CJIA 1CSOE 3RXFA 2QXHA 3T26A 2BX3A 1LVOA 1O3GA 4KGAA 3SHAH 4JCNA 1DICA 3OY5U 2BDYA 1CA8B 3TH4H 4K60A 1E0FD 1J14A 1JBUH 1DUAA 1RGQA 2GVFA 1K1PA 2XBXA 3P8FA 1K1MA 4YLUA 1PPGE 1O0DH 5J4QA 3CS7A 2NU3E 1E38B 5FPTA 1O34A 1A61H 1C5TA 2Z3EA 1EJNA 1QA0A 3A7VA 3TLOA 3NCLA 1QY6A 2ZHQH 3CP7A 1QRWA 5EXNA 1HDTH 1N1LA 2GTBA 1MH0A 3QZRA 4WXVA 1O2UA 4AYVB 3GOVB 1GBKA 1GBFA 5DP8A 3VXEH 5JYIA 2VWOA 2DE9A 2TPIZ 3NWUA 2ZTYA 4MNYA 1NO9H 1A3EH 2FO9A 4FUGA 1E37B 1TBRH 2W5EA 4MQAA 1GCTC 1GJ7B 1ID5H 1V2JT 1HCGA 2ANWA 2PR3A 1OX1A 1O3AA 1T4UH 3L6PA 1A3BH 2ANYA 1NS3A 1ANBA 1O36A 3L33A 1XVMA 3QDZB 1SB1H 2FLRH 1HPGA 4GLYA 4WF8A 3AVZA 2O8MA 4YTAA 1NPMA 3EQ0H 4NCYA 1BTPA 1CO7E 3ELAH 5A2MH 2G4UA 5FXLA 5BRRE 3P92A 1FY3A 4SGAE 1MKXK 4AB9A 1CT2E 1KXCA 5JDUB 1BRAA 1IQHA 3RLWH 2QIQA 3GDUA 3MU1A 3UY9A 1HJAB 2BLVA 2H9EH 4AN7A 2ZIQH 2XTTB 3HKIB 1AVXA 3GY2A 3PMHB 2BDAA 2AFQB 4AFSA 3T2NA 6CHAB 4ABBA 2PTCE 1XUJA 3N7OA 2GMTB 1O2RA 1TQ0B 3QK1A 5T3HA 1WBGB 5JB9S 1WU1A 4Q7ZA 1HAZB 1SHYA 1YPMH 2A7JA 3E0NB 3C27B 4B74A 2B7DH 3P6ZB 3VB5A 6ESTA 5GPIB 3BV9B 1GDNA 3OY6U 3DD2H 1FV9A 3T62A 1O2JA 2G4TA 1DVAH 1HYLA 3RXUA 3KEEA 1FLEE 3RXTA 1O35A 4F4OC 1C2GA 1L0ZA 1QIXB 1PPEE 3TK6A 1AHTH 1MCTA 1NFWA 4OS2A 3QLPH 5F8TA 2WYJA 1V2PT 1L1NA 4CRBA 4Y8XA 4NFEA 4ZROA 4AFQA 3OYPA 2K1QA 4D9QA 3RU4T 3K2UA 1OWKA 2VIWA 2P16A 2BMGB 1PPZA 1NRPH 1S83A 2SNVA 3PROA 3SU2A 5GXPA 1ZLRA 3MU8A 3SV6A 1DLKB 2GT7A 1V2LT 1GJAB 1TX7A 4H4FA 2VB0A 1IQJA 4K3JA 1HJAC 1INCA 3AAUA 1S6HA 3SUFA 1LPGB 4ZHLU 3SV2H 3MO9A 1UVTH 2YNBA 1O2YA 1BTUA 3GCHB 1NZQH 2Z9LA 3UFAA 1O5GH 2BOHB 1O33A 1XXFA 2EI8A 1JIRA 4ISHH 6CHAC 1QA7A 5DJ7A 2F9UA 2G55A 2GMTC 1NROH 1QJ1B 2OLGA 1PQAA 1ELBA 1LKBA 1AZZA 1GCDA 2GCHG 3RLYH 4X8UH 3D23A 4NIXA 1ZGVA 2P93A 1LHDH 5AF9H 2A2XH 3RXRA 4ZKRU 5JBBS 3MFJA 3MOCA 1YPGH 4NIWA 2BM2A 2ZGBH 3M3SA 2CN0H 1BDAA 3D62A 4QT8C 2FOGA 3P8GA 3RXLA 4GSOA 4INHA 1AMHA 1D3QB 1AFEH 4RKOB 3H5CB 1FN8A 4ISLA 2H9TH 2D8WA 4TY6A 4X2WA 1UCYK 2SNWA 5AFYH 4U01A 3RXPA 2ZKSA 1FONA 3LH1A 4CRGA 3KHVA 1MTUA 4X6NA 1THSH 1A2CH 3LDXH 4CRDA 2OBQA 1TLDA 4MPVA 1T4VH 1MTSA 4BNRA 4AYYB 3TVJB 3STIA 2ZP0H 7GCHF 2BD3A 1DITH 1O3IA 3E8LA 1AZ8A 2FP7B 2GV6A 5DP7A 1NRRH 2QN5T 3M5MA 1OKXA 4ZAEA 1AB9B 2D26C 2ZG0H 1V2RT 4X1QU 1LQEA 4ISIH 1G2MA 1ZPCA 1C2IA 4Y7AA 1DXWA 2EC9H 1YCPH 1UHBA 2JKHA 1SGFA 2ZWLH 4OS1A 4AX9H 3TJUA 3RP2A 5FCKA 2ZDKA 1FIZA 4GVUA 1LTOA 2WPMS 4ABFA 2BVXH 5A09A 5F8XA 1Z1IA 1AE5A 3T29A 2HWLB 2OD3B 3MWIU 5ESTE 5B6OA 1W7GH 1K1NA 1HAVB 5C1XA 3KNXA 1UTOA 3BTHE 3LONA 1C5SA 5HYOA 3RXMA 1UTKA 2XWAA 3SN8A 2AS9A 2R2WU 3SNAA 1FY4A 1WV7H 1C4U2 3ENSB 2AGEX 1UTMA 1CU1A 1K22H 4ZXXH 2KAIB 1CHOG 1C5UA 3BTDE 2OCVB 1A7SA 1CGIE 1NRQH 5GCHG 2W26A 1DX5M 2ZEBA 4IGDA 1HAHH 2YNAA 2ZECA 5CMXH 1AN1E 2FOHA 2UUKB 2AERH 4IMZA 3M7TA 1M9UA 1TGCA 1NTPA 1GBEA 2ZFSA 1C5OH 5A0AE 1EP5A 1D4PB 2A5KA 2XWBI 1DY8A 1O2PA 5C5NA 4NFFA 1YPKH 1H4WA 4KP0A 1RFNA 1AI8H 2W7SA 3SGBE 5DGJA 1TGNA 7KMEH 1UCYH 3A8AA 4ZUHA 4WVPE 1Y5UT 3F68H 1QJ7B 1JRSA 1P2OA 2Z94A 4ZKNU 1IQFA 1JMOH 3HGNA 3SU5A 1OWDA 1RS0A 2TRMA 3LIWA 1YYY1 1N6XA 1OWIA 4R0IA 1EOLA 3VPKA 1DANH 1EZSC 3EAJA 3UWJH 1SLXB 1A46H 3LC5A 1SL3A 1Y3XA 1F0SA 3HK3B 2JH6D 1SGFG 3BTTE 4D7FA 2ZDLA 1LHEH 3AW1A 3I78A 4MNXA 1SOTA 2VVVA 2SGFE 3B8JA 1YPJH 4IN1A 2QA9E 4I8HA 2FYRA 1IQMA 1VITH 1ESTA 1KLTA 2BDCA 4UFEH 1QL8A 3A8CA 1BTWA 3O8RA 1GI6A 3UWIA 1AKSA 1RD3B 4CH8B 2ZHEH 1EATA 1FUJA 1HLTH 1GBTA 3GDVA 1V2VT 3ZZ5A 3MNSA 1K9OE 4OS6A 4RN6A 4JMYA 1T8LA 2ZDNA 1WTHD 3SNBA 3ZZ3A 2XBYA 1L1GA 2BDBA 2VWMA 3PTBA 1ZMJA 1BBRE 1CT4E 1BTXA 4ABAA 3BEFB 3IWMA 4TPYA 2OQUA 1J8AA 3AASA 1HB0B 1C2MA 1TGBA 2XC5A 3VB6A 1BUIA 4CR5A 3NK8A 1DM4B 2WV4A 4MLFB 1O2KA 2GDDA 1BHXB 1WAYB 1LVBA 1Y5BT 3RXHA 4A92A 2R9PA 2Z6BD 3KF2A 4ZH8A 2EA3A 3BTWE 1HGTH 2UUJB 2AMPA 3SUDA 4XBCA 4E7RG 3S9CA 3TGIE 1OWEA 4GAWA 1UVPA 2HOBA 4O3UA 3FVFB 3UR6A 2G5NA 1B0EA 5EOKA 5CHAB 2J9NA 1UK3A 1O3HA 3LGWA 3SJ8A 1GBBA 1DDJA 1C4V2 1S85A 2WUBA 1HBTH 1GGDB 1YLCA 3DA9B 4Q2KA 3MH5A 1BRCE 4B71A 1G3EA 1AUTC 1ELDE 2ZNKH 5AHGH 1SLVB 1TIOA 3ZZ8A 1GDUA 9ESTA 3HATH 5E0JA 4H6SB 1ELAA 5GDSH 2ZDMA 2BQWB 2G51A 2ZA5A 2QC2A 2BY5X 2HNTF 1K21H 3ZVEA 1TA6A 2FTMA 4XFQA 4LZ4B 4WMFA 5T6DA 4AFUA 1C5VA 1S5SA 2IJOB 3MH4A 4E7NA 1EJMA 1DXPA 1JWTA 5FHTA 2BYAX 3ESTA 2ZF0H 2VIPA 2Y5FA 3M61U 2OP9A 2VH6A 2ZGJA 4JYUH 1NFYA 2CHAB 1L4ZA 1EX3A 1P2QA 2OQ5A 1XUHA 5C1UA 1GL1A 3ZVCA 1LO6A 5J4SA 5EQSA 3ATLA 1NT1A 2GCHF 5DP9A 1H1BA 1ELVA 1MBQA 2ZGHA 3OX7U 5CHAC 3E90B 3VXFH 1PPHE 5L2YH 3A87A 3IITA 1UVOA 1XUIA 1Z8GA 1IQGA 3RU4D 4IMQA 3MNBA 1MTNC 1V3XA 4FUEA 1GGDC 4RKJB 5L6NH 2BX4A 2Y5HA 2I6SA 5L2ZH 4GHTA 3MNXA 1UTJA 2Y5GA 1HV7A 1P2JA 1AFQB 3PLBA 1OYQA 3ZYEA 4HZHA 2V35A 2HNTE 2FZZA 3MHWU 4AZ2B 4B73A 5JBAS 3U8OH 1GVZA 1W8BH 1BITA 2P8OB 1ZSJA 2OC7A 1T8MA 1O30A 1BA8B 5C5OA 1SFIA 4JZIA 3RXOA 1GPZA 1EAIA 2JH5D 1K2I1 2A0QB 3V0XA 1SGYE 1XKAC 1SSXA 1UTNA 2Z9JA 4THNH 2J4IA 4YOIA 1B0FA 2HPQH 2CHAC 4X1NU 4DG4A 2QYIA 1G3DA 1P01A 5E2PA 1F5LA 3GY6A 5T6FA 3LGTA 2RA0A 2OBOA 1SGDE 1SOZA 4Y0ZE 1EAUA 2G52A 4NZLA 2VIVA 1D3PB 1EZUC 3TJNA 1EPTA 3BTGE 3O8BA 2P3FH 1GI4A 1TNJA 1C5WB 3MI4A 3KQCA 2PSXA 1MQ5A 3TPIZ 2HALA 3P17H 1O3FA 1AWHB 3QWCH 3ZZBA 4TPIZ 3ZZAA 3R3GB 3TJOA 1GWAA 1ZTKA 4R8TB 4YT6H 1MU6B 1AFQC 1AVGH 1KDQA 3ZV9A 4DY7B 1ZMNA 1HJ9A 3LU9B 4UDWH 2BD5A 2BZAA 1F0UA 1LKAA 1OPHB 2ZDAH 2F9PA 3EYDA 3UREA 3BIVH 2FOMB 4BXWA 2VWNA 2P8OC 2Y7ZA 4BOHA 1CHOF 4CH2B 1EOJA 1F92A 1XUFA 1O2LA 1HRTH 4AFZA 5GCHF 1C4Y2 3GY3A 1KIGH 1N6YA 1ZGIA 1C1NA 2THFB 4MPUA 1SGTA 1ZHMA 3KIDU 4WWYA 3E0PB 2VIOA 3FZDA 1AIXH 1W0YH 2TGTA 3URDA 4ABEA 4DIIH 3ZVBA 3RXSA 2SGAA 1HAIH 2ZPSA 4IC5A 4JYVH 1V6DA 4FUIA 1YPHE 2GD4B 1SPJA 1GMHG 2ZFQH 1H8DH 4Y71A 1QB6A 2J92A 4UFGH 4XE4A 5A0BA 2OUAA 1FPCH 1TMBH 1HAGE 1FXYA 3PLKA 3NZIA 2ODYB 4NIYA 3Q3YA 2IN2A 4DCDA 1P10A 1YLDA 1QHRB 2ESTE 4INKA 4A1XA 1S6FA 3SI3H 3LGYA 1MCVA 3SU6A 1W12U 2BD7A 1GHBG 5HM2A 3UTUH 3A8DA 3E16B 2BQ6B 2BY9X 6LPRA 2R2MB 1HIAA 2C4FH 3RM0H 5ESBA 5FAHA 1NN6A 3SJOA 1AGJA 4NSVA 3KCGH 2F83A 5C2ZA 1HAOH 3MO6A 2ZFFH 4GUXA 5EG4A 1SVPA 3EDXB 4KTCA 4UE7H 2QXGA 4NSYA 3F1SB 3BN9A 1S84A 1TGTA 3S0NA 1WSSH 1SR5C 4Y8YA 1THRH 1OP0A 2PKAB 1SI5H 2Z9KA 2W7UA 4K2YA 1AY6H 2WINI 2W3IA 1W2KH 2FX4A 1XX9A 2NU4E 1C5ZB 1ARBA 1DY9A 3P8NA 4Y7BA 1TOMH 4JZFH 1TNIA 1SQTA 2ZU5A 4YZUA 4B76A 1QJ6B 2WV5A 1EAXA 3BIUH 1FPHH 1EB1H 1O2ZA 5T6GA 1OP2A 4M7GA 3S7KB 4AGKA 1ZMLA 1FZZA 1KXFA 4RSPA 5GJ4B 3DT0H 3RDZA 4AGJA 3PV4A 3SORA 1HXEH 1DLEA 3Q3XA 3BF6H 4ZHAA 4B75A 1GMDG 3GICB 1Z8JB 2A4OA 2H6MA 3BTEE 1FY5A 2TGAA 1P04A 3RXCA 4FU9A 2ODQA 3RC6A 4DW2U 4IN2A 2GKVE 4B1TA 4A1TA 5C67A 1C5RA 1P09A 1A5HA 4MDSA 2F3CE 2A7CA 4X2VA 2ZO3H 1C1TA 1F0TA 4NGAH 4I8KA 5DKMA 1VCWA 3H7TA 1RTKA 1A0HB 1LVMA 1P2NA 1T31A