1GJCB

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting, hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjcB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjcB01
4A1TA 7KMEH 1RS0A 1BMNH 2GT8A 5EPNA 2ZNKH 3AAVA 3BTHE 4B2BA 1P11E 1PYTD 2FP7B 3SNBA 1GBDA 2ZDNA 3GICB 4D8NA 2UWLA 4BOHA 2PTCE 3SU5A 1MTUA 2R3UA 3RXKA 1YPLH 6CHAC 5HXFA 1ID5H 4WMDA 2BY9X 1FY8E 1P04A 1A0LA 1ZOMA 5CE1A 2QF3A 8LPRA 2I6QA 3GY6A 3OX7U 1KYNA 2ZF0H 2A45B 3ZYEA 5JBAS 2IJOB 4LOYH 1UO6A 1Y3WA 2ZA5A 1GDUA 4JZDH 1C5MD 2GKVE 2PTNA 3BSQA 3I78A 1D6WA 2ZHFH 1DY8A 2XYAA 2OD3B 4O3UA 5LGOA 3SV8A 1B7XB 1S0RA 4JYTA 1BJVA 1EZSC 4SGBE 5AFYH 3MO6A 1GBHA 1KY9A 5AFZH 1O3HA 3ZYDA 1YPGH 2ZPRA 2CGAA 1INCA 1S5SA 3DFJA 1DANH 1OP0A 3MTYA 2BLOA 2B0FA 4CHAC 1G3DA 1BBRK 1EJNA 1JXPA 2BLQA 2HOBA 3ZZ4A 3A80A 1QCPA 3LIWA 2PSXA 1EAXA 4AZ2B 2PGQB 3WY8A 2XXLA 1KLJH 5EG4A 1GJ8B 1SGDE 1ZSKA 1BITA 3SBKA 4Y7AA 1C2JA 3E16B 1IQEA 1NTPA 1A3BH 4IMZA 5J4SA 1TPOA 1BDAA 3M61U 1CVWH 1GJ5H 1JBUH 2ZGJA 3TJNA 3E91A 4LXBH 2XW9A 3M7TA 1PPFE 1XUFA 2WPHS 1G37A 1SGYE 3GY4A 1ESBA 4B76A 1EB2A 1ESAA 3S9AA 1O2VA 1AVGH 1NFXA 1HAZB 4K60A 5FCKA 4NIVA 2G51A 3H7TA 2H2ZA 4JZFH 3OY6U 1PFXC 1DUEA 1JWTA 4D7GA 2VWMA 4CR5A 2FI4E 3GDVA 5DG6A 1Z8JB 1BIOA 2WPLS 2HLCA 1JRTA 3M3SA 3M35A 4MPUA 2A7JA 4D76A 5A0CA 1TBRH 6GCHG 1Y3XA 4GCHF 5FPSA 2G4UA 4BXSA 2FPZA 2VINA 1P2QA 1ZHPA 2Q6FA 4I31A 1XUGA 4FU7A 2F3CE 2C3SA 8ESTE 1AN1E 5FBIA 3K6ZA 4Q2KA 1UCYE 3GDSA 2NU4E 1DDJA 2A4QA 4WMEA 1OWKA 3ZZDA 2FOMB 1THSH 2BDIA 1TQ7B 3IWMA 2O8WA 1O2PA 3KQDA 1O2LA 3LJOA 4H6SB 4ZUHA 6ESTA 2Z3DA 1HBTH 1GVZA 1KXBA 2QYIA 2JETB 1P3CA 1Y5BT 1AO5A 4H4FA 1GI8B 2D2DA 4INKA 4A1VA 2CV3A 1ETTH 4LK4A 3A86A 2C4FH 1GBAA 2J4IA 5B6OA 1PQAA 3M36A 1FV9A 3HGPA 2WUCA 4AFQA 1VITF 1CA0C 2A1DB 1O2HA 4NSYA 4B74A 1CHOF 1TYNA 2ALPA 3VFEA 1GCTB 1E38B 4NWLA 5BRRE 2GZ8A 3AW0A 3SO3A 4YO9A 3RP2A 1VZQH 1P2KA 3PO1B 4U01A 1OXGA 1ZLRA 3RC6A 1EAWA 1CT0E 4QT8C 1VJ9U 1OWIA 1K1NA 3SU0A 3DHKH 1ZMNA 2FOEA 3F9EA 1IQJA 2HPQH 2D26C 1MKXH 3MU1A 1MTVA 2GCHF 3Q3XA 4IW4E 3U8OH 5JYIA 1WTHD 4ZH8A 1HV7A 2BXUH 4DCDA 5E0JA 1J9CH 3B23B 1ZYOA 5TCCA 3MU5A 2GCTC 1LHDH 2QCYA 4CRBA 1QL8A 1C2LA 3T27A 4AORA 3PYHA 1Q2WA 1UHBA 2GGVB 3UFAA 1QFKH 3TGKE 3SUFA 1OPHB 3ATLA 1GBTA 3BEFB 1O36A 4I8KA 1Z1IA 3SV7A 3EA8A 1QURH 3DD2H 1P03A 4ZKRU 2ALVA 2P16A 2LPRA 2Q6DA 1CGHA 2B7DH 2VJ1A 4ABEA 1C2MA 1GJAB 1Z6JH 3PROA 4UFEH 4Y0YE 3SU2A 3TNTA 4Y6DA 2FOCA 3S7HB 1W10U 3M3VA 1O2TA 7GCHG 1LVMA 4XBDA 3UQOA 3AVZA 2V35A 1YPHE 4BTIB 2JETC 1FAXA 4NFFA 1A3EH 4WVPE 3SJOA 3ZZ5A 4WH8A 1XUKA 1Z8GA 2H9TH 3FZDA 3FZZA 3H5CB 3ZVEA 2J92A 2BLVA 5DP9A 5EW1H 5F8XA 2XBVA 1WQVH 1TNLA 3VEQB 4YZUA 2C8YB 1ZTKA 2AH4X 2P3TB 1GGDB 4HTCH 1XUIA 1JIMA 1GDNA 3GDUA 1GCTC 3T25A 1LKBA 1GMDG 2PKAB 5EOKA 1LQDB 2HPPH 1O3JA 3RXSA 2GZ7A 1QGFA 3PO1C 1V2NT 2J38A 3PLPA 4NA8A 3BTFE 5DJ7A 1IQFA 8GCHF 1A61H 1SQTA 3A7VA 1P06A 2ZDKA 1TNHA 4DURA 1M9UA 3RM2H 1SR5C 1Z71A 3GY3A 1SLXB 3A8BA 4NZLA 3ZVAA 2FOBA 3A84A 1GL1A 4XDEA 1PJPA 1AVWA 3N7OA 4JZIA 3SU6A 2NU2E 1HAGE 5TJXA 1PQ7A 1AZ8A 4D9RA 2O8UA 1EUFA 1ETSH 2GZ9A 1YCPK 3D23A 3U69H 2ZWLH 1RTFB 1F0SA 3KN2A 1IAUA 1J17T 2WPJS 1C5RA 4FUJA 1ANEA 1C5NH 3GY2A 2UWOA 2Y82A 1HAOH 3PB1E 1C5VA 2Z94A 4IC5A 4DW2U 5DP3A 3M5MA 3QZRA 1SVPA 1O5CB 3RLWH 2NWNA 4CRGA 1NC6A 1V6DA 1XUHA 4NWKA 3I77A 1HFDA 3RMNH 3F9FA 2FTMA 1UCYH 2FIRH 1DE7H 2FI3E 5C3NA 2D1JA 1VITH 4X2XA 3RU4T 1AGJA 1LVYA 3TVJB 1NRNH 3ODDA 1T8NA 1SGTA 1O3GA 3VGCC 2VGCB 3A8DA 1SB1H 1WTGH 3TITA 1YC0A 1GGDC 2A4RA 4B2CA 1BRCE 1O3OA 2V3OH 3P95A 2Y81A 1O5AB 3FFGA 3FANA 3KGPA 2SGEE 1G3BA 4A7IB 1H9LB 5GIBA 5FX5A 1LO6A 4I32A 2Z3CA 1O3BA 4GAWA 2ZTYA 1SLWB 2Z9IA 3A81A 4B73A 1TABE 2R0KA 3BTQE 3VB3A 5E0GA 1W7GH 2H9HA 1OP2A 2G55A 1BRBE 2WV4A 1V3XA 5HGGA 4X2VA 2ODQA 3QUMP 3RXRA 5A8YA 3RXCA 2ZFTA 4JZEH 1CBWB 2W3IA 4ZHMU 1L0ZA 2BM2A 4YLUA 4U30A 1P3EA 1LHGH 4J1YA 1Q31A 2ZDMA 1ARBA 1HXFH 2ZDLA 3LC3A 3ZVGA 4DG4A 3EA7A 1Y5AT 4YM9A 2OQ5A 2ASUB 4NIXA 1V2LT 1SOZA 3GY7A 2WYGA 1TAWA 1FLEE 1P57B 1SLVB 3GCTG 3RMMH 4K1SA 1FQ3A 2G5VA 2ZCHP 4O97A 1GBFA 1IOEA 2R3YA 1TRYA 4WMFA 1AFQB 1C9PA 2W3KA 2QAAA 3GYMA 1SG8B 1O2MA 1DT2A 4MPWA 4RKOB 4WXVA 3CENA 1V2PT 2XTTB 4K8BA 4KTUA 1QRXA 1O2YA 3QTOH 1S83A 1TBQH 1C5QA 1P2NA 2VGCC 5EXNA 3V7TA 2QXGA 1UTMA 1C1WH 1BTHH 2H1UA 2HNTC 3LJJA 3M5OA 4HGCA 5EXMA 1YGCH 2Z9JA 1HNEE 4Q80A 5C5OA 3LT3A 3Q77A 1BMLA 1O2OA 1OP8A 1O2NA 2ZHWH 3RXJA 1LVOA 1D4PB 1A4WH 1D3QB 4Y8XA 4E7RG 2H6MA 1K1JA 1ZSJA 4XBBA 2TRMA 5LH8A 4ZMAH 1EZUC 2BD9A 2QF0A 4O9VA 4X1QU 1TMBH 3UWIA 1FJSA 1OWEA 1L1NA 4AG1A 2ZFSA 3VXFH 7LPRA 1HAPH 4PROA 2RDLA 1F5LA 3SN8A 3LU9B 5DP6A 4CRAA 4AGJA 1BUIA 2VU8E 1UHBB 1CA8B 1CBWC 1P2MA 4Y0ZE 3KEEA 1XXFA 2PSYA 3HPTB 3NPSA 4AFUA 5A8XA 1ZHMA 1DWCH 2O8MA 3KCGH 1P2IA 2VIVA 3A8CA 3RXLA 2GDDA 1N8OB 5E2PA 1ELBA 2SGQE 1HJ8A 4JZ1A 2PWXA 3QWCH 4RKJB 1K1OA 2TGTA 3BIVH 2HGTH 3RXAA 2BZAA 1VR1H 1GBCA 1L4DA 1V2RT 1KLTA 4INLA 1W8BH 1DWDH 3QGJA 4GVUA 4KGAA 1HXEH 6CHAB 1KXEA 3K65B 2WINI 4MPXA 1ZMLA 1AFQC 2HWLB 4NSVA 1W0YH 2BQ6B 2TIOA 2BVRH 1XKBC 2BQWB 2FS9A 2HRVA 2O8LA 5CMXH 2VIQA 4ZKOU 3TU7H 2GD4B 2BDYA 1YPEH 1YKTA 2OXSA 2W7UA 1ARCA 1BJUA 1F5KU 3NKKA 4I8GA 4WY3A 2ZDVH 1AB9B 1ACBE 3LH1A 1NO9H 1NRRH 1G9IE 2FWWA 2QA9E 1UK2A 3ZZ7A 3LOXA 3LGIA 4I8HA 1MCVA 3G01A 3DFLA 1C5ZB 1TPSA 4GUXA 1V2QT 2ZZUH 1FN8A 1SGFG 3SI4H 3A7TA 2A5AA 1Z1JA 2SGFE 2UUFB 3AASA 1FPHH 1MKXK 4MPVA 3A8AA 1W11U 3A87A 4IC6A 1GJCB 3VXEH 3TIUA 1FDPA 5IYTA 3UNQA 5GPIB 1GBEA 1SOTA 1ZRBA 4CH2B 1F0UA 1PYTC 2ANKH 1UJ1A 4CBNA 1RXPA 1ANDA 1Y8TA 3SORA 1GI0A 5L2YH 1QQ4A 1GHBG 2PKAA 1N8OC 1C2KA 1C2DA 4AB8A 2AIQA 2VNTA 5C1XA 5L2ZH 1ZSLA 2GX4A 3FP7E 1HYLA 2ZGCA 1P12E 4X8UH 3BTME 1NESE 1A0JA 1C4Y2 1GJ6A 4Q7XA 1FZZA 1YPJH 1O3PB 4K1EA 1RD3B 1WYKA 1C5YB 1MQ5A 4JYUH 4Z0KA 1UTPA 1O2WA 2QY0B 1GVLA 2G81E 4MQAA 2UUKB 1RTKA 1HIAA 2B5TB 4IGDA 4U2WA 2QN5T 1H8IH 3M7UA 1UVPA 2UUYA 4HI3A 2ESTE 1VCQA 2G4TA 1T4VH 2XWBI 3BTWE 2OC1A 2XWAA 1AUJA 2FOGA 3K2UA 5H4IB 1PPBH 1DICA 3AW1A 1AB9C 1ZJKA 1Y3VA 1HRTH 2DE8A 3OYPA 3PMAB 2FYRA 3E0NB 3R3GB 1V2MT 2PHBA 2FYQA 1T8LA 2WV5A 1YYY1 2GT7A 1O2IA 2BDBA 4IS5A 3T26A 1Y3UA 2J95A 1SHHB 1O3MA 1FAKH 3NUMA 1S84A 3UNSA 3A85A 2Z9GA 5FHTA 3DA9B 3P70B 1FN6A 1OSSA 1UTNA 2PLXA 2NU3E 1CA0B 3P8FA 2STBE 1ELAA 5L30H 3LH3A 1H4WA 1OOKB 1P8VC 1GDQA 1O3EA 1AWHB 2PW8H 2P3UB 4NZQA 2XCFA 4Y79A 5F6MA 3TH2H 3TH4H 1CE5A 1FY5A 3BF6H 3T29A 3O8CA 1QIXB 3SHAH 3ZZCA 4X1PU 2A32A 1WV7H 2W5EA 1C5SA 1TBZH 1BBRE 1SQOA 2P93A 3NK8A 1HAIH 1O2JA 3MNCA 1WSSH 1WOFA 2DE9A 2A2QH 5ESTE 1GBLA 5A0BA 4TYDA 2GCTB 1NT1A 1HUTH 3F9GA 1SGQE 1UCYK 2G00A 1FXYA 4E06H 1SC8U 4TY6A 1CGJE 1AY6H 2FO9A 3EQ0H 1MUEB 2AGGX 4XFQA 1DXWA 2ZQ1A 1O3DA 4WJG2 4JK6A 1KXDA 2ZO3H 4YTAA 1THRH 1O31A 4XBCA 1RGQA 3BN9A 4GCHG 1BTPA 1G3EA 1YF4A 2NU0E 3EYDA 3BG4B 4IN2A 1SGFA 1ZJDA 2Z6BD 1XKAC 5DP7A 1AE8H 4ASHA 1Z8IB 2ZU1A 1NFUA 2PUQH 2XCNA 1CO7E 4LZ1H 1KXFA 1UTQA 5GCHF 1SGPE 1DWEH 1C9TA 3UOPA 3V13A 2K1QA 1GMHF 3SNAA 1UTJA 2A31A 1LKAA 1YP9A 1QB9A 1C1NA 2BTCE 2ZPSA 4Y8YA 3SQEE 2QXJA 3KL6A 3SI3H 1EAUA 4CBOA 2VIOA 3RUOA 1EAIA 1C2FA 1SGCA 1V2UT 4FU9A 3TJVA 3URDA 7ESTE 3Q76A 2ZPQA 4AFSA 4XSKU 4ZKSU 1V2VT 4AYVB 1QJ7B 1KSNA 1VITG 3RXIA 1B5GH 2FZZA 3O8BA 4ZKNU 1CHOG 2SGAA 1AFEH 1G30B 3M5LA 2PFEA 5G4BA 3P8NA 4K3JA 3QGNB 1AI8H 4OS6A 1DITH 1GBMA 2SNWA 3BTDE 1NFWA 1O5EH 2FLRH 3QN7A 2OQUA 3RXPA 1BHXB 1EQ9A 5K7RA 1OKXA 3SJIA 5EXLA 1A5GH 3MH5A 3SHCH 2EI7A 2P3FH 2C8XB 2F91A 1C4V2 4AX9H 4Z6AH 2QXIA 4X1RU 2OUAA 3A89A 1QHRB 3MU8A 4ZXXH 4NA9H 2GCHG 1MTWA 2ZFQH 2AFQB 1QB1A 3MU0A 1K1PA 3PV4A 2RA3A 2GV6A 4ZAEA 1ELTA 1ORFA 1P2OA 1CGIE 3F68H 2F83A 1ELGA 4ABGA 1PQ5A 2F9UA 3QDZB 1EOLA 2FESH 1N1LA 1O2UA 3BG4C 3T62A 1C5OH 5EQSA 3TH3H 2HVXA 2SGDE 2R0LA 1RIWB 5C20A 2OC7A 4I33A 4TY7A 1BMMH 1LPKB 2IPHA 2BY8X 3BIUH 1A5IA 3S7KB 2VVUA 4UFGH 3H7OA 2Y5HA 2EA3A 4KTCA 3UWJH 1EJMA 2A5KA 4Y8ZA 3L6PA 2FS8A 4FUGA 4CRFA 2PKSB 2ZFPH 3CS0A 1GCDA 1TIOA 4Y71A 3VGCB 1NU9A 3LGWA 1KIGH 4AGKA 4MLFB 1G3CA 2IN2A 3F1SB 2Y7XA 1XUJA 2ZGHA 1S85A 3E0PB 4YOJA 1HGTH 8KME2 2BD7A 1A46H 1BTXA 3O8DA 1HCGA 3BEUA 2Y7ZA 1ESTA 5F8ZA 1BOQA 1MKWH 2TGAA 4BAHB 1ZPCA 3GISB 3SGAE 4K5ZA 1LTOA 1EJAA 1O37A 1A0HB 4UDWH 3KF2A 5J4QA 1C2HA 1GBJA 8GCHG 1Y3YA 3RU4E 3T5FH 3TK5A 1HIAB 2ANYA 3EE0B 4DGJA 1AKSB 1F2SE 1NRSH 4MNVA 1OWHA 1S81A 2DUCA 3SW2B 1U6QA 1QQUA 2VVCA 1IQMA 1NPMA 2QC2A 2B9LA 1CU1A 1QBOA 2XBXA 1C1OA 1MAYA 2ZU5A 2M5TA 2G52A 1G36A 2A4GA 2GV7A 3L33A 5DK1A 5PTPA 1UVTH 1E35B 5FPYA 1O38A 3RLYH 2R2WU 2ZKSA 1RIWC 2WPIS 4OGYA 4AN7A 3FAOA 4ZHLU 1P0SH 5FBEA 2AEIH 1DLEA 3QK1A 2PKSC 3A7XA 1WAYB 3K9XB 1MQ6A 2F9BH 1LDTT 1IQHA 5C5NA 3EDXB 2AYWA 1V2KT 1LHFH 3B9FH 1MTNB 2AGEX 2A0QB 1ELVA 1ZGVA 3SV2H 4DT7B 2BOKA 2O8TA 4IBLH 1D3TB 2SNVA 4D9QA 1PQ8A 2BD5A 2FODA 1O3LA 3ZZ6A 2ZHQH 4R8TB 5FCRA 4E7NA 2TGPZ 1UMAH 2ZCKP 1ZTJA 2SFAA 2ZCLP 1O35A 4HFPB 5DP4A 3STIA 1C1QA 2Y6TA 3E1XB 5EU8A 1C1VH 1P09A 1GMCF 3ZV8A 2H5DA 4VGCB 2ODPA 1K2I1 1O5BB 4X1SU 3MNBA 1V2TT 1MZAA 3NCLA 2XC0A 3MH6A 2EI8A 1FUJA 2OCVB 1E0FD 2C8ZB 2FOHA 1XX9A 5HM9A 1C1SA 3KHVA 2A7CA 1GHVH 3ITIA 1ZRKA 1W3CA 2TGDA 1T4UH 2Q6GA 1SHYA 1F0TA 1GHAF 3SZNA 1AQ7A 3ESTA 1GHZA 2BMGB 2BYAX 3ZV9A 4A92A 2VWOA 4F49A 3S69A 3PWBA 2H9EH 4X6PA 1Z6EA 3RXEA 3ZZBA 3SUEA 1BTZA 1O5DH 1PPZA 1O2SA 1WQSA 5I25A 2WPMS 4K2YA 3TGJE 4A5TS 4DVAU 5FPTA 3LKWA 1Z8RA 3PMJA 1AHTH 4JCNA 3ZVBA 1O3FA 1V2JT 4BAKB 3KNXA 1O2KA 1MBMA 1FPCH 1QR3E 2BXTH 2Z3EA 4Q7ZA 1MTNC 2VB0A 1NRPH 1FIWA 1MH0A 3E6PH 4IN1A 4CREA 1TFXA 2OP9A 3SGBE 3ZZ9A 1ELEE 1UTKA 1TQ0B 3A7ZA 2FX6A 5C1YA 1O3IA 5LPRA 3GCOA 1AUTC 2ANMH 1W12U 5L6NH 3ZZ3A 3MWIU 2BDAA 3GY5A 1MBQA 3TPIZ 2W7SA 1HB0B 4X0WU 1FI8A 2SGPE 3LDXH 4I8LA 1DUAA 3D65E 2BB4A 3T2NA 2HNTE 1NY22 1YPKH 4VGCC 4X6NA 1TOMH 1TB6H 1BB0B 1HDTH 1NU7B 1VGCC 2RCEA 4X6OA 1O2ZA 2Y80A 2Z9KA 1WUNH 2PUXB 4RSPA 2BVSH 1O5FH 2YNAA 2R2MB 3HKIB 2FOFA 2BD4A 2V6NA 3UOUA 5DP5A 2BY6X 1DSUA 1O5GH 4ABJA 3PWCA 3Q3KA 3U98H 4FXGH 1TX7A 2GTBA 1EXFA 3JZ2B 2OC0A 3RC5A 1HAXB 3L3TA 4WWYA 4OS4A 2VWLA 3VB4A 3LGUA 1GJDB 1O2QA 1N6XA 2UUJB 1LMWB 5A2MH 1MD7A 3F9HA 1C4U2 1DOJA 2C93B 3PMBB 3E90B 6LPRA 4WXIA 3GYLB 1EOJA 2QXHA 3MO9A 2KAIB 1G2MA 1EPTC 1TPAE 3ZVCA 2BVXH 2P8OB 2OBOA 1JIRA 3HK6B 2ZU2A 4X8VH 3EA9A 5E8EH 4YOGA 3FVFB 2XBWA 3RDZA 5DP8A 1E36B 1DX5M 1MU6B 2BLWA 4KTSA 5EQQA 5GDSH 4B2AA 1QA0A 1MTSA 3TNSA 1ZPZA 3RXBA 1FY3A 2VWNA 1GG6C 2XNIA 1O2GH 1OX1A 2BZ6H 3P6ZB 3UNRA 3OU0A 4TWYA 4CH8B 1FY1A 2VH6A 3BTKE 3MYWA 1W0ZU 4ISLA 4AB9A 2CMYA 2FX4A 5I46H 4ZROA 3UQVA 1O32A 1ZPBA 1O0DH 3RXMA 2F9OA 3KQBA 2JH6D 3TK6A 1H8DH 1F92A 3MFJA 3BG8A 1GBIA 1SBWA 3MH7A 3MNSA 3QTVH 5CHAB 3A88A 4FUCA 3T28A 1EP6A 1C5WB 1GI5A 2ZIQH 2XBYA 5TCAA 2THFB 1TONA 2D8WA 3RXDA 5DO4H 3GY8A 3BTTE 1NROH 4GSOA 2ZGXH 4MNXA 1ANBA 3VB5A 1EP5A 3K6YA 5EPYA 3STJA 4FUIA 2ZQ2A 3PTNA 1HAHH 1C1RA 5F8TA 3OTJE 4X8SH 2BY7X 1GJ9B 3UPEA 2VIDA 5EW2H 2I6SA 1BRUP 3TLOA 1GI3A 1TPPA 4A6LA 2XC4A 1B0EA 1K9OE 1T8OA 5C2ZA 3D49H 1AKSA 1ETRH 1V2OT 2UWPA 4BXWA 3ATWA 4CR9A 3U1JB 1OS8A 2ZTZA 3A7YA 1BZXE 3BEIB 1NN6A 3RXGA 2P8OC 2G8TA 4F4OC 3JZ1B 4Y10E 1DFPA 1IQLA 1MKWK 2F9PA 3IITA 1GL0E 1W7XH 5A8ZA 2BOHB 1P9SA 4I7YH 1AVXA 2AMPA 1GBBA 3MHWU 1RJXB 5EGMA 4DIHH 3S9CA 1F5RA 3P8GA 5ESBA 4B75A 2TPIZ 1RTLA 2BX3A 4NFEA 4H6TA 1C5LH 1O3AA 2Z7FE 3A82A 5JB8S 1T8MA 1TE0A 4H42U 1LQEA 1TLDA 1A7SA 4X2YA 1ELDE 4K1TA 3SJ8A 3O8RA 5CHAC 1FY4A 1BTYA 4UD9H 5ABWA 2Y5GA 4AG2A 1YM0A 3MMGA 3U1IB 1S82A 2XRCA 9ESTA 1BA8B 4MVNA 3SNCA 1KTTB 1KXAA 4ABFA 1IHTH 2GVFA 1A2CH 1X7AC 1TALA 3RXFA 4D7FA 2AS9A 3UUZA 3VB6A 5DPAA 1AE5A 1MCTA 1SL3A 1L1JA 1PPHE 3HGNA 3PLKA 3FP6E 4O03A 3HATH 2ULLA 2ANWA 3UR9A 4AFZA 5HM2A 6GCHF 1GI6A 2VIPA 1TMTH 5AVDA 4ABDA 3TJUA 1O2RA 3ENSB 5T6GA 1K1LA 1GVKB 1NM6A 3PTBA 3W95A 2QIQA 1VCPA 3GOVB 3LGVA 4YT7H 3SNDA 1DWBH 4ABIA 1C5XB 1AMHA 4KELA 4XE4A 2ZEBA 2FMJA 4RN6A 1FNIA 1W14U 1TA2A 2STAE 1GJ4H 1EASA 1IQGA 5JB9S 2V3HH 1OWDA 3SU3A 1CQQA 1A1RA 1SQAA 4TPIZ 2FI5E 4MTBA 3RXVA 5GCHG 1GI1A 4ISNA 3MI4A 3HK3B 1LPZB 2ZECA 3BTEE 3SGQE 2ZG0H 3DUXH 4KP0A 1GMHG 5FX6A 1AZZA 2AMQA 2ZDAH 1DPOA 4FUHA 4M7GA 1C1MA 1QNJA 4NIYA 1IQIA 1Y59T 1BCUH 1CSOE 1EPTA 4KKDA 2V0BA 2O9QA 3R0FA 3MH4A 1O2XA 1XMNB 4ZHAA 3LC5A 5GXPA 3M7QA 4FVDA 2ILNA 1E37B 5F03A 5FXLA 1K1MA 1AWFH 1MMJN 3EAJA 4THNH 5AHGH 2AERH 3SOSA 1N6YA 2RG3A 2ZFFH 4WF8A 4XOJA 1P2JA 2A4OA 1BT7A 2JH5D 1H9HE 2J9NA 4DJZB 4FUFA 3OSYA 3Q00A 3RXQA 4X6MA 1O3KA 1RFNA 2BD2A 1CHGA 1GHYH 2TBSA 1C5TA 1YPMH 3TK9A 4INHA 1YPHC 2G5NA 1QJ1B 4HZHA 1TNIA 4FUDA 1D3PB 1WCZA 3UTUH 1KDQA 4BAOB 4BAMB 3GCHB 1UK3A 4ABHA 1G2LA 2AIPA 2BHGA 4YOIA 3E8LA 7GCHF 2CN0H 2BDCA 1LCYA 2YNBA 1TNJA 1ELCA 2BX4A 3D62A 1UVUH 1SFQB 1HAVB 3QLPH 5C67A 3URCA 5SGAE 4MG3A 3MO3A 1GHWH 1OWJA 4GHQA 1AD8H 4UEHH 3S0NA 1DLKB 1EZQA 3ZZ8A 1K21H 2CF9H 1H9IE 2AMDA 1UK4A 1EZXC 1QRZA 1ELFA 1XM1A 2W26A 2Z9LA 5HMAA 1GMDF 2KAIA 2JKHA 1SLUB 1DM4B 1F0RA 1FIZA 4K8YA 2ZC9H 1AU8A 4MNYA 1LHCH 5FAHA 1C2IA 3KQEA 1S6HA 4YESB 4DIIH 1QJ6B 4BTUB 2B8OH 4MDSA 4GPGA 3V3MA 1C2GA 1D9IA 2OBQA 1BTUA 1KLIH 2ZI2H 3RM0H 4E05H 1SI5H 1TGBA 1NFYA 3SQHE 5JBBS 5JDUB 2ODYB 1BTWA 3NZIA 1NRQH 2A2XH 1JMOH 2H5CA 4A1XA 3RXOA 1ZR0A 3RU4D 3P8OA 2GMTB 1BBRH 2A7HA 5E2OA 5T6DA 1Y5UT 4TWWA 2JH0D 1KXCA 5A0AE 4SGAE 1TNGA 2WYJA 1D3DB 4ESTE 3SUGA 1ZMJA 4ABAA 2YOLA 3BTGE 2QGRA 2ZP0H 1J14A 3GCHC 4GLYA 3ATIA 4CRDA 1IQKA 1GI7B 1WBGB 5EQRA 1ANCA 4UONA 1ABIH 5AF9H 4FUBA 3ATMA 3QX5H 3M3TA 3P92A 4YLQH 1WU1A 2EI6A 1GWAA 1TGSZ 3ELAH 1UTOA 1TOCB 1UTLM 1O30A 1DS2E 2PV9B 2ZTXA 1YBWA 3RC4A 3U9AH 1P10A 2FTLE 3B8JA 4UE7H 1C2EA 3C27B 2RA0A 5E0HA 1IQNA 3SNEA 5BPEA 1QL9A 4NCYA 2EEKA 5JPMH 4OS7A 1Z7KA 2ZU3A 1K1IA 3PM3A 3F6UH 1BHXF 2VIWA 1W2KH 1GI9B 4X2WA 4U32A 3UIRA 3SJKA 1O34A 2ZGBH 1K22H 4JYVH 1AIXH 2A5IA 1C1TA 2J2UA 1THPB 3C1KA 5GWZA 1QTFA 1MZDA 4OS5A 2WUBA 3PMHB 1H1BA 2PR3A 3OY5U 5LPFA 1GHXH 3AAUA 1SGIB 1ZGIA 1SGNE 3W94A 1P05A 4Y7BA 1VCWA 3NWUA 1P02A 3LPRA 4B1TA 3HKJB 2FLBH 3SUDA 2CHAB 5IDKA 2GMTC 3GCNA 1HJAB 1VGCB 1O33A 1QBNA 3M5NA 3RXHA 1GMCG 2BD3A 1TA6A 1YCPM 3U8RH 2QV1A 4BNRA 4ISOA 3QZQA 4CRCA 5LPEA 1PPGE 1ZZZA 1SGEE 3ODFA 4ABBA 2C90B 1PPEE 2PGBB 3IG6B 2F9VA 3LGTA 4ISIH 4UFFH 1QBVH 2OTVA 3GCTF 4ISHH 4X8TH 1OYTH 1VJAU 2NU1E 1GHAG 3UREA 4FU8A 1YLDA 4MNWA 4JK5A 3DT0H 4NIWA 4I8JA 2OINA 4BAQB 1SFIA 2BD8A 2J34A 1JOUB 1TRNA 2CJIA 4IMQA 5C1UA 3FP8E 1RRKA 2Y5FA 1CT2E 4NG9H 1E34B 2ZHDA 2Q1JA 3CS7A 5DGJA 5DKMA 3UR6A 1T32A 2F9NA 1EPTB 4TPYA 1C1PA 2BDGA 1NS3A 2R9PA 1O3CA 2AGIX 3KIDU 2P94A 1IHSH 1XXDA 4BTTB 4J2YB 5ETXA 1TGCA 4FVBA 3RMLH 1J15A 4DOQA 1TGTA 1ZHRA 1F7ZA 2XC5A 1GG6B 3SV6A 3SV9A 1TRMA 1TMUH 3CP7A 1TX8A 4K69A 1HLTH 1XVMA 2ZFRH 1ABJH 3ZZAA 3MNXA 3E3TA 4YT6H 1OYQA 4AYYB 1MU8B 4R0IA 3NXPA 1UVOA 4OGXA 2IOTA 1SSXA 1EATA 1C1UH 1DXPA 2CHAC 5T3HA 3SU4A 3SJ9A 1HJAC 4ZXYH 5GJ4B 5EODA 5HYOA 2EC9H 1V2ST 1TGNA 4FUEA 4UFDH 1BQYA 1T7CA 2VVVA 3A7WA 1CT4E 3RXTA 2J94A 5K0HA 3RXUA 1UVSH 1KDQB 3ZVDA 1KTSB 1C5UA 4OS2A 1GJ7B 3LGYA 3TJOA 1S6FA 1GI2A 2FM2A 1FONA 3V0XA 1Q3XA 1LHEH 1QRWA 3A83A 1C5PA 1FMGA 2BQ7B 2C8WB 4NA7A 1GBKA 1K28D 2FOAA 2HNTF 1DVAH 2P59A 4NGAH 2P95A 5T6FA 9LPRA 2FXRA 1O39A 4Q7YA 1HPGA 1BRAA 1D6RA 1L1GA 1P01A 4AOQA 2GDEH 3MU4A 1A5HA 4OS1A 4Y11E 3ZVFA 1DSTA 3PLBA 1S0QA 1V2WT 1O3NA 2OLGA 2BDHA 1LPGB 1B0FA 1J8AA 1GPZA 2FDAA 1NZQH 2LNCA 1T31A 4O3TA 3S9BA 3LONA 1QB6A 2CXVA 1YLCA 3M37A 4X1NU 3KQCA 2FEQH 1YCPH 1GJBB 1HJ9A 1JRSA 1TNKA 2WPKS 3MOCA 1DY9A 1QL7A 5JBTA 4JMYA 3TGIE 3QO6A 4Y76A 4GHTA 2CF8H 1EX3A 1TWXB 1SGRE 4WH6A 4BANB 4DY7B 1L4ZA 1PPCE 1W13U 1J16A 5JBCS 1BMAA 3ATKA 1L2EA 3EGKH 1HAVA 1SMFE 1P9UA 4CHAB 2GP9B 1ZTLA 3I29A 1QY6A 2HALA 5A09A 2ZHEH 1LVBA 1MAXA 3BV9B 1HAYB 3P17H 3Q3YA 1GI4A 4B71A 2BY5X 1MD8A 4LZ4B 3RMOH 3VB7A 1GHBF 3UY9A 1SPJA 3SU1A 2OC8A 1EB1H 1QA7A 1EKBB 3V12A 1TX6A 1XVOA 3U8TH 3VPKA 2VH0A 1G32B 2ZU4A
chains in the Genus database with same CATH superfamily
4A1TA 7KMEH 1RS0A 1BMNH 2GT8A 5EPNA 4P02A 2ZNKH 3AAVA 3CNRA 3BTHE 4B2BA 1P11E 1PYTD 2FP7B 3SNBA 1GBDA 2ZDNA 3GICB 4D8NA 2UWLA 4BOHA 2PTCE 3SU5A 1MTUA 2R3UA 3RXKA 1YPLH 6CHAC 5HXFA 1ID5H 4WMDA 2BY9X 2JDID 1FY8E 1P04A 1A0LA 1ZOMA 5CE1A 2QF3A 8LPRA 2I6QA 3GY6A 3OX7U 1KYNA 2ZF0H 2A45B 3ZYEA 5JBAS 2IJOB 4LOYH 1UO6A 1Y3WA 2ZA5A 1GDUA 4JZDH 1C5MD 2GKVE 2PTNA 3BSQA 3I78A 1D6WA 5DN6D 2ZHFH 1DY8A 5F53A 2XYAA 5EJ1A 5EIYA 2OD3B 4O3UA 5LGOA 3SV8A 1B7XB 1S0RA 4JYTA 4YXWD 1BJVA 1EZSC 4SGBE 5AFYH 3MO6A 1GBHA 1KY9A 5AFZH 1O3HA 3ZYDA 1YPGH 2ZPRA 2CGAA 1INCA 1S5SA 3DFJA 1DANH 1OP0A 3MTYA 2BLOA 2B0FA 4CHAC 1G3DA 2KR7A 1BBRK 1EJNA 1JXPA 2BLQA 2HOBA 3ZZ4A 3A80A 1QCPA 3LIWA 2PSXA 1EAXA 2WV9A 4AZ2B 2PGQB 3WY8A 2XXLA 1KLJH 5EG4A 1GJ8B 1SGDE 1ZSKA 1BITA 3SBKA 4Y7AA 1C2JA 3E16B 4DT4A 1IQEA 1NTPA 1A3BH 4IMZA 5J4SA 1TPOA 1BDAA 3M61U 1CVWH 1GJ5H 1JBUH 2ZGJA 3TJNA 3E91A 2J98B 4LXBH 2XW9A 3M7TA 1PPFE 1XUFA 2WPHS 1G37A 2WHXA 1SGYE 2WPDD 1ESBA 3GY4A 4B76A 1EB2A 1ESAA 3S9AA 3UAIC 1O2VA 1AVGH 2KX4A 1NFXA 1HAZB 4FETA 4K60A 5FCKA 4NIVA 2G51A 3H7TA 1MABB 2H2ZA 4JZFH 3OY6U 1PFXC 1DUEA 1JWTA 4D7GA 2VWMA 4CR5A 2FI4E 3GDVA 5DG6A 1Z8JB 1BIOA 2WPLS 2HLCA 1JRTA 3M3SA 3M35A 4MPUA 2A7JA 4D76A 5A0CA 1TBRH 6GCHG 1Y3XA 4GCHF 5FPSA 2G4UA 4BXSA 2FPZA 2VINA 1P2QA 1ZHPA 2Q6FA 4I31A 1XUGA 4FU7A 2F3CE 5B6LA 2C3SA 8ESTE 1AN1E 5FBIA 3K6ZA 4Q2KA 1UCYE 3GDSA 2NU4E 1DDJA 2A4QA 4WMEA 1OWKA 3ZZDA 2FOMB 1THSH 2BDIA 1TQ7B 3IWMA 2O8WA 1O2PA 3KQDA 1O2LA 3LJOA 4H6SB 4ZUHA 6ESTA 2Z3DA 1HBTH 1GVZA 1KXBA 2QYIA 2JETB 1P3CA 1Y5BT 1AO5A 4H4FA 1GI8B 2D2DA 4INKA 4A1VA 2CV3A 4Q4LA 1ETTH 4LK4A 2RFKC 3A86A 2C4FH 1GBAA 2J4IA 5B6OA 1PQAA 3M36A 1FV9A 3HGPA 2WUCA 4AFQA 1VITF 1CA0C 2A1DB 1O2HA 4NSYA 4B74A 1CHOF 1TYNA 2ALPA 3VFEA 1GCTB 1E38B 4NWLA 5BRRE 2GZ8A 3AW0A 3SO3A 4YO9A 3RP2A 4Q63A 1VZQH 1P2KA 3PO1B 4U01A 1OXGA 1ZLRA 3RC6A 1EAWA 2K0QA 1CT0E 4QT8C 1VJ9U 5KEDA 1OWIA 1K1NA 3SU0A 3DHKH 1ZMNA 2FOEA 3F9EA 1IQJA 2HPQH 2D26C 1MKXH 3MU1A 1MTVA 4RI0A 2GCHF 3Q3XA 4IW4E 3U8OH 5JYIA 1WTHD 4ZH8A 1HV7A 2BXUH 4DCDA 5E0JA 1J9CH 3B23B 1ZYOA 5TCCA 3MU5A 2GCTC 1LHDH 2QCYA 4CRBA 1QL8A 1C2LA 3T27A 4AORA 3PYHA 1Q2WA 1UHBA 2GGVB 3UFAA 1QFKH 3TGKE 3SUFA 1OPHB 3ATLA 1GBTA 3BEFB 1O36A 4I8KA 1Z1IA 3SV7A 3EA8A 1QURH 3DD2H 1P03A 4ZKRU 2ALVA 2P16A 2LPRA 2Q6DA 1CGHA 2B7DH 2VJ1A 4ABEA 1C2MA 1GJAB 1Z6JH 3PROA 4UFEH 4Y0YE 3SU2A 3TNTA 4Y6DA 2FOCA 3S7HB 1W10U 3M3VA 1O2TA 7GCHG 1LVMA 4XBDA 3UQOA 3AVZA 2V35A 1YPHE 4BTIB 2JETC 1FAXA 4NFFA 1A3EH 4WVPE 3SJOA 2XOKD 3ZZ5A 4WH8A 1XUKA 1Z8GA 2H9TH 3FZDA 3FZZA 3H5CB 3ZVEA 2J92A 2BLVA 5DP9A 5EW1H 2L6OA 5F8XA 2XBVA 1WQVH 1TNLA 3VEQB 4YZUA 2C8YB 1ZTKA 2AH4X 2P3TB 1GGDB 4HTCH 1XUIA 1JIMA 1GDNA 3GDUA 1GCTC 3T25A 1LKBA 1GMDG 2PKAB 5EOKA 1LQDB 2HPPH 1O3JA 3RXSA 2GZ7A 1QGFA 3PO1C 1V2NT 2J38A 3PLPA 4NA8A 3BTFE 1SKYE 5DJ7A 1IQFA 8GCHF 1A61H 1SQTA 3A7VA 1P06A 2ZDKA 1TNHA 4DURA 1M9UA 3RM2H 1SR5C 1Z71A 3GY3A 1SLXB 3A8BA 4NZLA 3ZVAA 2FOBA 3A84A 1GL1A 4XDEA 1PJPA 1NBMD 1AVWA 3N7OA 4JZIA 3SU6A 2NU2E 1HAGE 5TJXA 1PQ7A 1AZ8A 4D9RA 2O8UA 1EUFA 1ETSH 2GZ9A 3KYGA 3OAAD 1YCPK 3D23A 3U69H 2ZWLH 1RTFB 1F0SA 3KN2A 1IAUA 1J17T 2WPJS 2HVYB 1C5RA 4FUJA 1ANEA 1C5NH 3GY2A 2UWOA 2Y82A 1HAOH 3PB1E 1C5VA 2Z94A 4IC5A 4DW2U 5DP3A 3M5MA 3QZRA 1SVPA 1O5CB 3RLWH 2NWNA 4CRGA 1NC6A 1V6DA 1XUHA 4NWKA 3I77A 1HFDA 3RMNH 3F9FA 2FTMA 1UCYH 2FIRH 5KGOA 1DE7H 2FI3E 5C3NA 2D1JA 1VITH 4X2XA 3RU4T 1AGJA 1LVYA 3TVJB 1NRNH 3ODDA 4TSFD 1T8NA 1SGTA 2KM0A 1O3GA 3VGCC 2VGCB 3A8DA 1SB1H 1WTGH 2KCOA 3TITA 1YC0A 1GGDC 2A4RA 4B2CA 1BRCE 1O3OA 2V3OH 3P95A 2Y81A 1O5AB 3FFGA 3FANA 3KGPA 2SGEE 1G3BA 4A7IB 1H9LB 5GIBA 5FX5A 1LO6A 4I32A 2Z3CA 1O3BA 4GAWA 2ZTYA 1SLWB 2Z9IA 3A81A 4B73A 1TABE 3H09A 2R0KA 3BTQE 3VB3A 5E0GA 1W7GH 2H9HA 1OP2A 2G55A 1BRBE 2WV4A 1V3XA 5HGGA 4X2VA 2ODQA 3QUMP 3RXRA 5A8YA 3RXCA 2ZFTA 4JZEH 1CBWB 2L74A 2W3IA 4ZHMU 1L0ZA 2BM2A 2KCYA 4YLUA 4U30A 1P3EA 1LHGH 4J1YA 1Q31A 2ZDMA 1ARBA 1HXFH 2ZDLA 3LC3A 3ZVGA 4DG4A 3EA7A 2J98A 1Y5AT 4YM9A 2OQ5A 2ASUB 4NIXA 1V2LT 1SOZA 3GY7A 2WYGA 1TAWA 1FLEE 1P57B 1SLVB 3GCTG 3RMMH 4K1SA 1FQ3A 2G5VA 2ZCHP 4O97A 1GBFA 1IOEA 2R3YA 1TRYA 4WMFA 1AFQB 1C9PA 2W3KA 2QAAA 3GYMA 4M9FA 1SG8B 1O2MA 1DT2A 4MPWA 4RKOB 4WXVA 3CENA 1V2PT 2XTTB 4K8BA 4KTUA 1QRXA 1O2YA 3QTOH 1S83A 1TBQH 1C5QA 1P2NA 2VGCC 5EXNA 3V7TA 2QXGA 1UTMA 1C1WH 1BTHH 2H1UA 2HNTC 3LJJA 3M5OA 4HGCA 5EXMA 1YGCH 2Z9JA 1HNEE 4Q80A 5C5OA 4AC9A 3LT3A 3Q77A 1BMLA 1O2OA 1OP8A 1O2NA 2ZHWH 3RXJA 1LVOA 1D4PB 1A4WH 1D3QB 4Y8XA 4E7RG 2H6MA 1K1JA 1ZSJA 4XBBA 2TRMA 3U28C 5HIYA 5LH8A 4ZMAH 1EZUC 2BD9A 2QF0A 5CHBA 4O9VA 4X1QU 1TMBH 3UWIA 1FJSA 1OWEA 1L1NA 4AG1A 2ZFSA 3VXFH 7LPRA 1HAPH 4PROA 2RDLA 1F5LA 3SN8A 3LU9B 5DP6A 4CRAA 4AGJA 1BUIA 5C0UA 2VU8E 1UHBB 1CA8B 1CBWC 1P2MA 4Y0ZE 3KEEA 1XXFA 2PSYA 3HPTB 3NPSA 4AFUA 5A8XA 1ZHMA 2KCPA 1DWCH 2O8MA 3KCGH 1P2IA 2VIVA 3A8CA 3RXLA 2GDDA 1N8OB 5E2PA 1ELBA 3OTPA 2SGQE 1HJ8A 4JZ1A 2PWXA 3QWCH 4RKJB 1K1OA 2TGTA 3BIVH 2HGTH 3RXAA 2BZAA 3F2FA 1VR1H 1GBCA 1L4DA 1V2RT 1W0JD 1KLTA 4INLA 1W8BH 1DWDH 3QGJA 4GVUA 4KGAA 1HXEH 6CHAB 1KXEA 3K65B 3SYJA 2WINI 4MPXA 1ZMLA 1AFQC 2HWLB 4NSVA 1W0YH 2BQ6B 2TIOA 2BVRH 1XKBC 2BQWB 2FS9A 2HRVA 2O8LA 5CMXH 2VIQA 4ZKOU 3TU7H 2GD4B 2BDYA 1YPEH 2J5UA 1YKTA 2OXSA 2W7UA 3W1EA 1ARCA 1BJUA 1F5KU 3NKKA 4I8GA 4P00A 4WY3A 5C17A 2ZDVH 1AB9B 1ACBE 3LH1A 1NO9H 1NRRH 1G9IE 2FWWA 2QA9E 1UK2A 3ZZ7A 3LOXA 3FN8A 3LGIA 4I8HA 1MCVA 3G01A 3DFLA 1C5ZB 1TPSA 4GUXA 1V2QT 2ZZUH 1FN8A 1SGFG 3SI4H 3A7TA 2A5AA 1Z1JA 2SGFE 2UUFB 3AASA 1FPHH 1MKXK 4MPVA 3A8AA 1W11U 3A87A 4IC6A 1GJCB 3VXEH 3TIUA 1FDPA 5IYTA 3UNQA 5GPIB 1GBEA 1SOTA 1ZRBA 3EE7A 4CH2B 1F0UA 1PYTC 2ANKH 1UJ1A 4CBNA 1RXPA 1ANDA 1VKYA 1Y8TA 3SORA 1GI0A 5L2YH 1QQ4A 1GHBG 2PKAA 1N8OC 1C2KA 1C2DA 4AB8A 2J97A 2AIQA 2VNTA 5C1XA 5L2ZH 1ZSLA 2GX4A 3FP7E 1HYLA 3DCLA 2ZGCA 1P12E 4X8UH 3BTME 1NESE 1A0JA 1C4Y2 1GJ6A 4Q7XA 1FZZA 1YPJH 1O3PB 4K1EA 1FX0B 1RD3B 1WYKA 1C5YB 1MQ5A 4JYUH 4Z0KA 1UTPA 1O2WA 2QY0B 1GVLA 2G81E 4MQAA 2UUKB 1RTKA 1HIAA 2B5TB 4IGDA 4U2WA 2QN5T 1H8IH 3M7UA 1UVPA 2UUYA 4HI3A 2ESTE 1VCQA 2G4TA 1T4VH 2XWBI 3BTWE 2OC1A 2XWAA 1AUJA 2FOGA 3K2UA 5H4IB 1PPBH 1DICA 3AW1A 1AB9C 1ZJKA 4XD7D 1Y3VA 5GNDA 3F2GA 1HRTH 2DE8A 3OYPA 3PMAB 2FYRA 3E0NB 3R3GB 1E79D 1V2MT 2PHBA 2FYQA 1T8LA 2WV5A 1YYY1 2GT7A 1O2IA 2BDBA 4IS5A 3T26A 1Y3UA 2J95A 1SHHB 1O3MA 1FAKH 3NUMA 1S84A 3UNSA 3A85A 2Z9GA 2LP6A 5FHTA 1YLNA 3DA9B 3P70B 1FN6A 2EY4C 1OSSA 1UTNA 2M2AA 2PLXA 2NU3E 1CA0B 3P8FA 2STBE 1ELAA 5L30H 3LH3A 1H4WA 1OOKB 1P8VC 1GDQA 1O3EA 1AWHB 2PW8H 2P3UB 4NZQA 2XCFA 4Y79A 5F6MA 3TH2H 3TH4H 1CE5A 1FY5A 3BF6H 3T29A 3O8CA 1QIXB 3SHAH 3ZZCA 4X1PU 2A32A 1WV7H 2W5EA 1C5SA 1TBZH 1BBRE 1SQOA 2P93A 2F43B 3NK8A 1HAIH 1O2JA 3MNCA 1WSSH 1WOFA 2DE9A 2A2QH 5ESTE 1UW7A 1GBLA 5A0BA 4TYDA 2GCTB 1NT1A 1HUTH 3F9GA 1SGQE 1UCYK 2G00A 1FXYA 4E06H 1SC8U 2VBCA 4TY6A 1CGJE 1AY6H 2FO9A 2XNDD 3EQ0H 1MUEB 2W6JD 2AGGX 4ACBA 4XFQA 1COWD 1DXWA 2ZQ1A 1O3DA 4WJG2 4JK6A 1KXDA 2ZO3H 4YTAA 1THRH 1O31A 4XBCA 1RGQA 3BN9A 4GCHG 1BTPA 1G3EA 1YF4A 2NU0E 3EYDA 3BG4B 4IN2A 1SGFA 1ZJDA 2Z6BD 1XKAC 5DP7A 1AE8H 4ASHA 4XRNA 3FO8D 1Z8IB 2ZU1A 1NFUA 2PUQH 4B6FA 2XCNA 1CO7E 4LZ1H 1KXFA 1UTQA 5GCHF 1SGPE 1DWEH 1C9TA 3UOPA 3V13A 2K1QA 1GMHF 3SNAA 1UTJA 2A31A 1LKAA 1YP9A 1QB9A 1C1NA 2BTCE 2ZPSA 4Y8YA 3SQEE 2QXJA 3KL6A 3SI3H 1EAUA 4CBOA 2VIOA 3RUOA 1EAIA 1C2FA 1SGCA 1V2UT 2AHME 4FU9A 4RT0A 3TJVA 3URDA 7ESTE 3Q76A 2ZPQA 4AFSA 4XSKU 4ZKSU 1V2VT 4AYVB 1QJ7B 1KSNA 1VITG 3RXIA 1B5GH 2FZZA 3O8BA 5EJLA 4ZKNU 1CHOG 2SGAA 1AFEH 1G30B 3M5LA 2PFEA 2PP6A 5G4BA 3P8NA 4K3JA 3QGNB 1AI8H 4OS6A 1DITH 1GBMA 2SNWA 3BTDE 1NFWA 4ASUD 1O5EH 2FLRH 1QZ8A 3QN7A 2OQUA 3RXPA 1BHXB 1EQ9A 5K7RA 1OKXA 2WZQA 3SJIA 5EXLA 1A5GH 3MH5A 3SHCH 2EI7A 2P3FH 2C8XB 2F91A 1C4V2 4AX9H 4Z6AH 2QXIA 4X1RU 2OUAA 3A89A 1QHRB 3MU8A 4ZXXH 4NA9H 2GCHG 1MTWA 2ZFQH 2AFQB 1QB1A 3MU0A 1K1PA 3PV4A 2RA3A 2GV6A 4ZAEA 1ELTA 1ORFA 1P2OA 1CGIE 3F68H 2F83A 1ELGA 4ABGA 1PQ5A 2F9UA 3QDZB 1EOLA 2FESH 1N1LA 1O2UA 3BG4C 3T62A 1C5OH 5EQSA 3TH3H 2HVXA 2SGDE 2R0LA 1RIWB 2JIZD 5C20A 2OC7A 4I33A 4TY7A 1BMMH 1LPKB 2IPHA 2BY8X 3BIUH 1A5IA 3S7KB 2VVUA 4UFGH 3H7OA 2Y5HA 2EA3A 4KTCA 3GS9A 3UWJH 1EJMA 2A5KA 4Y8ZA 3L6PA 2FS8A 4FUGA 4CRFA 2PKSB 2ZFPH 3CS0A 1GCDA 1TIOA 4Y71A 3VGCB 1NU9A 3LGWA 1KIGH 3PRDA 4AGKA 4MLFB 1G3CA 2IN2A 3F1SB 2Y7XA 1XUJA 2ZGHA 1S85A 3E0PB 4YOJA 1HGTH 8KME2 2BD7A 1A46H 1BTXA 3O8DA 1HCGA 3BEUA 2Y7ZA 1ESTA 5F8ZA 1BOQA 1MKWH 2TGAA 4BAHB 1ZPCA 3GISB 3SGAE 4K5ZA 1LTOA 1EJAA 1O37A 1A0HB 2QE7D 4UDWH 3KF2A 5J4QA 1C2HA 1GBJA 8GCHG 1Y3YA 3RU4E 3T5FH 3TK5A 1HIAB 2ANYA 3EE0B 4DGJA 1AKSB 1F2SE 1NRSH 4MNVA 1OWHA 1S81A 1YWUA 2DUCA 3SW2B 1U6QA 1QQUA 2VVCA 1IQMA 1NPMA 3AK5A 2QC2A 3WWBA 3DSOA 2B9LA 1CU1A 1QBOA 2XBXA 1C1OA 1MAYA 2ZU5A 2M5TA 2G52A 1G36A 2A4GA 2GV7A 3L33A 5DK1A 5PTPA 1UVTH 1E35B 5FPYA 1O38A 3RLYH 2R2WU 2ZKSA 1RIWC 2WPIS 4OGYA 4AN7A 3FAOA 4ZHLU 1P0SH 5FBEA 2AEIH 1DLEA 3QK1A 2PKSC 3A7XA 1WAYB 3K9XB 5C0TA 1MQ6A 4I86A 2F9BH 1LDTT 3KQ5A 1IQHA 5C5NA 3EDXB 2AYWA 1V2KT 1LHFH 3B9FH 1MTNB 2AGEX 2A0QB 1ELVA 1ZGVA 3SV2H 4DT7B 2BOKA 2O8TA 4IBLH 1D3TB 2SNVA 4D9QA 1PQ8A 2BD5A 2FODA 3OFND 4OM9A 1O3LA 3ZZ6A 2ZHQH 4R8TB 5FCRA 4E7NA 2TGPZ 1UMAH 2ZCKP 1ZTJA 2SFAA 2ZCLP 1O35A 4HFPB 5DP4A 3STIA 1C1QA 2Y6TA 3E1XB 5EU8A 1C1VH 1P09A 1GMCF 2EQNA 3ZV8A 2H5DA 4VGCB 2ODPA 1K2I1 1O5BB 4X1SU 3MNBA 1V2TT 1MZAA 3NCLA 2XC0A 3MH6A 2EI8A 1FUJA 2OCVB 1E0FD 2C8ZB 2FOHA 1XX9A 5HM9A 1C1SA 3KHVA 2A7CA 1GHVH 3ITIA 1ZRKA 1W3CA 2TGDA 3NRLA 2W6ID 1T4UH 2Q6GA 1SHYA 1F0TA 1GHAF 3SZNA 1AQ7A 4ZCNA 3ESTA 1GHZA 1H8HD 2BMGB 2BYAX 3ZV9A 4A92A 2VWOA 4F49A 3S69A 3PWBA 2H9EH 4X6PA 1Z6EA 3RXEA 3ZZBA 2IPQX 3SUEA 1BTZA 1O5DH 1PPZA 1O2SA 1WQSA 5I25A 2WPMS 4K2YA 3TGJE 4A5TS 4DVAU 5FPTA 3LKWA 1Z8RA 3PMJA 1AHTH 4JCNA 3ZVBA 1O3FA 2GJGA 1V2JT 4BAKB 3KNXA 1O2KA 1MBMA 1FPCH 1QR3E 2BXTH 2Z3EA 4Q7ZA 1MTNC 2VB0A 1NRPH 1FIWA 1MH0A 3E6PH 4IN1A 4CREA 1TFXA 2OP9A 3SGBE 3ZZ9A 3PV2A 1ELEE 1UTKA 1TQ0B 2YMSC 3A7ZA 2FX6A 5C1YA 1O3IA 5LPRA 3GCOA 1AUTC 2ANMH 1W12U 5L6NH 3ZZ3A 3MWIU 2BDAA 3GY5A 1MBQA 3FOAA 3TPIZ 2W7SA 1HB0B 4X0WU 1FI8A 2SGPE 2OK5A 3FKSD 3LDXH 2YMSD 3DSPA 4I8LA 5FL7D 1DUAA 3D65E 2BB4A 3T2NA 2HNTE 1NY22 1YPKH 4VGCC 1WDIA 4X6NA 1TOMH 1TB6H 1BB0B 1HDTH 1NU7B 1VGCC 2RCEA 4X6OA 1O2ZA 2Y80A 2Z9KA 1WUNH 2PUXB 4RSPA 2BVSH 1O5FH 2YNAA 2R2MB 3HKIB 2FOFA 2BD4A 2V6NA 3UOUA 5DP5A 2BY6X 1DSUA 1O5GH 4ABJA 3PWCA 3Q3KA 3U98H 4FXGH 1TX7A 2GTBA 1EXFA 3JZ2B 2OC0A 3RC5A 1YY3A 1HAXB 3L3TA 4WWYA 4OS4A 2VWLA 3VB4A 2RDEA 1GJDB 3LGUA 1O2QA 1N6XA 2UUJB 1LMWB 5A2MH 1MD7A 3F9HA 1C4U2 1DOJA 2C93B 3PMBB 3E90B 6LPRA 4WXIA 3GYLB 1EOJA 2QXHA 3MO9A 2KAIB 3F2HA 1G2MA 1EPTC 1TPAE 3ZVCA 2BVXH 2P8OB 2OBOA 1JIRA 3HK6B 2ZU2A 4X8VH 3EA9A 5E8EH 4YOGA 3FVFB 2XBWA 3RDZA 5DP8A 1E36B 1DX5M 1MU6B 2BLWA 4KTSA 5EQQA 5GDSH 4B2AA 5CDFE 1QA0A 1MTSA 3TNSA 1ZPZA 3RXBA 1FY3A 2VWNA 1GG6C 2XNIA 1O2GH 5EJZA 1OX1A 2BZ6H 3P6ZB 3UNRA 3OU0A 4TWYA 4CH8B 1FY1A 2VH6A 3BTKE 3MYWA 1W0ZU 4ISLA 4AB9A 2CMYA 2FX4A 5I46H 4ZROA 3UQVA 1O32A 1ZPBA 1O0DH 3RXMA 2F9OA 3N7EA 3KQBA 2JH6D 3TK6A 1H8DH 1F92A 3MFJA 3BG8A 1GBIA 1SBWA 3MH7A 3MNSA 3QTVH 5CHAB 3A88A 4FUCA 3T28A 1EP6A 1C5WB 1GI5A 2ZIQH 2XBYA 5TCAA 2THFB 1TONA 2D8WA 3RXDA 5DO4H 1K0HA 2KZ4A 3GY8A 3BTTE 1NROH 4GSOA 2ZGXH 3OEHD 4MNXA 1ANBA 3VB5A 1EP5A 3K6YA 5EPYA 5HKKD 4TT3D 3STJA 4FUIA 2ZQ2A 3PTNA 1HAHH 1C1RA 5F8TA 3OTJE 4X8SH 2BY7X 1GJ9B 3UPEA 2VIDA 5EW2H 2I6SA 1BRUP 3TLOA 1GI3A 1TPPA 4A6LA 2XC4A 1B0EA 1K9OE 1T8OA 5C94A 5C2ZA 3D49H 1AKSA 1ETRH 1V2OT 2UWPA 4BXWA 4F48B 3ATWA 4CR9A 3U1JB 1OS8A 2ZTZA 3A7YA 1BZXE 3BEIB 1NN6A 3RXGA 2P8OC 2G8TA 4F4OC 3JZ1B 4Y10E 1DFPA 1IQLA 1MKWK 3WW7A 2F9PA 3IITA 1GL0E 1W7XH 5A8ZA 2BOHB 1P9SA 4I7YH 1AVXA 2AMPA 1GBBA 3MHWU 1RJXB 5EGMA 4DIHH 3S9CA 1F5RA 3P8GA 5ESBA 4B75A 2TPIZ 1RTLA 2BX3A 4NFEA 4H6TA 1C5LH 1O3AA 2Z7FE 3A82A 5JB8S 1T8MA 1TE0A 4H42U 1LQEA 1TLDA 1A7SA 4X2YA 1ELDE 4K1TA 3SJ8A 5KECA 3O8RA 2V7QD 5CHAC 1FY4A 1BTYA 4UD9H 5ABWA 2Y5GA 4AG2A 1YM0A 3MMGA 3U1IB 2JJ1D 1S82A 2XRCA 9ESTA 1BA8B 4MVNA 3SNCA 1KTTB 1KXAA 3PV5A 4ABFA 1IHTH 1WXRA 2GVFA 1A2CH 1X7AC 1TALA 3RXFA 4D7FA 2AS9A 3UUZA 3VB6A 5DPAA 1AE5A 1MCTA 1SL3A 1L1JA 1PPHE 3HGNA 3PLKA 3FP6E 4O03A 3HATH 2ULLA 2ANWA 3UR9A 4AFZA 5HM2A 6GCHF 1GI6A 4RT1A 2VIPA 1TMTH 5AVDA 4ABDA 3TJUA 1O2RA 3ENSB 5T6GA 1K1LA 1GVKB 1NM6A 3PTBA 3W95A 2QIQA 1VCPA 3GOVB 3LGVA 4YT7H 3SNDA 1DWBH 4ABIA 1C5XB 1AMHA 4KELA 4XE4A 2ZEBA 2FMJA 4RN6A 1E1QD 1FNIA 1W14U 1TA2A 2STAE 1GJ4H 1EASA 1IQGA 5JB9S 2V3HH 1OWDA 3SU3A 1CQQA 1A1RA 1SQAA 4TPIZ 2FI5E 4MTBA 3RXVA 5GCHG 1GI1A 4ISNA 3MI4A 3HK3B 1LPZB 2ZECA 3BTEE 3SGQE 2ZG0H 3DUXH 4KP0A 1GMHG 5FX6A 1AZZA 1W0KD 2AMQA 2ZDAH 1DPOA 4FUHA 4M7GA 1C1MA 1QNJA 4NIYA 1IQIA 1Y59T 1BCUH 1CSOE 1EPTA 4KKDA 2V0BA 4Z1MD 2O9QA 3R0FA 3MH4A 1O2XA 1XMNB 4ZHAA 3LC5A 5GXPA 3M7QA 4FVDA 2ILNA 1E37B 5F03A 5FXLA 1K1MA 1AWFH 1MMJN 3EAJA 4THNH 5AHGH 1EFRD 2AERH 3SOSA 1N6YA 2RG3A 2ZFFH 4WF8A 4XOJA 1P2JA 2A4OA 1BT7A 2JH5D 2HLDD 1H9HE 2J9NA 4DJZB 4FUFA 3OSYA 3Q00A 3RXQA 4X6MA 1O3KA 1RFNA 2BD2A 1CHGA 1GHYH 2TBSA 1C5TA 1YPMH 3TK9A 4INHA 1YPHC 2G5NA 1QJ1B 4HZHA 1TNIA 4FUDA 1D3PB 1WCZA 3UTUH 1KDQA 4BAOB 4BAMB 3GCHB 1UK3A 4ABHA 1G2LA 2AIPA 3UB0A 2BHGA 4YOIA 3E8LA 7GCHF 2CN0H 2BDCA 1LCYA 3SZEA 2YNBA 1TNJA 1ELCA 2BX4A 3D62A 5DSFA 1UVUH 1SFQB 1HAVB 3QLPH 5C67A 3URCA 5SGAE 4FOUC 4MG3A 3MO3A 1GHWH 1OWJA 1SQRA 4GHQA 1AD8H 4UEHH 3S0NA 1DLKB 1EZQA 3ZZ8A 1K21H 3WWFA 2CF9H 1H9IE 2AMDA 1UK4A 1EZXC 1QRZA 3ZIAD 1ELFA 1XM1A 2W26A 2Z9LA 5HMAA 1GMDF 2KAIA 2JKHA 1SLUB 1DM4B 1F0RA 2LELA 1FIZA 4K8YA 2ZC9H 1AU8A 2F4LA 4MNYA 1LHCH 5FAHA 1C2IA 3KQEA 1S6HA 4YESB 2IJD1 4HG6A 4DIIH 1QJ6B 4BTUB 2B8OH 5T1VA 4MDSA 4GPGA 3V3MA 1C2GA 1D9IA 1BTUA 1KLIH 2OBQA 2ZI2H 3RM0H 4E05H 1SI5H 1TGBA 1NFYA 3SQHE 5JBBS 5JDUB 2ODYB 1BTWA 3NZIA 1NRQH 2A2XH 1JMOH 2H5CA 4A1XA 1E1RD 3RXOA 1ZR0A 3RU4D 3P8OA 2GMTB 1BBRH 2A7HA 5E2OA 5T6DA 1Y5UT 4TWWA 2JH0D 1KXCA 5A0AE 1NBME 4SGAE 1TNGA 2WYJA 1D3DB 4ESTE 3MQKC 3SUGA 1ZMJA 4ABAA 2YOLA 3BTGE 2QGRA 2ZP0H 1J14A 3GCHC 4GLYA 3ATIA 4CRDA 1IQKA 1GI7B 1WBGB 5EQRA 1ANCA 4UONA 1ABIH 5AF9H 4FUBA 3ATMA 3QX5H 3M3TA 3P92A 4YLQH 1WU1A 2EI6A 1GWAA 1TGSZ 3ELAH 1UTOA 1TOCB 1S6LA 1O30A 1UTLM 1DS2E 2PV9B 2ZTXA 1YBWA 3RC4A 3U9AH 1P10A 2FTLE 3B8JA 4UE7H 1C2EA 3C27B 2RA0A 5E0HA 1IQNA 3SNEA 5BPEA 1QL9A 4NCYA 2EEKA 5JPMH 4OS7A 1Z7KA 2ZU3A 2QF5A 1K1IA 3PM3A 3F6UH 1BHXF 2VIWA 1W2KH 1GI9B 4X2WA 2YMSB 4U32A 3UIRA 3SJKA 1O34A 2ZGBH 1K22H 4JYVH 1AIXH 2A5IA 3PRBA 1C1TA 2J2UA 1THPB 3C1KA 5GWZA 1QTFA 1MZDA 4OS5A 2WUBA 3PMHB 1H1BA 2PR3A 3OY5U 5LPFA 1GHXH 3AAUA 1SGIB 1ZGIA 1H8ED 1SGNE 3W94A 1P05A 4Y7BA 1VCWA 3NWUA 1P02A 3LPRA 4B1TA 3HKJB 2FLBH 3DSGA 3SUDA 2CHAB 5IDKA 1OHHD 2GMTC 1HJAB 3GCNA 4B6EA 1VGCB 1O33A 1QBNA 3M5NA 3RXHA 1GMCG 3KYFA 2BD3A 1TA6A 1YCPM 3U8RH 2QV1A 4BNRA 4ISOA 3QZQA 4CRCA 5LPEA 1PPGE 1ZZZA 1BMFD 1SGEE 3ODFA 4ABBA 2C90B 1PPEE 2PGBB 3IG6B 2F9VA 3LGTA 4ISIH 4UFFH 1QBVH 2OTVA 3GCTF 4ISHH 4X8TH 1OYTH 1VJAU 2NU1E 1GHAG 3UREA 4FU8A 1YLDA 4MNWA 4JK5A 3DT0H 4NIWA 4I8JA 2OINA 4BAQB 1SFIA 2BD8A 2J34A 1JOUB 1TRNA 2CJIA 4IMQA 2CK3D 5C1UA 3FP8E 1RRKA 3F0OA 2Y5FA 1CT2E 4NG9H 1E34B 2ZHDA 2Q1JA 3CS7A 5DGJA 5DKMA 3F3BA 3UR6A 1T32A 2F9NA 1EPTB 4TPYA 1C1PA 2BDGA 1NS3A 2R9PA 1O3CA 2AGIX 3KIDU 2P94A 1IHSH 1XXDA 4BTTB 4J2YB 5ETXA 1TGCA 4FVBA 3RMLH 1J15A 4DOQA 1TGTA 1ZHRA 1F7ZA 2XC5A 1GG6B 3SV6A 3SV9A 1TRMA 1TMUH 3CP7A 1TX8A 4K69A 1HLTH 1XVMA 2ZFRH 1ABJH 3ZZAA 3MNXA 3E3TA 4YT6H 1OYQA 4AYYB 1MU8B 4R0IA 3NXPA 1UVOA 4OGXA 2IOTA 1SSXA 5HIZA 1EATA 1C1UH 1DXPA 2CHAC 5T3HA 3SU4A 3SJ9A 1HJAC 4ZXYH 5GJ4B 5EODA 5HYOA 2V3MA 2EC9H 1V2ST 1TGNA 4FUEA 4UFDH 1BQYA 1T7CA 2VVVA 3A7WA 1CT4E 3RXTA 2J94A 5K0HA 3RXUA 1UVSH 1KDQB 3ZVDA 1KTSB 1C5UA 5IK2D 4OS2A 1GJ7B 3LGYA 3TJOA 2JJ2D 1S6FA 1GI2A 2FM2A 1FONA 3V0XA 1Q3XA 1KMHB 1LHEH 1QRWA 3A83A 1C5PA 1FMGA 2BQ7B 2C8WB 4NA7A 1GBKA 1K28D 2FOAA 2HNTF 1DVAH 2P59A 4NGAH 2P95A 5T6FA 9LPRA 2FXRA 1O39A 4Q7YA 1HPGA 1BRAA 1D6RA 1L1GA 1P01A 4AOQA 2GDEH 3MU4A 1A5HA 4OS1A 4Y11E 3ZVFA 1DSTA 3PLBA 1S0QA 1V2WT 1O3NA 2OLGA 2BDHA 1LPGB 2KCAA 1B0FA 1J8AA 1GPZA 2FDAA 1NZQH 2LNCA 1T31A 4O3TA 3S9BA 3LONA 1QB6A 2CXVA 3F0PA 3N99A 1YLCA 3M37A 4X1NU 3KQCA 2FEQH 1YCPH 1GJBB 1HJ9A 1JRSA 1TNKA 2WPKS 3MOCA 3OEED 1DY9A 1QL7A 5JBTA 4JMYA 2QF4A 3TGIE 3QO6A 4Y76A 4GHTA 2CF8H 1EX3A 2K8IA 4ACAA 1TWXB 1SGRE 4F55A 4WH6A 4BANB 4DY7B 1L4ZA 1PPCE 1W13U 3VG8A 1J16A 5JBCS 1BMAA 3ATKA 1L2EA 3EGKH 1HAVA 1SMFE 1P9UA 4CHAB 2GP9B 1ZTLA 3I29A 1QY6A 2HALA 5A09A 2ZHEH 1LVBA 1MAXA 3BV9B 1HAYB 2KFWA 3P17H 3Q3YA 1GI4A 4B71A 2WSSD 2BY5X 1MD8A 3N7DA 4LZ4B 3OE7D 3RMOH 3VB7A 1GHBF 3UY9A 1SPJA 3SU1A 2OC8A 1EB1H 1QA7A 1EKBB 3V12A 1TX6A 1XVOA 3U8TH 3VPKA 2VH0A 1G32B 2ZU4A
chains in the Genus database with same CATH topology
4A1TA 7KMEH 1RS0A 1BMNH 2GT8A 5EPNA 2ZNKH 3AAVA 3BTHE 4B2BA 1P11E 1PYTD 2FP7B 3SNBA 1GBDA 2ZDNA 3GICB 4D8NA 2UWLA 4BOHA 2PTCE 3SU5A 1MTUA 2R3UA 3RXKA 1YPLH 6CHAC 5HXFA 1ID5H 4WMDA 2BY9X 1FY8E 1P04A 1A0LA 1ZOMA 5CE1A 2QF3A 8LPRA 2I6QA 3GY6A 3OX7U 1KYNA 2ZF0H 2A45B 3ZYEA 5JBAS 2IJOB 4LOYH 1UO6A 1Y3WA 2ZA5A 1GDUA 4JZDH 1C5MD 2GKVE 2PTNA 3BSQA 3I78A 1D6WA 2ZHFH 1DY8A 2XYAA 2OD3B 4O3UA 5LGOA 3SV8A 1B7XB 1S0RA 4JYTA 1BJVA 1EZSC 4SGBE 5AFYH 3MO6A 1GBHA 1KY9A 5AFZH 1O3HA 3ZYDA 1YPGH 2ZPRA 2CGAA 1INCA 1S5SA 3DFJA 1DANH 1OP0A 3MTYA 2BLOA 2B0FA 4CHAC 1G3DA 1BBRK 1EJNA 1JXPA 2BLQA 2HOBA 3ZZ4A 3A80A 1QCPA 3LIWA 2PSXA 1EAXA 4AZ2B 2PGQB 3WY8A 2XXLA 1KLJH 5EG4A 1GJ8B 1SGDE 1ZSKA 1BITA 3SBKA 4Y7AA 1C2JA 3E16B 1IQEA 1NTPA 1A3BH 4IMZA 5J4SA 1TPOA 1BDAA 3M61U 1CVWH 1GJ5H 1JBUH 2ZGJA 3TJNA 3E91A 4LXBH 2XW9A 3M7TA 1PPFE 1XUFA 2WPHS 1G37A 1SGYE 3GY4A 1ESBA 4B76A 1EB2A 1ESAA 3S9AA 1O2VA 1AVGH 1NFXA 1HAZB 4K60A 5FCKA 4NIVA 2G51A 3H7TA 2H2ZA 4JZFH 3OY6U 1PFXC 1DUEA 1JWTA 4D7GA 2VWMA 4CR5A 2FI4E 3GDVA 5DG6A 1Z8JB 1BIOA 2WPLS 2HLCA 1JRTA 3M3SA 3M35A 4MPUA 2A7JA 4D76A 5A0CA 1TBRH 6GCHG 1Y3XA 4GCHF 5FPSA 2G4UA 4BXSA 2FPZA 2VINA 1P2QA 1ZHPA 2Q6FA 4I31A 1XUGA 4FU7A 2F3CE 2C3SA 8ESTE 1AN1E 5FBIA 3K6ZA 4Q2KA 1UCYE 3GDSA 2NU4E 1DDJA 2A4QA 4WMEA 1OWKA 3ZZDA 2FOMB 1THSH 2BDIA 1TQ7B 3IWMA 2O8WA 1O2PA 3KQDA 1O2LA 3LJOA 4H6SB 4ZUHA 6ESTA 2Z3DA 1HBTH 1GVZA 1KXBA 2QYIA 2JETB 1P3CA 1Y5BT 1AO5A 4H4FA 1GI8B 2D2DA 4INKA 4A1VA 2CV3A 1ETTH 4LK4A 3A86A 2C4FH 1GBAA 2J4IA 5B6OA 1PQAA 3M36A 1FV9A 3HGPA 2WUCA 4AFQA 1VITF 1CA0C 2A1DB 1O2HA 4NSYA 4B74A 1CHOF 1TYNA 2ALPA 3VFEA 1GCTB 1E38B 4NWLA 5BRRE 2GZ8A 3AW0A 3SO3A 4YO9A 3RP2A 1VZQH 1P2KA 3PO1B 4U01A 1OXGA 1ZLRA 3RC6A 1EAWA 1CT0E 4QT8C 1VJ9U 1OWIA 1K1NA 3SU0A 3DHKH 1ZMNA 2FOEA 3F9EA 1IQJA 2HPQH 2D26C 1MKXH 3MU1A 1MTVA 2GCHF 3Q3XA 4IW4E 3U8OH 5JYIA 1WTHD 4ZH8A 1HV7A 2BXUH 4DCDA 5E0JA 1J9CH 3B23B 1ZYOA 5TCCA 3MU5A 2GCTC 1LHDH 2QCYA 4CRBA 1QL8A 1C2LA 3T27A 4AORA 3PYHA 1Q2WA 1UHBA 2GGVB 3UFAA 1QFKH 3TGKE 3SUFA 1OPHB 3ATLA 1GBTA 3BEFB 1O36A 4I8KA 1Z1IA 3SV7A 3EA8A 1QURH 3DD2H 1P03A 4ZKRU 2ALVA 2P16A 2LPRA 2Q6DA 1CGHA 2B7DH 2VJ1A 4ABEA 1C2MA 1GJAB 1Z6JH 3PROA 4UFEH 4Y0YE 3SU2A 3TNTA 4Y6DA 2FOCA 3S7HB 1W10U 3M3VA 1O2TA 7GCHG 1LVMA 4XBDA 3UQOA 3AVZA 2V35A 1YPHE 4BTIB 2JETC 1FAXA 4NFFA 1A3EH 4WVPE 3SJOA 3ZZ5A 4WH8A 1XUKA 1Z8GA 2H9TH 3FZDA 3FZZA 3H5CB 3ZVEA 2J92A 2BLVA 5DP9A 5EW1H 5F8XA 2XBVA 1WQVH 1TNLA 3VEQB 4YZUA 2C8YB 1ZTKA 2AH4X 2P3TB 1GGDB 4HTCH 1XUIA 1JIMA 1GDNA 3GDUA 1GCTC 3T25A 1LKBA 1GMDG 2PKAB 5EOKA 1LQDB 2HPPH 1O3JA 3RXSA 2GZ7A 1QGFA 3PO1C 1V2NT 2J38A 3PLPA 4NA8A 3BTFE 5DJ7A 1IQFA 8GCHF 1A61H 1SQTA 3A7VA 1P06A 2ZDKA 1TNHA 4DURA 1M9UA 3RM2H 1SR5C 1Z71A 3GY3A 1SLXB 3A8BA 4NZLA 3ZVAA 2FOBA 3A84A 1GL1A 4XDEA 1PJPA 1AVWA 3N7OA 4JZIA 3SU6A 2NU2E 1HAGE 5TJXA 1PQ7A 1AZ8A 4D9RA 2O8UA 1EUFA 1ETSH 2GZ9A 1YCPK 3D23A 3U69H 2ZWLH 1RTFB 1F0SA 3KN2A 1IAUA 1J17T 2WPJS 1C5RA 4FUJA 1ANEA 1C5NH 3GY2A 2UWOA 2Y82A 1HAOH 3PB1E 1C5VA 2Z94A 4IC5A 4DW2U 5DP3A 3M5MA 3QZRA 1SVPA 1O5CB 3RLWH 2NWNA 4CRGA 1NC6A 1V6DA 1XUHA 4NWKA 3I77A 1HFDA 3RMNH 3F9FA 2FTMA 1UCYH 2FIRH 1DE7H 2FI3E 5C3NA 2D1JA 1VITH 4X2XA 3RU4T 1AGJA 1LVYA 3TVJB 1NRNH 3ODDA 1T8NA 1SGTA 1O3GA 3VGCC 2VGCB 3A8DA 1SB1H 1WTGH 3TITA 1YC0A 1GGDC 2A4RA 4B2CA 1BRCE 1O3OA 2V3OH 3P95A 2Y81A 1O5AB 3FFGA 3FANA 3KGPA 2SGEE 1G3BA 4A7IB 1H9LB 5GIBA 5FX5A 1LO6A 4I32A 2Z3CA 1O3BA 4GAWA 2ZTYA 1SLWB 2Z9IA 3A81A 4B73A 1TABE 2R0KA 3BTQE 3VB3A 5E0GA 1W7GH 2H9HA 1OP2A 2G55A 1BRBE 2WV4A 1V3XA 5HGGA 4X2VA 2ODQA 3QUMP 3RXRA 5A8YA 3RXCA 2ZFTA 4JZEH 1CBWB 2W3IA 4ZHMU 1L0ZA 2BM2A 4YLUA 4U30A 1P3EA 1LHGH 4J1YA 1Q31A 2ZDMA 1ARBA 1HXFH 2ZDLA 3LC3A 3ZVGA 4DG4A 3EA7A 1Y5AT 4YM9A 2OQ5A 2ASUB 4NIXA 1V2LT 1SOZA 3GY7A 2WYGA 1TAWA 1FLEE 1P57B 1SLVB 3GCTG 3RMMH 4K1SA 1FQ3A 2G5VA 2ZCHP 4O97A 1GBFA 1IOEA 2R3YA 1TRYA 4WMFA 1AFQB 1C9PA 2W3KA 2QAAA 3GYMA 1SG8B 1O2MA 1DT2A 4MPWA 4RKOB 4WXVA 3CENA 1V2PT 2XTTB 4K8BA 4KTUA 1QRXA 1O2YA 3QTOH 1S83A 1TBQH 1C5QA 1P2NA 2VGCC 5EXNA 3V7TA 2QXGA 1UTMA 1C1WH 1BTHH 2H1UA 2HNTC 3LJJA 3M5OA 4HGCA 5EXMA 1YGCH 2Z9JA 1HNEE 4Q80A 5C5OA 3LT3A 3Q77A 1BMLA 1O2OA 1OP8A 1O2NA 2ZHWH 3RXJA 1LVOA 1D4PB 1A4WH 1D3QB 4Y8XA 4E7RG 2H6MA 1K1JA 1ZSJA 4XBBA 2TRMA 5LH8A 4ZMAH 1EZUC 2BD9A 2QF0A 4O9VA 4X1QU 1TMBH 3UWIA 1FJSA 1OWEA 1L1NA 4AG1A 2ZFSA 3VXFH 7LPRA 1HAPH 4PROA 2RDLA 1F5LA 3SN8A 3LU9B 5DP6A 4CRAA 4AGJA 1BUIA 2VU8E 1UHBB 1CA8B 1CBWC 1P2MA 4Y0ZE 3KEEA 1XXFA 2PSYA 3HPTB 3NPSA 4AFUA 5A8XA 1ZHMA 1DWCH 2O8MA 3KCGH 1P2IA 2VIVA 3A8CA 3RXLA 2GDDA 1N8OB 5E2PA 1ELBA 2SGQE 1HJ8A 4JZ1A 2PWXA 3QWCH 4RKJB 1K1OA 2TGTA 3BIVH 2HGTH 3RXAA 2BZAA 1VR1H 1GBCA 1L4DA 1V2RT 1KLTA 4INLA 1W8BH 1DWDH 3QGJA 4GVUA 4KGAA 1HXEH 6CHAB 1KXEA 3K65B 2WINI 4MPXA 1ZMLA 1AFQC 2HWLB 4NSVA 1W0YH 2BQ6B 2TIOA 2BVRH 1XKBC 2BQWB 2FS9A 2HRVA 2O8LA 5CMXH 2VIQA 4ZKOU 3TU7H 2GD4B 2BDYA 1YPEH 1YKTA 2OXSA 2W7UA 1ARCA 1BJUA 1F5KU 3NKKA 4I8GA 4WY3A 2ZDVH 1AB9B 1ACBE 3LH1A 1NO9H 1NRRH 1G9IE 2FWWA 2QA9E 1UK2A 3ZZ7A 3LOXA 3LGIA 4I8HA 1MCVA 3G01A 3DFLA 1C5ZB 1TPSA 4GUXA 1V2QT 2ZZUH 1FN8A 1SGFG 3SI4H 3A7TA 2A5AA 1Z1JA 2SGFE 2UUFB 3AASA 1FPHH 1MKXK 4MPVA 3A8AA 1W11U 3A87A 4IC6A 1GJCB 3VXEH 3TIUA 1FDPA 5IYTA 3UNQA 5GPIB 1GBEA 1SOTA 1ZRBA 4CH2B 1F0UA 1PYTC 2ANKH 1UJ1A 4CBNA 1RXPA 1ANDA 1Y8TA 3SORA 1GI0A 5L2YH 1QQ4A 1GHBG 2PKAA 1N8OC 1C2KA 1C2DA 4AB8A 2AIQA 2VNTA 5C1XA 5L2ZH 1ZSLA 2GX4A 3FP7E 1HYLA 2ZGCA 1P12E 4X8UH 3BTME 1NESE 1A0JA 1C4Y2 1GJ6A 4Q7XA 1FZZA 1YPJH 1O3PB 4K1EA 1RD3B 1WYKA 1C5YB 1MQ5A 4JYUH 4Z0KA 1UTPA 1O2WA 2QY0B 1GVLA 2G81E 4MQAA 2UUKB 1RTKA 1HIAA 2B5TB 4IGDA 4U2WA 2QN5T 1H8IH 3M7UA 1UVPA 2UUYA 4HI3A 2ESTE 1VCQA 2G4TA 1T4VH 2XWBI 3BTWE 2OC1A 2XWAA 1AUJA 2FOGA 3K2UA 5H4IB 1PPBH 1DICA 3AW1A 1AB9C 1ZJKA 1Y3VA 1HRTH 2DE8A 3OYPA 3PMAB 2FYRA 3E0NB 3R3GB 1V2MT 2PHBA 2FYQA 1T8LA 2WV5A 1YYY1 2GT7A 1O2IA 2BDBA 4IS5A 3T26A 1Y3UA 2J95A 1SHHB 1O3MA 1FAKH 3NUMA 1S84A 3UNSA 3A85A 2Z9GA 5FHTA 3DA9B 3P70B 1FN6A 1OSSA 1UTNA 2PLXA 2NU3E 1CA0B 3P8FA 2STBE 1ELAA 5L30H 3LH3A 1H4WA 1OOKB 1P8VC 1GDQA 1O3EA 1AWHB 2PW8H 2P3UB 4NZQA 2XCFA 4Y79A 5F6MA 3TH2H 3TH4H 1CE5A 1FY5A 3BF6H 3T29A 3O8CA 1QIXB 3SHAH 3ZZCA 4X1PU 2A32A 1WV7H 2W5EA 1C5SA 1TBZH 1BBRE 1SQOA 2P93A 3NK8A 1HAIH 1O2JA 3MNCA 1WSSH 1WOFA 2DE9A 2A2QH 5ESTE 1GBLA 5A0BA 4TYDA 2GCTB 1NT1A 1HUTH 3F9GA 1SGQE 1UCYK 2G00A 1FXYA 4E06H 1SC8U 4TY6A 1CGJE 1AY6H 2FO9A 3EQ0H 1MUEB 2AGGX 4XFQA 1DXWA 2ZQ1A 1O3DA 4WJG2 4JK6A 1KXDA 2ZO3H 4YTAA 1THRH 1O31A 4XBCA 1RGQA 3BN9A 4GCHG 1BTPA 1G3EA 1YF4A 2NU0E 3EYDA 3BG4B 4IN2A 1SGFA 1ZJDA 2Z6BD 1XKAC 5DP7A 1AE8H 4ASHA 1Z8IB 2ZU1A 1NFUA 2PUQH 2XCNA 1CO7E 4LZ1H 1KXFA 1UTQA 5GCHF 1SGPE 1DWEH 1C9TA 3UOPA 3V13A 2K1QA 1GMHF 3SNAA 1UTJA 2A31A 1LKAA 1YP9A 1QB9A 1C1NA 2BTCE 2ZPSA 4Y8YA 3SQEE 2QXJA 3KL6A 3SI3H 1EAUA 4CBOA 2VIOA 3RUOA 1EAIA 1C2FA 1SGCA 1V2UT 4FU9A 3TJVA 3URDA 7ESTE 3Q76A 2ZPQA 4AFSA 4XSKU 4ZKSU 1V2VT 4AYVB 1QJ7B 1KSNA 1VITG 3RXIA 1B5GH 2FZZA 3O8BA 4ZKNU 1CHOG 2SGAA 1AFEH 1G30B 3M5LA 2PFEA 5G4BA 3P8NA 4K3JA 3QGNB 1AI8H 4OS6A 1DITH 1GBMA 2SNWA 3BTDE 1NFWA 1O5EH 2FLRH 3QN7A 2OQUA 3RXPA 1BHXB 1EQ9A 5K7RA 1OKXA 3SJIA 5EXLA 1A5GH 3MH5A 3SHCH 2EI7A 2P3FH 2C8XB 2F91A 1C4V2 4AX9H 4Z6AH 2QXIA 4X1RU 2OUAA 3A89A 1QHRB 3MU8A 4ZXXH 4NA9H 2GCHG 1MTWA 2ZFQH 2AFQB 1QB1A 3MU0A 1K1PA 3PV4A 2RA3A 2GV6A 4ZAEA 1ELTA 1ORFA 1P2OA 1CGIE 3F68H 2F83A 1ELGA 4ABGA 1PQ5A 2F9UA 3QDZB 1EOLA 2FESH 1N1LA 1O2UA 3BG4C 3T62A 1C5OH 5EQSA 3TH3H 2HVXA 2SGDE 2R0LA 1RIWB 5C20A 2OC7A 4I33A 4TY7A 1BMMH 1LPKB 2IPHA 2BY8X 3BIUH 1A5IA 3S7KB 2VVUA 4UFGH 3H7OA 2Y5HA 2EA3A 4KTCA 3UWJH 1EJMA 2A5KA 4Y8ZA 3L6PA 2FS8A 4FUGA 4CRFA 2PKSB 2ZFPH 3CS0A 1GCDA 1TIOA 4Y71A 3VGCB 1NU9A 3LGWA 1KIGH 4AGKA 4MLFB 1G3CA 2IN2A 3F1SB 2Y7XA 1XUJA 2ZGHA 1S85A 3E0PB 4YOJA 1HGTH 8KME2 2BD7A 1A46H 1BTXA 3O8DA 1HCGA 3BEUA 2Y7ZA 1ESTA 5F8ZA 1BOQA 1MKWH 2TGAA 4BAHB 1ZPCA 3GISB 3SGAE 4K5ZA