1GJCB

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
total genus 51
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjcB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjcB01
4FVDA 1PPBH 3MNBA 4XE4A 2OBQA 3UWIA 2ZFRH 5A0BA 2K1QA 2Z9JA 1CO7E 1S83A 1UVOA 1AWFH 1W0YH 1AVWA 2VIPA 4WJG2 4YOGA 2BD5A 1CT0E 2QF0A 4I8LA 3PM3A 3TH2H 1UTKA 2ZDKA 3SUGA 1FUJA 1O2JA 1Z8JB 1BRCE 1N8OC 1W3CA 1C2IA 4E7RG 1TX7A 2G00A 5C3NA 2PV9B 1YPEH 2FESH 2RCEA 2WINI 3P8GA 1UHBA 1RTFB 5C1XA 1GHAG 2O9QA 1C1RA 1YPHE 1KXAA 2HPQH 1LMWB 1ANDA 3AW1A 2BM2A 2XCFA 3SNCA 2W26A 1H9HE 2Z3DA 3VXFH 1IQHA 1GHXH 1AFQB 3IWMA 1S5SA 1HB0B 3EA7A 1C1QA 1GMCG 1V6DA 3BN9A 1XUJA 1EAUA 3A8DA 2VGCC 3F9FA 1AZZA 3KCGH 1OWHA 2BQ7B 2WV4A 2B9LA 2ZFSA 1ZRBA 1AVGH 3KEEA 2H6MA 1E36B 4ISLA 2J95A 5GDSH 3QTOH 4JCNA 1GDUA 1GL1A 1SL3A 5ABWA 3RDZA 4F4OC 1OP0A 1FPCH 1BBRK 1GPZA 1HV7A 1O2MA 1YCPH 1DX5M 1O34A 4ZXYH 2Y80A 2EA3A 1N6YA 3PMBB 5E0GA 2PGQB 3NK8A 3E0PB 1C2JA 1GJCB 2FXRA 3QWCH 1CGIE 2EC9H 1Z1IA 2SNVA 5K7RA 1QFKH 2PHBA 1TLDA 2O8WA 4X6NA 4NIXA 2ANKH 2GCHG 4FUIA 2BY9X 2VWMA 1GI5A 1K2I1 1T8MA 2A5AA 1P05A 1QRXA 3A83A 3S69A 1TRYA 4RKJB 3GY4A 1TFXA 4Y6DA 1UO6A 3NPSA 2ZQ1A 2ZFTA 2BD9A 2W7SA 2D26C 2I6QA 4JK6A 1C5QA 1O3KA 1VCWA 2BXTH 3SNDA 1QCPA 1O2GH 3BIVH 1W7GH 1KYNA 4GAWA 4SGAE 2AIQA 3ZVEA 2ZTXA 3SGBE 1TPOA 3P8NA 1DSTA 3NZIA 1NFYA 1TMUH 3E6PH 2OUAA 1K1MA 4JZDH 1SQTA 3VEQB 1ZGVA 1UK3A 1AWHB 1KLTA 2AMQA 5E8EH 3SBKA 3RXKA 1QL7A 3SV9A 2FS9A 2ZCLP 1HAYB 5BRRE 2RA3A 1LVMA 5BPEA 1C4U2 3RXCA 2A1DB 1WTHD 3IITA 4KELA 1ELGA 3P8FA 1GHWH 3FP8E 3QGJA 1GHAF 5DO4H 3Q00A 4ZH8A 4BNRA 3TVJB 3E8LA 1SG8B 5DGJA 4X8UH 1BCUH 1A46H 1MTSA 5EG4A 4BXSA 3P92A 4YOIA 1F7ZA 3BTGE 1AGJA 3PTBA 4Q2KA 1XXDA 1TB6H 3KNXA 1KTTB 4I8JA 4X6PA 1NY22 4TWYA 1K1LA 1GMCF 4Y10E 2A7HA 4IC5A 3RMMH 1SLXB 1B7XB 1OX1A 1J9CH 1NZQH 2A45B 1YCPK 4WH6A 4NSVA 1E38B 2GD4B 3BV9B 4ABEA 1TE0A 1ZZZA 2ZEBA 4AB9A 3F6UH 1F0UA 1GBEA 3VB5A 2TGAA 3QO6A 1WBGB 1MQ5A 1P9SA 3UIRA 1LPKB 2A0QB 4UE7H 1ZMNA 1GVZA 1UMAH 2FS8A 4ABFA 3M3TA 1HAVA 1J14A 4IBLH 4X8TH 2VH0A 1AHTH 2TGDA 1SLVB 3RP2A 5J4SA 1H9IE 2P3TB 4U30A 5E0JA 3DD2H 1JRTA 1Y3XA 4E05H 4QT8C 2A32A 3A8AA 2ZHQH 3GDUA 4FUDA 1KXBA 2QGRA 1NRSH 3PMAB 3OYPA 1O3EA 4ZROA 1SHYA 1OYQA 5JDUB 2F91A 3RXRA 3SQHE 1SQAA 4AG1A 1V2RT 5GJ4B 2ZCHP 3A84A 1XMNB 3I78A 1IQIA 3RXEA 3A80A 4CHAB 3W95A 1IOEA 1RTKA 2FOMB 2ZC9H 4CR9A 1L1JA 1S0QA 2TGTA 3UQOA 2P16A 1BMNH 1ESAA 4AFSA 3PO1B 4MG3A 1DY9A 1HJ9A 2PKAA 1ZMLA 2FPZA 2Y5HA 2AEIH 2ZCKP 4D8NA 2GDDA 1GJ9B 1F0RA 2GDEH 1V2LT 5GXPA 1S0RA 3T25A 1KLJH 2PLXA 4FU7A 3SU5A 3QUMP 4UFFH 4FUJA 4X0WU 2XWAA 8LPRA 1GBIA 4I32A 2JH5D 1P11E 1UK2A 3MYWA 2AFQB 7LPRA 1LHGH 1O2TA 1LKBA 1QQ4A 2DE9A 2A5IA 2YNAA 1EB2A 1YCPM 1SC8U 1K1OA 2ZGJA 1BTPA 1C1SA 3U1JB 4OS1A 1A61H 1EZSC 3DFJA 1F2SE 2CF9H 7GCHF 5GWZA 3V13A 5FAHA 2BX4A 1LTOA 1XUKA 2A4RA 2PSYA 1BDAA 4IGDA 2FP7B 3VFEA 4HTCH 1EATA 1F5RA 2G51A 1GGDB 1HAZB 3LU9B 4JYVH 3TJNA 3O8RA 3SU4A 3M5MA 5EPNA 2ZDAH 2F9OA 1TNLA 1TONA 3RXUA 1SGYE 2ZU5A 2NU3E 4O03A 1GJBB 4R0IA 1PPEE 2XXLA 4ESTE 4AYYB 2LPRA 1JMOH 1BBRE 1GWAA 1HRTH 1KDQB 3MU5A 3SUFA 4A1XA 3SGAE 3UWJH 3T28A 2XRCA 1UJ1A 1SGNE 4O97A 5EODA 3TGJE 1NO9H 4ABJA 4R8TB 4ZAEA 3MU8A 2A7JA 5AFYH 1OKXA 3NXPA 1AQ7A 3QZQA 2GCTB 4IMQA 1G3CA 4LZ4B 4YLUA 1F5KU 3MNCA 3RXVA 1TOCB 1LHCH 3UNRA 1PQ5A 4K3JA 4Y79A 4WMFA 1NN6A 1O2IA 1GG6B 2BLOA 4A92A 1K21H 4TY7A 4K1EA 3UTUH 1KXFA 3GCTF 2QCYA 4IN2A 1C5ZB 3RC4A 4X6OA 2ASUB 3SU6A 1A0LA 1XUFA 5JBCS 3BTQE 4CRBA 3NCLA 3MNXA 1GBCA 2BTCE 2FI5E 2WPHS 4DURA 2XBVA 4MQAA 1DDJA 1BZXE 1PQAA 1DUAA 1LKAA 1P03A 1GHZA 1YYY1 1UCYK 1O2ZA 2A4GA 4LZ1H 4AGKA 2HOBA 4DVAU 5AFZH 1IQNA 1O3PB 1O32A 3ZZBA 3UQVA 4MPVA 1SFQB 1PPGE 1MKXK 3GCHB 2P3FH 2GT8A 3ODFA 2HVXA 1GHBF 1BOQA 2QN5T 2J4IA 1UVUH 2H5DA 2F9PA 1RTLA 3Q3KA 3DFLA 2BHGA 2UUFB 1S6FA 1FY3A 4NFEA 1GHBG 1QJ7B 4K8YA 4VGCB 2JH6D 5L30H 3HGPA 4YM9A 2AIPA 3ITIA 1CU1A 1GCTC 1FN8A 1HFDA 1P0SH 1ZSLA 1TAWA 1LO6A 5DP8A 2BXUH 3A87A 1P04A 2THFB 3O8CA 5HMAA 2H9HA 3MNSA 2VH6A 2ESTE 3MH6A 5EW1H 4IC6A 3ATLA 1YPGH 4PROA 3U8OH 5K0HA 2Z9LA 3RU4E 1V2QT 4NZQA 4ZHAA 4ISOA 5G4BA 1D9IA 2H1UA 4YTAA 5ESBA 4I33A 2PWXA 4I8KA 5LGOA 3GY6A 2A4QA 2J2UA 2WPIS 3O8BA 3LH1A 1HDTH 1OPHB 1S82A 3KQBA 7KMEH 4Y8XA 1AUTC 3GCOA 1AKSA 5ETXA 3BEFB 1TBZH 2GX4A 1D3TB 1JWTA 1O3JA 3M36A 4Y8ZA 5I46H 1SOTA 1FY4A 9ESTA 3F9HA 4MPXA 1JOUB 2DE8A 1SGQE 1YM0A 1NS3A 3A7TA 1ZMJA 2ZTZA 1K1JA 1GJDB 1P2NA 1TPSA 2HRVA 3C27B 4Q7XA 1MKXH 2W3IA 4NCYA 1GGDC 1JXPA 4FXGH 4CRGA 1EP6A 3SNBA 2ZPSA 4AFQA 1GI3A 4RN6A 2DUCA 4HFPB 3S9BA 3SJ9A 4H6SB 1TBQH 1BQYA 1LDTT 1EASA 3FZZA 1K9OE 1TMBH 1YC0A 2V6NA 1QQUA 4MPWA 3ESTA 2TPIZ 1MZDA 1Y3YA 3RU4D 1EOLA 1C2HA 1A5GH 3SV2H 2GV6A 4J2YB 1O2YA 3MMGA 4YESB 1KXCA 1LHDH 3SJ8A 1SGEE 1ELFA 1RJXB 1UTNA 2FO9A 3GCTG 1UTOA 4XBBA 2SGDE 5FBEA 1Y3WA 3ENSB 1EUFA 2V3HH 2J9NA 8GCHF 3UR6A 4FUHA 1ELDE 1A2CH 1QB6A 1GJ6A 2OQ5A 3LONA 1SLWB 2P95A 1PQ7A 1KIGH 2PFEA 1WQSA 1Y5UT 2STAE 3RXLA 4J1YA 1TYNA 2EI7A 2ZU3A 5TCAA 1NC6A 1TABE 2BY5X 5EXLA 1HIAB 4ABAA 1QBVH 4XOJA 1V2WT 1NROH 1DITH 1MU6B 1T8LA 1O5GH 1C5XB 2ZQ2A 2ALVA 2SGEE 4WXVA 3B9FH 3GY2A 1BTUA 3MU1A 3K6ZA 5EQRA 1DS2E 2BDIA 1T31A 2FX6A 1FIWA 3T5FH 1MTWA 4NIWA 4UFGH 1ZLRA 1FQ3A 1N1LA 1TGBA 2Q6DA 1LQDB 2RDLA 4OS2A 3TIUA 3ZZAA 2PUXB 1C2DA 2G55A 1B0FA 5A0AE 4YO9A 3QTVH 1MH0A 3FP7E 1QY6A 1Y8TA 2R2MB 3Q3YA 1P3CA 1GMDF 1O39A 2QY0B 5C1YA 2F83A 3RXMA 1CGJE 5EQQA 3BTEE 2OCVB 3TJOA 1GHYH 1OWDA 3RU4T 2R0LA 2VB0A 2IOTA 1C2EA 3CP7A 1N6XA 3D65E 2BVXH 1Z6JH 2LNCA 3GYLB 1F92A 4Y0ZE 6GCHG 2PSXA 3RC5A 8GCHG 3RC6A 4U2WA 2WUCA 1AU8A 1P2JA 1JIMA 3VB7A 5LPFA 1D6RA 1NT1A 4XFQA 3T2NA 2P8OC 4MVNA 1ZHRA 4I8GA 4JMYA 2FTLE 4AFZA 4DG4A 4ISIH 1C1WH 1CSOE 4JZIA 1OSSA 1T4VH 4FUCA 3U98H 1OP2A 2G5VA 1ZTLA 3TH4H 3PO1C 1T8NA 1H9LB 5T6GA 1SMFE 2HNTC 1BJUA 4AORA 5JPMH 4UFEH 1C5PA 2BD8A 2D2DA 1W2KH 2NU0E 4JYUH 1L4ZA 2XBYA 1ZPZA 1HCGA 1VITF 3S9AA 2Z7FE 4NGAH 4ZHLU 1GJ4H 1GBAA 1C5MD 3HGNA 4CRDA 3ZZ3A 5EPYA 3PTNA 1VCPA 2ANYA 1GMHF 1HAVB 1UTMA 1XKAC 2XNIA 1XKBC 1MQ6A 1DE7H 1GMHG 5AF9H 2QXGA 1TNJA 1NRRH 1Y3VA 1DWDH 2QIQA 1KDQA 1DANH 1FZZA 1P06A 2ZFFH 1QNJA 1G36A 1HUTH 5F6MA 1P2OA 5L2YH 1LQEA 5FCRA 3UR9A 1V2UT 1ORFA 4AG2A 3O8DA 1O31A 3C1KA 1O3HA 1G32B 4DCDA 1A0HB 1J16A 2FYQA 1IQKA 1SGFA 1QRWA 4AFUA 4DW2U 4GCHF 3S7KB 2BZ6H 4B73A 2STBE 4MPUA 5E0HA 3ATIA 4IN1A 1OWEA 3RXAA 1TNHA 4X8VH 3SUEA 5DP6A 1DFPA 2R3UA 1GBBA 1D4PB 1F0SA 3GCHC 4XBCA 1EOJA 6ESTA 3VGCC 2PKAB 2D8WA 1AE5A 1C1UH 1RRKA 2ODYB 1O2SA 1ABIH 2SGFE 1HJAC 1O2XA 1W12U 1XX9A 1VITG 3KIDU 3D49H 1IQLA 1O37A 1EAXA 3R3GB 1YBWA 4GLYA 1DICA 1TNIA 2FIRH 3SV8A 1L1NA 1TRNA 3LGYA 2ANMH 6CHAC 1FAXA 1GBTA 1QR3E 5EOKA 1P9UA 5CHAB 4NWLA 1ZYOA 1G3EA 3EGKH 1BITA 1BRUP 1YKTA 2Z3CA 1BT7A 2VIDA 2H9EH 5GCHG 2GVFA 3FVFB 1O2LA 1NU7B 4XBDA 4ZHMU 5LPRA 4GCHG 1GJAB 2BVRH 1CA8B 3MWIU 4K60A 2FOEA 2PTNA 5EQSA 1EX3A 2HNTF 2ZGBH 3SI3H 3ZV8A 1DXWA 1BTWA 4A1TA 1EJNA 2QAAA 1BMAA 3LGVA 2PKSB 3RXGA 1CA0B 3RXHA 2TRMA 5AHGH 4X2WA 1ELEE 1CGHA 4YLQH 4ASHA 1O2WA 3LGWA 1V2OT 4KKDA 4NIVA 3SI4H 4FUGA 1V2VT 1Y5AT 4BTIB 1FAKH 3K65B 1KSNA 3SV7A 1BTZA 3BG4B 1V2PT 1GJ5H 1QBNA 5FX6A 1ELVA 4O3UA 1P10A 2PUQH 1G2LA 2HPPH 3H5CB 3LDXH 1TGCA 1GCDA 3OTJE 2VVUA 2OC1A 2YOLA 2CN0H 1MTVA 1NFUA 1TPAE 3B23B 3EDXB 1HAIH 3SORA 2FOBA 4X1SU 2Y5GA 1P01A 4CREA 1C5RA 4NA8A 4D9RA 1B5GH 1THPB 1O5AB 5HGGA 2RA0A 2FI4E 1VR1H 1HJ8A 2XWBI 4OGXA 1QJ6B 3LGTA 4GUXA 3STIA 1FNIA 2OC0A 4ISHH 1P02A 4OS6A 5DP9A 4CR5A 3S0NA 3HPTB 1ETRH 1SVPA 2XC5A 4BXWA 1DY8A 1EPTA 1SGCA 2V0BA 5A0CA 1S84A 2A7CA 3BSQA 1CQQA 1OWKA 4X2XA 2VWOA 3RXSA 5A8ZA 3ZZDA 3TH3H 3NUMA 3RMOH 2ZI2H 4KTSA 3LPRA 3UNQA 2BB4A 3ZZ8A 1C2MA 4H6TA 3ODDA 2F9UA 2QXJA 1C5VA 2QYIA 3GY7A 3OY5U 4K1TA 3M5NA 2WPJS 3EYDA 3R0FA 1ELTA 1P12E 1Q2WA 2UUJB 1XUIA 2BYAX 1Z8RA 1C5UA 2BOKA 3V12A 3GOVB 2FOHA 2OXSA 4UFDH 3A7YA 4HGCA 4MNXA 1O38A 1QHRB 2AYWA 1DLEA 3AASA 2OP9A 1DPOA 3GY8A 2ZO3H 1GI6A 2KAIB 2Z9IA 2ZTYA 1BMLA 4AGJA 2ZHFH 3LOXA 1AY6H 4H42U 1P2QA 4ZKSU 1NU9A 3T26A 1H8DH 1HAGE 2J34A 2ZKSA 1MD8A 3SJKA 1HYLA 1ETTH 1W7XH 2OLGA 2WUBA 3M5LA 2W5EA 4E06H 1P09A 3BTME 1O36A 3LH3A 4JK5A 3SV6A 5DG6A 2VU8E 4OGYA 1XVOA 2D1JA 5F03A 1NRNH 2GMTB 3PMJA 5GPIB 4OS7A 2Q6FA 1VJAU 2ZDMA 4ABGA 2R0KA 1ANBA 1L2EA 2BLVA 1C5SA 4WVPE 1C5OH 1GDNA 6CHAB 1Z8GA 2EEKA 2Z6BD 1A3EH 5A09A 2BDYA 4Q7YA 2VVVA 2BY6X 3MO6A 1IQMA 2GT7A 3Q76A 1HXFH 4I31A 4FUEA 1SGFG 3L33A 1IHSH 8KME2 3QGNB 1HGTH 1TGTA 2WPLS 1T8OA 2ZF0H 4ABHA 5A8XA 1S81A 4NA9H 4IW4E 3BEIB 1O5FH 1GDQA 4K2YA 1WYKA 3ZVDA 2FLBH 1ZTJA 2BD4A 1ARBA 3TK5A 4WMEA 1C5TA 1NFXA 2Y7ZA 5AVDA 1TA2A 4IMZA 1DSUA 2BDAA 1GCTB 1BIOA 2C8WB 2A31A 2BMGB 4GHTA 3VB3A 3A82A 1SFIA 4FUFA 2VJ1A 2Z3EA 3UPEA 1PJPA 1O2OA 4FUBA 4NZLA 2AH4X 3M7UA 4ABBA 3BEUA 2HNTE 5JYIA 1HAXB 2G4TA 3HKJB 4Z0KA 5FPYA 1AUJA 2AS9A 4Q7ZA 3MH7A 1M9UA 4TPYA 1UVSH 2J38A 1ETSH 4MNYA 4BAHB 1D6WA 2NU1E 3BTFE 3SU1A 1GBJA 2GMTC 1A0JA 1SR5C 4Z6AH 5DP3A 5HYOA 3GDSA 2VIOA 4U01A 1BTXA 2IN2A 2BY8X 1C9TA 1HXEH 3AAUA 2AMDA 1MKWK 1AMHA 5FXLA 2BOHB 4IS5A 3GY3A 4K69A 1WUNH 5H4IB 5L6NH 4H4FA 3ZZ4A 3ZVBA 3B8JA 1UTPA 5DP4A 1HJAB 2BD7A 1MUEB 1E0FD 3VB4A 5F8ZA 3STJA 2ZG0H 3CS7A 3TNTA 2XW9A 1PYTD 2ZPRA 2Z94A 3MTYA 5I25A 2HGTH 1ZPCA 4NG9H 1OXGA 3LKWA 2XC0A 2CF8H 3SHAH 3ZYDA 1IQJA 4B2AA 1VJ9U 3GYMA 3SQEE 4Y7BA 3A7ZA 3T62A 1NM6A 1EXFA 1Z71A 1GJ8B 2FYRA 3BTHE 1SI5H 2GGVB 4TWWA 4MNWA 1NESE 3D23A 4X8SH 3RXBA 2WYJA 1MKWH 1ZJDA 6GCHF 1PYTC 2C4FH 2P94A 1C4Y2 1UK4A 4OS5A 1GI8B 3SU2A 1BRBE 4UDWH 4CRAA 1BHXB 1LVBA 1BUIA 3WY8A 2ZHDA 2SGAA 1BJVA 3ZVGA 2WPMS 2RG3A 3M7QA 1CBWC 3PWCA 2GCHF 3VGCB 4KGAA 1GBMA 3A7XA 3EA9A 1P57B 4UEHH 3OY6U 1GI2A 1TA6A 4TYDA 3UREA 2W7UA 4A7IB 1SOZA 3K2UA 1GI0A 1CA0C 3HATH 1LPZB 2GZ7A 3BTWE 4INKA 1SHHB 3UOPA 4HZHA 5LPEA 1TOMH 4ISNA 1DUEA 4A1VA 1YPLH 2BD3A 2XTTB 3BTDE 1V3XA 3LIWA 3SN8A 3S7HB 1YPJH 3JZ2B 1OWJA 4MDSA 2VINA 3RMLH 1ZHMA 1GMDG 1O3IA 4Y11E 1ARCA 4ZMAH 2FTMA 3ATMA 4ZKRU 1J8AA 1RD3B 4NSYA 3RM2H 2ZZUH 3K6YA 3U1IB 1O2HA 2AERH 2ZHWH 8ESTE 2FOCA 1BRAA 1EKBB 5HM2A 2GTBA 3SU0A 3HK3B 2Y7XA 1ELAA 3A88A 3KQCA 4INLA 1BA8B 4OS4A 2V35A 1RGQA 1WV7H 2ODPA 4THNH 2ZP0H 3T27A 3RLYH 2ZGCA 1SQOA 2VGCB 3TGKE 4B1TA 1ANEA 1GVLA 1GBLA 1TQ7B 3P17H 3MH5A 1XM1A 1SB1H 3UY9A 4AB8A 1HNEE 5J4QA 5EGMA 3KL6A 1K28D 2ZU2A 3TJVA 3ZVCA 1G9IE 3BG8A 1FMGA 1H4WA 1O3FA 3F9GA 5C5NA 2SNWA 2NU4E 3IG6B 2H2ZA 2PGBB 1QBOA 1YPKH 4AOQA 3UNSA 2A4OA 1RS0A 3EAJA 9LPRA 1FY8E 1GBHA 3RXOA 4X2VA 2UWLA 5TCCA 3TK9A 1AZ8A 3E3TA 3SHCH 1UVPA 4BTTB 3SJOA 3SUDA 2VNTA 3KQEA 1EZQA 3M35A 5ESTE 3CENA 2OC7A 1VZQH 1G3DA 1AIXH 3S9CA 4Y0YE 2A5KA 1ELBA 2VIWA 4Y71A 1T4UH 3MOCA 2ULLA 1ESTA 2QXIA 2M5TA 3ATKA 1FV9A 2O8LA 3LJJA 1CBWB 1Q3XA 3LJOA 2Q6GA 2ZHEH 3M5OA 1D3PB 7ESTE 3OSYA 3EA8A 2JETC 3LGIA 2ZIQH 1SSXA 2WPKS 2TGPZ 2BDGA 4A6LA 1O2QA 1TRMA 2HWLB 1XUHA 2QA9E 4I8HA 1OWIA 1THRH 1Y3UA 3PMHB 4NA7A 4Q80A 2GV7A 3DA9B 1A7SA 2Y81A 1OS8A 1QTFA 3SO3A 2ILNA 4XDEA 2ZWLH 1FLEE 2ZFQH 1O3DA 2Y6TA 1YPHC 3MU0A 5CE1A 2PTCE 1UTLM 1MTNB 1ACBE 5EXMA 1ELCA 1TWXB 5EW2H 3TITA 3A7VA 1O3GA 3URDA 2ZDNA 2C8YB 1NRPH 3V7TA 4E7NA 2XCNA 3PLKA 1EJAA 1SGIB 3MFJA 1JBUH 2BDHA 1Z6EA 2OTVA 1D3QB 2QF3A 2FM2A 1O2PA 2AMPA 2Y5FA 2ZGXH 4FVBA 4O3TA 1INCA 3GCNA 2CHAB 3FP6E 4ZKNU 1YF4A 1DLKB 3KN2A 1TPPA 3MHWU 1O3OA 1MMJN 1NPMA 1G37A 3U8RH 2BDCA 1E37B 3TLOA 1LPGB 3VPKA 3TGIE 5IYTA 1C5NH 1PPFE 1S85A 2ALPA 1MU8B 5JBTA 1UTQA 1QIXB 3DHKH 1HLTH 1J17T 4LXBH 1G2MA 4O9VA 1FXYA 1PFXC 3RXDA 1AO5A 4DGJA 1P2KA 1V2JT 2R3YA 4DIHH 1ANCA 5C2ZA 1OOKB 2FWWA 3GDVA 2TBSA 3ATWA 1MAXA 3N7OA 1ABJH 1QB9A 3VXEH 2PKSC 1BMMH 2OINA 3QN7A 2FEQH 1W10U 1V2TT 1MZAA 1C2LA 2FOAA 2P3UB 2SFAA 1QA7A 4CBOA 5DK1A 1MD7A 5E2PA 1ID5H 1UVTH 3UOUA 3ZVFA 2EI8A 4YT7H 3RXPA 1Y59T 3KGPA 2VIVA 4BAQB 5JB9S 5FPTA 1LCYA 1BTHH 5C5OA 3P70B 1FI8A 1O3LA 1T7CA 3JZ1B 1FIZA 5FBIA 4BTUB 5PTPA 4X6MA 1CHOG 2KAIA 2G81E 4JZ1A 1MAYA 5DP7A 2CGAA 2B5TB 4TY6A 2G4UA 1TNGA 3MO3A 3A8BA 5CHAC 3OX7U 2OQUA 1FPHH 1H8IH 4JZFH 1TGNA 1MTUA 4WF8A 2GCTC 3AW0A 3MO9A 5GIBA 3FFGA 2XBWA 1O5EH 2ZPQA 2FX4A 1ZPBA 1GG6C 1LHEH 3DT0H 1HAHH 2FLRH 4B76A 2UWOA 1CT4E 1YPMH 3PLBA 4BANB 2BD2A 1EPTB 3PV4A 1W14U 1L4DA 3SOSA 2CJIA 1C4V2 4NIYA 3RXJA 1XVMA 2G52A 4KTCA 1UHBB 1CT2E 1TIOA 6LPRA 1YLDA 1V2ST 1FY5A 2F9VA 1QB1A 1MTNC 3EE0B 3KHVA 1ZTKA 1QRZA 4CRCA 2CXVA 4HI3A 1VCQA 5JBAS 1WTGH 1JIRA 1NRQH 1FONA 2P8OB 2ZDVH 2VVCA 1SGTA 3FZDA 5A8YA 5DKMA 1PQ8A 1WAYB 5CMXH 1GJ7B 1THSH 4K1SA 2AGIX 4WXIA 1C2GA 2HLCA 1K22H 3QLPH 3ZV9A 2JETB 1PPCE 4Y7AA 1YLCA 5C20A 1TBRH 1C1PA 1GVKB 3ZZ9A 1K1PA 3RXFA 1PPZA 1H1BA 1O35A 3A89A 4D76A 2GP9B 3BTKE 1O2KA 3A7WA 1LVYA 1QA0A 2FDAA 1TALA 1GBKA 1A5HA 4NFFA 4RKOB 3ZVAA 3SGQE 1QL9A 2BQ6B 1GBFA 2F9NA 5L2ZH 3A86A 2O8MA 1WSSH 4D7FA 1DWBH 3BF6H 4B75A 3TU7H 3ZYEA 4WMDA 4B74A 1MBMA 2WV5A 5E2OA 3PLPA 1GI9B 3A8CA 1QL8A 4DT7B 2F3CE 1EZUC 1ZJKA 3F1SB 3T29A 1IQEA 1P2MA 2Z9GA 1F5LA 3TK6A 3UFAA 1A5IA 1DWCH 1U6QA 1EPTC 1NTPA 4YOJA 4GVUA 1VGCB 4X1QU 1K1NA 2ANWA 3H7TA 3L6PA 3MH4A 4MNVA 1A3BH 2J92A 3V0XA 1SGRE 2C93B 2VWNA 2G8TA 1Z7KA 5FX5A 3PYHA 1O5BB 1P8VC 1CHOF 2XBXA 1ZRKA 2B7DH 2O8TA 3M7TA 3Q77A 3PROA 2OBOA 1V2MT 3E1XB 2A2XH 4GPGA 4CHAC 2H9TH 1DVAH 2EI6A 4DIIH 1C1OA 3QX5H 5IDKA 4ZKOU 4INHA 1AE8H 3CS0A 3E90B 3K9XB 3BG4C 1QJ1B 1OYTH 5FPSA 1AI8H 1TX6A 5A2MH 3ELAH 1TQ0B 1VITH 3F9EA 3QDZB 4LOYH 1EAIA 3GY5A 1UCYH 5JBBS 1DT2A 1CE5A 3SZNA 1WU1A 1EB1H 1O33A 5JB8S 4X2YA 1HAPH 1ZGIA 2C3SA 2C90B 2OD3B 1HAOH 2CHAC 1O3CA 3D62A 1YP9A 4XSKU 5DP5A 3P6ZB 1KLIH 4MLFB 2JKHA 2IPHA 3H7OA 4JYTA 3I29A 2W3KA 3E16B 2QXHA 2H5CA 1UCYE 5DPAA 2VWLA 2ZGHA 3M61U 4WH8A 4JZEH 5F8XA 4UONA 1RXPA 1SBWA 2FI3E 4X1RU 1KY9A 1MCTA 4CH2B 2BX3A 3RLWH 3W94A 1ZSJA 4WY3A 1AFQC 1O2VA 1C5LH 2I6SA 3ZZ5A 3HKIB 2XYAA 1P3EA 1S6HA 3E0NB 4KTUA 4X1NU 4UD9H 3DUXH 4Y8YA 3HK6B 2UWPA 1O3BA 1YGCH 4MTBA 4F49A 1SLUB 3RXIA 1MBQA 3TJUA 5FCKA 3OU0A 1CVWH 1RFNA 4AN7A 1O3NA 2GKVE 4Y76A 1C1NA 3FANA 4FU8A 2GZ8A 1WOFA 5TJXA 2YNBA 5T3HA 3Q3XA 4ZXXH 1PPHE 4A5TS 1D3DB 1Q31A 2FZZA 3RM0H 4B2CA 1C2KA 4B2BA 1TGSZ 1WCZA 2F9BH 1C1VH 4K5ZA 3MU4A 1FDPA 2NWNA 1MCVA 1ZR0A 4RSPA 1DM4B 3LT3A 2FOGA 1AVXA 4ABIA 2ZU4A 3G01A 3SJIA 1EZXC 1ZSKA 2ODQA 1IAUA 3ZZCA 1UTJA 1SGDE 3BTTE 1Z8IB 4KP0A 3U69H 1DWEH 3UUZA 1O2NA 3F68H 1AFEH 3GICB 4BAKB 2PW8H 5SGAE 1J15A 2PR3A 2SGPE 1DOJA 1SGPE 2SGQE 5T6DA 1W11U 4NWKA 1F0TA 3NKKA 1O0DH 3RUOA 1V2NT 4TPIZ 1C9PA 1GHVH 2P59A 1TX8A 2UUYA 4CRFA 3P95A 4ZUHA 2Q1JA 3A85A 2QV1A 1G30B 1T32A 3TPIZ 3SW2B 1O3AA 1X7AC 3MI4A 2ZA5A 2TIOA 4U32A 3RMNH 1L0ZA 3M3VA 5HM9A 1XUGA 1P2IA 4GHQA 1IQGA 4AYVB 5DJ7A 1FN6A 1AB9C 1W13U 2CMYA 2AGEX 2HALA 3VB6A 1K1IA 2BZAA 4WWYA 1KTSB 4VGCC 1Y5BT 1QGFA 1GI7B 1OP8A 1EP5A 2C8ZB 5EXNA 1AD8H 4AX9H 1BBRH 1N8OB 1L1GA 1C5YB 4AZ2B 1RIWC 3PWBA 2CV3A 1AN1E 1ESBA 2BLQA 2GZ9A 1GBDA 1AKSB 1BTYA 2R9PA 1CHGA 4GSOA 1O5DH 3PB1E 2BY7X 2R2WU 3TNSA 2NU2E 2G5NA 5C1UA 1EQ9A 2JH0D 4K8BA 5T6FA 4CBNA 1GI4A 3ZZ6A 5LH8A 4D9QA 4CH8B 2BDBA 3M3SA 4X1PU 1O30A 2ZDLA 4DJZB 2FOFA 4YT6H 1O2UA 3KF2A 1TNKA 3E91A 1E34B 3GISB 5B6OA 1O3MA 3U8TH 2P93A 3L3TA 4I7YH 5GCHF 2A2QH 3RXTA 1FJSA 1SPJA 2QC2A 4DY7B 4FU9A 1VGCC 3U9AH 3EQ0H 1GL0E 1O5CB 1ZOMA 2Y82A 5FHTA 4BAMB 4ABDA 1IHTH 2FMJA 3RXQA 1A4WH 7GCHG 5EU8A 3KQDA 1BB0B 1C1MA 3SU3A 1G3BA 2UUKB 3SNEA 3URCA 1V2KT 1C1TA 3QZRA 4BAOB 1C2FA 1ZHPA 1AB9B 1BHXF 3SNAA 1FY1A 2O8UA 4SGBE 1QURH 2BLWA 1LVOA 1B0EA 1EJMA 3ZZ7A 2C8XB 3AVZA 4YZUA 5F8TA 1Z1JA 1HPGA 3BIUH 2XC4A 2ZNKH 1EAWA 1W0ZU 2B0FA 1NFWA 1KXEA 3AAVA 2OC8A 1XXFA 1HIAA 1GI1A 3QK1A 5HXFA 2V3OH 3LC5A 3FAOA 1KXDA 3LC3A 2Z9KA 1C5WB 1DXPA 1IQFA 1O2RA 3A81A 2AGGX 4D7GA 1WQVH 2BVSH 2ZU1A 2ZFPH 3I77A 4M7GA 3NWUA 2B8OH 3P8OA 2VIQA 3V3MA 4BOHA 1JRSA 1W8BH 2J94A 5C67A 3LGUA 4B71A 2FODA 1TMTH 2BQWB 1HBTH 3M37A 2WYGA 1A1RA 2ZECA 4DOQA 4LK4A 1LHFH 1E35B 2IJOB 1RIWB
chains in the Genus database with same CATH superfamily
4FVDA 1PPBH 3MNBA 4XE4A 2OBQA 3UWIA 2ZFRH 5A0BA 2K1QA 2Z9JA 1CO7E 1S83A 1UVOA 1AWFH 1W0YH 1AVWA 2VIPA 4WJG2 4YOGA 2BD5A 1CT0E 2QF0A 4I8LA 3PM3A 3TH2H 1UTKA 2ZDKA 3SUGA 1FUJA 1O2JA 1Z8JB 1BRCE 1N8OC 1W3CA 1C2IA 4E7RG 1TX7A 2G00A 5C3NA 2PV9B 1YPEH 2FESH 4FETA 2RCEA 2WINI 3P8GA 1UHBA 1RTFB 5C1XA 1GHAG 2O9QA 1C1RA 1YPHE 2PP6A 1KXAA 2HPQH 1LMWB 1ANDA 3AW1A 2BM2A 2XCFA 3SNCA 2W26A 1H9HE 2Z3DA 3VXFH 1IQHA 1GHXH 1AFQB 3IWMA 1S5SA 1HB0B 3EA7A 1C1QA 1GMCG 1V6DA 2XOKD 2HLDD 3BN9A 1XUJA 1EAUA 3A8DA 2VGCC 3F9FA 4RT0A 1AZZA 3KCGH 1OWHA 2BQ7B 2WV4A 2B9LA 2ZFSA 1ZRBA 1AVGH 2F43B 3KEEA 2H6MA 1E36B 4ISLA 2J95A 5GDSH 3QTOH 4JCNA 1GDUA 1GL1A 1SL3A 5ABWA 3RDZA 4F4OC 1OP0A 1FPCH 1BBRK 1GPZA 1HV7A 1O2MA 1NBME 1YCPH 1DX5M 1O34A 4ZXYH 2Y80A 2EA3A 1N6YA 3PMBB 5E0GA 2PGQB 3NK8A 3E0PB 1C2JA 1GJCB 2FXRA 3QWCH 1CGIE 2EC9H 5DN6D 1Z1IA 2SNVA 5K7RA 1QFKH 2PHBA 1TLDA 2O8WA 4X6NA 4NIXA 2ANKH 2GCHG 3H09A 4FUIA 2BY9X 2VWMA 1GI5A 1K2I1 1T8MA 2A5AA 1P05A 1QRXA 3A83A 3S69A 1TRYA 4RKJB 3GY4A 1TFXA 1EFRD 4Y6DA 1UO6A 3DCLA 3NPSA 2ZQ1A 2ZFTA 2BD9A 2W7SA 2D26C 2I6QA 4JK6A 1C5QA 1O3KA 1VCWA 2BXTH 3SNDA 1QCPA 1O2GH 3BIVH 1W7GH 1KYNA 4GAWA 4SGAE 2AIQA 3ZVEA 2ZTXA 3SGBE 1TPOA 3WWBA 3P8NA 1DSTA 3NZIA 1NFYA 1TMUH 5DSFA 3E6PH 2OUAA 1K1MA 4JZDH 1SQTA 3VEQB 1ZGVA 1UK3A 1AWHB 1KLTA 2AMQA 5E8EH 2GJGA 3SBKA 3RXKA 1QL7A 3SV9A 2FS9A 4TT3D 2ZCLP 1HAYB 5BRRE 2RA3A 1LVMA 5BPEA 1C4U2 3RXCA 2A1DB 1WTHD 3IITA 4KELA 1ELGA 3P8FA 1GHWH 5EJ1A 3FP8E 3QGJA 1GHAF 5DO4H 3Q00A 4ZH8A 4BNRA 3TVJB 3E8LA 1SG8B 5DGJA 4X8UH 1BCUH 1A46H 1MTSA 5EG4A 4BXSA 3P92A 4YOIA 1F7ZA 3BTGE 1AGJA 3PTBA 4Q2KA 1XXDA 1TB6H 3KNXA 1KTTB 4I8JA 4X6PA 1NY22 4TWYA 2WV9A 1K1LA 1GMCF 4Y10E 3PV2A 2A7HA 2KM0A 4IC5A 3RMMH 1SLXB 1B7XB 1OX1A 1J9CH 1NZQH 2A45B 1YCPK 4WH6A 4NSVA 1E38B 2GD4B 3BV9B 4ABEA 1TE0A 3EE7A 1ZZZA 2ZEBA 4AB9A 3F6UH 1F0UA 1GBEA 3VB5A 2TGAA 3QO6A 1WBGB 1MQ5A 2LELA 1P9SA 3UIRA 1LPKB 2A0QB 4UE7H 1ZMNA 1GVZA 1UMAH 2FS8A 4ABFA 3M3TA 1HAVA 1J14A 4IBLH 4X8TH 2VH0A 1AHTH 2TGDA 1SLVB 3RP2A 5J4SA 1H9IE 2P3TB 4U30A 1WDIA 5E0JA 3DD2H 1JRTA 1Y3XA 4E05H 4QT8C 2A32A 5B6LA 3A8AA 2ZHQH 3GDUA 4FUDA 1KXBA 2QGRA 1NRSH 3PMAB 3OYPA 1O3EA 4ZROA 1SHYA 1OYQA 5JDUB 1OHHD 2F91A 1MABB 3RXRA 1SQAA 3SQHE 4AG1A 1V2RT 5GJ4B 2ZCHP 3A84A 1XMNB 3I78A 1IQIA 3RXEA 3A80A 4CHAB 3W95A 2K8IA 1IOEA 1RTKA 2FOMB 2ZC9H 4CR9A 1L1JA 1S0QA 2TGTA 3UQOA 2P16A 1BMNH 1ESAA 4AFSA 3PO1B 2V7QD 4MG3A 1DY9A 1HJ9A 2PKAA 1ZMLA 2FPZA 2Y5HA 2AEIH 2ZCKP 4D8NA 2GDDA 1GJ9B 1F0RA 2GDEH 1V2LT 5GXPA 1S0RA 3T25A 1KLJH 2PLXA 4FU7A 3SU5A 3QUMP 4UFFH 4FUJA 4X0WU 2XWAA 8LPRA 1GBIA 4I32A 2JH5D 1P11E 1UK2A 3MYWA 2AFQB 7LPRA 3N7EA 1LHGH 1O2TA 1LKBA 1QQ4A 2DE9A 2A5IA 2YNAA 1EB2A 1YCPM 1SC8U 5FL7D 1K1OA 2ZGJA 1BTPA 1VKYA 1C1SA 3U1JB 4OS1A 4F48B 1A61H 1EZSC 3DFJA 4RT1A 1F2SE 2KCPA 4Q63A 2CF9H 7GCHF 5GWZA 3V13A 3AK5A 5FAHA 2BX4A 3CNRA 1H8HD 1LTOA 1XUKA 2A4RA 2PSYA 1BDAA 3OEHD 3PRDA 4IGDA 2KCOA 3UB0A 1YLNA 2FP7B 3VFEA 4HTCH 4DT4A 1EATA 1F5RA 2G51A 1GGDB 1HAZB 3LU9B 4JYVH 3TJNA 3O8RA 3SU4A 3M5MA 5EPNA 2ZDAH 2F9OA 1TNLA 1TONA 3RXUA 1SGYE 2ZU5A 2NU3E 4O03A 1GJBB 4R0IA 1PPEE 2XXLA 4ESTE 4AYYB 2LPRA 1JMOH 1BBRE 1GWAA 1HRTH 1KDQB 3F2GA 3MU5A 3SUFA 4A1XA 3SGAE 3UWJH 3T28A 5HIYA 2XRCA 1UJ1A 1SGNE 4O97A 5EODA 3TGJE 2W6ID 1NO9H 4ABJA 4R8TB 4ZAEA 3MU8A 2A7JA 5AFYH 1OKXA 3NXPA 1AQ7A 3QZQA 2GCTB 4IMQA 1G3CA 4LZ4B 4YLUA 1F5KU 3MNCA 3RXVA 1TOCB 1LHCH 3UNRA 1PQ5A 4K3JA 4Y79A 4WMFA 1NN6A 1O2IA 1GG6B 2BLOA 4A92A 1K21H 5C0TA 4TY7A 4K1EA 3UTUH 1KXFA 3GCTF 2QCYA 4IN2A 1C5ZB 3RC4A 4X6OA 2ASUB 4TSFD 1A0LA 3SU6A 1XUFA 5JBCS 3BTQE 4CRBA 3NCLA 3MNXA 1GBCA 2BTCE 2FI5E 2WPHS 4DURA 2XBVA 4MQAA 1DDJA 1BZXE 1PQAA 1DUAA 1LKAA 1P03A 1GHZA 1YYY1 1UCYK 1O2ZA 2A4GA 4LZ1H 4AGKA 2HOBA 4DVAU 1KMHB 5AFZH 1IQNA 1O3PB 1O32A 3ZZBA 3UQVA 4MPVA 1SFQB 1PPGE 1MKXK 3GCHB 2P3FH 2GT8A 3ODFA 2HVXA 1GHBF 1BOQA 2QN5T 2J4IA 1UVUH 2H5DA 2F9PA 1RTLA 3Q3KA 3DFLA 2BHGA 2UUFB 1S6FA 1FY3A 4NFEA 1GHBG 1QJ7B 4B6EA 4K8YA 1QZ8A 2K0QA 4VGCB 2JH6D 5L30H 3HGPA 2KX4A 4YM9A 2AIPA 3ITIA 1CU1A 1GCTC 1FN8A 1HFDA 1P0SH 1ZSLA 1TAWA 1LO6A 5DP8A 2BXUH 3A87A 1P04A 2THFB 3O8CA 5HMAA 2H9HA 3MNSA 2VH6A 2ESTE 3MH6A 5EW1H 4IC6A 3ATLA 1YPGH 4PROA 3U8OH 5K0HA 2Z9LA 3RU4E 1V2QT 4NZQA 4ZHAA 4ISOA 5G4BA 1D9IA 2H1UA 4YTAA 5ESBA 4I33A 2PWXA 4I8KA 5LGOA 3GY6A 2A4QA 2J2UA 2WPIS 3O8BA 3LH1A 1HDTH 1OPHB 1S82A 3KQBA 7KMEH 4Y8XA 1AUTC 3GCOA 1AKSA 5ETXA 3BEFB 1TBZH 4P00A 2GX4A 1D3TB 2JDID 1JWTA 1O3JA 3M36A 4Y8ZA 5I46H 1SOTA 1FY4A 9ESTA 3F9HA 4MPXA 1JOUB 2DE8A 1SGQE 1YM0A 4B6FA 1NS3A 3A7TA 1ZMJA 2ZTZA 1K1JA 1GJDB 1P2NA 1TPSA 2HRVA 3C27B 4Q7XA 1MKXH 2W3IA 4NCYA 1GGDC 1JXPA 4FXGH 4CRGA 1EP6A 3SNBA 2ZPSA 4AFQA 1GI3A 4RN6A 2DUCA 4HFPB 3S9BA 5EJLA 3SJ9A 4H6SB 1TBQH 1BQYA 1LDTT 1EASA 3FZZA 1K9OE 1TMBH 1YC0A 4F55A 2V6NA 1QQUA 4MPWA 3ESTA 2TPIZ 1MZDA 1Y3YA 3RU4D 1EOLA 1C2HA 1A5GH 3SV2H 2GV6A 4J2YB 1O2YA 3MMGA 4YESB 1KXCA 1LHDH 3SJ8A 1SGEE 1ELFA 1RJXB 1UTNA 2FO9A 3FOAA 3GCTG 1UTOA 4XBBA 2SGDE 5FBEA 1Y3WA 3ENSB 3GS9A 1EUFA 2V3HH 2J9NA 8GCHF 2WHXA 3UR6A 4FUHA 1ELDE 1A2CH 1QB6A 1GJ6A 2OQ5A 3LONA 1SLWB 2P95A 1PQ7A 1KIGH 2PFEA 1WQSA 1Y5UT 2STAE 2XNDD 3RXLA 3F0OA 4J1YA 1TYNA 2EI7A 2ZU3A 5TCAA 1NC6A 2RFKC 1TABE 2BY5X 5EXLA 1HIAB 4ABAA 1QBVH 4XOJA 1V2WT 1NROH 3FN8A 1DITH 1MU6B 1T8LA 1O5GH 1C5XB 2ZQ2A 4ASUD 2ALVA 2SGEE 4WXVA 3B9FH 3GY2A 1BTUA 2QF5A 3K6ZA 3MU1A 5EQRA 1DS2E 2BDIA 2VBCA 1T31A 2FX6A 1FIWA 3T5FH 1MTWA 4NIWA 4UFGH 1ZLRA 3MQKC 1FQ3A 1N1LA 1TGBA 3UAIC 2Q6DA 1LQDB 2RDLA 5IK2D 4OS2A 3TIUA 3ZZAA 2PUXB 1C2DA 2G55A 1B0FA 5A0AE 4YO9A 3QTVH 1MH0A 3FP7E 1QY6A 1Y8TA 2R2MB 3Q3YA 1P3CA 1GMDF 1O39A 2QY0B 5C1YA 2F83A 4AC9A 3RXMA 1CGJE 5EQQA 3BTEE 2OCVB 3TJOA 1GHYH 1OWDA 3RU4T 2R0LA 2VB0A 2IOTA 1C2EA 3CP7A 2J98A 1N6XA 3D65E 2BVXH 1Z6JH 2LNCA 3GYLB 1F92A 4Y0ZE 6GCHG 2PSXA 3RC5A 8GCHG 3RC6A 4U2WA 2J5UA 2WUCA 1AU8A 1P2JA 1JIMA 3VB7A 5LPFA 1D6RA 1NT1A 4XFQA 3T2NA 2P8OC 4MVNA 1ZHRA 4I8GA 4JMYA 2FTLE 4AFZA 4DG4A 4ISIH 1C1WH 1CSOE 4JZIA 1OSSA 1T4VH 4FUCA 3U98H 1OP2A 3DSPA 2G5VA 1ZTLA 4Q4LA 3TH4H 3PO1C 1T8NA 1H9LB 5T6GA 1SMFE 2HNTC 1BJUA 4AORA 5JPMH 4UFEH 1C5PA 2BD8A 2D2DA 1W2KH 2NU0E 4JYUH 1L4ZA 2XBYA 1ZPZA 1HCGA 1VITF 3S9AA 2Z7FE 4NGAH 4ZHLU 1GJ4H 1GBAA 1C5MD 3HGNA 4CRDA 3ZZ3A 5EPYA 3PTNA 1VCPA 2ANYA 1GMHF 1HAVB 1UTMA 1XKAC 2XNIA 1XKBC 1MQ6A 1DE7H 1GMHG 5HIZA 5AF9H 2QXGA 1TNJA 2RDEA 1NRRH 1Y3VA 1DWDH 2QIQA 1KDQA 1DANH 1FZZA 1P06A 2ZFFH 1QNJA 1G36A 1HUTH 5F6MA 1P2OA 5L2YH 1LQEA 5FCRA 5C94A 3UR9A 1V2UT 1ORFA 4AG2A 3O8DA 1O31A 3C1KA 1O3HA 1G32B 4DCDA 1A0HB 1J16A 2FYQA 1IQKA 1SGFA 1QRWA 4AFUA 4DW2U 4GCHF 3S7KB 2BZ6H 4B73A 2STBE 4MPUA 5E0HA 3ATIA 4IN1A 1OWEA 3RXAA 1TNHA 4X8VH 3SUEA 5DP6A 1DFPA 2R3UA 1GBBA 1D4PB 1F0SA 3GCHC 4XBCA 1EOJA 2JIZD 1H8ED 6ESTA 3VGCC 2PKAB 2D8WA 2KFWA 1AE5A 1C1UH 1RRKA 2ODYB 1O2SA 1ABIH 2SGFE 1HJAC 1O2XA 1W12U 1XX9A 1VITG 3KIDU 3D49H 1IQLA 1O37A 1EAXA 3R3GB 1YBWA 4GLYA 5KGOA 1DICA 1TNIA 2FIRH 3SV8A 1L1NA 1TRNA 3LGYA 2ANMH 6CHAC 1FAXA 1GBTA 1QR3E 5EOKA 1P9UA 5CHAB 4NWLA 1ZYOA 1G3EA 3EGKH 1BITA 1BRUP 1YKTA 2Z3CA 5T1VA 1BT7A 2VIDA 2H9EH 5GCHG 2GVFA 3FVFB 1O2LA 1NU7B 4XBDA 4ZHMU 5LPRA 4GCHG 1GJAB 2BVRH 1CA8B 3MWIU 4K60A 2FOEA 2PTNA 5EQSA 1EX3A 2HNTF 2ZGBH 2W6JD 3SI3H 3ZV8A 1DXWA 1BTWA 4A1TA 1EJNA 2QAAA 1BMAA 3LGVA 2PKSB 3RXGA 1SKYE 1CA0B 2KZ4A 3OTPA 3PRBA 3RXHA 2TRMA 5AHGH 4X2WA 1ELEE 1CGHA 4YLQH 4ASHA 1O2WA 3LGWA 1V2OT 4KKDA 4NIVA 3SI4H 4FUGA 1V2VT 2YMSC 2QF4A 1Y5AT 4BTIB 1FAKH 3K65B 1KSNA 3SV7A 1BTZA 3BG4B 3WW7A 1V2PT 1GJ5H 1NBMD 1QBNA 5FX6A 1ELVA 4O3UA 1P10A 3FO8D 2PUQH 1G2LA 2HPPH 3H5CB 3LDXH 1TGCA 1GCDA 3OTJE 2VVUA 2OC1A 2YOLA 2CN0H 1MTVA 1NFUA 1TPAE 3B23B 3EDXB 1HAIH 3SORA 2FOBA 4X1SU 2Y5GA 1P01A 4CREA 1C5RA 4NA8A 4D9RA 1B5GH 1SQRA 1THPB 1O5AB 5HGGA 3ZIAD 2RA0A 2FI4E 1VR1H 1HJ8A 2XWBI 4OGXA 1QJ6B 3LGTA 4GUXA 3STIA 1FNIA 2OC0A 4ISHH 1P02A 2L6OA 4OS6A 4CR5A 5DP9A 3S0NA 3HPTB 1ETRH 1SVPA 2XC5A 4BXWA 1DY8A 1EPTA 1SGCA 2V0BA 3DSOA 3SZEA 5A0CA 1S84A 2A7CA 3BSQA 3F2FA 1CQQA 1OWKA 4X2XA 2VWOA 3RXSA 5A8ZA 3ZZDA 3TH3H 3NUMA 3RMOH 2ZI2H 4KTSA 3LPRA 2WZQA 3UNQA 2BB4A 3ZZ8A 1C2MA 4H6TA 3ODDA 2F9UA 2QXJA 1C5VA 2QYIA 3GY7A 5CHBA 3OY5U 4K1TA 3M5NA 2WPJS 3EYDA 3R0FA 1ELTA 1P12E 1Q2WA 2UUJB 1XUIA 2BYAX 1Z8RA 1C5UA 2BOKA 3V12A 3GOVB 2FOHA 2OXSA 4UFDH 3A7YA 4HGCA 4MNXA 1O38A 4FOUC 1QHRB 2AYWA 1DLEA 3AASA 2OP9A 1DPOA 3GY8A 2ZO3H 1GI6A 2KAIB 2Z9IA 2ZTYA 1BMLA 4AGJA 2ZHFH 3LOXA 1AY6H 4H42U 1P2QA 3KQ5A 4ZKSU 1NU9A 3T26A 2LP6A 1H8DH 1HAGE 2J34A 2ZKSA 1MD8A 3SJKA 1HYLA 1ETTH 1W7XH 2OLGA 2WUBA 3M5LA 2W5EA 4E06H 1P09A 3BTME 1O36A 3LH3A 4JK5A 3SV6A 5DG6A 2VU8E 4OGYA 1XVOA 2D1JA 5F03A 1NRNH 2GMTB 3PMJA 5GPIB 4OS7A 2Q6FA 1VJAU 2ZDMA 4ABGA 5CDFE 2R0KA 1ANBA 1L2EA 2BLVA 1C5SA 2IPQX 3PV5A 4WVPE 1C5OH 1GDNA 6CHAB 1Z8GA 2EEKA 2Z6BD 1A3EH 5A09A 2BDYA 4Q7YA 4HG6A 2VVVA 2BY6X 3MO6A 1IQMA 2GT7A 3Q76A 1HXFH 4I31A 4FUEA 1SGFG 3L33A 1IHSH 8KME2 3QGNB 1HGTH 1TGTA 2WPLS 1T8OA 2ZF0H 4ABHA 5A8XA 1S81A 4NA9H 1YWUA 4IW4E 3BEIB 1O5FH 1GDQA 4K2YA 1WYKA 3ZVDA 2FLBH 2WSSD 1ZTJA 2BD4A 1ARBA 3TK5A 4WMEA 1C5TA 1NFXA 2Y7ZA 5AVDA 1TA2A 4IMZA 1DSUA 2BDAA 1GCTB 1BIOA 2C8WB 2A31A 2BMGB 4GHTA 3VB3A 3A82A 1SFIA 4FUFA 2VJ1A 2M2AA 2Z3EA 3UPEA 1PJPA 1O2OA 4FUBA 4NZLA 2AH4X 3M7UA 4ABBA 3BEUA 2HNTE 5JYIA 1HAXB 4ZCNA 2G4TA 3HKJB 4Z0KA 5FPYA 1AUJA 2AS9A 4Q7ZA 3MH7A 1M9UA 2YMSD 4TPYA 1S6LA 1UVSH 2J38A 1ETSH 4MNYA 4BAHB 1D6WA 2NU1E 3BTFE 3SU1A 1GBJA 2GMTC 1A0JA 1SR5C 3W1EA 5DP3A 4Z6AH 5HYOA 3GDSA 2VIOA 4U01A 1BTXA 2IN2A 2BY8X 1C9TA 1HXEH 3AAUA 2AMDA 1MKWK 1AMHA 5FXLA 2BOHB 4IS5A 3GY3A 4K69A 1WUNH 3FKSD 5H4IB 5L6NH 4H4FA 3ZZ4A 3ZVBA 3B8JA 1UTPA 5DP4A 1HJAB 2BD7A 1MUEB 1E0FD 3VB4A 5F8ZA 3STJA 2ZG0H 3CS7A 3TNTA 5HKKD 2XW9A 1PYTD 2ZPRA 2Z94A 3MTYA 5I25A 2HGTH 4ACAA 1ZPCA 4NG9H 1OXGA 3LKWA 2XC0A 2CF8H 3SHAH 3ZYDA 1IQJA 3N7DA 4B2AA 1VJ9U 3GYMA 3SQEE 4Y7BA 3A7ZA 3T62A 1NM6A 1EXFA 1Z71A 5GNDA 1GJ8B 2FYRA 3BTHE 1SI5H 2GGVB 4TWWA 4MNWA 2EQNA 1NESE 3D23A 4X8SH 3RXBA 2WYJA 1MKWH 1ZJDA 6GCHF 1PYTC 2C4FH 2P94A 1C4Y2 1UK4A 4OS5A 1GI8B 3SU2A 5C0UA 1BRBE 4UDWH 4CRAA 1BHXB 1LVBA 1BUIA 3WY8A 2ZHDA 2SGAA 1BJVA 3ZVGA 2WPMS 2RG3A 3M7QA 1CBWC 3PWCA 2GCHF 3VGCB 4KGAA 1GBMA 2YMSB 3A7XA 3EA9A 1P57B 4UEHH 3OY6U 1GI2A 1TA6A 4TYDA 3UREA 2W7UA 4A7IB 1SOZA 3K2UA 1GI0A 1CA0C 3HATH 1LPZB 2GZ7A 3BTWE 4INKA 1SHHB 3UOPA 4HZHA 3WWFA 5LPEA 1TOMH 4ISNA 1DUEA 2J97A 4A1VA 1YPLH 2BD3A 2XTTB 3BTDE 1V3XA 3LIWA 3SN8A 3S7HB 1YPJH 3JZ2B 1OWJA 4MDSA 2VINA 3RMLH 1ZHMA 1GMDG 1O3IA 4Y11E 1ARCA 4ZMAH 2FTMA 3ATMA 4ZKRU 1J8AA 1RD3B 4NSYA 1E1RD 3RM2H 2ZZUH 3K6YA 3U1IB 1O2HA 2AERH 3VG8A 2ZHWH 8ESTE 2FOCA 1BRAA 1EKBB 5HM2A 2GTBA 3SU0A 3HK3B 2Y7XA 1ELAA 1E1QD 3A88A 3KQCA 1BA8B 4INLA 4OS4A 2V35A 1RGQA 1WV7H 2ODPA 4THNH 2ZP0H 3T27A 3RLYH 2ZGCA 1SQOA 2VGCB 3TGKE 4B1TA 1ANEA 1GVLA 1GBLA 1TQ7B 3P17H 3MH5A 1XM1A 1SB1H 3UY9A 4AB8A 1HNEE 5J4QA 5EGMA 3KL6A 1K28D 2ZU2A 3TJVA 3ZVCA 1G9IE 3BG8A 1FMGA 1H4WA 1O3FA 3F9GA 5C5NA 2SNWA 2NU4E 3IG6B 2H2ZA 2PGBB 1QBOA 1YPKH 3KYGA 3DSGA 4AOQA 3UNSA 2A4OA 1RS0A 3EAJA 4P02A 9LPRA 1FY8E 1GBHA 3RXOA 4X2VA 2UWLA 5TCCA 3TK9A 1AZ8A 3E3TA 3SHCH 1UVPA 4BTTB 3SJOA 3SUDA 2VNTA 3KQEA 1EZQA 3M35A 5ESTE 1UW7A 3CENA 2OC7A 1VZQH 1G3DA 1AIXH 1YY3A 3S9CA 4Y0YE 2A5KA 1ELBA 2VIWA 4Y71A 1T4UH 3MOCA 2ULLA 1ESTA 2QXIA 3U28C 2M5TA 3ATKA 1FV9A 2O8LA 3LJJA 1CBWB 1Q3XA 3LJOA 2Q6GA 2ZHEH 3M5OA 1D3PB 7ESTE 3OSYA 3EA8A 3N99A 2JETC 2HVYB 2KR7A 2ZIQH 3LGIA 1SSXA 2WPKS 2TGPZ 2BDGA 4A6LA 1O2QA 1TRMA 2HWLB 1XUHA 2QA9E 4I8HA 1OWIA 1THRH 1Y3UA 3PMHB 4NA7A 4Q80A 2GV7A 3DA9B 1A7SA 2Y81A 1OS8A 1QTFA 3SO3A 2ILNA 4XDEA 2ZWLH 5EIYA 1FLEE 2ZFQH 1O3DA 2Y6TA 3OE7D 1YPHC 3MU0A 3OEED 2PTCE 5CE1A 1UTLM 1MTNB 2AHME 1ACBE 5EXMA 1ELCA 1TWXB 5EW2H 3TITA 3A7VA 1O3GA 4ACBA 3URDA 2ZDNA 2C8YB 1NRPH 3V7TA 4E7NA 2XCNA 3PLKA 1EJAA 1SGIB 3MFJA 1JBUH 2BDHA 1Z6EA 2OTVA 1D3QB 2QF3A 2FM2A 1O2PA 2AMPA 2Y5FA 2ZGXH 4FVBA 4O3TA 1INCA 3GCNA 2CHAB 3FP6E 4ZKNU 1YF4A 1WXRA 1DLKB 3KN2A 1TPPA 3MHWU 1O3OA 1MMJN 1NPMA 1G37A 3U8RH 2BDCA 1E37B 3TLOA 1LPGB 3VPKA 3TGIE 5IYTA 1C5NH 1PPFE 1S85A 2ALPA 1MU8B 3KYFA 5JBTA 1UTQA 1QIXB 3DHKH 1HLTH 1J17T 4LXBH 1G2MA 2V3MA 4O9VA 1FXYA 1PFXC 3RXDA 1AO5A 4DGJA 1P2KA 1V2JT 2R3YA 4DIHH 1ANCA 5C2ZA 1OOKB 3F3BA 2FWWA 3GDVA 3OAAD 2TBSA 3ATWA 1MAXA 3N7OA 1ABJH 1QB9A 3VXEH 2PKSC 1BMMH 2OINA 3QN7A 2FEQH 1W10U 1V2TT 1MZAA 1C2LA 2FOAA 2P3UB 2SFAA 1QA7A 4CBOA 5DK1A 1MD7A 2JJ1D 5E2PA 1W0KD 1ID5H 1UVTH 3UOUA 3ZVFA 2EI8A 4YT7H 3RXPA 1Y59T 3KGPA 2VIVA 4BAQB 5JB9S 5FPTA 1LCYA 1BTHH 5C5OA 3P70B 1FI8A 1O3LA 1T7CA 3JZ1B 1FIZA 5FBIA 4BTUB 5PTPA 4X6MA 1CHOG 2KAIA 2G81E 4JZ1A 1MAYA 5DP7A 2CGAA 2B5TB 4TY6A 2G4UA 1TNGA 3MO3A 3A8BA 5CHAC 3OX7U 2OQUA 1FPHH 1H8IH 2IJD1 4JZFH 1TGNA 1MTUA 4WF8A 2GCTC 3AW0A 3MO9A 5GIBA 3FFGA 2XBWA 1O5EH 2ZPQA 4XD7D 2FX4A 5EJZA 1ZPBA 1GG6C 2CK3D 1LHEH 3DT0H 1HAHH 2FLRH 4B76A 2UWOA 2KCYA 1CT4E 1YPMH 3PLBA 4BANB 4OM9A 2BD2A 1EPTB 3PV4A 1W14U 1L4DA 3SOSA 2CJIA 1C4V2 4NIYA 4YXWD 3RXJA 1XVMA 2G52A 4KTCA 1UHBB 1CT2E 1TIOA 6LPRA 1YLDA 1V2ST 1FY5A 2F9VA 1QB1A 1MTNC 3EE0B 3KHVA 1ZTKA 1QRZA 4CRCA 2CXVA 4HI3A 1VCQA 5JBAS 1WTGH 1JIRA 1NRQH 1FONA 2P8OB 2ZDVH 2VVCA 1SGTA 3FZDA 5A8YA 5DKMA 1PQ8A 1WAYB 5CMXH 1GJ7B 1THSH 4K1SA 2AGIX 4WXIA 1C2GA 2HLCA 1K22H 3QLPH 3ZV9A 2JETB 1PPCE 4Y7AA 1YLCA 2J98B 5C20A 1TBRH 1C1PA 1GVKB 3ZZ9A 1K1PA 3RXFA 1PPZA 1H1BA 1O35A 3A89A 4D76A 2GP9B 3BTKE 1O2KA 3A7WA 1LVYA 1QA0A 2FDAA 1TALA 1GBKA 1A5HA 4NFFA 2OK5A 4RKOB 3ZVAA 3SGQE 1QL9A 2BQ6B 1GBFA 2F9NA 5L2ZH 3A86A 2O8MA 1WSSH 4D7FA 1DWBH 3BF6H 4B75A 3TU7H 3ZYEA 4WMDA 4B74A 1MBMA 5KECA 2WV5A 5E2OA 3PLPA 1GI9B 3A8CA 1QL8A 4DT7B 2F3CE 1EZUC 1ZJKA 3F1SB 3T29A 1IQEA 1P2MA 2Z9GA 1F5LA 3TK6A 3UFAA 1A5IA 1DWCH 1U6QA 1EPTC 1NTPA 4YOJA 4GVUA 1VGCB 4X1QU 1K1NA 2ANWA 3H7TA 3L6PA 3MH4A 4MNVA 1A3BH 2J92A 3V0XA 1SGRE 3F2HA 2C93B 2VWNA 2G8TA 1Z7KA 5FX5A 2L74A 3PYHA 1O5BB 1P8VC 1CHOF 2XBXA 1ZRKA 2B7DH 2O8TA 3M7TA 3Q77A 3PROA 2OBOA 1V2MT 3E1XB 2A2XH 4GPGA 4CHAC 2H9TH 1DVAH 2EI6A 4DIIH 1C1OA 3QX5H 5IDKA 4ZKOU 4INHA 1AE8H 3CS0A 3E90B 3NRLA 3K9XB 3BG4C 1QJ1B 1OYTH 5FPSA 1AI8H 1TX6A 5A2MH 4RI0A 3ELAH 1TQ0B 1VITH 3F9EA 3QDZB 4LOYH 1EAIA 3GY5A 1UCYH 4M9FA 5JBBS 1DT2A 1CE5A 3SZNA 1WU1A 1EB1H 1O33A 5JB8S 4X2YA 1HAPH 1ZGIA 2C3SA 2C90B 2OD3B 1HAOH 2CHAC 1O3CA 3D62A 1YP9A 4XSKU 2KCAA 5DP5A 3P6ZB 1KLIH 4MLFB 2JKHA 2IPHA 3H7OA 4JYTA 3I29A 2W3KA 3E16B 2QXHA 2H5CA 1UCYE 5DPAA 2VWLA 2ZGHA 3M61U 4WH8A 4JZEH 5F8XA 2F4LA 4UONA 1RXPA 1SBWA 2FI3E 4X1RU 1KY9A 1MCTA 4CH2B 2BX3A 3RLWH 3W94A 1ZSJA 4WY3A 4Z1MD 1AFQC 1O2VA 1C5LH 2I6SA 3ZZ5A 3HKIB 2XYAA 1P3EA 1S6HA 3E0NB 4KTUA 4X1NU 4UD9H 3DUXH 4Y8YA 3HK6B 2UWPA 3OFND 1O3BA 1YGCH 4MTBA 4F49A 1SLUB 3RXIA 1MBQA 3SYJA 3TJUA 5FCKA 3OU0A 1CVWH 2EY4C 1RFNA 4AN7A 1O3NA 2GKVE 2JJ2D 4Y76A 5C17A 1C1NA 3FANA 4FU8A 3F0PA 2GZ8A 1WOFA 5TJXA 2YNBA 5T3HA 3Q3XA 4ZXXH 1BMFD 1PPHE 4A5TS 1D3DB 1Q31A 2FZZA 3RM0H 4B2CA 1C2KA 4B2BA 1TGSZ 1WCZA 2F9BH 1C1VH 4K5ZA 3MU4A 1FDPA 2NWNA 1MCVA 1ZR0A 4RSPA 1DM4B 3LT3A 2FOGA 1AVXA 4ABIA 2ZU4A 3G01A 3SJIA 1EZXC 1ZSKA 2ODQA 1IAUA 2QE7D 3ZZCA 1UTJA 1SGDE 3BTTE 1Z8IB 4KP0A 3U69H 1DWEH 3UUZA 1O2NA 3F68H 1AFEH 3GICB 4BAKB 2PW8H 5SGAE 1J15A 5F53A 2PR3A 2SGPE 1DOJA 1SGPE 2SGQE 5T6DA 1W11U 4NWKA 1W0JD 1F0TA 3NKKA 1O0DH 3RUOA 1V2NT 4TPIZ 1C9PA 1GHVH 2P59A 1TX8A 2UUYA 4CRFA 3P95A 4ZUHA 2Q1JA 3A85A 2QV1A 1G30B 1T32A 3TPIZ 3SW2B 1O3AA 1X7AC 3MI4A 2ZA5A 2TIOA 4U32A 3RMNH 1L0ZA 3M3VA 5HM9A 1XUGA 1P2IA 4GHQA 1IQGA 4AYVB 5DJ7A 1FN6A 1AB9C 1W13U 2CMYA 2AGEX 2HALA 3VB6A 1K1IA 2BZAA 4WWYA 1KTSB 4VGCC 1Y5BT 1QGFA 1GI7B 1OP8A 1EP5A 2C8ZB 5EXNA 1AD8H 4AX9H 1BBRH 1N8OB 1L1GA 1C5YB 4AZ2B 1RIWC 3PWBA 2CV3A 1AN1E 1ESBA 2BLQA 2GZ9A 1GBDA 1AKSB 1BTYA 2R9PA 1CHGA 4GSOA 1O5DH 3PB1E 2BY7X 2R2WU 3TNSA 2NU2E 4XRNA 2G5NA 1FX0B 5C1UA 1EQ9A 2JH0D 4K8BA 5T6FA 4CBNA 1GI4A 3ZZ6A 5LH8A 4D9QA 4CH8B 2BDBA 3M3SA 4X1PU 1O30A 2ZDLA 4DJZB 2FOFA 4YT6H 1O2UA 3KF2A 1TNKA 3E91A 1E34B 3GISB 5B6OA 5KEDA 1O3MA 3U8TH 2P93A 3L3TA 4I7YH 5GCHF 2A2QH 3RXTA 1FJSA 1SPJA 2QC2A 4DY7B 4FU9A 1VGCC 3U9AH 3EQ0H 1GL0E 1O5CB 1ZOMA 2Y82A 5FHTA 4BAMB 4ABDA 1IHTH 1K0HA 2FMJA 3RXQA 1A4WH 7GCHG 5EU8A 3KQDA 1BB0B 1C1MA 3SU3A 1G3BA 2UUKB 3SNEA 3URCA 1V2KT 1C1TA 3QZRA 4BAOB 1C2FA 1ZHPA 1AB9B 1BHXF 3SNAA 1FY1A 2O8UA 4SGBE 1QURH 2BLWA 1LVOA 1B0EA 1EJMA 3ZZ7A 2C8XB 3AVZA 4YZUA 5F8TA 1Z1JA 1HPGA 3BIUH 2XC4A 2ZNKH 4I86A 1EAWA 1W0ZU 2B0FA 1NFWA 1KXEA 3AAVA 2OC8A 1XXFA 1HIAA 1GI1A 3QK1A 5HXFA 2V3OH 2WPDD 3LC5A 3FAOA 1KXDA 3LC3A 2Z9KA 1C5WB 1DXPA 1IQFA 1COWD 1O2RA 3A81A 2AGGX 4D7GA 1WQVH 2BVSH 2ZU1A 2ZFPH 3I77A 4M7GA 3NWUA 2B8OH 3P8OA 2VIQA 3V3MA 4BOHA 1E79D 1JRSA 1W8BH 2J94A 5C67A 3LGUA 4B71A 2FODA 1TMTH 2BQWB 1HBTH 3M37A 2WYGA 1A1RA 2ZECA 4DOQA 4LK4A 1LHFH 1E35B 2IJOB 1RIWB
chains in the Genus database with same CATH topology
4FVDA 1PPBH 3MNBA 4XE4A 2OBQA 3UWIA 2ZFRH 5A0BA 2K1QA 2Z9JA 1CO7E 1S83A 1UVOA 1AWFH 1W0YH 1AVWA 2VIPA 4WJG2 4YOGA 2BD5A 1CT0E 2QF0A 4I8LA 3PM3A 3TH2H 1UTKA 2ZDKA 3SUGA 1FUJA 1O2JA 1Z8JB 1BRCE 1N8OC 1W3CA 1C2IA 4E7RG 1TX7A 2G00A 5C3NA 2PV9B 1YPEH 2FESH 2RCEA 2WINI 3P8GA 1UHBA 1RTFB 5C1XA 1GHAG 2O9QA 1C1RA 1YPHE 1KXAA 2HPQH 1LMWB 1ANDA 3AW1A 2BM2A 2XCFA 3SNCA 2W26A 1H9HE 2Z3DA 3VXFH 1IQHA 1GHXH 1AFQB 3IWMA 1S5SA 1HB0B 3EA7A 1C1QA 1GMCG 1V6DA 3BN9A 1XUJA 1EAUA 3A8DA 2VGCC 3F9FA 1AZZA 3KCGH 1OWHA 2BQ7B 2WV4A 2B9LA 2ZFSA 1ZRBA 1AVGH 3KEEA 2H6MA 1E36B 4ISLA 2J95A 5GDSH 3QTOH 4JCNA 1GDUA 1GL1A 1SL3A 5ABWA 3RDZA 4F4OC 1OP0A 1FPCH 1BBRK 1GPZA 1HV7A 1O2MA 1YCPH 1DX5M 1O34A 4ZXYH 2Y80A 2EA3A 1N6YA 3PMBB 5E0GA 2PGQB 3NK8A 3E0PB 1C2JA 1GJCB 2FXRA 3QWCH 1CGIE 2EC9H 1Z1IA 2SNVA 5K7RA 1QFKH 2PHBA 1TLDA 2O8WA 4X6NA 4NIXA 2ANKH 2GCHG 4FUIA 2BY9X 2VWMA 1GI5A 1K2I1 1T8MA 2A5AA 1P05A 1QRXA 3A83A 3S69A 1TRYA 4RKJB 3GY4A 1TFXA 4Y6DA 1UO6A 3NPSA 2ZQ1A 2ZFTA 2BD9A 2W7SA 2D26C 2I6QA 4JK6A 1C5QA 1O3KA 1VCWA 2BXTH 3SNDA 1QCPA 1O2GH 3BIVH 1W7GH 1KYNA 4GAWA 4SGAE 2AIQA 3ZVEA 2ZTXA 3SGBE 1TPOA 3P8NA 1DSTA 3NZIA 1NFYA 1TMUH 3E6PH 2OUAA 1K1MA 4JZDH 1SQTA 3VEQB 1ZGVA 1UK3A 1AWHB 1KLTA 2AMQA 5E8EH 3SBKA 3RXKA 1QL7A 3SV9A 2FS9A 2ZCLP 1HAYB 5BRRE 2RA3A 1LVMA 5BPEA 1C4U2 3RXCA 2A1DB 1WTHD 3IITA 4KELA 1ELGA 3P8FA 1GHWH 3FP8E 3QGJA 1GHAF 5DO4H 3Q00A 4ZH8A 4BNRA 3TVJB 3E8LA 1SG8B 5DGJA 4X8UH 1BCUH 1A46H 1MTSA 5EG4A 4BXSA 3P92A 4YOIA 1F7ZA 3BTGE 1AGJA 3PTBA 4Q2KA 1XXDA 1TB6H 3KNXA 1KTTB 4I8JA 4X6PA 1NY22 4TWYA 1K1LA 1GMCF 4Y10E 2A7HA 4IC5A 3RMMH 1SLXB 1B7XB 1OX1A 1J9CH 1NZQH 2A45B 1YCPK 4WH6A 4NSVA 1E38B 2GD4B 3BV9B 4ABEA 1TE0A 1ZZZA 2ZEBA 4AB9A 3F6UH 1F0UA 1GBEA 3VB5A 2TGAA 3QO6A 1WBGB 1MQ5A 1P9SA 3UIRA 1LPKB 2A0QB 4UE7H 1ZMNA 1GVZA 1UMAH 2FS8A 4ABFA 3M3TA 1HAVA 1J14A 4IBLH 4X8TH 2VH0A 1AHTH 2TGDA 1SLVB 3RP2A 5J4SA 1H9IE 2P3TB 4U30A 5E0JA 3DD2H 1JRTA 1Y3XA 4E05H 4QT8C 2A32A 3A8AA 2ZHQH 3GDUA 4FUDA 1KXBA 2QGRA 1NRSH 3PMAB 3OYPA 1O3EA 4ZROA 1SHYA 1OYQA 5JDUB 2F91A 3RXRA 3SQHE 1SQAA 4AG1A 1V2RT 5GJ4B 2ZCHP 3A84A 1XMNB 3I78A 1IQIA 3RXEA 3A80A 4CHAB 3W95A 1IOEA 1RTKA 2FOMB 2ZC9H 4CR9A 1L1JA 1S0QA 2TGTA 3UQOA 2P16A 1BMNH 1ESAA 4AFSA 3PO1B 4MG3A 1DY9A 1HJ9A 2PKAA 1ZMLA 2FPZA 2Y5HA 2AEIH 2ZCKP 4D8NA 2GDDA 1GJ9B 1F0RA 2GDEH 1V2LT 5GXPA 1S0RA 3T25A 1KLJH 2PLXA 4FU7A 3SU5A 3QUMP 4UFFH 4FUJA 4X0WU 2XWAA 8LPRA 1GBIA 4I32A 2JH5D 1P11E 1UK2A 3MYWA 2AFQB 7LPRA 1LHGH 1O2TA 1LKBA 1QQ4A 2DE9A 2A5IA 2YNAA 1EB2A 1YCPM 1SC8U 1K1OA 2ZGJA 1BTPA 1C1SA 3U1JB 4OS1A 1A61H 1EZSC 3DFJA 1F2SE 2CF9H 7GCHF 5GWZA 3V13A 5FAHA 2BX4A 1LTOA 1XUKA 2A4RA 2PSYA 1BDAA 4IGDA 2FP7B 3VFEA 4HTCH 1EATA 1F5RA 2G51A 1GGDB 1HAZB 3LU9B 4JYVH 3TJNA 3O8RA 3SU4A 3M5MA 5EPNA 2ZDAH 2F9OA 1TNLA 1TONA 3RXUA 1SGYE 2ZU5A 2NU3E 4O03A 1GJBB 4R0IA 1PPEE 2XXLA 4ESTE 4AYYB 2LPRA 1JMOH 1BBRE 1GWAA 1HRTH 1KDQB 3MU5A 3SUFA 4A1XA 3SGAE 3UWJH 3T28A 2XRCA 1UJ1A 1SGNE 4O97A 5EODA 3TGJE 1NO9H 4ABJA 4R8TB 4ZAEA 3MU8A 2A7JA 5AFYH 1OKXA 3NXPA 1AQ7A 3QZQA 2GCTB 4IMQA 1G3CA 4LZ4B 4YLUA 1F5KU 3MNCA 3RXVA 1TOCB 1LHCH 3UNRA 1PQ5A 4K3JA 4Y79A 4WMFA 1NN6A 1O2IA 1GG6B 2BLOA 4A92A 1K21H 4TY7A 4K1EA 3UTUH 1KXFA 3GCTF 2QCYA 4IN2A 1C5ZB 3RC4A 4X6OA 2ASUB 3SU6A 1A0LA 1XUFA 5JBCS 3BTQE 4CRBA 3NCLA 3MNXA 1GBCA 2BTCE 2FI5E 2WPHS 4DURA 2XBVA 4MQAA 1DDJA 1BZXE 1PQAA 1DUAA 1LKAA 1P03A 1GHZA 1YYY1 1UCYK 1O2ZA 2A4GA 4LZ1H 4AGKA 2HOBA 4DVAU 5AFZH 1IQNA 1O3PB 1O32A 3ZZBA 3UQVA 4MPVA 1SFQB 1PPGE 1MKXK 3GCHB 2P3FH 2GT8A 3ODFA 2HVXA 1GHBF 1BOQA 2QN5T 2J4IA 1UVUH 2H5DA 2F9PA 1RTLA 3Q3KA 3DFLA 2BHGA 2UUFB 1S6FA 1FY3A 4NFEA 1GHBG 1QJ7B 4K8YA 4VGCB 2JH6D 5L30H 3HGPA 4YM9A 2AIPA 3ITIA 1CU1A 1GCTC 1FN8A 1HFDA 1P0SH 1ZSLA 1TAWA 1LO6A 5DP8A 2BXUH 3A87A 1P04A 2THFB 3O8CA 5HMAA 2H9HA 3MNSA 2VH6A 2ESTE 3MH6A 5EW1H 4IC6A 3ATLA 1YPGH 4PROA 3U8OH 5K0HA 2Z9LA 3RU4E 1V2QT 4NZQA 4ZHAA 4ISOA 5G4BA 1D9IA 2H1UA 4YTAA 5ESBA 4I33A 2PWXA 4I8KA 5LGOA 3GY6A 2A4QA 2J2UA 2WPIS 3O8BA 3LH1A 1HDTH 1OPHB 1S82A 3KQBA 7KMEH 4Y8XA 1AUTC 3GCOA 1AKSA 5ETXA 3BEFB 1TBZH 2GX4A 1D3TB 1JWTA 1O3JA 3M36A 4Y8ZA 5I46H 1SOTA 1FY4A 9ESTA 3F9HA 4MPXA 1JOUB 2DE8A 1SGQE 1YM0A 1NS3A 3A7TA 1ZMJA 2ZTZA 1K1JA 1GJDB 1P2NA 1TPSA 2HRVA 3C27B 4Q7XA 1MKXH 2W3IA 4NCYA 1GGDC 1JXPA 4FXGH 4CRGA 1EP6A 3SNBA 2ZPSA 4AFQA 1GI3A 4RN6A 2DUCA 4HFPB 3S9BA 3SJ9A 4H6SB 1TBQH 1BQYA 1LDTT 1EASA 3FZZA 1K9OE 1TMBH 1YC0A 2V6NA 1QQUA 4MPWA 3ESTA 2TPIZ 1MZDA 1Y3YA 3RU4D 1EOLA 1C2HA 1A5GH 3SV2H 2GV6A 4J2YB 1O2YA 3MMGA 4YESB 1KXCA 1LHDH 3SJ8A 1SGEE 1ELFA 1RJXB 1UTNA 2FO9A 3GCTG 1UTOA 4XBBA 2SGDE 5FBEA 1Y3WA 3ENSB 1EUFA 2V3HH 2J9NA 8GCHF 3UR6A 4FUHA 1ELDE 1A2CH 1QB6A 1GJ6A 2OQ5A 3LONA 1SLWB 2P95A 1PQ7A 1KIGH 2PFEA 1WQSA 1Y5UT 2STAE 3RXLA 4J1YA 1TYNA 2EI7A 2ZU3A 5TCAA 1NC6A 1TABE 2BY5X 5EXLA 1HIAB 4ABAA 1QBVH 4XOJA 1V2WT 1NROH 1DITH 1MU6B 1T8LA 1O5GH 1C5XB 2ZQ2A 2ALVA 2SGEE 4WXVA 3B9FH 3GY2A 1BTUA 3MU1A 3K6ZA 5EQRA 1DS2E 2BDIA 1T31A 2FX6A 1FIWA 3T5FH 1MTWA 4NIWA 4UFGH 1ZLRA 1FQ3A 1N1LA 1TGBA 2Q6DA 1LQDB 2RDLA 4OS2A 3TIUA 3ZZAA 2PUXB 1C2DA 2G55A 1B0FA 5A0AE 4YO9A 3QTVH 1MH0A 3FP7E 1QY6A 1Y8TA 2R2MB 3Q3YA 1P3CA 1GMDF 1O39A 2QY0B 5C1YA 2F83A 3RXMA 1CGJE 5EQQA 3BTEE 2OCVB 3TJOA 1GHYH 1OWDA 3RU4T 2R0LA 2VB0A 2IOTA 1C2EA 3CP7A 1N6XA 3D65E 2BVXH 1Z6JH 2LNCA 3GYLB 1F92A 4Y0ZE 6GCHG 2PSXA 3RC5A 8GCHG 3RC6A 4U2WA 2WUCA 1AU8A 1P2JA 1JIMA 3VB7A 5LPFA 1D6RA 1NT1A 4XFQA 3T2NA 2P8OC 4MVNA 1ZHRA 4I8GA 4JMYA 2FTLE 4AFZA 4DG4A 4ISIH 1C1WH 1CSOE 4JZIA 1OSSA 1T4VH 4FUCA 3U98H 1OP2A 2G5VA 1ZTLA 3TH4H 3PO1C 1T8NA 1H9LB 5T6GA 1SMFE 2HNTC 1BJUA 4AORA 5JPMH 4UFEH 1C5PA 2BD8A 2D2DA 1W2KH 2NU0E 4JYUH 1L4ZA 2XBYA 1ZPZA 1HCGA 1VITF 3S9AA 2Z7FE 4NGAH 4ZHLU 1GJ4H 1GBAA 1C5MD 3HGNA 4CRDA 3ZZ3A 5EPYA 3PTNA 1VCPA 2ANYA 1GMHF 1HAVB 1UTMA 1XKAC 2XNIA 1XKBC 1MQ6A 1DE7H 1GMHG 5AF9H 2QXGA 1TNJA 1NRRH 1Y3VA 1DWDH 2QIQA 1KDQA 1DANH 1FZZA 1P06A 2ZFFH 1QNJA 1G36A 1HUTH 5F6MA 1P2OA 5L2YH 1LQEA 5FCRA 3UR9A 1V2UT 1ORFA 4AG2A 3O8DA 1O31A 3C1KA 1O3HA 1G32B 4DCDA 1A0HB 1J16A 2FYQA 1IQKA 1SGFA 1QRWA 4AFUA 4DW2U 4GCHF 3S7KB 2BZ6H 4B73A 2STBE 4MPUA 5E0HA 3ATIA 4IN1A 1OWEA 3RXAA 1TNHA 4X8VH 3SUEA 5DP6A 1DFPA 2R3UA 1GBBA 1D4PB 1F0SA 3GCHC 4XBCA 1EOJA 6ESTA 3VGCC 2PKAB 2D8WA 1AE5A 1C1UH 1RRKA 2ODYB 1O2SA 1ABIH 2SGFE 1HJAC 1O2XA 1W12U 1XX9A 1VITG 3KIDU 3D49H 1IQLA 1O37A 1EAXA 3R3GB 1YBWA 4GLYA 1DICA 1TNIA 2FIRH 3SV8A 1L1NA 1TRNA 3LGYA 2ANMH 6CHAC 1FAXA 1GBTA 1QR3E 5EOKA 1P9UA 5CHAB 4NWLA 1ZYOA 1G3EA 3EGKH 1BITA 1BRUP 1YKTA 2Z3CA 1BT7A 2VIDA 2H9EH 5GCHG 2GVFA 3FVFB 1O2LA 1NU7B 4XBDA 4ZHMU 5LPRA 4GCHG 1GJAB 2BVRH 1CA8B 3MWIU 4K60A 2FOEA 2PTNA 5EQSA 1EX3A 2HNTF 2ZGBH 3SI3H 3ZV8A 1DXWA 1BTWA 4A1TA 1EJNA 2QAAA 1BMAA 3LGVA 2PKSB 3RXGA 1CA0B 3RXHA 2TRMA 5AHGH 4X2WA 1ELEE 1CGHA 4YLQH 4ASHA 1O2WA 3LGWA 1V2OT 4KKDA 4NIVA 3SI4H 4FUGA 1V2VT 1Y5AT 4BTIB 1FAKH 3K65B 1KSNA 3SV7A 1BTZA 3BG4B 1V2PT 1GJ5H 1QBNA 5FX6A 1ELVA 4O3UA 1P10A 2PUQH 1G2LA 2HPPH 3H5CB 3LDXH 1TGCA 1GCDA 3OTJE 2VVUA 2OC1A 2YOLA 2CN0H 1MTVA 1NFUA 1TPAE 3B23B 3EDXB 1HAIH 3SORA 2FOBA 4X1SU 2Y5GA 1P01A 4CREA 1C5RA 4NA8A 4D9RA 1B5GH 1THPB 1O5AB 5HGGA 2RA0A 2FI4E 1VR1H 1HJ8A 2XWBI 4OGXA 1QJ6B 3LGTA 4GUXA 3STIA 1FNIA 2OC0A 4ISHH 1P02A 4OS6A 5DP9A 4CR5A 3S0NA 3HPTB 1ETRH 1SVPA 2XC5A 4BXWA 1DY8A 1EPTA 1SGCA 2V0BA 5A0CA 1S84A 2A7CA 3BSQA 1CQQA 1OWKA 4X2XA 2VWOA 3RXSA 5A8ZA 3ZZDA 3TH3H 3NUMA 3RMOH 2ZI2H 4KTSA 3LPRA 3UNQA 2BB4A 3ZZ8A 1C2MA 4H6TA 3ODDA 2F9UA 2QXJA 1C5VA 2QYIA 3GY7A 3OY5U 4K1TA 3M5NA 2WPJS 3EYDA 3R0FA 1ELTA 1P12E 1Q2WA 2UUJB 1XUIA 2BYAX 1Z8RA 1C5UA 2BOKA 3V12A 3GOVB 2FOHA 2OXSA 4UFDH 3A7YA 4HGCA 4MNXA 1O38A 1QHRB 2AYWA 1DLEA 3AASA 2OP9A 1DPOA 3GY8A 2ZO3H 1GI6A 2KAIB 2Z9IA 2ZTYA 1BMLA 4AGJA 2ZHFH 3LOXA 1AY6H 4H42U 1P2QA 4ZKSU 1NU9A 3T26A 1H8DH 1HAGE 2J34A 2ZKSA 1MD8A 3SJKA 1HYLA 1ETTH 1W7XH 2OLGA 2WUBA 3M5LA 2W5EA 4E06H 1P09A 3BTME 1O36A 3LH3A 4JK5A 3SV6A 5DG6A 2VU8E