1GJCB

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 51
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjcB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjcB01
2EA3A 1FLEE 3VB4A 3AAUA 3EA9A 5HGGA 3SU0A 4I33A 3QX5H 4ABHA 1GCTC 2BMGB 2FODA 1YPHC 2JH5D 2UWOA 1MD7A 1RIWC 3ZZ5A 4FUCA 4IS5A 4A92A 1GL0E 3SU3A 2XTTB 1MTWA 1WOFA 2UWLA 1A4WH 4U32A 2SGPE 3LH1A 1C5LH 2BY6X 2VVVA 2O9QA 3C1KA 1UTPA 2BD4A 2BOKA 5C1XA 3PTNA 3Q00A 4ABDA 1YBWA 2A7HA 1MTUA 2J95A 1O2NA 2RG3A 1Y5UT 2QA9E 3V7TA 1WQSA 2ULLA 4MDSA 4CR9A 1MBMA 3GISB 1C2LA 2PKSC 1V2NT 1SVPA 3M3VA 1J9CH 1DWEH 3S7HB 1O3IA 3SQEE 1BTUA 1O31A 1CHGA 1TRNA 3ZVAA 3BTQE 1F0RA 3GY5A 1G2MA 3LOXA 3MH4A 5ETXA 1SGIB 4CBOA 2TBSA 1GCTB 1L1JA 4INHA 1Z6JH 5FX5A 5FX6A 2FI3E 4K1EA 3M3SA 1RIWB 3GCOA 1O2JA 1SGEE 1D3PB 4D9QA 3SGBE 2VH6A 3Q77A 1O3JA 3RXDA 3ZYEA 1VGCB 1NPMA 1W0ZU 1ZMLA 2G55A 4JZ1A 3SNAA 2OC7A 2FOEA 2CF8H 2HRVA 3RLYH 3GCNA 1FIWA 1IQGA 4DY7B 2OBQA 4OS4A 6GCHF 2C8WB 2ZFFH 4BAQB 1XVMA 1DS2E 1ARCA 2GZ9A 5F8TA 4ASHA 1IQIA 1AZ8A 4TPIZ 2PKSB 1BTHH 3PLPA 2FOHA 1DICA 1QURH 1O5CB 2AH4X 2QY0B 3VB7A 3SJ9A 1BDAA 1O2WA 2HALA 2WUBA 3LC5A 3SUFA 3TGKE 2BY5X 2UUKB 3SOSA 2P95A 1O2KA 3HK3B 3TPIZ 4INKA 4AX9H 1G3CA 5F8XA 4NA7A 2VB0A 1TE0A 3RMOH 1ZHPA 4D7GA 2ASUB 1JMOH 2DE8A 1F5KU 1GBMA 2BQWB 3E91A 2G8TA 3IITA 2FOMB 4D7FA 1LPKB 2V6NA 1K2I1 1G30B 1ETSH 1GBKA 4NSVA 2BM2A 1AD8H 5PTPA 3RC6A 3MH5A 1WTHD 3ZZCA 1CT2E 4B2AA 1VZQH 3GCHC 4FU9A 4YOGA 2A31A 3NK8A 1OYQA 4WWYA 5TCCA 1H8IH 4E06H 3K9XB 1QCPA 4YZUA 2BZ6H 1MCTA 2QXGA 2ZTZA 1JRSA 1C5QA 2FP7B 1P9UA 1AQ7A 1QBNA 1HAZB 3ATWA 2BVXH 5L2ZH 1ZPCA 1C5TA 2VNTA 1TABE 1A5GH 1TGSZ 1O5DH 1D9IA 4K1TA 3BTKE 3NCLA 3UREA 3A88A 1TX7A 3M7QA 4X1SU 2GCTC 1QFKH 1YCPK 2BQ7B 3ZZ4A 4CH2B 5HXFA 4SGBE 3DD2H 4B71A 3M7TA 2QF3A 3K65B 2BY8X 2BD9A 4B1TA 5I46H 3FZDA 5DP4A 3HKIB 1X7AC 3GCHB 4WY3A 3RXVA 2VH0A 5AF9H 4ABIA 3BTFE 7ESTE 2FM2A 4YESB 4FUGA 1P2JA 1LMWB 1OWEA 4MQAA 3GCTF 1UK2A 1MD8A 2WPLS 2OINA 2BXUH 3QGJA 3A80A 3GY7A 1HAPH 3PMAB 1NC6A 2H5DA 5LPEA 4H4FA 1XVOA 3Q3KA 2PGBB 4NIXA 1HAVA 2ILNA 2JETC 1Z6EA 4DURA 2BB4A 1EAUA 1TGTA 4GLYA 3GY4A 4RSPA 1EOLA 4TWYA 5K7RA 1JIRA 1IOEA 1ABJH 3T2NA 5DKMA 1YPLH 4AFSA 1MU8B 3P8NA 3GDUA 2GCTB 4B2BA 2J92A 1TGNA 4BAKB 4CHAC 1BOQA 1T7CA 1GI3A 2ZGCA 3MNBA 5T6DA 1S6HA 2ZDLA 1KTTB 2FPZA 3STIA 2GMTC 5C67A 1ANDA 1GJDB 4OS2A 1P03A 1W7GH 4GHTA 2PSYA 1CA8B 1O2VA 1P02A 1K21H 4AOQA 3LGTA 1C5OH 2PTCE 1QJ7B 2VIQA 4Z6AH 1ZTKA 3ENSB 5TCAA 1O3LA 1V2ST 1AFQC 1V2MT 1XUGA 1L4DA 1HFDA 1P2NA 1C5PA 1H9HE 4CRFA 1BRBE 8LPRA 3RXHA 1C2MA 4GCHG 1C1UH 3NXPA 3SZNA 4AYYB 5HMAA 4O03A 2QN5T 3A82A 4Y76A 1SL3A 1QIXB 2BDIA 3FFGA 3Q3XA 1S81A 2G81E 2JETB 1IQNA 1EUFA 2VU8E 4X2YA 3TITA 2J9NA 1MTSA 1DT2A 5EQRA 1O2MA 3GY3A 1JXPA 1WTGH 1E37B 1LHDH 1GWAA 5C5NA 1PPFE 4MNYA 1P2IA 5E2OA 1K1PA 3B23B 2GV6A 1SHHB 4CHAB 5E0HA 3K6YA 3BV9B 2XC0A 1ESTA 1P2OA 3SJ8A 3SJOA 1O5AB 4ZKRU 3GDVA 1UTMA 3MHWU 2ZHWH 4XBDA 1UVPA 2IN2A 4WMDA 3DHKH 1FMGA 1KTSB 3TNTA 3U1IB 2ANWA 3MU5A 1OP2A 2FOCA 1AFQB 2PUXB 2Z3EA 2ZF0H 4AGJA 2AEIH 1LHFH 4BNRA 1TONA 1PPHE 1A3BH 1QRWA 5DK1A 4X2XA 1GBFA 1UMAH 1ZJKA 4XSKU 5GCHF 4HZHA 3RM0H 1HJAC 1Z8IB 1HRTH 1Z8GA 1WAYB 3BTWE 2BDAA 3LU9B 2FEQH 1XXFA 1VCQA 2QGRA 3ZZ3A 1NN6A 4K2YA 1HIAA 1NFWA 1O2HA 1P2MA 3EA7A 4ABBA 3KN2A 1WSSH 3BIVH 3O8CA 6ESTA 2SGQE 2EI8A 3S0NA 1IHSH 1Q31A 4H6SB 5DGJA 4B75A 2R2WU 3A7YA 1SGYE 1J14A 4CRCA 2ANYA 5A0BA 4X6NA 1P09A 2CJIA 2GCHG 1BJVA 2FESH 3A8CA 3KF2A 5EODA 1QBVH 1K1NA 1C2FA 4A6LA 5IDKA 1KDQA 1MTNC 4H6TA 3FAOA 2QXJA 5G4BA 2ANMH 3S9AA 2ZCLP 2FX6A 4GPGA 5L6NH 2HWLB 5EOKA 3VEQB 1E35B 1EQ9A 2WV4A 4UFEH 3RXRA 1XUHA 3U9AH 1BCUH 2B5TB 3KEEA 1HJAB 2RCEA 4F4OC 1JIMA 1AUJA 2H6MA 1C4V2 1Q3XA 4I32A 1KLIH 3SUDA 4NWLA 3ODFA 1UVUH 3UOUA 4FUFA 3BEUA 1KXCA 3BG8A 1TNLA 3OU0A 1F92A 1O34A 4X6PA 3PMHB 3QN7A 4Y6DA 1XUJA 2IPHA 3IWMA 4Y71A 1XM1A 2ZI2H 2R9PA 2KAIB 1BMLA 4KTCA 2W3KA 2VVCA 1C2KA 2ZZUH 4K1SA 1QB6A 1NTPA 1DOJA 2SNWA 4NIVA 3ATKA 1T31A 3SNCA 1O3MA 1T32A 1PJPA 2FS8A 5LGOA 4UONA 1UTJA 2R3UA 4AG1A 1MTNB 3SNEA 4IN1A 3V0XA 3PLKA 3P95A 2P16A 1YLCA 4YT6H 2B8OH 1O3GA 2BDYA 1W13U 1XUIA 1HPGA 3HATH 4DVAU 2PFEA 4X6MA 1BHXF 3EGKH 2ZIQH 1TPOA 4HFPB 4I31A 3TH3H 1O3AA 1GHAG 1MU6B 4XDEA 2DUCA 2A32A 1CT0E 3SU6A 1LHCH 4X2VA 2CXVA 5EW2H 1U6QA 1VITH 3HKJB 1VITG 5LPFA 4JYTA 2Q1JA 1KY9A 1GJCB 1C2EA 4CRGA 2ZPRA 3CS0A 1W8BH 1YCPH 2FLRH 2O8MA 1T4VH 2FOGA 3ATLA 2M5TA 4Y79A 1CBWC 1T8MA 2NU0E 1H1BA 2VGCC 1VITF 4YO9A 1JRTA 1B7XB 1TYNA 2WPHS 1NT1A 4U30A 4IBLH 5DP8A 1EATA 1F5RA 2V0BA 1S84A 1GI9B 2C8ZB 3ZZ7A 3TVJB 1SI5H 1ANEA 1G37A 2ZWLH 4INLA 1TRYA 1THRH 4OS5A 1DY8A 4RKJB 1HJ9A 1A1RA 2BDBA 1EB2A 1GMCG 1W3CA 4X1PU 3VB6A 4YOJA 4X2WA 1P2QA 4FXGH 4MNVA 2TIOA 1ZPBA 4AFUA 1CGHA 2XWAA 2A5KA 2ZPQA 3T5FH 1E0FD 3BN9A 1DPOA 2PKAB 3P6ZB 1FZZA 1GMCF 1WCZA 1GI0A 1C4Y2 1UVTH 3LIWA 3RXPA 1GG6C 1N6XA 4BANB 1FQ3A 1DWBH 2EEKA 2H9EH 3ELAH 3FANA 2PW8H 4XBBA 3OSYA 1C5NH 4AB9A 3RU4E 1Y3VA 1ZMNA 1CBWB 1V2KT 1OWHA 2EI7A 2BD3A 1RS0A 2VGCB 5JBTA 2P8OC 1LTOA 4NGAH 1A7SA 2XC5A 3NZIA 5T6FA 2CN0H 1O2PA 4Y8YA 4A1TA 3U1JB 1W12U 3FP6E 4WMEA 8ESTE 1NM6A 5A8YA 2BY7X 2GDEH 3PWBA 1Z8RA 1PQAA 2GZ8A 4AB8A 3WY8A 2PHBA 1N6YA 1P04A 1L2EA 1ZYOA 1KXAA 1RXPA 4TY7A 2A4RA 1HCGA 2ZDKA 2XBYA 2VIOA 2PWXA 1O30A 3ZZAA 4OGYA 1YKTA 2PSXA 2ZCHP 4X0WU 1YPMH 3H5CB 2ZGHA 1DUAA 1O32A 1F5LA 1GBEA 2HNTC 1AGJA 3H7OA 1GDQA 1EJAA 1THPB 5DP6A 5DG6A 2Z3CA 3BTEE 3RM2H 2PR3A 1GG6B 2P3UB 5ESTE 3BF6H 3RC4A 1BJUA 1P3EA 2FZZA 1QNJA 3DFLA 1QL9A 1C5UA 3LDXH 1CVWH 5EPYA 4B76A 1EPTC 1ELVA 2P8OB 5A8XA 1S85A 1NU7B 4K3JA 1ELBA 1RRKA 2ZDVH 1QY6A 4X8VH 3MI4A 4JZDH 2SGDE 1AMHA 3SO3A 3A8AA 2ZGBH 2QAAA 3ZVGA 1WV7H 1E38B 3UNSA 1YGCH 2TRMA 2OBOA 3A81A 5FBEA 1SC8U 3VPKA 1GBJA 1PYTD 2TGPZ 5ABWA 2V3HH 3SGAE 1CA0B 1GVLA 2Q6FA 1L4ZA 3RMNH 5JYIA 1ELCA 2D8WA 1QRZA 3F68H 1EZSC 3HGNA 3SI4H 1S0QA 1ANBA 1DLKB 4KKDA 3RXBA 5AFZH 1TAWA 4O97A 3CP7A 1UJ1A 3LGIA 3BTDE 1GBAA 1P3CA 3TJNA 3OY6U 1Q2WA 3KHVA 1IQJA 2QC2A 5DO4H 1F2SE 2FI4E 1EPTB 1BT7A 4WMFA 4CRBA 3RXCA 1C1SA 3HPTB 1ZHRA 4DGJA 2HNTE 3OYPA 3F9HA 2BDHA 4GSOA 3SU2A 1CGIE 1LQEA 2PTNA 1IAUA 1OWJA 1XX9A 2GX4A 1LPGB 3M35A 4PROA 1O2GH 1UVOA 1NRSH 3UWJH 5GWZA 4MNXA 9ESTA 1YPEH 1YPHE 2VIDA 2WPIS 3V13A 3EAJA 4KTUA 1ELDE 4BTIB 1BITA 2ZHFH 3AAVA 4A5TS 3KNXA 1ELEE 2HGTH 1GMDG 2H1UA 3MH7A 3W95A 1EAWA 4DIIH 1D3QB 4ZKOU 4AYVB 1AE5A 1UTKA 4FUJA 3SQHE 1HNEE 1JWTA 1GMDF 4AZ2B 1NRRH 2F9OA 5T3HA 3SUEA 1O39A 1LVOA 2XXLA 3VGCC 2WUCA 1FY8E 2G51A 1UVSH 2FOFA 2C93B 1P0SH 1T8OA 1TALA 2CGAA 3RXFA 1RTLA 4X8UH 4NSYA 1TQ7B 4KP0A 5FAHA 3KIDU 2JH0D 1ZZZA 2EC9H 2HVXA 3E0PB 2VIPA 1GHWH 2F9PA 4WH8A 2BLVA 1GGDC 2CF9H 1QTFA 1GL1A 5FHTA 1HXEH 2AMDA 3C27B 1S5SA 1FAKH 3UPEA 2UWPA 3ITIA 5H4IB 1BTWA 5LH8A 1GBLA 4ZROA 2WV5A 1YCPM 1F0SA 3PO1C 1QA0A 2A5IA 4JK6A 1O2LA 3A84A 5E0JA 1AHTH 1GMHG 2FTMA 2NU1E 2FDAA 5E8EH 2ALVA 1GVZA 2R2MB 2AS9A 1RD3B 3SI3H 3ATMA 1UCYK 2BY9X 3VGCB 2P59A 1MKWK 1D6WA 3S9CA 1Y3YA 1K9OE 1SGFG 2I6QA 1GMHF 2FYQA 4GHQA 1AWFH 1GHZA 2SGAA 1FONA 1T8NA 1A0JA 2JH6D 4B2CA 3O8DA 1C1WH 2BLOA 3EQ0H 4RN6A 5JB9S 1PPZA 1SG8B 2GGVB 5HYOA 5DP3A 1GGDB 3SJKA 2STBE 2VIWA 1V6DA 1O3HA 1CQQA 1O2SA 1P8VC 4UFGH 5SGAE 2F3CE 3KL6A 3UR9A 3ZVEA 1SSXA 4HTCH 3MO6A 1FN8A 3W94A 3U69H 1BZXE 2Z94A 1C5YB 3KQCA 3PO1B 2K1QA 1MCVA 3OX7U 1AKSB 4MPXA 2GT8A 3MWIU 1ELGA 2R0LA 3RU4D 1YC0A 5C3NA 3ODDA 1JBUH 1WYKA 2XCFA 4Z0KA 2OXSA 4FUEA 1VR1H 2RDLA 2G4UA 1FIZA 1GHBG 1INCA 1PPGE 4A1VA 2GDDA 3S69A 3AVZA 1NESE 1KYNA 4H42U 4MG3A 3SU5A 1O5GH 1V3XA 2B7DH 1BBRK 1ACBE 5EQQA 1DWDH 4MPWA 4TWWA 1QQ4A 5C1YA 1GHBF 4OGXA 1SGFA 1HXFH 1M9UA 3HK6B 1BTXA 4FU8A 1SBWA 1HAGE 1UK4A 1XKBC 5BRRE 1QL8A 3PMBB 1NFUA 1C5XB 8GCHG 2FLBH 1TPPA 1C5RA 4DG4A 3ZZBA 3OTJE 3RXTA 1OKXA 3KQEA 1V2LT 2Q6DA 1EP6A 1EKBB 2R0KA 1YP9A 1O3BA 1C5MD 1O5BB 1TGCA 3GOVB 4MLFB 4Q7XA 4R8TB 1A61H 3MFJA 2QV1A 1TLDA 2ZCKP 3RMLH 3P8GA 1UHBB 4J1YA 2I6SA 1QHRB 5CMXH 3E16B 1EOJA 1ABIH 2BOHB 4GCHF 5IYTA 4NZLA 1LVYA 1O2ZA 3FZZA 2ZPSA 2Y7ZA 3SV8A 4X1QU 2W5EA 2FOBA 1O0DH 1BB0B 3SGQE 3L33A 1ZRBA 2VVUA 1G32B 1O3NA 2J38A 4WJG2 1HGTH 2GMTB 2XBVA 3RLWH 2ZEBA 3ZVCA 1MAYA 1GJBB 1GJAB 3RUOA 3MNXA 3M5OA 4NWKA 3T26A 2WINI 5FPTA 3JZ1B 2BLQA 9LPRA 3RXUA 2ZC9H 2VWLA 3ZV8A 1BTZA 3UNQA 4UDWH 1FI8A 3RDZA 4X6OA 5K0HA 1P10A 1DY9A 3T27A 1BQYA 2Y5FA 4IGDA 4I8GA 3SV2H 4BAMB 5J4SA 3UQOA 2Y80A 1QB1A 2A4OA 1SQAA 1BTYA 4U01A 4ZAEA 4I8HA 3SHCH 2ZU4A 3UQVA 1TNJA 3SV9A 4ZUHA 1THSH 2Z9IA 3PM3A 2LNCA 1BMAA 1CE5A 3UY9A 5GPIB 2LPRA 3ZVBA 1IQLA 1LDTT 2IJOB 2OLGA 2HPQH 3E90B 4FUBA 3ZV9A 5C20A 3S7KB 3NWUA 1C5VA 1XXDA 1OWDA 4Y10E 5EG4A 1EP5A 2D2DA 4A7IB 1O3EA 1ZHMA 3UIRA 4X1NU 3URDA 1FNIA 1F0UA 1GBBA 3U98H 3SJIA 4CREA 4AFQA 1O3KA 3U8TH 4IMZA 2NU3E 1EZQA 4IN2A 3NUMA 3RXQA 1B0FA 2GCHF 3RXAA 3SHAH 5GXPA 4TYDA 3E8LA 2W7SA 1GI6A 1Z1IA 3LGWA 4NG9H 1TRMA 1TQ0B 1Z71A 2KAIA 1V2QT 2ZNKH 3D62A 1V2WT 3RXSA 1T8LA 2ZFTA 3SN8A 1FY5A 2PUQH 2ZGJA 1HLTH 4B73A 1DWCH 1FAXA 3T25A 3TIUA 3VB5A 1O3CA 2AGIX 5A0AE 2FWWA 3SU1A 1GJ4H 1P06A 2XRCA 1LHGH 3TH4H 2STAE 1H8DH 3GYMA 2F83A 1ZSKA 3LGUA 1QQUA 1L1NA 1DSTA 1WUNH 4CH8B 3SU4A 3DUXH 1C9PA 1BRUP 2P93A 1O33A 2BVSH 4KTSA 1HB0B 1W0YH 1ZRKA 1DX5M 5EQSA 1FJSA 3A7TA 1C1NA 1GHXH 1OPHB 2OTVA 3R3GB 3DT0H 1F0TA 4MPVA 2AMPA 4NA8A 4X8TH 3SBKA 5DP9A 2OQUA 1DANH 1P01A 1W14U 1VJAU 3RXGA 5FXLA 1HAOH 1AVGH 2Z9KA 2Y6TA 4F49A 1D6RA 1AI8H 5A0CA 5LPRA 1CHOG 2AIQA 3SUGA 4LZ1H 4U2WA 1GHAF 3P92A 3B9FH 2P3TB 1UTOA 2J34A 2ESTE 5GIBA 3SV7A 1Z8JB 2F9NA 1ETRH 1QA7A 1TOMH 4UD9H 2AGEX 4CBNA 1SLXB 2PV9B 4ZKSU 1CHOF 2ALPA 2ZECA 3A86A 4NCYA 5CHAC 1QBOA 2H5CA 3FP8E 1DFPA 4K5ZA 1O5EH 1DXPA 3LONA 5BPEA 4DIHH 3PV4A 2H9HA 3TK5A 1RTKA 2FTLE 2CMYA 4Y7BA 2PKAA 3VFEA 3RC5A 1O37A 3Q3YA 1ZR0A 4XOJA 1FUJA 3UOPA 1DUEA 1TB6H 2GT7A 1C1TA 1SLWB 1TNIA 3QUMP 2Y82A 3TK6A 1FY4A 1SOTA 1EAIA 3LJOA 1NRPH 1Z1JA 1G9IE 2VWNA 3M61U 3TU7H 2C4FH 4DW2U 2ZP0H 3KQBA 1V2UT 2ZU3A 1EJNA 1A5IA 1SR5C 2J94A 1MUEB 2ZA5A 3I29A 1UTNA 3VB3A 2WYJA 1SMFE 2GD4B 4UE7H 1TOCB 1DXWA 3UUZA 3A83A 4YT7H 5AHGH 1SQOA 1SLVB 1ZTLA 1O2IA 1BHXB 1F7ZA 2GKVE 5CHAB 1MMJN 3IG6B 1FN6A 1P11E 4YTAA 2BXTH 3E3TA 2A7JA 4IMQA 1BTPA 4BAOB 1G3BA 4MPUA 4ISLA 1TBQH 1HYLA 1NFXA 3GICB 1TMTH 2WPKS 2C3SA 3GYLB 4ZH8A 4AG2A 3RXKA 1GVKB 2NWNA 4ABJA 4WXVA 3QTVH 6CHAC 3RXJA 1UCYE 2TGDA 3UWIA 4ABAA 3F9FA 2FS9A 2H9TH 2CHAC 4ZMAH 3A7WA 1SGCA 1O2QA 1S82A 1SGNE 1GI8B 1BRCE 4NIYA 1KXEA 3K6ZA 1ZJDA 3NPSA 4ABFA 1N8OC 3Q76A 1IHTH 3NKKA 4WF8A 1C9TA 4QT8C 2AYWA 4Q7YA 2BD7A 4XE4A 2ODQA 4CRDA 2FOAA 4Y8ZA 3AW1A 1O2RA 1D3TB 1C2HA 4OS7A 1C1OA 1ID5H 2ODYB 2ZQ2A 1TFXA 1PQ7A 3LH3A 5TJXA 1EX3A 1LO6A 1O2XA 3EYDA 4FVBA 1OSSA 1TNKA 3PROA 1TNHA 1A5HA 1ZOMA 4I8JA 3MU4A 2Q6GA 2AGGX 1AZZA 5DP5A 3F6UH 1CSOE 2QXHA 1V2JT 4ABGA 1ESAA 1G3DA 2P3FH 3P8OA 5JPMH 2A4GA 1SGPE 3EE0B 1NU9A 4IC6A 3KCGH 6CHAB 5JDUB 1ELTA 1L0ZA 4LOYH 2BX3A 2CHAB 4Y7AA 1EPTA 2NU4E 2V35A 2XW9A 4Y0YE 1W7XH 1VGCC 5C2ZA 3GY8A 1XKAC 1TMUH 1BBRE 2XBWA 1GI5A 7LPRA 1K22H 1N8OB 3QWCH 5GJ4B 2FI5E 3M5NA 1C1PA 1MKXK 1O3DA 3BTTE 2FYRA 4D8NA 1O2OA 2V3OH 2G4TA 1H9LB 1K1MA 5FCKA 3EDXB 4Y8XA 3B8JA 1IQKA 1FV9A 4Y0ZE 4E7RG 4VGCC 5A2MH 5EXMA 1TX8A 3ZVFA 2BDCA 5JBBS 1MZAA 1V2VT 4B74A 1B5GH 4WVPE 2YNAA 1G3EA 4I8LA 2O8WA 2OUAA 3V3MA 4ZXXH 4OS1A 5FPYA 1GBDA 1TGBA 1TNGA 3O8BA 2ZKSA 2TGTA 1L1GA 2BZAA 4ISIH 2JKHA 3D23A 1ORFA 3T62A 6GCHG 2A2QH 3QLPH 1BA8B 1GDNA 3E1XB 1K1JA 2Y5HA 2TPIZ 1C5WB 4BXSA 1GBHA 1OOKB 3F1SB 2RA3A 1FPCH 2OC8A 2GVFA 1GI4A 4JK5A 1GCDA 4DCDA 1OYTH 3TJUA 1GI7B 2A4QA 2ZDAH 4WXIA 2W7UA 6LPRA 1EZXC 1GPZA 3MNSA 1KXBA 4VGCB 3UTUH 4NFFA 2BLWA 1ZLRA 3MTYA 1O5FH 2WYGA 1A46H 2ZHEH 1KXDA 3DFJA 1GI1A 2THFB 4FU7A 7GCHG 1C2JA 4ZHMU 1K1OA 2GP9B 4THNH 3M37A 2ZQ1A 2BD2A 1UK3A 2OQ5A 4NZQA 4GAWA 4I7YH 4HI3A 3RP2A 3E0NB 1GJ9B 3VXEH 1MQ5A 4JMYA 2BTCE 1GDUA 7GCHF 1TPAE 1C2GA 2A5AA 3H7TA 2BYAX 3PMJA 1KSNA 4TPYA 2XBXA 3SORA 1O3PB 1QRXA 1OX1A 1KXFA 1C1MA 2OCVB 4O3UA 2C8XB 3N7OA 3P70B 1BMMH 1LPZB 1RTFB 3PB1E 3JZ2B 5DP7A 1GJ5H 1O2TA 1C1VH 3BTGE 5FBIA 4IC5A 3MMGA 1A0LA 2B9LA 1SGTA 1AO5A 1HBTH 4X1RU 1O3OA 2ZDMA 3ZZ8A 1NFYA 8KME2 2O8TA 1A0HB 3RMMH 3V12A 2ZTYA 4I8KA 4K8YA 3U8RH 1TWXB 1S6FA 1TA2A 2GV7A 3TJOA 1SGDE 2OC0A 1J8AA 1Z7KA 1TMBH 2AFQB 2HLCA 5DJ7A 1GJ8B 1TBRH 1AKSA 2SGFE 2AMQA 5A09A 1W11U 3MNCA 1K1IA 1BMNH 2NU2E 1D3DB 1EXFA 1N1LA 1O2UA 1IQFA 4JZIA 4BXWA 3PWCA 1Y5BT 2J2UA 1YYY1 3L6PA 3ZZDA 3BSQA 4JYUH 3K2UA 4DOQA 1C5SA 1RFNA 2XNIA 2OC1A 3M3TA 4LXBH 1P2KA 2VWOA 1Y3WA 3GCTG 1OWKA 3DA9B 4J2YB 3OY5U 1TX6A 1AUTC 2D1JA 3ZZ9A 4XBCA 4GUXA 4OS6A 1SGRE 1O36A 1H4WA 4AFZA 1DITH 3TJVA 2IOTA 4YM9A 4LZ4B 1ZGIA 2O8LA 3GDSA 2VIVA 4YLUA 1WQVH 1Y59T 2G52A 2QYIA 5E2PA 1FPHH 2ZGXH 3QDZB 4NA9H 3BG4C 4YOIA 3BTME 2FXRA 1CO7E 1A3EH 1C2DA 5EGMA 3A87A 1SQTA 2XCNA 2ZFSA 5AFYH 1SOZA 4FVDA 1AVWA 1VCWA 1UHBA 2G00A 1Y3XA 3BEFB 2FX4A 3U8OH 1TIOA 4BTTB 1NROH 1NRNH 1HAVB 2C90B 3M7UA 1MTVA 3TLOA 8GCHF 5FCRA 3CENA 5EXNA 3A7VA 4ZHLU 1ELAA 1PYTC 1SPJA 1HDTH 2Y7XA 5GDSH 2ZU1A 1YLDA 2ZHQH 3HGPA 4BAHB 3FP7E 1GJ7B 3MYWA 4UFDH 1SLUB 1V2RT 4AGKA 4X8SH 1IQHA 1TPSA 2BDGA 3RXLA 1NRQH 2QXIA 3M5LA 3RXIA 3ZYDA 4E05H 1C4U2 3BG4B 3MOCA 1SFIA 3A8DA 2G5NA 4TY6A 3E6PH 1AVXA 4K60A 2Z3DA 3BTHE 3TNSA 2SGEE 3MO3A 3BIUH 1QB9A 1JOUB 2AIPA 1E34B 4JYVH 1VJ9U 4AORA 3PTBA 4MTBA 3FVFB 4JCNA 2FO9A 1AE8H 2ZG0H 4Q7ZA 3ATIA 1TA6A 1SB1H 3S9BA 4KELA 5A8ZA 3KQDA 2FIRH 1ZTJA 2J4IA 5F6MA 2EI6A 2O8UA 2Z7FE 3VXFH 1GJ6A 5AVDA 1BIOA 1MH0A 4O9VA 5GCHG 5DPAA 1MKXH 1BUIA 1OS8A 1YPJH 1C5ZB 1LVMA 5CE1A 1XUFA 3P17H 2F9VA 2SNVA 3QZRA 3MU1A 1KLJH 1AY6H 1G2LA 1SHYA 4E7NA 5JBCS 1S83A 3KGPA 3RXOA 1DVAH 1P05A 3I78A 1GBCA 2BHGA 4NFEA 3ZVDA 2WPJS 4ZHAA 5L2YH 1ZGVA 1MBQA 4YLQH 2VINA 3M5MA 4Q80A 5EPNA 2BD8A 1OWIA 5JBAS 1O2YA 1IQEA 4HGCA 1EJMA 2ZU5A 2ZO3H 2H2ZA 2Z9LA 3MH6A 4Q2KA 1Y5AT 1NS3A 1QL7A 1AN1E 1DSUA 3UNRA 2Z6BD 1LKBA 1O38A 4JZFH 1IQMA 3QK1A 4LK4A 1EZUC 4AN7A 5E0GA 3AASA 1ESBA 1G36A 5T6GA 1HIAB 2ZU2A 1RJXB 1BRAA 3RXMA 4FUDA 4MNWA 2F9UA 1B0EA 1XUKA 7KMEH 1CT4E 1WBGB 4O3TA 5EU8A 1HV7A 2VWMA 3TH2H 1LKAA 3SW2B 3PYHA 5ESBA 3TK9A 1GBIA 1KIGH 3A8BA 2Y81A 2QIQA 5EW1H 3QZQA 5I25A 4A1XA 3QTOH 1KDQB 1FY3A 1AWHB 1WU1A 5C5OA 1Y3UA 2YOLA 2FMJA 1P12E 3STJA 3LGVA 2UUFB 2A0QB 4D9RA 3MU0A 4M7GA 3LJJA 3MU8A 4IW4E 3P8FA 2W3IA 1K1LA 3SV6A 1ARBA 4ISHH 1ELFA 4WH6A 1HAIH 5FPSA 3ZZ6A 2ODPA 2BD5A 4DT7B 1SFQB 1EASA 3AW0A 1GHYH 1HAHH 1VCPA 2SFAA 4ABEA 3M36A 2WPMS 2R3YA 5JB8S 2ZTXA 2ZFPH 2XYAA 4FUHA 2D26C 5HM2A 2C8YB 3A7XA 2QF0A 1UCYH 1MKWH 1AB9C 4CR5A 1HJ8A 3LC3A 1C2IA 1P9SA 1NZQH 3SNDA 1TBZH 2VJ1A 3SNBA 1DE7H 1AU8A 1ZSLA 1W2KH 3LKWA 1P57B 3F9GA 1KLTA 4ESTE 5L30H 2HOBA 1W10U 2ZDNA 1C1RA 3D49H 1HAYB 1FY1A 4XFQA 5EXLA 1PPBH 1PPEE 1Y8TA 3LT3A 3GY2A 3LPRA 1ZSJA 2Z9GA 1NY22 4UFFH 4UEHH 1DDJA 4CRAA 4ZXYH 1MZDA 2A1DB 2BQ6B 2Y5GA 4D76A 2Z9JA 1QJ1B 1K28D 4FUIA 2F91A 5HM9A 1ANCA 1ETTH 1H9IE 1LQDB 5F03A 1PFXC 1O3FA 3URCA 1MQ6A 1LHEH 4ZKNU 2B0FA 4BTUB 2AERH 1J15A 4K69A 2OP9A 4K8BA 1PPCE 1NO9H 1UTQA 4RKOB 1AIXH 1FXYA 2ANKH 2UUJB 1AB9B 3ESTA 3LGYA 1O35A 5C1UA 1J17T 1QJ6B 2ZFRH 1AFEH 3QO6A 1FDPA 1MAXA 4ISNA 1T4UH 1V2PT 2A2XH 4Y11E 4SGAE 1YPGH 1BBRH 2CV3A 1UO6A 3BEIB 1HAXB 3F9EA 1RGQA 1OXGA 3QGNB 3A89A 3EA8A 2RA0A 2W26A 3RXEA 2OD3B 2F9BH 2UUYA 4MVNA 3D65E 2ZHDA 2YNBA 3A7ZA 3T29A 1EB1H 3A85A 1DM4B 2TGAA 1J16A 2GZ7A 1YM0A 1GI2A 2HNTF 3UFAA 3G01A 3R0FA 5J4QA 1YF4A 1UTLM 3I77A 3T28A 2BVRH 3UR6A 4KGAA 1CU1A 2XWBI 2PGQB 2PLXA 1C1QA 1OP0A 1OP8A 4GVUA 1PQ8A 1A2CH 1LCYA 1V2TT 1HUTH 1SGQE 1GHVH 3O8RA 3GY6A 3CS7A 2XC4A 1CGJE 1QGFA 2ZFQH 1E36B 3TGJE 3RU4T 1EAXA 1DLEA 4ISOA 1PQ5A 2A45B 3L3TA 5B6OA 2BX4A 2QCYA 1D4PB 1GBTA 1CA0C 1XMNB 2P94A 1YPKH 4R0IA 4DJZB 1S0RA 2HPPH 1ZPZA 4BOHA 2A7CA 5F8ZA 1ZMJA 1V2OT 2DE9A 2G5VA 2GTBA 4JZEH 4NIWA 3TGIE 1LVBA 3PLBA 1QR3E 3MO9A
chains in the Genus database with same CATH superfamily
2EA3A 1FLEE 3VB4A 3AAUA 3EA9A 5HGGA 3SU0A 4I33A 3QX5H 4ABHA 1GCTC 2BMGB 2FODA 1H8HD 1YPHC 2JH5D 2UWOA 1MD7A 1RIWC 3ZZ5A 4FUCA 4IS5A 4A92A 1GL0E 3SU3A 2XTTB 1MTWA 4ACBA 1WOFA 2UWLA 2LELA 1A4WH 4U32A 2SGPE 3LH1A 1C5LH 2BY6X 2VVVA 2WSSD 2O9QA 3C1KA 1UTPA 2BD4A 2BOKA 5C1XA 3PTNA 3Q00A 2L6OA 4ABDA 1YBWA 2A7HA 1MTUA 2J95A 1O2NA 2RG3A 1Y5UT 2QA9E 3V7TA 1WQSA 2ULLA 4MDSA 4CR9A 1MBMA 3GISB 2QF5A 1C2LA 2PKSC 1V2NT 1SVPA 3M3VA 3OEHD 1J9CH 1DWEH 3S7HB 1O3IA 3SQEE 1BTUA 1O31A 1CHGA 1TRNA 3ZVAA 3BTQE 1F0RA 3GY5A 1G2MA 3LOXA 3MH4A 5ETXA 1SGIB 2AHME 2TBSA 4CBOA 1MABB 1GCTB 1L1JA 4INHA 1Z6JH 5FX5A 5FX6A 2FI3E 4K1EA 3M3SA 1RIWB 3GCOA 1O2JA 1SGEE 2LP6A 1D3PB 4D9QA 3SGBE 3NRLA 2W6JD 5C17A 2VH6A 3Q77A 1O3JA 5HIYA 3RXDA 3ZYEA 1YY3A 1VGCB 1NPMA 1W0ZU 1ZMLA 2G55A 4JZ1A 3SNAA 2OC7A 1S6LA 2FOEA 2RFKC 2CF8H 2HRVA 3RLYH 3GCNA 1FIWA 1IQGA 4DY7B 2OBQA 4OS4A 6GCHF 2C8WB 2ZFFH 4BAQB 1XVMA 1DS2E 1ARCA 2GZ9A 5F8TA 4ASHA 1IQIA 1AZ8A 4TPIZ 2PKSB 1BTHH 3PLPA 2FOHA 3EE7A 1DICA 1QURH 1O5CB 2AH4X 2QY0B 3VB7A 3SJ9A 1BDAA 1O2WA 2HALA 2WUBA 3LC5A 3SUFA 3TGKE 2BY5X 2UUKB 3SOSA 2P95A 1O2KA 3HK3B 3TPIZ 4INKA 4AX9H 1G3CA 5F8XA 4NA7A 2VB0A 3WWBA 1TE0A 2XOKD 3RMOH 1ZHPA 4D7GA 2ASUB 1JMOH 2DE8A 1F5KU 1GBMA 2BQWB 3E91A 2G8TA 3IITA 1NBMD 2FOMB 4D7FA 1LPKB 2V6NA 1K2I1 1G30B 1ETSH 1GBKA 4NSVA 2BM2A 1AD8H 5PTPA 3RC6A 3MH5A 1WTHD 3N7EA 3ZZCA 1CT2E 4B2AA 1VZQH 3GCHC 4FU9A 4YOGA 2A31A 3NK8A 1OYQA 4WWYA 5TCCA 1SQRA 1H8IH 4E06H 3K9XB 1QCPA 4YZUA 2BZ6H 1MCTA 2QXGA 2ZTZA 1JRSA 1C5QA 2FP7B 1P9UA 1AQ7A 1QBNA 1HAZB 3ATWA 3F2FA 3OFND 2BVXH 5L2ZH 1ZPCA 1C5TA 2VNTA 5KGOA 1TABE 1A5GH 1TGSZ 1O5DH 1D9IA 4K1TA 3BTKE 3NCLA 3UREA 3A88A 1TX7A 3M7QA 4X1SU 2GCTC 1QFKH 1YCPK 2BQ7B 3F0OA 3ZZ4A 4CH2B 5HXFA 4SGBE 3DD2H 4B71A 3M7TA 2QF3A 3K65B 2BY8X 2BD9A 4B1TA 5I46H 3FZDA 5DP4A 3HKIB 3PV2A 1X7AC 2KCOA 3GCHB 4WY3A 3RXVA 2XNDD 4FOUC 2VH0A 5AF9H 4ABIA 3BTFE 7ESTE 2FM2A 4YESB 4FUGA 1P2JA 4TSFD 1LMWB 1OWEA 2KCYA 4MQAA 3GCTF 1UK2A 3KQ5A 1MD8A 2WPLS 2OINA 2BXUH 3QGJA 3A80A 3GY7A 1HAPH 3PMAB 1NC6A 2H5DA 5LPEA 4H4FA 1XVOA 3Q3KA 2PGBB 4NIXA 1HAVA 2ILNA 2JETC 1Z6EA 4DURA 4DT4A 2BB4A 1EAUA 1TGTA 4GLYA 3GY4A 4RSPA 1EOLA 4TWYA 5K7RA 1JIRA 1IOEA 2KZ4A 1ABJH 3T2NA 5DKMA 1YPLH 4AFSA 3UB0A 4F48B 1MU8B 3P8NA 3GDUA 2GCTB 4B2BA 2J92A 1TGNA 4BAKB 4CHAC 1BOQA 1T7CA 1GI3A 2ZGCA 3MNBA 5T6DA 1S6HA 2ZDLA 1KTTB 2FPZA 3STIA 2GMTC 5C67A 1ANDA 1GJDB 4OS2A 1P03A 1W7GH 4GHTA 2PSYA 1CA8B 1O2VA 1P02A 1K21H 4AOQA 3LGTA 1C5OH 2PTCE 1QJ7B 2VIQA 3H09A 4Z6AH 1ZTKA 3ENSB 5TCAA 1O3LA 1V2ST 1AFQC 1V2MT 1XUGA 1L4DA 1HFDA 1P2NA 1C5PA 1H9HE 4CRFA 1BRBE 8LPRA 3RXHA 1C2MA 4GCHG 1C1UH 3NXPA 3SZNA 4AYYB 5HMAA 4O03A 2QN5T 3A82A 4Y76A 1SL3A 1QIXB 2BDIA 3FFGA 3Q3XA 1S81A 3OAAD 2G81E 2JETB 1IQNA 2J98B 1EUFA 2VU8E 4X2YA 3TITA 2J9NA 1MTSA 1DT2A 5T1VA 5EQRA 1O2MA 3GY3A 3W1EA 1JXPA 1WTGH 1E37B 1LHDH 1GWAA 5C5NA 1PPFE 4MNYA 1P2IA 5E2OA 1K1PA 3B23B 2GV6A 1SHHB 3N7DA 4CHAB 5E0HA 3K6YA 3BV9B 2XC0A 1ESTA 1P2OA 3SJ8A 3SJOA 1O5AB 4ZKRU 3GDVA 1UTMA 3MHWU 2ZHWH 4XBDA 1UVPA 2IN2A 4WMDA 3DHKH 1FMGA 1KTSB 2EQNA 3TNTA 3U1IB 2ANWA 3MU5A 1OP2A 5KEDA 2FOCA 1AFQB 2PUXB 2Z3EA 2ZF0H 4AGJA 2AEIH 1LHFH 4BNRA 1TONA 1PPHE 1A3BH 1QRWA 5DK1A 4X2XA 1GBFA 1UMAH 1ZJKA 4XSKU 5GCHF 4HZHA 3RM0H 1HJAC 2VBCA 1Z8IB 1HRTH 1Z8GA 4M9FA 1WAYB 3BTWE 3OEED 2BDAA 2V7QD 2WPDD 3LU9B 2FEQH 1XXFA 1VCQA 2QGRA 3ZZ3A 1NN6A 4K2YA 1HIAA 1NFWA 1O2HA 1P2MA 3EA7A 4ABBA 3KN2A 1WSSH 3BIVH 3O8CA 6ESTA 2SGQE 1E1RD 2EI8A 3S0NA 1IHSH 1Q31A 4H6SB 5DGJA 4B75A 2R2WU 3A7YA 1SGYE 1J14A 4CRCA 2ANYA 5A0BA 4X6NA 1P09A 1WXRA 2CJIA 2GCHG 1BJVA 2FESH 3A8CA 3KF2A 5EODA 1QBVH 1K1NA 1C2FA 5HIZA 4A6LA 5IDKA 1KDQA 1MTNC 4H6TA 3FAOA 2QXJA 5G4BA 2ANMH 3S9AA 2ZCLP 2FX6A 4GPGA 5L6NH 5CDFE 4Q63A 2HWLB 5EOKA 3VEQB 1E35B 1EQ9A 2QF4A 2WV4A 4UFEH 3RXRA 1XUHA 3U9AH 1BCUH 2B5TB 3KEEA 1HJAB 2RCEA 4F4OC 1JIMA 1AUJA 2H6MA 1C4V2 1Q3XA 4I32A 1KLIH 3SUDA 4NWLA 3ODFA 1UVUH 3UOUA 4FUFA 3BEUA 1KXCA 3BG8A 1TNLA 3OU0A 1F92A 3FOAA 1O34A 4X6PA 3PMHB 3QN7A 4Y6DA 1XUJA 2IPHA 3IWMA 4Y71A 1XM1A 2ZI2H 2R9PA 2KAIB 1BMLA 2W6ID 4KTCA 2W3KA 2VVCA 1C2KA 2K8IA 2ZZUH 4K1SA 1QB6A 3ZIAD 1NTPA 1DOJA 2SNWA 4NIVA 3ATKA 1T31A 3SNCA 1O3MA 3AK5A 1T32A 1PJPA 2FS8A 5LGOA 3DSGA 4UONA 1UTJA 2R3UA 4AG1A 1MTNB 3SNEA 4IN1A 3V0XA 3PLKA 3P95A 2P16A 1YLCA 4YT6H 2B8OH 1O3GA 2BDYA 1W13U 1XUIA 1HPGA 3HATH 4DVAU 2PFEA 4X6MA 1BHXF 3EGKH 2ZIQH 1TPOA 4HFPB 4I31A 3TH3H 1O3AA 1GHAG 1MU6B 4XDEA 2DUCA 2A32A 1CT0E 3SU6A 1LHCH 4X2VA 2CXVA 5EW2H 1U6QA 1VITH 3HKJB 1VITG 5LPFA 4JYTA 2Q1JA 1KY9A 1GJCB 1C2EA 4CRGA 2ZPRA 3CS0A 1W8BH 1YCPH 2FLRH 2O8MA 1T4VH 2FOGA 1OHHD 3ATLA 2M5TA 4Y79A 1CBWC 1T8MA 2NU0E 1H1BA 2VGCC 1VITF 4YO9A 1JRTA 1B7XB 1TYNA 2WPHS 1NT1A 4U30A 4IBLH 5DP8A 1EATA 1F5RA 2V0BA 1S84A 2GJGA 1GI9B 2C8ZB 3ZZ7A 3TVJB 1SI5H 1ANEA 1G37A 2ZWLH 4INLA 1TRYA 1THRH 4OS5A 1DY8A 5CHBA 4RKJB 1HJ9A 1A1RA 2BDBA 1EB2A 1GMCG 1W3CA 4X1PU 3VB6A 5B6LA 4YOJA 4X2WA 1P2QA 4FXGH 4MNVA 2TIOA 1ZPBA 4AFUA 1CGHA 2XWAA 2A5KA 2ZPQA 3T5FH 1E0FD 3BN9A 1DPOA 2PKAB 3P6ZB 1FZZA 1GMCF 1WCZA 1GI0A 1C4Y2 1UVTH 3LIWA 3RXPA 1GG6C 1WDIA 1N6XA 4BANB 1FQ3A 1DWBH 2EEKA 2H9EH 3ELAH 3FANA 2PW8H 4XBBA 3OSYA 4ASUD 1C5NH 4AB9A 3RU4E 1Y3VA 1ZMNA 1CBWB 1V2KT 1OWHA 2EI7A 2BD3A 1RS0A 2VGCB 5JBTA 2P8OC 1LTOA 4NGAH 1A7SA 2XC5A 2KFWA 3NZIA 5T6FA 2CN0H 1O2PA 4Y8YA 4A1TA 3DCLA 3U1JB 1W12U 3FP6E 4WMEA 8ESTE 1NM6A 5A8YA 2BY7X 2GDEH 3PWBA 1Z8RA 1PQAA 2GZ8A 4AB8A 2EY4C 3WY8A 2PHBA 1N6YA 1P04A 1L2EA 1ZYOA 1KXAA 3PV5A 1RXPA 1H8ED 4TY7A 2A4RA 1HCGA 2ZDKA 2XBYA 4RI0A 2VIOA 2PWXA 1O30A 3ZZAA 4OGYA 1YKTA 2PSXA 2ZCHP 4X0WU 1YPMH 3H5CB 2ZGHA 1DUAA 1O32A 1YLNA 1F5LA 1GBEA 2HNTC 1AGJA 3H7OA 1GDQA 1EJAA 1THPB 5DP6A 5DG6A 2Z3CA 3BTEE 3RM2H 2PR3A 1GG6B 2P3UB 5ESTE 3BF6H 3RC4A 1BJUA 1P3EA 2FZZA 4I86A 1QNJA 3DFLA 1QL9A 1C5UA 3LDXH 1CVWH 5EPYA 4B76A 1EPTC 1ELVA 2P8OB 5A8XA 1S85A 1NU7B 4K3JA 1ELBA 1RRKA 2ZDVH 1QY6A 4X8VH 3MI4A 4JZDH 2SGDE 1AMHA 2J5UA 3A8AA 2ZGBH 2QAAA 3SO3A 3ZVGA 1WV7H 1E38B 3UNSA 1YGCH 2TRMA 2OBOA 3A81A 5FBEA 1SC8U 3VPKA 1GBJA 1PYTD 2TGPZ 5ABWA 2V3HH 3SGAE 1CA0B 1GVLA 2Q6FA 1L4ZA 3RMNH 5JYIA 1ELCA 2D8WA 1QRZA 3F68H 1EZSC 3HGNA 3SI4H 1S0QA 1ANBA 1DLKB 4KKDA 3RXBA 5AFZH 1TAWA 4O97A 3CP7A 1UJ1A 3LGIA 3BTDE 1GBAA 1P3CA 2WV9A 3TJNA 3OY6U 1Q2WA 3KHVA 4P02A 1IQJA 2QC2A 5DO4H 1F2SE 2FI4E 1EPTB 1BT7A 4WMFA 4CRBA 3RXCA 1C1SA 3HPTB 1ZHRA 4DGJA 2HNTE 3OYPA 3F9HA 2BDHA 4GSOA 3SU2A 1CGIE 1LQEA 2PTNA 1IAUA 1OWJA 1XX9A 2GX4A 1LPGB 3M35A 4PROA 1O2GH 1UVOA 1NRSH 2OK5A 3UWJH 5GWZA 4MNXA 9ESTA 1YPEH 1YPHE 2VIDA 2WPIS 3V13A 3EAJA 4KTUA 4YXWD 1ELDE 4BTIB 1BITA 2ZHFH 3AAVA 4A5TS 3KNXA 1ELEE 2HGTH 1GMDG 2H1UA 3MH7A 3W95A 1EAWA 4DIIH 1D3QB 4ZKOU 4AYVB 1AE5A 1UTKA 4FUJA 3SQHE 1HNEE 1JWTA 1GMDF 4AZ2B 1NRRH 2F9OA 5T3HA 3SUEA 1O39A 1LVOA 2XXLA 3VGCC 2WUCA 1FY8E 2G51A 1SKYE 1UVSH 2FOFA 2C93B 1P0SH 1T8OA 1TALA 2CGAA 3RXFA 1RTLA 4X8UH 4NSYA 1TQ7B 4KP0A 5FAHA 3KIDU 2JH0D 1ZZZA 2YMSD 2EC9H 2HVXA 3E0PB 2VIPA 1GHWH 2F9PA 4WH8A 2BLVA 1GGDC 2CF9H 1QTFA 1GL1A 5FHTA 1HXEH 2AMDA 3C27B 1S5SA 1FAKH 3UPEA 2UWPA 3ITIA 5H4IB 1BTWA 5LH8A 1GBLA 4ZROA 2WV5A 3WW7A 1YCPM 1F0SA 3PO1C 1QA0A 2A5IA 4JK6A 1O2LA 3A84A 5E0JA 1AHTH 1GMHG 2FTMA 2NU1E 2FDAA 5E8EH 2ALVA 1GVZA 2R2MB 2AS9A 1RD3B 3SI3H 3ATMA 1UCYK 2BY9X 3VGCB 2P59A 1MKWK 1D6WA 3S9CA 1Y3YA 1K9OE 2M2AA 1SGFG 2I6QA 1GMHF 2FYQA 4GHQA 1AWFH 5EJZA 1GHZA 2SGAA 2CK3D 1FONA 1T8NA 1A0JA 2JH6D 4B2CA 3O8DA 1C1WH 2BLOA 3EQ0H 4RN6A 3UAIC 5JB9S 1PPZA 1SG8B 2GGVB 5HYOA 5DP3A 1GGDB 3SJKA 2STBE 2VIWA 1V6DA 1O3HA 1CQQA 1O2SA 1P8VC 4UFGH 5SGAE 2F3CE 3KL6A 3UR9A 3ZVEA 1SSXA 4HTCH 3MO6A 1FN8A 3W94A 3U69H 1BZXE 2Z94A 2J97A 1C5YB 3KQCA 3PO1B 2K1QA 1MCVA 3OX7U 1AKSB 4MPXA 2GT8A 3MWIU 1ELGA 2R0LA 3RU4D 1YC0A 5C3NA 3ODDA 1JBUH 1WYKA 2XCFA 4Z0KA 2OXSA 4FUEA 1VR1H 2RDLA 2G4UA 1FIZA 1GHBG 1INCA 1PPGE 4A1VA 4F55A 2GDDA 3S69A 3AVZA 1NESE 1KYNA 4H42U 4MG3A 3SU5A 1O5GH 1V3XA 3GS9A 2B7DH 1BBRK 1ACBE 5EQQA 1DWDH 4MPWA 4TWWA 3SZEA 1QQ4A 3FKSD 1GHBF 5C1YA 4OGXA 1SGFA 1HXFH 1M9UA 3HK6B 1BTXA 4FU8A 1SBWA 1HAGE 1UK4A 1XKBC 1YWUA 5BRRE 1QL8A 2HLDD 3PMBB 1NFUA 1C5XB 8GCHG 2FLBH 4RT0A 3U28C 1TPPA 1C5RA 4DG4A 3ZZBA 3OTJE 3RXTA 2J98A 1OKXA 3KQEA 1V2LT 2Q6DA 1EP6A 1EKBB 2R0KA 1YP9A 1O3BA 1C5MD 1O5BB 1TGCA 3GOVB 4MLFB 4Q7XA 4R8TB 1A61H 3MFJA 4HG6A 2QV1A 1TLDA 2ZCKP 3RMLH 3P8GA 1UHBB 4J1YA 2I6SA 1QHRB 5CMXH 3E16B 1EOJA 1ABIH 2BOHB 4GCHF 5IYTA 4NZLA 1LVYA 1O2ZA 3FZZA 2ZPSA 2Y7ZA 3SV8A 4X1QU 2W5EA 2FOBA 1O0DH 1BB0B 3SGQE 3L33A 1ZRBA 2VVUA 3OE7D 1G32B 1O3NA 2J38A 4WJG2 1HGTH 2GMTB 2XBVA 3RLWH 2ZEBA 3ZVCA 1MAYA 1GJBB 1GJAB 3RUOA 3MNXA 3M5OA 4NWKA 3T26A 2WINI 5FPTA 3JZ1B 2BLQA 9LPRA 3RXUA 2ZC9H 2VWLA 3ZV8A 1BTZA 3UNQA 4UDWH 1FI8A 2JDID 3RDZA 4X6OA 5K0HA 1P10A 1DY9A 3T27A 1BQYA 2JJ1D 2Y5FA 4IGDA 4I8GA 3SV2H 4BAMB 1EFRD 3UQOA 2Y80A 5J4SA 1QB1A 2A4OA 1SQAA 1BTYA 4U01A 4ZAEA 4I8HA 3SHCH 2ZU4A 3UQVA 1TNJA 3SV9A 4ZUHA 1THSH 2Z9IA 3PM3A 2LNCA 1BMAA 1CE5A 3UY9A 3VG8A 5GPIB 2LPRA 2KCAA 3ZVBA 1IQLA 1LDTT 2IJOB 2OLGA 2HPQH 3E90B 4FUBA 3ZV9A 5C20A 3S7KB 3NWUA 1C5VA 1XXDA 1OWDA 4Y10E 5EG4A 1EP5A 2D2DA 4A7IB 1O3EA 1ZHMA 4B6EA 1W0KD 3UIRA 4X1NU 3URDA 1FNIA 1F0UA 1GBBA 5DN6D 3U98H 3SJIA 4CREA 4AFQA 1O3KA 3U8TH 5HKKD 4IMZA 2NU3E 1EZQA 4IN2A 3NUMA 3RXQA 1B0FA 2GCHF 3RXAA 3SHAH 5GXPA 4TYDA 3E8LA 2W7SA 1GI6A 1Z1IA 3LGWA 4NG9H 1TRMA 1TQ0B 1Z71A 2KAIA 1V2QT 2ZNKH 3D62A 1V2WT 3RXSA 1T8LA 2KX4A 2ZFTA 3SN8A 1FY5A 2PUQH 2ZGJA 1HLTH 4B73A 1DWCH 2WZQA 1FAXA 3T25A 3TIUA 3VB5A 1O3CA 2AGIX 5A0AE 2FWWA 3SU1A 1GJ4H 1P06A 2XRCA 1LHGH 3TH4H 2STAE 1H8DH 3GYMA 2F83A 1ZSKA 3LGUA 1QQUA 1L1NA 1DSTA 1WUNH 4CH8B 3SU4A 3DUXH 1C9PA 1BRUP 2P93A 1FX0B 1O33A 2BVSH 4KTSA 1HB0B 1W0YH 1ZRKA 1DX5M 5EQSA 1FJSA 3A7TA 1C1NA 1GHXH 1OPHB 2OTVA 3R3GB 3DT0H 1F0TA 4MPVA 3OTPA 2AMPA 4NA8A 4X8TH 3SBKA 5DP9A 2OQUA 1DANH 1P01A 1BMFD 1W14U 1VJAU 3RXGA 5FXLA 1HAOH 1AVGH 2Z9KA 2Y6TA 4F49A 1D6RA 1AI8H 1NBME 5A0CA 5LPRA 1CHOG 2AIQA 3SUGA 4LZ1H 4U2WA 1GHAF 3P92A 3B9FH 2P3TB 1UTOA 2J34A 2ESTE 5GIBA 3SV7A 1Z8JB 2F9NA 1ETRH 1QA7A 1TOMH 4UD9H 2AGEX 4CBNA 1SLXB 2PV9B 4ZKSU 1CHOF 2ALPA 2ZECA 3A86A 4NCYA 5CHAC 1QBOA 2H5CA 3PRDA 3FP8E 1DFPA 4K5ZA 1O5EH 1DXPA 3LONA 5BPEA 4DIHH 3PV4A 2H9HA 3TK5A 1RTKA 2FTLE 2CMYA 4Y7BA 2PKAA 1COWD 2KR7A 3VFEA 3RC5A 1O37A 3Q3YA 1KMHB 1ZR0A 4XOJA 1FUJA 4Q4LA 3UOPA 4OM9A 1DUEA 1TB6H 2GT7A 1C1TA 1SLWB 1TNIA 3QUMP 2Y82A 3TK6A 1FY4A 1SOTA 1EAIA 3LJOA 1NRPH 1Z1JA 1G9IE 2VWNA 3M61U 3F3BA 2C4FH 3TU7H 4DW2U 2ZP0H 3KQBA 1V2UT 2ZU3A 1EJNA 1A5IA 1SR5C 2J94A 1MUEB 2ZA5A 3I29A 1UTNA 3VB3A 2WYJA 1SMFE 2GD4B 4UE7H 1TOCB 1DXWA 3UUZA 3A83A 4YT7H 5AHGH 1SQOA 1SLVB 1ZTLA 1O2IA 1BHXB 1F7ZA 2GKVE 5CHAB 1MMJN 3IG6B 1FN6A 1P11E 4YTAA 2BXTH 3E3TA 2A7JA 4IMQA 1BTPA 4BAOB 1G3BA 4MPUA 4ISLA 1TBQH 1HYLA 1NFXA 3GICB 1TMTH 2WPKS 2C3SA 3GYLB 4ZH8A 4AG2A 3RXKA 1GVKB 4B6FA 2NWNA 4ABJA 4WXVA 3QTVH 6CHAC 3RXJA 1UCYE 2TGDA 3UWIA 4ABAA 3F9FA 2FS9A 2H9TH 2CHAC 4ZMAH 3A7WA 1SGCA 1O2QA 1S82A 1SGNE 1GI8B 1BRCE 4NIYA 1KXEA 3K6ZA 1ZJDA 3NPSA 4ABFA 1N8OC 3Q76A 1IHTH 3NKKA 4WF8A 1C9TA 4QT8C 2AYWA 1K0HA 4Q7YA 2BD7A 4XE4A 5EJLA 2ODQA 4CRDA 2FOAA 4Y8ZA 3AW1A 1O2RA 1D3TB 1C2HA 4OS7A 1C1OA 1ID5H 2ODYB 2ZQ2A 1TFXA 1PQ7A 3LH3A 5TJXA 1EX3A 1LO6A 1O2XA 3EYDA 4FVBA 1OSSA 4P00A 1TNKA 2F43B 3PROA 1TNHA 1A5HA 1ZOMA 4I8JA 3MU4A 2Q6GA 2AGGX 1AZZA 1W0JD 5DP5A 3F6UH 1CSOE 2QXHA 1V2JT 4ABGA 1ESAA 1G3DA 2P3FH 3P8OA 5JPMH 2A4GA 1SGPE 3EE0B 1NU9A 4IC6A 3KCGH 6CHAB 5JDUB 1ELTA 2PP6A 1L0ZA 4LOYH 2BX3A 2CHAB 4Y7AA 1EPTA 2NU4E 2V35A 2XW9A 4Y0YE 3KYGA 1QZ8A 1W7XH 1VGCC 5C2ZA 3GY8A 1XKAC 1TMUH 1BBRE 2XBWA 1GI5A 7LPRA 1K22H 1N8OB 3QWCH 5GJ4B 2FI5E 3M5NA 1C1PA 1MKXK 1O3DA 3BTTE 2FYRA 4D8NA 1O2OA 2V3OH 2G4TA 1H9LB 1K1MA 5FCKA 3EDXB 4Y8XA 3B8JA 1IQKA 1FV9A 4Y0ZE 4E7RG 4VGCC 5A2MH 5EXMA 1TX8A 3ZVFA 2BDCA 5JBBS 1MZAA 1V2VT 4B74A 1B5GH 4WVPE 5DSFA 2YNAA 1G3EA 4I8LA 2O8WA 2OUAA 2V3MA 3V3MA 4ZXXH 4OS1A 3PRBA 5FPYA 1GBDA 1TGBA 1TNGA 3O8BA 2ZKSA 2TGTA 1L1GA 2BZAA 4ISIH 2JKHA 3D23A 1ORFA 3T62A 6GCHG 5EIYA 2A2QH 3QLPH 1BA8B 1GDNA 5C0TA 3E1XB 1K1JA 2Y5HA 2TPIZ 1C5WB 4BXSA 1GBHA 1OOKB 3F1SB 2RA3A 1FPCH 5IK2D 2OC8A 2GVFA 1GI4A 4JK5A 1GCDA 4DCDA 1OYTH 3TJUA 1GI7B 2A4QA 2ZDAH 4WXIA 2W7UA 6LPRA 1EZXC 1GPZA 3MNSA 1KXBA 4VGCB 3UTUH 4FETA 4NFFA 2BLWA 1ZLRA 3MTYA 1O5FH 2WYGA 1A46H 2ZHEH 1KXDA 3DFJA 1GI1A 2THFB 4FU7A 7GCHG 1C2JA 4ZHMU 1K1OA 2GP9B 4THNH 3M37A 2ZQ1A 2BD2A 1UK3A 2OQ5A 2RDEA 4NZQA 4GAWA 4I7YH 4HI3A 3F0PA 3RP2A 3E0NB 1GJ9B 3VXEH 1MQ5A 4JMYA 3SYJA 2BTCE 1GDUA 7GCHF 1TPAE 1C2GA 2A5AA 3H7TA 2BYAX 3PMJA 1KSNA 3MQKC 4TPYA 2XBXA 2HVYB 3SORA 1O3PB 1QRXA 1OX1A 1KXFA 1C1MA 2OCVB 4O3UA 2C8XB 3F2HA 3N7OA 3P70B 1BMMH 1LPZB 1RTFB 3PB1E 3JZ2B 5DP7A 1GJ5H 1O2TA 1C1VH 3BTGE 5FBIA 4IC5A 3MMGA 1A0LA 2B9LA 1SGTA 1AO5A 1HBTH 4X1RU 1O3OA 2ZDMA 3ZZ8A 1NFYA 8KME2 2O8TA 1A0HB 3RMMH 3V12A 2ZTYA 5EJ1A 4I8KA 4K8YA 4Z1MD 3U8RH 1TWXB 1S6FA 1TA2A 2GV7A 3TJOA 1SGDE 2OC0A 1J8AA 1Z7KA 3FN8A 1TMBH 2AFQB 2HLCA 5DJ7A 1GJ8B 1TBRH 1AKSA 2SGFE 2AMQA 5A09A 1W11U 3MNCA 1K1IA 1BMNH 2NU2E 1D3DB 1EXFA 1N1LA 1O2UA 5GNDA 1IQFA 4JZIA 4BXWA 3PWCA 1Y5BT 2J2UA 1YYY1 3L6PA 3ZZDA 3BSQA 4JYUH 3K2UA 4DOQA 1C5SA 1RFNA 2XNIA 4ACAA 2OC1A 3M3TA 4LXBH 4XD7D 4ZCNA 1P2KA 2VWOA 1Y3WA 3GCTG 1OWKA 3DA9B 4J2YB 3OY5U 1TX6A 1AUTC 2D1JA 3ZZ9A 4XBCA 4GUXA 4OS6A 1SGRE 1O36A 1H4WA 4AFZA 1DITH 3TJVA 2IOTA 4YM9A 4LZ4B 1ZGIA 2O8LA 3GDSA 2VIVA 4YLUA 1WQVH 1Y59T 2G52A 2QYIA 5E2PA 1FPHH 2ZGXH 2KCPA 3QDZB 4NA9H 3BG4C 4YOIA 3BTME 2FXRA 1CO7E 1A3EH 1C2DA 5EGMA 3A87A 1SQTA 4XRNA 2XCNA 2ZFSA 5AFYH 1SOZA 4FVDA 1AVWA 1VCWA 1UHBA 2G00A 1Y3XA 3BEFB 2FX4A 3U8OH 1TIOA 4BTTB 1NROH 1NRNH 1HAVB 2C90B 3M7UA 1MTVA 3TLOA 8GCHF 5FCRA 3CENA 5EXNA 3A7VA 4ZHLU 2WHXA 1ELAA 1PYTC 1SPJA 1HDTH 2Y7XA 5GDSH 2ZU1A 1YLDA 2ZHQH 3HGPA 4BAHB 3FP7E 1GJ7B 2K0QA 3MYWA 4UFDH 1SLUB 1V2RT 4AGKA 4X8SH 2L74A 1IQHA 1TPSA 2BDGA 1E79D 3RXLA 1NRQH 2QXIA 3M5LA 3RXIA 3ZYDA 4E05H 1C4U2 3BG4B 3MOCA 1SFIA 3A8DA 2G5NA 4TY6A 3E6PH 1AVXA 4K60A 2Z3DA 3BTHE 3TNSA 2SGEE 3MO3A 1UW7A 3BIUH 1QB9A 1JOUB 2AIPA 1E34B 4JYVH 1VJ9U 2IJD1 4AORA 3PTBA 4MTBA 3FVFB 4JCNA 5C0UA 2FO9A 1AE8H 2ZG0H 4Q7ZA 3WWFA 3ATIA 1TA6A 1SB1H 3S9BA 4KELA 2IPQX 5A8ZA 3KQDA 2FIRH 1ZTJA 2J4IA 5F6MA 2EI6A 2O8UA 2Z7FE 3VXFH 1GJ6A 5AVDA 5C94A 1BIOA 1MH0A 4O9VA 5GCHG 5DPAA 1MKXH 1BUIA 1OS8A 1YPJH 1C5ZB 1LVMA 5CE1A 1XUFA 3P17H 2F9VA 2SNVA 3QZRA 3MU1A 1KLJH 1AY6H 1G2LA 1SHYA 4E7NA 5JBCS 1S83A 3KGPA 3RXOA 1DVAH 1P05A 3CNRA 3I78A 1GBCA 2BHGA 4NFEA 3ZVDA 2WPJS 4ZHAA 5L2YH 1ZGVA 1MBQA 4YLQH 2VINA 3M5MA 4Q80A 5EPNA 2BD8A 1OWIA 5JBAS 1O2YA 1IQEA 4HGCA 1EJMA 2ZU5A 2ZO3H 2H2ZA 2Z9LA 3MH6A 4Q2KA 1Y5AT 1NS3A 1QL7A 1AN1E 1DSUA 2YMSC 4AC9A 3UNRA 2Z6BD 1LKBA 1O38A 5KECA 4JZFH 1IQMA 3QK1A 4LK4A 1EZUC 4AN7A 5E0GA 3AASA 1ESBA 1G36A 5T6GA 1VKYA 1HIAB 2ZU2A 1RJXB 1BRAA 3RXMA 4FUDA 4MNWA 2QE7D 2F9UA 1B0EA 1XUKA 7KMEH 1CT4E 1WBGB 3N99A 4O3TA 5EU8A 1HV7A 2VWMA 3TH2H 1LKAA 3SW2B 3PYHA 5ESBA 3TK9A 1GBIA 1KIGH 3A8BA 2Y81A 2QIQA 2KM0A 3QZQA 5EW1H 5I25A 4A1XA 3QTOH 1KDQB 1FY3A 1AWHB 1WU1A 5C5OA 1Y3UA 2YOLA 2FMJA 1P12E 3STJA 3LGVA 2UUFB 2A0QB 4D9RA 3MU0A 4M7GA 3LJJA 3MU8A 4IW4E 3P8FA 2W3IA 1K1LA 3SV6A 1ARBA 1E1QD 1ELFA 4ISHH 1HAIH 4WH6A 5FPSA 2ODPA 2BD5A 2YMSB 3ZZ6A 4DT7B 1SFQB 1EASA 3AW0A 1GHYH 1HAHH 1VCPA 2SFAA 4ABEA 3M36A 5FL7D 2WPMS 2R3YA 4RT1A 5JB8S 2ZTXA 2ZFPH 2XYAA 4FUHA 2D26C 5HM2A 2C8YB 3A7XA 2QF0A 1UCYH 1MKWH 1AB9C 4CR5A 1HJ8A 3LC3A 1C2IA 1P9SA 1NZQH 3SNDA 1TBZH 2VJ1A 3SNBA 1DE7H 1AU8A 1ZSLA 1W2KH 3LKWA 1P57B 3F9GA 1KLTA 4ESTE 5L30H 2HOBA 1W10U 2ZDNA 1C1RA 3D49H 1HAYB 1FY1A 4XFQA 5EXLA 1PPBH 1PPEE 1Y8TA 3LT3A 3GY2A 3LPRA 1ZSJA 2Z9GA 1NY22 4UFFH 4UEHH 1DDJA 2JJ2D 4CRAA 4ZXYH 1MZDA 3KYFA 2A1DB 2BQ6B 2Y5GA 4D76A 2Z9JA 4TT3D 1QJ1B 1K28D 4FUIA 2F91A 5HM9A 1ANCA 1ETTH 1H9IE 1LQDB 5F03A 1PFXC 1O3FA 3URCA 1MQ6A 1LHEH 4ZKNU 2B0FA 4BTUB 2AERH 1J15A 4K69A 2OP9A 4K8BA 1PPCE 1NO9H 1UTQA 4RKOB 1AIXH 1FXYA 2ANKH 2UUJB 1AB9B 3ESTA 3LGYA 1O35A 5C1UA 1J17T 1QJ6B 2ZFRH 1AFEH 3QO6A 1FDPA 1MAXA 4ISNA 1T4UH 1V2PT 2A2XH 4Y11E 4SGAE 1YPGH 1BBRH 2CV3A 1UO6A 3BEIB 1HAXB 3F9EA 3FO8D 1RGQA 1OXGA 3QGNB 3A89A 3EA8A 2RA0A 2W26A 3RXEA 2OD3B 2F9BH 2UUYA 4MVNA 3D65E 2ZHDA 2YNBA 3A7ZA 3F2GA 3T29A 1EB1H 3A85A 5F53A 1DM4B 2TGAA 1J16A 2GZ7A 2F4LA 1YM0A 1GI2A 2HNTF 3UFAA 3G01A 3R0FA 5J4QA 1YF4A 1UTLM 3I77A 3T28A 2BVRH 3UR6A 4KGAA 1CU1A 2XWBI 2PGQB 2PLXA 1C1QA 1OP0A 1OP8A 4GVUA 1PQ8A 1A2CH 1LCYA 1V2TT 1HUTH 1SGQE 1GHVH 3O8RA 3GY6A 3CS7A 2XC4A 1CGJE 1QGFA 2ZFQH 1E36B 3TGJE 3RU4T 1EAXA 1DLEA 2JIZD 4ISOA 1PQ5A 2A45B 3L3TA 5B6OA 2BX4A 3DSPA 2QCYA 1D4PB 1GBTA 1CA0C 1XMNB 2P94A 1YPKH 4R0IA 4DJZB 1S0RA 2HPPH 3DSOA 1ZPZA 4BOHA 2A7CA 5F8ZA 1ZMJA 1V2OT 2DE9A 2G5VA 2GTBA 4JZEH 4NIWA 3TGIE 1LVBA 3PLBA 1QR3E 3MO9A
chains in the Genus database with same CATH topology
2EA3A 1FLEE 3VB4A 3AAUA 3EA9A 5HGGA 3SU0A 4I33A 3QX5H 4ABHA 1GCTC 2BMGB 2FODA 1YPHC 2JH5D 2UWOA 1MD7A 1RIWC 3ZZ5A 4FUCA 4IS5A 4A92A 1GL0E 3SU3A 2XTTB 1MTWA 1WOFA 2UWLA 1A4WH 4U32A 2SGPE 3LH1A 1C5LH 2BY6X 2VVVA 2O9QA 3C1KA 1UTPA 2BD4A 2BOKA 5C1XA 3PTNA 3Q00A 4ABDA 1YBWA 2A7HA 1MTUA 2J95A 1O2NA 2RG3A 1Y5UT 2QA9E 3V7TA 1WQSA 2ULLA 4MDSA 4CR9A 1MBMA 3GISB 1C2LA 2PKSC 1V2NT 1SVPA 3M3VA 1J9CH 1DWEH 3S7HB 1O3IA 3SQEE 1BTUA 1O31A 1CHGA 1TRNA 3ZVAA 3BTQE 1F0RA 3GY5A 1G2MA 3LOXA 3MH4A 5ETXA 1SGIB 4CBOA 2TBSA 1GCTB 1L1JA 4INHA 1Z6JH 5FX5A 5FX6A 2FI3E 4K1EA 3M3SA 1RIWB 3GCOA 1O2JA 1SGEE 1D3PB 4D9QA 3SGBE 2VH6A 3Q77A 1O3JA 3RXDA 3ZYEA 1VGCB 1NPMA 1W0ZU 1ZMLA 2G55A 4JZ1A 3SNAA 2OC7A 2FOEA 2CF8H 2HRVA 3RLYH 3GCNA 1FIWA 1IQGA 4DY7B 2OBQA 4OS4A 6GCHF 2C8WB 2ZFFH 4BAQB 1XVMA 1DS2E 1ARCA 2GZ9A 5F8TA 4ASHA 1IQIA 1AZ8A 4TPIZ 2PKSB 1BTHH 3PLPA 2FOHA 1DICA 1QURH 1O5CB 2AH4X 2QY0B 3VB7A 3SJ9A 1BDAA 1O2WA 2HALA 2WUBA 3LC5A 3SUFA 3TGKE 2BY5X 2UUKB 3SOSA 2P95A 1O2KA 3HK3B 3TPIZ 4INKA 4AX9H 1G3CA 5F8XA 4NA7A 2VB0A 1TE0A 3RMOH 1ZHPA 4D7GA 2ASUB 1JMOH 2DE8A 1F5KU 1GBMA 2BQWB 3E91A 2G8TA 3IITA 2FOMB 4D7FA 1LPKB 2V6NA 1K2I1 1G30B 1ETSH 1GBKA 4NSVA 2BM2A 1AD8H 5PTPA 3RC6A 3MH5A 1WTHD 3ZZCA 1CT2E 4B2AA 1VZQH 3GCHC 4FU9A 4YOGA 2A31A 3NK8A 1OYQA 4WWYA 5TCCA 1H8IH 4E06H 3K9XB 1QCPA 4YZUA 2BZ6H 1MCTA 2QXGA 2ZTZA 1JRSA 1C5QA 2FP7B 1P9UA 1AQ7A 1QBNA 1HAZB 3ATWA 2BVXH 5L2ZH 1ZPCA 1C5TA 2VNTA 1TABE 1A5GH 1TGSZ 1O5DH 1D9IA 4K1TA 3BTKE 3NCLA 3UREA 3A88A 1TX7A 3M7QA 4X1SU 2GCTC 1QFKH 1YCPK 2BQ7B 3ZZ4A 4CH2B 5HXFA 4SGBE 3DD2H 4B71A 3M7TA 2QF3A 3K65B 2BY8X 2BD9A 4B1TA 5I46H 3FZDA 5DP4A 3HKIB 1X7AC 3GCHB 4WY3A 3RXVA 2VH0A 5AF9H 4ABIA 3BTFE 7ESTE 2FM2A 4YESB 4FUGA 1P2JA 1LMWB 1OWEA 4MQAA 3GCTF 1UK2A 1MD8A 2WPLS 2OINA 2BXUH 3QGJA 3A80A 3GY7A 1HAPH 3PMAB 1NC6A 2H5DA 5LPEA 4H4FA 1XVOA 3Q3KA 2PGBB 4NIXA 1HAVA 2ILNA 2JETC 1Z6EA 4DURA 2BB4A 1EAUA 1TGTA 4GLYA 3GY4A 4RSPA 1EOLA 4TWYA 5K7RA 1JIRA 1IOEA 1ABJH 3T2NA 5DKMA 1YPLH 4AFSA 1MU8B 3P8NA 3GDUA 2GCTB 4B2BA 2J92A 1TGNA 4BAKB 4CHAC 1BOQA 1T7CA 1GI3A 2ZGCA 3MNBA 5T6DA 1S6HA 2ZDLA 1KTTB 2FPZA 3STIA 2GMTC 5C67A 1ANDA 1GJDB 4OS2A 1P03A 1W7GH 4GHTA 2PSYA 1CA8B 1O2VA 1P02A 1K21H 4AOQA 3LGTA 1C5OH 2PTCE 1QJ7B 2VIQA 4Z6AH 1ZTKA 3ENSB 5TCAA 1O3LA 1V2ST 1AFQC 1V2MT 1XUGA 1L4DA 1HFDA 1P2NA 1C5PA 1H9HE 4CRFA 1BRBE 8LPRA 3RXHA 1C2MA 4GCHG 1C1UH 3NXPA 3SZNA 4AYYB 5HMAA 4O03A 2QN5T 3A82A 4Y76A 1SL3A 1QIXB 2BDIA 3FFGA 3Q3XA 1S81A 2G81E 2JETB 1IQNA 1EUFA 2VU8E 4X2YA 3TITA 2J9NA 1MTSA 1DT2A 5EQRA 1O2MA 3GY3A 1JXPA 1WTGH 1E37B 1LHDH 1GWAA 5C5NA 1PPFE 4MNYA 1P2IA 5E2OA 1K1PA 3B23B 2GV6A 1SHHB 4CHAB 5E0HA 3K6YA 3BV9B 2XC0A 1ESTA 1P2OA 3SJ8A 3SJOA 1O5AB 4ZKRU 3GDVA 1UTMA 3MHWU 2ZHWH 4XBDA 1UVPA 2IN2A 4WMDA 3DHKH 1FMGA 1KTSB 3TNTA 3U1IB 2ANWA 3MU5A 1OP2A 2FOCA 1AFQB 2PUXB 2Z3EA 2ZF0H 4AGJA 2AEIH 1LHFH 4BNRA 1TONA 1PPHE 1A3BH 1QRWA 5DK1A 4X2XA 1GBFA 1UMAH 1ZJKA 4XSKU 5GCHF 4HZHA 3RM0H 1HJAC 1Z8IB 1HRTH 1Z8GA 1WAYB 3BTWE 2BDAA 3LU9B 2FEQH 1XXFA 1VCQA 2QGRA 3ZZ3A 1NN6A 4K2YA 1HIAA 1NFWA 1O2HA 1P2MA 3EA7A 4ABBA 3KN2A 1WSSH 3BIVH 3O8CA 6ESTA 2SGQE 2EI8A 3S0NA 1IHSH 1Q31A 4H6SB 5DGJA 4B75A 2R2WU 3A7YA 1SGYE 1J14A 4CRCA 2ANYA 5A0BA 4X6NA 1P09A 2CJIA 2GCHG 1BJVA 2FESH 3A8CA 3KF2A 5EODA 1QBVH 1K1NA 1C2FA 4A6LA 5IDKA 1KDQA 1MTNC 4H6TA 3FAOA 2QXJA 5G4BA 2ANMH 3S9AA 2ZCLP 2FX6A 4GPGA 5L6NH 2HWLB 5EOKA 3VEQB 1E35B 1EQ9A 2WV4A 4UFEH 3RXRA 1XUHA 3U9AH 1BCUH 2B5TB 3KEEA 1HJAB 2RCEA 4F4OC 1JIMA 1AUJA 2H6MA 1C4V2 1Q3XA 4I32A 1KLIH 3SUDA 4NWLA 3ODFA 1UVUH 3UOUA 4FUFA 3BEUA 1KXCA 3BG8A 1TNLA 3OU0A 1F92A 1O34A 4X6PA 3PMHB 3QN7A 4Y6DA 1XUJA 2IPHA 3IWMA 4Y71A 1XM1A 2ZI2H 2R9PA 2KAIB 1BMLA 4KTCA 2W3KA 2VVCA 1C2KA 2ZZUH 4K1SA 1QB6A 1NTPA 1DOJA 2SNWA 4NIVA 3ATKA 1T31A 3SNCA 1O3MA 1T32A 1PJPA 2FS8A 5LGOA 4UONA 1UTJA 2R3UA 4AG1A 1MTNB 3SNEA 4IN1A 3V0XA 3PLKA 3P95A 2P16A 1YLCA 4YT6H 2B8OH 1O3GA 2BDYA 1W13U 1XUIA 1HPGA 3HATH 4DVAU 2PFEA 4X6MA 1BHXF 3EGKH 2ZIQH 1TPOA 4HFPB 4I31A 3TH3H 1O3AA 1GHAG 1MU6B 4XDEA 2DUCA 2A32A 1CT0E 3SU6A 1LHCH 4X2VA 2CXVA 5EW2H 1U6QA 1VITH 3HKJB 1VITG 5LPFA 4JYTA 2Q1JA 1KY9A 1GJCB 1C2EA 4CRGA 2ZPRA 3CS0A 1W8BH 1YCPH 2FLRH 2O8MA 1T4VH 2FOGA 3ATLA 2M5TA 4Y79A 1CBWC 1T8MA 2NU0E 1H1BA 2VGCC 1VITF 4YO9A 1JRTA 1B7XB 1TYNA 2WPHS 1NT1A 4U30A 4IBLH 5DP8A 1EATA 1F5RA 2V0BA 1S84A 1GI9B 2C8ZB 3ZZ7A 3TVJB 1SI5H 1ANEA 1G37A 2ZWLH 4INLA 1TRYA 1THRH 4OS5A 1DY8A 4RKJB 1HJ9A 1A1RA 2BDBA 1EB2A 1GMCG 1W3CA 4X1PU 3VB6A 4YOJA 4X2WA 1P2QA 4FXGH 4MNVA 2TIOA 1ZPBA 4AFUA 1CGHA 2XWAA 2A5KA 2ZPQA 3T5FH 1E0FD 3BN9A 1DPOA 2PKAB 3P6ZB 1FZZA 1GMCF 1WCZA 1GI0A 1C4Y2 1UVTH 3LIWA 3RXPA 1GG6C 1N6XA 4BANB 1FQ3A 1DWBH 2EEKA 2H9EH 3ELAH 3FANA 2PW8H 4XBBA 3OSYA 1C5NH 4AB9A 3RU4E 1Y3VA 1ZMNA 1CBWB 1V2KT 1OWHA 2EI7A 2BD3A 1RS0A 2VGCB 5JBTA 2P8OC 1LTOA 4NGAH 1A7SA 2XC5A 3NZIA 5T6FA 2CN0H 1O2PA 4Y8YA 4A1TA 3U1JB 1W12U 3FP6E 4WMEA 8ESTE 1NM6A 5A8YA 2BY7X 2GDEH 3PWBA 1Z8RA 1PQAA 2GZ8A 4AB8A 3WY8A 2PHBA 1N6YA 1P04A 1L2EA 1ZYOA 1KXAA 1RXPA 4TY7A 2A4RA 1HCGA 2ZDKA 2XBYA 2VIOA 2PWXA 1O30A 3ZZAA 4OGYA 1YKTA 2PSXA 2ZCHP 4X0WU 1YPMH 3H5CB 2ZGHA 1DUAA 1O32A 1F5LA 1GBEA 2HNTC 1AGJA 3H7OA 1GDQA 1EJAA 1THPB 5DP6A 5DG6A 2Z3CA 3BTEE 3RM2H 2PR3A 1GG6B 2P3UB 5ESTE 3BF6H 3RC4A 1BJUA 1P3EA 2FZZA 1QNJA 3DFLA 1QL9A 1C5UA 3LDXH 1CVWH 5EPYA 4B76A 1EPTC 1ELVA 2P8OB 5A8XA 1S85A 1NU7B 4K3JA 1ELBA 1RRKA 2ZDVH 1QY6A 4X8VH 3MI4A 4JZDH 2SGDE 1AMHA 3SO3A 3A8AA 2ZGBH 2QAAA 3ZVGA 1WV7H 1E38B 3UNSA 1YGCH 2TRMA 2OBOA 3A81A 5FBEA 1SC8U 3VPKA 1GBJA 1PYTD 2TGPZ 5ABWA 2V3HH 3SGAE 1CA0B 1GVLA 2Q6FA 1L4ZA 3RMNH 5JYIA 1ELCA 2D8WA 1QRZA 3F68H 1EZSC 3HGNA 3SI4H 1S0QA 1ANBA 1DLKB 4KKDA 3RXBA 5AFZH 1TAWA 4O97A 3CP7A 1UJ1A 3LGIA 3BTDE 1GBAA 1P3CA 3TJNA 3OY6U 1Q2WA 3KHVA 1IQJA 2QC2A 5DO4H 1F2SE 2FI4E 1EPTB 1BT7A 4WMFA 4CRBA 3RXCA 1C1SA 3HPTB 1ZHRA 4DGJA 2HNTE 3OYPA 3F9HA 2BDHA 4GSOA 3SU2A 1CGIE 1LQEA 2PTNA 1IAUA 1OWJA 1XX9A 2GX4A 1LPGB 3M35A 4PROA 1O2GH 1UVOA 1NRSH 3UWJH 5GWZA 4MNXA 9ESTA 1YPEH 1YPHE 2VIDA 2WPIS 3V13A 3EAJA 4KTUA 1ELDE 4BTIB 1BITA 2ZHFH 3AAVA 4A5TS 3KNXA 1ELEE 2HGTH 1GMDG 2H1UA 3MH7A 3W95A 1EAWA 4DIIH 1D3QB 4ZKOU 4AYVB 1AE5A 1UTKA 4FUJA 3SQHE 1HNEE 1JWTA 1GMDF 4AZ2B 1NRRH 2F9OA 5T3HA 3SUEA 1O39A 1LVOA 2XXLA 3VGCC 2WUCA 1FY8E 2G51A 1UVSH 2FOFA 2C93B 1P0SH 1T8OA 1TALA 2CGAA 3RXFA 1RTLA 4X8UH 4NSYA 1TQ7B 4KP0A 5FAHA 3KIDU 2JH0D 1ZZZA 2EC9H 2HVXA 3E0PB 2VIPA 1GHWH 2F9PA 4WH8A 2BLVA 1GGDC 2CF9H 1QTFA 1GL1A 5FHTA 1HXEH 2AMDA 3C27B 1S5SA 1FAKH 3UPEA 2UWPA 3ITIA 5H4IB 1BTWA 5LH8A 1GBLA 4ZROA 2WV5A 1YCPM 1F0SA 3PO1C 1QA0A 2A5IA 4JK6A 1O2LA 3A84A 5E0JA 1AHTH 1GMHG 2FTMA 2NU1E 2FDAA 5E8EH 2ALVA 1GVZA 2R2MB 2AS9A 1RD3B 3SI3H 3ATMA 1UCYK 2BY9X 3VGCB 2P59A 1MKWK 1D6WA 3S9CA 1Y3YA 1K9OE 1SGFG 2I6QA 1GMHF 2FYQA 4GHQA 1AWFH 1GHZA 2SGAA 1FONA 1T8NA 1A0JA 2JH6D 4B2CA 3O8DA 1C1WH 2BLOA 3EQ0H 4RN6A 5JB9S 1PPZA 1SG8B 2GGVB 5HYOA 5DP3A 1GGDB 3SJKA 2STBE 2VIWA 1V6DA 1O3HA 1CQQA 1O2SA 1P8VC 4UFGH 5SGAE 2F3CE 3KL6A 3UR9A 3ZVEA 1SSXA 4HTCH 3MO6A 1FN8A 3W94A 3U69H 1BZXE 2Z94A 1C5YB 3KQCA 3PO1B 2K1QA 1MCVA 3OX7U 1AKSB 4MPXA 2GT8A 3MWIU 1ELGA 2R0LA 3RU4D 1YC0A 5C3NA 3ODDA 1JBUH 1WYKA 2XCFA 4Z0KA 2OXSA 4FUEA 1VR1H 2RDLA 2G4UA 1FIZA 1GHBG 1INCA 1PPGE 4A1VA 2GDDA 3S69A 3AVZA 1NESE 1KYNA 4H42U 4MG3A 3SU5A 1O5GH 1V3XA 2B7DH 1BBRK 1ACBE 5EQQA 1DWDH 4MPWA 4TWWA 1QQ4A 5C1YA 1GHBF 4OGXA 1SGFA 1HXFH 1M9UA 3HK6B 1BTXA 4FU8A 1SBWA 1HAGE 1UK4A 1XKBC 5BRRE 1QL8A 3PMBB 1NFUA 1C5XB 8GCHG 2FLBH 1TPPA 1C5RA 4DG4A 3ZZBA 3OTJE 3RXTA 1OKXA 3KQEA 1V2LT 2Q6DA 1EP6A 1EKBB 2R0KA 1YP9A 1O3BA 1C5MD 1O5BB 1TGCA 3GOVB 4MLFB 4Q7XA 4R8TB 1A61H 3MFJA 2QV1A 1TLDA 2ZCKP 3RMLH 3P8GA 1UHBB 4J1YA 2I6SA 1QHRB 5CMXH 3E16B 1EOJA 1ABIH 2BOHB 4GCHF 5IYTA 4NZLA 1LVYA 1O2ZA 3FZZA 2ZPSA 2Y7ZA 3SV8A 4X1QU 2W5EA 2FOBA 1O0DH 1BB0B 3SGQE 3L33A 1ZRBA 2VVUA 1G32B 1O3NA 2J38A 4WJG2 1HGTH 2GMTB 2XBVA 3RLWH 2ZEBA 3ZVCA 1MAYA 1GJBB <