1GI0A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi0A02
4FUDA 1SBWA 4X8SH 2PKAA 1MCVA 1O5CB 4UFFH 1D3QB 1SI5H 1SC8U 1YPMH 2CMYA 1KXDA 2F83A 2ZHEH 2FOMB 2GZ9A 1AFEH 2TGPZ 3SN8A 5AHGH 4TY6A 4NFFA 2RCEA 2GZ8A 3M7QA 1YCPM 2BDYA 3D23A 3UUZA 4OS5A 2HNTE 1DS2E 1HXEH 2ULLA 1FQ3A 1FZZA 2JETC 2ZU3A 3DUXH 5IYTA 2QXHA 2FS9A 1GL1A 2XW9A 3VB3A 3A85A 1O33A 3QZRA 1LTOA 3L33A 4NZLA 1PQ7A 1VCQA 2QIQA 2XCNA 1WU1A 3FP6E 1Z8JB 2BZ6H 4CR9A 1W11U 1UTJA 3FP8E 3MI4A 1W10U 1G2LA 2CXVA 3SGQE 1VGCB 1QL9A 2ZFFH 1ZPBA 2ZDKA 1HYLA 2P3FH 3O8CA 1J15A 3URCA 3KQCA 3A7YA 3TGIE 2FOBA 1O35A 2OLGA 4BAQB 5E2OA 1VGCC 1FJSA 1P2QA 1C5UA 2VH6A 1HJ9A 1C5TA 3EAJA 1BT7A 2Y81A 1GHAF 3LJJA 1BBRH 1EKBB 2GKVE 1W2KH 4JZDH 2GTBA 1C5SA 3M5LA 2SGFE 1O2LA 2BOKA 2ZDNA 4R0IA 5J4QA 2FX6A 5EODA 1SLWB 1UTNA 2Q6GA 1S85A 4DGJA 1G3BA 4E7RG 3A86A 1WUNH 2BD3A 1W7XH 2BM2A 3GY4A 4NIYA 3BTFE 4UD9H 2F9NA 2A32A 3E91A 3SBKA 1WYKA 1QNJA 4ZUHA 1SGFG 4AX9H 2OC0A 4IC6A 1GVZA 1ZRBA 1HGTH 1A0JA 1EAIA 1XUGA 1BOQA 2ZPQA 3UOUA 4JK5A 1MTUA 3BTHE 1F0UA 1P57B 1PPGE 3RMOH 5A0CA 3VPKA 1H8IH 1T8MA 1SGPE 1JRTA 3BIUH 1GMHG 3GCNA 2QXJA 1ZSJA 3PMAB 2J95A 1GGDB 1MQ6A 4YZUA 1TA6A 2EI6A 3RC5A 1GJBB 5FPYA 1QCPA 3DT0H 2HLCA 1BRCE 2ZCKP 1XUHA 3HPTB 1OP0A 1LPKB 4B2BA 4ZAEA 1GGDC 1YPJH 2ZWLH 3ZZ8A 1FNIA 2GD4B 3K6ZA 5LH8A 3EGKH 1UTQA 2BQWB 4X8UH 4FU8A 2ZGJA 4FVBA 3SORA 1Y3XA 1FY8E 1O2RA 1K1MA 4DJZB 4I8HA 3PROA 1LO6A 1JBUH 2XBVA 1CT0E 3LC5A 2ZHFH 4ABJA 2Z3DA 4ISLA 2CHAB 5DP9A 1ZR0A 1EPTA 3ZZ6A 1UTOA 5FXLA 1ZPCA 3RP2A 3L3TA 1UO6A 3AVZA 3SV6A 1IQHA 1C2IA 1P01A 2CHAC 1SHHB 1HAIH 1TNHA 3RXLA 1OWEA 3SW2B 1O3HA 3SNCA 1KLTA 3SU4A 1W13U 3LONA 1OX1A 4FU7A 3PMBB 1O2XA 4YESB 5A8ZA 4OGYA 3SNBA 4AYYB 2VVUA 5EW2H 1K2I1 1DSUA 1DY8A 4X6NA 1O39A 1K28D 2BDHA 2ZGXH 1EB2A 2KAIB 1O38A 2JKHA 3NWUA 1RTLA 1TGCA 4MPVA 3SV7A 3VB5A 3TH4H 1P0SH 5PTPA 1IQNA 1TIOA 1C2HA 2SGDE 2G5NA 1NT1A 3NPSA 1RRKA 3Q3YA 4KKDA 2VGCB 4OS2A 1P3CA 1H1BA 1CU1A 5F6MA 2B8OH 2P94A 1V2QT 3PWCA 4ABAA 3VGCB 3I77A 1QURH 1A1RA 4J2YB 1V2OT 2VGCC 2FOAA 3TJOA 1AVXA 4DOQA 4JZ1A 3VGCC 4X6OA 3PWBA 1Z7KA 1MTSA 4ABGA 3SJ8A 2G8TA 3ATKA 1DUAA 3F6UH 3KCGH 2ODQA 1UVPA 2WPMS 3VXFH 1MKWK 3T26A 2THFB 2SNVA 4FUHA 5JPMH 1TABE 4BAHB 2FWWA 1YBWA 3E0PB 5DO4H 3STJA 1XXFA 4JZFH 4DG4A 1V2MT 3GY2A 1T4UH 3BN9A 2BXTH 2Q1JA 2A45B 4WF8A 7KMEH 1GWAA 1CHOG 1IHTH 1KTSB 2Y5HA 1PPEE 3V7TA 1NTPA 1FDPA 1DE7H 1PPHE 1SSXA 1W12U 3K2UA 2ILNA 3ELAH 5B6OA 4ABDA 4HTCH 4Q7XA 1O2HA 4NWLA 3V3MA 5ETXA 1P06A 7GCHF 1C5PA 2BLWA 5DGJA 1A5IA 4X1RU 2BD4A 4CBOA 1ZSLA 4IGDA 1BMNH 2AERH 2R2WU 1WTHD 1ZPZA 1W8BH 5EPYA 3PLPA 4A1TA 1GBAA 3EE0B 4KTSA 3SNAA 4OS4A 1BDAA 1NRQH 3F9GA 4NCYA 5L30H 8LPRA 1EUFA 1TLDA 1A0HB 2SGAA 2PSYA 1HBTH 2Y80A 3BSQA 1FY1A 3TITA 1ANCA 1ZRKA 4MQAA 5EXMA 5DG6A 1G2MA 2C93B 2J92A 5ESTE 5JBCS 5LGOA 1C1TA 3ZZ4A 4BTUB 2YNBA 3MFJA 3A7VA 2ZC9H 4MPWA 4XSKU 1O3KA 1HB0B 2VVVA 5ESBA 1EXFA 4U32A 4ZMAH 1SFQB 2QYIA 1S0RA 1SGNE 4ZKRU 5C67A 1BTUA 2BDGA 1L1GA 4INHA 4ESTE 4X2WA 2AEIH 1LMWB 3MH6A 4SGBE 3TLOA 1GJAB 5TCCA 2C90B 1SLUB 5E8EH 3SJ9A 1O2NA 5E2PA 1T8OA 1HAYB 1ETTH 1SGRE 1GMDF 1T4VH 3KL6A 3PMJA 2QY0B 2A5IA 1HIAA 1GBCA 2H9TH 3MH7A 1V2UT 5BRRE 1SMFE 4WY3A 1UHBB 1TALA 1CA8B 1RTFB 3RXEA 3E0NB 4GHQA 3LGVA 4BXWA 3TH2H 3O8RA 3AW0A 1IQEA 2OUAA 3EQ0H 1CO7E 1QJ1B 3SUFA 1AU8A 1MTVA 2XBWA 2Q6DA 3QGJA 3GDSA 1YCPH 4ABFA 2JH0D 2TPIZ 2PKAB 2ZFSA 4MPUA 1C5LH 1AUJA 4DW2U 1O2PA 3VB7A 1L4DA 4X8VH 4QT8C 2ZDLA 1UK4A 3SNDA 1GBEA 3ZZ9A 2A4QA 3CS7A 3MU4A 8KME2 1C2LA 1O2SA 4K69A 1YLCA 1OWIA 4YOJA 4NWKA 3DA9B 4B2AA 1Z6JH 3RMMH 3QTOH 1O0DH 2HPPH 3UFAA 3MNBA 4BAKB 1TX6A 4MPXA 5DP3A 3FANA 3WY8A 1BQYA 3RDZA 3GCTF 4AORA 5A8YA 4KGAA 1GMCF 2GX4A 3UNQA 2FLRH 3GDUA 1C2KA 1RD3B 5A8XA 1IHSH 1N6XA 3DD2H 3B8JA 2EI8A 2XBYA 1MQ5A 1OS8A 1GCDA 3P70B 1S82A 5FHTA 3M7UA 4E06H 1AGJA 4XFQA 4D9QA 3T27A 3SUDA 3FP7E 4FU9A 1O30A 2NWNA 1AHTH 3KGPA 2FMJA 5HYOA 1EOLA 3R3GB 1TPOA 2TGAA 3V12A 1DANH 3A84A 1TX8A 3C27B 1HAZB 2FPZA 3BEFB 1O2IA 3HGNA 4Y8XA 3KHVA 3G01A 3UR6A 1QR3E 3MMGA 1DWEH 4Y0ZE 4FUGA 1HAXB 1C4V2 3RXIA 3PO1B 1V2VT 4CRGA 3A80A 1CT2E 2GT7A 4K8BA 2ANMH 3SU6A 4XE4A 2GP9B 3EYDA 3PO1C 3F68H 2F9BH 1VR1H 5FPTA 1AD8H 1NRSH 1MZDA 8GCHF 5I46H 4ABHA 5E0GA 2R3YA 5JB8S 2EC9H 1GBDA 1DLKB 1F7ZA 1LPZB 2G5VA 5HGGA 1NFXA 3RXAA 2R0KA 1BMLA 1S6FA 1GDQA 1C1PA 1C2JA 1NRNH 1WQVH 3UNSA 2FYRA 4YLUA 2FZZA 4Y7BA 4B74A 3V0XA 1QRZA 3U1IB 2P8OB 1YPHE 3LGWA 1UK2A 1THSH 1KXFA 1KXAA 4JMYA 2NU3E 2FO9A 2GV6A 2IOTA 1FXYA 3SUEA 2XRCA 3TJNA 1QB1A 1ANBA 1HAPH 1BMMH 3STIA 3TK5A 2BD8A 2ASUB 2AIPA 1UTKA 3R0FA 2PSXA 2ZG0H 2FX4A 2Y82A 4O9VA 2VB0A 2H5DA 2ZCLP 1QQUA 3LIWA 4YM9A 1BTWA 2EEKA 1TRNA 4O3UA 3E1XB 3OSYA 1P2IA 2ZHWH 3FAOA 4X6MA 1E37B 3MTYA 2ZU1A 1BJVA 4YO9A 3NKKA 3RXCA 2P16A 3BIVH 1C4Y2 1SQAA 5FBEA 2O8UA 9LPRA 1B7XB 3ZZ7A 2Z9LA 1O36A 1AKSA 2EI7A 5GPIB 4WXIA 5FX5A 4A92A 3V13A 2DUCA 1Y3VA 1HDTH 1SGIB 2G81E 1ELEE 1A2CH 1C5RA 4RSPA 3VB6A 3VXEH 1ANDA 2P3UB 4HFPB 1ELVA 2ZKSA 3RLWH 1GI8B 1UK3A 1ZGIA 2ANKH 2P3TB 1MBQA 4BTTB 1V2NT 3SJOA 4TY7A 1DWDH 5FCRA 3ZYEA 1CSOE 1TYNA 2CF8H 2ZCHP 1YYY1 2Z9IA 5A2MH 3LKWA 4NSYA 2FS8A 1VCPA 1XVOA 1KYNA 2IN2A 2PR3A 3T2NA 4B71A 3A8CA 1IQMA 2F3CE 3PYHA 1H4WA 1QA7A 2Z94A 1C1OA 1XUKA 4DCDA 2O9QA 1ESBA 1E36B 1TWXB 3ZVBA 1Q3XA 4DT7B 2HWLB 3LDXH 1BMAA 1C5VA 1GBLA 3SI3H 1W3CA 1D3PB 5LPFA 1TMUH 2O8LA 2ZPRA 3UWIA 2A4OA 4HI3A 5I25A 2WPLS 2J2UA 2FODA 1TGSZ 3S9CA 3KQEA 3QX5H 5SGAE 3TGKE 3IG6B 1D3DB 3P8GA 1SGEE 1QTFA 1ZMNA 1C2EA 3S7KB 3Q3XA 2VWOA 4IBLH 1KTTB 1EAWA 5T3HA 5FAHA 3ATWA 3UIRA 1XM1A 1A0LA 1E0FD 1SPJA 1LHEH 3A88A 2BY5X 1O2WA 1P11E 1H9IE 1V2TT 1O5BB 2C3SA 4UFGH 1TPPA 2Z9GA 1VJ9U 4Z0KA 1K1OA 1B0FA 2LPRA 5C1YA 4U30A 1O2YA 1SGDE 3M36A 1P2NA 1C1MA 1GBTA 1CA0B 1HAVA 5FX6A 1P2OA 1A46H 1H8DH 1J8AA 5JBAS 1JOUB 2CJIA 2VIVA 4AOQA 4X2XA 1ARCA 2FI3E 3RM0H 4IMZA 2WV5A 1CA0C 1DT2A 1IQLA 1MAXA 3ZZBA 4MNVA 3S9BA 1F2SE 2WPKS 5DP6A 1FMGA 2W3IA 3GOVB 1YPLH 1TOMH 3TVJB 2XC0A 4IS5A 4WJG2 5CE1A 2QF3A 1SB1H 1NN6A 2XYAA 5EXNA 2A1DB 1EB1H 4GUXA 1QQ4A 1ELBA 2BYAX 1JWTA 1C1VH 2BY6X 4NFEA 5F8XA 1HUTH 2Z9KA 4AN7A 4CRCA 1FAKH 2ZIQH 3UPEA 5FCKA 3U8OH 1A3BH 1KDQA 1UTPA 1ACBE 1LVYA 3TU7H 1O5FH 3K9XB 3LGUA 3KF2A 2RDLA 2JH6D 3E3TA 1A61H 2AH4X 1AZZA 2HVXA 4JCNA 1NO9H 4IMQA 3MOCA 1GL0E 1UVSH 1DXWA 1BCUH 1P05A 1OPHB 1T7CA 2HOBA 1TGNA 3OX7U 5GCHG 1G3DA 2CN0H 2VVCA 2AFQB 3D65E 2UUJB 4ZKNU 1GJCB 4AGJA 1O5GH 4E7NA 2HNTC 3QZQA 5T6DA 2IPHA 2XC5A 2G51A 3MO9A 1SVPA 2H5CA 1CGJE 2O8MA 3ATIA 1E34B 4YOGA 1TBZH 3UQVA 1ZMJA 1HIAB 1XX9A 1KLJH 2DE9A 1MKXH 3M3TA 1T32A 4NSVA 1UCYK 2M5TA 2CF9H 5EQSA 1NESE 4PROA 1ORFA 4CHAB 4YLQH 1LQDB 1ZZZA 1ID5H 2ZP0H 3RXPA 3ZZ3A 3QK1A 1AE5A 1JRSA 4WMDA 1GJ4H 4CHAC 4FVDA 1LKBA 3QDZB 2W3KA 2V3HH 4MDSA 1SFIA 1BTYA 1KLIH 1SGTA 2P95A 2QGRA 2VIWA 4H6TA 3BEUA 4CRDA 2BDCA 1Z8IB 4JZIA 1BTPA 1AN1E 3SOSA 1IQGA 1P9SA 1O3NA 2PTNA 3RXJA 3ZYDA 4B73A 1OP8A 5E0HA 4AFQA 5DJ7A 6LPRA 1F5RA 1MZAA 1C5XB 4GCHG 4UFDH 3MO6A 8ESTE 1E38B 1J16A 1F0RA 2BVRH 3P95A 4JK6A 1GHYH 5GXPA 2VJ1A 1AIXH 2FI5E 5GWZA 1V2WT 5AF9H 1Q2WA 2GCHG 2Y6TA 3P8NA 1TRYA 2BLVA 1NM6A 5A0BA 2WUCA 2XCFA 5DK1A 4I8GA 1ESAA 3SQEE 1GHXH 2BD9A 1EZSC 2ZI2H 1DOJA 4KELA 1AVGH 2UWOA 1XMNB 2PV9B 5EU8A 3SNEA 1BBRK 2GMTB 1ZTJA 1SR5C 1TNLA 1K1LA 1YP9A 1AMHA 5L6NH 3MU5A 3W94A 3BTGE 2WINI 3ATLA 2F91A 3H7TA 4BANB 5DP7A 3M5NA 2GMTC 1AZ8A 1O3IA 1GJ7B 2F9OA 2UUFB 2W5EA 2W26A 1ESTA 3TPIZ 3P8FA 3ZV9A 4ABBA 3QGNB 1O2OA 1OXGA 4AFZA 2HNTF 1CHOF 5F8ZA 1UJ1A 1PQ5A 5GDSH 5LPRA 1HRTH 4OS6A 7GCHG 4IC5A 1AO5A 4DVAU 4K3JA 1CGIE 3SHCH 1PPFE 4MLFB 1O3OA 1XKAC 1TB6H 1NFYA 4AB9A 1OWJA 2TIOA 3P17H 2XNIA 1D4PB 1S6HA 3IWMA 2NU1E 3LT3A 1EX3A 3TJVA 1A5HA 1GBHA 1TE0A 1Z8GA 1Y8TA 4YT6H 5DP4A 4M7GA 1D9IA 1S84A 1L0ZA 1W0ZU 1BITA 4B1TA 6ESTA 3M3SA 1QB6A 1A3EH 1DSTA 1QBVH 2XXLA 3JZ2B 1WAYB 1VJAU 1ZMLA 3F9EA 1HCGA 3PLBA 3Q00A 4MTBA 2F9VA 1GBIA 2CGAA 1BJUA 1GI2A 3SUGA 3ATMA 1O3MA 2ZFTA 4LOYH 4X2VA 3E6PH 4ISIH 5K7RA 2VIOA 1C4U2 3EDXB 4NA7A 3BTQE 4Y6DA 1NRPH 1XUFA 5FBIA 2ZO3H 1TNJA 2A31A 1C1UH 2FXRA 2ZTXA 3ESTA 3ZVCA 3SU2A 4O3TA 3PTBA 1Z8RA 1YM0A 1FAXA 1QHRB 1O5DH 3ZVEA 4SGAE 1V6DA 3S9AA 1MCTA 1GBMA 1GPZA 3VB4A 3GY8A 1BHXB 4KTUA 3QN7A 1EJAA 1OOKB 1XXDA 1GMDG 2H9EH 1C9PA 3FZDA 4GVUA 1GI7B 2V3OH 1ZYOA 1UVTH 2WYGA 2ZFQH 1ELAA 5BPEA 3C1KA 1JIRA 3HATH 2PFEA 4CR5A 1NRRH 3ZVDA 1FPHH 2ESTE 3S7HB 1O2KA 1L1JA 3EA9A 3A7WA 3DFJA 1CGHA 5JDUB 3FVFB 5DP5A 3P92A 3SU0A 1EZQA 1D6WA 3SV8A 2YOLA 2QAAA 2C8XB 2B0FA 2LNCA 2XWBI 1VITF 2FIRH 2Z3EA 1O2MA 1CBWB 1KXCA 2FESH 2ZHDA 2BQ6B 1YGCH 3P8OA 2KAIA 1C2GA 4F4OC 1EAUA 1GHZA 3UWJH 2Z3CA 4WH6A 2FI4E 2WYJA 3GY5A 3RMLH 4FUBA 1MU6B 1CBWC 3MNXA 1NPMA 1MD8A 4XOJA 2PHBA 1HJ8A 1C5YB 1NZQH 2D1JA 4K2YA 4WMEA 4YOIA 1GHBF 3T29A 4MNYA 1C5ZB 3RXOA 1SGCA 1S5SA 2SGPE 5F03A 1C5NH 1O3JA 1P12E 1P2JA 1LHDH 3N7OA 1O32A 3UTUH 1PPZA 1WTGH 3SJIA 5LPEA 1RS0A 2BD2A 1ANEA 1TBQH 4K1TA 3U1JB 1HV7A 1TOCB 1OYTH 3UNRA 9ESTA 1CHGA 4A6LA 4D8NA 4TWYA 1F0SA 1S81A 1C1QA 1C2MA 4AG2A 1V3XA 1ZTLA 1CVWH 3GYMA 1OP2A 3BTME 2ZU4A 1BRUP 2C8ZB 6GCHG 2BTCE 2ZU5A 2H1UA 1INCA 2QXIA 1C9TA 1MMJN 3FFGA 2XWAA 1PYTC 4AFSA 1SLVB 2BHGA 2RA3A 1QB9A 2EA3A 2PKSB 3RXSA 3RU4T 1EJNA 3JZ1B 3A7XA 1Z71A 3MNSA 3RU4D 1C2DA 4FUJA 4BAOB 1M9UA 1BHXF 2FYQA 1V2PT 4ZHLU 1IOEA 1BIOA 3PTNA 1QJ6B 1C5QA 3GCOA 4H6SB 4BNRA 5A0AE 5DP8A 3QO6A 4TYDA 3NXPA 2ALPA 1EZXC 1O3PB 1H9LB 3SJKA 1S83A 2ANYA 1LCYA 4KTCA 1BTZA 2C4FH 2TGTA 2ZPSA 2J94A 4LZ1H 5JBTA 3KQDA 2DE8A 2K1QA 3F9FA 4JYTA 2GV7A 4X1NU 2A2QH 3NCLA 1DVAH 3MHWU 1FY5A 2ZDMA 1THRH 1TMTH 1P10A 5HMAA 1T8NA 2GGVB 1PJPA 3NK8A 1HNEE 3I78A 2ZECA 2PWXA 3S69A 5T6GA 3ZVFA 2PTCE 4Y7AA 2FLBH 2PW8H 1TFXA 2P8OC 5CHAB 1GJ5H 1V2ST 2WPHS 2BVSH 1P9UA 2BDIA 1A7SA 3ZZAA 3O8DA 1TGBA 1LDTT 1P09A 1QRXA 2TBSA 3KN2A 3DHKH 2ZEBA 1KDQB 1KY9A 2Z9JA 5CHAC 2BDBA 4WH8A 3A7ZA 5EXLA 4NZQA 3CENA 3W95A 2ANWA 2ZDVH 2OD3B 3GY7A 2W7SA 3H7OA 2G00A 1XVMA 2G4UA 3RM2H 1O2VA 2PLXA 2ODPA 1N6YA 3PMHB 1L2EA 1C1WH 4K1SA 3OYPA 1QY6A 4FUFA 2H2ZA 4I8LA 3MU0A 1SQOA 5HM9A 3U98H 1EPTB 3T25A 5K0HA 1MUEB 1RJXB 1X7AC 1JXPA 1LVOA 1GHVH 2Y7XA 4GSOA 1P02A 1HPGA 4K5ZA 2A0QB 3E8LA 1BZXE 1V2RT 3GCHB 4I33A 3UOPA 1UHBA 1V2LT 4RKJB 1A4WH 2HGTH 1EPTC 1P2KA 2OC1A 5TCAA 1A5GH 2JH5D 4Z6AH 2FOFA 4INLA 3SZNA 3LH3A 2QF0A 2FM2A 3GCHC 4RN6A 1KSNA 1FIWA 1VCWA 1ZGVA 3UY9A 1BA8B 1YCPK 1LHCH 3ENSB 3LJOA 1GI0A 3S0NA 2AGIX 5E0JA 1Z1IA 4D7FA 1JIMA 2ZQ2A 2J34A 4X0WU 4CH2B 2AIQA 3BTTE 3DFLA 5L2ZH 3U9AH 1DLEA 4ABIA 3M35A 1K22H 3PB1E 2WUBA 4AGKA 1ETSH 2QC2A 3E90B 1DPOA 3RMNH 4FUEA 3OY6U 1P2MA 1TBRH 5J4SA 1O3AA 1DUEA 2JETB 4Y10E 2OC7A 3FZZA 5EGMA 2P59A 1Y59T 1Q31A 1SLXB 1ZOMA 3OY5U 1ELCA 1W7GH 4F49A 4UFEH 1SQTA 1WBGB 3M7TA 2V6NA 2QA9E 1G9IE 2CV3A 2QCYA 3SQHE 4TWWA 2FEQH 4XBBA 1TQ0B 2Q6FA 1GBJA 3RXVA 4TPYA 2VWLA 4Q7ZA 4K1EA 1MBMA 1QIXB 3ZVAA 1O5EH 1DX5M 1PFXC 2BB4A 2HALA 4XBDA 1PPBH 1HAHH 2Z7FE 4OS1A 4BOHA 4X8TH 4UONA 1GHAG 1O3CA 3A83A 5AFZH 3SU3A 3URDA 3LOXA 5JB9S 3EA7A 1MKWH 1GI3A 3UQOA 3M37A 3MYWA 2J4IA 2AMDA 2FOEA 1ZHPA 2OBOA 4U01A 5EQRA 3RXRA 1AB9B 2J9NA 1YPHC 1IQKA 4D7GA 2ZHQH 2OP9A 3AW1A 3GY3A 2A5AA 3RXQA 2GDEH 1AB9C 3MWIU 2A7HA 4INKA 3EA8A 1GBFA 1HFDA 5C5NA 5DKMA 3A89A 4H4FA 3H5CB 3BTEE 1K1JA 3GISB 4CBNA 2R9PA 5A09A 1YKTA 1GJ8B 2FTMA 1TAWA 3M5MA 1HAOH 4JZEH 3VEQB 1QL7A 3RLYH 2BX4A 2R0LA 3LC3A 1NY22 4UEHH 1NFUA 5TJXA 2B9LA 3BTKE 4CRAA 1GBKA 1O3FA 4ZROA 1O3GA 4VGCB 3U8RH 2O8TA 1L4ZA 3TJUA 3OU0A 1J9CH 3Q3KA 4D76A 5T6FA 4GLYA 1EOJA 4VGCC 1SHYA 1AY6H 2BD7A 2D8WA 3BTWE 4I31A 2ODYB 5JBBS 2TGDA 4Q80A 2PGQB 4UE7H 2BDAA 4CRFA 1AUTC 1GMHF 3TK6A 2SFAA 2ZFRH 1C2FA 1GJ9B 3A87A 1P3EA 3RXBA 1IQFA 1V2JT 3SV9A 1DXPA 2VWNA 1IAUA 2SGEE 2ZU2A 3AASA 3GICB 1DICA 2PGBB 2SGQE 2B7DH 4MVNA 1UTLM 3RC4A 2WV4A 3BTDE 3TNSA 1XUIA 4GHTA 1BRBE 1FIZA 5EOKA 1FY3A 1NS3A 2IJOB 3KEEA 1YC0A 4Q7YA 5ABWA 6CHAB 1B5GH 1GJ6A 2TRMA 1UTMA 1YF4A 1DITH 1WV7H 1O37A 2GZ7A 5GCHF 2ZGHA 3LGYA 5C5OA 1LHFH 1O34A 3U69H 2AGEX 3GYLB 3LU9B 1FONA 4RKOB 1BTHH 1QFKH 6CHAC 1O2ZA 4WVPE 1RFNA 1F5KU 2ZGBH 4ZHAA 1C1NA 1F5LA 3KNXA 4AYVB 1T31A 4A5TS 1WSSH 1P04A 4DY7B 1RXPA 2OQUA 4ISNA 1EQ9A 2ZNKH 2BX3A 4K8YA 5F8TA 1SGFA 1L1NA 1THPB 2UWPA 4Y8YA 7ESTE 1MTNB 2XTTB 2FTLE 5AFYH 4DURA 5C1UA 1G30B 2UUKB 1QJ7B 4NG9H 3BG4B 2G52A 1GJDB 1MTNC 4WWYA 2A4RA 1FV9A 1WCZA 3MH5A 1O2QA 2A7CA 2A4GA 1UCYE 3BV9B 2BY9X 3QUMP 2BY8X 4BAMB 3AAVA 3BG4C 3ZZCA 4BTIB 4E05H 4Y8ZA 1OWDA 2GDDA 3E16B 3RXTA 3ODFA 1N8OB 1QA0A 4X1QU 1LVBA 4BXSA 1O2GH 2D2DA 2VIQA 3P6ZB 2BD5A 1DWCH 2Y5FA 3F1SB 1VZQH 1NU9A 1UMAH 4J1YA 3RU4E 3RXMA 4ZXXH 4AB8A 4GCHF 4Y71A 4A7IB 3ZVGA 3HK6B 1TMBH 3MNCA 1AFQB 5EPNA 5C20A 1N8OC 1O3DA 2NU4E 4LZ4B 4FUCA 2J38A 4GPGA 4X1SU 2RG3A 1O3BA 1EASA 1Z1JA 3MU1A 4B75A 3M61U 1GVLA 1HLTH 1Y5AT 1AFQC 4ZH8A 3D49H 2VU8E 1ZTKA 2GCHF 3GDVA 2V35A 4Y11E 3T62A 3NZIA 1GDNA 1ZHMA 3MO3A 2PUXB 3KIDU 1FLEE 3UR9A 1PQ8A 3A81A 1S0QA 1MH0A 4HGCA 2VINA 3RXHA 2HRVA 1BUIA 1W14U 4ISOA 4GAWA 1Z6EA 2QV1A 3SI4H 3RC6A 4MG3A 2FOCA 2AMPA 1BB0B 1O5AB 1ELTA 3LGIA 2W7UA 4I8JA 1FY4A 1GDUA 2QXGA 1EP5A 1ZJKA 2VWMA 1C5WB 3M3VA 1BBRE 1KXEA 4AG1A 1F0TA 3RXFA 1GHWH 4ABEA 1QBOA 1W0YH 4AFUA 2ZTYA 1AVWA 3VFEA 1AI8H 1YPKH 2F9PA 1GG6B 3B9FH 3UREA 1AWHB 2WPIS 2C8YB 2FOGA 1FUJA 3TGJE 1ABJH 3SV2H 4ZKOU 1AWFH 3A8AA 3BEIB 2C8WB 1YPGH 1SOZA 1MD7A 1O3LA 2NU2E 1GG6C 1N1LA 1D6RA 1CE5A 1FPCH 4I32A 2XBXA 2OCVB 2ZZUH 4WMFA 1SGQE 2A5KA 1DDJA 1EP6A 4LK4A 1NFWA 4ZHMU 1C5MD 1TPAE 3ZZDA 2BOHB 3F9HA 3BF6H 1P8VC 3RXKA 4K60A 1ABIH 2H6MA 2RA0A 2UWLA 1DFPA 4THNH 1XKBC 4JYUH 3ZZ5A 1KIGH 1O2UA 1LKAA 2ALVA 4LXBH 5JYIA 1G3EA 4Y76A 2BLQA 3A82A 5GIBA 3L6PA 2ZA5A 4IN1A 3TH3H 4CH8B 2WPJS 3A8BA 3PM3A 1UVUH 4FUIA 4I7YH 2O8WA 1TONA 1GI1A 4O03A 4U2WA 5C3NA 5GJ4B 3Q76A 2GVFA 4ZKSU 2OINA 2STAE 3NUMA 1JMOH 2STBE 1MKXK 1ZJDA 2ZFPH 1NROH 3RXDA 3O8BA 3A7TA 1ELGA 1G3CA 5EG4A 3B23B 3QLPH 3ITIA 1LVMA 3QTVH 1AKSB 5FPSA 1G32B 1O2TA 1O3EA 5IDKA 1IQIA 3LGTA 1V2KT 1QBNA 1TX7A 1ARBA 1U6QA 4YT7H 4Y0YE 3MU8A 1MU8B 1TA2A 1ELDE 4NGAH 1TGTA 1Y3UA 3OTJE 3T5FH 1VITG 1BTXA 1K1PA 4AZ2B 2SNWA 2OC8A 4XBCA 2YNAA 4DIHH 3TK9A 1UVOA 1TRMA 2A2XH 1HXFH 1MTWA 1SL3A 2ZF0H 3K6YA 1C5OH 1QGFA 1OSSA 5G4BA 1YPEH 1XUJA 2BMGB 3SHAH 3HK3B 3SGBE 1Y5UT 2HPQH 1CT4E 1GHBG 4NA9H 4ZXYH 4Q2KA 1RIWB 1LHGH 3GCTG 1GCTB 1GMCG 4XDEA 3A8DA 1ETRH 2Y7ZA 4X2YA 1B0EA 1FI8A 1OKXA 3CS0A 2R3UA 3SO3A 1AE8H 2BQ7B 1RIWC 1J14A 1PQAA 1YLDA 2I6QA 2XC4A 4X1PU 1GCTC 3HKIB 1G36A 1DY9A 3LH1A 1OWKA 3SU1A 4R8TB 1GI6A 2BVXH 2OQ5A 4JYVH 4X6PA 2OBQA 4IN2A 5H4IB 1E35B 5CMXH 5HM2A 1C1SA 2AGGX 1ELFA 2OTVA 3K65B 4ISHH 3PV4A 2B5TB 2FOHA 3RUOA 4B76A 4HZHA 3BG8A 3LPRA 3PLKA 1KXBA 1O2JA 3TNTA 2PUQH 1IQJA 5EQQA 2BXUH 2GCTB 2GT8A 1AQ7A 1GI5A 1EATA 1EAXA 4ASHA 3SU5A 7LPRA 6GCHF 5EW1H 4I8KA 1DM4B 1G37A 2OXSA 2G55A 2GCTC 4WXVA 5HXFA 4MNXA 1K1NA 2QN5T 3I29A 4NIWA 2PKSC 1J17T 4OS7A 3MH4A 3Q77A 2VNTA 2Z6BD 4NIVA 2ZGCA 5AVDA 8GCHG 1EJMA 1FN8A 2FP7B 1ZLRA 4YTAA 4TPIZ 1HAVB 4IW4E 3TIUA 4CRBA 2VIPA 3T28A 2ZQ1A 4A1XA 1WOFA 1LQEA 2A7JA 1FN6A 4H42U 2AMQA 1D3TB 1GBBA 1H9HE 1O31A 3AAUA 4B2CA 4KP0A 1K21H 2ZTZA 2UUYA 1GI4A 3RXGA 1T8LA 1TQ7B 4NIXA 3CP7A 1VITH 1Y3WA 2G4TA 2I6SA 3GY6A 1K9OE 3KQBA 1TNIA 1OWHA 3HKJB 4A1VA 4DIIH 3IITA 2BLOA 1RTKA 1QRWA 5C2ZA 3ODDA 4UDWH 3U8TH 1C1RA 1ZSKA 1PPCE 1K1IA 1SGYE 5DPAA 2VIDA 4NA8A 1HJAB 2FDAA 4Y79A 1LPGB 1Y5BT 1OYQA 2P93A 1WQSA 4O97A 1QL8A 1RGQA 1GVKB 1GI9B 1HJAC 2NU0E 4CREA 2H9HA 4FXGH 2F9UA 1DWBH 1SG8B 5L2YH 1ZHRA 1CQQA 1NC6A 1TNKA 3SGAE 2R2MB 1Y3YA 1TPSA 2D26C 5C1XA 4D9RA 1SOTA 3HGPA 1P03A 1PYTD 1TNGA 1BRAA 3RXUA 2AYWA 3D62A 1EZUC 1NU7B 2V0BA 2AS9A 2ZDAH 4MNWA 4OGXA 1MAYA 3QWCH 2Y5GA 3ZV8A 1UCYH 3M5OA 2BY7X 2BZAA 2VH0A 1F92A 1HAGE
chains in the Genus database with same CATH superfamily
4FUDA 1SBWA 4X8SH 2PKAA 1MCVA 1O5CB 4UFFH 1D3QB 1SI5H 1SC8U 1YPMH 2CMYA 1KXDA 2F83A 2ZHEH 3F2GA 2FOMB 2GZ9A 1AFEH 2TGPZ 3SN8A 5AHGH 4TY6A 4NFFA 2RCEA 2GZ8A 3M7QA 1YCPM 2BDYA 2F4LA 3D23A 3UUZA 4OS5A 2HNTE 4XD7D 1DS2E 1HXEH 2ULLA 5KECA 1FQ3A 1FZZA 2JETC 2ZU3A 3DUXH 5IYTA 2QXHA 2FS9A 1GL1A 2XW9A 3VB3A 3A85A 1O33A 3QZRA 1LTOA 3L33A 4NZLA 1PQ7A 2L74A 3AK5A 1VCQA 2QIQA 2XCNA 3WWBA 1WU1A 3FP6E 1Z8JB 2BZ6H 4CR9A 1W11U 1UTJA 3FP8E 3MI4A 1W10U 1G2LA 2CXVA 3SGQE 1VGCB 1QL9A 2ZFFH 1ZPBA 2ZDKA 1HYLA 2P3FH 3O8CA 1J15A 3URCA 3KQCA 3A7YA 3TGIE 2FOBA 1O35A 2OLGA 4BAQB 5E2OA 1VGCC 1FJSA 1P2QA 1C5UA 2VH6A 1HJ9A 1C5TA 3EAJA 1BT7A 2Y81A 1GHAF 3LJJA 3F3BA 1BBRH 1EKBB 2GKVE 1W2KH 4JZDH 2GTBA 1C5SA 3M5LA 2SGFE 1O2LA 2BOKA 2ZDNA 4R0IA 5J4QA 2FX6A 5EODA 1SLWB 3GS9A 1UTNA 3PV5A 2Q6GA 1S85A 4DGJA 1G3BA 4E7RG 3A86A 1WUNH 2BD3A 1W7XH 2BM2A 3GY4A 4NIYA 3BTFE 4UD9H 2F9NA 2A32A 3E91A 3SBKA 1WYKA 1QNJA 4ZUHA 1SGFG 4AX9H 2OC0A 4IC6A 1GVZA 1ZRBA 1HGTH 1A0JA 1EAIA 1XUGA 1BOQA 2ZPQA 3UOUA 4JK5A 1MTUA 3BTHE 1F0UA 1P57B 1PPGE 3RMOH 1FX0B 5A0CA 3VPKA 1H8IH 1T8MA 1SGPE 1JRTA 3BIUH 1GMHG 3GCNA 2QXJA 1ZSJA 3PMAB 2J95A 1GGDB 3DCLA 1MQ6A 4YZUA 1TA6A 2EI6A 2KX4A 3RC5A 1GJBB 5FPYA 1QCPA 3DT0H 2HLCA 1BRCE 1NBMD 2ZCKP 1XUHA 3HPTB 1OP0A 1LPKB 4B2BA 4ZAEA 1GGDC 1YPJH 2ZWLH 3ZZ8A 1FNIA 2GD4B 3K6ZA 5LH8A 3EGKH 1UTQA 2BQWB 4X8UH 4FU8A 2ZGJA 4FVBA 3SORA 1Y3XA 1FY8E 1O2RA 1K1MA 4DJZB 4I8HA 3PROA 1LO6A 1JBUH 2XBVA 1CT0E 3LC5A 2ZHFH 4ABJA 2Z3DA 4ISLA 2CHAB 5DP9A 1ZR0A 1EPTA 3ZZ6A 1UTOA 5FXLA 1ZPCA 3RP2A 3L3TA 1UO6A 1OHHD 3AVZA 3SV6A 1IQHA 1C2IA 1P01A 2CHAC 2KZ4A 1SHHB 1HAIH 1TNHA 3RXLA 1OWEA 3SW2B 1O3HA 3SNCA 1KLTA 3SU4A 1W13U 3LONA 1OX1A 4FU7A 3PMBB 3OAAD 1O2XA 4YESB 5A8ZA 4OGYA 2JJ2D 3SNBA 4AYYB 2VVUA 5EW2H 1K2I1 1DSUA 1DY8A 4X6NA 1O39A 1K28D 2BDHA 2ZGXH 1EB2A 2KAIB 1O38A 2JKHA 3NWUA 1RTLA 1TGCA 4MPVA 3SV7A 3VB5A 3TH4H 1P0SH 5PTPA 1IQNA 1TIOA 1C2HA 2SGDE 2G5NA 1NT1A 3NPSA 1RRKA 3Q3YA 4KKDA 2VGCB 4OS2A 1P3CA 1H1BA 1CU1A 5F6MA 2B8OH 2P94A 1V2QT 3PWCA 4ABAA 3VGCB 3I77A 1QURH 1A1RA 4J2YB 1V2OT 2VGCC 2FOAA 2QF4A 3TJOA 1AVXA 4DOQA 4JZ1A 3VGCC 4X6OA 3PWBA 3DSOA 1Z7KA 1MTSA 4ABGA 3SJ8A 2G8TA 3ATKA 1DUAA 3F6UH 3KCGH 2ODQA 1UVPA 2WPMS 3VXFH 1MKWK 3T26A 2THFB 2SNVA 4FUHA 5JPMH 1TABE 4BAHB 2FWWA 1YBWA 3E0PB 5DO4H 3STJA 1XXFA 4JZFH 4DG4A 2JDID 1V2MT 3GY2A 1T4UH 3BN9A 2BXTH 2Q1JA 3F0OA 2A45B 4WF8A 7KMEH 1GWAA 4AC9A 1CHOG 1IHTH 1KTSB 2Y5HA 1KMHB 1PPEE 3V7TA 1NTPA 1FDPA 1DE7H 1PPHE 1SSXA 1W12U 4DT4A 3K2UA 2ILNA 3ELAH 5B6OA 4ABDA 4HTCH 4Q7XA 1O2HA 4NWLA 3V3MA 5ETXA 1P06A 7GCHF 1C5PA 2BLWA 5DGJA 1A5IA 4X1RU 2BD4A 4CBOA 1ZSLA 4IGDA 1BMNH 2AERH 4RT1A 2R2WU 1WTHD 1ZPZA 1W8BH 5EPYA 3PLPA 4A1TA 1GBAA 3EE0B 4KTSA 3SNAA 4OS4A 1BDAA 1NRQH 3F9GA 4NCYA 5L30H 8LPRA 1EUFA 1TLDA 1A0HB 2SGAA 2PSYA 1HBTH 2Y80A 3BSQA 1FY1A 3TITA 1ANCA 1ZRKA 4MQAA 4Q63A 5EXMA 5DG6A 1G2MA 2C93B 2J92A 5ESTE 5JBCS 5LGOA 1C1TA 3ZZ4A 4BTUB 2YNBA 3MFJA 3A7VA 2ZC9H 4MPWA 4XSKU 1O3KA 1HB0B 2VVVA 5ESBA 1EXFA 4U32A 4ZMAH 1SFQB 2QYIA 1S0RA 1SGNE 4ZKRU 5C67A 1BTUA 2BDGA 1L1GA 4INHA 4ESTE 3FOAA 4X2WA 2AEIH 1LMWB 3MH6A 4SGBE 3TLOA 1GJAB 5TCCA 2C90B 1SLUB 5E8EH 3SJ9A 1O2NA 5E2PA 1T8OA 1HAYB 1ETTH 1SGRE 1GMDF 1T4VH 2V7QD 3KL6A 3PMJA 2QY0B 2A5IA 1HIAA 1GBCA 2H9TH 3MH7A 1V2UT 5BRRE 1SMFE 4WY3A 1UHBB 5FL7D 1TALA 1CA8B 1RTFB 3RXEA 3E0NB 4GHQA 3LGVA 4BXWA 3TH2H 3O8RA 3AW0A 1IQEA 2OUAA 3EQ0H 1CO7E 1QJ1B 3SUFA 1AU8A 1MTVA 2XBWA 2Q6DA 3QGJA 3GDSA 1YCPH 4ABFA 2JH0D 2TPIZ 2PKAB 2ZFSA 4MPUA 1C5LH 1WDIA 1AUJA 4DW2U 1O2PA 3VB7A 1L4DA 4X8VH 4QT8C 3DSGA 2ZDLA 1UK4A 3SNDA 1GBEA 3ZZ9A 2A4QA 3CS7A 3MU4A 8KME2 1C2LA 1O2SA 4K69A 1YLCA 5HIZA 1OWIA 4YOJA 4NWKA 3DA9B 4B2AA 1Z6JH 3RMMH 3QTOH 1O0DH 2K8IA 2HPPH 3UFAA 3MNBA 4BAKB 1TX6A 2XNDD 4MPXA 5DP3A 3FANA 4F55A 3WY8A 1BQYA 3RDZA 3GCTF 4AORA 5A8YA 4KGAA 1GMCF 2GX4A 3UNQA 2FLRH 3GDUA 1C2KA 1RD3B 5A8XA 1IHSH 1N6XA 3DD2H 3B8JA 2EI8A 2XBYA 1MQ5A 1OS8A 1GCDA 3P70B 1S82A 5FHTA 3M7UA 4E06H 1AGJA 2J5UA 4XFQA 2HVYB 4D9QA 3T27A 3SUDA 3FP7E 4FU9A 4B6EA 1O30A 2NWNA 1AHTH 3KGPA 2FMJA 5HYOA 1EOLA 3R3GB 2PP6A 1TPOA 2TGAA 3V12A 1DANH 3A84A 1TX8A 3C27B 1HAZB 2FPZA 3BEFB 1O2IA 3HGNA 4Y8XA 3KHVA 3G01A 3UR6A 1QR3E 1E79D 3MMGA 1DWEH 4Y0ZE 4FUGA 1HAXB 1C4V2 3RXIA 3PO1B 1V2VT 4CRGA 3A80A 1CT2E 2GT7A 4K8BA 2ANMH 3SU6A 4XE4A 2GP9B 3EYDA 3WWFA 3PO1C 3F68H 2F9BH 1VR1H 5FPTA 1AD8H 1NRSH 1MZDA 8GCHF 5I46H 4ABHA 5E0GA 2R3YA 5GNDA 5JB8S 2EC9H 1GBDA 1DLKB 5EJZA 1F7ZA 1LPZB 2G5VA 5HGGA 1YY3A 2J98A 1NFXA 3RXAA 2R0KA 1BMLA 1S6FA 1GDQA 1C1PA 1C2JA 1NRNH 1WQVH 3UNSA 2FYRA 4YLUA 2FZZA 4Y7BA 4B74A 3V0XA 1QRZA 3U1IB 2P8OB 1YPHE 3LGWA 1UK2A 1THSH 1KXFA 1KXAA 4JMYA 2NU3E 2FO9A 2GV6A 2WV9A 2IOTA 1FXYA 3SUEA 2XRCA 3TJNA 1QB1A 1ANBA 1HAPH 1BMMH 3STIA 3TK5A 2BD8A 2ASUB 2AIPA 1UTKA 3R0FA 2PSXA 2ZG0H 2FX4A 2Y82A 4O9VA 2VB0A 2H5DA 2ZCLP 1QQUA 3LIWA 4YM9A 1BTWA 2EEKA 1TRNA 4O3UA 3E1XB 3OSYA 1P2IA 2ZHWH 3FAOA 4X6MA 1E37B 3MTYA 2ZU1A 1BJVA 4YO9A 3NKKA 3RXCA 2P16A 3BIVH 1C4Y2 1SQAA 5FBEA 2O8UA 9LPRA 1B7XB 3ZZ7A 2Z9LA 1O36A 1AKSA 2EI7A 5GPIB 4WXIA 3U28C 2RDEA 5FX5A 4A92A 3V13A 2DUCA 1Y3VA 1HDTH 1SGIB 2G81E 1ELEE 1A2CH 1C5RA 4RSPA 3VB6A 3VXEH 1ANDA 2P3UB 4HFPB 1ELVA 2ZKSA 3RLWH 1GI8B 1UK3A 1ZGIA 2ANKH 2P3TB 1MBQA 4BTTB 1V2NT 3SJOA 4TY7A 1DWDH 5FCRA 3ZYEA 1CSOE 1TYNA 2CF8H 2ZCHP 3EE7A 1YYY1 2Z9IA 5A2MH 3LKWA 4NSYA 2FS8A 1VCPA 1XVOA 5HIYA 1KYNA 2IN2A 2PR3A 3T2NA 4B71A 3A8CA 1IQMA 2F3CE 3PYHA 1H4WA 1QA7A 2Z94A 1C1OA 1XUKA 2KR7A 3W1EA 4DCDA 2O9QA 1ESBA 1E36B 1TWXB 3ZVBA 1Q3XA 4DT7B 2HWLB 3LDXH 1BMAA 1C5VA 1GBLA 3SI3H 1W3CA 1D3PB 5LPFA 1BMFD 1TMUH 2O8LA 2ZPRA 3UWIA 2A4OA 4HI3A 5I25A 2WPLS 2J2UA 3PRBA 2FODA 1TGSZ 3S9CA 3KQEA 3QX5H 5SGAE 3TGKE 3IG6B 1D3DB 3P8GA 1SGEE 1QTFA 1ZMNA 1C2EA 3S7KB 5CDFE 3Q3XA 2VWOA 4IBLH 1KTTB 1EAWA 5T3HA 5FAHA 3ATWA 3UIRA 1XM1A 1A0LA 1E0FD 1SPJA 1LHEH 3A88A 2BY5X 1O2WA 1P11E 1H9IE 1V2TT 1O5BB 2C3SA 4UFGH 1TPPA 2Z9GA 1VJ9U 4Z0KA 1K1OA 1B0FA 2LPRA 5C1YA 4U30A 1O2YA 1SGDE 3M36A 1P2NA 1C1MA 1GBTA 3WW7A 1CA0B 1HAVA 5FX6A 1P2OA 1A46H 1H8DH 1J8AA 5JBAS 1JOUB 2CJIA 2VIVA 4AOQA 4X2XA 1ARCA 2FI3E 3RM0H 4IMZA 2WV5A 1CA0C 1DT2A 1YLNA 1IQLA 1MAXA 3ZZBA 4MNVA 3S9BA 1F2SE 2WPKS 5DP6A 1FMGA 2W3IA 3GOVB 1YPLH 1TOMH 3TVJB 5KEDA 2XC0A 4IS5A 4WJG2 5CE1A 2QF3A 1SB1H 1NN6A 2XYAA 5EXNA 2A1DB 1EB1H 4GUXA 1QQ4A 1ELBA 2BYAX 1JWTA 1C1VH 2BY6X 4NFEA 5F8XA 1HUTH 3UAIC 2Z9KA 4AN7A 4CRCA 1FAKH 2ZIQH 3UPEA 5FCKA 3U8OH 1A3BH 1KDQA 1UTPA 1ACBE 1LVYA 3TU7H 5KGOA 1O5FH 3K9XB 3LGUA 2L6OA 3KF2A 2RDLA 2JH6D 3E3TA 1A61H 3ZIAD 2AH4X 1AZZA 2HVXA 4JCNA 1NO9H 4IMQA 3MOCA 1GL0E 1UVSH 1DXWA 1BCUH 1P05A 1OPHB 1T7CA 2HOBA 1TGNA 3OX7U 5GCHG 1G3DA 2CN0H 2VVCA 2AFQB 3D65E 2UUJB 4ZKNU 1GJCB 4AGJA 1O5GH 4E7NA 2HNTC 3QZQA 3OEHD 1SQRA 2IPHA 2XC5A 5T6DA 2G51A 3MO9A 1SVPA 2H5CA 1CGJE 2O8MA 1QZ8A 3ATIA 1E34B 4YOGA 1TBZH 5F53A 3UQVA 1ZMJA 1HIAB 1XX9A 1KLJH 4ACAA 2DE9A 1MKXH 3M3TA 1T32A 4NSVA 1UCYK 2M5TA 2CF9H 5EQSA 1NESE 4PROA 1ORFA 4CHAB 4YLQH 1LQDB 1ZZZA 2JJ1D 1ID5H 2ZP0H 3RXPA 5EJ1A 3ZZ3A 3QK1A 1AE5A 1JRSA 4TSFD 4WMDA 2KCOA 1GJ4H 4CHAC 4FVDA 1LKBA 3QDZB 2W3KA 2V3HH 4MDSA 1SFIA 1BTYA 1KLIH 1SGTA 2P95A 2QGRA 2VIWA 4H6TA 3BEUA 4I86A 1K0HA 1W0JD 4CRDA 2BDCA 1Z8IB 4JZIA 1BTPA 1AN1E 3OTPA 3SOSA 1IQGA 1P9SA 1O3NA 2PTNA 3RXJA 3ZYDA 4B73A 1OP8A 5E0HA 4AFQA 5DJ7A 6LPRA 1F5RA 1MZAA 1C5XB 4GCHG 4UFDH 3MO6A 8ESTE 1E38B 1J16A 1F0RA 2BVRH 3P95A 4JK6A 1GHYH 5GXPA 2VJ1A 1AIXH 2FI5E 5GWZA 1V2WT 5AF9H 1Q2WA 3OE7D 2GCHG 2Y6TA 3P8NA 1TRYA 2BLVA 2OK5A 1NM6A 5A0BA 2WUCA 2XCFA 5DK1A 4I8GA 1ESAA 3SQEE 1GHXH 2BD9A 1EZSC 2ZI2H 1DOJA 4KELA 4XRNA 1AVGH 2UWOA 1XMNB 2PV9B 5EU8A 3SNEA 1BBRK 2GMTB 1ZTJA 1SR5C 1TNLA 1K1LA 1YP9A 1AMHA 5L6NH 3MU5A 3W94A 3BTGE 2WINI 3ATLA 2F91A 3H7TA 4BANB 5DP7A 3M5NA 2GMTC 1AZ8A 1O3IA 1GJ7B 2F9OA 2UUFB 2CK3D 2W5EA 2KCAA 2W26A 1ESTA 3TPIZ 3P8FA 3ZV9A 4ABBA 3QGNB 1O2OA 1OXGA 4AFZA 2HNTF 1CHOF 5F8ZA 1UJ1A 1PQ5A 5GDSH 5LPRA 1HRTH 4OS6A 7GCHG 4IC5A 1AO5A 4DVAU 4K3JA 1CGIE 3SHCH 1PPFE 4MLFB 1O3OA 1XKAC 1TB6H 1NFYA 4AB9A 1OWJA 2TIOA 3P17H 2XNIA 1D4PB 1S6HA 2K0QA 2GJGA 3IWMA 2NU1E 3LT3A 1EX3A 3TJVA 1A5HA 1GBHA 1TE0A 1Z8GA 1Y8TA 4YT6H 5DP4A 4M7GA 1D9IA 1S84A 1L0ZA 1W0ZU 1BITA 4B1TA 6ESTA 3M3SA 1QB6A 1A3EH 1DSTA 1QBVH 2XXLA 3JZ2B 1WAYB 1VJAU 1ZMLA 3F9EA 1HCGA 3PLBA 3Q00A 4MTBA 2F9VA 1GBIA 2CGAA 1BJUA 1GI2A 3SUGA 3ATMA 1O3MA 2ZFTA 4LOYH 4X2VA 3E6PH 4ISIH 5K7RA 2AHME 2VIOA 1C4U2 3EDXB 4NA7A 3BTQE 4Y6DA 1NRPH 1XUFA 5FBIA 2ZO3H 1TNJA 2A31A 1C1UH 2FXRA 2ZTXA 3ESTA 3SYJA 3ZVCA 3SU2A 4O3TA 2EQNA 3PTBA 1Z8RA 1YM0A 1FAXA 1QHRB 1O5DH 3ZVEA 4SGAE 1V6DA 3S9AA 1MCTA 1GBMA 1GPZA 3VB4A 3GY8A 1BHXB 4KTUA 3QN7A 1EJAA 3KYGA 1OOKB 1XXDA 1GMDG 2H9EH 1C9PA 3FZDA 4GVUA 1GI7B 2V3OH 1ZYOA 1UVTH 2WYGA 2ZFQH 1ELAA 5BPEA 3C1KA 1JIRA 3HATH 2PFEA 4CR5A 1NRRH 3ZVDA 1FPHH 2ESTE 3S7HB 1O2KA 1L1JA 3EA9A 3A7WA 3DFJA 1CGHA 2QF5A 5JDUB 3FVFB 5DP5A 3P92A 3SU0A 1EZQA 1D6WA 3SV8A 2YOLA 3VG8A 2QAAA 2C8XB 2B0FA 2LNCA 2XWBI 1VITF 2FIRH 2Z3EA 1O2MA 1CBWB 1KXCA 2FESH 2ZHDA 2BQ6B 3SZEA 1YGCH 3P8OA 3PV2A 2KAIA 1C2GA 4F4OC 1EAUA 3NRLA 1GHZA 3UWJH 2Z3CA 4WH6A 2FI4E 2WYJA 3GY5A 3RMLH 4FUBA 1MU6B 1CBWC 3MNXA 1NPMA 1MD8A 4XOJA 2PHBA 1HJ8A 1C5YB 1NZQH 2D1JA 4K2YA 4WMEA 4YOIA 1GHBF 3T29A 4MNYA 1C5ZB 3RXOA 1SGCA 1S5SA 2SGPE 5F03A 1C5NH 1O3JA 4F48B 1P12E 1P2JA 1LHDH 3N7OA 1O32A 3UTUH 1PPZA 1WTGH 3SJIA 5LPEA 1RS0A 2BD2A 1ANEA 1TBQH 4K1TA 3U1JB 1HV7A 1TOCB 1OYTH 3UNRA 9ESTA 1CHGA 4A6LA 2KCPA 4D8NA 4TWYA 1SKYE 1EFRD 1F0SA 1S81A 1C1QA 1C2MA 5C0TA 4AG2A 4FETA 1V3XA 1ZTLA 1CVWH 3GYMA 1OP2A 3BTME 2ZU4A 1BRUP 2C8ZB 6GCHG 2BTCE 2ZU5A 2H1UA 1INCA 2QXIA 1C9TA 1MMJN 3FFGA 2XWAA 1PYTC 4AFSA 1SLVB 2BHGA 2RA3A 1QB9A 2EA3A 2PKSB 3RXSA 3RU4T 1EJNA 3JZ1B 3A7XA 1Z71A 3MNSA 4RT0A 3RU4D 1C2DA 4FUJA 4BAOB 1NBME 1M9UA 1BHXF 2FYQA 1V2PT 4ZHLU 1IOEA 1BIOA 3PTNA 1QJ6B 1C5QA 3GCOA 4H6SB 4BNRA 5A0AE 5DP8A 3QO6A 4TYDA 3NXPA 2ALPA 1EZXC 1O3PB 1H9LB 3SJKA 1S83A 2ANYA 1LCYA 4KTCA 1BTZA 2C4FH 2TGTA 2ZPSA 2J94A 4LZ1H 5JBTA 1VKYA 3KQDA 2DE8A 2K1QA 3F9FA 4JYTA 2GV7A 4X1NU 2A2QH 3NCLA 1DVAH 3MHWU 1FY5A 2ZDMA 1THRH 1TMTH 1P10A 5HMAA 1T8NA 2GGVB 1PJPA 3NK8A 1HNEE 3I78A 2ZECA 2PWXA 3S69A 5T6GA 3ZVFA 2PTCE 4Y7AA 2FLBH 2PW8H 1TFXA 2P8OC 5CHAB 1GJ5H 1V2ST 5EIYA 2WPHS 2BVSH 1P9UA 2BDIA 1A7SA 3ZZAA 3O8DA 1TGBA 1LDTT 1P09A 1QRXA 2TBSA 3KN2A 3DHKH 2ZEBA 1KDQB 1KY9A 2Z9JA 5CHAC 2BDBA 4WH8A 3A7ZA 5EXLA 4NZQA 3CENA 3W95A 2ANWA 2ZDVH 2OD3B 3GY7A 2WZQA 2W7SA 3H7OA 2G00A 3UB0A 1XVMA 2G4UA 3RM2H 1O2VA 2PLXA 2ODPA 1N6YA 3PMHB 1L2EA 1C1WH 4K1SA 3OYPA 1QY6A 4FUFA 2H2ZA 4I8LA 3MU0A 1SQOA 5HM9A 3U98H 1EPTB 3T25A 5K0HA 1MUEB 1RJXB 1X7AC 1JXPA 1LVOA 4Q4LA 1GHVH 2Y7XA 4B6FA 4GSOA 1P02A 1HPGA 4K5ZA 2A0QB 3E8LA 1BZXE 1V2RT 3GCHB 4I33A 3UOPA 1UHBA 1V2LT 3OFND 4RKJB 1A4WH 2HGTH 1EPTC 1P2KA 2OC1A 5TCAA 1A5GH 2JH5D 4Z6AH 2FOFA 4INLA 3N99A 3SZNA 3LH3A 2QF0A 2FM2A 3GCHC 4RN6A 1KSNA 1FIWA 1VCWA 1ZGVA 3UY9A 1BA8B 1YCPK 1LHCH 3ENSB 3LJOA 1GI0A 3S0NA 2AGIX 5E0JA 1Z1IA 4D7FA 1JIMA 2ZQ2A 2J34A 4X0WU 4CH2B 2AIQA 3BTTE 3DFLA 5L2ZH 3U9AH 1DLEA 4ABIA 4YXWD 3M35A 1K22H 3PB1E 2WUBA 4AGKA 1ETSH 2QC2A 3E90B 1DPOA 3RMNH 4FUEA 3OY6U 1P2MA 1TBRH 4HG6A 5J4SA 1O3AA 1DUEA 2JETB 4Y10E 2OC7A 3FZZA 5EGMA 2P59A 1Y59T 1Q31A 1SLXB 1ZOMA 3OY5U 1ELCA 1W7GH 2JIZD 4F49A 4UFEH 1SQTA 1WBGB 3M7TA 2V6NA 2QA9E 1G9IE 1H8ED 2CV3A 2QCYA 3SQHE 4TWWA 4ZCNA 2FEQH 2KM0A 4XBBA 1TQ0B 2Q6FA 1GBJA 3RXVA 4TPYA 2VWLA 4Q7ZA 4K1EA 1MBMA 1QIXB 1UW7A 3ZVAA 1O5EH 5DN6D 1DX5M 1PFXC 2BB4A 2M2AA 2HALA 4P02A 1PPBH 4XBDA 1HAHH 2Z7FE 4OS1A 4BOHA 4FOUC 4X8TH 3F2HA 4UONA 1GHAG 1O3CA 3A83A 5AFZH 3SU3A 3URDA 3LOXA 5JB9S 3EA7A 1MKWH 1GI3A 3UQOA 3M37A 3MYWA 2J4IA 2AMDA 2FOEA 1ZHPA 2OBOA 4U01A 5EQRA 3RXRA 1AB9B 2J9NA 3F2FA 5EJLA 1YPHC 1IQKA 4D7GA 2ZHQH 2OP9A 3AW1A 3GY3A 3KQ5A 2A5AA 3RXQA 2GDEH 1AB9C 3MWIU 2A7HA 4INKA 3EA8A 1GBFA 1HFDA 5C5NA 5DKMA 3A89A 4H4FA 3H5CB 3BTEE 1K1JA 3GISB 4CBNA 2R9PA 5A09A 1YKTA 1GJ8B 2FTMA 1TAWA 3M5MA 1HAOH 4JZEH 3VEQB 1QL7A 3RLYH 2BX4A 2R0LA 3LC3A 1NY22 4UEHH 1NFUA 5TJXA 2B9LA 3BTKE 4CRAA 1GBKA 1O3FA 4ZROA 1O3GA 4VGCB 5IK2D 3U8RH 2O8TA 1L4ZA 3TJUA 3OU0A 1J9CH 3Q3KA 4D76A 5T6FA 4GLYA 2W6ID 1EOJA 4VGCC 1SHYA 1AY6H 2BD7A 2D8WA 3BTWE 4I31A 2ODYB 5JBBS 2TGDA 4Q80A 2PGQB 4UE7H 2BDAA 4CRFA 1AUTC 1GMHF 3TK6A 2SFAA 2ZFRH 1C2FA 1GJ9B 3A87A 1P3EA 3RXBA 1IQFA 1V2JT 3SV9A 1DXPA 2VWNA 1IAUA 2SGEE 2W6JD 2ZU2A 3AASA 3GICB 1DICA 2PGBB 2SGQE 2B7DH 3OEED 2HLDD 1UTLM 4MVNA 3RC4A 2WV4A 3BTDE 3TNSA 1XUIA 2WSSD 4GHTA 1BRBE 1FIZA 5EOKA 1FY3A 1NS3A 2IJOB 3KEEA 1YC0A 4Q7YA 5ABWA 6CHAB 1B5GH 1GJ6A 2TRMA 1UTMA 1YF4A 1DITH 1WV7H 1O37A 2GZ7A 5GCHF 2ZGHA 2F43B 3LGYA 5C5OA 2WPDD 1LHFH 1O34A 3U69H 2AGEX 3GYLB 3LU9B 1W0KD 1FONA 4RKOB 3MQKC 1BTHH 1QFKH 6CHAC 1O2ZA 4WVPE 1RFNA 1F5KU 2ZGBH 4ZHAA 1C1NA 1F5LA 3KNXA 4AYVB 1T31A 4A5TS 2RFKC 2QE7D 1WSSH 1P04A 4DY7B 1RXPA 2OQUA 4ISNA 1EQ9A 2ZNKH 2BX3A 4K8YA 5F8TA 1SGFA 1L1NA 1THPB 2UWPA 4Y8YA 7ESTE 1MTNB 2XTTB 2FTLE 2VBCA 5AFYH 4DURA 5C1UA 1G30B 2UUKB 1QJ7B 1E1QD 4NG9H 3BG4B 2G52A 1GJDB 1MTNC 4WWYA 2A4RA 1FV9A 1WCZA 3MH5A 1O2QA 2A7CA 2A4GA 1UCYE 3BV9B 2BY9X 3QUMP 2BY8X 4BAMB 3FO8D 3AAVA 3BG4C 2LP6A 3ZZCA 4BTIB 4E05H 4Y8ZA 1OWDA 5CHBA 2GDDA 3E16B 3RXTA 3ODFA 1N8OB 1QA0A 4X1QU 1LVBA 4BXSA 1O2GH 3KYFA 2D2DA 2VIQA 3P6ZB 2BD5A 1DWCH 2Y5FA 3F1SB 1VZQH 1NU9A 1UMAH 4J1YA 3RU4E 3RXMA 4ZXXH 4AB8A 4GCHF 4Y71A 4A7IB 3ZVGA 3HK6B 1TMBH 3MNCA 1AFQB 5EPNA 5C20A 1N8OC 1O3DA 2NU4E 4LZ4B 4FUCA 2J38A 4GPGA 4X1SU 2RG3A 1O3BA 1EASA 1Z1JA 3MU1A 4B75A 3M61U 5HKKD 1GVLA 1HLTH 1Y5AT 3N7EA 1AFQC 4ZH8A 3D49H 2VU8E 3FKSD 1ZTKA 2GCHF 3GDVA 4ASUD 2V35A 4Y11E 3T62A 3NZIA 1GDNA 1ZHMA 3MO3A 2PUXB 3KIDU 1FLEE 3UR9A 1PQ8A 3A81A 1S0QA 1MH0A 2XOKD 4HGCA 2VINA 3RXHA 2HRVA 1BUIA 1W14U 4ISOA 4GAWA 1Z6EA 2QV1A 3SI4H 3RC6A 4MG3A 4RI0A 2FOCA 2AMPA 1BB0B 1O5AB 1ELTA 3LGIA 2W7UA 4I8JA 1FY4A 1GDUA 2QXGA 1EP5A 1ZJKA 2VWMA 1C5WB 3M3VA 1BBRE 1KXEA 3CNRA 4AG1A 1F0TA 3RXFA 1GHWH 4ABEA 1QBOA 1W0YH 4AFUA 2ZTYA 1AVWA 4Z1MD 3H09A 2LELA 3VFEA 1AI8H 5C94A 1YPKH 2F9PA 1GG6B 3B9FH 3UREA 1AWHB 2WPIS 2C8YB 2FOGA 1FUJA 3TGJE 1ABJH 3SV2H 4ZKOU 1AWFH 3A8AA 3BEIB 2C8WB 1YPGH 1SOZA 1MD7A 1O3LA 2J98B 2NU2E 1GG6C 1N1LA 1D6RA 1CE5A 1FPCH 4I32A 2XBXA 2OCVB 2ZZUH 4WMFA 1SGQE 2A5KA 1DDJA 1EP6A 4LK4A 1NFWA 4ZHMU 1C5MD 1TPAE 3ZZDA 2BOHB 3F9HA 3BF6H 1P8VC 3PRDA 1COWD 3RXKA 4K60A 1ABIH 1E1RD 2H6MA 2RA0A 2UWLA 1DFPA 4THNH 4TT3D 1XKBC 4JYUH 3ZZ5A 1KIGH 1O2UA 1LKAA 2ALVA 4LXBH 5JYIA 1G3EA 4Y76A 2BLQA 3A82A 5GIBA 3L6PA 2ZA5A 2EY4C 2KCYA 4IN1A 3TH3H 4CH8B 2WPJS 3A8BA 3PM3A 1UVUH 2J97A 4FUIA 4I7YH 2O8WA 1TONA 1GI1A 4O03A 4U2WA 5C3NA 5GJ4B 3Q76A 2GVFA 4ZKSU 2IPQX 2OINA 2STAE 3NUMA 1JMOH 2STBE 1MKXK 1ZJDA 2ZFPH 1NROH 3RXDA 3O8BA 3A7TA 1ELGA 1G3CA 5EG4A 3B23B 2YMSB 3QLPH 3ITIA 1LVMA 3QTVH 1AKSB 5FPSA 1G32B 2IJD1 1O2TA 1O3EA 5IDKA 1IQIA 3LGTA 1V2KT 1QBNA 1TX7A 1ARBA 1U6QA 2YMSC 4YT7H 4Y0YE 3MU8A 1MU8B 3DSPA 1TA2A 1ELDE 4NGAH 1TGTA 1Y3UA 3OTJE 3T5FH 4ACBA 1VITG 1BTXA 1K1PA 4AZ2B 2SNWA 2OC8A 4XBCA 2YNAA 4DIHH 3TK9A 1UVOA 1TRMA 2A2XH 1HXFH 1MTWA 1SL3A 2ZF0H 3K6YA 1C5OH 1QGFA 1OSSA 5G4BA 1YPEH 1XUJA 2BMGB 3SHAH 3HK3B 3SGBE 1Y5UT 2HPQH 1CT4E 1GHBG 4NA9H 4ZXYH 4Q2KA 1RIWB 1LHGH 3GCTG 1GCTB 1GMCG 4XDEA 3A8DA 1ETRH 2Y7ZA 4X2YA 1B0EA 1FI8A 1OKXA 3CS0A 2R3UA 3SO3A 1AE8H 1S6LA 2BQ7B 1RIWC 1J14A 1PQAA 1YLDA 2I6QA 2XC4A 4X1PU 1GCTC 3HKIB 1G36A 5B6LA 1DY9A 3LH1A 1OWKA 3SU1A 4R8TB 1GI6A 2BVXH 2OQ5A 4JYVH 4X6PA 2OBQA 4IN2A 5H4IB 3N7DA 1E35B 5CMXH 5HM2A 1C1SA 2AGGX 1ELFA 2OTVA 3K65B 4ISHH 1H8HD 3PV4A 2B5TB 2FOHA 3RUOA 4B76A 4HZHA 3BG8A 3LPRA 3PLKA 1KXBA 1O2JA 3TNTA 2PUQH 1IQJA 5EQQA 2BXUH 2GCTB 2GT8A 1AQ7A 1GI5A 4M9FA 3FN8A 1EATA 1EAXA 4ASHA 3SU5A 5C0UA 7LPRA 6GCHF 5EW1H 4I8KA 1DM4B 1G37A 2OXSA 2G55A 2GCTC 4WXVA 5HXFA 4MNXA 1K1NA 2QN5T 2WHXA 3I29A 4NIWA 2PKSC 1J17T 4OS7A 5T1VA 3MH4A 3Q77A 2VNTA 5C17A 2Z6BD 4NIVA 2ZGCA 5AVDA 8GCHG 1EJMA 1FN8A 2FP7B 4P00A 1ZLRA 4YTAA 4TPIZ 1HAVB 2V3MA 4IW4E 1MABB 3TIUA 4CRBA 2VIPA 3T28A 2ZQ1A 2YMSD 2KFWA 4A1XA 1WOFA 1LQEA 2A7JA 1FN6A 4H42U 2AMQA 5DSFA 1D3TB 1GBBA 1H9HE 1O31A 3AAUA 4B2CA 4KP0A 1K21H 2ZTZA 2UUYA 1GI4A 3RXGA 1T8LA 1TQ7B 4NIXA 3CP7A 1WXRA 1VITH 1Y3WA 4OM9A 2G4TA 2I6SA 3GY6A 1K9OE 3KQBA 1TNIA 1YWUA 1OWHA 3HKJB 4A1VA 4DIIH 3IITA 2BLOA 1RTKA 1QRWA 5C2ZA 3ODDA 4UDWH 3U8TH 1C1RA 1ZSKA 1PPCE 1K1IA 1SGYE 5DPAA 2VIDA 4NA8A 1HJAB 2FDAA 4Y79A 1LPGB 1Y5BT 1OYQA 2P93A 1WQSA 4O97A 1QL8A 1RGQA 1GVKB 1GI9B 1HJAC 2NU0E 4CREA 2H9HA 4FXGH 2F9UA 1DWBH 1SG8B 5L2YH 1ZHRA 1CQQA 1NC6A 1TNKA 3SGAE 3F0PA 2R2MB 1Y3YA 1TPSA 2D26C 5C1XA 4D9RA 1SOTA 3HGPA 1P03A 1PYTD 1TNGA 1BRAA 3RXUA 2AYWA 3D62A 1EZUC 1NU7B 2V0BA 2AS9A 2ZDAH 4MNWA 4OGXA 1MAYA 3QWCH 2Y5GA 3ZV8A 1UCYH 3M5OA 2BY7X 2BZAA 2VH0A 1F92A 1HAGE
chains in the Genus database with same CATH topology
4FUDA 1SBWA 4X8SH 2PKAA 1MCVA 1O5CB 4UFFH 1D3QB 1SI5H 1SC8U 1YPMH 2CMYA 1KXDA 2F83A 2ZHEH 2FOMB 2GZ9A 1AFEH 2TGPZ 3SN8A 5AHGH 4TY6A 4NFFA 2RCEA 2GZ8A 3M7QA 1YCPM 2BDYA 3D23A 3UUZA 4OS5A 2HNTE 1DS2E 1HXEH 2ULLA 1FQ3A 1FZZA 2JETC 2ZU3A 3DUXH 5IYTA 2QXHA 2FS9A 1GL1A 2XW9A 3VB3A 3A85A 1O33A 3QZRA 1LTOA 3L33A 4NZLA 1PQ7A 1VCQA 2QIQA 2XCNA 1WU1A 3FP6E 1Z8JB 2BZ6H 4CR9A 1W11U 1UTJA 3FP8E 3MI4A 1W10U 1G2LA 2CXVA 3SGQE 1VGCB 1QL9A 2ZFFH 1ZPBA 2ZDKA 1HYLA 2P3FH 3O8CA 1J15A 3URCA 3KQCA 3A7YA 3TGIE 2FOBA 1O35A 2OLGA 4BAQB 5E2OA 1VGCC 1FJSA 1P2QA 1C5UA 2VH6A 1HJ9A 1C5TA 3EAJA 1BT7A 2Y81A 1GHAF 3LJJA 1BBRH 1EKBB 2GKVE 1W2KH 4JZDH 2GTBA 1C5SA 3M5LA 2SGFE 1O2LA 2BOKA 2ZDNA 4R0IA 5J4QA 2FX6A 5EODA 1SLWB 1UTNA 2Q6GA 1S85A 4DGJA 1G3BA 4E7RG 3A86A 1WUNH 2BD3A 1W7XH 2BM2A 3GY4A 4NIYA 3BTFE 4UD9H 2F9NA 2A32A 3E91A 3SBKA 1WYKA 1QNJA 4ZUHA 1SGFG 4AX9H 2OC0A 4IC6A 1GVZA 1ZRBA 1HGTH 1A0JA 1EAIA 1XUGA 1BOQA 2ZPQA 3UOUA 4JK5A 1MTUA 3BTHE 1F0UA 1P57B 1PPGE 3RMOH 5A0CA 3VPKA 1H8IH 1T8MA 1SGPE 1JRTA 3BIUH 1GMHG 3GCNA 2QXJA 1ZSJA 3PMAB 2J95A 1GGDB 1MQ6A 4YZUA 1TA6A 2EI6A 3RC5A 1GJBB 5FPYA 1QCPA 3DT0H 2HLCA 1BRCE 2ZCKP 1XUHA 3HPTB 1OP0A 1LPKB 4B2BA 4ZAEA 1GGDC 1YPJH 2ZWLH 3ZZ8A 1FNIA 2GD4B 3K6ZA 5LH8A 3EGKH 1UTQA 2BQWB 4X8UH 4FU8A 2ZGJA 4FVBA 3SORA 1Y3XA 1FY8E 1O2RA 1K1MA 4DJZB 4I8HA 3PROA 1LO6A 1JBUH 2XBVA 1CT0E 3LC5A 2ZHFH 4ABJA 2Z3DA 4ISLA 2CHAB 5DP9A 1ZR0A 1EPTA 3ZZ6A 1UTOA 5FXLA 1ZPCA 3RP2A 3L3TA 1UO6A 3AVZA 3SV6A 1IQHA 1C2IA 1P01A 2CHAC 1SHHB 1HAIH 1TNHA 3RXLA 1OWEA 3SW2B 1O3HA 3SNCA 1KLTA 3SU4A 1W13U 3LONA 1OX1A 4FU7A 3PMBB 1O2XA 4YESB 5A8ZA 4OGYA 3SNBA 4AYYB 2VVUA 5EW2H 1K2I1 1DSUA 1DY8A 4X6NA 1O39A 1K28D 2BDHA 2ZGXH 1EB2A 2KAIB 1O38A 2JKHA 3NWUA 1RTLA 1TGCA 4MPVA 3SV7A 3VB5A 3TH4H 1P0SH 5PTPA 1IQNA 1TIOA 1C2HA 2SGDE 2G5NA 1NT1A 3NPSA 1RRKA 3Q3YA 4KKDA 2VGCB 4OS2A 1P3CA 1H1BA 1CU1A 5F6MA 2B8OH 2P94A 1V2QT 3PWCA 4ABAA 3VGCB 3I77A 1QURH 1A1RA 4J2YB 1V2OT 2VGCC 2FOAA 3TJOA 1AVXA 4DOQA 4JZ1A 3VGCC 4X6OA 3PWBA 1Z7KA 1MTSA 4ABGA 3SJ8A 2G8TA 3ATKA 1DUAA 3F6UH 3KCGH 2ODQA 1UVPA 2WPMS 3VXFH 1MKWK 3T26A 2THFB 2SNVA 4FUHA 5JPMH 1TABE 4BAHB 2FWWA 1YBWA 3E0PB 5DO4H 3STJA 1XXFA 4JZFH 4DG4A 1V2MT 3GY2A 1T4UH 3BN9A 2BXTH 2Q1JA 2A45B 4WF8A 7KMEH 1GWAA 1CHOG 1IHTH 1KTSB 2Y5HA 1PPEE 3V7TA 1NTPA 1FDPA 1DE7H 1PPHE 1SSXA 1W12U 3K2UA 2ILNA 3ELAH 5B6OA 4ABDA 4HTCH 4Q7XA 1O2HA 4NWLA 3V3MA 5ETXA 1P06A 7GCHF 1C5PA 2BLWA 5DGJA 1A5IA 4X1RU 2BD4A 4CBOA 1ZSLA 4IGDA 1BMNH 2AERH 2R2WU 1WTHD 1ZPZA 1W8BH 5EPYA 3PLPA 4A1TA 1GBAA 3EE0B 4KTSA 3SNAA 4OS4A 1BDAA 1NRQH 3F9GA 4NCYA 5L30H 8LPRA 1EUFA 1TLDA 1A0HB 2SGAA 2PSYA 1HBTH 2Y80A 3BSQA 1FY1A 3TITA 1ANCA 1ZRKA 4MQAA 5EXMA 5DG6A 1G2MA 2C93B 2J92A 5ESTE 5JBCS 5LGOA 1C1TA 3ZZ4A 4BTUB 2YNBA 3MFJA 3A7VA 2ZC9H 4MPWA 4XSKU 1O3KA 1HB0B 2VVVA 5ESBA 1EXFA 4U32A 4ZMAH 1SFQB 2QYIA 1S0RA 1SGNE 4ZKRU 5C67A 1BTUA 2BDGA 1L1GA 4INHA 4ESTE 4X2WA 2AEIH 1LMWB 3MH6A 4SGBE 3TLOA 1GJAB 5TCCA 2C90B 1SLUB 5E8EH 3SJ9A 1O2NA 5E2PA 1T8OA 1HAYB 1ETTH 1SGRE 1GMDF 1T4VH 3KL6A 3PMJA 2QY0B 2A5IA 1HIAA 1GBCA 2H9TH 3MH7A 1V2UT 5BRRE 1SMFE 4WY3A 1UHBB 1TALA 1CA8B 1RTFB 3RXEA 3E0NB 4GHQA 3LGVA 4BXWA 3TH2H 3O8RA 3AW0A 1IQEA 2OUAA 3EQ0H 1CO7E 1QJ1B 3SUFA 1AU8A 1MTVA 2XBWA 2Q6DA 3QGJA 3GDSA 1YCPH 4ABFA 2JH0D 2TPIZ 2PKAB 2ZFSA 4MPUA 1C5LH 1AUJA 4DW2U 1O2PA 3VB7A 1L4DA 4X8VH 4QT8C 2ZDLA 1UK4A 3SNDA 1GBEA 3ZZ9A 2A4QA 3CS7A 3MU4A 8KME2 1C2LA 1O2SA 4K69A 1YLCA 1OWIA 4YOJA 4NWKA 3DA9B 4B2AA 1Z6JH 3RMMH 3QTOH 1O0DH 2HPPH 3UFAA 3MNBA 4BAKB 1TX6A 4MPXA 5DP3A 3FANA 3WY8A 1BQYA 3RDZA 3GCTF 4AORA 5A8YA 4KGAA 1GMCF 2GX4A 3UNQA 2FLRH 3GDUA 1C2KA 1RD3B 5A8XA 1IHSH 1N6XA 3DD2H 3B8JA 2EI8A 2XBYA 1MQ5A 1OS8A 1GCDA 3P70B 1S82A 5FHTA 3M7UA 4E06H 1AGJA 4XFQA 4D9QA 3T27A 3SUDA 3FP7E 4FU9A 1O30A 2NWNA 1AHTH 3KGPA 2FMJA 5HYOA 1EOLA 3R3GB 1TPOA 2TGAA 3V12A 1DANH 3A84A 1TX8A 3C27B 1HAZB 2FPZA 3BEFB 1O2IA 3HGNA 4Y8XA 3KHVA 3G01A 3UR6A 1QR3E 3MMGA 1DWEH 4Y0ZE 4FUGA 1HAXB 1C4V2 3RXIA 3PO1B 1V2VT 4CRGA 3A80A 1CT2E 2GT7A 4K8BA 2ANMH 3SU6A 4XE4A 2GP9B 3EYDA 3PO1C 3F68H 2F9BH 1VR1H 5FPTA 1AD8H 1NRSH 1MZDA 8GCHF 5I46H 4ABHA 5E0GA 2R3YA 5JB8S 2EC9H 1GBDA 1DLKB 1F7ZA 1LPZB 2G5VA 5HGGA 1NFXA 3RXAA 2R0KA 1BMLA 1S6FA 1GDQA 1C1PA 1C2JA 1NRNH 1WQVH 3UNSA 2FYRA 4YLUA 2FZZA 4Y7BA 4B74A 3V0XA 1QRZA 3U1IB 2P8OB 1YPHE 3LGWA 1UK2A 1THSH 1KXFA 1KXAA 4JMYA 2NU3E 2FO9A 2GV6A 2IOTA 1FXYA 3SUEA 2XRCA 3TJNA 1QB1A 1ANBA 1HAPH 1BMMH 3STIA 3TK5A 2BD8A 2ASUB 2AIPA 1UTKA 3R0FA 2PSXA 2ZG0H 2FX4A 2Y82A 4O9VA 2VB0A 2H5DA 2ZCLP 1QQUA 3LIWA 4YM9A 1BTWA 2EEKA 1TRNA 4O3UA 3E1XB 3OSYA 1P2IA 2ZHWH 3FAOA 4X6MA 1E37B 3MTYA 2ZU1A 1BJVA 4YO9A 3NKKA 3RXCA 2P16A 3BIVH 1C4Y2 1SQAA 5FBEA 2O8UA 9LPRA 1B7XB 3ZZ7A 2Z9LA 1O36A 1AKSA 2EI7A 5GPIB 4WXIA 5FX5A 4A92A 3V13A 2DUCA 1Y3VA 1HDTH 1SGIB 2G81E 1ELEE 1A2CH 1C5RA 4RSPA 3VB6A 3VXEH 1ANDA 2P3UB 4HFPB 1ELVA 2ZKSA 3RLWH 1GI8B 1UK3A 1ZGIA 2ANKH 2P3TB 1MBQA 4BTTB 1V2NT 3SJOA 4TY7A 1DWDH 5FCRA 3ZYEA 1CSOE 1TYNA 2CF8H 2ZCHP 1YYY1 2Z9IA 5A2MH 3LKWA 4NSYA 2FS8A 1VCPA 1XVOA 1KYNA 2IN2A 2PR3A 3T2NA 4B71A 3A8CA 1IQMA 2F3CE 3PYHA 1H4WA 1QA7A 2Z94A 1C1OA 1XUKA 4DCDA 2O9QA 1ESBA 1E36B 1TWXB 3ZVBA 1Q3XA 4DT7B 2HWLB 3LDXH 1BMAA 1C5VA 1GBLA 3SI3H 1W3CA 1D3PB 5LPFA 1TMUH 2O8LA 2ZPRA 3UWIA 2A4OA 4HI3A 5I25A 2WPLS 2J2UA 2FODA 1TGSZ 3S9CA 3KQEA 3QX5H 5SGAE 3TGKE 3IG6B 1D3DB 3P8GA 1SGEE 1QTFA 1ZMNA 1C2EA 3S7KB 3Q3XA 2VWOA 4IBLH 1KTTB 1EAWA 5T3HA 5FAHA 3ATWA 3UIRA 1XM1A 1A0LA 1E0FD 1SPJA 1LHEH 3A88A 2BY5X 1O2WA 1P11E 1H9IE 1V2TT 1O5BB 2C3SA 4UFGH 1TPPA 2Z9GA 1VJ9U 4Z0KA 1K1OA 1B0FA 2LPRA 5C1YA 4U30A 1O2YA 1SGDE 3M36A 1P2NA 1C1MA 1GBTA 1CA0B 1HAVA 5FX6A 1P2OA 1A46H 1H8DH 1J8AA 5JBAS 1JOUB 2CJIA 2VIVA 4AOQA 4X2XA 1ARCA 2FI3E 3RM0H 4IMZA 2WV5A 1CA0C 1DT2A 1IQLA 1MAXA 3ZZBA 4MNVA 3S9BA 1F2SE 2WPKS 5DP6A 1FMGA 2W3IA 3GOVB 1YPLH 1TOMH 3TVJB 2XC0A 4IS5A 4WJG2 5CE1A 2QF3A 1SB1H 1NN6A 2XYAA 5EXNA 2A1DB 1EB1H 4GUXA 1QQ4A 1ELBA 2BYAX 1JWTA 1C1VH 2BY6X 4NFEA 5F8XA 1HUTH 2Z9KA 4AN7A 4CRCA 1FAKH 2ZIQH 3UPEA 5FCKA 3U8OH 1A3BH 1KDQA 1UTPA 1ACBE 1LVYA 3TU7H 1O5FH 3K9XB 3LGUA 3KF2A 2RDLA 2JH6D 3E3TA 1A61H 2AH4X 1AZZA 2HVXA 4JCNA 1NO9H 4IMQA 3MOCA 1GL0E 1UVSH 1DXWA 1BCUH 1P05A 1OPHB 1T7CA 2HOBA 1TGNA 3OX7U 5GCHG 1G3DA 2CN0H 2VVCA 2AFQB 3D65E 2UUJB 4ZKNU 1GJCB 4AGJA 1O5GH 4E7NA 2HNTC 3QZQA 5T6DA 2IPHA 2XC5A 2G51A 3MO9A 1SVPA 2H5CA 1CGJE 2O8MA 3ATIA 1E34B 4YOGA 1TBZH 3UQVA 1ZMJA 1HIAB 1XX9A 1KLJH 2DE9A 1MKXH 3M3TA 1T32A 4NSVA 1UCYK 2M5TA 2CF9H 5EQSA 1NESE 4PROA 1ORFA 4CHAB 4YLQH 1LQDB 1ZZZA 1ID5H 2ZP0H 3RXPA 3ZZ3A 3QK1A 1AE5A 1JRSA 4WMDA 1GJ4H 4CHAC 4FVDA 1LKBA 3QDZB 2W3KA 2V3HH 4MDSA 1SFIA 1BTYA 1KLIH 1SGTA 2P95A 2QGRA 2VIWA 4H6TA 3BEUA 4CRDA 2BDCA 1Z8IB 4JZIA 1BTPA 1AN1E 3SOSA 1IQGA 1P9SA 1O3NA 2PTNA 3RXJA 3ZYDA 4B73A 1OP8A 5E0HA 4AFQA 5DJ7A 6LPRA 1F5RA 1MZAA 1C5XB 4GCHG 4UFDH 3MO6A 8ESTE 1E38B 1J16A 1F0RA 2BVRH 3P95A 4JK6A 1GHYH 5GXPA 2VJ1A 1AIXH 2FI5E 5GWZA 1V2WT 5AF9H 1Q2WA 2GCHG 2Y6TA 3P8NA 1TRYA 2BLVA 1NM6A 5A0BA 2WUCA 2XCFA 5DK1A 4I8GA 1ESAA 3SQEE 1GHXH 2BD9A 1EZSC 2ZI2H 1DOJA 4KELA 1AVGH 2UWOA 1XMNB 2PV9B 5EU8A 3SNEA 1BBRK 2GMTB 1ZTJA 1SR5C 1TNLA 1K1LA 1YP9A 1AMHA 5L6NH 3MU5A 3W94A 3BTGE 2WINI 3ATLA 2F91A 3H7TA 4BANB 5DP7A 3M5NA 2GMTC 1AZ8A 1O3IA 1GJ7B 2F9OA 2UUFB 2W5EA 2W26A 1ESTA 3TPIZ 3P8FA 3ZV9A 4ABBA 3QGNB 1O2OA 1OXGA 4AFZA 2HNTF 1CHOF 5F8ZA 1UJ1A 1PQ5A 5GDSH 5LPRA 1HRTH 4OS6A 7GCHG 4IC5A 1AO5A 4DVAU 4K3JA 1CGIE 3SHCH 1PPFE 4MLFB 1O3OA 1XKAC 1TB6H 1NFYA 4AB9A 1OWJA 2TIOA 3P17H 2XNIA 1D4PB 1S6HA 3IWMA 2NU1E 3LT3A 1EX3A 3TJVA 1A5HA 1GBHA 1TE0A 1Z8GA 1Y8TA 4YT6H 5DP4A 4M7GA 1D9IA 1S84A 1L0ZA 1W0ZU 1BITA 4B1TA 6ESTA 3M3SA 1QB6A 1A3EH 1DSTA 1QBVH 2XXLA 3JZ2B 1WAYB 1VJAU 1ZMLA 3F9EA 1HCGA 3PLBA 3Q00A 4MTBA 2F9VA 1GBIA 2CGAA 1BJUA 1GI2A 3SUGA 3ATMA 1O3MA 2ZFTA 4LOYH 4X2VA 3E6PH 4ISIH 5K7RA 2VIOA 1C4U2 3EDXB 4NA7A 3BTQE 4Y6DA 1NRPH 1XUFA 5FBIA 2ZO3H 1TNJA 2A31A 1C1UH 2FXRA 2ZTXA <