1C1PA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1pA02
1TPPA 1TRNA 1XVMA 1ZHPA 1ELDE 4YESB 1Z8RA 4CREA 2D1JA 1PJPA 2NU0E 3TK5A 2BXUH 1T8MA 2A4OA 1FY8E 1HJ9A 3SQHE 1O2XA 4KGAA 3ZYDA 5IDKA 1YCPH 1RGQA 3KHVA 2XWAA 1A3BH 4X6OA 2VWNA 3U9AH 3S7HB 2FODA 1LHEH 1HAGE 1HXEH 1L0ZA 3MNSA 2FTLE 3BTFE 4HTCH 3QTVH 4Y0YE 2AFQB 1MTNC 3RC4A 4YT7H 4LZ1H 1CA8B 1M9UA 2ZQ2A 4BAQB 5GCHG 1HB0B 1K1LA 3O8RA 1MU6B 2FI5E 5ABWA 2AGIX 1OXGA 6GCHG 3U1JB 1DSUA 1Q2WA 3EA9A 4IBLH 1HPGA 1C2IA 1RXPA 4B73A 1GI9B 3VGCB 2ANYA 6CHAB 1UCYH 5FCKA 3PB1E 1TNGA 1GDUA 3E0PB 1A5IA 2AMPA 2Z9IA 2VWLA 1P2IA 1TGCA 3DHKH 1KLIH 1DS2E 1TA6A 1EPTA 4X1PU 2UWLA 4D9RA 1BTYA 5JBBS 2YNAA 1P2KA 3KGPA 4ASHA 1IQIA 2WYJA 5AFZH 4JYTA 1Z8IB 4YLUA 1A5GH 1OX1A 1TE0A 3QTOH 4AFSA 1E0FD 1QQUA 1SG8B 1V2LT 5T3HA 2EA3A 3KQBA 1O2MA 1YYY1 4WY3A 3A89A 4XBCA 1EJAA 1HIAA 1YPEH 1V2QT 4Q2KA 5JBCS 3H7OA 4YOJA 2F83A 3ZVEA 3SOSA 1NPMA 5E2PA 3GY4A 2SGFE 4WXIA 4B2CA 4CHAC 1B0EA 2QXIA 3RXDA 1TGSZ 2BQWB 1SHYA 2BZAA 5TCCA 1C1OA 3KL6A 1O35A 1P09A 3SZNA 1HAIH 4DURA 7GCHF 2ZDLA 1E36B 3MH4A 3RLYH 4E7NA 3EQ0H 3V13A 1A61H 2GCHF 1TFXA 1UVPA 3GDUA 1GJCB 2THFB 2XC0A 2Y80A 2QGRA 1O3CA 1GDQA 1KLTA 2ZNKH 4LOYH 2SGEE 1K21H 1YLDA 4BAKB 5DKMA 1EOLA 2QV1A 4DIIH 1GI5A 1NESE 4K1TA 1C2GA 3M5LA 4AX9H 1P01A 1MH0A 1LHGH 5CE1A 2RG3A 4GCHG 2BLWA 5FHTA 4OS5A 3RU4T 1FIWA 1CO7E 1PPCE 2A7JA 1TBZH 2GMTC 2B0FA 1ZTJA 3MYWA 1YF4A 2CHAB 4ISIH 4J2YB 5EW1H 1OWJA 3FZZA 1GJAB 2R3YA 3LGUA 4XBDA 1AWHB 2G55A 1PYTD 1CT4E 1F7ZA 3A87A 3WY8A 3MFJA 1N1LA 3RXVA 2A4GA 1QGFA 3V3MA 4CBOA 1C2DA 1O2QA 1D3TB 3G01A 3MNXA 2BDYA 1EAIA 1FLEE 1TMBH 4Y79A 2ZPQA 1G3DA 2GD4B 2VNTA 1G37A 3FP7E 1Y3XA 4A5TS 1EQ9A 1LPGB 1ZTKA 3LGVA 2BDBA 5C3NA 3ODDA 3A7TA 3HK3B 2F3CE 3A81A 2FESH 2HPQH 3BEUA 1P12E 5E0HA 1LKAA 4E7RG 2ZIQH 2O8LA 5C5OA 3RP2A 2F9OA 1MD7A 1PPGE 1XX9A 2A5KA 4FVBA 2FYRA 3GICB 1GBLA 1C1PA 1EPTC 1FZZA 1L4ZA 4HGCA 1V2OT 3ZVCA 4AGJA 1GCTC 1PQAA 3TH4H 4ABBA 3A88A 3M7QA 1K9OE 1SGTA 4ZHAA 1UTNA 3SNEA 2F9BH 4GVUA 4RKOB 1H9HE 1SGNE 1L2EA 1P9UA 1GL1A 2G5VA 4I8KA 2FIRH 4OS1A 2OC8A 3A84A 2V3OH 3UWIA 1AFQB 1FXYA 3O8BA 1DY8A 2Z9LA 1LVOA 2Y5HA 2ZU5A 1Z6JH 2CJIA 3DT0H 3GCHB 4DVAU 3TGKE 1ELEE 2PR3A 3MHWU 1AE8H 1GI1A 1N6YA 1MCVA 1W10U 3MO9A 4NFFA 3P8FA 1QB9A 4OS2A 1BCUH 1KYNA 4X1SU 5EG4A 3JZ1B 1O3GA 5DPAA 1FN6A 1QURH 1ZHMA 4I7YH 5HXFA 2ZCKP 1HAOH 4NSYA 4R0IA 5EW2H 1YPKH 4FUCA 3SU2A 3RXBA 1T7CA 4X8TH 3B9FH 3R3GB 4JZFH 3V7TA 2HLCA 1CT0E 2IN2A 3IITA 3ZZ7A 1AGJA 4CH8B 1QBOA 1AKSB 2P59A 3I77A 5EPYA 3MH5A 4AN7A 1C2EA 3BF6H 4O03A 1BBRK 3ATIA 1D9IA 1SSXA 1ZSLA 3M5MA 1HXFH 3BTKE 4NZLA 4UONA 1C5NH 1V2NT 2FM2A 2JETC 1MMJN 1DLEA 2WPKS 1S0QA 2BTCE 2VIQA 2D2DA 2W3KA 1NRPH 5FX5A 3QGNB 4A7IB 1A0HB 3SV7A 2J95A 1ARCA 1WBGB 1DVAH 1ZMJA 3GY3A 4ISHH 2P93A 4NIWA 2G4TA 2VVUA 1C5PA 3Q77A 1UMAH 2Z3DA 3P8NA 1GBKA 1ZJKA 3M3SA 1KXBA 2EC9H 4CRBA 1AFEH 2ZGJA 2EI6A 2OQ5A 4Y7BA 1OKXA 1O5GH 1MBMA 2GT8A 9ESTA 2VH6A 4H42U 1DWCH 1MKWK 1CBWB 2OCVB 5GCHF 1MUEB 1G3CA 1A46H 1P06A 4K60A 6GCHF 1ACBE 1Y5AT 4OGXA 4ISLA 1GJ5H 4ZROA 1KSNA 1JRTA 2ZHFH 4IC5A 3SJ8A 3M5NA 2ZC9H 1OS8A 2R2WU 2CN0H 3GY8A 4IN1A 4B76A 2PKSB 3O8DA 5BRRE 1NRSH 5LPEA 1FDPA 2ZA5A 3PLPA 2W7SA 2F9NA 4ABJA 1QJ6B 3MU0A 3OYPA 2K1QA 3DD2H 1NFXA 1PYTC 7LPRA 2ZHDA 4U01A 2QXJA 1KIGH 1V2UT 3A83A 1PFXC 3M3TA 4ZXYH 1Y5BT 2Q6GA 3VGCC 6CHAC 1ZTLA 3SHAH 2C8WB 2PUQH 4BXWA 1BMAA 3PMHB 3URDA 1KTTB 3QN7A 1T8NA 1WYKA 4DG4A 2J94A 1O5AB 1S83A 3ZZ9A 1TNJA 3U98H 1FUJA 1Y3WA 1KLJH 5EQRA 2ZO3H 3URCA 3LU9B 1P2JA 1C1TA 3M35A 2ZHQH 4I8LA 2Z3EA 2TRMA 2PTCE 3GY5A 1ELBA 3PV4A 1D3PB 5L2YH 4D9QA 3ZVGA 4LZ4B 2WPHS 1N6XA 1GMHG 2FXRA 3UR9A 4ZXXH 1F5LA 5T6GA 1CU1A 4THNH 4DIHH 3F6UH 1GI0A 1QB6A 1S6FA 2TGTA 4X6PA 1O38A 1W0ZU 2UUYA 1P2OA 3RMMH 1SGRE 1V2ST 2WINI 1ZMLA 3DFJA 3T28A 4OS7A 1O5EH 1TPOA 1ETTH 1P04A 3RC6A 1O5CB 1G36A 1O2RA 2BD3A 4ISNA 3RXPA 4FUJA 3SNAA 2BXTH 1NFUA 5DK1A 1EZSC 5DP6A 4X8UH 3LH3A 3E0NB 2BD8A 1ANBA 1L4DA 4GCHF 1C5YB 4AORA 5FAHA 2R0LA 3BIVH 1K22H 1O2HA 2OC0A 1LPKB 4KTUA 2Z6BD 1U6QA 1AKSA 1ZJDA 2F91A 3SO3A 1THPB 3UOPA 5JDUB 2V0BA 3UR6A 4ABGA 5JB9S 4X2WA 1MAYA 3MU8A 1SOZA 4GHQA 1EUFA 4ABEA 1QRWA 4GLYA 1FONA 1HV7A 1Y3UA 1TQ0B 2HRVA 1ZLRA 1VGCB 4BTUB 1O32A 3LGTA 1ESTA 3RXIA 2ULLA 3LGIA 4CRAA 5JBAS 3OX7U 4JZIA 2DUCA 4R8TB 1G32B 4ABAA 2ALPA 3DA9B 3M7UA 5C67A 4YTAA 3STJA 1BRUP 1NT1A 1EATA 1GI4A 1EZQA 1Z1JA 2HVXA 2R9PA 1MZDA 4H6SB 2AGEX 2PV9B 1O2JA 2VIOA 2CHAC 5EU8A 1O2YA 2Y6TA 4GSOA 1GJ7B 3UIRA 2C4FH 4AGKA 3EAJA 4MG3A 2QYIA 3MH7A 3TGJE 1JIMA 1C5VA 2OBOA 4FUEA 2BVXH 3UTUH 5L6NH 2NU1E 1TWXB 2ZFFH 1O3HA 1C5SA 1C4U2 1GMDG 2QY0B 1GG6B 4B2AA 3BG4B 2TGAA 4INHA 1IQLA 2XW9A 4NG9H 1C2LA 4WMDA 5DP4A 1AUJA 1K1PA 3SUDA 3EA8A 2ZFTA 1MKXK 1OYQA 2FOEA 3UFAA 3SU6A 1C5WB 1DUAA 1BRAA 1O30A 4RKJB 1GI7B 4BXSA 1XMNB 1A5HA 4YO9A 1BTXA 1C1RA 1BJVA 1GVKB 1FAXA 1ARBA 2FTMA 3BTHE 1N8OB 1O2UA 1A3EH 2ZGXH 3BTWE 1TRMA 3HPTB 2HGTH 3L33A 3T29A 1ETRH 3LOXA 1LHCH 1ORFA 1EP6A 3P6ZB 1JIRA 3SI4H 5FBEA 3FVFB 1BMNH 4BANB 1HCGA 3HGNA 3P8GA 1ZMNA 3LPRA 1ZSKA 3UQVA 3VB7A 1ELCA 3ATLA 4MNXA 2ZDNA 1SGIB 2ZZUH 4K2YA 3LGYA 1GI8B 1Z8JB 2ZDKA 1HJAB 4INLA 3UNQA 1FJSA 4CRFA 4AYVB 3OSYA 1D6RA 3RMOH 4NA9H 3V12A 3PYHA 1BTZA 1J16A 2P3FH 4MPUA 4Q7ZA 1NFYA 4VGCB 1AFQC 1IQJA 1V2VT 1MCTA 1GBDA 1QFKH 1TOCB 4MQAA 5DGJA 2BOHB 4QT8C 2BZ6H 3GCHC 1JWTA 4FU7A 3SNBA 3TGIE 1C9PA 2A4RA 2PUXB 1MQ5A 3P95A 5GPIB 4O3TA 2BOKA 4FUBA 2FO9A 3T5FH 3SU0A 2HPPH 2AMQA 2QIQA 2SFAA 1V2WT 1H8DH 8LPRA 3LC5A 3SN8A 1X7AC 1AIXH 3F68H 1GCDA 4B2BA 1W0YH 1FPHH 2G4UA 2H6MA 5E0JA 2EEKA 2BDGA 1GGDB 4BNRA 1IHTH 3NXPA 1NC6A 1NU7B 1OWEA 3BTME 3CS0A 3UQOA 5FPYA 2H1UA 4GPGA 3VXEH 3PROA 2PSXA 2JKHA 4YOGA 1P03A 2STBE 1HRTH 4WMFA 2VVCA 1MZAA 3A7ZA 4JZEH 2R0KA 5CHAB 1IQMA 1XKAC 4K69A 5F03A 2OC7A 1HUTH 2Y7ZA 3GDSA 2BY5X 5T6FA 1T4VH 1O3PB 2BDAA 5AFYH 5EXLA 4KELA 4Q7XA 2ZF0H 3HATH 1SGFA 1GHBG 1NM6A 5T6DA 4TPIZ 2Z3CA 1DX5M 2VWMA 3I78A 4X1QU 4X6MA 1DPOA 3LDXH 4O97A 2V6NA 4NWKA 1KXCA 2ZI2H 1CBWC 1MTWA 3PO1B 1B7XB 4YOIA 2BDIA 3TH3H 1BDAA 1XXDA 3MTYA 1ANEA 1QR3E 4Y10E 2SGQE 3LGWA 1A0JA 1W12U 2PLXA 2ZDAH 2LNCA 1SR5C 4DCDA 6ESTA 3GCOA 2PKSC 2BQ6B 3AAUA 4FVDA 3TK9A 2UUJB 4X6NA 2VGCB 3TJOA 4A6LA 1JBUH 1UVSH 3SU4A 1EX3A 1O34A 1TMUH 2ODQA 1LQEA 1S5SA 3V0XA 4YM9A 1C1VH 2ZHEH 3UPEA 2ZGBH 1WQVH 5GWZA 1TA2A 3O8CA 3E3TA 5GXPA 3HKJB 4XOJA 4TPYA 1SGDE 1C1QA 1GHVH 3QX5H 1ELGA 2M5TA 1C2KA 3QO6A 1CGJE 1GMHF 1O5BB 4IC6A 1NZQH 1SVPA 3MU4A 3GOVB 1VJ9U 1E37B 4ZHMU 5A0BA 2C8XB 2ZDVH 2XYAA 1C1WH 4JYVH 1DT2A 1YKTA 3F9FA 3NKKA 2OUAA 1O3BA 4YZUA 2C3SA 4FXGH 4FUHA 2FOFA 3VEQB 1Y8TA 1CHOG 1TIOA 2FWWA 2QA9E 2XTTB 1L1GA 3BTGE 1RS0A 1C5MD 1XUJA 3F9EA 1TYNA 3D62A 3SORA 4ZKNU 4CR5A 4SGBE 2A7HA 1O3OA 1O2LA 2XRCA 1O2KA 2BMGB 2H9HA 2ALVA 3IG6B 2HOBA 1BMLA 3LONA 2GDEH 1ZR0A 1CSOE 3NUMA 2A2XH 1NROH 4NFEA 4Q7YA 3QLPH 3RXJA 3P92A 4BAHB 2Y82A 5LPFA 1CQQA 2FI3E 5A0CA 2ZGCA 1F92A 2HNTF 2OQUA 5AVDA 2O8TA 3TVJB 8GCHG 3RXOA 3SI3H 1ZPBA 4HFPB 1XUFA 2OBQA 1H9LB 3D65E 2BDCA 3ZV9A 1P9SA 4AOQA 1AO5A 1E38B 5LPRA 4MDSA 1Z6EA 1T8OA 2GVFA 4ESTE 1HDTH 3MNBA 1QNJA 2NU4E 1D6WA 2VB0A 1SQAA 3AW1A 1TNKA 1S85A 1VGCC 2VWOA 1C5OH 1EAWA 1K1IA 4MNYA 3BIUH 4KKDA 3SV8A 3TPIZ 4K5ZA 1SOTA 4NZQA 2ZPSA 1GHYH 1OP0A 1W14U 5ESBA 3SJOA 2F9VA 1O2GH 3A80A 1GVLA 1O2ZA 4X2XA 1P05A 2ZCLP 2G81E 5EPNA 3U8TH 1GBJA 3OU0A 1C2MA 1QB1A 2IJOB 2BD4A 1LO6A 2B5TB 4ZHLU 2ZU4A 1O3LA 2H9EH 3NWUA 1C2FA 1SQTA 1ZRBA 2J92A 2DE8A 3GY2A 2AMDA 1F0TA 1G3BA 4ZKOU 5A8YA 1AZ8A 1FQ3A 3UNRA 2W26A 1B5GH 1ESBA 4Y8YA 1W7GH 2ZCHP 1TPSA 7KMEH 4UFDH 3RC5A 2O8WA 1HGTH 1S82A 3UREA 2HNTC 2A1DB 1GG6C 1UK4A 3BG4C 1IQHA 4X8SH 3N7OA 4DW2U 2CV3A 1SFIA 4FU8A 3A8DA 1ZSJA 2NU2E 1HNEE 3U8RH 3VXFH 4FUGA 4UFEH 1Y3YA 3LC3A 1F5KU 1V2KT 3C27B 1VITH 4CBNA 1NO9H 2OC1A 3ITIA 1NRRH 4JCNA 1AHTH 1AVWA 5A8ZA 5C20A 4BTIB 3B8JA 1O3NA 1N8OC 1O37A 1Z7KA 5AHGH 4MNWA 1OWHA 1PPZA 1O5FH 2AEIH 2FOMB 1BTWA 1TBQH 2GV7A 9LPRA 2Y5GA 3A7YA 2H5CA 3TH2H 4D76A 4BOHA 2J38A 1HJAC 2PHBA 3SUFA 3KEEA 1LHFH 2WYGA 2BLOA 5FX6A 5L30H 1TPAE 1UVTH 2FLBH 2TGPZ 1MBQA 3JZ2B 4VGCC 1KDQB 2V35A 4K8YA 2VJ1A 1BBRE 3T25A 3CS7A 2ZTYA 1DANH 3ATKA 2TPIZ 1GBCA 4NIXA 2PFEA 1O5DH 1RTLA 1ESAA 1F0RA 2NU3E 1FNIA 3M61U 5HMAA 2FS9A 3ZZ8A 1O2OA 1DWBH 1EB1H 3RDZA 1QL7A 1MTSA 4FUIA 2FX4A 2B7DH 5A2MH 1C2JA 4TWWA 5FPSA 2VIDA 1GBIA 1CGHA 2P8OB 2GDDA 5HGGA 5FCRA 2GCTB 1QTFA 1SMFE 1HLTH 2Y81A 3RXKA 1RTKA 1SB1H 5FPTA 2CF8H 5G4BA 3RU4E 1GJBB 1OP2A 3GCTG 3KIDU 3LKWA 1LTOA 2A32A 2ODYB 1BZXE 1ZYOA 1TNIA 3PWBA 2BVSH 4UD9H 3TITA 5L2ZH 1UTKA 8KME2 1THSH 3ESTA 4MPWA 3VFEA 2ZHWH 5AF9H 4WH6A 1GBEA 1GGDC 1W13U 4WVPE 3PLBA 3TJNA 2A5IA 4NA8A 2BY8X 1NRQH 3RMNH 7GCHG 4FUDA 3SJIA 1QY6A 4DJZB 3T26A 1HAHH 1F5RA 3ZZBA 1GHBF 4XFQA 1C5LH 1SFQB 1AMHA 4IMQA 1TRYA 1ZRKA 2XBVA 4CRDA 5CHAC 5B6OA 1VJAU 3QUMP 3FP8E 1TQ7B 2SGDE 4NWLA 4F4OC 1F0UA 1KXFA 5EQSA 1BRCE 1YPJH 1YCPK 3MU1A 1SL3A 3LT3A 1YPHC 3UOUA 1BMMH 4Z6AH 2Z94A 2CF9H 3RM2H 1DXWA 6LPRA 2EI7A 4E05H 3MI4A 1ZGVA 3UNSA 4IW4E 2WPIS 3KQDA 1WTHD 1V2PT 5E0GA 3M36A 5HM9A 1GJ6A 2B9LA 1FY5A 1GJ4H 3MO3A 2ZP0H 3PO1C 4HI3A 1FY1A 5CMXH 3Q00A 1ABJH 4A1XA 1QL8A 1TGNA 3K2UA 1RJXB 3A8CA 3A7WA 3A8AA 2AERH 1UCYK 3MNCA 3RXQA 4A1VA 3E90B 5DP8A 3S9CA 1KXEA 3A86A 2F9UA 5F6MA 1C9TA 1J14A 1J15A 2VGCC 3RLWH 2GZ7A 3BSQA 1W3CA 3Q3XA 1GMCG 3E8LA 1P3EA 1V2MT 3TIUA 1AQ7A 1UK2A 3SGBE 1CA0B 2BLQA 2DE9A 3EA7A 2OLGA 4MTBA 3TLOA 2RA3A 2RDLA 2Q6FA 3DFLA 2OINA 1XXFA 1CHOF 2BX3A 7ESTE 1UVUH 5A0AE 1CT2E 2NWNA 1BBRH 1ZHRA 4M7GA 1QQ4A 1BT7A 1KXAA 2FZZA 4H6TA 1DDJA 1O0DH 1T8LA 2ZEBA 1YLCA 1W11U 3SW2B 2JH5D 1GJ8B 4Y8ZA 1O2VA 1SGQE 1GWAA 1GPZA 2AGGX 1B0FA 2WUBA 2OXSA 1K28D 3NPSA 1AB9B 1KDQA 2ANWA 2EI8A 4Y11E 2XWBI 3VB4A 2J4IA 2FPZA 3ZVDA 4ISOA 3TK6A 1BRBE 3PM3A 1YGCH 2STAE 4Y76A 2J2UA 4WJG2 8GCHF 1WOFA 2ZTZA 1DY9A 1C1NA 2QN5T 1O3EA 2RA0A 2XBYA 4TWYA 4DT7B 4HZHA 5J4QA 1O3JA 3M7TA 1DWDH 1DUEA 1HFDA 3PMAB 4TY7A 1WCZA 3RXHA 1O2WA 4JZDH 1QA7A 1MKWH 3ZYEA 4Y7AA 1EZUC 1FIZA 1KY9A 2ASUB 4BAMB 1HAYB 3AASA 1TMTH 5TCAA 2ZFPH 4GAWA 5GIBA 4ZH8A 3VB3A 2BY6X 3RXMA 1P57B 3ZZDA 4ABFA 4Y0ZE 1RTFB 1O36A 5DP7A 2IOTA 4U2WA 4UFFH 1DLKB 2UWPA 4JK6A 1O3FA 4OGYA 1HAVB 1XUGA 4ABDA 5JB8S 1Q31A 2AYWA 3D23A 1IQNA 5LGOA 2Z9KA 1DE7H 3GISB 3LIWA 1RIWB 4YLQH 1GHXH 1ELVA 1NS3A 2H2ZA 2XBXA 5GDSH 1NN6A 5ETXA 3M37A 4O3UA 1JXPA 3OY6U 4KTCA 2QF3A 4WXVA 3BV9B 5EXNA 2OD3B 1OWIA 1QHRB 1C4Y2 1RD3B 2VIPA 2BD7A 2BB4A 3GYMA 1G2MA 1HBTH 4H4FA 2ZU2A 1AVXA 3STIA 4BTTB 3NZIA 1WUNH 1AU8A 4RSPA 1P11E 2BY7X 3P8OA 1ID5H 1W7XH 1YCPM 1ZPZA 2HWLB 1E35B 4K1SA 2HALA 4BAOB 1O2PA 2UWOA 1V3XA 2FYQA 1YM0A 3E1XB 4AYYB 2CGAA 2G00A 2QCYA 2FMJA 3ZZ3A 4O9VA 2A0QB 3BTDE 4AZ2B 2BX4A 5ESTE 1O2NA 2P94A 3FFGA 2FEQH 1LVYA 1AZZA 1EZXC 1TX7A 2R3UA 1OWDA 3A85A 3RXTA 3PTNA 3KCGH 1QCPA 3GYLB 3RXCA 3FAOA 5LH8A 4D7FA 3QZQA 3T62A 3BTTE 2SNVA 4I32A 1PQ7A 1PQ5A 3R0FA 3ZVFA 4I33A 1NY22 1VZQH 3RXEA 1Z1IA 4Z0KA 2C93B 4DGJA 1VITG 4FUFA 4X2VA 2AIPA 1GJ9B 2O8UA 3LJOA 3SU5A 4GHTA 1S0RA 2O9QA 1GHAG 5SGAE 3IWMA 1EAUA 3KQCA 1AY6H 1ABIH 1ELTA 4MPVA 4DY7B 1P02A 3KNXA 5HYOA 4AFUA 3PTBA 1O3KA 3VB5A 3SJKA 4K1EA 2Z9JA 1CVWH 2FP7B 1BHXB 2B8OH 1GDNA 1NTPA 4U32A 3GCTF 1P2MA 3DUXH 2A5AA 1AI8H 3EDXB 1ZOMA 5BPEA 2P3TB 3KQEA 1MAXA 2YOLA 3U69H 2VIWA 1XUIA 1EJNA 3ATWA 1EB2A 2XCNA 2P8OC 1H9IE 1EXFA 1HAXB 1LKBA 2GCTC 1H8IH 1AN1E 1THRH 1YPMH 3MO6A 1A2CH 1W8BH 4MNVA 1YPHE 3TNSA 3M5OA 5A09A 1YBWA 1XVOA 2UUKB 2W5EA 5I25A 1UTMA 2FDAA 3LH1A 4WF8A 1A7SA 3BG8A 1C4V2 1ANCA 2ZDMA 1P0SH 1NU9A 1O33A 5PTPA 2XNIA 3HK6B 4E06H 5FBIA 3W95A 4MLFB 3S0NA 1MKXH 2R2MB 1CGIE 1HAVA 3ELAH 1V2JT 2A7CA 1P10A 2FOHA 3MWIU 2XCFA 1UTOA 2FOCA 2ZGHA 3SGQE 1SLXB 3U1IB 4DOQA 4OS6A 1O2IA 2LPRA 1K1JA 1EOJA 1BTPA 1E34B 1NRNH 4D8NA 3TJVA 2WUCA 2FOBA 2ANMH 3ATMA 3T27A 3RXSA 1DM4B 1OPHB 3SNCA 2P95A 5EXMA 1SGYE 1W2KH 1SBWA 3FANA 4JYUH 1O3AA 3Q3KA 4K3JA 2QAAA 3QWCH 1HAPH 2GX4A 3SV2H 1BITA 1QIXB 4AB8A 3A8BA 3F9HA 2ZFRH 1C1UH 4D7GA 3SU3A 1UK3A 1PPBH 1QA0A 5C2ZA 2GP9B 1GI3A 1MU8B 3SNDA 3RXLA 1EAXA 4FU9A 1GMCF 1O3IA 3I29A 2VIVA 2G8TA 2Q6DA 2UUFB 1PPHE 1CHGA 3NCLA 4A1TA 2XC5A 2ZQ1A 5A8XA 2G5NA 1ZZZA 1MQ6A 1ELFA 2WPJS 3GY7A 2GT7A 1C5TA 4XBBA 1VCWA 2FI4E 1TGBA 1XUHA 1LQDB 1C5ZB 2ZWLH 4U30A 2RCEA 3GCNA 3Q76A 3FP6E 1TGTA 1SI5H 1K1MA 3T2NA 3U8OH 2FOAA 1TLDA 4IN2A 3RXFA 4ZKRU 4IMZA 5E2OA 3QZRA 1CA0C 3GY6A 4CR9A 1GL0E 3F1SB 2PKAB 1LCYA 1QJ7B 3H7TA 3SHCH 3RXAA 5HM2A 1VCQA 1AUTC 5EODA 3LJJA 3BTEE 5JPMH 4X1NU 1WQSA 2TIOA 1MD8A 2PGBB 3ODFA 1TABE 3RXRA 4PROA 2GTBA 2SNWA 1WSSH 4RN6A 2QXGA 1DWEH 1BA8B 1IOEA 1GMDF 1S84A 2A4QA 4MPXA 1Z71A 4UFGH 5GJ4B 2WV5A 3BEIB 1LHDH 2BD9A 1FV9A 3AVZA 1IQGA 2H5DA 5I46H 4CRCA 5E8EH 3ZZ6A 1HAZB 4LXBH 1AB9C 2CXVA 5DG6A 3EE0B 5J4SA 1AWFH 2GKVE 3ZZAA 4UEHH 1T4UH 1BTUA 1LVBA 5H4IB 1IQKA 2WPLS 1TBRH 1S81A 1C1SA 1GI2A 1FY4A 1YPGH 2BLVA 2TGDA 4NGAH 1SLWB 4INKA 4I8GA 1MTNB 3MMGA 1BUIA 1G30B 1Z8GA 2C8YB 2ZU3A 1KTSB 2Y7XA 1VCPA 2OP9A 4AFZA 4AG2A 3SUEA 1QL9A 3H5CB 1OSSA 4F49A 2SGAA 2BVRH 3VB6A 1S6HA 1L1NA 1FI8A 1UTJA 2FS8A 1O3DA 5DO4H 4SGAE 1JRSA 5C5NA 1DFPA 1EASA 1EP5A 1UTPA 2ZPRA 3KF2A 1FAKH 3RXGA 2J9NA 2PGQB 1A1RA 1J17T 1J9CH 1Y5UT 1QBVH 1INCA 3S69A 1GBBA 3P70B 3TNTA 1Y59T 2ZFQH 4NA7A 1CE5A 1SLUB 1GJDB 3PMJA 1BB0B 1K1NA 1TOMH 3PMBB 1RIWC 2BHGA 2BYAX 1F2SE 2C8ZB 4A92A 1D3QB 1G2LA 2QC2A 1O3MA 1ANDA 4IGDA 3SQEE 2JH0D 2GZ8A 1ETSH 4I8HA 1FPCH 1PPEE 5C1YA 2PSYA 5F8ZA 1DITH 2V3HH 1D4PB 3PLKA 2VH0A 2TBSA 3K65B 1TALA 3CENA 4X0WU 3K6ZA 1XM1A 2ESTE 1LMWB 4J1YA 4NCYA 4AB9A 3P17H 1Q3XA 3L6PA 5C1XA 3BEFB 1LDTT 1LPZB 3K9XB 4CHAB 2A45B 1RRKA 2SGPE 1FMGA 3S9BA 4IS5A 4XDEA 2P16A 3K6YA 4AG1A 1BHXF 1L1JA 3ZV8A 1D3DB 1P2NA 8ESTE 1T32A 3ZZ5A 2PWXA 3VPKA 3SBKA 5K0HA 3ZZ4A 4JK5A 2GGVB 1OP8A 2KAIB 1TNHA 1VITF 2D26C 4LK4A 1RFNA 2P3UB 2D8WA 1GHWH 5DJ7A 3MH6A 5K7RA 3NK8A 3UY9A 4XE4A 2A2QH 2A31A 3S9AA 1GHAF 1NFWA 3W94A 1AE5A 1DXPA 4NIYA 2FOGA 3A7XA 3E91A 4XSKU 1OYTH 1UHBB 1GBMA 1GBAA 2GCHG 4Q80A 4WWYA 3A82A 1C5UA 1V2TT 3GDVA 3QK1A 3RXUA 2JH6D 1HJ8A 2G51A 4YT6H 2PKAA 1OWKA 3AAVA 4UDWH 3QGJA 2IPHA 2ZG0H 3UUZA 2GMTB 5DP9A 3PWCA 1PQ8A 1VR1H 2W3IA 4Y6DA 1YP9A 2AIQA 2GV6A 1GVZA 1XUKA 2AH4X 4I8JA 1H1BA 4ZUHA 4Y71A 3ENSB 2G52A 1T31A 1GBFA 1HYLA 1UJ1A 3D49H 1O31A 4WMEA 1AD8H 1EJMA 5EOKA 1KXDA 2GZ9A 2Z9GA 2BD2A 3B23B 2ZU1A 5C1UA 1DICA 1MTUA 4X8VH 2PTNA 1SGPE 1F0SA 3SV9A 2OTVA 1GI6A 3RUOA 1A4WH 2BM2A 1BOQA 3KN2A 1BJUA 4TY6A 1C1MA 5IYTA 4WH8A 2VINA 3Q3YA 3SV6A 3HGPA 4KP0A 1EKBB 3BN9A 2O8MA 1C5RA 2FX6A 1IHSH 1SGFG 4X2YA 5F8XA 3BTQE 1ELAA 1WTGH 3HKIB 2J34A 2ODPA 5JYIA 5FXLA 1K1OA 1J8AA 4GUXA 3RU4D 2QXHA 3RMLH 4NSVA 3MU5A 3CP7A 1SGEE 2Y5FA 4CH2B 1P2QA 1H4WA 3SJ9A 1QRXA 4OS4A 3A7VA 1P8VC 5DP5A 1EPTB 1Y3VA 3MOCA 2W7UA 2XBWA 1GCTB 4KTSA 1C2HA 1MTVA 1QRZA 1YC0A 5EGMA 1O39A 1DOJA 1UCYE 5EQQA 1YPLH 2FLRH 3SU1A 1V6DA 1BQYA 4MVNA 4ABIA 1SPJA 2BD5A 2Z7FE 1TNLA 1ZPCA 2BY9X 2YNBA 3AW0A 2PW8H 4JMYA 2XXLA 1HIAB 1IQFA 1JOUB 1G3EA 1WU1A 1XKBC 5F8TA 1A0LA 3E6PH 2I6SA 2ZECA 4CRGA 1UVOA 4I31A 1BIOA 1O2SA 1SGCA 3C1KA 3UWJH 4Y8XA 1ZGIA 4JZ1A 3TJUA 2F9PA 5JBTA 2WPMS 2ANKH 1TONA 3FZDA 1WAYB 1QJ1B 2WV4A 2ZTXA 4K8BA 1UO6A 3TU7H 3EYDA 4UE7H 1SHHB 3RM0H 1LVMA 1TX8A 2Q1JA 1QBNA 4TYDA 1JMOH 2KAIA 1P3CA 1PPFE 2ZFSA 4AFQA 4ABHA 1V2RT 3QDZB 1GHZA 4B74A 2ZKSA 2VU8E 1GBHA 1C5XB 2BQ7B 3M3VA 2AS9A 1IAUA 5DP3A 4B1TA 3OY5U 1SC8U 2CMYA 1SLVB 1BTHH 1FY3A 4ZMAH 2XC4A 4ZAEA 1FN8A 1O2TA 2I6QA 2H9TH 1UTQA 4ZKSU 1G9IE 2C90B 1UHBA 3SGAE 4X1RU 1OOKB 1DSTA 2JETB 3E16B 1GBTA 3SUGA 3S7KB 5TJXA 3EGKH 3ZVAA 1C5QA 2HNTE 4NIVA 1TB6H 1WV7H 1TX6A 3ZZCA 1TAWA 2QF0A 4B71A 4B75A 1IQEA 1SQOA 1K2I1 3L3TA 2ILNA 2VVVA 2BDHA 3ZVBA 1AVGH 1UTLM 3OTJE 3F9GA
chains in the Genus database with same CATH superfamily
1TPPA 1TRNA 1XVMA 1ZHPA 1ELDE 5KGOA 4YESB 1Z8RA 4CREA 2D1JA 1PJPA 2NU0E 3TK5A 2BXUH 1T8MA 2A4OA 1FY8E 1HJ9A 3SQHE 1O2XA 4KGAA 3ZYDA 5IDKA 1YCPH 1RGQA 3KHVA 2XWAA 1A3BH 4X6OA 2VWNA 3PRDA 3U9AH 3S7HB 2QE7D 2FODA 1LHEH 1HAGE 1HXEH 1L0ZA 3MNSA 3SZEA 4FOUC 2FTLE 3BTFE 4HTCH 3QTVH 4Y0YE 2AFQB 1MTNC 3RC4A 4YT7H 4LZ1H 1CA8B 1M9UA 2ZQ2A 4BAQB 5GCHG 1HB0B 1K1LA 3O8RA 1MU6B 2FI5E 5ABWA 2AGIX 1OXGA 6GCHG 3U1JB 1DSUA 1Q2WA 3EA9A 4IBLH 1HPGA 1C2IA 1RXPA 4B73A 1GI9B 3VGCB 2ANYA 6CHAB 1UCYH 1NBMD 5FCKA 3PB1E 1TNGA 3DSOA 1GDUA 3E0PB 1A5IA 2AMPA 2Z9IA 2VWLA 1P2IA 1TGCA 3DHKH 5C0TA 1KLIH 1DS2E 1TA6A 1EPTA 4X1PU 2UWLA 4D9RA 1BTYA 5JBBS 2YNAA 1P2KA 3KGPA 4ASHA 1IQIA 2WYJA 5AFZH 4JYTA 1Z8IB 4YLUA 2YMSD 1A5GH 1OX1A 1TE0A 3QTOH 4AFSA 1E0FD 1QQUA 1SG8B 1V2LT 5T3HA 2EA3A 3KQBA 1O2MA 1YYY1 4WY3A 3A89A 4XBCA 1EJAA 1HIAA 1YPEH 1V2QT 4Q2KA 5JBCS 1BMFD 3H7OA 5EIYA 4YOJA 2F83A 3ZVEA 3SOSA 1NPMA 2JDID 5E2PA 3GY4A 2SGFE 4WXIA 1YLNA 4B2CA 4CHAC 1B0EA 2QXIA 3RXDA 1TGSZ 2BQWB 1SHYA 2BZAA 5TCCA 1C1OA 3KL6A 1O35A 1P09A 2WZQA 3SZNA 2RDEA 1HAIH 4DURA 7GCHF 2ZDLA 1E36B 3MH4A 3RLYH 5T1VA 4E7NA 2JIZD 3EQ0H 3V13A 1A61H 2GCHF 1TFXA 1UVPA 3GDUA 1GJCB 2THFB 2XC0A 2Y80A 2QGRA 1O3CA 1GDQA 1KLTA 2ZNKH 4LOYH 2SGEE 1K21H 1YLDA 4BAKB 5DKMA 1EOLA 2QV1A 4DIIH 1GI5A 1NESE 4K1TA 1C2GA 3M5LA 4AX9H 1P01A 1MH0A 1LHGH 5CE1A 2RG3A 4GCHG 2BLWA 5FHTA 4OS5A 3RU4T 1FIWA 1CO7E 1PPCE 2A7JA 1TBZH 2GMTC 2B0FA 1ZTJA 3MYWA 1YF4A 2CHAB 4ISIH 4J2YB 5EW1H 1OWJA 3FZZA 5CHBA 1GJAB 2R3YA 3LGUA 4XBDA 1AWHB 2G55A 1PYTD 1CT4E 1F7ZA 3A87A 5KECA 3WY8A 3MFJA 1N1LA 3RXVA 2A4GA 1QGFA 3V3MA 4CBOA 1C2DA 1O2QA 1D3TB 3G01A 3MNXA 2BDYA 1EAIA 1FLEE 1TMBH 4Y79A 2ZPQA 1G3DA 2GD4B 2VNTA 1G37A 3FP7E 1Y3XA 4A5TS 1EQ9A 1LPGB 1ZTKA 3LGVA 2BDBA 5C3NA 3ODDA 3A7TA 3UAIC 3HK3B 2F3CE 3A81A 2FESH 2HPQH 3BEUA 1P12E 5E0HA 1LKAA 4E7RG 2ZIQH 2O8LA 5C5OA 3RP2A 2F9OA 1MD7A 1PPGE 1XX9A 1KMHB 2A5KA 4FVBA 2FYRA 3GICB 1GBLA 1C1PA 1EPTC 1FZZA 1L4ZA 4HGCA 1V2OT 3ZVCA 4AGJA 1GCTC 1PQAA 3TH4H 1VKYA 4ABBA 3A88A 3M7QA 1K9OE 1SGTA 4ZHAA 1UTNA 3SNEA 2F9BH 2EQNA 4GVUA 4RKOB 1H9HE 3OEHD 1SGNE 1L2EA 3N7DA 1P9UA 1GL1A 2G5VA 4I8KA 2FIRH 4OS1A 2OC8A 3A84A 2V3OH 3UWIA 1AFQB 1FXYA 3O8BA 1DY8A 2Z9LA 5EJLA 1LVOA 2Y5HA 2ZU5A 1Z6JH 2CJIA 3DT0H 3GCHB 4DVAU 3TGKE 1ELEE 2PR3A 3MHWU 2HLDD 1AE8H 1GI1A 1N6YA 1MCVA 1W10U 3MO9A 4NFFA 3P8FA 1QB9A 4OS2A 1BCUH 1KYNA 4X1SU 5EG4A 3JZ1B 1O3GA 5DPAA 1FN6A 1QURH 1ZHMA 4I7YH 3FO8D 5HXFA 2ZCKP 2YMSC 1HAOH 2WV9A 4NSYA 4R0IA 5EW2H 1YPKH 4FUCA 3SU2A 3RXBA 1T7CA 4X8TH 3B9FH 3R3GB 4JZFH 2M2AA 3V7TA 2HLCA 1CT0E 2L6OA 2IN2A 3IITA 3ZZ7A 1AGJA 4CH8B 1QBOA 1AKSB 2P59A 3I77A 5EPYA 3MH5A 4AN7A 1C2EA 3BF6H 4O03A 1BBRK 1E1QD 3ATIA 1D9IA 1SSXA 1ZSLA 3M5MA 1HXFH 3BTKE 4NZLA 4UONA 1C5NH 1V2NT 2FM2A 2JETC 4M9FA 1MMJN 1DLEA 2WPKS 1S0QA 2BTCE 2VIQA 2D2DA 2W3KA 1NRPH 5FX5A 3QGNB 4A7IB 1A0HB 3SV7A 2J95A 1ARCA 1WBGB 1DVAH 1ZMJA 3GY3A 4ISHH 2P93A 4NIWA 2G4TA 2VVUA 1C5PA 3Q77A 1UMAH 2Z3DA 3P8NA 1GBKA 1ZJKA 3M3SA 1KXBA 2EC9H 4CRBA 1AFEH 2ZGJA 2EI6A 2OQ5A 4Y7BA 1OKXA 1O5GH 1MBMA 2GT8A 2QF4A 9ESTA 1QZ8A 2VH6A 4H42U 1DWCH 1MKWK 1CBWB 2OCVB 5GCHF 1MUEB 1G3CA 1A46H 1P06A 4K60A 6GCHF 1ACBE 1Y5AT 4OGXA 4ISLA 1GJ5H 4ZROA 1KSNA 1JRTA 2ZHFH 4IC5A 3SJ8A 3M5NA 2ZC9H 1OS8A 2R2WU 2CN0H 2XOKD 3GY8A 4IN1A 4B76A 2PKSB 5HIYA 3O8DA 5BRRE 1NRSH 5LPEA 1FDPA 2ZA5A 3PLPA 2W7SA 2F9NA 4ABJA 1QJ6B 3MU0A 1H8ED 3OYPA 2K1QA 3DD2H 1NFXA 1PYTC 7LPRA 2ZHDA 4U01A 2QXJA 1KIGH 1V2UT 3A83A 1PFXC 3M3TA 4ZXYH 1Y5BT 2Q6GA 3VGCC 6CHAC 1ZTLA 3SHAH 2C8WB 2PUQH 4BXWA 1BMAA 3PMHB 3URDA 1KTTB 3QN7A 1T8NA 1WYKA 4DG4A 2J94A 3F2FA 1O5AB 1S83A 3ZZ9A 1TNJA 3U98H 1FUJA 1Y3WA 1KLJH 5EQRA 2ZO3H 2J98A 3URCA 3LU9B 1P2JA 1C1TA 3M35A 2ZHQH 4I8LA 2V3MA 2CK3D 2Z3EA 2TRMA 4TT3D 2PTCE 3GY5A 1ELBA 3PV4A 1D3PB 5L2YH 4D9QA 3ZVGA 4LZ4B 1WDIA 2WPHS 1N6XA 1GMHG 2FXRA 3UR9A 4ZXXH 1F5LA 5T6GA 1CU1A 4THNH 4DIHH 3F6UH 1GI0A 1QB6A 1S6FA 2TGTA 4X6PA 1O38A 1W0ZU 2UUYA 1P2OA 3RMMH 1SGRE 1V2ST 2WINI 1ZMLA 3DFJA 3T28A 4OS7A 1O5EH 1TPOA 1ETTH 1P04A 3RC6A 1O5CB 1G36A 1O2RA 2BD3A 4ISNA 3RXPA 3FN8A 4FUJA 3DCLA 3SNAA 2BXTH 1NFUA 5DK1A 1EZSC 5DP6A 4X8UH 3LH3A 3E0NB 2BD8A 1ANBA 1L4DA 4GCHF 1C5YB 4AORA 5FAHA 2R0LA 3BIVH 1K22H 1O2HA 2OC0A 1LPKB 4KTUA 2Z6BD 1U6QA 1AKSA 1ZJDA 2F91A 3SO3A 1THPB 3UOPA 5JDUB 2V0BA 3UR6A 2KFWA 4ABGA 5JB9S 4X2WA 4RI0A 1MAYA 3MU8A 1SOZA 4GHQA 1EUFA 4ABEA 1QRWA 4GLYA 1FONA 1HV7A 1Y3UA 1TQ0B 2HRVA 1ZLRA 1VGCB 4BTUB 1O32A 3LGTA 1ESTA 3RXIA 2ULLA 3LGIA 4CRAA 5JBAS 3OX7U 4JZIA 2DUCA 4R8TB 1G32B 4ABAA 2ALPA 3DA9B 3M7UA 5C67A 4YTAA 3STJA 1BRUP 1NT1A 1EATA 1GI4A 1EZQA 1Z1JA 2HVXA 2R9PA 1MZDA 4H6SB 2AGEX 2PV9B 2J97A 1O2JA 2VIOA 3OAAD 2CHAC 2EY4C 5EU8A 1O2YA 2Y6TA 4GSOA 1GJ7B 3UIRA 2C4FH 4AGKA 3EAJA 4MG3A 2WPDD 2QYIA 3MH7A 3TGJE 1JIMA 1C5VA 2OBOA 4FUEA 2BVXH 3UTUH 5L6NH 5HIZA 2NU1E 1TWXB 2ZFFH 1O3HA 1C5SA 1C4U2 1GMDG 5KEDA 2QY0B 1GG6B 4B2AA 3BG4B 2TGAA 4INHA 1IQLA 2XW9A 4NG9H 1C2LA 4WMDA 5DP4A 1AUJA 1K1PA 3SUDA 3EA8A 2ZFTA 3F2GA 1MKXK 1OYQA 2FOEA 3UFAA 3SU6A 1C5WB 1DUAA 1BRAA 1O30A 4RKJB 1GI7B 4BXSA 1XMNB 1A5HA 4YO9A 1BTXA 1NBME 1C1RA 1BJVA 1GVKB 1FAXA 1ARBA 2FTMA 3BTHE 1N8OB 1O2UA 1A3EH 2ZGXH 3BTWE 1TRMA 3HPTB 2HGTH 3L33A 3T29A 1ETRH 3LOXA 1LHCH 1ORFA 1EP6A 3P6ZB 1JIRA 3SI4H 2KCOA 3FVFB 5FBEA 1BMNH 4BANB 1HCGA 3HGNA 3P8GA 1ZMNA 3LPRA 1ZSKA 3UQVA 3VB7A 1ELCA 3ATLA 4MNXA 2ZDNA 1SGIB 2ZZUH 4K2YA 3LGYA 1GI8B 1Z8JB 2ZDKA 1HJAB 4INLA 3UNQA 1FJSA 4CRFA 4AYVB 3OSYA 1D6RA 3RMOH 4ZCNA 4NA9H 3V12A 3PYHA 1BTZA 1J16A 2P3FH 4MPUA 4Q7ZA 1NFYA 4VGCB 1AFQC 1IQJA 1V2VT 1MCTA 1GBDA 1QFKH 1TOCB 2V7QD 4MQAA 5DGJA 2BOHB 4QT8C 2BZ6H 3GCHC 1SKYE 1JWTA 4FU7A 3SNBA 3TGIE 1C9PA 2A4RA 2PUXB 1MQ5A 3P95A 5GPIB 4O3TA 2BOKA 4FUBA 2FO9A 3T5FH 3SU0A 2HPPH 2AMQA 2QIQA 4XRNA 2SFAA 1V2WT 1H8DH 8LPRA 3LC5A 3OE7D 3SN8A 1X7AC 1AIXH 3F68H 1GCDA 2KR7A 4B2BA 1W0YH 1FPHH 2G4UA 4Q4LA 2H6MA 5E0JA 2LELA 2EEKA 2BDGA 1GGDB 4BNRA 1IHTH 3NXPA 1NC6A 1NU7B 1OWEA 3BTME 3CS0A 3UQOA 5FPYA 2H1UA 4GPGA 3VXEH 1WXRA 3PROA 2PSXA 2JKHA 4OM9A 4YOGA 1P03A 2STBE 1HRTH 4WMFA 2VVCA 1MZAA 3A7ZA 4JZEH 2R0KA 5CHAB 1IQMA 1XKAC 4K69A 5F03A 2OC7A 1HUTH 3DSGA 2Y7ZA 3GDSA 2BY5X 5T6FA 1T4VH 5DSFA 1O3PB 2BDAA 5AFYH 5EXLA 4KELA 4Q7XA 2ZF0H 3HATH 1SGFA 1GHBG 1NM6A 4B6EA 5T6DA 4TPIZ 2Z3CA 3WWFA 1DX5M 2VWMA 3I78A 4X1QU 3CNRA 4X6MA 1DPOA 3LDXH 4O97A 2V6NA 4NWKA 1KXCA 2ZI2H 1CBWC 1MTWA 3PO1B 1B7XB 4YOIA 2BDIA 3TH3H 1BDAA 1XXDA 3MTYA 1ANEA 1QR3E 4Y10E 2SGQE 3LGWA 1A0JA 1W12U 2PLXA 4RT0A 2ZDAH 2LNCA 1SR5C 4DCDA 6ESTA 3GCOA 2PKSC 2W6ID 2BQ6B 3AAUA 4FVDA 3TK9A 2UUJB 4X6NA 2VGCB 3TJOA 4A6LA 2LP6A 1JBUH 1UVSH 3SU4A 1EX3A 1O34A 1TMUH 2KM0A 2ODQA 1LQEA 1S5SA 3V0XA 3DSPA 4YM9A 1C1VH 2ZHEH 3UPEA 2ZGBH 3PRBA 1WQVH 2KCAA 5GWZA 1TA2A 3O8CA 3E3TA 5GXPA 3HKJB 4XOJA 4TPYA 1SGDE 1C1QA 1GHVH 3QX5H 1ELGA 2M5TA 1C2KA 3QO6A 1CGJE 1GMHF 1O5BB 4IC6A 1NZQH 1SVPA 3MU4A 3GOVB 3U28C 1VJ9U 1E37B 4ZHMU 5A0BA 2C8XB 2ZDVH 2XYAA 1C1WH 4JYVH 1DT2A 1YKTA 3F9FA 3NKKA 2OUAA 1O3BA 4YZUA 2C3SA 4ASUD 4FXGH 4FUHA 2FOFA 3VEQB 1Y8TA 1CHOG 1TIOA 2FWWA 2QA9E 2XTTB 1L1GA 3BTGE 1RS0A 1C5MD 1XUJA 3F9EA 1TYNA 3D62A 3SORA 4ZKNU 4CR5A 4SGBE 1FX0B 3KYFA 2A7HA 1O3OA 2RFKC 1O2LA 2XRCA 1O2KA 2BMGB 2H9HA 2ALVA 3IG6B 2HOBA 1BMLA 3LONA 2GDEH 1ZR0A 1CSOE 3NUMA 2A2XH 1NROH 4NFEA 4Q7YA 3QLPH 3RXJA 3MQKC 3F3BA 3P92A 2Y82A 4BAHB 5C0UA 5LPFA 1CQQA 2FI3E 5A0CA 2ZGCA 1F92A 2HNTF 2OQUA 5AVDA 2O8TA 3TVJB 8GCHG 3RXOA 3SI3H 1ZPBA 4HFPB 1XUFA 2OBQA 1H9LB 3D65E 2BDCA 1YY3A 3ZV9A 4Z1MD 1P9SA 4AOQA 1AO5A 1E38B 5LPRA 4MDSA 1Z6EA 5F53A 1T8OA 2GVFA 4ESTE 5CDFE 1HDTH 3MNBA 1QNJA 2NU4E 1D6WA 2VB0A 1SQAA 3AW1A 1TNKA 1S85A 1VGCC 2VWOA 1C5OH 1EAWA 1K1IA 4MNYA 3BIUH 4KKDA 3SV8A 3TPIZ 4K5ZA 1SOTA 4NZQA 2ZPSA 1GHYH 1OP0A 1W14U 5ESBA 3SJOA 2F9VA 1O2GH 3A80A 1GVLA 1O2ZA 4FETA 4X2XA 1P05A 2ZCLP 2G81E 5EPNA 3U8TH 1GBJA 3OU0A 1C2MA 1QB1A 2IJOB 2BD4A 1LO6A 2B5TB 4ZHLU 2ZU4A 1O3LA 2H9EH 3WW7A 3NWUA 1C2FA 1SQTA 1ZRBA 2J92A 2DE8A 3GY2A 2AMDA 1F0TA 1G3BA 4ZKOU 5A8YA 1AZ8A 1FQ3A 3UNRA 2W26A 1B5GH 1ESBA 4Y8YA 1W7GH 2ZCHP 1TPSA 7KMEH 4UFDH 3RC5A 2O8WA 1HGTH 1S82A 3UREA 2HNTC 2A1DB 1GG6C 1UK4A 3BG4C 1IQHA 4X8SH 3N7OA 3KYGA 4DW2U 2CV3A 1SFIA 4FU8A 3A8DA 1ZSJA 1HNEE 2NU2E 3U8RH 3VXFH 4FUGA 4UFEH 1Y3YA 3LC3A 5IK2D 1F5KU 1V2KT 3C27B 1VITH 2XNDD 4CBNA 1NO9H 2OC1A 3ITIA 1NRRH 4JCNA 1AHTH 1AVWA 5A8ZA 5C20A 4BTIB 3B8JA 1O3NA 1N8OC 1O37A 1Z7KA 5AHGH 4MNWA 2GJGA 2QF5A 1OWHA 1PPZA 1O5FH 2AEIH 2FOMB 1BTWA 1TBQH 2GV7A 9LPRA 2Y5GA 3A7YA 2H5CA 3TH2H 4D76A 4BOHA 2J38A 1HJAC 2PHBA 3SUFA 3KEEA 1LHFH 2WYGA 4F48B 2BLOA 5FX6A 5L30H 1TPAE 1UVTH 2FLBH 2TGPZ 1MBQA 3JZ2B 4VGCC 1KDQB 2V35A 4K8YA 2VJ1A 1BBRE 3T25A 4DT4A 3CS7A 2ZTYA 1DANH 3ATKA 2TPIZ 1GBCA 4NIXA 2PFEA 1O5DH 1RTLA 1ESAA 1F0RA 5HKKD 2NU3E 1FNIA 3M61U 5HMAA 2FS9A 1OHHD 3ZZ8A 1O2OA 1DWBH 1EB1H 3RDZA 5C94A 1QL7A 1MTSA 4FUIA 2FX4A 2B7DH 5A2MH 1C2JA 4TWWA 5FPSA 2VIDA 1GBIA 1CGHA 2P8OB 2GDDA 5HGGA 5FCRA 2GCTB 1QTFA 1SMFE 1HLTH 2Y81A 3RXKA 1RTKA 1SB1H 5FPTA 2CF8H 5G4BA 3RU4E 1GJBB 1OP2A 3GCTG 3KIDU 3LKWA 1LTOA 2A32A 2ODYB 1BZXE 1ZYOA 1TNIA 3PWBA 2BVSH 4UD9H 3TITA 5L2ZH 1UTKA 8KME2 1THSH 3ESTA 4MPWA 3VFEA 2ZHWH 5AF9H 4WH6A 1GBEA 1GGDC 1W13U 4WVPE 3PLBA 3TJNA 2A5IA 4NA8A 2BY8X 1NRQH 3RMNH 7GCHG 4FUDA 3SJIA 1QY6A 4DJZB 3T26A 1HAHH 1F5RA 3ZZBA 1GHBF 4XFQA 1C5LH 1SFQB 1AMHA 4IMQA 1TRYA 1ZRKA 2XBVA 4CRDA 2F4LA 5CHAC 1VJAU 3QUMP 3FP8E 5B6OA 1TQ7B 2SGDE 4NWLA 4F4OC 1F0UA 1KXFA 5EQSA 1BRCE 1YPJH 1YCPK 3MU1A 1SL3A 3LT3A 1YPHC 3UOUA 1BMMH 4Z6AH 2Z94A 2CF9H 3RM2H 1DXWA 6LPRA 2EI7A 4E05H 3MI4A 1ZGVA 3UNSA 4IW4E 2WPIS 3KQDA 1WTHD 1V2PT 5E0GA 3M36A 1SQRA 4Q63A 5HM9A 1GJ6A 3PV2A 2B9LA 1FY5A 1GJ4H 3MO3A 2ZP0H 3PO1C 4HI3A 1FY1A 5CMXH 3Q00A 1ABJH 4A1XA 1QL8A 1TGNA 3K2UA 2WHXA 1RJXB 3A8CA 3A7WA 3A8AA 2AERH 1UCYK 3MNCA 3RXQA 4A1VA 3E90B 5DP8A 3S9CA 1KXEA 5C17A 3A86A 2F9UA 5F6MA 1C9TA 1J14A 1J15A 2VGCC 3RLWH 2GZ7A 3BSQA 1W3CA 3Q3XA 4RT1A 1GMCG 3E8LA 1P3EA 1V2MT 3TIUA 1AQ7A 1UK2A 3SGBE 1CA0B 2IJD1 2BLQA 2DE9A 3EA7A 2OLGA 4MTBA 3TLOA 2RA3A 2RDLA 2Q6FA 3DFLA 2OINA 1XXFA 1CHOF 2BX3A 7ESTE 1UVUH 5A0AE 1CT2E 2NWNA 1BBRH 1ZHRA 4M7GA 1QQ4A 1BT7A 1KXAA 2FZZA 4H6TA 1DDJA 1O0DH 1T8LA 5DN6D 2ZEBA 1YLCA 1W11U 3SW2B 2JH5D 1GJ8B 2F43B 4Y8ZA 1O2VA 1SGQE 1GWAA 1GPZA 2AGGX 1B0FA 2WUBA 2OXSA 2OK5A 1K28D 3KQ5A 3NPSA 1AB9B 1KDQA 2ANWA 2EI8A 4Y11E 2XWBI 3VB4A 2J4IA 2FPZA 3ZVDA 4ISOA 3TK6A 1BRBE 3PM3A 1YGCH 4HG6A 2STAE 4Y76A 2J2UA 4WJG2 8GCHF 1WOFA 2ZTZA 1DY9A 1C1NA 2QN5T 3FKSD 1O3EA 2RA0A 2XBYA 4TWYA 4DT7B 4HZHA 5J4QA 1O3JA 3M7TA 1DWDH 1DUEA 1HFDA 3PMAB 4TY7A 1WCZA 3RXHA 1O2WA 4JZDH 1QA7A 1MKWH 3ZYEA 4Y7AA 1EZUC 1FIZA 1KY9A 2ASUB 4BAMB 1HAYB 3AASA 4AC9A 4TSFD 1TMTH 5TCAA 2ZFPH 4GAWA 5GIBA 4ZH8A 3VB3A 2BY6X 3RXMA 1P57B 3ZZDA 4ABFA 4Y0ZE 1RTFB 1O36A 5DP7A 2IOTA 4U2WA 4UFFH 1DLKB 2UWPA 4JK6A 2K8IA 1O3FA 4OGYA 1HAVB 1EFRD 3GS9A 1XUGA 4ABDA 5JB8S 1Q31A 2AYWA 3D23A 1IQNA 5LGOA 2Z9KA 1DE7H 3GISB 3LIWA 1RIWB 4YLQH 1GHXH 1ELVA 1NS3A 2H2ZA 2XBXA 5GDSH 1NN6A 5ETXA 3M37A 4O3UA 1JXPA 3OY6U 4KTCA 2QF3A 3F0PA 4WXVA 3BV9B 5EXNA 3WWBA 2OD3B 5FL7D 1OWIA 1QHRB 1C4Y2 1RD3B 2VIPA 1COWD 2BD7A 2BB4A 3GYMA 1G2MA 1HBTH 4H4FA 2ZU2A 1AVXA 3STIA 4BTTB 3NZIA 1WUNH 1AU8A 4RSPA 3F0OA 1P11E 2BY7X 2JJ1D 3P8OA 1ID5H 1W7XH 1YCPM 1ZPZA 2HWLB 1E35B 4K1SA 2HALA 4BAOB 1O2PA 2UWOA 1V3XA 2FYQA 1YM0A 3E1XB 2WSSD 4AYYB 2CGAA 2G00A 2QCYA 2FMJA 3ZZ3A 4O9VA 2A0QB 3BTDE 4AZ2B 2BX4A 5ESTE 1O2NA 2P94A 3FFGA 2FEQH 1LVYA 1AZZA 1EZXC 1TX7A 2R3UA 1OWDA 3A85A 3RXTA 3PTNA 3KCGH 1QCPA 3GYLB 3RXCA 3FAOA 5LH8A 4D7FA 3QZQA 3T62A 3BTTE 2SNVA 4I32A 1E79D 1PQ7A 1PQ5A 3R0FA 3ZVFA 4I33A 1E1RD 4ACBA 1NY22 1VZQH 3RXEA 1Z1IA 4Z0KA 2C93B 4DGJA 1VITG 4FUFA 4X2VA 2AIPA 1GJ9B 2O8UA 3LJOA 4YXWD 3SU5A 4GHTA 1S0RA 2O9QA 1GHAG 3F2HA 3OTPA 5SGAE 3IWMA 1EAUA 3KQCA 1AY6H 1ABIH 1ELTA 1UW7A 2KZ4A 4MPVA 4DY7B 1P02A 3KNXA 5HYOA 2W6JD 4AFUA 3PTBA 1O3KA 3VB5A 3SJKA 4K1EA 2Z9JA 1CVWH 2FP7B 1BHXB 2B8OH 1GDNA 2PP6A 1NTPA 4U32A 4P00A 3GCTF 1P2MA 3DUXH 2A5AA 1AI8H 3EDXB 1ZOMA 2J5UA 5BPEA 2P3TB 3KQEA 1MAXA 2YOLA 3U69H 2VIWA 2K0QA 1XUIA 1EJNA 3ATWA 1EB2A 2XCNA 2P8OC 1H9IE 1EXFA 1HAXB 1LKBA 2GCTC 1H8IH 1AN1E 1THRH 1YPMH 3MO6A 1A2CH 1W8BH 4MNVA 1YPHE 3TNSA 3M5OA 5A09A 1YBWA 1XVOA 2UUKB 2W5EA 5I25A 1UTMA 2FDAA 3LH1A 4WF8A 1A7SA 3BG8A 2KCPA 1C4V2 1ANCA 2ZDMA 1P0SH 1NU9A 1O33A 5PTPA 2XNIA 3HK6B 4E06H 5FBIA 3W95A 4MLFB 3S0NA 1MKXH 2R2MB 1CGIE 1HAVA 1K0HA 3ELAH 1V2JT 2A7CA 1P10A 3AK5A 2FOHA 3MWIU 2XCFA 1UTOA 2FOCA 2ZGHA 1YWUA 3SGQE 1SLXB 3U1IB 4DOQA 4OS6A 1O2IA 2LPRA 1K1JA 1EOJA 3OEED 1BTPA 1E34B 1NRNH 4D8NA 3TJVA 3UB0A 2WUCA 2FOBA 2ANMH 3ATMA 3T27A 3RXSA 1DM4B 1OPHB 3SNCA 2P95A 5EXMA 1SGYE 1W2KH 1SBWA 3FANA 4JYUH 1O3AA 3Q3KA 4K3JA 2QAAA 3QWCH 1HAPH 2GX4A 3SV2H 2L74A 1BITA 1QIXB 4AB8A 3A8BA 3F9HA 2ZFRH 1C1UH 4D7GA 3SU3A 1UK3A 1PPBH 1QA0A 5C2ZA 2GP9B 1GI3A 1MU8B 3SNDA 3RXLA 1EAXA 4FU9A 1GMCF 1O3IA 3I29A 2VIVA 2KX4A 2G8TA 2Q6DA 2UUFB 1PPHE 1CHGA 3NCLA 4A1TA 2XC5A 2ZQ1A 5A8XA 2G5NA 1ZZZA 1MQ6A 1ELFA 2WPJS 3GY7A 2GT7A 1C5TA 4XBBA 1VCWA 2FI4E 1TGBA 1XUHA 1LQDB 1W0JD 1C5ZB 2ZWLH 4U30A 2RCEA 3GCNA 3Q76A 3FP6E 1TGTA 1SI5H 1K1MA 3T2NA 3U8OH 2FOAA 1TLDA 4IN2A 3RXFA 4ZKRU 4IMZA 5E2OA 3H09A 3QZRA 1CA0C 3GY6A 4CR9A 1GL0E 3F1SB 2PKAB 1LCYA 1QJ7B 3H7TA 3SHCH 3RXAA 5HM2A 1VCQA 1AUTC 5EODA 3LJJA 3BTEE 5JPMH 4X1NU 1WQSA 2TIOA 1MD8A 2PGBB 3ODFA 1TABE 3RXRA 4PROA 2GTBA 2SNWA 1WSSH 4RN6A 2QXGA 1DWEH 1BA8B 1IOEA 3ZIAD 1GMDF 1S84A 2A4QA 2J98B 1Z71A 4MPXA 4UFGH 5GJ4B 2WV5A 3BEIB 1LHDH 1MABB 2BD9A 1FV9A 3AVZA 1IQGA 2H5DA 5I46H 4CRCA 5E8EH 3ZZ6A 4F55A 1HAZB 4LXBH 1AB9C 2CXVA 5DG6A 3EE0B 5J4SA 1AWFH 2GKVE 3ZZAA 4UEHH 1T4UH 2KCYA 1BTUA 1LVBA 5H4IB 1IQKA 2WPLS 1TBRH 1S81A 1C1SA 1GI2A 1FY4A 1YPGH 2BLVA 2TGDA 4NGAH 1SLWB 4INKA 4I8GA 1MTNB 3MMGA 1BUIA 1G30B 1Z8GA 2C8YB 2ZU3A 1KTSB 2Y7XA 1VCPA 2OP9A 4AFZA 4AG2A 3SUEA 1QL9A 3H5CB 1OSSA 4F49A 2SGAA 2BVRH 3VB6A 1S6HA 1L1NA 1FI8A 1UTJA 2FS8A 1O3DA 5DO4H 4SGAE 1JRSA 5C5NA 1DFPA 1EASA 1EP5A 1UTPA 2ZPRA 3KF2A 1FAKH 3RXGA 2J9NA 2PGQB 3EE7A 1A1RA 1J17T 1J9CH 1Y5UT 1QBVH 4XD7D 1INCA 3S69A 4B6FA 1GBBA 3P70B 3TNTA 1Y59T 2ZFQH 3PV5A 1CE5A 4NA7A 1SLUB 1GJDB 3PMJA 1BB0B 1K1NA 1TOMH 3PMBB 1RIWC 2BHGA 2BYAX 1F2SE 2C8ZB 4A92A 1D3QB 1G2LA 3SYJA 2QC2A 1O3MA 1ANDA 4IGDA 3SQEE 3VG8A 2JH0D 2GZ8A 1ETSH 4I8HA 1FPCH 1PPEE 5C1YA 2PSYA 5F8ZA 1DITH 2VBCA 2V3HH 1D4PB 3PLKA 2VH0A 2TBSA 3K65B 1TALA 3CENA 4X0WU 3K6ZA 1XM1A 2ESTE 1LMWB 4J1YA 4NCYA 4AB9A 3P17H 1Q3XA 3L6PA 5C1XA 3BEFB 1LDTT 1H8HD 1LPZB 3K9XB 4CHAB 2A45B 1RRKA 2SGPE 1FMGA 3S9BA 4IS5A 4XDEA 2P16A 3K6YA 4AG1A 1BHXF 1L1JA 3ZV8A 1D3DB 1P2NA 8ESTE 1T32A 3OFND 3ZZ5A 2PWXA 3VPKA 4I86A 3SBKA 5K0HA 3ZZ4A 4JK5A 2GGVB 1OP8A 2KAIB 1TNHA 1VITF 2D26C 4LK4A 1RFNA 2P3UB 2D8WA 1GHWH 5DJ7A 3MH6A 5K7RA 3NK8A 3UY9A 4XE4A 2A2QH 2A31A 3S9AA 1GHAF 1NFWA 3W94A 1AE5A 1DXPA 4NIYA 2FOGA 3A7XA 3E91A 4XSKU 1OYTH 1UHBB 1GBMA 1GBAA 2GCHG 4Q80A 4WWYA 3A82A 1C5UA 1V2TT 3GDVA 3QK1A 3RXUA 2JH6D 1HJ8A 2G51A 2IPQX 4YT6H 2PKAA 1OWKA 3AAVA 4UDWH 3QGJA 2IPHA 2ZG0H 3UUZA 2GMTB 5DP9A 3PWCA 1PQ8A 1VR1H 2W3IA 4Y6DA 1YP9A 2AIQA 2GV6A 1GVZA 1XUKA 2AH4X 4I8JA 1H1BA 4ZUHA 4Y71A 3ENSB 2G52A 1T31A 1GBFA 1HYLA 1UJ1A 3D49H 1O31A 4WMEA 1AD8H 1EJMA 5EOKA 1KXDA 2GZ9A 2Z9GA 2BD2A 3B23B 2ZU1A 5C1UA 1DICA 1MTUA 4X8VH 2PTNA 1SGPE 1F0SA 3SV9A 2OTVA 1GI6A 3RUOA 2AHME 1A4WH 2BM2A 1BOQA 3KN2A 1BJUA 4TY6A 1C1MA 5IYTA 4WH8A 2VINA 3Q3YA 3SV6A 3HGPA 4KP0A 3NRLA 1EKBB 3BN9A 2O8MA 1C5RA 2FX6A 1IHSH 1SGFG 4X2YA 5F8XA 3BTQE 1ELAA 1WTGH 3N7EA 3HKIB 2J34A 2JJ2D 2ODPA 5JYIA 3FOAA 5FXLA 1K1OA 1J8AA 4GUXA 3RU4D 2QXHA 3RMLH 3N99A 4NSVA 3MU5A 3CP7A 1SGEE 2Y5FA 4CH2B 1P2QA 1H4WA 3SJ9A 1QRXA 4OS4A 3A7VA 1P8VC 5DP5A 1EPTB 1Y3VA 3MOCA 2W7UA 2XBWA 1GCTB 4KTSA 1C2HA 1MTVA 1QRZA 1YC0A 5EGMA 1O39A 1DOJA 1UCYE 5EQQA 1YPLH 2FLRH 3SU1A 1V6DA 1BQYA 4MVNA 4ABIA 1SPJA 2BD5A 4P02A 2Z7FE 1TNLA 1ZPCA 2BY9X 2YNBA 3AW0A 2PW8H 4JMYA 2XXLA 1HIAB 1IQFA 1JOUB 1G3EA 1WU1A 1XKBC 5F8TA 1W0KD 1A0LA 3E6PH 2I6SA 2ZECA 4CRGA 1UVOA 4I31A 5B6LA 1BIOA 1O2SA 1SGCA 3C1KA 3UWJH 4Y8XA 1ZGIA 4JZ1A 3TJUA 2YMSB 3W1EA 2F9PA 5JBTA 2WPMS 2ANKH 1TONA 3FZDA 1WAYB 1QJ1B 2WV4A 2ZTXA 4K8BA 1UO6A 2HVYB 3TU7H 3EYDA 4UE7H 1SHHB 3RM0H 1LVMA 1TX8A 2Q1JA 1QBNA 5EJ1A 4TYDA 1JMOH 2KAIA 1P3CA 1PPFE 2ZFSA 4AFQA 4ABHA 1V2RT 3QDZB 1GHZA 4B74A 2ZKSA 2VU8E 1GBHA 1C5XB 2BQ7B 3M3VA 2AS9A 1IAUA 5DP3A 4B1TA 3OY5U 1SC8U 2CMYA 1SLVB 1BTHH 1FY3A 4ZMAH 2XC4A 4ZAEA 1FN8A 1O2TA 2I6QA 2H9TH 1UTQA 4ZKSU 1G9IE 2C90B 1S6LA 1UHBA 3SGAE 4X1RU 1OOKB 1DSTA 2JETB 3E16B 1GBTA 3SUGA 3S7KB 5TJXA 3EGKH 3ZVAA 1C5QA 2HNTE 4NIVA 5EJZA 1TB6H 1WV7H 1TX6A 3ZZCA 1TAWA 2QF0A 5GNDA 4B71A 4B75A 1IQEA 1SQOA 1K2I1 3L3TA 2ILNA 2VVVA 2BDHA 3ZVBA 1AVGH 4ACAA 1UTLM 3OTJE 3F9GA
chains in the Genus database with same CATH topology
1TPPA 1TRNA 1XVMA 1ZHPA 1ELDE 4YESB 1Z8RA 4CREA 2D1JA 1PJPA 2NU0E 3TK5A 2BXUH 1T8MA 2A4OA 1FY8E 1HJ9A 3SQHE 1O2XA 4KGAA 3ZYDA 5IDKA 1YCPH 1RGQA 3KHVA 2XWAA 1A3BH 4X6OA 2VWNA 3U9AH 3S7HB 2FODA 1LHEH 1HAGE 1HXEH 1L0ZA 3MNSA 2FTLE 3BTFE 4HTCH 3QTVH 4Y0YE 2AFQB 1MTNC 3RC4A 4YT7H 4LZ1H 1CA8B 1M9UA 2ZQ2A 4BAQB 5GCHG 1HB0B 1K1LA 3O8RA 1MU6B 2FI5E 5ABWA 2AGIX 1OXGA 6GCHG 3U1JB 1DSUA 1Q2WA 3EA9A 4IBLH 1HPGA 1C2IA 1RXPA 4B73A 1GI9B 3VGCB 2ANYA 6CHAB 1UCYH 5FCKA 3PB1E 1TNGA 1GDUA 3E0PB 1A5IA 2AMPA 2Z9IA 2VWLA 1P2IA 1TGCA 3DHKH 1KLIH 1DS2E 1TA6A 1EPTA 4X1PU 2UWLA 4D9RA 1BTYA 5JBBS 2YNAA 1P2KA 3KGPA 4ASHA 1IQIA 2WYJA 5AFZH 4JYTA 1Z8IB 4YLUA 1A5GH 1OX1A 1TE0A 3QTOH 4AFSA 1E0FD 1QQUA 1SG8B 1V2LT 5T3HA 2EA3A 3KQBA 1O2MA 1YYY1 4WY3A 3A89A 4XBCA 1EJAA 1HIAA 1YPEH 1V2QT 4Q2KA 5JBCS 3H7OA 4YOJA 2F83A 3ZVEA 3SOSA 1NPMA 5E2PA 3GY4A 2SGFE 4WXIA 4B2CA 4CHAC 1B0EA 2QXIA 3RXDA 1TGSZ 2BQWB 1SHYA 2BZAA 5TCCA 1C1OA 3KL6A 1O35A 1P09A 3SZNA 1HAIH 4DURA 7GCHF 2ZDLA 1E36B 3MH4A 3RLYH 4E7NA 3EQ0H 3V13A 1A61H 2GCHF 1TFXA 1UVPA 3GDUA 1GJCB 2THFB 2XC0A 2Y80A 2QGRA 1O3CA 1GDQA 1KLTA 2ZNKH 4LOYH 2SGEE 1K21H 1YLDA 4BAKB 5DKMA 1EOLA 2QV1A 4DIIH 1GI5A 1NESE 4K1TA 1C2GA 3M5LA 4AX9H 1P01A 1MH0A 1LHGH 5CE1A 2RG3A 4GCHG 2BLWA 5FHTA 4OS5A 3RU4T 1FIWA 1CO7E 1PPCE 2A7JA 1TBZH 2GMTC 2B0FA 1ZTJA 3MYWA 1YF4A 2CHAB 4ISIH 4J2YB 5EW1H 1OWJA 3FZZA 1GJAB 2R3YA 3LGUA 4XBDA 1AWHB 2G55A 1PYTD 1CT4E 1F7ZA 3A87A 3WY8A 3MFJA 1N1LA 3RXVA 2A4GA 1QGFA 3V3MA 4CBOA 1C2DA 1O2QA 1D3TB 3G01A 3MNXA 2BDYA 1EAIA 1FLEE 1TMBH 4Y79A 2ZPQA 1G3DA 2GD4B 2VNTA 1G37A 3FP7E 1Y3XA 4A5TS 1EQ9A 1LPGB 1ZTKA 3LGVA 2BDBA 5C3NA 3ODDA 3A7TA 3HK3B 2F3CE 3A81A 2FESH 2HPQH 3BEUA 1P12E 5E0HA 1LKAA 4E7RG 2ZIQH 2O8LA 5C5OA 3RP2A 2F9OA 1MD7A 1PPGE 1XX9A 2A5KA 4FVBA 2FYRA 3GICB 1GBLA 1C1PA 1EPTC 1FZZA 1L4ZA 4HGCA 1V2OT 3ZVCA 4AGJA 1GCTC 1PQAA 3TH4H 4ABBA 3A88A 3M7QA 1K9OE 1SGTA 4ZHAA 1UTNA 3SNEA 2F9BH 4GVUA 4RKOB 1H9HE 1SGNE 1L2EA 1P9UA 1GL1A 2G5VA 4I8KA 2FIRH 4OS1A 2OC8A 3A84A 2V3OH 3UWIA 1AFQB 1FXYA 3O8BA 1DY8A 2Z9LA 1LVOA 2Y5HA 2ZU5A 1Z6JH 2CJIA 3DT0H 3GCHB 4DVAU 3TGKE 1ELEE 2PR3A 3MHWU 1AE8H 1GI1A 1N6YA 1MCVA 1W10U 3MO9A 4NFFA 3P8FA 1QB9A 4OS2A 1BCUH 1KYNA 4X1SU 5EG4A 3JZ1B 1O3GA 5DPAA 1FN6A 1QURH 1ZHMA 4I7YH 5HXFA 2ZCKP 1HAOH 4NSYA 4R0IA 5EW2H 1YPKH 4FUCA 3SU2A 3RXBA 1T7CA 4X8TH 3B9FH 3R3GB 4JZFH 3V7TA 2HLCA 1CT0E 2IN2A 3IITA 3ZZ7A 1AGJA 4CH8B 1QBOA 1AKSB 2P59A 3I77A 5EPYA 3MH5A 4AN7A 1C2EA 3BF6H 4O03A 1BBRK 3ATIA 1D9IA 1SSXA 1ZSLA 3M5MA 1HXFH 3BTKE 4NZLA 4UONA 1C5NH 1V2NT 2FM2A 2JETC 1MMJN 1DLEA 2WPKS 1S0QA 2BTCE 2VIQA 2D2DA 2W3KA 1NRPH 5FX5A 3QGNB 4A7IB 1A0HB 3SV7A 2J95A 1ARCA 1WBGB 1DVAH 1ZMJA 3GY3A 4ISHH 2P93A 4NIWA 2G4TA 2VVUA 1C5PA 3Q77A 1UMAH 2Z3DA 3P8NA 1GBKA 1ZJKA 3M3SA 1KXBA 2EC9H 4CRBA 1AFEH 2ZGJA 2EI6A 2OQ5A 4Y7BA 1OKXA 1O5GH 1MBMA 2GT8A 9ESTA 2VH6A 4H42U 1DWCH 1MKWK 1CBWB 2OCVB 5GCHF 1MUEB 1G3CA 1A46H 1P06A 4K60A 6GCHF 1ACBE 1Y5AT 4OGXA 4ISLA 1GJ5H 4ZROA 1KSNA 1JRTA 2ZHFH 4IC5A 3SJ8A 3M5NA 2ZC9H 1OS8A 2R2WU 2CN0H 3GY8A 4IN1A 4B76A 2PKSB 3O8DA 5BRRE 1NRSH 5LPEA 1FDPA 2ZA5A 3PLPA 2W7SA 2F9NA 4ABJA 1QJ6B 3MU0A 3OYPA 2K1QA 3DD2H 1NFXA 1PYTC 7LPRA 2ZHDA 4U01A 2QXJA 1KIGH 1V2UT 3A83A 1PFXC 3M3TA 4ZXYH 1Y5BT 2Q6GA 3VGCC 6CHAC 1ZTLA 3SHAH 2C8WB 2PUQH 4BXWA 1BMAA 3PMHB 3URDA 1KTTB 3QN7A 1T8NA 1WYKA 4DG4A 2J94A 1O5AB 1S83A 3ZZ9A 1TNJA 3U98H 1FUJA 1Y3WA 1KLJH 5EQRA 2ZO3H 3URCA 3LU9B 1P2JA 1C1TA 3M35A 2ZHQH 4I8LA 2Z3EA 2TRMA 2PTCE 3GY5A 1ELBA 3PV4A 1D3PB 5L2YH 4D9QA 3ZVGA 4LZ4B 2WPHS 1N6XA 1GMHG 2FXRA 3UR9A 4ZXXH 1F5LA 5T6GA 1CU1A 4THNH 4DIHH 3F6UH 1GI0A 1QB6A 1S6FA 2TGTA 4X6PA 1O38A 1W0ZU 2UUYA 1P2OA 3RMMH 1SGRE 1V2ST 2WINI 1ZMLA 3DFJA 3T28A 4OS7A 1O5EH 1TPOA 1ETTH 1P04A 3RC6A 1O5CB 1G36A 1O2RA 2BD3A 4ISNA 3RXPA 4FUJA 3SNAA 2BXTH 1NFUA 5DK1A 1EZSC 5DP6A 4X8UH 3LH3A 3E0NB 2BD8A 1ANBA 1L4DA 4GCHF 1C5YB 4AORA 5FAHA 2R0LA 3BIVH 1K22H 1O2HA 2OC0A 1LPKB 4KTUA 2Z6BD 1U6QA 1AKSA 1ZJDA 2F91A 3SO3A 1THPB 3UOPA 5JDUB 2V0BA 3UR6A 4ABGA 5JB9S 4X2WA 1MAYA 3MU8A 1SOZA 4GHQA 1EUFA 4ABEA 1QRWA 4GLYA 1FONA 1HV7A 1Y3UA 1TQ0B 2HRVA 1ZLRA 1VGCB 4BTUB 1O32A 3LGTA 1ESTA 3RXIA 2ULLA 3LGIA 4CRAA 5JBAS 3OX7U 4JZIA 2DUCA 4R8TB 1G32B 4ABAA 2ALPA 3DA9B 3M7UA 5C67A 4YTAA 3STJA 1BRUP 1NT1A 1EATA 1GI4A 1EZQA 1Z1JA 2HVXA 2R9PA 1MZDA 4H6SB 2AGEX 2PV9B 1O2JA 2VIOA 2CHAC 5EU8A 1O2YA 2Y6TA 4GSOA 1GJ7B 3UIRA 2C4FH 4AGKA 3EAJA 4MG3A 2QYIA 3MH7A 3TGJE 1JIMA 1C5VA 2OBOA 4FUEA 2BVXH 3UTUH 5L6NH 2NU1E 1TWXB 2ZFFH 1O3HA 1C5SA 1C4U2 1GMDG 2QY0B 1GG6B 4B2AA 3BG4B 2TGAA 4INHA 1IQLA 2XW9A 4NG9H 1C2LA 4WMDA 5DP4A 1AUJA 1K1PA 3SUDA 3EA8A 2ZFTA 1MKXK 1OYQA 2FOEA 3UFAA 3SU6A 1C5WB 1DUAA 1BRAA 1O30A 4RKJB 1GI7B 4BXSA 1XMNB 1A5HA 4YO9A 1BTXA 1C1RA 1BJVA 1GVKB 1FAXA 1ARBA 2FTMA 3BTHE 1N8OB 1O2UA 1A3EH 2ZGXH 3BTWE 1TRMA 3HPTB 2HGTH 3L33A 3T29A 1ETRH 3LOXA 1LHCH 1ORFA 1EP6A 3P6ZB 1JIRA 3SI4H 5FBEA 3FVFB 1BMNH 4BANB 1HCGA 3HGNA 3P8GA 1ZMNA 3LPRA 1ZSKA 3UQVA 3VB7A 1ELCA 3ATLA 4MNXA 2ZDNA 1SGIB 2ZZUH 4K2YA 3LGYA 1GI8B 1Z8JB 2ZDKA 1HJAB 4INLA 3UNQA 1FJSA 4CRFA 4AYVB 3OSYA 1D6RA 3RMOH 4NA9H 3V12A 3PYHA 1BTZA 1J16A 2P3FH 4MPUA 4Q7ZA 1NFYA 4VGCB 1AFQC 1IQJA 1V2VT 1MCTA 1GBDA 1QFKH 1TOCB 4MQAA 5DGJA 2BOHB 4QT8C 2BZ6H 3GCHC 1JWTA 4FU7A 3SNBA 3TGIE 1C9PA 2A4RA 2PUXB 1MQ5A 3P95A 5GPIB 4O3TA 2BOKA 4FUBA 2FO9A 3T5FH 3SU0A 2HPPH 2AMQA 2QIQA 2SFAA 1V2WT 1H8DH 8LPRA 3LC5A 3SN8A 1X7AC 1AIXH 3F68H 1GCDA 4B2BA 1W0YH 1FPHH 2G4UA 2H6MA 5E0JA 2EEKA 2BDGA 1GGDB 4BNRA 1IHTH 3NXPA 1NC6A 1NU7B 1OWEA 3BTME 3CS0A 3UQOA 5FPYA 2H1UA 4GPGA 3VXEH 3PROA 2PSXA 2JKHA 4YOGA 1P03A 2STBE 1HRTH 4WMFA 2VVCA 1MZAA 3A7ZA 4JZEH 2R0KA 5CHAB 1IQMA 1XKAC 4K69A 5F03A 2OC7A 1HUTH 2Y7ZA 3GDSA 2BY5X 5T6FA 1T4VH 1O3PB 2BDAA 5AFYH 5EXLA 4KELA 4Q7XA 2ZF0H 3HATH 1SGFA 1GHBG 1NM6A 5T6DA 4TPIZ 2Z3CA 1DX5M 2VWMA 3I78A 4X1QU 4X6MA 1DPOA 3LDXH 4O97A 2V6NA 4NWKA 1KXCA 2ZI2H 1CBWC 1MTWA 3PO1B 1B7XB 4YOIA 2BDIA 3TH3H 1BDAA 1XXDA 3MTYA 1ANEA 1QR3E 4Y10E 2SGQE 3LGWA 1A0JA 1W12U 2PLXA 2ZDAH 2LNCA 1SR5C 4DCDA 6ESTA 3GCOA 2PKSC 2BQ6B 3AAUA 4FVDA 3TK9A 2UUJB 4X6NA 2VGCB 3TJOA 4A6LA 1JBUH 1UVSH 3SU4A 1EX3A 1O34A 1TMUH 2ODQA 1LQEA 1S5SA 3V0XA 4YM9A 1C1VH 2ZHEH 3UPEA 2ZGBH 1WQVH 5GWZA 1TA2A 3O8CA 3E3TA 5GXPA 3HKJB 4XOJA 4TPYA 1SGDE 1C1QA 1GHVH 3QX5H 1ELGA 2M5TA 1C2KA 3QO6A 1CGJE 1GMHF 1O5BB 4IC6A 1NZQH 1SVPA 3MU4A 3GOVB 1VJ9U 1E37B 4ZHMU 5A0BA 2C8XB 2ZDVH 2XYAA 1C1WH 4JYVH 1DT2A 1YKTA 3F9FA 3NKKA 2OUAA 1O3BA 4YZUA 2C3SA 4FXGH 4FUHA 2FOFA 3VEQB 1Y8TA 1CHOG 1TIOA 2FWWA 2QA9E 2XTTB 1L1GA 3BTGE 1RS0A 1C5MD 1XUJA 3F9EA 1TYNA 3D62A 3SORA 4ZKNU 4CR5A 4SGBE 2A7HA 1O3OA 1O2LA 2XRCA 1O2KA 2BMGB 2H9HA 2ALVA 3IG6B 2HOBA 1BMLA 3LONA 2GDEH 1ZR0A 1CSOE 3NUMA 2A2XH 1NROH 4NFEA 4Q7YA 3QLPH 3RXJA 3P92A 4BAHB 2Y82A 5LPFA 1CQQA 2FI3E 5A0CA 2ZGCA 1F92A 2HNTF 2OQUA 5AVDA 2O8TA 3TVJB 8GCHG 3RXOA 3SI3H 1ZPBA 4HFPB 1XUFA 2OBQA 1H9LB 3D65E 2BDCA 3ZV9A 1P9SA 4AOQA 1AO5A 1E38B 5LPRA 4MDSA 1Z6EA 1T8OA 2GVFA 4ESTE 1HDTH 3MNBA 1QNJA 2NU4E 1D6WA 2VB0A 1SQAA 3AW1A 1TNKA 1S85A 1VGCC 2VWOA 1C5OH 1EAWA 1K1IA 4MNYA 3BIUH 4KKDA 3SV8A 3TPIZ 4K5ZA 1SOTA 4NZQA 2ZPSA 1GHYH 1OP0A 1W14U 5ESBA 3SJOA 2F9VA 1O2GH 3A80A 1GVLA 1O2ZA 4X2XA 1P05A 2ZCLP 2G81E 5EPNA 3U8TH 1GBJA 3OU0A 1C2MA 1QB1A 2IJOB 2BD4A 1LO6A 2B5TB 4ZHLU 2ZU4A 1O3LA 2H9EH 3NWUA 1C2FA 1SQTA 1ZRBA 2J92A 2DE8A 3GY2A 2AMDA 1F0TA 1G3BA 4ZKOU 5A8YA 1AZ8A 1FQ3A 3UNRA 2W26A 1B5GH 1ESBA 4Y8YA 1W7GH 2ZCHP 1TPSA 7KMEH 4UFDH 3RC5A 2O8WA 1HGTH 1S82A 3UREA 2HNTC 2A1DB 1GG6C 1UK4A 3BG4C 1IQHA 4X8SH 3N7OA 4DW2U 2CV3A 1SFIA 4FU8A 3A8DA 1ZSJA 2NU2E 1HNEE 3U8RH 3VXFH 4FUGA 4UFEH 1Y3YA 3LC3A 1F5KU 1V2KT 3C27B 1VITH 4CBNA 1NO9H 2OC1A 3ITIA 1NRRH 4JCNA 1AHTH 1AVWA 5A8ZA 5C20A 4BTIB 3B8JA 1O3NA 1N8OC 1O37A 1Z7KA 5AHGH 4MNWA 1OWHA 1PPZA 1O5FH 2AEIH 2FOMB 1BTWA 1TBQH 2GV7A 9LPRA 2Y5GA 3A7YA 2H5CA 3TH2H 4D76A 4BOHA 2J38A 1HJAC 2PHBA 3SUFA 3KEEA 1LHFH 2WYGA 2BLOA 5FX6A 5L30H 1TPAE 1UVTH