1GI0A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi0A02
3D23A 1O2GH 1KLIH 1O3JA 2ZI2H 2VIWA 1ZTKA 3OX7U 1GPZA 3V0XA 3ZZ3A 2OQ5A 1F7ZA 3M5OA 3GY8A 4MPXA 4BAQB 3SV2H 3A80A 3RMOH 2A45B 4GUXA 2ZEBA 4UFDH 3DFLA 1QA7A 3SNDA 1E38B 1GG6B 5CE1A 2ZA5A 1C9TA 3RXJA 1UVUH 1QB1A 1IQKA 2J9NA 2GZ9A 1FI8A 1C1UH 1C2DA 1C2EA 3FVFB 4ISOA 1ELEE 3TK6A 4CH2B 2J95A 1O33A 2ANWA 2C8WB 2AERH 4MNXA 4B74A 7GCHF 1WCZA 1QFKH 2FWWA 1HJAC 2XCNA 3DHKH 2WINI 5A0CA 3PWBA 1NC6A 2ZDAH 2I6SA 3TJUA 1HUTH 2O8LA 3T2NA 3GY5A 1ABJH 2DE8A 2V3OH 1FN6A 2WPMS 4D76A 4X1NU 3SU0A 2QY0B 1TPAE 2ZGJA 4ABEA 1HFDA 4UFGH 1Y3VA 4BOHA 8ESTE 2TGPZ 1AMHA 1J16A 2FI5E 1O0DH 1ABIH 2DUCA 1MH0A 3TITA 2ZHEH 3E8LA 1O2NA 4AX9H 9LPRA 1O2KA 1SFIA 3Q3KA 1TNHA 2Y5FA 3TH4H 3U69H 1IQLA 4WJG2 2ZCHP 1NRQH 4YOIA 3V7TA 5DP8A 1CHOF 2A5KA 1IQHA 2XTTB 3PLKA 3UQVA 4MLFB 3QLPH 1ZZZA 1O2QA 1BCUH 1HAVA 1LVOA 3MNBA 2VWLA 3Q76A 1EUFA 3S9CA 1KTSB 2ZQ1A 1UCYE 2PSXA 1ZR0A 2ZFTA 4Q7ZA 4NIXA 1VITF 3SV8A 1FAXA 1FPCH 2BMGB 1C1WH 3ZVEA 3MH5A 1MTUA 2EEKA 2QF0A 2ODYB 1AQ7A 1HB0B 6CHAC 8GCHF 4KTSA 3GYLB 4A1XA 1FY4A 4FU9A 3MH7A 1O2IA 3H7TA 1GL0E 3MU4A 1GI0A 1WYKA 2ZKSA 3PM3A 1C1SA 4IC5A 1EAWA 2C4FH 2GGVB 3PROA 1W8BH 1T8OA 1GI8B 1F0TA 1A5HA 1GJ6A 2GVFA 4ISIH 4HGCA 1AY6H 1ZTLA 4DW2U 1C2JA 3JZ2B 5FPSA 1PQ7A 1P2IA 1DLKB 1QCPA 2J4IA 2CGAA 1P2JA 1QA0A 2ZGHA 3P95A 1DT2A 2BDYA 2VJ1A 4X1QU 3ATLA 4BAHB 1GI1A 2UUYA 3A8AA 5G4BA 3VGCB 1GJCB 2BOKA 1LQDB 5EGMA 3TH3H 1BUIA 1WTGH 4Q7XA 4XSKU 3EAJA 5JPMH 1G3EA 4MG3A 1W13U 1DUAA 2FESH 1C1PA 3UFAA 1CO7E 2G8TA 5EW1H 2P8OC 1DOJA 4Y11E 3RMNH 3LC3A 1BTXA 3ODDA 2YNBA 2XBYA 2XCFA 2ZF0H 3LGUA 1LKAA 4BTTB 3RXRA 1NFYA 1V2JT 2FOEA 5E0JA 2ZCKP 1LPKB 5SGAE 1O36A 3RM2H 1LKBA 5EU8A 1V2UT 2Q1JA 5IYTA 3LGVA 1C2LA 2Z9JA 4UD9H 3DD2H 1IQGA 1S81A 3D65E 1ETSH 3M37A 1TIOA 3A83A 2H6MA 2GV7A 6ESTA 5EPYA 1TNJA 1GCDA 3SHCH 3MO3A 5JYIA 1P2QA 3DT0H 4SGAE 2H5CA 1OWEA 1AGJA 2G5NA 1A1RA 3MTYA 3QZQA 3SI3H 6CHAB 3M35A 1SGPE 1VCQA 1QIXB 3R3GB 4I8GA 1PPGE 3RXFA 4NWLA 4AB8A 4MNYA 3TNSA 2WV4A 1GCTC 5T3HA 4FUCA 4JK6A 4NG9H 3AASA 1SGDE 1EB2A 1TRYA 5AHGH 5A8XA 8KME2 1XUGA 4FXGH 1ZPCA 1FIWA 3NK8A 2ZDKA 1C5QA 1YPJH 1YPGH 3RDZA 2PKAA 1W0ZU 2H5DA 4JZDH 2ODPA 2Z3EA 3SV9A 1F92A 1V2RT 1V2WT 2OC1A 3KN2A 3M7TA 3RXAA 4OS6A 1ZHMA 1PYTC 5K7RA 1D9IA 3RXGA 1IHSH 5DK1A 2W26A 3EA7A 1TOMH 5LPFA 1C2GA 3FP7E 3T25A 1HNEE 1P10A 3RXTA 2XWAA 4JZIA 3A87A 1HAPH 2P8OB 1SLUB 3MNSA 1C5YB 1GBLA 2GP9B 3OY6U 5A8YA 4Y8ZA 3UUZA 1O2PA 4D9QA 2OBQA 3P8OA 1IQEA 1RTFB 2AEIH 2BDGA 4WMDA 5DKMA 4HZHA 2J34A 4H6TA 3CS7A 1K1PA 4R0IA 2ZDLA 4OS4A 4DOQA 3A7YA 1WU1A 1LHFH 4NSVA 4JZFH 1GJ5H 1SGFG 1UCYK 4ABJA 1NROH 3BTEE 1UCYH 1H9LB 1Y5BT 3L6PA 3RU4D 4X0WU 1P2KA 3ZVAA 1SOZA 1TX7A 2FXRA 4NA7A 3T26A 4X2XA 4GVUA 5TJXA 1GJBB 3PMJA 3MI4A 3K2UA 2BVXH 4IN1A 1O2UA 1QRWA 3RC5A 1SGYE 3VPKA 2J2UA 2ASUB 3ZVBA 3A7WA 5GCHG 1NFXA 4B75A 1SLWB 3E90B 2IJOB 1DVAH 4MPVA 5J4QA 2BLWA 3NPSA 4XDEA 3KNXA 2FI4E 4I8LA 1GJ9B 3IWMA 1OWIA 4GHQA 1GHVH 4NZQA 3R0FA 2ZPQA 1CQQA 1H4WA 2ESTE 1HYLA 1SGFA 3MU0A 3UWIA 2TGTA 3TJOA 2LPRA 2GZ7A 1BMMH 3SV6A 4F49A 3SNCA 3U1IB 1BMLA 4KELA 4B73A 2BYAX 3TK9A 4INLA 1AE5A 2G52A 1GL1A 3U8TH 1T7CA 2UWPA 2Y5GA 2BDHA 3LDXH 1BTYA 2OD3B 1DPOA 5K0HA 5GWZA 1BTWA 1YLCA 2XW9A 4ISNA 5DP3A 1WQVH 1DXWA 3TGIE 2A4QA 3UREA 1EKBB 5GXPA 1CT4E 3RM0H 4NIWA 3ZV8A 1DLEA 5T6GA 1IHTH 5E8EH 3SOSA 4YZUA 4FUJA 4NA9H 4YM9A 1TMTH 3MO6A 1V2OT 1T31A 4Q2KA 2R9PA 4UE7H 1A5GH 2A2QH 1P9UA 1XUHA 1O3LA 1HAVB 1ZGVA 1C2IA 3RU4T 1LVBA 1ZSKA 1G3CA 1GBHA 1LVMA 2WPLS 3NUMA 2V6NA 3D62A 4X2VA 1UTKA 3GDVA 4X8SH 2G81E 2RA0A 3MU8A 5PTPA 1IAUA 3GCOA 1NRSH 3TK5A 1D4PB 1A0LA 4B2AA 3U1JB 1EOLA 3MO9A 1Z8RA 1NTPA 1EX3A 1NY22 1P3EA 4ABGA 3T29A 4AG1A 3SU4A 1THPB 5F6MA 2SGQE 1KXBA 1OXGA 1G2MA 3GISB 2AIQA 3OYPA 4NWKA 4X1PU 2XXLA 1C4U2 1HPGA 2ZQ2A 2VWOA 4TY6A 1Y5UT 2BQ7B 3BTFE 1ZSJA 3SJ9A 4B71A 1TNIA 5LPEA 1UVSH 3NXPA 4IGDA 4X6OA 1FJSA 3SQEE 1O32A 2WPKS 5LH8A 1LQEA 3TPIZ 4O3UA 1ESAA 2BLVA 1FAKH 1MD8A 4IC6A 1TB6H 3BTGE 1V2KT 2AMDA 3ZYEA 1NO9H 3TGJE 1QL8A 2FP7B 1ETTH 2D8WA 2GT7A 1GI6A 1RD3B 3SI4H 2I6QA 2Y7XA 3MH6A 3T5FH 2GTBA 2ZNKH 4DIIH 2CJIA 1G2LA 5ESBA 1NRNH 1J14A 1OPHB 2P59A 2VWMA 3UOPA 1GHZA 1C2MA 1L1GA 2C8XB 1MTSA 2NU2E 2BM2A 4IN2A 3RXQA 1Y3UA 5GDSH 1PPFE 2R2WU 2WPHS 3HK6B 1YM0A 1BDAA 1QHRB 4WWYA 4D7GA 2D26C 4FUBA 4AFUA 1C5OH 4NGAH 2J94A 4K5ZA 4CRAA 2FOGA 3UOUA 2BHGA 4DG4A 1OSSA 3KIDU 2HPQH 2PHBA 5BRRE 3OY5U 5GPIB 2HNTE 4H6SB 4TPYA 1O3AA 5GJ4B 1O2MA 4ZKSU 2FS8A 1V3XA 1PQ5A 1JWTA 4XBBA 2OUAA 3RXLA 2GCTB 1ZPBA 3BTWE 3GY7A 1B0EA 4VGCB 3Q3XA 2OC7A 2EA3A 2PKAB 1TGNA 2ZP0H 4WMEA 1TBZH 1P9SA 1D3DB 3P8NA 1ANBA 1OYQA 4A6LA 2FOCA 2WYJA 3MOCA 1O3OA 2ZFQH 3LIWA 4KGAA 1OX1A 4ABBA 4BNRA 1L1JA 2O9QA 1FY8E 1GBEA 1V6DA 5JBAS 2NU0E 4THNH 2Z9GA 5HYOA 3AAVA 4AORA 5C20A 1W2KH 1SLVB 2PR3A 3BEUA 2HALA 5JBCS 4PROA 2XRCA 4NIYA 3ZVGA 3LU9B 1EAIA 2BDIA 3S0NA 1O3MA 1IQNA 1NZQH 2BX4A 3P92A 1P04A 1GJAB 1UTPA 4WMFA 1DUEA 2PUQH 3QX5H 5JB8S 1AVGH 1K28D 2FM2A 4Y7BA 1A0HB 1QNJA 2FX6A 3PTBA 1UVPA 2OP9A 3S9AA 1DWCH 4D9RA 1ELCA 1G3DA 4YT6H 2O8TA 5FPTA 4DCDA 2CF9H 3EE0B 2OC0A 4XBDA 4MDSA 3CENA 4Z6AH 2TBSA 4JK5A 2TGAA 2OC8A 5C67A 4B1TA 2JETC 1HCGA 1V2MT 2OLGA 3Q77A 2J92A 2ZFRH 2J38A 3E6PH 3BIVH 4J1YA 1NT1A 4CRFA 1ETRH 3F68H 1T4UH 2BOHB 2ZTXA 1UTLM 2VIQA 4B2CA 1C5UA 1K1IA 1SVPA 1THRH 1F5LA 5FCKA 1SPJA 4SGBE 1ZRBA 1GVLA 3BIUH 2B9LA 3VXFH 3TNTA 2JKHA 1WOFA 1G9IE 2TGDA 5T6FA 2F9VA 1KXDA 2HLCA 3QN7A 1AKSA 1BBRE 1FDPA 1G37A 1TYNA 1UO6A 1GBBA 2A5IA 2G51A 2VGCB 2V35A 3HK3B 2GX4A 1L1NA 2ANMH 1C5PA 4JCNA 5C5NA 3TU7H 4AN7A 1GHAF 3DA9B 4DY7B 3B9FH 3M5NA 4YESB 1BJVA 4IW4E 1W10U 1YCPK 2HVXA 5F8XA 6LPRA 2ZDNA 5EQSA 1C5TA 4A7IB 2W3IA 1FXYA 1S85A 2C8ZB 2K1QA 1EZXC 1MTNB 4KKDA 2FMJA 4X6NA 1W12U 3ODFA 1GDUA 1Y8TA 3LGWA 5IDKA 1HDTH 1Y59T 1A0JA 3L33A 1UJ1A 1IQFA 1N6XA 2AH4X 3GY2A 4MQAA 3V13A 2W3KA 3DUXH 4JZEH 3E1XB 2FS9A 1H9IE 3RXEA 3OTJE 1LMWB 4Y0ZE 3VFEA 1C4V2 1K1LA 1S5SA 2H9HA 2G5VA 2NWNA 4Y76A 1H9HE 4K69A 1KSNA 3HGNA 2ZU1A 1NESE 1ZMLA 1O31A 4CRCA 2V0BA 2PV9B 3D49H 1NRPH 1C1TA 1ZJDA 4BTIB 2CXVA 1WUNH 2QC2A 3ZV9A 1UMAH 1ZRKA 1O3IA 4Y10E 2A4RA 2B7DH 4I8KA 3UNRA 3GOVB 2FTMA 5JBTA 2OTVA 2A0QB 3C27B 2QCYA 3QZRA 3GCTG 3S7KB 2FLBH 2W5EA 1HJAB 2BB4A 1Q2WA 2ZFPH 3PO1C 1P0SH 4AFZA 2VVCA 1Q31A 3F9EA 3SJ8A 3EGKH 4ISLA 4JYVH 3HKIB 3RC4A 1YBWA 3FZZA 3GYMA 2ZGBH 3KF2A 1GI9B 5FXLA 3GY3A 2ZGCA 1V2LT 4UONA 1D6WA 2GMTC 3SUDA 2BY9X 4HI3A 1OP2A 2ZGXH 2D2DA 5HGGA 1DFPA 1ELVA 3ATIA 1V2PT 2Y7ZA 3FZDA 2PGBB 3ZZ8A 1GJ8B 1ELTA 2QXJA 4Y8XA 5JBBS 2H9TH 1YPKH 2UUJB 3SJOA 1O3KA 1E37B 5C1YA 4X6MA 1NFUA 3RXSA 3SQHE 1P01A 4IBLH 3HATH 3UTUH 1YF4A 1O3NA 1SGQE 2QAAA 4AYYB 1OP8A 1UHBA 2AYWA 1MKXK 2A2XH 1MKXH 1DY8A 1RTKA 3UY9A 2VIVA 1TE0A 2FX4A 1E36B 4AG2A 3M61U 1D3PB 1SLXB 2A4OA 1LDTT 1JIMA 5CHAC 1HRTH 1T8LA 1BHXF 1TNLA 5A09A 1U6QA 1T8MA 1TWXB 3CS0A 1LHDH 1ZOMA 3F1SB 4H42U 1CHGA 3PYHA 5HXFA 3A7ZA 1K1MA 3UIRA 1TNGA 1OOKB 1A2CH 2ZECA 2UWLA 1S84A 1OS8A 1SR5C 4RSPA 3T62A 1Y3XA 4R8TB 2PTCE 1C2FA 4NFEA 4ZROA 4FVBA 3PO1B 1ZLRA 2P94A 2WPIS 3PMBB 1TGSZ 3SUFA 1GDQA 3A86A 4GSOA 1RTLA 1MKWK 3EQ0H 5ABWA 3UR6A 2QYIA 1MKWH 1H1BA 1DSTA 1GJ7B 3VB7A 3A88A 3OU0A 2YOLA 4CBOA 3V3MA 2VU8E 1F2SE 2HOBA 1PPHE 1BBRK 1EATA 1BBRH 1W7XH 4HTCH 1W3CA 1E34B 1O5FH 1RFNA 1Q3XA 5FPYA 4UEHH 1ORFA 2R0LA 1QURH 4RKOB 2P3FH 2BD9A 4AB9A 1SQOA 1MCVA 1CGIE 4A1VA 4DIHH 4O03A 4IMZA 1D6RA 4OGYA 5DO4H 1IQMA 1ELFA 1FMGA 1SHYA 1VCPA 1BJUA 5DP4A 1O5EH 1YPHE 2XC4A 3H7OA 1F0UA 2PUXB 5LGOA 1P3CA 2THFB 5FHTA 1DX5M 1SB1H 2P3TB 1LCYA 1AFQC 4ABIA 1O39A 1LO6A 2CHAC 3TLOA 2PSYA 3M36A 4ZXXH 3RXCA 1EB1H 5AFZH 1TRMA 2STAE 3ITIA 3GDUA 1MU6B 5FX5A 2FLRH 4I8JA 3LOXA 1SOTA 1KLTA 1SI5H 1XVMA 3JZ1B 3VEQB 1GI5A 4NIVA 3RP2A 5EG4A 4ABAA 3A7XA 2AGGX 3FP6E 4X2WA 2QIQA 1GCTB 2AMPA 3BTQE 1HXFH 1VCWA 2ILNA 4WVPE 1HBTH 3UNSA 3HKJB 1K1JA 4FUIA 5C3NA 5HM9A 4ASHA 1BHXB 3KGPA 2HGTH 2VVVA 3NZIA 3NCLA 4K1EA 4MPUA 1GJ4H 2VB0A 4AFQA 1QBNA 1YPHC 4KTCA 3ENSB 2F9UA 4GCHG 3IITA 2ZDMA 3SU3A 2ZHDA 2B0FA 4ISHH 1TAWA 1WTHD 3GCTF 3M7QA 1NPMA 3O8DA 4NZLA 1TBQH 3FFGA 3LGYA 4CR9A 1QJ7B 1AKSB 1DWDH 1P8VC 1HV7A 1AN1E 3HPTB 5B6OA 1BMNH 2BD3A 3MHWU 1QTFA 1XXFA 2GCHG 1BTUA 2BXUH 1CT2E 3STIA 1GWAA 2XBVA 1MCTA 3KCGH 1TMUH 1INCA 1T8NA 2EI7A 2BD7A 1GMDG 1GMHG 1AUTC 5EXLA 3MU5A 3MMGA 4K8BA 1C5XB 1K9OE 3BTKE 4F4OC 4FUEA 3RXUA 3RLYH 2C8YB 3SU2A 4E7NA 1Z8IB 1CU1A 1F5KU 1VJ9U 1H8IH 4WF8A 3LH3A 5C2ZA 2P16A 3AAUA 4LOYH 1AFQB 2CN0H 4M7GA 1AVXA 2FOMB 2CHAB 4KTUA 3A7TA 1BRUP 5I25A 3UR9A 2R2MB 4GLYA 1TPPA 1HGTH 3DFJA 3QWCH 3K6ZA 3WY8A 4MNWA 1RRKA 3LT3A 1A61H 1KTTB 4IS5A 5J4SA 1O35A 3RXBA 3A7VA 3AVZA 2R3UA 1VR1H 2RG3A 2FOBA 1MAXA 2VNTA 1V2QT 1OWHA 3B8JA 5JDUB 1GBTA 4UFEH 4LZ1H 2UUFB 4JYTA 5TCAA 2SNVA 1HAHH 2VWNA 2WV5A 1ELBA 4YLQH 4BXSA 1HAOH 2FTLE 1O2HA 2A7HA 4AOQA 1Z6EA 1G36A 2Y5HA 3GICB 2O8UA 1UTJA 4ESTE 7GCHG 1AD8H 2H2ZA 3BN9A 2FOHA 5EODA 3NKKA 1AWHB 4CRGA 5A2MH 4MPWA 3SN8A 1P05A 2IN2A 1EJAA 2FPZA 1OWDA 2LNCA 2OQUA 3PMHB 1YPEH 4FU8A 4U30A 1O5AB 1P06A 1ARBA 4NFFA 4Q80A 2IPHA 4Y7AA 1OP0A 1THSH 1DITH 1Z6JH 1GGDC 1FY3A 1PQ8A 2STBE 3BF6H 2PFEA 2NU3E 3ELAH 3TJNA 1WQSA 3RMLH 4ABHA 4K3JA 1JRSA 5DP7A 1C9PA 1T4VH 1C5SA 4FUGA 4XOJA 3SNEA 1XXDA 2BTCE 4LK4A 2BY8X 4DVAU 3ZZ4A 3VB3A 1PYTD 1C5LH 1RJXB 1GBAA 1YCPM 2VINA 5ETXA 5E2OA 1QL9A 1TALA 1E0FD 1UHBB 1BRAA 2BXTH 1AVWA 2G4UA 1SQTA 3UQOA 5EQRA 2XC5A 3GCNA 2ZHFH 1YLDA 1TGTA 1AZZA 4CHAC 1AU8A 1MD7A 4FUFA 1X7AC 1C5ZB 1XUJA 1FV9A 3MNXA 1ANEA 3QK1A 1HIAA 5DG6A 1N6YA 1Y3YA 1SG8B 1PPBH 1QL7A 3AW1A 1SGEE 2WUBA 4JMYA 2BZAA 4K2YA 2JH0D 1C2HA 4HFPB 4Y6DA 3H5CB 1P2MA 1GI4A 2EI6A 3M3TA 1ESBA 4MVNA 1DANH 2XBXA 3URCA 2BZ6H 1KY9A 2G00A 2HNTF 2O8MA 4I31A 2VH0A 3LPRA 1EJNA 3O8CA 2ZZUH 1O2YA 5GCHF 2PW8H 1GBFA 1Z7KA 1EJMA 2D1JA 1YPMH 1XKBC 1J9CH 4Y71A 1ARCA 1QGFA 1P12E 4XBCA 1UVOA 1HXEH 4CH8B 3A8BA 2AS9A 2H9EH 2ZDVH 3PLBA 4A92A 1C5MD 1LPZB 4YOJA 6GCHG 1NU9A 1F5RA 1MU8B 1SHHB 1HAYB 1GBMA 3ATMA 1SGCA 4ZHLU 1MQ5A 2GCHF 3LJJA 2BVRH 1KYNA 2HNTC 1JBUH 1FLEE 2AGEX 5C1XA 3M5LA 3RUOA 2KAIA 2XNIA 3QDZB 1GMDF 1YYY1 5E2PA 1F0RA 5L6NH 4E7RG 3K65B 2FIRH 2Y6TA 2ZPSA 4CR5A 3MYWA 3SGBE 4X6PA 1Z1JA 2W7SA 2B5TB 4KP0A 1N1LA 1GBJA 4CRDA 4J2YB 1FUJA 1TGBA 4ZHAA 1CSOE 1J8AA 1ID5H 5TCCA 1K21H 2Q6DA 1P57B 3ZVCA 1CA0C 1BA8B 4WH8A 3URDA 2QF3A 2XWBI 4H4FA 1TQ7B 4U32A 3MFJA 4MNVA 2A31A 5L2YH 1V2ST 1GHYH 3BTHE 1G3BA 2OXSA 2SGPE 2P95A 4FU7A 1FY5A 4Z0KA 1O3HA 2VH6A 1QJ6B 4JYUH 1XMNB 1LHGH 5EXMA 2BVSH 1DSUA 4NSYA 1P11E 3KQEA 2FO9A 4TPIZ 3STJA 3A84A 3I29A 2BDAA 1C1RA 2WYGA 5DP6A 3FP8E 1OYTH 2Y80A 1KDQA 3BG4C 3LGIA 1F0SA 3PTNA 2BQWB 1SC8U 1T32A 2ZPRA 1S6FA 1QB6A 1UK4A 1A46H 2BD8A 3F9HA 1B0FA 1J15A 3SJKA 5BPEA 1GBCA 3RU4E 4A5TS 1O5GH 3ZZ5A 4OGXA 1NS3A 2QXGA 1GI3A 1BOQA 1MTWA 1YCPH 1ZGIA 3Q3YA 3QO6A 1Y5AT 1TABE 1ZHPA 5HMAA 1M9UA 1MTVA 4FVDA 3BTTE 1HAIH 1FN8A 2B8OH 3CP7A 3VGCC 1G32B 3IG6B 3T28A 4GPGA 5EPNA 1QRZA 1TQ0B 2FOAA 2FZZA 1SGIB 2FDAA 2AFQB 1UTOA 4I32A 3P17H 4YTAA 1A7SA 3UWJH 4LXBH 2FEQH 2WPJS 1TA2A 1WV7H 1CA0B 5EOKA 1L2EA 4XFQA 1XKAC 4JZ1A 4YLUA 2H1UA 4AZ2B 1O5BB 1ANDA 1QBVH 3K6YA 5L30H 2JETB 1ACBE 3QTVH 4NA8A 3SW2B 1FIZA 1AFEH 2GV6A 1YP9A 1EP6A 4WXVA 2QV1A 1O38A 4DT7B 1S6HA 5AF9H 3SZNA 4Y79A 2A4GA 2ANKH 1TLDA 3BV9B 1KXCA 1BITA 1AI8H 1W11U 1DY9A 3P8GA 3M3SA 1TFXA 3PLPA 3TVJB 2XYAA 4Y0YE 1VGCC 4MTBA 4YT7H 3S69A 2QXHA 3FANA 1OWKA 3UPEA 3BG4B 2BY5X 1ELDE 1O3GA 1S0QA 2RDLA 1IQIA 2CF8H 2A1DB 2ZIQH 3NWUA 4X8UH 1DWEH 1ZJKA 2GD4B 3AW0A 1TBRH 1ELGA 4TWWA 1FZZA 4AGKA 1BRCE 1FONA 1GDNA 5FX6A 3F6UH 4X1RU 1AB9C 1DDJA 3HGPA 5F8ZA 3T27A 2Z94A 2BDCA 1K2I1 4X1SU 3I77A 2F83A 2SGFE 1SL3A 4X8TH 3RMMH 1DE7H 3GCHC 1O3EA 3RXKA 1C1NA 1KXAA 1NFWA 1RIWC 1FNIA 3PMAB 3LKWA 5GIBA 3N7OA 1CGHA 1QQ4A 3LGTA 2C93B 1V2NT 1TMBH 3SHAH 2C3SA 5DP9A 1CVWH 2BD4A 2GZ8A 4O97A 1SSXA 1GI7B 4K8YA 3TH2H 2SGEE 6GCHF 2G4TA 3OSYA 2ZWLH 2FODA 1WSSH 1UK3A 2QXIA 2Z3CA 3MH4A 1EZQA 9ESTA 1QRXA 1A4WH 1GHBG 2Y82A 1WBGB 3ATWA 1HJ9A 1LPGB 2C90B 2Y81A 1L0ZA 1C5NH 1LHEH 1ZYOA 2BY6X 4DURA 3V12A 1PPZA 3S9BA 1NRRH 4U2WA 2SFAA 3ZZ9A 2QGRA 2ANYA 3E91A 4I8HA 1N8OC 5AFYH 3U8OH 2ZCLP 1DICA 3BTDE 3A89A 1UTQA 2EC9H 2RA3A 1MUEB 1HIAB 4GAWA 3M3VA 1GVKB 4BAKB 5EW2H 1GI2A 1S83A 2ODQA 1L4ZA 1SGNE 1XUKA 1JOUB 1YKTA 2ALPA 1CA8B 2SGAA 1C1QA 1VGCB 1O34A 1O2LA 2FOFA 1BTHH 4X2YA 4RN6A 4CRBA 4FUDA 3LONA 1GBIA 2WUCA 2A7JA 3E3TA 2Z9IA 4XE4A 1J17T 2Z7FE 1BZXE 2Z6BD 3U98H 2P93A 1TNKA 1PQAA 2GMTB 1KXFA 2TRMA 1IOEA 3SGQE 4ABFA 3S7HB 3RXDA 1AB9B 1ESTA 4TYDA 2Z9LA 4E05H 4QT8C 1GMCG 3M5MA 3TJVA 1A5IA 7LPRA 2PGQB 3W95A 2ALVA 4BXWA 3SJIA 5FCRA 2PTNA 3GCHB 2OBOA 3VB4A 2GT8A 2Z3DA 4ZXYH 3KQBA 4RKJB 1RIWB 3P8FA 1O3BA 1ZSLA 1XUIA 1ZMNA 1LHCH 1O37A 3A85A 4ZKRU 5EXNA 1AZ8A 1O3FA 1LTOA 1YC0A 2ZC9H 3SBKA 4O9VA 1EP5A 1EPTA 2UUKB 2UWOA 2ZG0H 1TGCA 3EDXB 2NU1E 1JRTA 4D8NA 2KAIB 5EQQA 4ZKNU 5CHAB 5F03A 3PB1E 4GHTA 1TX6A 4WY3A 3MNCA 1UTNA 1GBDA 1SBWA 1EAUA 3SUGA 2AGIX 4AYVB 1SGTA 5HM2A 4D7FA 2VIOA 1N8OB 1A3BH 3RXPA 4OS7A 1C1OA 1PJPA 3U9AH 3ZYDA 4BAMB 1B5GH 1O5DH 1IQJA 2A32A 1AO5A 2P3UB 1QR3E 4K1TA 3BEFB 4BANB 3LJOA 1O3CA 1YPLH 1AWFH 1Z71A 4ABDA 1DM4B 2ZFFH 1JMOH 4K1SA 4ZKOU 1BMAA 3UNQA 1Z1IA 3C1KA 3KHVA 5DGJA 4ZHMU 2ZHWH 3ESTA 5FBEA 3RXOA 5AVDA 2ZFSA 3ZZCA 1P2OA 1RXPA 5A8ZA 4TWYA 1VITH 2A5AA 1V2VT 4X8VH 3EYDA 2TIOA 3MWIU 2M5TA 2CMYA 4UFFH 3ZZ7A 4A1TA 3QUMP 1EOJA 2XBWA 1XVOA 4DJZB 1XM1A 2R3YA 1BQYA 1K1OA 5DJ7A 1O2TA 2JH5D 1PPCE 2F3CE 3M7UA 2HWLB 1NU7B 1RS0A 1KLJH 1MMJN 3ZVDA 1KDQB 1O2SA 1JIRA 1CBWC 1QQUA 3BSQA 3Q00A 4ZH8A 3F9GA 4OS2A 2PWXA 3FAOA 5E0HA 2F9NA 2ZU3A 1W7GH 2ZO3H 1AIXH 1HJ8A 1OKXA 1QJ1B 3I78A 2ULLA 2SGDE 1NM6A 3SU6A 4E06H 1GHWH 3B23B 1W0YH 1V2TT 5CMXH 2ZU2A 4LZ4B 4O3TA 1O2VA 3A81A 2F91A 2Q6FA 2PKSC 1GJDB 1P09A 1MBMA 3P6ZB 7KMEH 1TA6A 5DP5A 1GBKA 3EA9A 3ZZDA 1PPEE 2GDDA 4OS1A 5I46H 3QGNB 3A8DA 1XX9A 4BTUB 2XC0A 1GHBF 2YNAA 1A3EH 2BQ6B 2AMQA 2BX3A 1CE5A 5ESTE 3RC6A 4NCYA 1AHTH 3O8BA 3SO3A 5FBIA 8LPRA 3RXHA 3ZZAA 5JB9S 4CBNA 2GDEH 1O2WA 1SQAA 1EAXA 2GKVE 1OWJA 2VIDA 1FQ3A 4AFSA 5LPRA 2RCEA 1O30A 3O8RA 1C5WB 2W7UA 3RLWH 7ESTE 1LVYA 2IOTA 3TGKE 4B2BA 4OS5A 3SUEA 2JH6D 2VIPA 3GY4A 4Q7YA 1O2OA 1G30B 3KQDA 3KL6A 4ZUHA 5A0AE 2BLOA 1HAZB 1CBWB 4WXIA 3VB6A 4INHA 4CREA 1C2KA 2G55A 3PV4A 3ZVFA 5L2ZH 1DS2E 1K22H 1UTMA 3VB5A 1O2XA 2BD2A 1GMCF 2GCTC 1FY1A 1GHAG 2Q6GA 1DXPA 1SGRE 4INKA 3TIUA 2SNWA 4VGCC 5E0GA 1AE8H 4I33A 1JXPA 3ATKA 3RXVA 2FYRA 5FAHA 1L4DA 2OCVB 1EZUC 3E0NB 3BG8A 1MQ6A 3RXMA 1BRBE 3MU1A 2PKSB 3U8RH 2EI8A 1C1MA 1P03A 1ZHRA 1CT0E 1CHOG 2DE9A 3QGJA 2F9BH 3BEIB 1C5VA 1CGJE 1FPHH 1EPTC 1ELAA 3GDSA 3SNAA 1O3PB 1ANCA 3E0PB 1MZAA 3GY6A 1S82A 1D3TB 3ZZBA 1EXFA 2QN5T 1C5RA 1BTZA 1RGQA 1TPSA 1VZQH 1TOCB 1PFXC 1TONA 1AUJA 1BTPA 1GVZA 1VITG 3W94A 4Y8YA 4IMQA 2PLXA 2R0KA 1QY6A 1GHXH 4YO9A 1O3DA 1KIGH 4WH6A 1BT7A 3A8CA 8GCHG 4U01A 2HPPH 2ZU5A 2HRVA 1SMFE 1WAYB 1D3QB 2TPIZ 1HLTH 5A0BA 3LC5A 1P02A 1UK2A 1Z8JB 1Z8GA 3EA8A 1ZMJA 4ZMAH 4AGJA 2AIPA 2A7CA 1TX8A 1O2JA 1EQ9A 4DGJA 2F9PA 1O5CB 3SU5A 2Z9KA 1GG6C 1HAXB 2ZU4A 5T6DA 2FYQA 3BTME 1UVTH 3SORA 3PWCA 1E35B 3SGAE 3F9FA 1B7XB 4GCHF 4ZAEA 1MBQA 2QA9E 2NU4E 3QTOH 2BY7X 1BIOA 4FUHA 1O2RA 1DWBH 1GGDB 1SFQB 2F9OA 1Y3WA 5H4IB 2ZTZA 1P2NA 1TRNA 3G01A 3E16B 1ZTJA 1W14U 1K1NA 3K9XB 1YGCH 3L3TA 2V3HH 5C5OA 2CV3A 1XUFA 1EZSC 2VGCC 2ZTYA 4B76A 1KXEA 4TY7A 3LH1A 1QBOA 2FI3E 4YOGA 1S0RA 3KEEA 1GMHF 5C1UA 1HAGE 5F8TA 4UDWH 4I7YH 4K60A 3ZZ6A 1EPTB 1MAYA 1NN6A 1VJAU 4CHAB 3SNBA 1QB9A 2BLQA 3VXEH 1TPOA 2O8WA 1ZPZA 3KQCA 3A82A 2VVUA 5DPAA 3RXIA 2OINA 1MZDA 1EASA 2BDBA 1C1VH 3SU1A 2BD5A 1H8DH 1O2ZA 1C4Y2 3SV7A 1MTNC 1BB0B 2ZHQH 4BAOB 3P70B
chains in the Genus database with same CATH superfamily
3D23A 1O2GH 1KLIH 1O3JA 2JDID 2ZI2H 2VIWA 1ZTKA 3OX7U 5IK2D 1GPZA 3V0XA 3ZZ3A 2OQ5A 1F7ZA 3M5OA 3GY8A 4MPXA 4BAQB 3SV2H 3A80A 3RMOH 2A45B 4GUXA 2ZEBA 4UFDH 3DFLA 1QA7A 3SNDA 1E38B 1GG6B 5CE1A 2ZA5A 1C9TA 3RXJA 1UVUH 1QB1A 1IQKA 2J9NA 2GZ9A 2LELA 1FI8A 1C1UH 1C2DA 1C2EA 3FVFB 4ISOA 1ELEE 3TK6A 4CH2B 2J95A 1O33A 2ANWA 2C8WB 2AERH 4MNXA 4B74A 7GCHF 1WCZA 1QFKH 2FWWA 1HJAC 2XCNA 3DHKH 2V3MA 2WINI 5A0CA 3PWBA 1NC6A 2ZDAH 2I6SA 3TJUA 1HUTH 2O8LA 3T2NA 3GY5A 1ABJH 2DE8A 2WSSD 2V3OH 1FN6A 2WPMS 4D76A 4X1NU 3SU0A 2QY0B 1TPAE 2ZGJA 4ABEA 1HFDA 4UFGH 1Y3VA 4BOHA 8ESTE 2TGPZ 2J5UA 1AMHA 1J16A 2FI5E 1O0DH 1ABIH 2DUCA 1MH0A 1WDIA 4TSFD 3TITA 2ZHEH 3E8LA 1O2NA 4AX9H 9LPRA 1O2KA 1SFIA 3Q3KA 1TNHA 2Y5FA 3TH4H 3U69H 1IQLA 4WJG2 2ZCHP 1NRQH 4YOIA 3V7TA 5DP8A 1CHOF 2A5KA 1IQHA 2XTTB 3PLKA 2J97A 3UQVA 4MLFB 3QLPH 1ZZZA 1O2QA 1BCUH 1HAVA 1LVOA 3MNBA 2VWLA 5CDFE 3Q76A 1EUFA 3S9CA 1KTSB 2ZQ1A 1UCYE 2PSXA 1ZR0A 2ZFTA 4Q7ZA 4NIXA 2KX4A 1VITF 3SV8A 1FAXA 1FPCH 2BMGB 1C1WH 3ZVEA 3MH5A 1MTUA 2EEKA 2QF0A 2ODYB 1AQ7A 1HB0B 6CHAC 8GCHF 4KTSA 3GYLB 4A1XA 1FY4A 2M2AA 4FU9A 3MH7A 1O2IA 3H7TA 1GL0E 3MU4A 1GI0A 1WYKA 1OHHD 2ZKSA 1C1SA 3PM3A 4TT3D 4IC5A 1EAWA 2C4FH 2GGVB 3PROA 3UAIC 1W8BH 1T8OA 1GI8B 1F0TA 1A5HA 1GJ6A 2GVFA 1H8HD 4ISIH 4HGCA 1AY6H 1ZTLA 4DW2U 1C2JA 3JZ2B 5FPSA 1PQ7A 1P2IA 1DLKB 1QCPA 2J4IA 2CGAA 1P2JA 1QA0A 2ZGHA 3P95A 1DT2A 2BDYA 2VJ1A 4X1QU 3ATLA 4BAHB 1GI1A 2UUYA 3A8AA 5G4BA 3VGCB 1GJCB 2BOKA 1LQDB 5EGMA 2KR7A 3TH3H 1BUIA 1WTGH 4Q7XA 4XSKU 3EAJA 5JPMH 4ASUD 1G3EA 4MG3A 1W13U 1DUAA 2FESH 1C1PA 3UFAA 1CO7E 2G8TA 5EW1H 2P8OC 1DOJA 4Y11E 3RMNH 3LC3A 1BTXA 3ODDA 2YNBA 2XBYA 2XCFA 2ZF0H 3LGUA 1LKAA 4BTTB 3RXRA 2L74A 1NFYA 1V2JT 2FOEA 5E0JA 2ZCKP 1LPKB 5SGAE 1O36A 3RM2H 1LKBA 5EU8A 1V2UT 2Q1JA 5IYTA 3LGVA 1C2LA 2Z9JA 4UD9H 3DD2H 1IQGA 1S81A 3D65E 1ETSH 3M37A 1TIOA 3A83A 2H6MA 2GV7A 6ESTA 5EPYA 1TNJA 1GCDA 3SHCH 3MO3A 5JYIA 1P2QA 3DT0H 4SGAE 2H5CA 1OWEA 1AGJA 2G5NA 1A1RA 3MTYA 3QZQA 3SI3H 6CHAB 3M35A 1SGPE 1VCQA 1QIXB 3R3GB 4I8GA 1PPGE 3RXFA 4NWLA 2KZ4A 4AB8A 4MNYA 3TNSA 4DT4A 2WV4A 1GCTC 5T3HA 4FUCA 4JK6A 4NG9H 3AASA 1SGDE 1EB2A 1TRYA 5AHGH 5A8XA 8KME2 1XUGA 4FXGH 1ZPCA 1FIWA 3N7EA 2ZDKA 3NK8A 1C5QA 1YPJH 1YPGH 3RDZA 2PKAA 1W0ZU 2H5DA 4JZDH 2ODPA 2Z3EA 3SV9A 1F92A 1V2RT 1V2WT 2OC1A 3KN2A 3M7TA 5DN6D 3KYFA 3RXAA 4OS6A 1ZHMA 1PYTC 5K7RA 1D9IA 3RXGA 1IHSH 3F2GA 5DK1A 2W26A 3EA7A 1TOMH 5LPFA 1C2GA 3FP7E 3T25A 1HNEE 1P10A 2QF4A 3RXTA 2XWAA 4JZIA 3A87A 1HAPH 2P8OB 5C17A 1SLUB 3MNSA 1C5YB 1GBLA 2GP9B 3OY6U 5A8YA 4Y8ZA 3UUZA 1O2PA 4D9QA 2OBQA 2K0QA 3P8OA 2EQNA 1IQEA 1RTFB 2AEIH 2BDGA 4WMDA 5DKMA 4HZHA 2J34A 4H6TA 3CS7A 1K1PA 3DCLA 4R0IA 2ZDLA 4OS4A 4DOQA 3A7YA 1WU1A 1LHFH 4NSVA 4JZFH 1GJ5H 1SGFG 1UCYK 4ABJA 1NROH 3BTEE 1UCYH 1H9LB 1Y5BT 3L6PA 3RU4D 4X0WU 1P2KA 3ZVAA 1SOZA 1TX7A 3OFND 2FXRA 3F0PA 4NA7A 3T26A 4X2XA 4GVUA 5TJXA 1GJBB 3PMJA 3MI4A 3K2UA 2BVXH 4IN1A 1O2UA 1QRWA 3RC5A 1SGYE 3VPKA 2J2UA 2ASUB 3ZVBA 3A7WA 5GCHG 1NFXA 4B75A 1SLWB 3E90B 2IJOB 1DVAH 4MPVA 5J4QA 2BLWA 3NPSA 4XDEA 3KNXA 2FI4E 4I8LA 1GJ9B 3IWMA 1OWIA 2KCAA 4GHQA 1GHVH 4NZQA 3R0FA 2ZPQA 1CQQA 1H4WA 2ESTE 1HYLA 1SGFA 3MU0A 3UWIA 2TGTA 3TJOA 2LPRA 2GZ7A 1BMMH 3SV6A 4F49A 3SNCA 3U1IB 1BMLA 2JJ2D 4KELA 4B73A 2BYAX 3TK9A 4INLA 1AE5A 2G52A 1GL1A 3U8TH 1T7CA 2UWPA 2Y5GA 2BDHA 3LDXH 1BTYA 2OD3B 1DPOA 5K0HA 5GWZA 1BTWA 1YLCA 2XW9A 4ISNA 5EJZA 5DP3A 1WQVH 1DXWA 3TGIE 2A4QA 3UREA 1EKBB 5GXPA 1CT4E 3RM0H 4NIWA 5KECA 3ZV8A 1DLEA 5T6GA 1IHTH 5E8EH 2WHXA 3SOSA 4YZUA 4FUJA 4NA9H 4YM9A 1TMTH 3MO6A 1V2OT 1T31A 4Q2KA 2R9PA 4UE7H 1A5GH 2A2QH 1P9UA 1XUHA 1O3LA 1HAVB 1ZGVA 1C2IA 3RU4T 1LVBA 1ZSKA 1G3CA 1GBHA 1LVMA 2WPLS 3NUMA 2V6NA 3D62A 4X2VA 1UTKA 3GDVA 4X8SH 3FOAA 2G81E 2RA0A 3MU8A 5PTPA 1IAUA 3GCOA 1NRSH 3TK5A 1D4PB 1A0LA 4B2AA 3U1JB 1EOLA 3MO9A 1Z8RA 1NTPA 1EX3A 1NY22 1P3EA 4ABGA 1E79D 3T29A 4AG1A 3SU4A 1THPB 5F6MA 2SGQE 1KXBA 1OXGA 1G2MA 3GISB 2AIQA 3OYPA 4NWKA 4X1PU 2XXLA 5EIYA 1C4U2 1HPGA 2ZQ2A 2VWOA 4FOUC 4TY6A 1Y5UT 2BQ7B 3BTFE 1ZSJA 3F2HA 3SJ9A 4B71A 1TNIA 5LPEA 1UVSH 3NXPA 4IGDA 4X6OA 1FJSA 3SQEE 1MABB 1O32A 2WPKS 5LH8A 1LQEA 3TPIZ 4O3UA 1ESAA 2BLVA 1FAKH 1W0KD 1MD8A 4IC6A 1TB6H 3BTGE 1V2KT 2AMDA 3PRDA 3ZYEA 1NO9H 3TGJE 1QL8A 2FP7B 2L6OA 1ETTH 2D8WA 2GT7A 1GI6A 1RD3B 3SI4H 2I6QA 2Y7XA 3MH6A 3OEED 3T5FH 2GTBA 2KM0A 2ZNKH 4DIIH 2CJIA 1G2LA 5ESBA 1NRNH 1J14A 2WV9A 1OPHB 2P59A 2VWMA 3UOPA 1GHZA 1C2MA 1L1GA 2C8XB 1MTSA 2NU2E 2BM2A 4IN2A 3RXQA 3N99A 5DSFA 1Y3UA 5GDSH 4M9FA 1PPFE 2R2WU 2V7QD 2WPHS 3HK6B 1YM0A 1BDAA 1QHRB 4WWYA 4D7GA 2D26C 4FUBA 4AFUA 1C5OH 4NGAH 2J94A 4K5ZA 4CRAA 2FOGA 3UOUA 2BHGA 3CNRA 4DG4A 1OSSA 3KIDU 2HPQH 2PHBA 5BRRE 3OY5U 5GPIB 2HNTE 4Z1MD 4H6SB 4TPYA 1O3AA 5GJ4B 4OM9A 1O2MA 4ZKSU 2FS8A 1V3XA 1PQ5A 1JWTA 4XBBA 2HLDD 2OUAA 3RXLA 2GCTB 1ZPBA 3BTWE 3GY7A 1B0EA 4VGCB 2EY4C 3Q3XA 2OC7A 2EA3A 2PKAB 1TGNA 2ZP0H 4WMEA 1TBZH 3H09A 1P9SA 1D3DB 3P8NA 1ANBA 1OYQA 4A6LA 2KCYA 2FOCA 2WYJA 1UW7A 3MOCA 1O3OA 2ZFQH 3LIWA 4KGAA 1OX1A 3SYJA 4ABBA 4RI0A 4BNRA 1L1JA 2O9QA 1FY8E 1GBEA 1V6DA 5JBAS 2NU0E 4THNH 2Z9GA 5HYOA 3AAVA 4AORA 5C20A 1W2KH 1SLVB 2PR3A 3BEUA 2HALA 5JBCS 4PROA 2XRCA 4NIYA 3ZVGA 3LU9B 1EAIA 2BDIA 3S0NA 1O3MA 1IQNA 1NZQH 2BX4A 3P92A 1P04A 1GJAB 1UTPA 4WMFA 1DUEA 1KMHB 2PUQH 3QX5H 5JB8S 1AVGH 1K28D 2FM2A 4Y7BA 5EJ1A 1A0HB 1QNJA 2FX6A 3PTBA 1UVPA 2OP9A 3S9AA 1DWCH 4D9RA 1ELCA 1G3DA 4YT6H 2O8TA 5FPTA 4DCDA 2CF9H 3EE0B 2OC0A 4XBDA 4MDSA 3CENA 4Z6AH 2TBSA 4JK5A 2TGAA 2OC8A 5C67A 4B1TA 2JETC 1HCGA 1V2MT 2OLGA 3Q77A 2J92A 2ZFRH 2J38A 3E6PH 3BIVH 4J1YA 1NT1A 4CRFA 1ETRH 3F68H 1T4UH 2BOHB 2ZTXA 1UTLM 2VIQA 4B2CA 1C5UA 1K1IA 1SVPA 1THRH 1F5LA 5FCKA 1SPJA 4SGBE 1ZRBA 1GVLA 3BIUH 2B9LA 3VXFH 3TNTA 2JKHA 1WOFA 1G9IE 2TGDA 5T6FA 2F9VA 1KXDA 2HLCA 3QN7A 1AKSA 1BBRE 1FDPA 1G37A 1TYNA 4P00A 1UO6A 1GBBA 2QE7D 2A5IA 2G51A 2VGCB 2V35A 3PV2A 3HK3B 2GX4A 1L1NA 2ANMH 1C5PA 4JCNA 2XNDD 5C5NA 3TU7H 4AN7A 1GHAF 3DA9B 4DY7B 3B9FH 3M5NA 4YESB 1BJVA 2PP6A 4IW4E 1W10U 1YCPK 2HVXA 5F8XA 6LPRA 2ZDNA 5EQSA 1C5TA 4A7IB 2W3IA 1FXYA 1S85A 2C8ZB 2K1QA 1EZXC 1MTNB 4KKDA 2FMJA 4X6NA 3UB0A 1W12U 3ODFA 1GDUA 1Y8TA 3LGWA 5IDKA 1HDTH 1Y59T 3KYGA 1A0JA 3L33A 1UJ1A 1IQFA 1N6XA 2AH4X 3GY2A 4MQAA 3V13A 2W3KA 3DUXH 4JZEH 3E1XB 2FS9A 1H9IE 3RXEA 3OTJE 1LMWB 4Y0ZE 1YY3A 3VFEA 1C4V2 1K1LA 1S5SA 2H9HA 2G5VA 2NWNA 4Y76A 1H9HE 4K69A 1KSNA 3HGNA 2ZU1A 1NESE 1ZMLA 1O31A 4CRCA 2V0BA 2PV9B 3D49H 1NRPH 1C1TA 1ZJDA 4BTIB 2CXVA 1WUNH 2QC2A 3ZV9A 2KCPA 1UMAH 1ZRKA 1O3IA 4Y10E 2A4RA 2B7DH 4I8KA 3UNRA 3GOVB 2FTMA 5JBTA 2OTVA 2A0QB 3C27B 2QCYA 3QZRA 3GCTG 3S7KB 2FLBH 2W5EA 1HJAB 2BB4A 1Q2WA 2ZFPH 5T1VA 3PO1C 1P0SH 4AFZA 2VVCA 3DSGA 1Q31A 3F9EA 3SJ8A 3EGKH 4ISLA 4JYVH 3HKIB 1NBMD 3RC4A 1YBWA 3FZZA 3GYMA 2ZGBH 3KF2A 1GI9B 3SZEA 5FXLA 3GY3A 2ZGCA 1V2LT 4UONA 1D6WA 2GMTC 4B6FA 3SUDA 2BY9X 4HI3A 2XOKD 1OP2A 2ZGXH 2D2DA 5HGGA 1DFPA 1ELVA 3ATIA 1V2PT 2Y7ZA 3FZDA 2PGBB 1W0JD 3ZZ8A 1GJ8B 1ELTA 2QXJA 4Y8XA 5JBBS 2H9TH 1YPKH 2UUJB 3FO8D 3SJOA 1O3KA 1E37B 5C1YA 4X6MA 1NFUA 3RXSA 3SQHE 1P01A 4IBLH 3HATH 3UTUH 1YF4A 1O3NA 1SGQE 2QAAA 4AYYB 1OP8A 1UHBA 2AYWA 1MKXK 2WPDD 2A2XH 3WWBA 1MKXH 1DY8A 1RTKA 3UY9A 2VIVA 1TE0A 2FX4A 1E36B 4AG2A 3M61U 1D3PB 1SLXB 2A4OA 1LDTT 1JIMA 5CHAC 1HRTH 1T8LA 4P02A 1BHXF 1TNLA 2JJ1D 5A09A 1U6QA 2KCOA 1T8MA 1TWXB 3CS0A 1LHDH 1ZOMA 3F1SB 4H42U 1CHGA 3PYHA 5HXFA 3A7ZA 1K1MA 3UIRA 1TNGA 1OOKB 1A2CH 2ZECA 2UWLA 1S84A 1BMFD 1OS8A 1SR5C 4RSPA 3T62A 1Y3XA 4R8TB 2PTCE 1C2FA 4NFEA 4ZROA 4FVBA 3PO1B 1ZLRA 2P94A 2WPIS 3PMBB 1TGSZ 3SUFA 1GDQA 3A86A 4GSOA 1RTLA 1MKWK 3EQ0H 5ABWA 3UR6A 2QYIA 1MKWH 2W6JD 1H1BA 1DSTA 1GJ7B 3VB7A 3A88A 3OU0A 2YOLA 4CBOA 3V3MA 2VU8E 1F2SE 2HOBA 1PPHE 1BBRK 4YXWD 1EATA 1BBRH 1W7XH 4HTCH 1W3CA 1E34B 1O5FH 1RFNA 1Q3XA 5FPYA 4UEHH 1ORFA 2R0LA 1QURH 4RKOB 2P3FH 2BD9A 4AB9A 1FX0B 1SQOA 1MCVA 1CGIE 4A1VA 4DIHH 4O03A 4IMZA 1D6RA 4OGYA 5DO4H 1IQMA 1ELFA 1FMGA 1SHYA 1VCPA 1BJUA 5DP4A 1O5EH 1YPHE 4ACBA 2XC4A 3H7OA 1F0UA 2PUXB 5LGOA 1P3CA 2THFB 5FHTA 1DX5M 1SB1H 2P3TB 1LCYA 1AFQC 4ACAA 4ABIA 1O39A 1LO6A 2CHAC 3TLOA 2PSYA 3M36A 3PRBA 4ZXXH 3RXCA 1EB1H 5AFZH 1TRMA 2STAE 3ITIA 3GDUA 1MU6B 5FX5A 2FLRH 4I8JA 3LOXA 2YMSC 2K8IA 1SOTA 1KLTA 1SI5H 1XVMA 3JZ1B 3VEQB 2VBCA 1GI5A 4NIVA 3RP2A 5EG4A 4ABAA 3A7XA 2AGGX 3FP6E 4X2WA 2QIQA 1GCTB 2AMPA 3BTQE 1HXFH 1VCWA 2ILNA 4WVPE 1HBTH 3UNSA 3HKJB 1K1JA 4FUIA 5C3NA 5HM9A 4ASHA 1BHXB 3KGPA 2HGTH 2VVVA 3NZIA 3NCLA 3OEHD 4K1EA 4MPUA 1GJ4H 2VB0A 4AFQA 1QBNA 1YPHC 4KTCA 3ENSB 2F9UA 4GCHG 3IITA 2ZDMA 3SU3A 2ZHDA 2B0FA 4ISHH 1TAWA 1WTHD 3GCTF 3M7QA 1NPMA 3O8DA 4NZLA 1TBQH 3FFGA 3LGYA 4CR9A 1QJ7B 1AKSB 1DWDH 1P8VC 1HV7A 1AN1E 3HPTB 5B6OA 1BMNH 2BD3A 3MHWU 1QTFA 1XXFA 2GCHG 1BTUA 2BXUH 1CT2E 3STIA 1GWAA 2XBVA 1MCTA 3KCGH 1TMUH 1INCA 1T8NA 2EI7A 2BD7A 1GMDG 1GMHG 1AUTC 5EXLA 3F3BA 3MMGA 3MU5A 1C5XB 4K8BA 3WWFA 1K9OE 3BTKE 4F4OC 4FUEA 3RXUA 3RLYH 4RT0A 2RFKC 2C8YB 3SU2A 4E7NA 1Z8IB 1CU1A 1F5KU 1VJ9U 1H8IH 3U28C 4WF8A 3LH3A 5C2ZA 2P16A 3AAUA 4LOYH 1AFQB 2CN0H 4M7GA 1AVXA 2FOMB 2CHAB 4KTUA 3A7TA 5GNDA 1BRUP 5I25A 3UR9A 2R2MB 4GLYA 1TPPA 1HGTH 3DFJA 3QWCH 2YMSB 3K6ZA 4B6EA 3WY8A 4MNWA 1RRKA 3LT3A 1A61H 1KTTB 4IS5A 5J4SA 1O35A 3RXBA 3A7VA 3AVZA 2R3UA 1VR1H 2RG3A 2FOBA 1MAXA 2VNTA 1V2QT 1OWHA 3B8JA 5JDUB 1GBTA 4UFEH 4LZ1H 2UUFB 4JYTA 5TCAA 2SNVA 1HAHH 2VWNA 2WV5A 1ELBA 4YLQH 4BXSA 1HAOH 2FTLE 1O2HA 2A7HA 4AOQA 1Z6EA 1G36A 2Y5HA 3GICB 2O8UA 1UTJA 4ESTE 7GCHG 1AD8H 2H2ZA 5C94A 2AHME 3BN9A 2FOHA 5EODA 3NKKA 1AWHB 4CRGA 5A2MH 4MPWA 3SN8A 1P05A 2IN2A 1EJAA 2FPZA 1OWDA 2LNCA 2OQUA 3PMHB 1YPEH 4Q4LA 4FU8A 4U30A 1O5AB 1P06A 1ARBA 4NFFA 4Q80A 2IPHA 4Y7AA 1OP0A 1THSH 1DITH 1Z6JH 1GGDC 1FY3A 1PQ8A 2STBE 3BF6H 2PFEA 2NU3E 3ELAH 3TJNA 1WQSA 3RMLH 4ABHA 4K3JA 1JRSA 5DP7A 1C9PA 1T4VH 1C5SA 4FUGA 4XOJA 3GS9A 3SNEA 1XXDA 2BTCE 4LK4A 2BY8X 4DVAU 3ZZ4A 3VB3A 1PYTD 1C5LH 1RJXB 1GBAA 1YCPM 2VINA 5ETXA 5E2OA 5HIZA 1QL9A 1TALA 1E0FD 3DSPA 1UHBB 1BRAA 2BXTH 1AVWA 2G4UA 1SQTA 3UQOA 5EQRA 2XC5A 3GCNA 2ZHFH 1YLDA 1TGTA 1AZZA 4CHAC 1AU8A 1MD7A 4FUFA 1X7AC 1C5ZB 1XUJA 1FV9A 3MNXA 1ANEA 5C0UA 3QK1A 1HIAA 5DG6A 1N6YA 1Y3YA 1SG8B 1PPBH 1QL7A 3AW1A 1SGEE 2WUBA 4JMYA 2BZAA 4K2YA 2JH0D 1C2HA 4HFPB 4Y6DA 3H5CB 1P2MA 2J98A 1GI4A 2EI6A 3M3TA 1ESBA 4MVNA 1DANH 2XBXA 3URCA 2BZ6H 2YMSD 1KY9A 2G00A 2HNTF 2O8MA 4I31A 2VH0A 3LPRA 1EJNA 3O8CA 2ZZUH 1O2YA 5GCHF 2PW8H 1GBFA 1Z7KA 1EJMA 2D1JA 1YPMH 1XKBC 1J9CH 4Y71A 1ARCA 1QGFA 1P12E 4XBCA 1UVOA 3AK5A 1HXEH 4CH8B 3A8BA 2AS9A 2H9EH 2ZDVH 3PLBA 4A92A 1C5MD 1LPZB 4YOJA 6GCHG 1NU9A 1F5RA 1MU8B 1SHHB 3F2FA 1HAYB 1GBMA 3ATMA 1SGCA 4ZHLU 1MQ5A 2GCHF 3LJJA 2BVRH 2CK3D 1KYNA 1JBUH 1FLEE 2AGEX 2HNTC 5C1XA 3M5LA 3RUOA 2KAIA 5KEDA 2XNIA 3QDZB 1GMDF 1YYY1 5E2PA 1F0RA 5L6NH 3N7DA 4E7RG 3K65B 2OK5A 2FIRH 2Y6TA 2ZPSA 4CR5A 3MYWA 3SGBE 4X6PA 1Z1JA 2W7SA 2B5TB 4KP0A 1N1LA 1GBJA 4CRDA 4J2YB 1FUJA 1TGBA 4ZHAA 1CSOE 1J8AA 1YLNA 1ID5H 5TCCA 2KFWA 1K21H 2Q6DA 1P57B 3ZVCA 1CA0C 1BA8B 4WH8A 3URDA 2QF3A 2XWBI 4H4FA 1TQ7B 4U32A 3MFJA 4MNVA 2A31A 5F53A 5L2YH 1V2ST 1GHYH 3BTHE 1G3BA 2OXSA 2SGPE 2P95A 4FU7A 1FY5A 4Z0KA 1O3HA 2VH6A 1QJ6B 4JYUH 3VG8A 1XMNB 1LHGH 5EXMA 2BVSH 1DSUA 4NSYA 1P11E 3KQEA 2FO9A 1S6LA 4TPIZ 3STJA 3A84A 3I29A 2BDAA 1C1RA 2WYGA 5DP6A 3FP8E 1OYTH 2Y80A 1KDQA 4AC9A 3BG4C 3LGIA 1F0SA 3PTNA 2BQWB 1SC8U 1T32A 2ZPRA 1S6FA 1QB6A 1UK4A 1A46H 2BD8A 3F9HA 1B0FA 1J15A 3SJKA 2LP6A 5BPEA 1GBCA 3RU4E 4A5TS 1O5GH 3ZZ5A 4OGXA 1NS3A 2QXGA 1GI3A 1BOQA 1MTWA 1YCPH 1ZGIA 3Q3YA 3QO6A 1Y5AT 1TABE 1ZHPA 5HMAA 1M9UA 1MTVA 4FVDA 3BTTE 1HAIH 1FN8A 2B8OH 1QZ8A 3CP7A 3VGCC 1G32B 3IG6B 3T28A 4GPGA 4FETA 5EPNA 1QRZA 1TQ0B 3W1EA 2FOAA 2FZZA 1SGIB 2FDAA 2AFQB 1UTOA 4I32A 3P17H 4YTAA 1A7SA 3UWJH 4LXBH 2FEQH 2WPJS 1TA2A 1WV7H 3WW7A 1CA0B 5EOKA 1L2EA 3KQ5A 4XFQA 1XKAC 4JZ1A 4YLUA 2H1UA 4AZ2B 1O5BB 1ANDA 1QBVH 3K6YA 5L30H 2JETB 1ACBE 3QTVH 4NA8A 3SW2B 1FIZA 1AFEH 2GV6A 2F43B 1YP9A 1EP6A 4WXVA 2QV1A 1O38A 4DT7B 1S6HA 5AF9H 3SZNA 4Y79A 2A4GA 5B6LA 2ANKH 1TLDA 3BV9B 1KXCA 1BITA 1AI8H 1W11U 1DY9A 3P8GA 3M3SA 1TFXA 3PLPA 3TVJB 2XYAA 4Y0YE 1VGCC 4MTBA 4YT7H 3S69A 2QXHA 3FANA 1OWKA 3UPEA 3BG4B 2BY5X 1ELDE 1O3GA 1S0QA 2RDLA 1IQIA 2CF8H 2A1DB 3FKSD 2ZIQH 3NWUA 4X8UH 4I86A 1DWEH 1ZJKA 2GD4B 3AW0A 1TBRH 1ELGA 4TWWA 1FZZA 4AGKA 1BRCE 1FONA 1GDNA 5FX6A 3F6UH 4X1RU 1AB9C 1DDJA 3HGPA 5F8ZA 3T27A 2Z94A 2BDCA 1K2I1 4X1SU 3I77A 2F83A 2SGFE 1SL3A 4X8TH 3RMMH 1DE7H 3GCHC 1O3EA 3RXKA 1C1NA 1KXAA 1NFWA 1RIWC 1FNIA 3PMAB 3LKWA 5GIBA 3N7OA 1CGHA 1QQ4A 3LGTA 2C93B 1V2NT 1TMBH 3SHAH 2C3SA 5DP9A 1CVWH 2BD4A 2GZ8A 4O97A 1SSXA 1GI7B 4K8YA 3TH2H 2SGEE 6GCHF 2G4TA 3OSYA 2ZWLH 2FODA 1WSSH 1UK3A 2QXIA 2Z3CA 3MH4A 1EZQA 9ESTA 1QRXA 1A4WH 1GHBG 2Y82A 1WBGB 3ATWA 1HJ9A 1LPGB 2C90B 2Y81A 1L0ZA 1C5NH 1LHEH 1ZYOA 2BY6X 4DURA 3V12A 1PPZA 3S9BA 1NRRH 4U2WA 2SFAA 3ZZ9A 2QGRA 2ANYA 3E91A 4I8HA 1N8OC 5AFYH 3U8OH 2ZCLP 1DICA 4F48B 3BTDE 3A89A 5FL7D 1UTQA 2EC9H 2RA3A 1MUEB 2GJGA 1HIAB 4GAWA 3M3VA 1GVKB 4BAKB 5EW2H 1GI2A 1S83A 2ODQA 1L4ZA 1SGNE 1XUKA 1JOUB 1YKTA 2ALPA 1CA8B 2SGAA 1C1QA 1VGCB 1O34A 1O2LA 2FOFA 1BTHH 4X2YA 2J98B 4RN6A 3EE7A 4CRBA 4FUDA 3LONA 1GBIA 2WUCA 2A7JA 3E3TA 2Z9IA 4XE4A 1J17T 2Z7FE 4XRNA 1BZXE 2Z6BD 3U98H 2P93A 1TNKA 1PQAA 2GMTB 1KXFA 2TRMA 1IOEA 3SGQE 4ABFA 3S7HB 3RXDA 1AB9B 1ESTA 4TYDA 2Z9LA 4E05H 4QT8C 1GMCG 3M5MA 3TJVA 1A5IA 7LPRA 2PGQB 3W95A 2ALVA 4BXWA 3SJIA 5FCRA 2PTNA 3GCHB 2OBOA 3VB4A 2GT8A 2Z3DA 4ZXYH 3KQBA 4RKJB 1RIWB 3P8FA 1O3BA 1ZSLA 1XUIA 1ZMNA 4XD7D 1LHCH 1O37A 3A85A 4ZKRU 5EXNA 1AZ8A 1O3FA 1LTOA 1YC0A 2ZC9H 3SBKA 4O9VA 1EP5A 1EPTA 2UUKB 2UWOA 2ZG0H 1TGCA 3EDXB 2NU1E 1JRTA 4D8NA 2KAIB 5EQQA 4ZKNU 5CHAB 5F03A 3PB1E 4GHTA 2QF5A 1TX6A 2RDEA 4WY3A 3MNCA 1UTNA 1GBDA 1SBWA 1EAUA 3SUGA 2AGIX 4AYVB 1SGTA 5HM2A 4D7FA 2VIOA 1N8OB 1A3BH 3RXPA 4OS7A 1C1OA 1PJPA 3U9AH 3ZYDA 4BAMB 1B5GH 1O5DH 1IQJA 2A32A 1AO5A 2P3UB 1QR3E 4K1TA 3BEFB 4BANB 3LJOA 1O3CA 1YPLH 1AWFH 1Z71A 5KGOA 4ABDA 1DM4B 2ZFFH 1JMOH 1EFRD 4K1SA 4ZKOU 1BMAA 3UNQA 1Z1IA 3C1KA 3KHVA 5DGJA 4ZHMU 2ZHWH 3ESTA 5FBEA 3RXOA 5AVDA 2ZFSA 3ZZCA 1P2OA 1RXPA 5A8ZA 4TWYA 1VITH 2A5AA 1V2VT 4X8VH 3EYDA 2TIOA 3MWIU 2M5TA 1COWD 2CMYA 4UFFH 3ZZ7A 4A1TA 3QUMP 1EOJA 2XBWA 1XVOA 2JIZD 4DJZB 1XM1A 2R3YA 1BQYA 1K1OA 5DJ7A 1O2TA 2JH5D 1PPCE 4Q63A 2F3CE 3M7UA 2HWLB 1NU7B 1RS0A 1KLJH 1MMJN 3ZVDA 1KDQB 1O2SA 1JIRA 1CBWC 1QQUA 3BSQA 3Q00A 4ZH8A 3F9GA 4OS2A 2PWXA 3FAOA 5E0HA 2F9NA 2ZU3A 1W7GH 2ZO3H 1AIXH 1HJ8A 1OKXA 1QJ1B 3I78A 2ULLA 2SGDE 1NM6A 3SU6A 4E06H 1GHWH 3B23B 1W0YH 1V2TT 5CMXH 2ZU2A 4LZ4B 4O3TA 1O2VA 3A81A 2F91A 2Q6FA 1YWUA 2PKSC 5CHBA 1GJDB 1P09A 1MBMA 3P6ZB 7KMEH 1TA6A 5DP5A 1GBKA 3EA9A 3ZZDA 1PPEE 1E1QD 2GDDA 4OS1A 5I46H 3QGNB 3A8DA 1XX9A 4BTUB 2XC0A 1GHBF 2YNAA 1A3EH 2BQ6B 2AMQA 2BX3A 1CE5A 5ESTE 3RC6A 4NCYA 1AHTH 3O8BA 3SO3A 5FBIA 8LPRA 3RXHA 3ZZAA 5JB9S 4CBNA 2GDEH 1O2WA 1SQAA 1EAXA 2GKVE 1OWJA 2VIDA 1SQRA 3OTPA 1FQ3A 4AFSA 5LPRA 2RCEA 1O30A 3O8RA 5C0TA 1C5WB 2W7UA 3RLWH 7ESTE 1LVYA 2IOTA 3TGKE 4B2BA 4OS5A 3SUEA 2JH6D 2VIPA 3GY4A 4Q7YA 1O2OA 1G30B 3KQDA 3KL6A 4ZUHA 5A0AE 2BLOA 1HAZB 2F4LA 1CBWB 4WXIA 3VB6A 4INHA 4CREA 1C2KA 2G55A 3PV4A 3ZVFA 5L2ZH 1E1RD 1DS2E 4HG6A 1K22H 1UTMA 3VB5A 1O2XA 2BD2A 3OE7D 3PV5A 1GMCF 2GCTC 1FY1A 1GHAG 2Q6GA 1DXPA 1SGRE 4INKA 3TIUA 2IJD1 2SNWA 4VGCC 5E0GA 1H8ED 1AE8H 4I33A 1JXPA 3ATKA 3RXVA 2FYRA 5FAHA 1L4DA 2OCVB 1EZUC 2W6ID 3E0NB 3BG8A 1MQ6A 3RXMA 1BRBE 3MU1A 1NBME 2PKSB 3U8RH 2EI8A 1C1MA 1P03A 1ZHRA 1CT0E 1CHOG 2DE9A 3QGJA 2F9BH 3BEIB 1C5VA 1CGJE 1FPHH 1EPTC 1ELAA 3GDSA 3SNAA 1O3PB 1ANCA 3E0PB 1MZAA 3GY6A 1S82A 1D3TB 3ZZBA 1EXFA 2QN5T 1C5RA 1BTZA 1RGQA 1TPSA 1VZQH 1TOCB 1PFXC 1TONA 1AUJA 1WXRA 1BTPA 1GVZA 1VITG 3NRLA 3W94A 4Y8YA 4IMQA 2PLXA 2R0KA 1QY6A 1GHXH 4YO9A 1O3DA 1KIGH 4WH6A 1BT7A 3ZIAD 3A8CA 8GCHG 4U01A 2HPPH 2ZU5A 2HRVA 1SMFE 1WAYB 1D3QB 2TPIZ 1HLTH 5A0BA 3LC5A 1P02A 1UK2A 1Z8JB 1Z8GA 3EA8A 1ZMJA 4ZMAH 4AGJA 2AIPA 2A7CA 1K0HA 1TX8A 4F55A 1O2JA 1EQ9A 4DGJA 2F9PA 2HVYB 1O5CB 3SU5A 2Z9KA 1GG6C 1HAXB 2ZU4A 5T6DA 2FYQA 3BTME 1UVTH 4RT1A 3SORA 3PWCA 1E35B 3SGAE 3F9FA 1B7XB 3FN8A 4GCHF 5EJLA 4ZAEA 1MBQA 2QA9E 2NU4E 3QTOH 2BY7X 5HIYA 1BIOA 4FUHA 1O2RA 3DSOA 2IPQX 1DWBH 1GGDB 1SFQB 2F9OA 1Y3WA 5H4IB 2ZTZA 1P2NA 1SKYE 1TRNA 3G01A 3E16B 1ZTJA 1W14U 1K1NA 3K9XB 2WZQA 1YGCH 3L3TA 2V3HH 5C5OA 2CV3A 1XUFA 1EZSC 2VGCC 2ZTYA 4B76A 1KXEA 4TY7A 3LH1A 1QBOA 2FI3E 4YOGA 1S0RA 5HKKD 3KEEA 1GMHF 3OAAD 1HAGE 5C1UA 5F8TA 4ZCNA 4UDWH 4I7YH 4K60A 3ZZ6A 1EPTB 1MAYA 1NN6A 1VKYA 1VJAU 4CHAB 3SNBA 1QB9A 2BLQA 3VXEH 3MQKC 1TPOA 2O8WA 1ZPZA 3KQCA 3A82A 2VVUA 5DPAA 3RXIA 2OINA 1MZDA 1EASA 2BDBA 1C1VH 3F0OA 2BD5A 3SU1A 1H8DH 1O2ZA 1C4Y2 3SV7A 1MTNC 1BB0B 2ZHQH 4BAOB 3P70B
chains in the Genus database with same CATH topology
3D23A 1O2GH 1KLIH 1O3JA 2ZI2H 2VIWA 1ZTKA 3OX7U 1GPZA 3V0XA 3ZZ3A 2OQ5A 1F7ZA 3M5OA 3GY8A 4MPXA 4BAQB 3SV2H 3A80A 3RMOH 2A45B 4GUXA 2ZEBA 4UFDH 3DFLA 1QA7A 3SNDA 1E38B 1GG6B 5CE1A 2ZA5A 1C9TA 3RXJA 1UVUH 1QB1A 1IQKA 2J9NA 2GZ9A 1FI8A 1C1UH 1C2DA 1C2EA 3FVFB 4ISOA 1ELEE 3TK6A 4CH2B 2J95A 1O33A 2ANWA 2C8WB 2AERH 4MNXA 4B74A 7GCHF 1WCZA 1QFKH 2FWWA 1HJAC 2XCNA 3DHKH 2WINI 5A0CA 3PWBA 1NC6A 2ZDAH 2I6SA 3TJUA 1HUTH 2O8LA 3T2NA 3GY5A 1ABJH 2DE8A 2V3OH 1FN6A 2WPMS 4D76A 4X1NU 3SU0A 2QY0B 1TPAE 2ZGJA 4ABEA 1HFDA 4UFGH 1Y3VA 4BOHA 8ESTE 2TGPZ 1AMHA 1J16A 2FI5E 1O0DH 1ABIH 2DUCA 1MH0A 3TITA 2ZHEH 3E8LA 1O2NA 4AX9H 9LPRA 1O2KA 1SFIA 3Q3KA 1TNHA 2Y5FA 3TH4H 3U69H 1IQLA 4WJG2 2ZCHP 1NRQH 4YOIA 3V7TA 5DP8A 1CHOF 2A5KA 1IQHA 2XTTB 3PLKA 3UQVA 4MLFB 3QLPH 1ZZZA 1O2QA 1BCUH 1HAVA 1LVOA 3MNBA 2VWLA 3Q76A 1EUFA 3S9CA 1KTSB 2ZQ1A 1UCYE 2PSXA 1ZR0A 2ZFTA 4Q7ZA 4NIXA 1VITF 3SV8A 1FAXA 1FPCH 2BMGB 1C1WH 3ZVEA 3MH5A 1MTUA 2EEKA 2QF0A 2ODYB 1AQ7A 1HB0B 6CHAC 8GCHF 4KTSA 3GYLB 4A1XA 1FY4A 4FU9A 3MH7A 1O2IA 3H7TA 1GL0E 3MU4A 1GI0A 1WYKA 2ZKSA 3PM3A 1C1SA 4IC5A 1EAWA 2C4FH 2GGVB 3PROA 1W8BH 1T8OA 1GI8B 1F0TA 1A5HA 1GJ6A 2GVFA 4ISIH 4HGCA 1AY6H 1ZTLA 4DW2U 1C2JA 3JZ2B 5FPSA 1PQ7A 1P2IA 1DLKB 1QCPA 2J4IA 2CGAA 1P2JA 1QA0A 2ZGHA 3P95A 1DT2A 2BDYA 2VJ1A 4X1QU 3ATLA 4BAHB 1GI1A 2UUYA 3A8AA 5G4BA 3VGCB 1GJCB 2BOKA 1LQDB 5EGMA 3TH3H 1BUIA 1WTGH 4Q7XA 4XSKU 3EAJA 5JPMH 1G3EA 4MG3A 1W13U 1DUAA 2FESH 1C1PA 3UFAA 1CO7E 2G8TA 5EW1H 2P8OC 1DOJA 4Y11E 3RMNH 3LC3A 1BTXA 3ODDA 2YNBA 2XBYA 2XCFA 2ZF0H 3LGUA 1LKAA 4BTTB 3RXRA 1NFYA 1V2JT 2FOEA 5E0JA 2ZCKP 1LPKB 5SGAE 1O36A 3RM2H 1LKBA 5EU8A 1V2UT 2Q1JA 5IYTA 3LGVA 1C2LA 2Z9JA 4UD9H 3DD2H 1IQGA 1S81A 3D65E 1ETSH 3M37A 1TIOA 3A83A 2H6MA 2GV7A 6ESTA 5EPYA 1TNJA 1GCDA 3SHCH 3MO3A 5JYIA 1P2QA 3DT0H 4SGAE 2H5CA 1OWEA 1AGJA 2G5NA 1A1RA 3MTYA 3QZQA 3SI3H 6CHAB 3M35A 1SGPE 1VCQA 1QIXB 3R3GB 4I8GA 1PPGE 3RXFA 4NWLA 4AB8A 4MNYA 3TNSA 2WV4A 1GCTC 5T3HA 4FUCA 4JK6A 4NG9H 3AASA 1SGDE 1EB2A 1TRYA 5AHGH 5A8XA 8KME2 1XUGA 4FXGH 1ZPCA 1FIWA 3NK8A 2ZDKA 1C5QA 1YPJH 1YPGH 3RDZA 2PKAA 1W0ZU 2H5DA 4JZDH 2ODPA 2Z3EA 3SV9A 1F92A 1V2RT 1V2WT 2OC1A 3KN2A 3M7TA 3RXAA 4OS6A 1ZHMA 1PYTC 5K7RA 1D9IA 3RXGA 1IHSH 5DK1A 2W26A 3EA7A 1TOMH 5LPFA 1C2GA 3FP7E 3T25A 1HNEE 1P10A 3RXTA 2XWAA 4JZIA 3A87A 1HAPH 2P8OB 1SLUB 3MNSA 1C5YB 1GBLA 2GP9B 3OY6U 5A8YA 4Y8ZA 3UUZA 1O2PA 4D9QA 2OBQA 3P8OA 1IQEA 1RTFB 2AEIH 2BDGA 4WMDA 5DKMA 4HZHA 2J34A 4H6TA 3CS7A 1K1PA 4R0IA 2ZDLA 4OS4A 4DOQA 3A7YA 1WU1A 1LHFH 4NSVA 4JZFH 1GJ5H 1SGFG 1UCYK 4ABJA 1NROH 3BTEE 1UCYH 1H9LB 1Y5BT 3L6PA 3RU4D 4X0WU 1P2KA 3ZVAA 1SOZA 1TX7A 2FXRA 4NA7A 3T26A 4X2XA 4GVUA 5TJXA 1GJBB 3PMJA 3MI4A 3K2UA 2BVXH 4IN1A 1O2UA 1QRWA 3RC5A 1SGYE 3VPKA 2J2UA 2ASUB 3ZVBA 3A7WA 5GCHG 1NFXA 4B75A 1SLWB 3E90B 2IJOB 1DVAH 4MPVA 5J4QA 2BLWA 3NPSA 4XDEA 3KNXA 2FI4E 4I8LA 1GJ9B 3IWMA 1OWIA 4GHQA 1GHVH 4NZQA 3R0FA 2ZPQA 1CQQA 1H4WA 2ESTE 1HYLA 1SGFA 3MU0A 3UWIA 2TGTA 3TJOA 2LPRA 2GZ7A 1BMMH 3SV6A 4F49A 3SNCA 3U1IB 1BMLA 4KELA 4B73A 2BYAX 3TK9A 4INLA 1AE5A 2G52A 1GL1A 3U8TH 1T7CA 2UWPA 2Y5GA 2BDHA 3LDXH 1BTYA 2OD3B 1DPOA 5K0HA 5GWZA 1BTWA 1YLCA 2XW9A 4ISNA 5DP3A 1WQVH 1DXWA 3TGIE 2A4QA 3UREA 1EKBB 5GXPA 1CT4E 3RM0H 4NIWA 3ZV8A 1DLEA 5T6GA 1IHTH 5E8EH 3SOSA 4YZUA 4FUJA 4NA9H 4YM9A 1TMTH 3MO6A 1V2OT 1T31A 4Q2KA 2R9PA 4UE7H 1A5GH 2A2QH 1P9UA 1XUHA 1O3LA 1HAVB 1ZGVA 1C2IA 3RU4T 1LVBA 1ZSKA 1G3CA 1GBHA 1LVMA 2WPLS 3NUMA 2V6NA 3D62A 4X2VA 1UTKA 3GDVA 4X8SH 2G81E 2RA0A 3MU8A 5PTPA 1IAUA 3GCOA 1NRSH 3TK5A 1D4PB 1A0LA 4B2AA 3U1JB 1EOLA 3MO9A 1Z8RA 1NTPA 1EX3A 1NY22 1P3EA 4ABGA 3T29A 4AG1A 3SU4A 1THPB 5F6MA 2SGQE 1KXBA 1OXGA 1G2MA 3GISB 2AIQA 3OYPA 4NWKA 4X1PU 2XXLA 1C4U2 1HPGA 2ZQ2A 2VWOA 4TY6A 1Y5UT 2BQ7B 3BTFE 1ZSJA 3SJ9A 4B71A 1TNIA 5LPEA 1UVSH 3NXPA 4IGDA 4X6OA 1FJSA 3SQEE 1O32A 2WPKS 5LH8A 1LQEA 3TPIZ 4O3UA 1ESAA 2BLVA 1FAKH 1MD8A 4IC6A 1TB6H 3BTGE 1V2KT 2AMDA 3ZYEA 1NO9H 3TGJE 1QL8A 2FP7B 1ETTH 2D8WA 2GT7A 1GI6A 1RD3B 3SI4H 2I6QA 2Y7XA 3MH6A 3T5FH 2GTBA 2ZNKH 4DIIH 2CJIA 1G2LA 5ESBA 1NRNH 1J14A 1OPHB 2P59A 2VWMA 3UOPA 1GHZA 1C2MA 1L1GA 2C8XB 1MTSA 2NU2E 2BM2A 4IN2A 3RXQA 1Y3UA 5GDSH 1PPFE 2R2WU 2WPHS 3HK6B 1YM0A 1BDAA 1QHRB 4WWYA 4D7GA 2D26C 4FUBA 4AFUA 1C5OH 4NGAH 2J94A 4K5ZA 4CRAA 2FOGA 3UOUA 2BHGA 4DG4A 1OSSA 3KIDU 2HPQH 2PHBA 5BRRE 3OY5U 5GPIB 2HNTE 4H6SB 4TPYA 1O3AA 5GJ4B 1O2MA 4ZKSU 2FS8A 1V3XA 1PQ5A 1JWTA 4XBBA 2OUAA 3RXLA 2GCTB 1ZPBA 3BTWE 3GY7A 1B0EA 4VGCB 3Q3XA 2OC7A 2EA3A 2PKAB 1TGNA 2ZP0H 4WMEA 1TBZH 1P9SA 1D3DB 3P8NA 1ANBA 1OYQA 4A6LA 2FOCA 2WYJA 3MOCA 1O3OA 2ZFQH 3LIWA 4KGAA 1OX1A 4ABBA 4BNRA 1L1JA 2O9QA 1FY8E 1GBEA 1V6DA 5JBAS 2NU0E 4THNH 2Z9GA 5HYOA 3AAVA 4AORA 5C20A 1W2KH 1SLVB 2PR3A 3BEUA 2HALA 5JBCS 4PROA 2XRCA 4NIYA 3ZVGA 3LU9B 1EAIA 2BDIA 3S0NA 1O3MA 1IQNA 1NZQH 2BX4A 3P92A 1P04A 1GJAB 1UTPA 4WMFA 1DUEA 2PUQH 3QX5H 5JB8S 1AVGH 1K28D 2FM2A 4Y7BA 1A0HB 1QNJA 2FX6A 3PTBA 1UVPA 2OP9A 3S9AA 1DWCH 4D9RA 1ELCA 1G3DA 4YT6H 2O8TA 5FPTA 4DCDA 2CF9H 3EE0B 2OC0A 4XBDA 4MDSA 3CENA 4Z6AH 2TBSA 4JK5A 2TGAA 2OC8A 5C67A 4B1TA 2JETC 1HCGA 1V2MT 2OLGA 3Q77A 2J92A 2ZFRH 2J38A 3E6PH 3BIVH 4J1YA 1NT1A 4CRFA 1ETRH 3F68H 1T4UH 2BOHB 2ZTXA 1UTLM 2VIQA 4B2CA 1C5UA 1K1IA 1SVPA 1THRH 1F5LA 5FCKA 1SPJA 4SGBE 1ZRBA 1GVLA 3BIUH 2B9LA 3VXFH 3TNTA 2JKHA 1WOFA 1G9IE 2TGDA 5T6FA 2F9VA 1KXDA 2HLCA 3QN7A 1AKSA 1BBRE 1FDPA 1G37A 1TYNA 1UO6A 1GBBA 2A5IA 2G51A 2VGCB 2V35A 3HK3B 2GX4A 1L1NA 2ANMH 1C5PA 4JCNA 5C5NA 3TU7H 4AN7A 1GHAF 3DA9B 4DY7B 3B9FH 3M5NA 4YESB 1BJVA 4IW4E 1W10U 1YCPK 2HVXA 5F8XA 6LPRA 2ZDNA 5EQSA 1C5TA 4A7IB 2W3IA 1FXYA 1S85A 2C8ZB 2K1QA 1EZXC 1MTNB 4KKDA 2FMJA 4X6NA 1W12U 3ODFA 1GDUA 1Y8TA 3LGWA 5IDKA 1HDTH 1Y59T 1A0JA 3L33A 1UJ1A 1IQFA 1N6XA 2AH4X 3GY2A 4MQAA 3V13A 2W3KA 3DUXH 4JZEH 3E1XB 2FS9A 1H9IE 3RXEA 3OTJE 1LMWB 4Y0ZE 3VFEA 1C4V2 1K1LA 1S5SA 2H9HA 2G5VA 2NWNA 4Y76A 1H9HE 4K69A 1KSNA 3HGNA 2ZU1A 1NESE 1ZMLA 1O31A 4CRCA 2V0BA 2PV9B 3D49H 1NRPH 1C1TA 1ZJDA 4BTIB 2CXVA 1WUNH 2QC2A 3ZV9A 1UMAH 1ZRKA 1O3IA 4Y10E 2A4RA 2B7DH 4I8KA 3UNRA 3GOVB 2FTMA 5JBTA 2OTVA 2A0QB 3C27B 2QCYA 3QZRA 3GCTG 3S7KB 2FLBH 2W5EA 1HJAB 2BB4A 1Q2WA 2ZFPH 3PO1C 1P0SH 4AFZA 2VVCA 1Q31A 3F9EA 3SJ8A 3EGKH 4ISLA 4JYVH 3HKIB 3RC4A 1YBWA 3FZZA 3GYMA 2ZGBH 3KF2A 1GI9B 5FXLA 3GY3A 2ZGCA 1V2LT 4UONA 1D6WA 2GMTC 3SUDA 2BY9X 4HI3A 1OP2A 2ZGXH 2D2DA 5HGGA 1DFPA 1ELVA 3ATIA 1V2PT 2Y7ZA 3FZDA 2PGBB 3ZZ8A 1GJ8B 1ELTA 2QXJA 4Y8XA 5JBBS 2H9TH 1YPKH 2UUJB 3SJOA 1O3KA 1E37B 5C1YA 4X6MA 1NFUA 3RXSA 3SQHE 1P01A 4IBLH 3HATH 3UTUH 1YF4A 1O3NA 1SGQE 2QAAA 4AYYB 1OP8A 1UHBA 2AYWA 1MKXK 2A2XH 1MKXH 1DY8A 1RTKA 3UY9A 2VIVA 1TE0A 2FX4A 1E36B 4AG2A 3M61U 1D3PB 1SLXB 2A4OA 1LDTT 1JIMA 5CHAC 1HRTH 1T8LA 1BHXF 1TNLA 5A09A 1U6QA 1T8MA 1TWXB 3CS0A 1LHDH 1ZOMA 3F1SB 4H42U 1CHGA 3PYHA 5HXFA 3A7ZA 1K1MA 3UIRA 1TNGA 1OOKB 1A2CH 2ZECA 2UWLA 1S84A 1OS8A 1SR5C 4RSPA 3T62A 1Y3XA 4R8TB 2PTCE 1C2FA 4NFEA 4ZROA 4FVBA 3PO1B 1ZLRA 2P94A 2WPIS 3PMBB 1TGSZ 3SUFA 1GDQA 3A86A 4GSOA 1RTLA 1MKWK 3EQ0H 5ABWA 3UR6A 2QYIA 1MKWH 1H1BA 1DSTA 1GJ7B 3VB7A 3A88A 3OU0A 2YOLA 4CBOA 3V3MA 2VU8E 1F2SE 2HOBA 1PPHE 1BBRK 1EATA 1BBRH 1W7XH 4HTCH 1W3CA 1E34B 1O5FH 1RFNA 1Q3XA 5FPYA 4UEHH 1ORFA 2R0LA 1QURH 4RKOB 2P3FH 2BD9A 4AB9A 1SQOA 1MCVA 1CGIE 4A1VA 4DIHH 4O03A 4IMZA 1D6RA 4OGYA 5DO4H 1IQMA 1ELFA 1FMGA 1SHYA 1VCPA 1BJUA 5DP4A 1O5EH 1YPHE 2XC4A 3H7OA 1F0UA 2PUXB 5LGOA 1P3CA 2THFB 5FHTA 1DX5M 1SB1H 2P3TB 1LCYA 1AFQC 4ABIA 1O39A 1LO6A 2CHAC 3TLOA 2PSYA 3M36A 4ZXXH 3RXCA 1EB1H 5AFZH 1TRMA 2STAE 3ITIA 3GDUA 1MU6B 5FX5A 2FLRH 4I8JA 3LOXA 1SOTA 1KLTA 1SI5H 1XVMA 3JZ1B 3VEQB 1GI5A 4NIVA 3RP2A 5EG4A 4ABAA 3A7XA 2AGGX 3FP6E 4X2WA 2QIQA 1GCTB 2AMPA 3BTQE 1HXFH 1VCWA 2ILNA 4WVPE 1HBTH 3UNSA 3HKJB 1K1JA 4FUIA 5C3NA 5HM9A 4ASHA 1BHXB 3KGPA 2HGTH 2VVVA 3NZIA 3NCLA 4K1EA 4MPUA 1GJ4H 2VB0A 4AFQA 1QBNA 1YPHC 4KTCA 3ENSB 2F9UA 4GCHG 3IITA 2ZDMA 3SU3A 2ZHDA 2B0FA 4ISHH