1C1MA

Porcine elastase under xenon pressure (8 bar)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PORCINE ELASTASE)
publication title Exploring hydrophobic sites in proteins with xenon or krypton.
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1mA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1mA01
4ZUHA 1IOEA 1INCA 5FHTA 4HFPB 1L0ZA 1ZTJA 3SBKA 1J9CH 1O2VA 2G5VA 1TQ7B 1XUFA 6CHAB 2ZU1A 4ABGA 2CJIA 1FY1A 2VIDA 3QN7A 4QT8C 3A80A 1DWBH 5T6FA 2ESTE 1V2JT 2BD7A 5A8YA 2G4UA 4UFGH 3RXQA 8GCHG 2A4GA 4I8HA 3TITA 3CS0A 1P09A 4MPUA 1YLCA 1DWEH 1LHEH 1HJAC 1BITA 5TCCA 5LH8A 1TMTH 1F7ZA 2GKVE 2ZDLA 3ZZ6A 1O2MA 1XM1A 2GV6A 4ISLA 1K9OE 1C5RA 1FPCH 1L1NA 3F9HA 2A4QA 3BF6H 1XKAC 2FDAA 1EKBB 3RM2H 1P05A 3A7YA 2A45B 1GJCB 3MO3A 1O3IA 1LPGB 2ZA5A 5K7RA 2BLOA 1SR5C 3BTKE 3SW2B 1C5LH 1SOZA 2WV5A 5ABWA 1EXFA 3BTTE 1EAIA 4X2VA 5DKMA 1GI4A 2Z9GA 2FLBH 2VH0A 3ZV9A 1M9UA 3ATIA 1J14A 1ANEA 1TPOA 1C2LA 2WUBA 3OU0A 1BZXE 4A7IB 3HATH 2K1QA 3BTME 4K1EA 5AFYH 2WPMS 1O3AA 3QWCH 3RXMA 2Q6DA 1MZDA 3QZQA 5GDSH 1F0RA 2GP9B 1CE5A 1GBBA 3IITA 2Y81A 5DPAA 4RN6A 1AZZA 1P11E 1W3CA 5E2OA 1GMDG 1VGCB 1OYTH 1O36A 1TGNA 1YPHE 2AMQA 4OGXA 1C4U2 2OD3B 1O3KA 1J8AA 1BDAA 1C2HA 1SQAA 6GCHG 3PTBA 4DY7B 3E6PH 3TVJB 2FM2A 1MBQA 3SHAH 1PQ5A 3SNBA 1SHYA 2UUKB 4INLA 4NGAH 4BNRA 4XFQA 2GMTB 3CS7A 1GBHA 2OTVA 3PTNA 3D62A 3RXLA 1LO6A 3U9AH 4DOQA 1SGQE 3RXRA 5T3HA 1JIMA 2ZGHA 2Z7FE 4Y79A 1E34B 1ORFA 1BTZA 1QBOA 2PSXA 4ISIH 1UTPA 5C2ZA 4CRCA 3BTDE 4NZLA 2V3OH 2A4OA 1C1PA 2BZAA 2A32A 4BAMB 1P2KA 1KTTB 4ZXXH 5L6NH 4YOIA 3SN8A 1DITH 5EGMA 2CF9H 1DE7H 1YKTA 1TONA 1ZRBA 1FONA 3MFJA 4UE7H 1F5LA 1L4ZA 1PPEE 2BB4A 1SL3A 3URDA 2VWLA 1IQNA 1GDQA 1DXWA 2WV4A 2OBQA 4ABIA 1BMLA 3NCLA 1P03A 1D3QB 4SGAE 4Y7BA 3M3TA 2BY8X 1EAUA 3VGCC 1AKSA 2QY0B 3TIUA 1QRWA 5DP3A 3VB3A 4B2BA 1NRNH 1A1RA 3UNRA 4AFZA 2A7JA 1IQGA 1CA8B 2G81E 1LTOA 2ZU2A 1TPPA 2B0FA 1TNKA 2KAIA 1AIXH 1LPKB 2VVCA 5GPIB 1BRBE 1ELEE 3P6ZB 5CMXH 2EC9H 1CSOE 4H6SB 2Z94A 2BLQA 2JH0D 1YYY1 3UOPA 1UVOA 2XCFA 2F3CE 4O3TA 4D76A 2ZFRH 2AYWA 5C5NA 1TE0A 2XXLA 3RXVA 1K1PA 2FX4A 1Z1JA 3KEEA 2O9QA 4NA8A 3LGTA 1OX1A 1TX8A 2FOAA 1TRNA 1KSNA 2R3UA 4JYUH 1XUGA 2VGCB 3BSQA 2A4RA 1S82A 1O39A 1MTUA 4A1VA 2PTNA 1V2NT 1J15A 3M7UA 3TH4H 4Q7YA 5C1YA 2GX4A 3GY8A 3WY8A 1BJVA 3UWJH 4BXWA 2TPIZ 1AFQC 1D3PB 1DPOA 4RSPA 3KCGH 2G55A 1IQJA 2SGEE 1EQ9A 2F9OA 2ZP0H 1OWEA 5EG4A 4BTIB 5HGGA 5F8ZA 2FI3E 1VCQA 1B7XB 3QGJA 1QA7A 4ZROA 3ZZ7A 1MD8A 1N8OB 4DIHH 3QGNB 4BAHB 4GVUA 5I25A 1NO9H 2R2WU 3R0FA 1V2PT 4GAWA 4R8TB 1S0RA 3HKIB 4ZAEA 3BG4C 3UNSA 1QL8A 1BCUH 1T8LA 2JKHA 2G51A 2BOKA 4X1NU 2ZC9H 1KY9A 3SO3A 1V2OT 1HV7A 3PYHA 3E16B 3M7QA 2V6NA 3TLOA 4Y0YE 2ZDMA 4BTTB 2JETB 1GGDC 3VB7A 1HAPH 1C2GA 1O5GH 1GMCF 2BQ7B 1YPLH 1HRTH 2B9LA 1DLEA 3GY6A 2PGQB 3MNCA 1Y3VA 1GJ7B 2J94A 1EOJA 1ESTA 1QURH 1P9SA 3RXJA 4XOJA 4B76A 1GJAB 4MTBA 3GY5A 5SGAE 1ZMJA 2WINI 1AKSB 1GI1A 4FU7A 3SUDA 5J4SA 5DGJA 1SC8U 3S9AA 2ZGXH 5I46H 2UUJB 2EA3A 3Q3KA 1GVZA 1SLXB 1O38A 4INHA 3FP8E 4BAOB 4FU8A 3FANA 2C93B 3ZVCA 4TY7A 5FPYA 3TJNA 3LONA 4AG1A 3SNCA 1WQVH 4YZUA 4ESTE 3BIUH 4NFFA 4LZ4B 2A5AA 4JZ1A 1P3CA 1K22H 3EE0B 4E7NA 3K9XB 1A0HB 1Y3UA 5HMAA 1HAYB 4YO9A 1VR1H 3ZYDA 1CA0C 2OC7A 2XBYA 3TNTA 3KHVA 3EA7A 3PLPA 3RXDA 3P8FA 1XUJA 1MTNB 2XYAA 3KF2A 4GSOA 5EW1H 1S85A 4B71A 3PWBA 4D9QA 1HAIH 2BD9A 1TPSA 2ZI2H 2VINA 3TPIZ 2Z9KA 1RTKA 1P06A 1EUFA 4WH8A 2CGAA 4I31A 4YTAA 4INKA 2FI4E 3A81A 3RLWH 1AUTC 4A6LA 3RXKA 1V2KT 4RKOB 3QK1A 4OS4A 3TNSA 1UVTH 2GGVB 1K21H 4UFEH 1MMJN 5EPYA 2P93A 2SGFE 4NIVA 5GWZA 4CREA 5E0HA 5H4IB 2EI7A 1YPJH 1G3CA 5L2ZH 4X2WA 1O32A 3RUOA 3GDSA 2VH6A 1P02A 2H2ZA 5T6DA 4JCNA 5B6OA 4U2WA 2HVXA 1S6FA 4K8BA 4O3UA 4FUJA 1T8NA 6LPRA 2ZDNA 4B2AA 3MWIU 4FU9A 1Z6JH 4K60A 2VVVA 4A92A 1HAVA 3P17H 1P57B 5C3NA 1FY3A 1LPZB 1QGFA 3U8OH 4FXGH 2RG3A 3U8RH 1H1BA 4H6TA 2A2QH 1PPHE 3SJ8A 2Z3DA 1HJ8A 3SUEA 1N6YA 1H8DH 1TX7A 3FP7E 3MI4A 3HK6B 4PROA 5GJ4B 2P95A 2GTBA 1MU6B 1N1LA 4AG2A 3UREA 1CHGA 1GMHF 2G52A 1WCZA 4IW4E 3VB6A 3KN2A 3ZYEA 3F68H 4X8SH 2Y6TA 4K5ZA 4Z0KA 2V35A 4IN1A 4UONA 5HM9A 3TJUA 2WUCA 5JB9S 3SJOA 4YM9A 1OKXA 2ZTZA 4ISOA 1XX9A 1JIRA 3ZVBA 1NM6A 3GCHB 2ZCHP 3A87A 1HAGE 3BIVH 2ANYA 2BHGA 2AGIX 1GI9B 1ELVA 1YGCH 1KIGH 3GYMA 1ZPZA 1LHFH 1QA0A 1UTLM 2XWAA 4FUHA 4O97A 3DFJA 3RXFA 4AORA 2QA9E 2BDAA 2QXGA 1SGEE 1AZ8A 1FJSA 1RJXB 4X8TH 2FTMA 1GPZA 2VIWA 1K1JA 3H5CB 3ZZ4A 2H9TH 1YP9A 2H9EH 2ZWLH 1GJ6A 4XBBA 1EAXA 3AASA 1AO5A 1OWIA 1KTSB 7KMEH 3MO6A 2QYIA 1XMNB 2ZHFH 3UY9A 1TRMA 3AW1A 4UFDH 3GOVB 3QTVH 2FX6A 4MPWA 4X6NA 4DG4A 2Y80A 4B74A 1O2HA 3FFGA 3MU8A 2QAAA 1ELBA 2P94A 3QLPH 1NFUA 3A7TA 3QDZB 3MMGA 2OC0A 3K6YA 1EB2A 1ZTKA 1LVBA 3BN9A 4FUBA 1HAVB 2ZU4A 2QN5T 3ATLA 3EGKH 1MU8B 1GJDB 1WQSA 1S5SA 2BZ6H 3ATMA 3SV2H 1GMCG 3M5NA 4YLQH 3MTYA 3Q3YA 3M36A 3S7HB 2OCVB 2XNIA 1JMOH 2ZFTA 1L2EA 3HGPA 5AVDA 4O03A 1DDJA 2ODQA 1C9TA 2FO9A 4AFSA 1C1MA 2NU4E 1YPKH 3MU0A 4ABJA 2ZZUH 1Q3XA 3RC4A 2P59A 1MTWA 3LGYA 3U69H 1S84A 7ESTE 1ZZZA 1GBIA 2TBSA 2Z3CA 5JPMH 2OQ5A 1Y3YA 3HK3B 4I8KA 3BTGE 1O31A 3TK6A 4D8NA 5K0HA 1ZYOA 4JYTA 4K1TA 5L30H 4D9RA 1AWFH 3BTEE 2ALVA 3V0XA 3SV7A 1O2WA 3SU3A 3LC3A 1DY8A 2XW9A 2WYGA 2O8UA 3NXPA 1SVPA 1AB9C 4VGCB 3P8GA 2ZHQH 1HXEH 2QC2A 4ABEA 3BTWE 2XCNA 1WUNH 4WMEA 1GDNA 1ZSLA 3M3VA 3Q3XA 1O3OA 3EYDA 1HLTH 1T4UH 3RU4T 2QIQA 1KXCA 3KQEA 3SQHE 2VJ1A 3MOCA 3B9FH 3T5FH 5BRRE 1TLDA 1OXGA 2H9HA 4FUFA 2TGDA 5ESBA 1K1LA 4KGAA 3A8DA 4UD9H 1G30B 4YESB 7GCHF 1KLTA 2AS9A 1P2NA 1O5EH 2A31A 3GDVA 4A1TA 1OP0A 1THRH 3ODDA 2THFB 2FPZA 1HJAB 1NFWA 4U30A 4I32A 1GI6A 1LHDH 3VB4A 1AWHB 2QGRA 3RC5A 1LVOA 3ZZDA 1DUEA 2Y7XA 2V0BA 4WH6A 2OQUA 1EZXC 3PWCA 5L2YH 1O3LA 4NWKA 3A7VA 3EA9A 3SV9A 2HWLB 4OGYA 2FI5E 1C5QA 1NU7B 1CU1A 8LPRA 4B75A 1O33A 1O3JA 4Y0ZE 1PPFE 1AI8H 3RXUA 2SGAA 1D9IA 3RMLH 1W14U 3S0NA 3SNAA 4E05H 2EI8A 3RU4E 3VB5A 5HXFA 1O30A 2J92A 1UVSH 2NU2E 2GVFA 4XDEA 3KGPA 1C1NA 1TYNA 1O2JA 2ANWA 4IMZA 2SGDE 4GHTA 3LJJA 1O35A 1DY9A 1QHRB 1TFXA 2ALPA 1CQQA 1E0FD 1HAXB 1LKAA 1PPZA 2Z9IA 3A7ZA 3RLYH 2J95A 3STIA 1ZJDA 2Z3EA 5EQSA 3OY5U 5DP8A 1BJUA 5JBCS 2IN2A 1O5DH 1SGYE 1C2JA 3MU5A 1O2XA 2BDYA 1MBMA 2EI6A 1XKBC 3EQ0H 1TIOA 3BEUA 1L1GA 1O2PA 1GL1A 1GCDA 1C5OH 1GMHG 1E37B 2B7DH 4CRAA 3RXIA 3W95A 3VEQB 3D65E 2C4FH 1P3EA 1JXPA 5LPRA 1O5FH 3ZVDA 3A86A 1AFEH 1AVWA 1NT1A 2Y7ZA 4R0IA 4I8LA 4I33A 3B8JA 3PV4A 3U8TH 1TMUH 1KXAA 4NFEA 1XXDA 3L3TA 1ZRKA 1C5UA 1SLVB 2NWNA 1J17T 5EPNA 4AN7A 5DP9A 1B5GH 1MTSA 1TNLA 4MNYA 1F0TA 2VWOA 3M61U 1GBFA 3KQBA 1GDUA 4E06H 3A83A 3PB1E 4M7GA 1DSUA 2BVRH 2J34A 4AOQA 2UWLA 1TNIA 3PROA 3SV6A 3LDXH 3OTJE 3PM3A 1ZGIA 2FLRH 4BANB 1UTJA 2FWWA 4ZKNU 3PLBA 1GI5A 2CHAC 2CHAB 2ZGBH 1S0QA 1P2OA 5FPSA 1GVKB 1P2IA 1GHBF 3G01A 4BAKB 1GL0E 2ZEBA 3M35A 2EEKA 3GCNA 2HRVA 3OYPA 4DT7B 3M7TA 3LGIA 2FOFA 3K65B 1QY6A 1GBEA 4GLYA 4F4OC 1O3MA 1IQIA 4OS6A 1BMMH 1T8OA 3A8BA 3P8NA 4XE4A 1GBLA 2OINA 1BHXF 5EXMA 4K8YA 3TH3H 5C67A 4Y6DA 2FEQH 1W11U 4MPXA 4Y8XA 1GBJA 3P70B 3DT0H 2PW8H 1BOQA 2OXSA 4CBOA 3Q00A 2RA3A 1C9PA 1V2WT 3O8CA 5FXLA 1SLWB 2IJOB 5GCHG 2OC8A 1UCYH 1BT7A 3RXAA 4CHAB 1BHXB 1MH0A 3VGCB 4CHAC 4LZ1H 1AHTH 1GJ8B 4NG9H 1QRXA 2STBE 2BVXH 2H5CA 3IG6B 5TCAA 4X0WU 2ZIQH 2HPPH 3EDXB 2OBOA 2VB0A 1ZSJA 3ITIA 1EZSC 4B2CA 2PKAA 2ASUB 1QJ1B 2BY9X 1QJ7B 5DP5A 4JMYA 2P8OC 2P8OB 1NPMA 1WU1A 1JWTA 1K1IA 5BPEA 2TGTA 1B0EA 2I6QA 2NU0E 1LKBA 1ZJKA 3RXPA 1W2KH 3QO6A 1T8MA 2BD3A 1LHGH 3QUMP 1NRQH 1O3EA 1TPAE 4X6MA 4XBCA 1HIAA 1O34A 4U32A 3T25A 2W3KA 1HJ9A 1D4PB 1LQDB 4ISNA 4YT6H 4IN2A 3FZDA 1H9IE 1SBWA 1V2RT 1V6DA 4Q80A 2FOHA 1Z71A 3SJIA 1A3BH 2WYJA 3MU1A 3RMOH 1UCYK 4AGJA 4KTUA 2DE8A 1D6RA 4DIIH 1RTFB 1AMHA 1V2ST 1ZMNA 2O8MA 1GHXH 1AFQB 1OWDA 2O8WA 4ZKOU 3P95A 2AGEX 1TQ0B 1KXFA 1GG6C 1GG6B 1GVLA 2GZ8A 1NTPA 3UIRA 1ETTH 1DICA 1O2LA 4A1XA 7GCHG 2IPHA 1FI8A 2ODYB 3U1JB 1ANBA 2ZFFH 3BG4B 1BTPA 4KP0A 3ATWA 1XUHA 1UMAH 3TU7H 3A7XA 1VCWA 4IC6A 1GBTA 3GICB 2ZDKA 4MDSA 1HAOH 3AVZA 4LK4A 2AIQA 1A3EH 1GGDB 4ZXYH 1YF4A 1IQEA 3BTQE 1RRKA 1E36B 1AU8A 3QZRA 4XSKU 1PJPA 5A0AE 1NESE 1TGCA 1OPHB 3F1SB 3UQOA 5A0CA 1C5WB 1BUIA 3TGJE 1BTYA 1MQ5A 4FUCA 2ULLA 3GCTF 4WF8A 1CVWH 3MH7A 2YNAA 3H7TA 1ZPBA 5GIBA 1KXBA 2ZPRA 1KXEA 4Y11E 2PKAB 3SI3H 1ZPCA 1O3HA 1WSSH 1ETSH 2R9PA 4CR9A 1T32A 3MHWU 1W8BH 1W10U 1DT2A 3TK9A 3OX7U 1MQ6A 2KAIB 1A4WH 1A5GH 2H5DA 3T29A 3MH4A 4HZHA 2LNCA 4OS7A 3RXOA 3ZVGA 1ZLRA 1Y3WA 5LPFA 3M5OA 2BY6X 1F5RA 3I77A 1YC0A 3F9GA 5EW2H 1Z8RA 2BD5A 1C1RA 4RKJB 1GBKA 1CA0B 1O2NA 1SGDE 2SNWA 1Z1IA 2P3UB 3SNDA 1C1VH 1T4VH 1QB6A 1EJMA 3SU0A 2D26C 1EZQA 1YCPH 2F83A 1Y5AT 3BEFB 4LOYH 2FOMB 4DCDA 1V2MT 1BTUA 3KL6A 1GI2A 3GISB 4WMFA 2C3SA 5ESTE 4UEHH 1EJNA 1C5MD 1T31A 4JZEH 5LPEA 2Z9JA 3FP6E 3GDUA 4FUEA 4Y7AA 3UFAA 4OS1A 2Y5GA 1YPMH 2HGTH 1GI7B 1FIWA 3M3SA 5DJ7A 3TH2H 1BMAA 1SMFE 1FUJA 2G4TA 4O9VA 5T6GA 1GHVH 1SFIA 1TNJA 1O2YA 3VPKA 1MUEB 2PGBB 1AE5A 8KME2 2BDHA 2PLXA 2XTTB 4CRDA 1GHBG 1PQ8A 1AUJA 9LPRA 3S9CA 2B8OH 2ZKSA 1DWCH 3EAJA 2ZO3H 2G8TA 1PPBH 5A0BA 2VVUA 1TNHA 1PQ7A 2ZECA 1QQUA 4IMQA 3AAVA 1S83A 3DHKH 3LGUA 4NIYA 1GBAA 1FQ3A 1K1NA 1YCPK 1EPTA 3SQEE 2DE9A 5GXPA 4HGCA 3RXBA 1AE8H 5CHAB 5CHAC 1CBWC 1CBWB 1HUTH 3U98H 4K1SA 2QF3A 1C2DA 1O2RA 2QXHA 3SZNA 1TABE 4MLFB 2RDLA 1CHOF 2FS8A 4MVNA 1YLDA 1FV9A 1SG8B 2ZGJA 5CE1A 1KLIH 3QX5H 2D1JA 2W26A 1O5AB 3SU2A 1LVYA 1TB6H 4MG3A 5C1XA 2GZ7A 4A5TS 3LOXA 1BIOA 1DM4B 4TPYA 1C5PA 1NRSH 2ZF0H 1TAWA 1OWHA 2CXVA 4CRBA 1TGSZ 5HYOA 1O5BB 5A09A 5IDKA 3JZ2B 1O2ZA 4JK6A 2XC0A 3ZZ3A 1HXFH 1ARCA 1ZOMA 1ZSKA 1C1OA 1P01A 1EOLA 1PQAA 1A46H 1C5VA 4FUGA 3A7WA 1E38B 4Q2KA 3SGBE 1H9HE 1SGFA 4J2YB 1LHCH 1UCYE 2BDIA 1YM0A 4AGKA 1H4WA 1Y3XA 3F9FA 1UVUH 4UFFH 1FIZA 3LGVA 2HNTF 1SSXA 2R0KA 1THPB 2GCTC 2GCTB 1F2SE 2SFAA 2YOLA 3IWMA 1O2UA 1BTHH 1ANCA 1NFXA 4ZHLU 1OWJA 2FOEA 1LQEA 1MKXH 2ZCLP 1MAYA 1O2SA 1DVAH 1X7AC 2FXRA 1CGJE 3LH1A 1AD8H 1RIWC 1RIWB 1V3XA 2HNTC 1Y5BT 2BTCE 5TJXA 4WXIA 1FDPA 2FOCA 1QNJA 1SGRE 4U01A 1SGPE 1OP8A 4Q7ZA 5JBTA 4JZFH 2SGQE 4WY3A 2J2UA 1U6QA 1KLJH 5FX6A 2BDBA 4THNH 2NU1E 1ELAA 2PV9B 2FS9A 3RXGA 5FPTA 1EPTC 1EPTB 1QL7A 3T27A 1C2MA 4ZHAA 4DURA 2ZHDA 1FAXA 4NSYA 2OUAA 2ZFSA 2PFEA 2YNBA 4LXBH 3S7KB 2UWOA 1DXPA 2VIQA 4MNXA 2P3TB 2UWPA 4AFQA 1O2QA 1VJ9U 4ZKRU 3SU5A 1FZZA 2VWNA 1OP2A 2Y82A 3GCTG 2TRMA 1C4V2 1PFXC 1MKXK 4IC5A 1SHHB 1BRCE 1SQOA 2PHBA 1T7CA 1ACBE 1DFPA 4X6PA 2ZCKP 2BY5X 3ZZ5A 3S9BA 2XBWA 3E91A 1C1WH 4ABAA 1QL9A 3UWIA 2BLWA 1AY6H 3V13A 4K3JA 1O3NA 1GJ9B 4WWYA 4GCHF 1VITF 4TWWA 1ELFA 1HGTH 2WPLS 1Y8TA 1JRSA 1PYTD 5E0JA 2O8LA 4MQAA 5JYIA 1GJBB 3NK8A 5PTPA 1AB9B 2ANKH 4WMDA 2PKSC 2PKSB 3A85A 3ELAH 4NA7A 4DJZB 1HBTH 2CMYA 1L1JA 1H8IH 2FTLE 5FX5A 2BD2A 1MD7A 3N7OA 3E3TA 2M5TA 3HGNA 5EXLA 1Y59T 3GY2A 1QCPA 2GT8A 2Z9LA 3V7TA 4FUDA 1YPGH 1BA8B 3GCOA 2JH6D 3SJKA 4AZ2B 1QTFA 2R2MB 4Y76A 5C20A 3O8RA 1ABJH 2GDDA 1ELDE 1CGHA 5DP4A 1O3CA 2ZDVH 2BY7X 1C1TA 4ABFA 1UO6A 1C2FA 3NWUA 3RXHA 5A8XA 1GJ4H 1TGBA 4CR5A 5G4BA 3MNBA 3A84A 6CHAC 2BQ6B 1BTXA 1PYTC 2GCHF 1QBVH 1P8VC 1O2IA 4X1SU 1O2OA 3NKKA 1CT4E 4DGJA 1TA6A 1F0SA 1WBGB 2SGPE 3URCA 1AGJA 1O5CB 1HAZB 1YPEH 2BYAX 4KTCA 1O0DH 2J9NA 4FVBA 1YBWA 1BBRH 3LH3A 3PLKA 2A7CA 3M5LA 2W7UA 3NUMA 2J4IA 5E2PA 1JRTA 1ZHRA 4MNVA 4E7RG 1HB0B 2O8TA 4Y10E 4GPGA 1ZTLA 4H42U 5C5OA 5J4QA 2CN0H 4WVPE 1LDTT 1GHZA 5E8EH 5ETXA 1C5YB 2ZQ2A 3M5MA 1YPHC 3A82A 1NY22 2F9NA 1SB1H 1XUIA 1A0JA 3FZZA 3QTOH 5FCKA 1P12E 2ZPSA 4X1PU 1CHOG 1W7XH 3SORA 4ZH8A 1KDQA 1C2EA 1VCPA 1VJAU 3ESTA 3SU6A 4WJG2 1EAWA 4BAQB 1TMBH 4D7FA 3OY6U 1FY4A 1NU9A 1TALA 1FAKH 1ABIH 3UPEA 5EXNA 1BBRK 3A8CA 1GHAF 1CT0E 2FZZA 1TBRH 1DWDH 1QB9A 2GDEH 2CF8H 3E0NB 2G00A 3GY3A 4AB9A 1BMNH 3LIWA 3AW0A 2F9BH 1DOJA 1GI0A 1VGCC 1UK3A 2PTCE 4JZDH 2GZ9A 3S69A 3Q76A 2F91A 4D7GA 4JK5A 1BTWA 1QRZA 1OYQA 1RXPA 1TBQH 1C5SA 4X2YA 1G3DA 2ZHWH 1WAYB 4NIXA 1SI5H 1IAUA 1C5XB 3A8AA 3ZVAA 1PPCE 1O3BA 3RMNH 2GMTC 4OS5A 1V2LT 2F9PA 2WPHS 1IQLA 7LPRA 3B23B 3SJ9A 3SU4A 1UTMA 4K69A 3MH6A 4X6OA 3L6PA 1A0LA 2PSYA 3UR6A 2FESH 1A5IA 3ZVEA 4B73A 2PUXB 2C8XB 1Z8GA 2W3IA 3TGIE 4AFUA 1EZUC 1TNGA 3LU9B 2ZQ1A 1TA2A 4BTUB 2BOHB 2C8YB 4YLUA 1P0SH 2H6MA 3UUZA 3LC5A 2OC1A 1V2QT 1B0FA 1W0ZU 1FXYA 4Y71A 2C8ZB 1RS0A 1G2LA 4K2YA 3D23A 3LT3A 1GWAA 3E0PB 3RXCA 1TBZH 2WPIS 3FAOA 1LMWB 3SU1A 1IQFA 1V2VT 4UDWH 1QQ4A 1FN8A 3KNXA 1K2I1 3EA8A 1HPGA 4DVAU 1DSTA 5HM2A 3V12A 1TX6A 1KDQB 1BRUP 1GCTB 1GCTC 2AMPA 1A61H 2P16A 5DG6A 3UNQA 1ZR0A 1F92A 3FVFB 3BTHE 4CRGA 2BDGA 3HPTB 1O2TA 4X2XA 1YCPM 3K6ZA 1EP5A 3CP7A 4KTSA 4Y8ZA 1P2MA 3U1IB 4IS5A 4F49A 1SGIB 4J1YA 3RXSA 1Z8JB 3ZZ8A 4GCHG 1A7SA 1VITG 1A2CH 1TOCB 2ANMH 2XBXA 3SOSA 2STAE 4GUXA 2PUQH 4CRFA 1TWXB 2ZG0H 1SGFG 3PMAB 3DFLA 1UTKA 4TPIZ 3SGAE 2I6SA 1MAXA 1O3FA 2SNVA 3I29A 1Z6EA 2UUFB 4NSVA 3T2NA 1CT2E 3DUXH 3E8LA 3T26A 2R3YA 2VIPA 1GHYH 5E0GA 1K1OA 1NN6A 1SOTA 3PO1C 3PO1B 2VGCC 2BVSH 6ESTA 2Q1JA 2G5NA 1UHBA 3ZZ9A 1GI3A 1NFYA 3HKJB 3R3GB 2ZGCA 2BXUH 4KELA 1ZMLA 1O3DA 3BEIB 3BTFE 3KQDA 5EOKA 2HALA 1NC6A 3ENSB 3TK5A 2A0QB 2Y5HA 2AEIH 5EQQA 2ILNA 4I7YH 2GCHG 1UTOA 4JYVH 1THSH 4ASHA 1DLKB 2AH4X 1N8OC 1V2UT 4AYYB 1S81A 3RC6A 2Z6BD 4HTCH 4ZMAH 1UJ1A 2AIPA 1HAHH 4H4FA 1RTLA 1V2TT 4YT7H 1Q2WA 1FN6A 1C5NH 1HFDA 2VNTA 3P8OA 1ZHPA 2ODPA 2BX4A 1H9LB 4CH8B 1NRRH 2JETC 1WYKA 2VU8E 4NZQA 5FBIA 3V3MA 1KYNA 3NZIA 4IBLH 3F6UH 1SLUB 2FMJA 5DK1A 2ZPQA 1ARBA 4MNWA 2GD4B 1K28D 1D6WA 1UK2A 4Q7XA 1TGTA 2FYQA 1O3PB 2BQWB 1WTGH 3O8BA 4MPVA 2AGGX 3KQCA 2ZDAH 1CO7E 2Y5FA 4YOJA 1GBMA 3JZ1B 2ZU5A 1ANDA 1HIAB 1P9UA 1VITH 2WPKS 5EU8A 3MU4A 1AVXA 1DX5M 4TYDA 3NPSA 1BBRE 2CV3A 1RFNA 2XBVA 1UVPA 2HOBA 3PMBB 3L33A 2OLGA 1ELTA 3MNXA 3GYLB 2VIVA 2ZFQH 1AN1E 1GHAG 2J38A 2IOTA 2QF0A 5DP7A 3GY7A 3ATKA 3C27B 1DANH 2OP9A 3ZZCA 1HNEE 5DO4H 2P3FH 2C8WB 2W5EA 2C90B 1MTNC 4BOHA 2FP7B 3DD2H 3RMMH 1W13U 4ZKSU 1FNIA 1D3TB 1XVOA 2FIRH 1OWKA 1UHBB 4NWLA 3E1XB 4X1QU 1BQYA 3SUFA 3A88A 1E35B 2XRCA 5F8TA 2QXIA 1OSSA 1ETRH 3MO9A 8GCHF 3BV9B 3RM0H 3UQVA 1C2IA 1CGIE 2FODA 2QXJA 2W7SA 2D8WA 4WXVA 4NCYA 1MKWH 2ZHEH 3SGQE 5JDUB 4ZHMU 5A8ZA 1BRAA 1C1SA 5C1UA 2F9VA 1GBDA 1OS8A 1FY5A 1J16A 4ABBA 1K1MA 4IGDA 1EX3A 2RA0A 4AB8A 4CH2B 1EB1H 2BD4A 1UK4A 1Z7KA 3TJVA 2A5IA 1NRPH 1GBCA 3RP2A 3UOUA 3VFEA 1XVMA 1O3GA 4JZIA 2A2XH 1P10A 3MH5A 2ZFPH 3ZZAA 3SNEA 1F0UA 1SGTA 4ABHA 3SI4H 1HDTH 2A1DB 2V3HH 3E90B 3M37A 2JH5D 1LVMA 1MTVA 2FYRA 1P2JA 1GJ5H 1EJAA 1DUAA 1QIXB 4DW2U 4X1RU 1WOFA 1SFQB 5LGOA 1TOMH 2VWMA 4NIWA 1AQ7A 1FMGA 4ABDA 1ELCA 1MKWK 5AHGH 1JBUH 1XXFA 1ELGA 1XUKA 1G36A 1AVGH 4B1TA 3W94A 9ESTA 2D2DA 4X8VH 2R0LA 1G3EA 1TRYA 3O8DA 4BXSA 1EASA 2HPQH 1GI8B 1LCYA 1IQKA 1A5HA 3LGWA 1PPGE 2FOGA 8ESTE 1GMDF 2NU3E 4Y8YA 1QBNA 5AFZH 1SQTA 1SPJA 5IYTA 1P2QA 3T62A 1ZHMA 4X8UH 3SHCH 3LPRA 1ID5H 3F9EA 1QFKH 5F8XA 1JOUB 3LJOA 1IQMA 6GCHF 1WV7H 2A7HA 1C1QA 1D3DB 1SGCA 2AFQB 3AAUA 3GCHC 1N6XA 2F9UA 3D49H 2B5TB 2BDCA 5EQRA 3C1KA 3SUGA 3MNSA 3Q77A 4HI3A 4SGBE 1NROH 2QV1A 1L4DA 1P04A 1C2KA 1DS2E 1HCGA 4AX9H 5AF9H 2FOBA 5JBBS 1W12U 3T28A 2TIOA 2ZTXA 1O2GH 1G32B 4I8JA 2TGPZ 2UUYA 4GHQA 5JBAS 2ZTYA 3P92A 1QR3E 2BLVA 5F03A 2PWXA 1O2KA 1NZQH 3ZVFA 2RCEA 1G2MA 1QJ6B 2HLCA 3CENA 3PMHB 2AERH 1WTHD 1MZAA 2GT7A 2BM2A 1GHWH 4I8GA 1IHSH 3OSYA 3I78A 3PMJA 1G37A 4ISHH 2XC5A 4FUIA 3MYWA 2VIOA 1Z8IB 1C1UH 1BB0B 3UR9A 1SGNE 3GY4A 2QCYA 1QB1A 1MCTA 1UTNA 1FLEE 3SV8A 5GCHF 3RXEA 2ZNKH 1O37A 1UTQA 1MCVA 2A5KA 4FVDA 1C4Y2 2Q6GA 3ZZBA 2HNTE 3TGKE 1NS3A 3ZV8A 2XWBI 5DP6A 1F5KU 2TGAA 3LKWA 3RU4D 3DA9B 1Y5UT 3K2UA 2XC4A 4KKDA 3RDZA 5FCRA 2AMDA 2GV7A 4YOGA 1OOKB 3KIDU 5FBEA 2BX3A 1VZQH 1Q31A 3ODFA 4OS2A 1ESBA 2DUCA 1ZGVA 4AYVB 1IQHA 2H1UA 1W0YH 5JB8S 1IHTH 1G9IE 2BMGB 2BXTH 3RXTA 1S6HA 1C5ZB 2PR3A 3A89A 4NA9H 4XBDA 1EATA 5FAHA 1RD3B 4TY6A 5F6MA 2Q6FA 1HYLA 4VGCC 5EODA 3VXEH 3H7OA 3UTUH 1KXDA 5A2MH 2ZU3A 1G3BA 1W7GH 4CBNA 1C5TA 3BG8A 3VXFH 3STJA 2BD8A 4Z6AH 1RGQA 1ESAA 4TWYA 3TJOA 1EP6A 1FPHH 2WPJS 2LPRA 1FY8E
chains in the Genus database with same CATH superfamily
4ZUHA 1IOEA 1INCA 5FHTA 4HFPB 1L0ZA 1ZTJA 3SBKA 1J9CH 1O2VA 2G5VA 3CNRA 1TQ7B 1XUFA 6CHAB 2JDID 2ZU1A 1E1QD 1W0KD 2CJIA 4ABGA 1FY1A 2VIDA 3QN7A 4QT8C 3A80A 1DWBH 5T6FA 2ESTE 1V2JT 2BD7A 5A8YA 2G4UA 4UFGH 3RXQA 8GCHG 2A4GA 4I8HA 3TITA 3CS0A 1P09A 4MPUA 1YLCA 1DWEH 1LHEH 2WV9A 1HJAC 1BITA 5TCCA 5LH8A 1TMTH 1F7ZA 2GKVE 2IPQX 2ZDLA 3ZZ6A 1O2MA 1XM1A 2GV6A 4ISLA 1K9OE 1C5RA 1FPCH 1L1NA 2F4LA 3F9HA 2A4QA 3BF6H 1XKAC 2FDAA 1EKBB 3RM2H 1P05A 3A7YA 2A45B 1GJCB 3MO3A 1O3IA 1LPGB 2ZA5A 3KYFA 5K7RA 2BLOA 1SR5C 3BTKE 3SW2B 1C5LH 1SOZA 2WV5A 5ABWA 1EXFA 3BTTE 1EAIA 4X2VA 5DKMA 1GI4A 2Z9GA 2FLBH 2VH0A 3ZV9A 1M9UA 3ATIA 1J14A 1ANEA 1TPOA 1C2LA 2WUBA 3OU0A 1BZXE 4A7IB 3HATH 2K1QA 3BTME 4K1EA 5AFYH 3F2HA 2WPMS 1O3AA 3QWCH 3RXMA 5KECA 2Q6DA 1MZDA 3QZQA 5EJLA 5GDSH 1F0RA 2GP9B 1CE5A 1GBBA 3IITA 1K0HA 2Y81A 5DPAA 4RN6A 1AZZA 1P11E 1H8ED 1W3CA 5E2OA 1GMDG 1VGCB 1OYTH 1O36A 1TGNA 1YPHE 2AMQA 4OGXA 1C4U2 2OD3B 1O3KA 1J8AA 1BDAA 1C2HA 1SQAA 6GCHG 3PTBA 4DY7B 3E6PH 3TVJB 2FM2A 1MBQA 3SHAH 1PQ5A 3SNBA 1SHYA 2UUKB 4INLA 2QE7D 4NGAH 4BNRA 4XFQA 2GMTB 3CS7A 1GBHA 2OTVA 3PTNA 3WWBA 3D62A 3RXLA 1LO6A 3U9AH 4DOQA 1SGQE 3RXRA 5T3HA 1JIMA 2ZGHA 2Z7FE 4Y79A 1E34B 1ORFA 1BTZA 1QBOA 2PSXA 4ISIH 1UTPA 5C2ZA 4CRCA 3BTDE 4NZLA 2V3OH 2A4OA 1C1PA 2BZAA 2A32A 4BAMB 1P2KA 1KTTB 4ZXXH 5L6NH 4YOIA 3SN8A 1DITH 5EGMA 2CF9H 1DE7H 1YKTA 1TONA 1ZRBA 1FONA 3MFJA 4UE7H 1F5LA 1L4ZA 1PPEE 2BB4A 1SL3A 3URDA 3FO8D 2VWLA 1IQNA 1GDQA 1DXWA 2WV4A 2OBQA 4Q63A 4ABIA 1BMLA 3NCLA 1P03A 3WWFA 5CDFE 1D3QB 4SGAE 4Y7BA 3M3TA 2BY8X 1EAUA 3VGCC 1AKSA 2QY0B 3TIUA 1QRWA 3H09A 5DP3A 3VB3A 4B2BA 4P00A 3PRBA 1NRNH 1A1RA 3UNRA 4AFZA 2A7JA 1IQGA 1CA8B 2G81E 1LTOA 2ZU2A 1TPPA 5EIYA 2B0FA 1TNKA 2KAIA 1AIXH 1LPKB 2VVCA 5GPIB 1BRBE 1ELEE 3P6ZB 5CMXH 2EC9H 1CSOE 4H6SB 1WDIA 2BLQA 2Z94A 2JH0D 1YYY1 3UOPA 1UVOA 2XCFA 2F3CE 4O3TA 4D76A 2ZFRH 2AYWA 5C5NA 1TE0A 2XXLA 3RXVA 1K1PA 2FX4A 1Z1JA 3KEEA 2O9QA 4NA8A 3LGTA 1OX1A 3AK5A 1TX8A 4AC9A 2FOAA 1TRNA 1KSNA 2R3UA 4JYUH 1XUGA 2VGCB 3BSQA 2A4RA 1S82A 1O39A 1MTUA 4A1VA 2PTNA 1V2NT 1J15A 3M7UA 3TH4H 4Q7YA 5C1YA 2GX4A 3GY8A 3WY8A 1BJVA 3UWJH 4BXWA 2TPIZ 5C17A 1AFQC 1D3PB 1DPOA 4RSPA 3KCGH 2G55A 1IQJA 2SGEE 1EQ9A 2F9OA 2ZP0H 1OWEA 5EG4A 4BTIB 5HGGA 2EY4C 5F8ZA 2FI3E 1VCQA 1B7XB 3QGJA 1QA7A 4ZROA 3ZZ7A 1MD8A 1N8OB 4DIHH 3QGNB 4BAHB 4GVUA 5I25A 1NO9H 2R2WU 3R0FA 1V2PT 4GAWA 4R8TB 1S0RA 3HKIB 4ZAEA 3BG4C 3UNSA 1QL8A 1BCUH 1T8LA 2JKHA 2G51A 3FN8A 2BOKA 4X1NU 2ZC9H 1KY9A 3SO3A 1V2OT 1HV7A 3PYHA 3E16B 3M7QA 2V6NA 3TLOA 4Y0YE 2ZDMA 4BTTB 2JETB 1GGDC 3VB7A 1HAPH 1C2GA 1O5GH 1GMCF 2BQ7B 1YPLH 1HRTH 2B9LA 1DLEA 3GY6A 2PGQB 3MNCA 1Y3VA 1GJ7B 2J94A 1EOJA 1ESTA 1QURH 1P9SA 3RXJA 4XOJA 4B76A 1GJAB 4MTBA 3GY5A 5SGAE 1ZMJA 2WINI 4F55A 1AKSB 1GI1A 4FU7A 3SUDA 5J4SA 5DGJA 1SC8U 3S9AA 2ZGXH 5I46H 2UUJB 2EA3A 3Q3KA 1GVZA 1SLXB 1O38A 4INHA 3FP8E 4BAOB 4FU8A 3FANA 2C93B 3ZVCA 4TY7A 2J97A 5FPYA 3TJNA 3LONA 4AG1A 2HLDD 3SNCA 1WQVH 4YZUA 4ESTE 3BIUH 4NFFA 4LZ4B 2A5AA 4JZ1A 1P3CA 1K22H 3EE0B 4E7NA 3K9XB 1A0HB 1Y3UA 5HMAA 1HAYB 4YO9A 1VR1H 3ZYDA 1CA0C 2OC7A 2XBYA 3TNTA 3KHVA 3EA7A 3PLPA 3RXDA 3P8FA 1XUJA 1MTNB 2XYAA 3KF2A 4FOUC 4GSOA 5EW1H 1S85A 4B71A 3PWBA 4D9QA 1HAIH 2BD9A 3UB0A 1TPSA 2ZI2H 2VINA 3TPIZ 2Z9KA 1RTKA 1P06A 3OE7D 1EUFA 4WH8A 2CGAA 4I31A 4YTAA 3F3BA 2FI4E 3A81A 4INKA 3RLWH 1AUTC 4A6LA 3RXKA 3FOAA 1V2KT 4RKOB 3QK1A 4OS4A 3TNSA 1UVTH 2GGVB 1K21H 4UFEH 1MMJN 5EPYA 2P93A 2SGFE 4TSFD 4NIVA 5GWZA 4CREA 5E0HA 5H4IB 2EI7A 1YPJH 1G3CA 5L2ZH 4X2WA 1O32A 3RUOA 3GDSA 2VH6A 1P02A 2H2ZA 5T6DA 4JCNA 5B6OA 4U2WA 2HVXA 1S6FA 4K8BA 4DT4A 4O3UA 4FUJA 1T8NA 6LPRA 2ZDNA 4B2AA 3MWIU 4FU9A 1Z6JH 4K60A 2VVVA 4A92A 1HAVA 3P17H 1P57B 5C3NA 1FY3A 1LPZB 1QGFA 3U8OH 4FXGH 2RG3A 2QF4A 3U8RH 1H1BA 3OAAD 4H6TA 2A2QH 1PPHE 3SJ8A 2Z3DA 1HJ8A 3SUEA 1N6YA 1H8DH 1TX7A 3FP7E 3MI4A 3HK6B 4PROA 5GJ4B 2P95A 2GTBA 1MU6B 1N1LA 4AG2A 3UREA 1CHGA 1GMHF 2G52A 1WCZA 4IW4E 3VB6A 3KN2A 3ZYEA 3F68H 4X8SH 2Y6TA 4K5ZA 4Z0KA 2V35A 4IN1A 4UONA 5HM9A 3TJUA 2WUCA 5JB9S 3SJOA 4YM9A 1OKXA 2ZTZA 4ISOA 1XX9A 1JIRA 3ZVBA 1NM6A 3GCHB 2ZCHP 3A87A 1HAGE 3BIVH 2ANYA 2BHGA 2AGIX 1GI9B 1ELVA 1YGCH 2LELA 3PRDA 1KIGH 3GYMA 1ZPZA 1LHFH 1QA0A 1WXRA 1UTLM 2XWAA 4FUHA 4O97A 3DFJA 3RXFA 4AORA 2QA9E 2BDAA 3DCLA 2KM0A 2QXGA 1SGEE 1AZ8A 1FJSA 1RJXB 3F0PA 4X8TH 2FTMA 1GPZA 2VIWA 1K1JA 3H5CB 3ZZ4A 2H9TH 1YP9A 2H9EH 2ZWLH 1GJ6A 4XBBA 1EAXA 3AASA 1AO5A 1OWIA 1KTSB 7KMEH 3MO6A 2QYIA 1XMNB 2ZHFH 3UY9A 1TRMA 3AW1A 4UFDH 3GOVB 3QTVH 2FX6A 4MPWA 4X6NA 4DG4A 2Y80A 4B74A 3DSOA 1O2HA 3FFGA 3MU8A 2QAAA 1ELBA 2P94A 3QLPH 1NFUA 3A7TA 3QDZB 3MMGA 2OC0A 3K6YA 1EB2A 1ZTKA 1LVBA 3BN9A 4FUBA 1HAVB 2ZU4A 2QN5T 3ATLA 3EGKH 1MU8B 1GJDB 1WQSA 1S5SA 2BZ6H 3ATMA 2QF5A 3SV2H 1GMCG 3M5NA 4YLQH 3MTYA 3Q3YA 3M36A 3S7HB 2OCVB 2XNIA 1JMOH 2ZFTA 1L2EA 3HGPA 5AVDA 4O03A 1DDJA 2ODQA 1C9TA 2FO9A 4AFSA 1NBME 1C1MA 2NU4E 1YPKH 3MU0A 4ABJA 2ZZUH 1Q3XA 3RC4A 2P59A 1MTWA 3LGYA 3U69H 1S84A 7ESTE 1ZZZA 5HIZA 1GBIA 2TBSA 2Z3CA 5JPMH 2OQ5A 1Y3YA 3HK3B 4I8KA 3BTGE 1O31A 3TK6A 4D8NA 5K0HA 1ZYOA 4JYTA 4K1TA 5L30H 4D9RA 1AWFH 3BTEE 2ALVA 3V0XA 3SV7A 1O2WA 3SU3A 3LC3A 1DY8A 2XW9A 2WYGA 2O8UA 1H8HD 3NXPA 1SVPA 1AB9C 4VGCB 3P8GA 2ZHQH 1HXEH 2QC2A 4ABEA 3BTWE 2XCNA 1WUNH 4WMEA 1GDNA 1ZSLA 3M3VA 3Q3XA 1O3OA 3EYDA 1HLTH 1T4UH 3RU4T 2QIQA 1KXCA 3KQEA 3SQHE 2VJ1A 3MOCA 3B9FH 3T5FH 5BRRE 1TLDA 1OXGA 2H9HA 4FUFA 2TGDA 5ESBA 1UW7A 1K1LA 4KGAA 3A8DA 4UD9H 3F0OA 1G30B 4YESB 7GCHF 1KLTA 2AS9A 1P2NA 1O5EH 2A31A 3GDVA 4A1TA 1OP0A 1THRH 3ODDA 2THFB 2FPZA 1HJAB 1NFWA 4U30A 4I32A 1GI6A 1LHDH 3VB4A 2IJD1 1AWHB 2QGRA 3RC5A 1LVOA 3ZZDA 1DUEA 2Y7XA 2V0BA 4WH6A 2OQUA 1EZXC 3PWCA 5L2YH 1O3LA 4NWKA 3A7VA 3EA9A 3SV9A 2HWLB 4OGYA 2FI5E 1C5QA 1NU7B 1CU1A 8LPRA 3NRLA 4B75A 2OK5A 1O33A 1O3JA 4Y0ZE 1PPFE 2YMSD 1AI8H 4RT1A 3RXUA 3OEED 2SGAA 1D9IA 3RMLH 1W14U 3S0NA 5IK2D 3SNAA 4E05H 5FL7D 2EI8A 3RU4E 3VB5A 5HXFA 1O30A 2J92A 1UVSH 2NU2E 2GVFA 4XDEA 3KGPA 2KCOA 1C1NA 1TYNA 1O2JA 2ANWA 4IMZA 2SGDE 4GHTA 3LJJA 1O35A 1DY9A 1QHRB 1TFXA 2ALPA 1CQQA 1E0FD 1HAXB 1LKAA 1PPZA 2Z9IA 3A7ZA 4FETA 3RLYH 2J95A 3STIA 1ZJDA 2Z3EA 5EQSA 3OY5U 5DP8A 1BJUA 5JBCS 2IN2A 1O5DH 1SGYE 1C2JA 3MU5A 1O2XA 2BDYA 1MBMA 2EI6A 1XKBC 3EQ0H 1TIOA 3BEUA 1L1GA 1O2PA 1GL1A 1GCDA 1C5OH 1GMHG 1E37B 2B7DH 4CRAA 3RXIA 3W95A 3VEQB 3D65E 2YMSC 2C4FH 1P3EA 1JXPA 5LPRA 1O5FH 3ZVDA 3A86A 1AFEH 1AVWA 1NT1A 2Y7ZA 4R0IA 4ACBA 4I8LA 4I33A 3B8JA 2HVYB 3PV4A 3U8TH 1TMUH 1KXAA 4NFEA 1XXDA 3L3TA 1ZRKA 1C5UA 1SLVB 2NWNA 1J17T 5EPNA 4AN7A 5DP9A 1B5GH 1MTSA 1TNLA 4MNYA 1F0TA 2VWOA 2CK3D 3M61U 1GBFA 3KQBA 1GDUA 4E06H 3A83A 3PB1E 4M7GA 1DSUA 2BVRH 2J34A 4AOQA 2UWLA 1TNIA 3PROA 3SV6A 3LDXH 3OTJE 3PM3A 1ZGIA 2FLRH 4BANB 1UTJA 3MQKC 2FWWA 4ZKNU 3PLBA 1GI5A 2CHAC 2CHAB 2ZGBH 1S0QA 1P2OA 5FPSA 1GVKB 1P2IA 1GHBF 3G01A 4BAKB 1GL0E 2ZEBA 3M35A 2EEKA 3GCNA 2HRVA 3OYPA 4DT7B 3M7TA 3LGIA 4TT3D 2FOFA 3K65B 1QY6A 1GBEA 4GLYA 4F4OC 1O3MA 1IQIA 4OS6A 1BMMH 3F2FA 1T8OA 3A8BA 3P8NA 5HIYA 4XE4A 1GBLA 2OINA 1BHXF 5EXMA 4K8YA 3TH3H 5C67A 4Y6DA 2FEQH 1W11U 4MPXA 3KQ5A 4Y8XA 1GBJA 3P70B 3DT0H 2PW8H 1BOQA 2OXSA 4CBOA 3Q00A 2RA3A 1C9PA 1V2WT 3O8CA 5FXLA 1SLWB 2IJOB 5GCHG 2OC8A 1UCYH 1BT7A 3OFND 3RXAA 1BHXB 1MH0A 3VGCB 4CHAB 4CHAC 1AHTH 1GJ8B 4NG9H 1QRXA 4LZ1H 2STBE 2BVXH 2H5CA 3IG6B 5TCAA 4X0WU 2ZIQH 2HPPH 3EDXB 2OBOA 2VB0A 1ZSJA 3ITIA 1EZSC 4B2CA 2PKAA 2ASUB 1QJ1B 2BY9X 1QJ7B 5DP5A 4JMYA 2P8OC 2P8OB 1NPMA 1WU1A 1JWTA 1K1IA 5BPEA 2TGTA 1B0EA 2I6QA 1VKYA 2NU0E 1LKBA 1ZJKA 3RXPA 1W2KH 3QO6A 1T8MA 2BD3A 1LHGH 3QUMP 1NRQH 1O3EA 1TPAE 4X6MA 5GNDA 4XBCA 1HIAA 1O34A 4U32A 3T25A 2W3KA 1HJ9A 1D4PB 1LQDB 4ISNA 4YT6H 4IN2A 3FZDA 1H9IE 1SBWA 1V2RT 1V6DA 4Q80A 2FOHA 1Z71A 3SJIA 1A3BH 2WYJA 3MU1A 3RMOH 1UCYK 4AGJA 4KTUA 2DE8A 1D6RA 4DIIH 1RTFB 2EQNA 4YXWD 1AMHA 1V2ST 1ZMNA 2O8MA 1GHXH 1AFQB 1E1RD 1OWDA 2O8WA 4ZKOU 3P95A 2AGEX 1TQ0B 1KXFA 1GG6C 1GG6B 1OHHD 1GVLA 2GZ8A 1NTPA 3UIRA 1ETTH 1DICA 1O2LA 4A1XA 7GCHG 2IPHA 1FI8A 2ODYB 3U1JB 1ANBA 2ZFFH 3BG4B 1BTPA 4KP0A 3ATWA 5HKKD 1XUHA 1UMAH 3TU7H 3A7XA 1VCWA 4IC6A 5DSFA 1E79D 1GBTA 3GICB 2ZDKA 5EJ1A 4MDSA 1HAOH 3AVZA 4LK4A 2AIQA 1A3EH 1GGDB 4ZXYH 1YF4A 1IQEA 2J98A 1RRKA 1E36B 1AU8A 3BTQE 3QZRA 4XSKU 1PJPA 5A0AE 1NESE 1TGCA 5C0UA 1OPHB 3F1SB 3UQOA 5A0CA 1C5WB 1BUIA 3TGJE 2JJ2D 1BTYA 1MQ5A 4FUCA 2ULLA 3GCTF 4WF8A 1CVWH 4ZCNA 3MH7A 2YNAA 3H7TA 1ZPBA 2WZQA 5GIBA 1KXBA 2ZPRA 5CHBA 1KXEA 4Y11E 2PKAB 3SI3H 1ZPCA 1O3HA 1WSSH 1ETSH 2R9PA 4CR9A 1T32A 3MHWU 1W8BH 2M2AA 1EFRD 1W10U 1DT2A 3TK9A 3OX7U 1MQ6A 2KAIB 1A4WH 1A5GH 2H5DA 3T29A 3EE7A 3MH4A 4HZHA 2LNCA 4OS7A 3RXOA 3ZVGA 1ZLRA 1Y3WA 5LPFA 3M5OA 2BY6X 2W6ID 1F5RA 3I77A 1YC0A 3F9GA 5EW2H 1Z8RA 2BD5A 1C1RA 4RKJB 1GBKA 1CA0B 1O2NA 1SGDE 2SNWA 1Z1IA 2P3UB 3SNDA 5F53A 1C1VH 1T4VH 1QB6A 1EJMA 3SU0A 2D26C 1EZQA 1YCPH 2F83A 1Y5AT 3BEFB 4LOYH 2FOMB 4DCDA 1V2MT 1BTUA 3KL6A 1GI2A 3GISB 4WMFA 2C3SA 5ESTE 4UEHH 1EJNA 1C5MD 1T31A 4JZEH 5LPEA 2Z9JA 3FP6E 3N7EA 3GDUA 4FUEA 4Y7AA 3UFAA 4OS1A 2Y5GA 1YPMH 2HGTH 1GI7B 1FIWA 3M3SA 5DJ7A 3TH2H 1BMAA 1COWD 1SMFE 1FUJA 2G4TA 4O9VA 5KGOA 5T6GA 1GHVH 1SFIA 1TNJA 1O2YA 3VPKA 1MUEB 2PGBB 1AE5A 8KME2 2BDHA 2PLXA 2XTTB 4CRDA 1GHBG 1PQ8A 1AUJA 9LPRA 3S9CA 2B8OH 2ZKSA 1DWCH 3EAJA 2ZO3H 2G8TA 2XNDD 1PPBH 5A0BA 2VVUA 1TNHA 1PQ7A 2ZECA 1QQUA 4IMQA 3AAVA 2J98B 1S83A 2V3MA 3DHKH 3LGUA 4NIYA 1GBAA 1FQ3A 1K1NA 1YCPK 1EPTA 3SQEE 2DE9A 5GXPA 4HGCA 3RXBA 1AE8H 5CHAB 5CHAC 1CBWC 1CBWB 1HUTH 3U98H 4K1SA 2QF3A 1C2DA 1O2RA 2QXHA 3SZNA 1TABE 3OTPA 4MLFB 2V7QD 2RDLA 1CHOF 2FS8A 4MVNA 1YLDA 2WPDD 1FV9A 1SG8B 2ZGJA 3SZEA 5CE1A 1KLIH 3QX5H 2D1JA 2W26A 1O5AB 3SU2A 1LVYA 1TB6H 4MG3A 1KMHB 5C1XA 2GZ7A 4A5TS 3LOXA 1BIOA 2JJ1D 1DM4B 4TPYA 1C5PA 1NRSH 2ZF0H 1TAWA 1OWHA 2CXVA 4CRBA 1TGSZ 5HYOA 1O5BB 5A09A 5IDKA 5C94A 3JZ2B 1O2ZA 4JK6A 2XC0A 3ZZ3A 1HXFH 1ARCA 1ZOMA 1ZSKA 1C1OA 1NBMD 1P01A 1EOLA 3GS9A 3DSGA 1PQAA 1A46H 1C5VA 3FKSD 4FUGA 3A7WA 1E38B 4Q2KA 3SGBE 1YWUA 1H9HE 1SGFA 4J2YB 1LHCH 1UCYE 2BDIA 1YM0A 4AGKA 1H4WA 1Y3XA 3F9FA 1UVUH 2J5UA 4UFFH 1FIZA 3LGVA 2HNTF 1SSXA 2R0KA 1THPB 2GCTC 2GCTB 1F2SE 2SFAA 2YOLA 3IWMA 1O2UA 1BTHH 1ANCA 5KEDA 1NFXA 4ZHLU 1OWJA 2FOEA 1LQEA 1MKXH 2ZCLP 1MAYA 1O2SA 1DVAH 4Q4LA 1X7AC 2FXRA 1CGJE 3LH1A 1AD8H 1RIWC 1RIWB 1V3XA 2HNTC 1Y5BT 2BTCE 5TJXA 2KZ4A 4WXIA 1FDPA 2FOCA 1QNJA 1SGRE 4U01A 1SGPE 1OP8A 4Q7ZA 5JBTA 4JZFH 2SGQE 4WY3A 2J2UA 1U6QA 1KLJH 3VG8A 3PV2A 5FX6A 2BDBA 4THNH 2NU1E 1ELAA 2PV9B 2FS9A 3RXGA 5FPTA 1EPTC 1EPTB 1QL7A 3T27A 1C2MA 4ZHAA 1SQRA 4DURA 2ZHDA 5B6LA 1FAXA 4NSYA 2OUAA 2ZFSA 2PFEA 2YNBA 4LXBH 3S7KB 2RDEA 2UWOA 1DXPA 2VIQA 3SYJA 4MNXA 2P3TB 2UWPA 4AFQA 1O2QA 1VJ9U 4ZKRU 3SU5A 1FZZA 2VWNA 1OP2A 2Y82A 3GCTG 2TRMA 1C4V2 1PFXC 1MKXK 4IC5A 2WHXA 1SHHB 1BRCE 1SQOA 2PHBA 1T7CA 1ACBE 1DFPA 4X6PA 2ZCKP 2BY5X 3ZZ5A 3S9BA 2XBWA 3E91A 1C1WH 4ABAA 1QL9A 3UWIA 2BLWA 1AY6H 3V13A 4K3JA 1O3NA 1GJ9B 4WWYA 4GCHF 1VITF 4TWWA 1ELFA 1HGTH 2LP6A 2WPLS 1Y8TA 1JRSA 1PYTD 5E0JA 2O8LA 4MQAA 5JYIA 1GJBB 3NK8A 5PTPA 1AB9B 2ANKH 4WMDA 2PKSC 2PKSB 3A85A 3ELAH 4NA7A 4XD7D 4DJZB 1HBTH 2CMYA 1L1JA 1H8IH 2FTLE 5FX5A 2BD2A 1MD7A 3N7OA 3E3TA 2M5TA 3HGNA 5EXLA 1Y59T 3GY2A 1QCPA 2GT8A 2Z9LA 3V7TA 4FUDA 1YPGH 1BA8B 3GCOA 2JH6D 3SJKA 4AZ2B 1QTFA 2R2MB 4Y76A 5C20A 3O8RA 1ABJH 2F43B 2GDDA 1ELDE 1CGHA 4HG6A 5DP4A 1O3CA 2ZDVH 2BY7X 1C1TA 4ABFA 1UO6A 1C2FA 3NWUA 3RXHA 5A8XA 1GJ4H 1TGBA 4CR5A 5G4BA 3MNBA 3A84A 6CHAC 2BQ6B 1BTXA 1PYTC 2GCHF 1QBVH 1P8VC 1O2IA 4X1SU 1O2OA 3NKKA 1W0JD 1CT4E 4DGJA 3KYGA 1TA6A 1F0SA 1WBGB 2SGPE 3URCA 1AGJA 1O5CB 1HAZB 1YPEH 2BYAX 4KTCA 1O0DH 2J9NA 3F2GA 4FVBA 1YBWA 1BBRH 3LH3A 3PLKA 2A7CA 3M5LA 2W7UA 3NUMA 2J4IA 5E2PA 2K8IA 1JRTA 1ZHRA 4MNVA 4E7RG 4RT0A 1SKYE 1HB0B 2O8TA 4Y10E 4GPGA 1ZTLA 4H42U 5C5OA 5J4QA 2CN0H 4WVPE 1LDTT 1GHZA 5E8EH 5ETXA 1C5YB 2ZQ2A 3M5MA 1YPHC 3A82A 1NY22 2F9NA 1SB1H 1XUIA 1A0JA 3FZZA 3QTOH 2KX4A 5FCKA 1P12E 2ZPSA 4X1PU 1CHOG 1W7XH 3SORA 4ZH8A 1KDQA 3OEHD 1C2EA 1VCPA 1VJAU 3ESTA 3SU6A 4WJG2 1EAWA 4BAQB 1TMBH 4D7FA 3OY6U 1FY4A 1NU9A 2GJGA 1TALA 1FAKH 1ABIH 2YMSB 3UPEA 5EXNA 1BBRK 3A8CA 1GHAF 1CT0E 2FZZA 1TBRH 1DWDH 1QB9A 2GDEH 2CF8H 3E0NB 5T1VA 2G00A 3GY3A 4AB9A 1BMNH 3LIWA 3AW0A 2F9BH 1DOJA 1GI0A 1VGCC 1UK3A 4ACAA 2PTCE 4JZDH 2GZ9A 3S69A 3Q76A 2F91A 4D7GA 4JK5A 1BTWA 1QRZA 1OYQA 1RXPA 1TBQH 1C5SA 4X2YA 1G3DA 2ZHWH 1WAYB 4NIXA 1SI5H 1IAUA 1C5XB 3A8AA 3ZVAA 1PPCE 1O3BA 3RMNH 2GMTC 4OS5A 1V2LT 2F9PA 2WPHS 1IQLA 7LPRA 3PV5A 3B23B 3SJ9A 3SU4A 1UTMA 4K69A 3MH6A 4X6OA 3L6PA 1A0LA 2PSYA 3UR6A 2FESH 1A5IA 3ZVEA 4B73A 2PUXB 2C8XB 1Z8GA 2W3IA 3TGIE 2KCAA 4AFUA 1EZUC 1TNGA 3LU9B 2ZQ1A 1TA2A 4BTUB 3N99A 2BOHB 2C8YB 4YLUA 1P0SH 2H6MA 3UUZA 3LC5A 2KCYA 2OC1A 1V2QT 1B0FA 1W0ZU 1FXYA 4Y71A 2C8ZB 1RS0A 1G2LA 4K2YA 3D23A 3LT3A 1GWAA 3E0PB 3RXCA 2KCPA 1TBZH 2WPIS 3FAOA 1LMWB 3SU1A 1IQFA 1V2VT 4UDWH 1QQ4A 1FN8A 3KNXA 1K2I1 3EA8A 1HPGA 4DVAU 1DSTA 5HM2A 3V12A 1TX6A 1KDQB 1BRUP 1GCTB 1GCTC 2AMPA 4XRNA 1A61H 2P16A 5DG6A 3UNQA 1ZR0A 1F92A 3FVFB 3BTHE 4CRGA 2BDGA 3HPTB 1O2TA 2PP6A 1YCPM 4X2XA 3K6ZA 1EP5A 3CP7A 4KTSA 4Y8ZA 1P2MA 3U1IB 4IS5A 4F49A 1SGIB 4J1YA 3RXSA 1Z8JB 3ZZ8A 4GCHG 1A7SA 1VITG 1A2CH 1TOCB 2ANMH 2XBXA 3SOSA 2STAE 4GUXA 2PUQH 4CRFA 1TWXB 2ZG0H 1SGFG 3PMAB 3DFLA 1UTKA 4TPIZ 3SGAE 2I6SA 1MAXA 1O3FA 2SNVA 3I29A 1Z6EA 2UUFB 4NSVA 3T2NA 1CT2E 3DUXH 3E8LA 3T26A 2R3YA 2VIPA 1GHYH 3U28C 5E0GA 1K1OA 1NN6A 1SOTA 3PO1C 3PO1B 4F48B 2VGCC 2BVSH 6ESTA 2Q1JA 2G5NA 1UHBA 3ZZ9A 1GI3A 1NFYA 3HKJB 3R3GB 2ZGCA 2BXUH 4KELA 1ZMLA 1O3DA 3BEIB 3BTFE 3KQDA 5EOKA 2HALA 1NC6A 3ENSB 3TK5A 2A0QB 2Y5HA 2AEIH 5EQQA 2ILNA 4I7YH 2GCHG 1UTOA 4JYVH 1THSH 4ASHA 3ZIAD 1DLKB 2AH4X 2L6OA 1N8OC 1V2UT 4AYYB 1S81A 2RFKC 3RC6A 2Z6BD 4HTCH 4ZMAH 1UJ1A 2AIPA 1HAHH 4H4FA 1RTLA 1V2TT 4YT7H 1Q2WA 1FN6A 1C5NH 1YY3A 1HFDA 2VNTA 3P8OA 1ZHPA 2ODPA 2BX4A 1H9LB 4CH8B 1NRRH 2JETC 1WYKA 2JIZD 2VU8E 4NZQA 5FBIA 3V3MA 1KYNA 3NZIA 4IBLH 3F6UH 1SLUB 5EJZA 2FMJA 5DK1A 2ZPQA 2KR7A 1ARBA 4MNWA 2GD4B 1K28D 1D6WA 1UK2A 4Q7XA 1TGTA 2FYQA 1O3PB 2BQWB 1WTGH 3O8BA 4MPVA 2AGGX 3KQCA 2ZDAH 1CO7E 2Y5FA 4YOJA 1GBMA 3JZ1B 2ZU5A 1ANDA 1HIAB 1P9UA 1VITH 2WPKS 5EU8A 3MU4A 1AVXA 1DX5M 4TYDA 3NPSA 1BBRE 2CV3A 1RFNA 2XBVA 1UVPA 2HOBA 3PMBB 3L33A 2OLGA 1ELTA 3MNXA 3GYLB 2VIVA 2ZFQH 1AN1E 1GHAG 2J38A 2IOTA 3UAIC 2QF0A 5DP7A 3GY7A 3ATKA 4B6EA 3C27B 1DANH 2OP9A 3ZZCA 1HNEE 5DO4H 2P3FH 2C8WB 2W5EA 2C90B 1MTNC 4BOHA 2FP7B 3DD2H 3RMMH 1W13U 4ZKSU 1FNIA 1D3TB 1XVOA 2FIRH 1OWKA 1UHBB 4NWLA 3E1XB 4X1QU 1BQYA 3SUFA 3A88A 1E35B 2XRCA 5F8TA 2QXIA 1OSSA 1ETRH 3MO9A 8GCHF 3BV9B 5C0TA 3RM0H 3UQVA 1C2IA 1CGIE 2FODA 2QXJA 1FX0B 2W7SA 2D8WA 4WXVA 4NCYA 1MKWH 2ZHEH 3SGQE 3WW7A 5JDUB 4ZHMU 5A8ZA 1BRAA 1C1SA 5C1UA 2F9VA 1GBDA 1QZ8A 1OS8A 1FY5A 1J16A 4ABBA 1K1MA 4IGDA 1EX3A 2RA0A 4AB8A 4CH2B 1EB1H 2BD4A 1UK4A 1Z7KA 3TJVA 2A5IA 1NRPH 1GBCA 2KFWA 3RP2A 3UOUA 3VFEA 1XVMA 1O3GA 4JZIA 2A2XH 1P10A 3MH5A 2ZFPH 3ZZAA 3SNEA 1F0UA 1SGTA 2WSSD 4I86A 4ABHA 3SI4H 1HDTH 2A1DB 2V3HH 3E90B 3M37A 2JH5D 2AHME 1LVMA 1MTVA 2FYRA 1P2JA 1GJ5H 1EJAA 1DUAA 1QIXB 4DW2U 4X1RU 1WOFA 1SFQB 5LGOA 1TOMH 2VWMA 4NIWA 1AQ7A 1FMGA 4ABDA 1ELCA 1MKWK 5AHGH 1JBUH 1XXFA 4M9FA 1ELGA 1XUKA 1G36A 1AVGH 4B1TA 3W94A 9ESTA 2D2DA 4X8VH 5DN6D 2R0LA 1G3EA 4P02A 1TRYA 3O8DA 4BXSA 1EASA 2HPQH 1GI8B 1LCYA 1IQKA 1A5HA 3LGWA 1PPGE 2FOGA 8ESTE 1GMDF 2NU3E 4OM9A 4Y8YA 1QBNA 2L74A 5AFZH 1SQTA 1SPJA 5IYTA 1P2QA 3T62A 1ZHMA 4X8UH 3SHCH 3LPRA 1ID5H 3F9EA 1QFKH 5F8XA 1JOUB 3DSPA 3LJOA 1IQMA 6GCHF 1WV7H 2A7HA 3W1EA 1C1QA 1D3DB 1SGCA 2AFQB 3AAUA 3GCHC 1N6XA 2F9UA 3D49H 2B5TB 2BDCA 5EQRA 3C1KA 3SUGA 3MNSA 3Q77A 4HI3A 4SGBE 4B6FA 1NROH 2QV1A 1L4DA 1P04A 1C2KA 1DS2E 1HCGA 4AX9H 5AF9H 2FOBA 5JBBS 1W12U 3T28A 2TIOA 2ZTXA 1O2GH 1G32B 4I8JA 2TGPZ 2UUYA 4GHQA 5JBAS 2ZTYA 3P92A 1QR3E 2BLVA 5F03A 2PWXA 1O2KA 1NZQH 3ZVFA 2RCEA 1G2MA 1QJ6B 2HLCA 2XOKD 3CENA 3PMHB 1MABB 2AERH 1WTHD 1MZAA 2GT7A 2BM2A 1GHWH 4I8GA 1IHSH 3OSYA 2VBCA 2W6JD 3I78A 3PMJA 4ASUD 1G37A 1YLNA 2XC5A 4ISHH 4FUIA 3MYWA 2VIOA 1Z8IB 1C1UH 1BB0B 3UR9A 1SGNE 3GY4A 3N7DA 2QCYA 1QB1A 1MCTA 1UTNA 1FLEE 3SV8A 5GCHF 3RXEA 2ZNKH 1O37A 1UTQA 1MCVA 2A5KA 1BMFD 1C4Y2 4FVDA 2Q6GA 1S6LA 3ZZBA 2HNTE 3TGKE 1NS3A 3ZV8A 2K0QA 2XWBI 5DP6A 1F5KU 2TGAA 3LKWA 3RU4D 3DA9B 1Y5UT 3K2UA 2XC4A 4KKDA 3RDZA 5FCRA 2AMDA 2GV7A 4YOGA 1OOKB 3KIDU 5FBEA 2BX3A 1VZQH 1Q31A 3ODFA 4OS2A 1ESBA 2DUCA 1ZGVA 4AYVB 1IQHA 2H1UA 1W0YH 5JB8S 1IHTH 1G9IE 2BMGB 4RI0A 2BXTH 3RXTA 1S6HA 1C5ZB 2PR3A 3A89A 4NA9H 4XBDA 1EATA 5FAHA 1RD3B 4TY6A 5F6MA 2Q6FA 1HYLA 4VGCC 5EODA 3VXEH 3H7OA 3UTUH 1KXDA 5A2MH 2ZU3A 1G3BA 1W7GH 4CBNA 1C5TA 3BG8A 4Z1MD 3VXFH 3STJA 2BD8A 4Z6AH 1RGQA 1ESAA 4TWYA 3TJOA 1EP6A 1FPHH 2WPJS 2LPRA 1FY8E
chains in the Genus database with same CATH topology
4ZUHA 1IOEA 1INCA 5FHTA 4HFPB 1L0ZA 1ZTJA 3SBKA 1J9CH 1O2VA 2G5VA 1TQ7B 1XUFA 6CHAB 2ZU1A 4ABGA 2CJIA 1FY1A 2VIDA 3QN7A 4QT8C 3A80A 1DWBH 5T6FA 2ESTE 1V2JT 2BD7A 5A8YA 2G4UA 4UFGH 3RXQA 8GCHG 2A4GA 4I8HA 3TITA 3CS0A 1P09A 4MPUA 1YLCA 1DWEH 1LHEH 1HJAC 1BITA 5TCCA 5LH8A 1TMTH 1F7ZA 2GKVE 2ZDLA 3ZZ6A 1O2MA 1XM1A 2GV6A 4ISLA 1K9OE 1C5RA 1FPCH 1L1NA 3F9HA 2A4QA 3BF6H 1XKAC 2FDAA 1EKBB 3RM2H 1P05A 3A7YA 2A45B 1GJCB 3MO3A 1O3IA 1LPGB 2ZA5A 5K7RA 2BLOA 1SR5C 3BTKE 3SW2B 1C5LH 1SOZA 2WV5A 5ABWA 1EXFA 3BTTE 1EAIA 4X2VA 5DKMA 1GI4A 2Z9GA 2FLBH 2VH0A 3ZV9A 1M9UA 3ATIA 1J14A 1ANEA 1TPOA 1C2LA 2WUBA 3OU0A 1BZXE 4A7IB 3HATH 2K1QA 3BTME 4K1EA 5AFYH 2WPMS 1O3AA 3QWCH 3RXMA 2Q6DA 1MZDA 3QZQA 5GDSH 1F0RA 2GP9B 1CE5A 1GBBA 3IITA 2Y81A 5DPAA 4RN6A 1AZZA 1P11E 1W3CA 5E2OA 1GMDG 1VGCB 1OYTH 1O36A 1TGNA 1YPHE 2AMQA 4OGXA 1C4U2 2OD3B 1O3KA 1J8AA 1BDAA 1C2HA 1SQAA 6GCHG 3PTBA 4DY7B 3E6PH 3TVJB 2FM2A 1MBQA 3SHAH 1PQ5A 3SNBA 1SHYA 2UUKB 4INLA 4NGAH 4BNRA 4XFQA 2GMTB 3CS7A 1GBHA 2OTVA 3PTNA 3D62A 3RXLA 1LO6A 3U9AH 4DOQA 1SGQE 3RXRA 5T3HA 1JIMA 2ZGHA 2Z7FE 4Y79A 1E34B 1ORFA 1BTZA 1QBOA 2PSXA 4ISIH 1UTPA 5C2ZA 4CRCA 3BTDE 4NZLA 2V3OH 2A4OA 1C1PA 2BZAA 2A32A 4BAMB 1P2KA 1KTTB 4ZXXH 5L6NH 4YOIA 3SN8A 1DITH 5EGMA 2CF9H 1DE7H 1YKTA 1TONA 1ZRBA 1FONA 3MFJA 4UE7H 1F5LA 1L4ZA 1PPEE 2BB4A 1SL3A 3URDA 2VWLA 1IQNA 1GDQA 1DXWA 2WV4A 2OBQA 4ABIA 1BMLA 3NCLA 1P03A 1D3QB 4SGAE 4Y7BA 3M3TA 2BY8X 1EAUA 3VGCC 1AKSA 2QY0B 3TIUA 1QRWA 5DP3A 3VB3A 4B2BA 1NRNH 1A1RA 3UNRA 4AFZA 2A7JA 1IQGA 1CA8B 2G81E 1LTOA 2ZU2A 1TPPA 2B0FA 1TNKA 2KAIA 1AIXH 1LPKB 2VVCA 5GPIB 1BRBE 1ELEE 3P6ZB 5CMXH 2EC9H 1CSOE 4H6SB 2Z94A 2BLQA 2JH0D 1YYY1 3UOPA 1UVOA 2XCFA 2F3CE 4O3TA 4D76A 2ZFRH 2AYWA 5C5NA 1TE0A 2XXLA 3RXVA 1K1PA 2FX4A 1Z1JA 3KEEA 2O9QA 4NA8A 3LGTA 1OX1A 1TX8A 2FOAA 1TRNA 1KSNA 2R3UA 4JYUH 1XUGA 2VGCB 3BSQA 2A4RA 1S82A 1O39A 1MTUA 4A1VA 2PTNA 1V2NT 1J15A 3M7UA 3TH4H 4Q7YA 5C1YA 2GX4A 3GY8A 3WY8A 1BJVA 3UWJH 4BXWA 2TPIZ 1AFQC 1D3PB 1DPOA 4RSPA 3KCGH 2G55A 1IQJA 2SGEE 1EQ9A 2F9OA 2ZP0H 1OWEA 5EG4A 4BTIB 5HGGA 5F8ZA 2FI3E 1VCQA 1B7XB 3QGJA 1QA7A 4ZROA 3ZZ7A 1MD8A 1N8OB 4DIHH 3QGNB 4BAHB 4GVUA 5I25A 1NO9H 2R2WU 3R0FA 1V2PT 4GAWA 4R8TB 1S0RA 3HKIB 4ZAEA 3BG4C 3UNSA 1QL8A 1BCUH 1T8LA 2JKHA 2G51A 2BOKA 4X1NU 2ZC9H 1KY9A 3SO3A 1V2OT 1HV7A 3PYHA 3E16B 3M7QA 2V6NA 3TLOA 4Y0YE 2ZDMA 4BTTB 2JETB 1GGDC 3VB7A 1HAPH 1C2GA 1O5GH 1GMCF 2BQ7B 1YPLH 1HRTH 2B9LA 1DLEA 3GY6A 2PGQB 3MNCA 1Y3VA 1GJ7B 2J94A 1EOJA 1ESTA 1QURH 1P9SA 3RXJA 4XOJA 4B76A 1GJAB 4MTBA 3GY5A 5SGAE 1ZMJA 2WINI 1AKSB 1GI1A 4FU7A 3SUDA 5J4SA 5DGJA 1SC8U 3S9AA 2ZGXH 5I46H 2UUJB 2EA3A 3Q3KA 1GVZA 1SLXB 1O38A 4INHA 3FP8E 4BAOB 4FU8A 3FANA 2C93B 3ZVCA 4TY7A 5FPYA 3TJNA 3LONA 4AG1A 3SNCA 1WQVH 4YZUA 4ESTE 3BIUH 4NFFA 4LZ4B 2A5AA 4JZ1A 1P3CA 1K22H 3EE0B 4E7NA 3K9XB 1A0HB 1Y3UA 5HMAA 1HAYB 4YO9A 1VR1H 3ZYDA 1CA0C 2OC7A 2XBYA 3TNTA 3KHVA 3EA7A 3PLPA 3RXDA 3P8FA 1XUJA 1MTNB 2XYAA 3KF2A 4GSOA 5EW1H 1S85A 4B71A 3PWBA 4D9QA 1HAIH 2BD9A 1TPSA 2ZI2H 2VINA 3TPIZ 2Z9KA 1RTKA 1P06A 1EUFA 4WH8A 2CGAA 4I31A 4YTAA 4INKA 2FI4E 3A81A 3RLWH 1AUTC 4A6LA 3RXKA 1V2KT 4RKOB 3QK1A 4OS4A 3TNSA 1UVTH 2GGVB 1K21H 4UFEH 1MMJN 5EPYA 2P93A 2SGFE 4NIVA 5GWZA 4CREA 5E0HA 5H4IB 2EI7A 1YPJH 1G3CA 5L2ZH 4X2WA 1O32A 3RUOA 3GDSA 2VH6A 1P02A 2H2ZA 5T6DA 4JCNA 5B6OA 4U2WA 2HVXA 1S6FA 4K8BA 4O3UA 4FUJA 1T8NA 6LPRA 2ZDNA 4B2AA 3MWIU 4FU9A 1Z6JH 4K60A 2VVVA 4A92A 1HAVA 3P17H 1P57B 5C3NA 1FY3A 1LPZB 1QGFA 3U8OH 4FXGH 2RG3A 3U8RH 1H1BA 4H6TA 2A2QH 1PPHE 3SJ8A 2Z3DA 1HJ8A 3SUEA 1N6YA 1H8DH 1TX7A 3FP7E 3MI4A 3HK6B 4PROA 5GJ4B 2P95A 2GTBA 1MU6B 1N1LA 4AG2A 3UREA 1CHGA 1GMHF 2G52A 1WCZA 4IW4E 3VB6A 3KN2A 3ZYEA 3F68H 4X8SH 2Y6TA 4K5ZA 4Z0KA 2V35A 4IN1A 4UONA 5HM9A 3TJUA 2WUCA 5JB9S 3SJOA 4YM9A 1OKXA 2ZTZA 4ISOA 1XX9A 1JIRA 3ZVBA 1NM6A 3GCHB 2ZCHP 3A87A 1HAGE 3BIVH 2ANYA 2BHGA 2AGIX 1GI9B 1ELVA 1YGCH 1KIGH 3GYMA 1ZPZA 1LHFH 1QA0A 1UTLM 2XWAA 4FUHA 4O97A 3DFJA 3RXFA 4AORA 2QA9E 2BDAA 2QXGA 1SGEE 1AZ8A 1FJSA 1RJXB 4X8TH 2FTMA 1GPZA 2VIWA 1K1JA 3H5CB 3ZZ4A 2H9TH 1YP9A 2H9EH 2ZWLH 1GJ6A 4XBBA 1EAXA 3AASA 1AO5A 1OWIA 1KTSB 7KMEH 3MO6A 2QYIA 1XMNB 2ZHFH 3UY9A 1TRMA 3AW1A 4UFDH 3GOVB 3QTVH 2FX6A 4MPWA 4X6NA 4DG4A 2Y80A 4B74A 1O2HA 3FFGA 3MU8A 2QAAA 1ELBA 2P94A 3QLPH 1NFUA 3A7TA 3QDZB 3MMGA 2OC0A 3K6YA 1EB2A 1ZTKA 1LVBA 3BN9A 4FUBA 1HAVB 2ZU4A 2QN5T 3ATLA 3EGKH 1MU8B 1GJDB 1WQSA 1S5SA 2BZ6H 3ATMA 3SV2H 1GMCG 3M5NA 4YLQH 3MTYA 3Q3YA 3M36A 3S7HB 2OCVB 2XNIA 1JMOH 2ZFTA 1L2EA 3HGPA 5AVDA 4O03A 1DDJA 2ODQA 1C9TA 2FO9A 4AFSA 1C1MA 2NU4E 1YPKH 3MU0A 4ABJA 2ZZUH 1Q3XA 3RC4A 2P59A 1MTWA 3LGYA 3U69H 1S84A 7ESTE 1ZZZA 1GBIA 2TBSA 2Z3CA 5JPMH 2OQ5A 1Y3YA 3HK3B 4I8KA 3BTGE 1O31A 3TK6A 4D8NA 5K0HA 1ZYOA 4JYTA 4K1TA 5L30H 4D9RA 1AWFH 3BTEE 2ALVA 3V0XA 3SV7A 1O2WA 3SU3A 3LC3A 1DY8A 2XW9A 2WYGA 2O8UA 3NXPA 1SVPA 1AB9C 4VGCB 3P8GA 2ZHQH 1HXEH 2QC2A 4ABEA 3BTWE 2XCNA 1WUNH 4WMEA 1GDNA 1ZSLA 3M3VA 3Q3XA 1O3OA 3EYDA 1HLTH 1T4UH 3RU4T 2QIQA 1KXCA 3KQEA 3SQHE 2VJ1A 3MOCA 3B9FH 3T5FH 5BRRE 1TLDA 1OXGA 2H9HA 4FUFA 2TGDA 5ESBA 1K1LA 4KGAA 3A8DA 4UD9H 1G30B 4YESB 7GCHF 1KLTA 2AS9A 1P2NA 1O5EH 2A31A 3GDVA 4A1TA 1OP0A 1THRH 3ODDA 2THFB 2FPZA 1HJAB 1NFWA 4U30A 4I32A 1GI6A 1LHDH 3VB4A 1AWHB 2QGRA 3RC5A 1LVOA 3ZZDA 1DUEA 2Y7XA 2V0BA 4WH6A 2OQUA 1EZXC 3PWCA 5L2YH 1O3LA 4NWKA 3A7VA 3EA9A 3SV9A 2HWLB 4OGYA 2FI5E 1C5QA 1NU7B 1CU1A 8LPRA 4B75A 1O33A 1O3JA 4Y0ZE 1PPFE 1AI8H 3RXUA 2SGAA 1D9IA 3RMLH 1W14U 3S0NA 3SNAA 4E05H 2EI8A 3RU4E 3VB5A 5HXFA 1O30A 2J92A 1UVSH 2NU2E 2GVFA 4XDEA 3KGPA 1C1NA 1TYNA 1O2JA 2ANWA 4IMZA 2SGDE 4GHTA 3LJJA 1O35A 1DY9A 1QHRB 1TFXA 2ALPA 1CQQA 1E0FD 1HAXB 1LKAA 1PPZA 2Z9IA 3A7ZA 3RLYH 2J95A 3STIA 1ZJDA 2Z3EA 5EQSA 3OY5U 5DP8A 1BJUA 5JBCS 2IN2A 1O5DH 1SGYE 1C2JA 3MU5A 1O2XA 2BDYA 1MBMA 2EI6A 1XKBC 3EQ0H 1TIOA 3BEUA 1L1GA 1O2PA 1GL1A 1GCDA 1C5OH 1GMHG 1E37B 2B7DH 4CRAA 3RXIA 3W95A 3VEQB 3D65E 2C4FH 1P3EA 1JXPA 5LPRA 1O5FH 3ZVDA 3A86A 1AFEH 1AVWA 1NT1A 2Y7ZA 4R0IA 4I8LA 4I33A 3B8JA 3PV4A 3U8TH 1TMUH 1KXAA 4NFEA 1XXDA 3L3TA 1ZRKA 1C5UA 1SLVB 2NWNA 1J17T 5EPNA 4AN7A 5DP9A 1B5GH 1MTSA 1TNLA 4MNYA 1F0TA 2VWOA 3M61U 1GBFA 3KQBA 1GDUA 4E06H 3A83A 3PB1E 4M7GA 1DSUA 2BVRH 2J34A 4AOQA 2UWLA 1TNIA 3PROA 3SV6A 3LDXH 3OTJE 3PM3A 1ZGIA 2FLRH 4BANB 1UTJA 2FWWA 4ZKNU 3PLBA 1GI5A 2CHAC 2CHAB 2ZGBH 1S0QA 1P2OA 5FPSA 1GVKB 1P2IA 1GHBF 3G01A 4BAKB 1GL0E 2ZEBA 3M35A 2EEKA 3GCNA 2HRVA 3OYPA 4DT7B 3M7TA 3LGIA 2FOFA 3K65B 1QY6A 1GBEA 4GLYA 4F4OC 1O3MA 1IQIA 4OS6A 1BMMH 1T8OA 3A8BA 3P8NA 4XE4A 1GBLA 2OINA 1BHXF 5EXMA 4K8YA 3TH3H 5C67A 4Y6DA 2FEQH 1W11U 4MPXA 4Y8XA 1GBJA 3P70B 3DT0H 2PW8H 1BOQA 2OXSA 4CBOA 3Q00A 2RA3A 1C9PA 1V2WT 3O8CA 5FXLA 1SLWB 2IJOB 5GCHG 2OC8A 1UCYH 1BT7A 3RXAA 4CHAB 1BHXB 1MH0A 3VGCB 4CHAC 4LZ1H 1AHTH 1GJ8B 4NG9H 1QRXA 2STBE 2BVXH 2H5CA 3IG6B 5TCAA 4X0WU 2ZIQH 2HPPH 3EDXB 2OBOA 2VB0A 1ZSJA 3ITIA 1EZSC 4B2CA 2PKAA 2ASUB 1QJ1B 2BY9X 1QJ7B 5DP5A 4JMYA 2P8OC 2P8OB 1NPMA 1WU1A 1JWTA 1K1IA 5BPEA 2TGTA 1B0EA 2I6QA 2NU0E 1LKBA 1ZJKA 3RXPA 1W2KH 3QO6A 1T8MA 2BD3A 1LHGH 3QUMP 1NRQH 1O3EA 1TPAE 4X6MA 4XBCA 1HIAA 1O34A 4U32A 3T25A 2W3KA 1HJ9A 1D4PB 1LQDB 4ISNA 4YT6H 4IN2A 3FZDA 1H9IE 1SBWA 1V2RT 1V6DA 4Q80A 2FOHA 1Z71A 3SJIA 1A3BH 2WYJA 3MU1A 3RMOH 1UCYK 4AGJA 4KTUA 2DE8A 1D6RA 4DIIH 1RTFB 1AMHA 1V2ST 1ZMNA 2O8MA 1GHXH 1AFQB 1OWDA 2O8WA 4ZKOU 3P95A 2AGEX 1TQ0B 1KXFA 1GG6C 1GG6B 1GVLA 2GZ8A 1NTPA 3UIRA 1ETTH 1DICA 1O2LA 4A1XA 7GCHG 2IPHA 1FI8A 2ODYB 3U1JB 1ANBA 2ZFFH 3BG4B 1BTPA 4KP0A 3ATWA 1XUHA 1UMAH 3TU7H 3A7XA 1VCWA 4IC6A 1GBTA 3GICB 2ZDKA 4MDSA 1HAOH 3AVZA 4LK4A 2AIQA 1A3EH 1GGDB 4ZXYH 1YF4A 1IQEA 3BTQE 1RRKA 1E36B 1AU8A 3QZRA 4XSKU 1PJPA 5A0AE 1NESE 1TGCA 1OPHB 3F1SB 3UQOA 5A0CA 1C5WB 1BUIA 3TGJE 1BTYA 1MQ5A 4FUCA 2ULLA 3GCTF 4WF8A 1CVWH 3MH7A 2YNAA 3H7TA 1ZPBA 5GIBA 1KXBA 2ZPRA 1KXEA 4Y11E 2PKAB 3SI3H 1ZPCA 1O3HA 1WSSH 1ETSH 2R9PA 4CR9A 1T32A 3MHWU 1W8BH 1W10U