1C1MA

Porcine elastase under xenon pressure (8 bar)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (PORCINE ELASTASE)
publication title Exploring hydrophobic sites in proteins with xenon or krypton.
pubmed doi rcsb
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1mA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1mA01
3LDXH 3RDZA 2ZFSA 1O0DH 1PPZA 1QJ7B 3ZVFA 3ZZDA 1GBLA 2QAAA 1SLUB 1SBWA 1AQ7A 1C9PA 1DLKB 2SGQE 3HGNA 1G30B 1EUFA 3OSYA 4YM9A 3SNEA 7KMEH 4ZHMU 1SLVB 4IGDA 1NFWA 1TBRH 3W95A 3RMLH 1HV7A 1MKXK 1NO9H 2GCHG 1GBCA 4YO9A 4XBDA 1OYTH 1C5SA 2ANYA 2A2QH 1V3XA 4GPGA 4Y0ZE 3Q76A 3GY8A 3TJVA 2B5TB 3PTNA 3VPKA 1DE7H 3NXPA 4Y79A 2SFAA 3RXAA 2BVRH 3RLWH 3BTQE 2CF9H 1W13U 3KQCA 5C20A 3E1XB 1W10U 5A09A 4O3TA 1OX1A 3PROA 4CR5A 1C1PA 1W0ZU 2GCTC 1O2HA 2A5IA 2C4FH 1TRMA 4BAKB 4D9RA 2A7HA 1C2DA 1ZGIA 3SNBA 4Y71A 1P10A 3RU4T 2NU1E 1GCTB 2SNVA 4DGJA 4J1YA 4CRDA 1HAHH 3PLBA 1ANEA 2BQWB 2ZEBA 2BOHB 3BTKE 4MNWA 2ZTZA 2GX4A 2J9NA 4X1SU 1LPZB 1P2MA 4E7NA 1TNLA 4CHAB 1C2MA 1ZLRA 4NG9H 1SPJA 5I25A 1GI8B 4X6OA 3SUDA 3OU0A 1LVMA 1PQ8A 1CO7E 1GHWH 1BT7A 1A2CH 2ZPRA 1GJ9B 4ISOA 2ZI2H 3HGPA 3K6ZA 1HPGA 1SLXB 3E3TA 1KXDA 4B73A 2ZFFH 1IOEA 4XE4A 3VEQB 3LC5A 3ZZAA 2BXUH 1SQOA 1UVTH 3V12A 1TRYA 4RN6A 2G81E 3QGNB 1O3DA 3QUMP 3TVJB 1EAWA 1G3BA 2SGEE 4UD9H 3PMBB 4U30A 1ZPBA 2F9OA 1MKWH 1PPBH 1C5XB 1G3DA 3BEFB 4Q80A 1XKAC 4O03A 3UWIA 2V6NA 3I77A 4X6PA 1O30A 2XC0A 1TB6H 4WXVA 2FOEA 1DDJA 2VWOA 4GHTA 1A3EH 3U8OH 1AUTC 6GCHG 3RXRA 4AFZA 2XC4A 8GCHF 3HK6B 1JIRA 2P95A 1AIXH 4JYVH 4WXIA 3HKIB 1SG8B 1MU6B 2H1UA 1T31A 5J4QA 4JCNA 3E90B 3GDSA 3ZVCA 2R2MB 1TPAE 2WYJA 3G01A 1A46H 4Y8XA 1C1MA 2FPZA 3DA9B 1MU8B 5A0CA 2Z3DA 3RMMH 2PR3A 3GDVA 4BANB 2XCNA 4B2AA 2DE9A 2XBXA 1CBWB 1O3BA 4R8TB 2XW9A 1QA0A 3EA8A 4CRBA 2ALPA 1AU8A 1KXBA 1V2LT 1O5AB 1O3HA 1SQTA 3Q3XA 1C5WB 3R0FA 3GCHC 4ABGA 4LOYH 2VVUA 2ZHFH 4IN2A 1TOCB 3QGJA 1C4V2 3ATWA 1K21H 4CRCA 5HMAA 2PUQH 3ZVDA 2XBVA 3A7ZA 1P3CA 5C1UA 1GDUA 1KSNA 2KAIB 2G4UA 2QIQA 3PB1E 1TGNA 2ZECA 1GMHF 1EZUC 2A45B 7GCHF 5AF9H 1F2SE 2ZU1A 1QA7A 5T3HA 5A0BA 1EB2A 5DO4H 3LGYA 2WPHS 5J4SA 2HPQH 2YNAA 3QTOH 1NT1A 4M7GA 1YC0A 1UO6A 2HALA 1GHXH 1Y3UA 1HAZB 5GPIB 2ZDAH 4NZQA 1D9IA 3FP7E 1GVZA 1KY9A 1MKXH 2IJOB 3FFGA 3KN2A 4FVBA 1ESTA 4Y11E 1ARCA 1SR5C 1HB0B 2GCTB 1IQFA 2A7CA 1C5VA 2VIWA 1YYY1 1SGNE 3SQHE 2FP7B 1TBZH 4XOJA 1CGHA 4ISLA 3RXLA 5C1XA 2SGPE 1YLDA 1K9OE 2XWBI 4CRFA 3O8BA 1EZQA 4K3JA 5B6OA 4AOQA 3GCTG 3R3GB 4ABIA 1UVSH 1GBBA 3PM3A 1OXGA 4PROA 1O2PA 1D3TB 1GBIA 2AGEX 2GMTC 3E8LA 1WBGB 3MH6A 2AERH 2XYAA 3L6PA 4JZEH 2WUCA 1TNHA 4FU8A 2ODYB 1VCWA 1V2WT 1TWXB 1NFXA 4DT7B 3GY5A 2CGAA 2DUCA 2VJ1A 3U1IB 4Y6DA 1XUHA 1D4PB 2SGAA 3EDXB 4WMDA 1P2JA 2UUYA 3LU9B 2Z3CA 1GMDF 1P8VC 1WTGH 3RMNH 3OY5U 2A1DB 3KF2A 1NRPH 1AWFH 1GBDA 3BTFE 1O2RA 3PWBA 2A32A 3SJIA 3SN8A 3MNCA 1J9CH 3QZRA 3URDA 4A7IB 1FY5A 5DKMA 2DE8A 4FVDA 4HFPB 1MAXA 3FZDA 1DWDH 2PKSC 1AY6H 2J38A 3S7HB 1S84A 1VJ9U 1TGSZ 3A83A 1P2KA 1EQ9A 2P3UB 1JMOH 2AGGX 5FPTA 8GCHG 2VIPA 4U2WA 4ZKRU 1HNEE 4JK6A 4CRGA 4DIIH 5AHGH 2O8TA 1Z7KA 4UE7H 1V2OT 1E38B 2SNWA 1F5LA 1LKBA 2PFEA 1BMMH 2W26A 2ZGJA 3SO3A 2UUKB 5A8XA 1S6FA 3TH2H 1O3EA 2FS9A 1BCUH 1VGCC 4VGCC 1YLCA 3VB6A 3M5LA 1C2EA 3UFAA 3TGKE 2CMYA 3E0NB 1NTPA 3VXEH 1BBRH 2HNTC 1TGCA 3TJNA 1UTPA 3MHWU 5E0GA 4MDSA 1OSSA 1HJ9A 1P9UA 3GCHB 1SGTA 1QRWA 2AS9A 3RC5A 1C1OA 2XWAA 5JBAS 1V2RT 1O3CA 1T4UH 1WOFA 2F9PA 2F91A 1CHOF 4FUEA 1OWHA 1UTOA 3SV2H 2ZFQH 4KELA 1AZ8A 2PKAB 2B7DH 1DWBH 1V2NT 3KEEA 2M5TA 1EXFA 3F9HA 1W7XH 2A4OA 1Z1IA 1FI8A 4IC5A 2BDCA 2BTCE 1P01A 1GMHG 7GCHG 1Y5AT 2FI5E 2ZGBH 2WPKS 4ZH8A 1HCGA 1XUJA 2G51A 3UWJH 4IS5A 2ZGCA 4CR9A 3LH3A 2OC1A 1C1QA 2Z6BD 3SUEA 1ESAA 2GV6A 1PPHE 1AFEH 2BDAA 2Z9IA 2R9PA 2C3SA 1Y3YA 1T8MA 1GJ8B 3K65B 3MWIU 3SGBE 3P92A 2ULLA 2F9UA 2R3YA 1GI5A 1NZQH 5L6NH 1PFXC 3ZZCA 2CJIA 1HYLA 1TFXA 3U98H 1MTNC 1MBMA 2TGTA 5LH8A 2C8WB 1CU1A 3D49H 7LPRA 3F68H 1A5GH 1O3IA 1P06A 4WMFA 2J92A 3M5NA 1C2KA 3ZYDA 1TA6A 3KQBA 3ZZ8A 3RXDA 1TX7A 2ZU4A 3M3VA 2ZO3H 1NPMA 3AW1A 2VIVA 2GMTB 3SQEE 1E37B 3MO9A 3KNXA 1ANCA 4MQAA 4RSPA 3GY4A 1AO5A 2QXHA 1TGBA 3A80A 1C1NA 1VITF 5C67A 2HWLB 2VH0A 4GUXA 1IAUA 3A84A 4K8YA 4LZ4B 1MCTA 2QV1A 5JB9S 1OPHB 1YPLH 1D6WA 1MTUA 1C2HA 4MLFB 1OWEA 2XTTB 3KL6A 5DP4A 1DICA 1ABJH 2ZTYA 5EW2H 4I7YH 1O3FA 2Z94A 2ZU3A 1EX3A 2YOLA 3S9BA 4JZ1A 3F9FA 1GBHA 1LVBA 5ESTE 3RXCA 4U32A 2TGAA 4BAQB 1O3NA 1WYKA 1HAXB 1W12U 2GDEH 3MU1A 3BG4C 1THPB 1HRTH 1BA8B 1XKBC 2PKSB 3NZIA 3PLPA 4B71A 1EPTA 4UFEH 3B9FH 1YPKH 1TMBH 5FAHA 1IQKA 3ESTA 1A3BH 5EG4A 1YKTA 3MH4A 4WF8A 4JK5A 5G4BA 1FY1A 2JH5D 1D6RA 4ZAEA 1AVGH 2UUJB 4UEHH 1F7ZA 4ISIH 2TIOA 4FUFA 2XXLA 3HKJB 1TABE 1DWEH 1YCPM 2EEKA 1OYQA 1MBQA 4YESB 2C90B 4CH2B 1GBAA 4D9QA 4GHQA 4UFGH 4JMYA 2ZFTA 3AAUA 1VGCB 4VGCB 4MNXA 1V2ST 3OY6U 2ZDVH 4ISHH 5DP8A 1GDNA 3LGVA 1ESBA 2QC2A 2FTMA 1S0QA 1K1JA 4K8BA 2BVSH 4NFFA 1TMUH 4CBNA 3DFJA 4MVNA 1YBWA 2BDIA 3LJOA 2GT8A 1BMLA 1GJ4H 2A4RA 2OC0A 2F9VA 4H6TA 3LKWA 1P9SA 4ABDA 3M61U 4E06H 2CN0H 4AB9A 2G00A 3GY3A 2WPMS 4OS7A 4ZKSU 3V7TA 1C5UA 1O32A 4O9VA 2BQ7B 1PPEE 5L2YH 3UNRA 1GHVH 3SW2B 1O2XA 1C4Y2 1FPCH 2RCEA 2Y5FA 3LC3A 1MZAA 5DJ7A 3SJ8A 1QNJA 1E36B 3DFLA 4AFUA 1A4WH 3T28A 1EASA 4I8JA 5A2MH 4YOIA 2OLGA 1X7AC 5DGJA 5C1YA 1G9IE 2FDAA 4BAHB 2ZHDA 1DVAH 1FPHH 1AD8H 1WV7H 1ZMLA 2BY6X 1ANBA 4GCHF 4X1PU 5ABWA 4I31A 5H4IB 1FAKH 2BD2A 2F9BH 1O5GH 4KGAA 4ZMAH 1DSUA 1E0FD 1CA0C 1GVKB 1LDTT 2GZ9A 2ZNKH 1MQ6A 5FPYA 3SV7A 1SGIB 1C1WH 1BJVA 2QF0A 1O36A 1MTNB 1O3OA 5GDSH 2F83A 1BHXF 5I46H 2ZDMA 3BTEE 5GCHG 1EZXC 1NRSH 4O3UA 3EQ0H 5K7RA 2ZQ1A 2BD8A 3PV4A 3SU5A 1LCYA 3BIVH 4TPIZ 5FX5A 4NGAH 1A0HB 1UTLM 2V0BA 3UNQA 1M9UA 4FUGA 1CA8B 2BD9A 3SV8A 4AGKA 5C3NA 3HPTB 3U69H 5IYTA 3LPRA 3N7OA 1C1RA 1XUFA 5E2OA 3PTBA 1DSTA 1CE5A 1GI9B 3A82A 5DK1A 1UHBA 4K1SA 3RXSA 3M36A 4JZDH 4Q7ZA 1YPJH 3P8OA 1AVWA 4MPVA 4RKOB 1ELBA 1ID5H 4CH8B 1CT4E 1TPPA 3IITA 2OINA 3EGKH 3T29A 1W8BH 1O2SA 1O2OA 2QXGA 3M35A 4TYDA 2BB4A 1GG6C 1UVUH 1IQGA 3IG6B 4ZKNU 2TGDA 4B76A 2FYQA 2G5NA 5EXNA 5LPEA 1XXFA 3GOVB 4K1EA 5FBIA 1FLEE 4NA8A 1V2TT 2UWPA 3BG4B 1Z6EA 1D3DB 1MUEB 4BOHA 3O8CA 2FWWA 1FONA 2TBSA 2ZDKA 4J2YB 3A88A 1ABIH 1FN8A 1L2EA 1UMAH 1ZJKA 1IQNA 1DY9A 5A0AE 2JETC 3ZVBA 5FHTA 2OC7A 3ZZ3A 3ZVAA 5K0HA 1IHTH 1C1VH 4X2YA 1ETTH 4YT6H 4JZIA 4BAOB 3QZQA 4HTCH 1MAYA 1BMAA 4IC6A 1UCYK 3QDZB 1ZR0A 5HGGA 5EW1H 3MH7A 1C2FA 1GJ7B 2EA3A 3M7UA 1HIAB 1UTJA 3TH3H 3MO6A 2GDDA 2Z3EA 4CBOA 3K6YA 1C5QA 1XUIA 2WUBA 1O5FH 4X8UH 3BN9A 4H6SB 2BX3A 3LGTA 1SGDE 3A7WA 4K2YA 2TPIZ 3PMJA 4X6NA 2IN2A 2QXJA 2AFQB 1CHGA 2W5EA 2AGIX 4JYUH 4BXSA 5HXFA 2O9QA 1F5KU 5FCRA 1TQ0B 1LQDB 2GV7A 3MNXA 1QY6A 2VVVA 1WQVH 4HGCA 5T6FA 8LPRA 2ESTE 2VIOA 3BTTE 2OXSA 2PSYA 1WCZA 4K69A 9LPRA 2G5VA 2FOBA 1ZYOA 1O2JA 1QL9A 1T8NA 1QBNA 3SUGA 3NWUA 1BMNH 3TNTA 1SC8U 2PSXA 4ABAA 2BD7A 4DG4A 4X2VA 2Y82A 3U9AH 3RMOH 2FI4E 1Z8IB 1A1RA 1YPMH 4A6LA 1NY22 1YP9A 1EP6A 4R0IA 3PLKA 2EI6A 1CA0B 1GHBF 1BBRK 1CT2E 1O39A 4GCHG 1SGFG 2W3IA 5CE1A 4JZFH 3RXVA 3M37A 1OP2A 5L2ZH 2BLOA 3FANA 1TGTA 2ZHQH 2HOBA 2TGPZ 3RC4A 3LT3A 1TBQH 2PHBA 3M7TA 2JKHA 2PW8H 1TOMH 1RGQA 4OS6A 4IBLH 3QN7A 1S5SA 3D65E 1KTSB 3GYMA 3VB3A 1BJUA 2ZDLA 1LVYA 1JBUH 3E91A 3UTUH 2R2WU 1SSXA 1O5EH 1RXPA 1TALA 1ELCA 2AEIH 4GLYA 1DFPA 5EODA 3L3TA 4I8GA 1O2IA 4FUIA 3A7YA 1K1PA 1HAVA 5CHAC 4BTIB 2NU2E 5EOKA 4NA7A 3RXQA 3KQEA 3BTHE 2D26C 3SU6A 3A87A 3S69A 1V2VT 2VGCC 2VVCA 3SNAA 2ZF0H 1F92A 2KAIA 1OWDA 2ZTXA 2OUAA 3GCOA 1NESE 1HBTH 1Q3XA 3RXEA 2ZG0H 5AVDA 3M7QA 1KDQB 1DITH 3V13A 1A7SA 1QR3E 1A5HA 1CGIE 1O2QA 1O3MA 5ETXA 4OS4A 1DXPA 3STJA 3TJUA 1IQMA 4I33A 4FUBA 4U01A 1YCPH 2B8OH 1P2NA 4WH6A 1GL1A 2A0QB 2CV3A 4GAWA 9ESTA 4B2CA 3NCLA 3VB5A 1ELTA 1V2JT 3ZVGA 1P03A 1UCYE 1C4U2 2JETB 5HM9A 4A1XA 3RXHA 3STIA 4LK4A 1RJXB 3S9AA 2QN5T 2FYRA 1V6DA 5BPEA 4ABEA 4DOQA 5C5NA 2H9TH 3U1JB 2GGVB 2AIQA 2W7UA 1T8LA 2J95A 1GPZA 1SB1H 2FLBH 4NSYA 4NWKA 3SGAE 1V2QT 1IQIA 3C27B 2BVXH 3LIWA 3SUFA 2BZAA 6CHAC 3ZYEA 1UCYH 3EE0B 4LXBH 3A8AA 3UQVA 1SGPE 3RXFA 1MZDA 2WINI 2A4QA 2FM2A 1LPKB 2FOMB 2WYGA 1ZGVA 2Z9JA 2AYWA 5EQRA 4CREA 1CQQA 1QBVH 3RU4D 1J14A 1HFDA 2G4TA 1TLDA 2LPRA 3RC6A 4BNRA 3LGWA 4AG1A 1GMCF 3QX5H 3UR9A 2QCYA 2Y80A 5AFZH 1S6HA 1NROH 2AMPA 3IWMA 2Z9GA 1Z1JA 2BLQA 3Q00A 2H5DA 2BY7X 1WSSH 2VU8E 3NK8A 2VH6A 4X2WA 1ELEE 4NIXA 1TNGA 1DY8A 4X1QU 1EPTC 1FIZA 1PQ5A 1SOTA 5JDUB 2BX4A 1BBRE 3U8RH 1GBKA 3RU4E 1NRRH 1EP5A 3RXGA 1PPCE 2Q6GA 4Q7XA 2Q6FA 3QWCH 2VIQA 4SGAE 5F6MA 4WWYA 5C5OA 3P95A 3VFEA 1YF4A 3EAJA 4AYVB 8ESTE 1FXYA 5TJXA 2LNCA 2RA0A 5PTPA 2ZPSA 1DPOA 3MI4A 1GL0E 1PYTC 1O3PB 2CF8H 3BG8A 1AVXA 3RXKA 2FS8A 1FQ3A 3RXJA 1Z6JH 1MQ5A 3AAVA 3I29A 3SGQE 1HLTH 1TQ7B 1EAIA 1PQAA 1HAIH 3KGPA 1PYTD 1BZXE 1C2GA 2O8LA 1HAYB 1G2LA 5ESBA 2F3CE 5E8EH 3UNSA 1KTTB 1ZPCA 5LPRA 1XUKA 1UTMA 4AFSA 5EPNA 2BDBA 3S7KB 1O3AA 1Z8JB 1UVPA 3MFJA 4NIWA 2ZCKP 3PWCA 1XUGA 2HVXA 4QT8C 1NFYA 1O5BB 5CHAB 4ZKOU 3P17H 1ELAA 2ZA5A 2PKAA 4KTSA 1GI4A 5GIBA 2VGCB 1MMJN 4AYYB 3ATLA 3A8CA 1BRUP 3RXOA 1SLWB 4WJG2 1DX5M 2HNTE 3BV9B 1N8OC 4DCDA 4AGJA 1RIWC 2EI8A 5GJ4B 1WUNH 3RXPA 4YLUA 2PUXB 4SGBE 1GBJA 1XVOA 2XBYA 1H4WA 1IQHA 1VITH 4INHA 1UK3A 1O35A 1O34A 3TK9A 3F1SB 1ZOMA 3ELAH 3Q77A 1C5PA 1QJ6B 1AKSB 5HM2A 1DLEA 4GVUA 1HXFH 3TJOA 2FEQH 1P57B 5AFYH 3EA9A 1S83A 2A7JA 4DURA 4HZHA 2GD4B 1C5YB 3P8NA 3TIUA 1QIXB 4AN7A 1ZSLA 3RXMA 1WQSA 1KIGH 1CVWH 3T62A 2AMQA 1L1NA 2QF3A 2A2XH 1K22H 1ZRBA 4ESTE 4XDEA 2ZHEH 1AMHA 1GBTA 1RD3B 3BTDE 4X0WU 3WY8A 3SJOA 4FUJA 2FX6A 1Q31A 4D7GA 1K1MA 1ZRKA 3BEIB 2SGDE 3SU0A 1LHGH 1C5OH 2ZGHA 4KTCA 1RTLA 3BIUH 5DP6A 1A61H 4INKA 1DANH 1TYNA 3A85A 1GMDG 1RTKA 1Y3VA 1E35B 1O2NA 2BY5X 4X1RU 1MH0A 3NUMA 1S0RA 1TNJA 2GCHF 1AB9C 3ZV8A 3UR6A 1JRTA 3KCGH 1J17T 1GMCG 1ZPZA 4INLA 1P02A 1BTPA 1UK4A 1Y3WA 3SU2A 1VCQA 3ATMA 4ABBA 2P3TB 2BY8X 2BQ6B 2RG3A 3DHKH 4MNVA 3MU0A 1EPTB 2W7SA 4NIVA 2BLWA 2TRMA 4AG2A 3TU7H 4FU9A 1TX6A 2Y5GA 4FXGH 1QGFA 1WAYB 3MU8A 2OQUA 2XNIA 1K2I1 1DXWA 3MH5A 3K9XB 1TPSA 1HDTH 5IDKA 1EKBB 4F4OC 1O3KA 1TMTH 1P2QA 2BY9X 2WPLS 3UREA 3TK5A 1YPEH 3F9EA 3AVZA 3O8DA 1O38A 1Y8TA 2FOFA 4B75A 1Z71A 1L4DA 1O2YA 1IQEA 4XSKU 1HAOH 1SOZA 1IHSH 1BTXA 1GI7B 3JZ2B 1GDQA 4AB8A 3PMAB 1XVMA 4Y76A 2Z7FE 3TH4H 1EAUA 1OS8A 3CENA 2PV9B 3B23B 4X6MA 4MG3A 2ZKSA 3Q3YA 1ZTKA 1B0EA 1CHOG 4KTUA 4X8VH 1ACBE 3QO6A 1PPFE 5DP9A 2ZCLP 3RM0H 1GJDB 3T25A 2P16A 2Z9LA 2FIRH 3PO1C 1NRNH 4UONA 5DG6A 2STAE 1NFUA 5GWZA 2ZFPH 1B7XB 1QB1A 2C8YB 2B9LA 2ZWLH 1H9HE 2FLRH 2CHAC 2ZHWH 2FI3E 1V2UT 1KLIH 2VIDA 3MMGA 4YZUA 3C1KA 1ELDE 1SGYE 1N8OB 1QCPA 2BMGB 1VCPA 6GCHF 4TWYA 1RIWB 3V0XA 3P8FA 2PTCE 4THNH 1FN6A 1QRXA 4NCYA 2QYIA 3PYHA 4ZUHA 1W11U 3OTJE 1C9TA 3A8DA 2A5KA 1D3QB 4HI3A 4DY7B 2C8ZB 2BZ6H 1Q2WA 4DJZB 1ZHRA 4JYTA 2V35A 3GYLB 3W94A 2K1QA 4E05H 1DS2E 2G55A 1T8OA 2ZFRH 3DUXH 2BD3A 3SBKA 5TCAA 4GSOA 1O2UA 3ODDA 5JBTA 1BTUA 2P59A 3UIRA 3HK3B 1GHYH 1J15A 1C5RA 3UQOA 3GY6A 1GWAA 4MPUA 1XX9A 1B5GH 2V3HH 1GGDC 1FY3A 1KXFA 1GHAF 5A8YA 4TY6A 4Y10E 3L33A 1QQ4A 4IMQA 1NRQH 2FO9A 1VITG 1QQUA 2XC5A 3SI3H 3URCA 1UHBB 3GICB 1FY8E 1QRZA 1P09A 1UTKA 1FJSA 4A92A 1HAPH 1AWHB 1K1NA 3PMHB 3UOPA 4AX9H 1O2LA 1THSH 1FNIA 7ESTE 2CXVA 1BITA 2ANKH 5SGAE 4K60A 1G3EA 1AB9B 1NU9A 1YCPK 1P04A 1EATA 4OGXA 1TONA 5LGOA 3SI4H 3MU4A 1EJAA 2VWLA 3GCNA 1DUEA 1PQ7A 1HUTH 4OGYA 1THRH 1HAGE 1OKXA 1A0JA 1BHXB 1RTFB 2OD3B 4B1TA 3KHVA 1SGFA 1GI1A 1T32A 1Y5UT 2IPHA 1O3JA 3BEUA 3FAOA 2OQ5A 3A86A 4Y8ZA 3B8JA 3FP6E 4YT7H 1FIWA 1EAXA 2P93A 4UDWH 1ZMJA 4Y7AA 2C93B 1GVLA 4I32A 5EXMA 4WY3A 1ZHPA 1N6XA 2WPJS 4YLQH 2BXTH 3S0NA 1XMNB 3SORA 1DOJA 2ILNA 3D23A 3UUZA 1GJAB 3QLPH 1SGRE 2H5CA 1GI3A 3GCTF 4D7FA 2O8MA 3M5OA 2HLCA 3RP2A 5CMXH 1EOLA 1TAWA 1AE5A 2I6QA 1SI5H 2VINA 4H42U 3MO3A 1XXDA 3H7TA 3ZZ9A 3NPSA 1QB9A 1HIAA 1H8DH 1MTVA 4NZLA 1G3CA 3GY7A 1P05A 3SU4A 2OBOA 4TWWA 3BTGE 2Y81A 1CSOE 2R0KA 3PO1B 5F03A 2BM2A 3TK6A 3A89A 3UOUA 1ELFA 3FZZA 4WMEA 2NU4E 1VJAU 1NC6A 2CHAB 4YTAA 4NA9H 1NS3A 1P11E 4AORA 1AGJA 1Y5BT 1BTWA 4XFQA 3ZZ6A 2Y6TA 3OX7U 3RXUA 1AUJA 3MOCA 1KXCA 1ZMNA 1YPHC 1EOJA 2BOKA 1O2GH 3V3MA 5DP3A 1BTYA 2FOHA 4UFFH 4XBBA 2QA9E 1QBOA 3FP8E 1FMGA 3RXTA 1PPGE 1GJ5H 1RS0A 1MD7A 1J8AA 1MTSA 1ANDA 5F8XA 1LHCH 1CGJE 3LGIA 1H9IE 1TX8A 4LZ1H 1INCA 1W2KH 4Q7YA 1T4VH 4B2BA 5C2ZA 4B74A 1F5RA 1MTWA 1LKAA 2UUFB 3CS7A 1GGDB 1C5ZB 2UWOA 2WV4A 3I78A 1G2MA 3GISB 1YPHE 1ZSJA 2FZZA 1EJMA 4X8TH 4Y0YE 1GHAG 1ZTJA 3ZZBA 1JOUB 1HAVB 1BRBE 1QL8A 2ZIQH 5LPFA 5FCKA 2H9EH 3EYDA 3MTYA 2D1JA 1GG6B 4I8HA 1ETRH 3KIDU 1BIOA 2R3UA 1TNIA 1SQAA 4WH8A 2D2DA 1P0SH 2ANWA 3SZNA 3MYWA 1PJPA 3SNCA 3ODFA 3A8BA 5JPMH 4AFQA 4FUHA 2H6MA 1ELGA 1QTFA 3T27A 3TGIE 4ABHA 3T5FH 2NU0E 1BRCE 1O3GA 2I6SA 1KDQA 4BAMB 3GDUA 2AMDA 1OOKB 1GBEA 4KKDA 4DVAU 2FODA 1P3EA 1J16A 2QGRA 1F0SA 1C2IA 2FXRA 3A81A 4UFDH 1LHFH 3TGJE 3RUOA 1LQEA 1CT0E 2ZC9H 1MCVA 2ANMH 3CS0A 3SJKA 3H7OA 2VWMA 4Y7BA 2ZDNA 3ATKA 5JBBS 4IN1A 4YOGA 4I8KA 3M3TA 1H9LB 1GBMA 1QHRB 1K1IA 1O2KA 1W0YH 1O31A 1OP0A 3U8TH 4ZROA 8KME2 5DP5A 4RKJB 1FDPA 5GXPA 1VR1H 1E34B 1SL3A 4NWLA 3RLYH 2JH0D 1TIOA 2O8UA 2FX4A 1OWKA 5E0HA 4ZXYH 1Z8RA 1W3CA 1O5DH 2VWNA 2ODQA 1C5LH 2BD4A 1SMFE 3FVFB 1WTHD 3LH1A 3SV6A 1V2KT 4TY7A 2Q6DA 5L30H 1L1JA 4NFEA 2VB0A 1LMWB 4F49A 3D62A 4X1NU 1S82A 1AHTH 4ISNA 1O2VA 4E7RG 2ZP0H 1YM0A 2THFB 3E6PH 4ZXXH 2XBWA 3S9CA 1WU1A 2UWLA 2GT7A 2OC8A 4MTBA 1AN1E 1YPGH 1C5NH 3SOSA 1C1TA 1JRSA 1GHBG 3UPEA 4XBCA 1C1UH 4DW2U 4WVPE 2STBE 1NU7B 1A0LA 1LO6A 5FPSA 3QTVH 2VNTA 1IQJA 2H2ZA 1C2JA 4KP0A 4K1TA 4MPXA 2PGQB 1LTOA 2PLXA 2XRCA 1C5MD 1TRNA 2ZZUH 2P8OC 3SHAH 3A7VA 3DD2H 4FUDA 2BDGA 2OBQA 1AFQC 1S81A 2FOCA 2QXIA 3ZVEA 2OTVA 3VGCC 2GTBA 1C2LA 1JXPA 1KLTA 2HPPH 3H5CB 3SU3A 1EZSC 4I8LA 2GP9B 1BDAA 2BLVA 1GHZA 1GBFA 3KQDA 2PTNA 2P3FH 2O8WA 2QY0B 1FV9A 2ZGXH 1BRAA 2JH6D 3BTME 1BTHH 1V2MT 1W14U 3A7TA 1LHEH 2GVFA 1B0FA 2FMJA 1SGCA 4IMZA 1TPOA 5FXLA 3LJJA 1GI2A 3E0PB 2ZQ2A 1ZJDA 2WPIS 2SGFE 5EXLA 3SHCH 1O3LA 3OYPA 3ATIA 2AIPA 1ARBA 1KXAA 3MNBA 3LGUA 3GY2A 3VB7A 3M3SA 5F8TA 1O2WA 2BDHA 3QK1A 4OS1A 4D8NA 1SGEE 3A7XA 4K5ZA 1GCDA 1GI0A 1F0UA 5F8ZA 5JBCS 2H9HA 1O37A 1QL7A 3SV9A 1A5IA 1EJNA 1ORFA 1SFIA 1MD8A 2ALVA 3ZZ7A 1K1LA 1AKSA 1HJAC 1D3PB 1N1LA 1HGTH 5GCHF 1V2PT 1ZTLA 2Y5HA 4NSVA 4DIHH 4A5TS 4FUCA 4Z6AH 1KXEA 2D8WA 4Q2KA 6CHAB 2GKVE 1HXEH 3P6ZB 1DWCH 1FUJA 3UY9A 4A1VA 1VZQH 2Q1JA 1AZZA 3SNDA 2ASUB 4CRAA 3T26A 2PGBB 5DPAA 2G8TA 1UK2A 1BB0B 3HATH 1LPGB 1C5TA 2AH4X 1ZZZA 1H8IH 2C8XB 3BTWE 2YNBA 1SHYA 1Y3XA 3F6UH 1YGCH 2ZU5A 4H4FA 4BTUB 3CP7A 3EA7A 1BTZA 3RM2H 2ZCHP 1F0RA 1QURH 3BF6H 2HNTF 3NKKA 4A1TA 1OWJA 5FBEA 2B0FA 1NN6A 1RFNA 3ENSB 1XM1A 2V3OH 5HYOA 2BHGA 3TNSA 3JZ1B 4AZ2B 4ASHA 1AI8H 5DP7A 2A5AA 3ZZ4A 4X8SH 2R0LA 1KYNA 4MPWA 1H1BA 1JIMA 3P70B 3TPIZ 1FAXA 1JWTA 1UTQA 2J4IA 3MNSA 1QJ1B 2HRVA 1HJ8A 5T6DA 4O97A 4YOJA 1SFQB 1FY4A 2PWXA 1DUAA 1K1OA 1C1SA 2G52A 1IQLA 4FU7A 1GCTC 3AW0A 2FESH 1FZZA 1ZSKA 1DT2A 4IW4E 4CHAC 4Z0KA 3K2UA 2FOGA 3TLOA 1TE0A 4ABJA 2P8OB 5E0JA 5EQSA 1ETSH 3DT0H 3ZZ5A 5EPYA 1L0ZA 2OP9A 1RRKA 1EB1H 2IOTA 4NIYA 1AFQB 3RXBA 1P2OA 2W3KA 4OS5A 1GJBB 2EC9H 2Z9KA 1O2TA 3VGCB 1Z8GA 3AASA 5JB8S 1S85A 1MKWK 2J2UA 5EU8A 1ELVA 2NWNA 1T7CA 1UJ1A 6LPRA 2F9NA 1ZHMA 6ESTA 1GJ6A 1BQYA 2RDLA 2HGTH 1OP8A 3T2NA 2NU3E 4TPYA 1BUIA 3F9GA 3ITIA 1QB6A 2ZU2A 3M5MA 4ABFA 1U6QA 2FTLE 2J34A 1W7GH 1P12E 1G36A 2Y7ZA 1GJCB 3BSQA 5JYIA 2A31A 5FX6A 3LONA 4ZHAA 1L1GA 1GI6A 1P2IA 5TCCA 1KLJH 4MNYA 2A4GA 4D76A 3RXIA 3TITA 4X2XA 1LVOA 2BYAX 1O2ZA 2Y7XA 1SHHB 4Y8YA 1F0TA 1O5CB 3VXFH 2GZ8A 2EI7A 2RA3A 4ZHLU 1O2MA 1TNKA 1UTNA 4BTTB 2J94A 1G32B 1AE8H 3E16B 1UVOA 3SJ9A 1G37A 1OWIA 1Y59T 5BRRE 3Q3KA 2P94A 5A8ZA 2BDYA 3SU1A 3VB4A 3ZV9A 4OS2A 1BOQA 1HJAB 2FOAA 2ODPA 1CBWC 5T6GA 1N6YA 1DM4B 2GZ7A 3O8RA 1LHDH 2BD5A 5EQQA 1K28D 5EGMA 2OCVB 1NM6A 3P8GA 1SGQE 2WV5A 2XCFA 1SVPA 5E2PA 3MU5A 1O33A 2ZPQA 1TA2A 4BXWA 1L4ZA 1QFKH 3LOXA
chains in the Genus database with same CATH superfamily
3LDXH 3RDZA 2ZFSA 1O0DH 1PPZA 1QJ7B 3ZVFA 3ZZDA 1GBLA 2QAAA 1SLUB 1SBWA 1AQ7A 1C9PA 1DLKB 2SGQE 3HGNA 1G30B 1EUFA 3OSYA 4YM9A 3SNEA 7KMEH 4ZHMU 3UAIC 1SLVB 4IGDA 1NFWA 1TBRH 3W95A 3RMLH 1HV7A 1MKXK 1NO9H 2GCHG 1GBCA 4YO9A 4XBDA 1OYTH 1C5SA 2ANYA 2A2QH 1V3XA 4GPGA 4Y0ZE 3Q76A 3GY8A 3TJVA 2B5TB 3PTNA 3VPKA 1DE7H 3NXPA 4Y79A 2SFAA 3RXAA 2BVRH 3RLWH 3BTQE 2CF9H 1W13U 3KQCA 5C20A 3E1XB 1W10U 5A09A 4O3TA 1OX1A 3PROA 4CR5A 1C1PA 1W0ZU 2GCTC 1O2HA 2A5IA 2C4FH 1TRMA 2GJGA 4BAKB 4D9RA 2A7HA 1C2DA 1ZGIA 3SNBA 4Y71A 1P10A 2J98A 3RU4T 2NU1E 1GCTB 2SNVA 4DGJA 4J1YA 4CRDA 1HAHH 3PLBA 1ANEA 2BQWB 2ZEBA 2BOHB 3BTKE 4MNWA 2ZTZA 2GX4A 2J9NA 4X1SU 1LPZB 1P2MA 4E7NA 1TNLA 4CHAB 1C2MA 1ZLRA 4NG9H 1SPJA 5I25A 1GI8B 4X6OA 3SUDA 3OU0A 1LVMA 1PQ8A 1CO7E 1GHWH 1BT7A 1A2CH 2ZPRA 1GJ9B 4ISOA 2ZI2H 3HGPA 1YY3A 3K6ZA 1HPGA 1SLXB 3E3TA 1KXDA 4B73A 2W6JD 2ZFFH 1IOEA 4XE4A 1FX0B 3VEQB 3LC5A 3ZZAA 2BXUH 1SQOA 1UVTH 3V12A 1TRYA 4RN6A 2G81E 3QGNB 1O3DA 3QUMP 3TVJB 1EAWA 1G3BA 2SGEE 4UD9H 3PMBB 4U30A 1ZPBA 2F9OA 1MKWH 1PPBH 1C5XB 1G3DA 3BEFB 4Q80A 1XKAC 4O03A 3UWIA 2V6NA 3I77A 5T1VA 4X6PA 1O30A 2XC0A 1TB6H 4WXVA 3SZEA 2FOEA 1DDJA 2VWOA 4GHTA 1A3EH 3U8OH 1AUTC 6GCHG 3RXRA 4AFZA 2XC4A 8GCHF 3HK6B 1JIRA 2P95A 1AIXH 4JYVH 4TT3D 4WXIA 3HKIB 1SG8B 1MU6B 2H1UA 1T31A 5J4QA 4JCNA 3E90B 3OFND 3GDSA 3ZVCA 2R2MB 1TPAE 2WYJA 3G01A 1A46H 4Y8XA 1C1MA 2FPZA 3DA9B 1MU8B 5A0CA 2Z3DA 3RMMH 2PR3A 3GDVA 4BANB 4I86A 2XCNA 4B2AA 2DE9A 2XBXA 1CBWB 1O3BA 4R8TB 2XW9A 1QA0A 3EA8A 4CRBA 2ALPA 1AU8A 1KXBA 1V2LT 2QF5A 1O5AB 1O3HA 1SQTA 3Q3XA 1C5WB 3R0FA 3GCHC 4ABGA 4LOYH 2VVUA 2ZHFH 4IN2A 1TOCB 3QGJA 1C4V2 3ATWA 1K21H 4CRCA 5HMAA 2PUQH 3ZVDA 2XBVA 3A7ZA 1P3CA 5C1UA 1GDUA 1KSNA 2KAIB 2KFWA 2G4UA 2QIQA 3PB1E 1TGNA 2ZECA 1GMHF 1EZUC 2A45B 7GCHF 5AF9H 1F2SE 2ZU1A 1QA7A 5T3HA 5A0BA 1EB2A 5DO4H 3LGYA 2WPHS 5J4SA 2HPQH 2YNAA 3QTOH 1NT1A 4M7GA 1YC0A 1UO6A 2HALA 1GHXH 1Y3UA 1HAZB 5GPIB 2ZDAH 4NZQA 1D9IA 3FP7E 1GVZA 1KY9A 1MKXH 2IJOB 3FFGA 3KN2A 3H09A 4FVBA 1ESTA 4Y11E 1ARCA 1SR5C 5B6LA 1HB0B 2GCTB 4ASUD 1IQFA 2A7CA 1C5VA 2VIWA 1YYY1 1SGNE 3SQHE 2FP7B 1TBZH 4XOJA 1CGHA 4ISLA 3RXLA 5C1XA 2SGPE 1YLDA 1K9OE 2KM0A 2XWBI 4CRFA 3O8BA 1EZQA 4K3JA 5B6OA 4AOQA 4Q63A 3GCTG 3R3GB 4ABIA 1UVSH 1GBBA 3PM3A 1OXGA 4PROA 1O2PA 1D3TB 1GBIA 2AGEX 2GMTC 3E8LA 1WBGB 3MH6A 2AERH 2XYAA 3L6PA 4JZEH 2WUCA 1TNHA 4FU8A 2ODYB 1VCWA 1V2WT 1TWXB 1NFXA 4DT7B 3GY5A 2CGAA 2DUCA 2VJ1A 3U1IB 4Y6DA 1XUHA 1D4PB 2SGAA 3EDXB 4WMDA 1P2JA 2UUYA 3LU9B 2Z3CA 1GMDF 1P8VC 1WTGH 3RMNH 3OY5U 2A1DB 3KF2A 3PV5A 2KCYA 1NRPH 1AWFH 1GBDA 3BTFE 1O2RA 3PWBA 2A32A 3SJIA 3SN8A 3MNCA 1J9CH 3QZRA 3URDA 4A7IB 1FY5A 5DKMA 2DE8A 4FVDA 4HFPB 1MAXA 3FZDA 1DWDH 5C17A 3AK5A 2PKSC 1AY6H 2J38A 3S7HB 1S84A 3KYGA 1VJ9U 3OE7D 1TGSZ 2V7QD 3A83A 1P2KA 1EQ9A 2P3UB 1JMOH 2AGGX 5FPTA 8GCHG 2VIPA 4U2WA 4ZKRU 1HNEE 4JK6A 4CRGA 4DIIH 1COWD 5AHGH 2O8TA 1Z7KA 4UE7H 1EFRD 1E38B 1V2OT 2SNWA 1F5LA 1LKBA 2PFEA 1BMMH 2W26A 2ZGJA 3SO3A 2HLDD 2F4LA 2UUKB 5A8XA 1S6FA 3TH2H 1O3EA 2FS9A 1BCUH 1VGCC 4VGCC 1YLCA 3VB6A 3M5LA 1C2EA 3UFAA 3TGKE 2CMYA 3E0NB 1NTPA 3VXEH 1BBRH 2HNTC 1TGCA 3TJNA 1UTPA 3MHWU 5E0GA 4MDSA 1OSSA 1HJ9A 1P9UA 3GCHB 1SGTA 1QRWA 2AS9A 3RC5A 1C1OA 2XWAA 5JBAS 1V2RT 1O3CA 1T4UH 1WOFA 2F9PA 2F91A 1CHOF 4FUEA 1OWHA 1UTOA 3SV2H 2ZFQH 4KELA 2J97A 1AZ8A 2PKAB 2B7DH 4RT0A 1DWBH 1V2NT 3KEEA 2M5TA 1EXFA 3F9HA 1W7XH 2A4OA 1Z1IA 1FI8A 4IC5A 2BDCA 2BTCE 1P01A 1GMHG 7GCHG 1Y5AT 2FI5E 2ZGBH 2WPKS 4ZH8A 1HCGA 1W0KD 1XUJA 2G51A 4IS5A 3UWJH 2ZGCA 4CR9A 3LH3A 2OC1A 1C1QA 2Z6BD 3SUEA 1ESAA 2GV6A 1PPHE 1AFEH 2BDAA 2Z9IA 2R9PA 2C3SA 1Y3YA 1T8MA 1GJ8B 3K65B 3MWIU 3SGBE 2JIZD 3P92A 2ULLA 2F9UA 2R3YA 1GI5A 1NZQH 4FETA 5L6NH 1PFXC 3ZZCA 2CJIA 1HYLA 1TFXA 3U98H 1MTNC 1MBMA 2TGTA 5LH8A 2C8WB 1CU1A 3D49H 7LPRA 3F68H 1A5GH 1O3IA 1P06A 4WMFA 2J92A 3M5NA 1C2KA 3ZYDA 1TA6A 3KQBA 3ZZ8A 3RXDA 1VKYA 1TX7A 2ZU4A 3M3VA 2ZO3H 1NPMA 3AW1A 2VIVA 2GMTB 3SQEE 1E37B 3MO9A 2KX4A 3KNXA 1ANCA 4MQAA 4RSPA 3GY4A 1AO5A 2QXHA 1TGBA 3A80A 1C1NA 1VITF 5C67A 2HWLB 2VH0A 4GUXA 1IAUA 2EY4C 3A84A 4K8YA 4LZ4B 1MCTA 2QV1A 5JB9S 1OPHB 1YPLH 1D6WA 1MTUA 1C2HA 4MLFB 1OWEA 2XTTB 3KL6A 5DP4A 1DICA 1ABJH 2ZTYA 5EW2H 4I7YH 1O3FA 2Z94A 2ZU3A 1EX3A 2YOLA 3S9BA 4JZ1A 3F9FA 1GBHA 1LVBA 5ESTE 3RXCA 4U32A 2TGAA 4BAQB 1O3NA 1WYKA 1HAXB 1W12U 2GDEH 3MU1A 3BG4C 1THPB 1HRTH 1BA8B 1XKBC 2PKSB 3NZIA 3PLPA 4B71A 1EPTA 4UFEH 3B9FH 1YPKH 1TMBH 5FAHA 1IQKA 3ESTA 4HG6A 1A3BH 5EG4A 1YKTA 3MH4A 4WF8A 4JK5A 5G4BA 1FY1A 2JH5D 3DCLA 1D6RA 4ZAEA 1AVGH 2UUJB 4UEHH 1F7ZA 4ISIH 2TIOA 4FUFA 2XXLA 3HKJB 1TABE 1DWEH 1YCPM 2EEKA 1OYQA 1MBQA 4YESB 2C90B 4CH2B 1GBAA 4D9QA 4GHQA 4UFGH 4JMYA 2ZFTA 3AAUA 2AHME 1VGCB 4VGCB 4MNXA 1V2ST 3MQKC 3OY6U 2ZDVH 4ISHH 5DP8A 1GDNA 3LGVA 1ESBA 2QC2A 2FTMA 1S0QA 1K1JA 4K8BA 2BVSH 3KQ5A 4NFFA 1TMUH 4CBNA 3DFJA 4MVNA 1YBWA 2BDIA 3LJOA 2GT8A 1BMLA 1GJ4H 2A4RA 2OC0A 2F9VA 4H6TA 3LKWA 1P9SA 4ABDA 4RT1A 3M61U 4E06H 2CN0H 4AB9A 2G00A 3GY3A 2WPMS 4OS7A 4ZKSU 3V7TA 1C5UA 1O32A 4O9VA 2BQ7B 1PPEE 4ACBA 2JJ1D 5L2YH 3UNRA 1GHVH 3SW2B 1O2XA 1C4Y2 1FPCH 2RCEA 2Y5FA 3LC3A 1MZAA 5DJ7A 3SJ8A 1QNJA 1E36B 3DFLA 4AFUA 1A4WH 3T28A 1EASA 3F2HA 4I8JA 5A2MH 4YOIA 2OLGA 1X7AC 5DGJA 5C1YA 1G9IE 2FDAA 4BAHB 2ZHDA 1DVAH 1FPHH 1AD8H 1WV7H 1ZMLA 2BY6X 1ANBA 4GCHF 4X1PU 5ABWA 4I31A 5H4IB 4DT4A 1FAKH 2BD2A 2F9BH 1O5GH 4KGAA 4ZMAH 1DSUA 1E0FD 1CA0C 1GVKB 1LDTT 2GZ9A 2ZNKH 1MQ6A 5FPYA 3SV7A 1SGIB 1C1WH 1BJVA 2QF0A 4F48B 1O36A 1MTNB 1O3OA 5GDSH 2F83A 1BHXF 5I46H 2ZDMA 3BTEE 1WXRA 5GCHG 1EZXC 1NRSH 4O3UA 3EQ0H 5K7RA 2ZQ1A 2BD8A 3PV4A 3SU5A 1LCYA 3BIVH 4TPIZ 5FX5A 4NGAH 1A0HB 2XNDD 1UTLM 2V0BA 3UNQA 1M9UA 4FUGA 1CA8B 2BD9A 3SV8A 4AGKA 5C3NA 3HPTB 3U69H 5IYTA 3LPRA 3N7OA 1C1RA 1XUFA 5E2OA 3PTBA 1DSTA 1CE5A 1GI9B 3A82A 5DK1A 1UHBA 4K1SA 3RXSA 3M36A 4JZDH 3ZIAD 4Q7ZA 1YPJH 3P8OA 1AVWA 5EJ1A 4MPVA 4RKOB 1ELBA 1ID5H 4CH8B 1CT4E 1TPPA 3FKSD 3IITA 2OINA 3EGKH 3T29A 1W8BH 1O2SA 1O2OA 2QXGA 3M35A 4TYDA 2BB4A 1GG6C 1UVUH 1IQGA 3IG6B 4ZKNU 2TGDA 4B76A 2FYQA 2G5NA 5EXNA 5LPEA 1XXFA 3GOVB 4K1EA 5FBIA 1FLEE 4NA8A 1V2TT 2UWPA 3BG4B 1Z6EA 1D3DB 1MUEB 4BOHA 3O8CA 2FWWA 1FONA 3FO8D 2TBSA 2ZDKA 4J2YB 3A88A 1ABIH 1FN8A 1L2EA 1UMAH 1ZJKA 1IQNA 2J98B 1DY9A 5A0AE 2JETC 3ZVBA 5FHTA 3WWFA 2OC7A 3ZZ3A 3ZVAA 5K0HA 1IHTH 1C1VH 4X2YA 1ETTH 2F43B 4JZIA 4YT6H 4BAOB 3QZQA 4HTCH 1MAYA 1BMAA 4IC6A 1UCYK 3QDZB 1ZR0A 5HGGA 5EW1H 3MH7A 1C2FA 1GJ7B 2K0QA 2EA3A 3M7UA 1HIAB 1UTJA 3TH3H 3MO6A 2GDDA 2Z3EA 4CBOA 3K6YA 1C5QA 1XUIA 2WUBA 1O5FH 4X8UH 3BN9A 2KZ4A 4H6SB 2BX3A 3LGTA 1SGDE 3A7WA 4K2YA 2TPIZ 3PMJA 4X6NA 2IN2A 2QXJA 2AFQB 1CHGA 2W5EA 2AGIX 4JYUH 4BXSA 5HXFA 2O9QA 1F5KU 5FCRA 1TQ0B 1LQDB 1S6LA 2GV7A 3MNXA 1QY6A 2VVVA 1WQVH 4HGCA 5T6FA 8LPRA 5KECA 2ESTE 2VIOA 3BTTE 2OXSA 2PSYA 1WCZA 4K69A 9LPRA 2G5VA 2FOBA 1ZYOA 1O2JA 5EIYA 1QL9A 1T8NA 1QBNA 3SUGA 3NWUA 1BMNH 3TNTA 1SC8U 2PSXA 4ABAA 2BD7A 4DG4A 4X2VA 2Y82A 3U9AH 3RMOH 2FI4E 1Z8IB 1A1RA 1YPMH 4A6LA 1NY22 1YP9A 1EP6A 4R0IA 3PLKA 2EI6A 1CA0B 1GHBF 1BBRK 1CT2E 1O39A 4GCHG 1SGFG 2W3IA 5CE1A 4JZFH 1E79D 3RXVA 3M37A 1OP2A 5L2ZH 2BLOA 1NBMD 3FANA 1TGTA 2ZHQH 2HOBA 2TGPZ 3RC4A 3LT3A 1TBQH 2PHBA 3M7TA 2JKHA 2PW8H 1TOMH 1RGQA 5CHBA 4OS6A 4IBLH 3QN7A 1S5SA 3KYFA 3D65E 1KTSB 3GYMA 3VB3A 1BJUA 2ZDLA 1LVYA 1JBUH 3E91A 3UTUH 2R2WU 5EJZA 1SSXA 1O5EH 1RXPA 1TALA 1ELCA 2AEIH 4GLYA 1DFPA 5EODA 3L3TA 4I8GA 1O2IA 1YWUA 4FUIA 3A7YA 1K1PA 1NBME 1HAVA 5CHAC 4BTIB 2NU2E 5EOKA 4NA7A 3RXQA 3KQEA 3BTHE 2D26C 3SU6A 3A87A 3S69A 1V2VT 2VGCC 2VVCA 3SNAA 2ZF0H 1F92A 2KAIA 4P02A 1OWDA 2ZTXA 2OUAA 3GCOA 1NESE 1HBTH 1Q3XA 3RXEA 2ZG0H 1KMHB 5AVDA 3M7QA 1KDQB 1DITH 3V13A 1A7SA 1QR3E 1A5HA 1CGIE 1O2QA 1O3MA 5ETXA 4OS4A 1DXPA 3STJA 3TJUA 1IQMA 4I33A 4FUBA 4U01A 1YCPH 2B8OH 1P2NA 4WH6A 1MABB 1GL1A 3F0OA 2A0QB 2CV3A 4GAWA 9ESTA 4B2CA 5C0UA 3NCLA 3VB5A 1ELTA 1V2JT 3ZVGA 1P03A 1UCYE 1C4U2 3OTPA 2JETB 5HM9A 4A1XA 3RXHA 3STIA 4LK4A 5C0TA 1RJXB 3S9AA 2QN5T 2FYRA 1V6DA 5BPEA 4ABEA 4DOQA 5C5NA 2H9TH 3U1JB 2GGVB 2AIQA 2W7UA 1T8LA 2J95A 1GPZA 1SB1H 2FLBH 4NSYA 4NWKA 3SGAE 5F53A 1V2QT 1IQIA 3C27B 2BVXH 3LIWA 3SUFA 2BZAA 6CHAC 3ZYEA 1UCYH 3EE0B 4LXBH 3A8AA 3UQVA 4ACAA 1SGPE 3RXFA 1MZDA 2WINI 2A4QA 2FM2A 1LPKB 2FOMB 2WYGA 5DSFA 1ZGVA 2Z9JA 2AYWA 5EQRA 4CREA 1CQQA 1QBVH 3RU4D 1J14A 1HFDA 2G4TA 1TLDA 2LPRA 3RC6A 4BNRA 3LGWA 1H8ED 4AG1A 1GMCF 3QX5H 3UR9A 2QCYA 2Y80A 5AFZH 1S6HA 1NROH 2AMPA 3IWMA 2Z9GA 1Z1JA 2BLQA 3Q00A 2H5DA 2BY7X 1WSSH 2VU8E 3NK8A 2VH6A 4FOUC 1ELEE 4NIXA 4X2WA 1TNGA 1DY8A 4X1QU 1EPTC 1FIZA 1PQ5A 1SOTA 5JDUB 2BX4A 1BBRE 3U8RH 1GBKA 3RU4E 1NRRH 1EP5A 3RXGA 1PPCE 2Q6GA 4Q7XA 2Q6FA 3QWCH 2VIQA 4SGAE 5F6MA 4WWYA 5C5OA 3P95A 3VFEA 1YF4A 3EAJA 4AYVB 8ESTE 1FXYA 5TJXA 2LNCA 2RA0A 5PTPA 2ZPSA 1DPOA 3MI4A 1GL0E 1PYTC 1O3PB 2CF8H 3BG8A 1AVXA 3RXKA 2FS8A 1FQ3A 3RXJA 1Z6JH 1MQ5A 3AAVA 3I29A 3SGQE 2YMSC 1HLTH 1TQ7B 3F3BA 1EAIA 1PQAA 1HAIH 2M2AA 3KGPA 1PYTD 1BZXE 1C2GA 2O8LA 5HKKD 1HAYB 1G2LA 5ESBA 2F3CE 2RDEA 5E8EH 3UNSA 1KTTB 1ZPCA 2QF4A 5LPRA 1XUKA 1UTMA 4AFSA 5EPNA 2BDBA 3S7KB 1O3AA 1Z8JB 1UVPA 3MFJA 4NIWA 2ZCKP 3PWCA 1XUGA 2HVXA 4QT8C 1NFYA 1O5BB 5CHAB 4ZKOU 3P17H 3CNRA 1ELAA 2ZA5A 2KCAA 2PKAA 4KTSA 1GI4A 5GIBA 2VGCB 1MMJN 4AYYB 3ATLA 3A8CA 1BRUP 3RXOA 1SLWB 2J5UA 4WJG2 1DX5M 2HNTE 3BV9B 1N8OC 4DCDA 4AGJA 1RIWC 2EI8A 5GJ4B 3F2GA 3WWBA 1WUNH 3RXPA 4YLUA 2PUXB 4SGBE 1GBJA 3SYJA 1XVOA 2XBYA 1H4WA 1IQHA 1VITH 4INHA 3F0PA 1UK3A 1O35A 1O34A 3TK9A 3F1SB 1ZOMA 3ELAH 3Q77A 1C5PA 1QJ6B 1AKSB 5HM2A 2WPDD 1DLEA 4GVUA 1HXFH 3TJOA 2FEQH 1P57B 5AFYH 3EA9A 1S83A 2A7JA 4DURA 3PV2A 4HZHA 2GD4B 1C5YB 3P8NA 3TIUA 1QIXB 4AN7A 1ZSLA 3RXMA 1WQSA 1KIGH 1CVWH 3T62A 2AMQA 1L1NA 2QF3A 2A2XH 1K22H 1ZRBA 4ESTE 4XDEA 2ZHEH 1AMHA 1GBTA 1RD3B 3BTDE 4X0WU 3WY8A 3SJOA 3PRBA 4FUJA 2FX6A 2LELA 1Q31A 4D7GA 1K1MA 1ZRKA 3BEIB 2SGDE 3SU0A 1LHGH 1C5OH 2OK5A 2ZGHA 4KTCA 1RTLA 3BIUH 5DP6A 1A61H 4INKA 4P00A 1DANH 4XRNA 1TYNA 3A85A 1GMDG 1RTKA 1Y3VA 1E35B 1O2NA 2BY5X 4X1RU 1MH0A 3NUMA 1S0RA 1TNJA 2GCHF 1AB9C 3ZV8A 3UR6A 1JRTA 3KCGH 1J17T 1GMCG 1ZPZA 4INLA 1P02A 1BTPA 1UK4A 1Y3WA 3SU2A 1VCQA 3ATMA 4ABBA 2P3TB 2BY8X 2BQ6B 2RG3A 3DHKH 4MNVA 3MU0A 4ZCNA 1EPTB 2W7SA 2CK3D 4NIVA 2BLWA 2TRMA 4AG2A 3TU7H 4FU9A 1TX6A 2Y5GA 4FXGH 1QGFA 1WAYB 3MU8A 2OQUA 2XNIA 1K2I1 1DXWA 3MH5A 1WDIA 3K9XB 1TPSA 3EE7A 1HDTH 5IDKA 1EKBB 4F4OC 1O3KA 1H8HD 1TMTH 1P2QA 2BY9X 2WPLS 3UREA 3TK5A 1YPEH 3F9EA 3AVZA 3O8DA 5EJLA 1O38A 3DSGA 2YMSB 1Y8TA 2FOFA 4B75A 1Z71A 1L4DA 1O2YA 3N99A 1IQEA 4M9FA 4XSKU 1HAOH 2WZQA 1SOZA 1IHSH 1BTXA 1GI7B 3JZ2B 1GDQA 4AB8A 3PMAB 1XVMA 4Y76A 2Z7FE 3TH4H 1EAUA 1OS8A 3CENA 2PV9B 3B23B 4X6MA 4MG3A 2ZKSA 3Q3YA 1ZTKA 1B0EA 1CHOG 3OEHD 4KTUA 4X8VH 1ACBE 3QO6A 1PPFE 5DP9A 2QE7D 2ZCLP 3RM0H 1GJDB 3T25A 2P16A 2Z9LA 2FIRH 3PO1C 1NRNH 2JJ2D 4UONA 5DG6A 2STAE 1NFUA 4Q4LA 5GWZA 2ZFPH 1B7XB 1QB1A 2C8YB 2B9LA 2ZWLH 1H9HE 2FLRH 2CHAC 2ZHWH 2FI3E 1V2UT 1KLIH 4F55A 2VIDA 3MMGA 4YZUA 3C1KA 1ELDE 1SGYE 1N8OB 1QCPA 2BMGB 1VCPA 6GCHF 4TWYA 1RIWB 3V0XA 3P8FA 2PTCE 1OHHD 4THNH 1FN6A 1QRXA 4NCYA 2QYIA 3PYHA 4ZUHA 1W11U 3OTJE 1C9TA 3A8DA 2A5KA 1D3QB 4HI3A 4DY7B 2C8ZB 2BZ6H 1Q2WA 4DJZB 1ZHRA 4JYTA 2V35A 1W0JD 3GYLB 3W94A 2K1QA 4E05H 1DS2E 2G55A 1T8OA 2ZFRH 3DUXH 2JDID 2BD3A 3SBKA 2KCPA 5TCAA 4GSOA 1O2UA 3ODDA 5JBTA 1BTUA 2P59A 4OM9A 3UIRA 3HK3B 4AC9A 1GHYH 1J15A 1C5RA 3UQOA 2V3MA 3GY6A 1GWAA 4MPUA 1XX9A 1B5GH 2V3HH 1GGDC 1FY3A 1KXFA 1GHAF 5A8YA 4TY6A 4Y10E 3L33A 1QQ4A 4IMQA 1NRQH 2FO9A 1VITG 1QQUA 2XC5A 3SI3H 3URCA 1UHBB 3GICB 1FY8E 1QRZA 1P09A 1UTKA 1FJSA 4A92A 1HAPH 1AWHB 1K1NA 3PMHB 3UOPA 4AX9H 1O2LA 1THSH 1FNIA 7ESTE 2CXVA 1BITA 2ANKH 5SGAE 4K60A 1G3EA 1AB9B 1NU9A 1YCPK 1P04A 1EATA 4OGXA 1TONA 5LGOA 3SI4H 3MU4A 1EJAA 2VWLA 3GCNA 1DUEA 1PQ7A 1HUTH 4OGYA 1THRH 5DN6D 1HAGE 1OKXA 1A0JA 1BHXB 1RTFB 2OD3B 4B1TA 3KHVA 1SGFA 1GI1A 1T32A 1Y5UT 2IPHA 1O3JA 3BEUA 3FAOA 2OQ5A 3A86A 4Y8ZA 3B8JA 3FP6E 4YT7H 1FIWA 1EAXA 4XD7D 2P93A 4UDWH 1ZMJA 4Y7AA 2C93B 1GVLA 4I32A 5EXMA 4WY3A 1ZHPA 1N6XA 2WPJS 4YLQH 2BXTH 3S0NA 1XMNB 3SORA 1DOJA 2ILNA 3D23A 3UUZA 1GJAB 3QLPH 1SGRE 2H5CA 1GI3A 3GCTF 4D7FA 2O8MA 3M5OA 2HLCA 3RP2A 5CMXH 1K0HA 1EOLA 1TAWA 1AE5A 2I6QA 1SI5H 2VINA 4H42U 3MO3A 1XXDA 3H7TA 3ZZ9A 3NPSA 1QB9A 1HIAA 1H8DH 1MTVA 4NZLA 1G3CA 3GY7A 1P05A 3SU4A 2OBOA 4TWWA 3BTGE 2Y81A 1CSOE 2R0KA 3PO1B 5F03A 2BM2A 3TK6A 3A89A 3UOUA 1ELFA 3FZZA 4WMEA 1VJAU 2NU4E 1NC6A 2CHAB 3W1EA 4YTAA 4NA9H 1NS3A 1P11E 4AORA 1AGJA 1Y5BT 1BTWA 4XFQA 2WSSD 3ZZ6A 2Y6TA 3OX7U 3RXUA 3U28C 1AUJA 3MOCA 1KXCA 1ZMNA 1YPHC 1EOJA 2KCOA 2BOKA 1O2GH 4Z1MD 3V3MA 5DP3A 1BTYA 1E1QD 2FOHA 1SKYE 4UFFH 4XBBA 2QA9E 4TSFD 1QBOA 3FP8E 1FMGA 3RXTA 1PPGE 1GJ5H 2K8IA 1RS0A 5C94A 1MD7A 1J8AA 1MTSA 1ANDA 5F8XA 1LHCH 1CGJE 2KR7A 3LGIA 1H9IE 1TX8A 4LZ1H 1INCA 1W2KH 4Q7YA 1T4VH 4B2BA 5C2ZA 5HIZA 4B74A 1F5RA 1MTWA 1LKAA 2UUFB 3CS7A 1GGDB 1C5ZB 2UWOA 2WV4A 3I78A 1SQRA 1G2MA 3GISB 1YPHE 1ZSJA 2FZZA 1EJMA 4X8TH 4Y0YE 1GHAG 1ZTJA 3ZZBA 1JOUB 1HAVB 1BRBE 1QL8A 2ZIQH 5LPFA 5FCKA 2H9EH 3EYDA 3MTYA 2IPQX 2D1JA 1GG6B 4I8HA 1ETRH 3KIDU 1BIOA 2R3UA 1TNIA 5CDFE 1SQAA 4WH8A 2D2DA 1P0SH 5GNDA 2ANWA 3SZNA 3MYWA 1PJPA 3SNCA 3ODFA 3A8BA 5JPMH 4AFQA 4FUHA 2H6MA 1ELGA 1QTFA 3T27A 3TGIE 4ABHA 3T5FH 2NU0E 1BRCE 1O3GA 2I6SA 5HIYA 1KDQA 4BAMB 3GDUA 2AMDA 1OOKB 1GBEA 4KKDA 4DVAU 2FODA 1P3EA 1J16A 2QGRA 1F0SA 1C2IA 2FXRA 3A81A 4UFDH 1LHFH 3TGJE 3RUOA 1LQEA 1CT0E 2ZC9H 1MCVA 2ANMH 3CS0A 3SJKA 2RFKC 3H7OA 2VWMA 3N7EA 4Y7BA 2ZDNA 3ATKA 5JBBS 4IN1A 4YOGA 4I8KA 3M3TA 1H9LB 1GBMA 1QHRB 5FL7D 1K1IA 1O2KA 1W0YH 1O31A 1OP0A 3U8TH 4ZROA 8KME2 3OEED 4RKJB 5DP5A 1FDPA 5GXPA 1VR1H 1E34B 1SL3A 4NWLA 3RLYH 2JH0D 1TIOA 2O8UA 2XOKD 2FX4A 1OWKA 5E0HA 4ZXYH 1Z8RA 1W3CA 1O5DH 2VWNA 2ODQA 1C5LH 2BD4A 1SMFE 3FVFB 1WTHD 3LH1A 3SV6A 1V2KT 4TY7A 2Q6DA 5L30H 1L1JA 4NFEA 4YXWD 2VB0A 1LMWB 4F49A 2L74A 3D62A 4X1NU 1S82A 1AHTH 4ISNA 1O2VA 4E7RG 2ZP0H 1YM0A 2THFB 3E6PH 4ZXXH 2XBWA 3S9CA 1WU1A 2UWLA 2GT7A 2OC8A 4MTBA 1AN1E 1YPGH 1C5NH 3SOSA 1C1TA 1JRSA 1GHBG 3UPEA 4XBCA 1C1UH 4DW2U 4WVPE 3NRLA 2STBE 1NU7B 1A0LA 1LO6A 5FPSA 3QTVH 2VNTA 1IQJA 2H2ZA 1C2JA 4KP0A 4K1TA 4MPXA 2PGQB 1LTOA 2PLXA 2XRCA 1C5MD 1TRNA 2ZZUH 2P8OC 3SHAH 3A7VA 2YMSD 3DD2H 4FUDA 2BDGA 2OBQA 1AFQC 1S81A 1E1RD 2FOCA 2QXIA 3ZVEA 2OTVA 3VGCC 2GTBA 2PP6A 1C2LA 1JXPA 1KLTA 2HPPH 3H5CB 3SU3A 1EZSC 4I8LA 2GP9B 2LP6A 1BDAA 2BLVA 1GHZA 1GBFA 3KQDA 2PTNA 2P3FH 2O8WA 2QY0B 1FV9A 2ZGXH 1BRAA 1YLNA 2JH6D 3BTME 1BTHH 1V2MT 1W14U 3A7TA 1LHEH 3UB0A 2GVFA 1B0FA 2FMJA 1SGCA 4IMZA 1TPOA 5FXLA 3LJJA 1GI2A 3OAAD 3E0PB 4B6EA 2ZQ2A 1ZJDA 2WPIS 2SGFE 5EXLA 3SHCH 1O3LA 3OYPA 3ATIA 2AIPA 1ARBA 1KXAA 3MNBA 3LGUA 3GY2A 3VB7A 1QZ8A 3M3SA 5F8TA 1O2WA 2BDHA 3QK1A 4OS1A 4D8NA 1SGEE 3A7XA 4K5ZA 1GCDA 1GI0A 1F0UA 5F8ZA 5JBCS 2H9HA 1O37A 1QL7A 3SV9A 1A5IA 1EJNA 1ORFA 2HVYB 1SFIA 1MD8A 2ALVA 3ZZ7A 1K1LA 1AKSA 1HJAC 1D3PB 1N1LA 3F2FA 1HGTH 5GCHF 1V2PT 1ZTLA 2Y5HA 4NSVA 4DIHH 4A5TS 4FUCA 4Z6AH 1KXEA 2D8WA 4Q2KA 6CHAB 2GKVE 1HXEH 3P6ZB 2L6OA 1DWCH 1FUJA 3UY9A 4A1VA 1VZQH 2Q1JA 1AZZA 3SNDA 2ASUB 4CRAA 3T26A 2PGBB 5DPAA 2G8TA 1UK2A 1BB0B 3HATH 1LPGB 1C5TA 2AH4X 1ZZZA 1H8IH 2C8XB 2WHXA 3BTWE 2YNBA 1SHYA 1Y3XA 3F6UH 1YGCH 2ZU5A 4H4FA 4BTUB 3CP7A 3EA7A 1BTZA 3RM2H 2ZCHP 1F0RA 1QURH 3BF6H 2HNTF 3NKKA 4A1TA 1OWJA 5FBEA 2B0FA 1NN6A 1RFNA 3ENSB 1XM1A 2V3OH 5HYOA 2BHGA 3TNSA 3VG8A 3JZ1B 4AZ2B 4ASHA 1AI8H 5DP7A 2A5AA 3ZZ4A 4X8SH 2R0LA 1KYNA 4MPWA 1H1BA 1JIMA 3P70B 3TPIZ 1FAXA 1JWTA 3WW7A 1UTQA 2J4IA 3FN8A 1QJ1B 3MNSA 5IK2D 2HRVA 1HJ8A 5T6DA 4O97A 4YOJA 1SFQB 1FY4A 2PWXA 1DUAA 4B6FA 1K1OA 1C1SA 2G52A 2VBCA 1IQLA 4FU7A 1GCTC 3AW0A 3PRDA 2FESH 1FZZA 1ZSKA 1BMFD 1DT2A 4IW4E 4CHAC 4Z0KA 3K2UA 2FOGA 3TLOA 1TE0A 4ABJA 2P8OB 5E0JA 5EQSA 1ETSH 3DT0H 3ZZ5A 5EPYA 1L0ZA 2OP9A 1RRKA 1EB1H 2IOTA 4NIYA 1AFQB 3RXBA 1P2OA 2W3KA 4OS5A 1GJBB 2EC9H 2Z9KA 1O2TA 3VGCB 1Z8GA 3AASA 5JB8S 1S85A 5KEDA 1MKWK 2J2UA 5EU8A 1ELVA 2NWNA 1T7CA 1UJ1A 6LPRA 2F9NA 1ZHMA 6ESTA 1GJ6A 1BQYA 5KGOA 2RDLA 2HGTH 1OP8A 3T2NA 2NU3E 4TPYA 1BUIA 3F9GA 3ITIA 1QB6A 3N7DA 3DSOA 2ZU2A 3M5MA 4ABFA 1U6QA 2FTLE 2J34A 1W7GH 1P12E 1G36A 2Y7ZA 1GJCB 3BSQA 5JYIA 2A31A 5FX6A 3LONA 4ZHAA 1L1GA 2EQNA 1GI6A 1P2IA 5TCCA 1KLJH 4MNYA 2A4GA 4D76A 3RXIA 3TITA 4X2XA 1LVOA 2BYAX 1O2ZA 2Y7XA 1SHHB 4Y8YA 1F0TA 1O5CB 3VXFH 2GZ8A 2EI7A 2RA3A 3FOAA 1O2MA 4ZHLU 1TNKA 1UTNA 4BTTB 2J94A 1G32B 1AE8H 3E16B 1UVOA 3SJ9A 1G37A 1OWIA 1Y59T 1UW7A 5BRRE 3Q3KA 2P94A 5A8ZA 2BDYA 3SU1A 3VB4A 3ZV9A 4OS2A 1BOQA 2IJD1 1HJAB 2FOAA 2ODPA 1CBWC 5T6GA 1N6YA 1DM4B 2GZ7A 3O8RA 1LHDH 2BD5A 2WV9A 3GS9A 1K28D 5EGMA 5EQQA 2OCVB 1NM6A 3P8GA 1SGQE 2W6ID 2WV5A 2XCFA 1SVPA 5E2PA 3MU5A 1O33A 2ZPQA 1TA2A 4BXWA 1L4ZA 1QFKH 4RI0A 3DSPA 3LOXA
chains in the Genus database with same CATH topology
3LDXH 3RDZA 2ZFSA 1O0DH 1PPZA 1QJ7B 3ZVFA 3ZZDA 1GBLA 2QAAA 1SLUB 1SBWA 1AQ7A 1C9PA 1DLKB 2SGQE 3HGNA 1G30B 1EUFA 3OSYA 4YM9A 3SNEA 7KMEH 4ZHMU 1SLVB 4IGDA 1NFWA 1TBRH 3W95A 3RMLH 1HV7A 1MKXK 1NO9H 2GCHG 1GBCA 4YO9A 4XBDA 1OYTH 1C5SA 2ANYA 2A2QH 1V3XA 4GPGA 4Y0ZE 3Q76A 3GY8A 3TJVA 2B5TB 3PTNA 3VPKA 1DE7H 3NXPA 4Y79A 2SFAA 3RXAA 2BVRH 3RLWH 3BTQE 2CF9H 1W13U 3KQCA 5C20A 3E1XB 1W10U 5A09A 4O3TA 1OX1A 3PROA 4CR5A 1C1PA 1W0ZU 2GCTC 1O2HA 2A5IA 2C4FH 1TRMA 4BAKB 4D9RA 2A7HA 1C2DA 1ZGIA 3SNBA 4Y71A 1P10A 3RU4T 2NU1E 1GCTB 2SNVA 4DGJA 4J1YA 4CRDA 1HAHH 3PLBA 1ANEA 2BQWB 2ZEBA 2BOHB 3BTKE 4MNWA 2ZTZA 2GX4A 2J9NA 4X1SU 1LPZB 1P2MA 4E7NA 1TNLA 4CHAB 1C2MA 1ZLRA 4NG9H 1SPJA 5I25A 1GI8B 4X6OA 3SUDA 3OU0A 1LVMA 1PQ8A 1CO7E 1GHWH 1BT7A 1A2CH 2ZPRA 1GJ9B 4ISOA 2ZI2H 3HGPA 3K6ZA 1HPGA 1SLXB 3E3TA 1KXDA 4B73A 2ZFFH 1IOEA 4XE4A 3VEQB 3LC5A 3ZZAA 2BXUH 1SQOA 1UVTH 3V12A 1TRYA 4RN6A 2G81E 3QGNB 1O3DA 3QUMP 3TVJB 1EAWA 1G3BA 2SGEE 4UD9H 3PMBB 4U30A 1ZPBA 2F9OA 1MKWH 1PPBH 1C5XB 1G3DA 3BEFB 4Q80A 1XKAC 4O03A 3UWIA 2V6NA 3I77A 4X6PA 1O30A 2XC0A 1TB6H 4WXVA 2FOEA 1DDJA 2VWOA 4GHTA 1A3EH 3U8OH 1AUTC 6GCHG 3RXRA 4AFZA 2XC4A 8GCHF 3HK6B 1JIRA 2P95A 1AIXH 4JYVH 4WXIA 3HKIB 1SG8B 1MU6B 2H1UA 1T31A 5J4QA 4JCNA 3E90B 3GDSA 3ZVCA 2R2MB 1TPAE 2WYJA 3G01A 1A46H 4Y8XA 1C1MA 2FPZA 3DA9B 1MU8B 5A0CA 2Z3DA 3RMMH 2PR3A 3GDVA 4BANB 2XCNA 4B2AA 2DE9A 2XBXA 1CBWB 1O3BA 4R8TB 2XW9A 1QA0A 3EA8A 4CRBA 2ALPA 1AU8A 1KXBA 1V2LT 1O5AB 1O3HA 1SQTA 3Q3XA 1C5WB 3R0FA 3GCHC 4ABGA 4LOYH 2VVUA 2ZHFH 4IN2A 1TOCB 3QGJA 1C4V2 3ATWA 1K21H 4CRCA 5HMAA 2PUQH 3ZVDA 2XBVA 3A7ZA 1P3CA 5C1UA 1GDUA 1KSNA 2KAIB 2G4UA 2QIQA 3PB1E 1TGNA 2ZECA 1GMHF 1EZUC 2A45B 7GCHF 5AF9H 1F2SE 2ZU1A 1QA7A 5T3HA 5A0BA 1EB2A 5DO4H 3LGYA 2WPHS 5J4SA 2HPQH 2YNAA 3QTOH 1NT1A 4M7GA 1YC0A 1UO6A 2HALA 1GHXH 1Y3UA 1HAZB 5GPIB 2ZDAH 4NZQA 1D9IA 3FP7E 1GVZA 1KY9A 1MKXH 2IJOB 3FFGA 3KN2A 4FVBA 1ESTA 4Y11E 1ARCA 1SR5C 1HB0B 2GCTB 1IQFA 2A7CA 1C5VA 2VIWA 1YYY1 1SGNE 3SQHE 2FP7B 1TBZH 4XOJA 1CGHA 4ISLA 3RXLA 5C1XA 2SGPE 1YLDA 1K9OE 2XWBI 4CRFA 3O8BA 1EZQA 4K3JA 5B6OA 4AOQA 3GCTG 3R3GB 4ABIA 1UVSH 1GBBA 3PM3A 1OXGA 4PROA 1O2PA 1D3TB 1GBIA 2AGEX 2GMTC 3E8LA 1WBGB 3MH6A 2AERH 2XYAA 3L6PA 4JZEH 2WUCA 1TNHA 4FU8A 2ODYB 1VCWA 1V2WT 1TWXB 1NFXA 4DT7B 3GY5A 2CGAA 2DUCA 2VJ1A 3U1IB 4Y6DA 1XUHA 1D4PB 2SGAA 3EDXB 4WMDA 1P2JA 2UUYA 3LU9B 2Z3CA 1GMDF 1P8VC 1WTGH 3RMNH 3OY5U 2A1DB 3KF2A 1NRPH 1AWFH 1GBDA 3BTFE 1O2RA 3PWBA 2A32A 3SJIA 3SN8A 3MNCA 1J9CH 3QZRA 3URDA 4A7IB 1FY5A 5DKMA 2DE8A 4FVDA 4HFPB 1MAXA 3FZDA 1DWDH 2PKSC 1AY6H 2J38A 3S7HB 1S84A 1VJ9U 1TGSZ 3A83A 1P2KA 1EQ9A 2P3UB 1JMOH 2AGGX 5FPTA 8GCHG 2VIPA 4U2WA 4ZKRU 1HNEE 4JK6A 4CRGA 4DIIH 5AHGH 2O8TA 1Z7KA 4UE7H 1V2OT 1E38B 2SNWA 1F5LA 1LKBA 2PFEA 1BMMH 2W26A 2ZGJA 3SO3A 2UUKB 5A8XA 1S6FA 3TH2H 1O3EA 2FS9A 1BCUH 1VGCC 4VGCC 1YLCA 3VB6A 3M5LA 1C2EA 3UFAA 3TGKE 2CMYA 3E0NB 1NTPA 3VXEH 1BBRH 2HNTC 1TGCA 3TJNA 1UTPA 3MHWU 5E0GA 4MDSA 1OSSA 1HJ9A 1P9UA 3GCHB 1SGTA 1QRWA 2AS9A 3RC5A 1C1OA 2XWAA 5JBAS 1V2RT 1O3CA 1T4UH 1WOFA 2F9PA 2F91A 1CHOF 4FUEA 1OWHA 1UTOA 3SV2H 2ZFQH 4KELA 1AZ8A 2PKAB 2B7DH 1DWBH 1V2NT 3KEEA 2M5TA 1EXFA 3F9HA 1W7XH 2A4OA 1Z1IA 1FI8A 4IC5A 2BDCA 2BTCE 1P01A 1GMHG 7GCHG 1Y5AT 2FI5E 2ZGBH 2WPKS 4ZH8A 1HCGA 1XUJA 2G51A 3UWJH 4IS5A 2ZGCA 4CR9A 3LH3A 2OC1A 1C1QA 2Z6BD 3SUEA 1ESAA 2GV6A 1PPHE 1AFEH 2BDAA 2Z9IA 2R9PA 2C3SA 1Y3YA 1T8MA 1GJ8B 3K65B 3MWIU 3SGBE 3P92A 2ULLA 2F9UA 2R3YA 1GI5A 1NZQH 5L6NH 1PFXC 3ZZCA 2CJIA 1HYLA 1TFXA 3U98H 1MTNC 1MBMA 2TGTA 5LH8A 2C8WB 1CU1A 3D49H 7LPRA 3F68H 1A5GH 1O3IA 1P06A 4WMFA 2J92A 3M5NA 1C2KA 3ZYDA 1TA6A 3KQBA 3ZZ8A 3RXDA 1TX7A 2ZU4A 3M3VA 2ZO3H 1NPMA 3AW1A 2VIVA 2GMTB 3SQEE 1E37B 3MO9A 3KNXA 1ANCA 4MQAA 4RSPA 3GY4A 1AO5A 2QXHA 1TGBA 3A80A 1C1NA 1VITF 5C67A 2HWLB 2VH0A 4GUXA 1IAUA 3A84A 4K8YA 4LZ4B 1MCTA 2QV1A 5JB9S 1OPHB 1YPLH 1D6WA 1MTUA 1C2HA 4MLFB 1OWEA 2XTTB 3KL6A 5DP4A 1DICA 1ABJH 2ZTYA 5EW2H 4I7YH 1O3FA 2Z94A 2ZU3A 1EX3A 2YOLA 3S9BA 4JZ1A 3F9FA 1GBHA 1LVBA 5ESTE 3RXCA 4U32A 2TGAA 4BAQB 1O3NA 1WYKA 1HAXB 1W12U 2GDEH 3MU1A 3BG4C 1THPB 1HRTH 1BA8B 1XKBC 2PKSB 3NZIA 3PLPA 4B71A 1EPTA 4UFEH 3B9FH 1YPKH 1TMBH 5FAHA 1IQKA 3ESTA 1A3BH 5EG4A 1YKTA 3MH4A 4WF8A 4JK5A 5G4BA 1FY1A 2JH5D 1D6RA 4ZAEA 1AVGH 2UUJB 4UEHH 1F7ZA 4ISIH 2TIOA 4FUFA 2XXLA 3HKJB 1TABE 1DWEH 1YCPM 2EEKA 1OYQA 1MBQA 4YESB 2C90B 4CH2B 1GBAA 4D9QA 4GHQA 4UFGH 4JMYA 2ZFTA 3AAUA 1VGCB 4VGCB 4MNXA 1V2ST 3OY6U 2ZDVH 4ISHH 5DP8A 1GDNA 3LGVA 1ESBA 2QC2A 2FTMA 1S0QA 1K1JA 4K8BA 2BVSH 4NFFA 1TMUH 4CBNA 3DFJA 4MVNA 1YBWA 2BDIA 3LJOA 2GT8A 1BMLA 1GJ4H 2A4RA 2OC0A 2F9VA 4H6TA 3LKWA 1P9SA 4ABDA 3M61U 4E06H 2CN0H 4AB9A 2G00A 3GY3A 2WPMS 4OS7A 4ZKSU 3V7TA 1C5UA 1O32A 4O9VA 2BQ7B 1PPEE 5L2YH 3UNRA 1GHVH 3SW2B 1O2XA 1C4Y2 1FPCH 2RCEA 2Y5FA 3LC3A 1MZAA 5DJ7A 3SJ8A 1QNJA 1E36B 3DFLA 4AFUA 1A4WH 3T28A 1EASA 4I8JA 5A2MH 4YOIA 2OLGA 1X7AC 5DGJA 5C1YA 1G9IE 2FDAA 4BAHB 2ZHDA 1DVAH 1FPHH 1AD8H 1WV7H 1ZMLA 2BY6X 1ANBA 4GCHF 4X1PU 5ABWA 4I31A 5H4IB 1FAKH 2BD2A 2F9BH 1O5GH 4KGAA 4ZMAH 1DSUA 1E0FD 1CA0C 1GVKB 1LDTT 2GZ9A 2ZNKH 1MQ6A 5FPYA 3SV7A 1SGIB 1C1WH 1BJVA 2QF0A 1O36A 1MTNB 1O3OA 5GDSH 2F83A 1BHXF 5I46H 2ZDMA 3BTEE 5GCHG 1EZXC 1NRSH 4O3UA 3EQ0H 5K7RA 2ZQ1A 2BD8A 3PV4A 3SU5A 1LCYA 3BIVH 4TPIZ 5FX5A 4NGAH 1A0HB 1UTLM 2V0BA 3UNQA 1M9UA 4FUGA 1CA8B 2BD9A 3SV8A 4AGKA 5C3NA 3HPTB 3U69H 5IYTA 3LPRA 3N7OA 1C1RA 1XUFA 5E2OA 3PTBA 1DSTA 1CE5A 1GI9B 3A82A 5DK1A 1UHBA 4K1SA 3RXSA 3M36A 4JZDH 4Q7ZA 1YPJH 3P8OA 1AVWA 4MPVA 4RKOB 1ELBA 1ID5H 4CH8B 1CT4E 1TPPA 3IITA 2OINA 3EGKH 3T29A 1W8BH 1O2SA 1O2OA 2QXGA 3M35A 4TYDA 2BB4A 1GG6C 1UVUH 1IQGA 3IG6B 4ZKNU 2TGDA 4B76A 2FYQA 2G5NA 5EXNA 5LPEA 1XXFA 3GOVB 4K1EA 5FBIA 1FLEE 4NA8A 1V2TT 2UWPA 3BG4B 1Z6EA 1D3DB 1MUEB 4BOHA 3O8CA 2FWWA 1FONA 2TBSA 2ZDKA 4J2YB 3A88A 1ABIH 1FN8A 1L2EA 1UMAH 1ZJKA 1IQNA 1DY9A 5A0AE 2JETC 3ZVBA 5FHTA 2OC7A 3ZZ3A 3ZVAA 5K0HA 1IHTH 1C1VH 4X2YA 1ETTH 4YT6H 4JZIA 4BAOB 3QZQA 4HTCH 1MAYA 1BMAA 4IC6A 1UCYK 3QDZB 1ZR0A 5HGGA 5EW1H 3MH7A 1C2FA 1GJ7B 2EA3A 3M7UA 1HIAB 1UTJA 3TH3H 3MO6A 2GDDA 2Z3EA 4CBOA 3K6YA 1C5QA 1XUIA 2WUBA 1O5FH 4X8UH 3BN9A 4H6SB 2BX3A 3LGTA 1SGDE 3A7WA 4K2YA 2TPIZ 3PMJA 4X6NA 2IN2A 2QXJA 2AFQB 1CHGA 2W5EA 2AGIX 4JYUH 4BXSA 5HXFA 2O9QA 1F5KU 5FCRA 1TQ0B 1LQDB 2GV7A 3MNXA 1QY6A 2VVVA 1WQVH 4HGCA 5T6FA 8LPRA 2ESTE 2VIOA 3BTTE 2OXSA 2PSYA 1WCZA 4K69A 9LPRA 2G5VA 2FOBA 1ZYOA 1O2JA 1QL9A 1T8NA 1QBNA 3SUGA 3NWUA 1BMNH 3TNTA 1SC8U 2PSXA 4ABAA 2BD7A 4DG4A 4X2VA 2Y82A 3U9AH 3RMOH 2FI4E 1Z8IB 1A1RA 1YPMH 4A6LA 1NY22 1YP9A 1EP6A 4R0IA 3PLKA 2EI6A 1CA0B 1GHBF 1BBRK 1CT2E 1O39A 4GCHG 1SGFG 2W3IA 5CE1A 4JZFH 3RXVA 3M37A 1OP2A 5L2ZH 2BLOA 3FANA 1TGTA 2ZHQH 2HOBA 2TGPZ 3RC4A 3LT3A 1TBQH 2PHBA 3M7TA 2JKHA 2PW8H 1TOMH 1RGQA 4OS6A 4IBLH 3QN7A 1S5SA 3D65E 1KTSB 3GYMA 3VB3A 1BJUA 2ZDLA 1LVYA 1JBUH 3E91A 3UTUH 2R2WU 1SSXA 1O5EH 1RXPA 1TALA 1ELCA 2AEIH 4GLYA 1DFPA 5EODA 3L3TA 4I8GA 1O2IA 4FUIA 3A7YA 1K1PA 1HAVA 5CHAC 4BTIB 2NU2E 5EOKA 4NA7A 3RXQA 3KQEA 3BTHE 2D26C 3SU6A 3A87A 3S69A 1V2VT 2VGCC 2VVCA 3SNAA 2ZF0H 1F92A 2KAIA 1OWDA 2ZTXA 2OUAA 3GCOA 1NESE 1HBTH 1Q3XA 3RXEA 2ZG0H 5AVDA 3M7QA 1KDQB 1DITH 3V13A 1A7SA 1QR3E 1A5HA 1CGIE 1O2QA 1O3MA 5ETXA 4OS4A 1DXPA 3STJA 3TJUA 1IQMA 4I33A 4FUBA 4U01A 1YCPH 2B8OH 1P2NA 4WH6A 1GL1A 2A0QB 2CV3A 4GAWA 9ESTA 4B2CA 3NCLA 3VB5A 1ELTA 1V2JT 3ZVGA 1P03A 1UCYE 1C4U2 2JETB 5HM9A 4A1XA 3RXHA 3STIA 4LK4A 1RJXB 3S9AA 2QN5T 2FYRA 1V6DA 5BPEA 4ABEA 4DOQA 5C5NA 2H9TH 3U1JB 2GGVB 2AIQA 2W7UA 1T8LA 2J95A 1GPZA 1SB1H 2FLBH 4NSYA 4NWKA 3SGAE 1V2QT 1IQIA 3C27B 2BVXH 3LIWA 3SUFA 2BZAA 6CHAC 3ZYEA 1UCYH 3EE0B 4LXBH 3A8AA 3UQVA 1SGPE 3RXFA 1MZDA 2WINI 2A4QA 2FM2A 1LPKB 2FOMB 2WYGA 1ZGVA 2Z9JA 2AYWA 5EQRA 4CREA 1CQQA 1QBVH 3RU4D 1J14A 1HFDA 2G4TA 1TLDA 2LPRA 3RC6A 4BNRA 3LGWA 4AG1A 1GMCF 3QX5H 3UR9A 2QCYA 2Y80A 5AFZH 1S6HA 1NROH 2AMPA 3IWMA 2Z9GA 1Z1JA 2BLQA 3Q00A 2H5DA