1GJCB

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 51
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjcB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjcB01
2WINI 3GCOA 1UCYH 3K6YA 3STIA 1S81A 3RMLH 1Z6EA 3CS0A 5DP5A 2FPZA 2R3UA 1QBVH 1MTWA 1IQIA 1AE5A 2GMTB 1BZXE 3NPSA 4ZXYH 3T2NA 1HUTH 1P8VC 4JMYA 1FMGA 3F9FA 3KEEA 1PYTC 4Q80A 5E8EH 2EEKA 2Y5FA 1OX1A 1A4WH 1G30B 1P01A 3Q00A 3A84A 1LQEA 1O5GH 1AWFH 1D4PB 5CHAB 4ZUHA 4DW2U 1EXFA 1F0SA 3TVJB 2H5CA 3BTEE 4WJG2 2A5AA 1G36A 2ASUB 2ZGHA 2WPIS 4FUJA 3ZVGA 1GDUA 3MH7A 4AGKA 2QXIA 1GBBA 1GBAA 2ODPA 3K2UA 2Q6FA 3MMGA 2AYWA 1GHWH 1TGCA 4FUIA 1BBRE 1K22H 2LPRA 3RC4A 3GCTG 1J16A 4JYTA 3MO6A 1HAVA 4JZEH 3B9FH 3F1SB 3UNQA 1GHAF 3EE0B 2PLXA 2BLWA 2ZFFH 4D8NA 2Y7ZA 2FYQA 4GCHF 1H1BA 4BNRA 1Y3XA 1UVSH 3RXSA 1Y59T 6GCHG 2GT8A 1T8LA 1EP5A 1P10A 1T7CA 3M35A 2FEQH 2QXJA 3RXEA 3BTQE 1O3KA 1D3QB 3ZVFA 1XUHA 3FZDA 1GG6C 1GL1A 3KQCA 2F91A 1SOTA 4UFFH 4ZHLU 2EI6A 2GZ7A 3PB1E 4AOQA 1P2NA 5JYIA 4GVUA 1HJ9A 2ZDVH 3N7OA 3D49H 4XSKU 1ABIH 2TPIZ 2CN0H 1ZHRA 1GCDA 1C1TA 1DT2A 2ZO3H 1T4UH 1GJ8B 2BD5A 2ZPQA 1O3FA 1JWTA 1K2I1 1PQ5A 1OPHB 2O8LA 5FBEA 1Y3VA 3QTOH 2ZU4A 1GHBF 5GPIB 4YESB 1A7SA 4NWLA 2BY8X 4Y10E 3SZNA 2PSXA 3MO3A 1C5YB 1FN6A 1L2EA 1RRKA 2AS9A 1O3IA 1TRMA 2P3TB 1SGIB 2ZU5A 4B2CA 3S7HB 1PQ7A 4O03A 1GBLA 1SHYA 1LHGH 4Z6AH 5A0BA 1EUFA 1SC8U 4I32A 5JBBS 8GCHG 1AIXH 4OS2A 3MNXA 2PTNA 1KLJH 1YF4A 4TPIZ 1N6YA 3RXRA 3A7WA 5IYTA 3QK1A 5DP4A 3SGQE 1EB2A 5H4IB 4TWYA 1UMAH 3RU4D 1IQHA 4DIIH 1A5IA 2AIPA 2OQUA 3ZZ7A 3IITA 1OKXA 5GCHG 3SHAH 3TH3H 2A32A 1Q31A 3I77A 1UK2A 2BZAA 3LJOA 4AFUA 1HIAA 2VINA 2BLOA 3SU2A 3TJUA 1XVMA 2YOLA 1SLXB 4I31A 3TGKE 5C20A 1FDPA 4DJZB 1P2IA 4KTUA 1BTZA 4OS4A 3S69A 4GHTA 1BBRK 1HJAC 4FXGH 1BRCE 3LH1A 1IAUA 2G4UA 1V3XA 2FX4A 2XBVA 1P2OA 4OS7A 3ATKA 4IN1A 1ZLRA 3MNCA 1D3TB 3FAOA 3EGKH 1T32A 4ZKSU 1NFYA 1QRWA 3H7TA 3LOXA 2ZHWH 4MDSA 3F9GA 1HFDA 5A8XA 1NFWA 4X2YA 3RXQA 5EGMA 4X6OA 2XBWA 7GCHF 2O8TA 2FI3E 2P3FH 4GLYA 1QNJA 1JMOH 3VB7A 1PPEE 1PPZA 1AFQC 1FXYA 2NU0E 3S7KB 5JBAS 4KGAA 2Z94A 1ZGVA 1FN8A 2V6NA 3SU0A 3PLKA 1NESE 4KTSA 2VIDA 1O32A 5T6DA 2QAAA 3VFEA 5TCAA 3DHKH 4RKJB 2ODYB 1LKAA 1SR5C 4KP0A 1ELBA 1WBGB 3TNSA 1NFXA 5FAHA 1B0EA 4UFEH 5GJ4B 1W12U 1HCGA 1P3CA 4ZKRU 4ZKNU 1QQ4A 1C5XB 4X8TH 1TYNA 3LGUA 1LHEH 1NU7B 1O3NA 2FWWA 1KLTA 1Q2WA 1TABE 1W7XH 4YZUA 1ELFA 8KME2 1QJ6B 3G01A 4BAMB 1C2GA 3QGNB 2VVUA 1QQUA 3BIVH 1NFUA 1PFXC 4X1PU 4AZ2B 9LPRA 1KXFA 3PMBB 1C1OA 4U30A 1SQOA 2PKAB 2NU3E 4XBBA 1OS8A 1ZRKA 1ANEA 1AZ8A 2R2WU 4D7GA 1FPHH 3FP8E 4MPUA 3BG8A 1H8DH 1EZQA 1SGCA 2EA3A 3PROA 3FFGA 1C5LH 3QZQA 5EXMA 2ZFTA 3MU1A 1TOCB 2C4FH 3NXPA 4JZIA 1P03A 1SLUB 2BVXH 3P70B 6CHAC 4CBOA 2OC0A 2F9UA 2G81E 2ZIQH 4IMQA 2UUKB 2GKVE 1GMDG 1A61H 1GHXH 3S0NA 1A1RA 1ESBA 3RXTA 2BM2A 1KXCA 3P8FA 2P3UB 2P16A 3BTKE 4KKDA 3LH3A 1O2OA 3R0FA 1O3GA 2JETC 2FOHA 3E6PH 2Y82A 4INHA 3ZV9A 1KXAA 2BVRH 4CRBA 1O3MA 2A1DB 3LC5A 1A0HB 5GWZA 1MMJN 1D3DB 1O2SA 1MKXH 1D6RA 3HK6B 2QGRA 1QRZA 2ILNA 4UE7H 4O9VA 2GZ8A 4UDWH 4K60A 4ABAA 5A8ZA 1ARBA 1EJMA 2QY0B 1ESAA 1NTPA 1TX8A 1ZSJA 3PLBA 3BEFB 4FUEA 1QCPA 1TWXB 1W0ZU 3PMAB 5EPNA 1P3EA 4MLFB 3SNAA 3MH6A 4OS6A 1YYY1 5DO4H 1TGSZ 3L3TA 5PTPA 2GCTC 1O2WA 1AFQB 3VPKA 2ESTE 3ITIA 2J9NA 4X1NU 1QR3E 4YLUA 1C2JA 1CHOG 2OD3B 2D2DA 1A3EH 3OY6U 1V2QT 2Z3EA 3LONA 1AWHB 4X6PA 2PV9B 4Y0YE 1QB1A 1THSH 2STAE 2FP7B 1Z6JH 1DWDH 2YNBA 4MNWA 2ALVA 1YPHE 4MPXA 3E0NB 1MBMA 4ABJA 2SGQE 2SGEE 1O2LA 3ZZ6A 1UTMA 4X2VA 1NRRH 1UTJA 1Y5AT 4FU9A 1IQMA 4LOYH 1TLDA 3KGPA 4B2AA 1O31A 3VB5A 4WMEA 1CA8B 1CQQA 1SGTA 2PSYA 3A82A 2JH6D 1FJSA 1GHVH 1O5EH 1K21H 2AMPA 3KIDU 1AN1E 1M9UA 4CREA 2CF9H 3ZZ5A 4TWWA 1RJXB 1N1LA 3AVZA 1BMMH 1DFPA 2J38A 5GIBA 3E91A 3ZYDA 3ODDA 4AG1A 1C2IA 2ZDMA 4UEHH 1F5KU 3KQDA 1XMNB 3VGCC 1G9IE 1JBUH 2J95A 2A4QA 2H6MA 6CHAB 1JIMA 2XYAA 1P06A 3A8AA 1C5QA 1C1MA 4XBDA 3Q3YA 2UUJB 3SQEE 5EPYA 2PFEA 2Z9JA 1SB1H 2F83A 3URDA 4DVAU 1VCPA 3GYMA 1FLEE 2GV7A 1TIOA 4NSYA 2AH4X 5A8YA 1C9TA 1ANDA 1ELEE 1J15A 1IHTH 5J4QA 3SO3A 3E3TA 4IW4E 3RP2A 3SUEA 3URCA 4BTUB 2JETB 1K28D 1WCZA 1H9IE 3PYHA 3KCGH 4BTIB 1FY8E 1DOJA 2XCFA 3C27B 2FZZA 5JDUB 2VWLA 2UWLA 1K1JA 1TMBH 1DPOA 2QXGA 2PUXB 3M36A 1GBTA 2A7JA 1O2YA 4Y11E 1C1SA 1RXPA 2VIVA 2XWAA 1TE0A 2B7DH 3V12A 2ZTXA 1GJBB 1W2KH 1P57B 2GCTB 5CMXH 1TALA 1UCYK 1FAXA 5DGJA 2HVXA 2VB0A 2BDYA 2A5KA 2BDBA 1ZTJA 3Q3XA 2TGDA 2V3HH 2BDGA 3SI3H 1VGCB 3UWIA 5HM2A 4YT6H 2HNTF 1UTPA 4KTCA 5L6NH 2GV6A 1HBTH 1CA0C 1KDQA 2J34A 3K65B 4UD9H 3U1JB 1C2MA 3HKIB 1GBMA 1O2JA 1G3EA 2BQ7B 2GDEH 6GCHF 1O2UA 3VB3A 4Z0KA 1C1PA 1C5SA 1BRBE 1O34A 2PUQH 4GUXA 3UTUH 1MTVA 2HALA 3FVFB 1YBWA 1GVLA 3P95A 1L1NA 2ZU1A 2OUAA 2A4GA 4CR5A 1TPPA 1MTNC 2KAIA 5B6OA 1DXWA 2FS8A 5AFYH 1VITH 1C1WH 1SG8B 1S6FA 5I25A 1VITG 1UVOA 1QBOA 2VJ1A 1SGNE 5F03A 1O2GH 2BQWB 5AF9H 3T27A 3MFJA 1V2RT 3VGCB 3LKWA 2XCNA 4A92A 1SQAA 4OS5A 2FDAA 1FIZA 2ZGCA 2IPHA 2CHAC 5ESTE 3SQHE 1GI9B 1V2JT 4ZMAH 2XC5A 2ZCLP 5C2ZA 3BEIB 1JRTA 1BIOA 1FV9A 2PTCE 3A88A 1BB0B 2J4IA 2BMGB 3RXDA 1QIXB 3BG4C 1XKAC 8GCHF 1OYTH 2QN5T 1WSSH 5EG4A 3LGTA 4AN7A 3D62A 1GBHA 1YPHC 5LPFA 1C2FA 1UK4A 2WPJS 4Y6DA 3EAJA 1EB1H 2QIQA 1ZSLA 1QBNA 5GCHF 4NIVA 1BTWA 3RXIA 1HXEH 3T26A 1BT7A 3RMNH 1DLEA 1UHBB 2VGCC 3KL6A 1OWJA 3GISB 2D26C 2GCHG 4SGBE 3LJJA 2PKSC 1UJ1A 5EQSA 1ELTA 1P9UA 1NN6A 2XXLA 2ZNKH 3QO6A 2F9OA 4CHAC 1N8OB 2V3OH 2XC4A 1NT1A 1CU1A 4D9QA 2AGIX 1GJ4H 3A83A 2ZECA 2WPHS 4YOGA 1RTFB 2ZDKA 4IGDA 1CA0B 2P93A 2H2ZA 5C67A 5HMAA 1C5TA 1O5BB 3M5MA 5ABWA 3QGJA 4ZHAA 3STJA 4ZH8A 2SGPE 2ZF0H 3ESTA 1KLIH 5FCKA 1XM1A 3A85A 4J2YB 2STBE 3UOPA 1QHRB 2VWNA 1H8IH 1TGNA 4HTCH 1WUNH 3M7TA 4WVPE 1DWBH 1MTNB 2SNWA 3ZZ4A 4X8SH 2O8WA 1D6WA 1ZRBA 1HAPH 1T31A 1Z7KA 1EZSC 3H7OA 4X1RU 3BTTE 3NCLA 1GI4A 3ZZ8A 3FANA 3ENSB 1Y3UA 2H1UA 1BTPA 3E1XB 3PWCA 4Q7ZA 5J4SA 4X6NA 2B9LA 3RC5A 3A87A 1GBEA 1T8MA 3SV9A 4JZFH 3TH4H 2C8WB 1C5OH 1TGBA 5A0AE 3RXMA 4I8LA 4H6SB 1ZPBA 2BXUH 4A7IB 1MKWK 1PJPA 2CHAB 4DCDA 1O37A 1C5UA 2FTMA 1DSUA 1P02A 2FIRH 2VIQA 3M3VA 1BOQA 4X8UH 3I29A 4X0WU 1C5WB 4FUBA 1UO6A 4YM9A 3SOSA 4Y7AA 5AFZH 1V2UT 3DA9B 3UNSA 3SJ9A 3L33A 2WPLS 1SFQB 3M5LA 3MTYA 3ZVCA 1O39A 2VIWA 1YCPH 1AHTH 1JRSA 4LZ4B 8ESTE 1E35B 3A81A 3CS7A 4X2XA 5FCRA 5C5NA 2FLRH 1S6HA 3AW1A 1OP0A 1UK3A 1E0FD 1VR1H 3KHVA 1QURH 4RKOB 1P2MA 4NA8A 3BTDE 2FLBH 2O8UA 4I8JA 2ZU3A 4DT7B 2GX4A 1MZDA 1GMDF 2VGCB 3NKKA 5HGGA 1K1OA 2SGAA 3BN9A 3RLWH 5ETXA 1WTHD 1W3CA 1WQVH 4MPVA 2QF3A 1O2XA 3ZZ3A 1C5PA 1HPGA 3MU0A 4K5ZA 4ABFA 1TONA 4CHAB 1CGHA 1ACBE 1HAVB 4CH8B 1AD8H 1F7ZA 5A09A 3NK8A 1TNGA 4DGJA 5FBIA 1ORFA 1SGEE 5GDSH 3RXPA 5FPSA 1TAWA 1S0QA 2D8WA 1ANBA 1EX3A 1ZHPA 3D65E 1ZHMA 1GPZA 1GJDB 4TY7A 4FU7A 1G3CA 2BY9X 2ZG0H 2C90B 4AX9H 1T4VH 1C2EA 2ZEBA 2A2XH 2LNCA 1O36A 1NY22 2FTLE 1SGDE 1HAXB 4B75A 1OWIA 1WYKA 5FX6A 1BMAA 1S5SA 2BX3A 1BMLA 1AMHA 1TRNA 4ZHMU 1O38A 2BHGA 2Y6TA 1H4WA 3KQEA 1BTUA 4ESTE 1SGYE 2Z9KA 3VEQB 3QN7A 1ELCA 3TNTA 2F3CE 1SGRE 2HWLB 1W10U 1B7XB 1BITA 2SGFE 3GYLB 3RXUA 1NRSH 1TQ7B 1UTOA 4JZDH 1O2VA 2ZI2H 4H4FA 4K1EA 3B23B 4OGXA 2PKAA 1HAYB 4ABHA 4LXBH 4U2WA 1GVZA 1P9SA 3GDUA 7LPRA 2EI7A 2OC7A 1XKBC 4BTTB 4A1VA 2BVSH 2BD2A 4B74A 3U98H 1RTKA 2JH0D 1GG6B 2HPPH 3TJVA 5LPEA 4QT8C 5GXPA 3FZZA 1G3DA 4OS1A 3Q3KA 2I6SA 1TNLA 3E16B 1CE5A 1GBKA 1BJVA 3E90B 2AERH 2V0BA 1HXFH 3MOCA 5SGAE 1GJAB 4K2YA 1UVUH 2ZWLH 1KIGH 2ZDLA 1PPGE 4PROA 1P2QA 3S9BA 1L4DA 5DJ7A 1GDQA 1C1NA 1HIAB 3UY9A 2CF8H 3TH2H 5C1YA 1LVOA 4YLQH 3D23A 2GT7A 1O5FH 4I33A 4CH2B 1TPAE 4JYUH 4K8YA 3RXVA 2A7HA 2XC0A 1C2HA 1IHSH 1FY4A 3RM0H 2I6QA 3LGWA 4UFDH 2NWNA 1K1PA 4B73A 3SNCA 4O3UA 4X2WA 2A45B 3SBKA 4GAWA 1P09A 2FESH 1DY8A 1AI8H 4CRAA 3IG6B 3PTBA 4ISOA 5FX5A 1J17T 2H9HA 1C1VH 3QUMP 2QV1A 1TBRH 2AFQB 3GCHC 1GBCA 1GGDC 1P2KA 3EDXB 1O3HA 1PPHE 1YPJH 2ZHDA 4UFGH 2C8ZB 1GL0E 3IWMA 3SGBE 5JPMH 1S82A 2EI8A 3ATLA 2TIOA 1HAOH 4IMZA 3RXHA 4FUFA 3TGIE 1GHBG 3RXBA 1FY1A 2GGVB 1CGJE 2ZC9H 5DKMA 2BTCE 1P11E 1HJAB 1QJ7B 2G55A 1GJ6A 1VJ9U 1W0YH 3LU9B 5T3HA 3MO9A 4DY7B 1WTGH 1V2MT 1CBWC 2VNTA 1HNEE 2WUBA 1BBRH 3LGYA 7ESTE 3RLYH 1O5CB 2RCEA 1ESTA 2AMDA 2OTVA 1TNIA 1AUTC 1LO6A 1O2NA 1TBZH 4IC6A 3U1IB 1W14U 4HFPB 3OYPA 1TA2A 2UWPA 2FI5E 1EZXC 2ZQ1A 3QWCH 4AG2A 1XUFA 1UCYE 1Z8IB 2ZGBH 2ZPRA 3Q76A 1AKSA 2CMYA 4AORA 4NCYA 5DPAA 1SGFG 1ZTKA 1TRYA 2VIOA 3MI4A 1MAYA 3GDSA 5FPYA 3QZRA 1NRQH 1IQKA 2A5IA 2P8OC 5LPRA 5DP9A 1Y3YA 1ARCA 1SFIA 3VB4A 1MU8B 3ATWA 2OBOA 1THPB 3AAVA 1A3BH 3LT3A 1O2IA 1VITF 1AQ7A 1BA8B 1BJUA 1AVXA 3QTVH 5HM9A 5EU8A 1HAGE 4XDEA 4VGCC 1EPTA 1AGJA 1QTFA 1O3JA 3DUXH 2XTTB 1GBJA 1SGPE 3MNSA 3SV7A 1K9OE 1V2ST 1FIWA 1KXBA 3ATMA 3TITA 3RU4T 2BLVA 1ANCA 1INCA 1C2DA 1SGQE 4X8VH 3SUDA 3VXFH 1H9HE 4GHQA 1BDAA 4LK4A 1G3BA 1OYQA 1O5AB 2GVFA 2BB4A 1GMHG 3VXEH 1A5HA 1MCVA 1JOUB 1FNIA 1O0DH 1ZMJA 1LKBA 4FVDA 5A0CA 4RSPA 1C4U2 3DFJA 2BX4A 2WV5A 3RMMH 2ZU2A 1HRTH 2GZ9A 1GMCG 1V6DA 2A2QH 2Z9LA 1F0TA 3GCHB 2QYIA 1GGDB 2AEIH 5E2OA 3A8CA 2ZQ2A 3UQOA 2OCVB 4ISNA 4AFSA 4X1SU 1N6XA 1V2VT 1MD8A 5TJXA 2DUCA 3GY4A 4R8TB 1V2TT 4ISIH 4DG4A 2HLCA 1CVWH 1UVPA 1OWHA 2SGDE 6ESTA 2ZHQH 2HPQH 1RGQA 2CXVA 2PWXA 1YP9A 2Y5HA 5ESBA 1KXEA 1LCYA 1S0RA 1NS3A 1SHHB 4DIHH 2OQ5A 5IDKA 1DS2E 3SNEA 2UWOA 2AGGX 5DP7A 1CBWB 4NSVA 3U8OH 5A2MH 1HYLA 3UR9A 1L1GA 1KYNA 3UNRA 4XE4A 3JZ2B 3ZV8A 1CO7E 1GJ9B 3O8RA 2C8XB 4SGAE 1WOFA 2ZGXH 1OWEA 4NWKA 4YOJA 1ZJKA 3HPTB 2ZZUH 1Y5BT 2Y7XA 1AE8H 3GY8A 1LTOA 3BV9B 1ZTLA 2C3SA 3LDXH 2QF0A 1TFXA 1PPCE 2BDHA 3GCTF 4GSOA 2P95A 4E7RG 1UTLM 4ZXXH 2JH5D 1S84A 3F9EA 1EATA 3F6UH 1SSXA 5HYOA 4B71A 4F4OC 5AVDA 1EZUC 2O8MA 2P8OB 1FQ3A 2BXTH 2K1QA 3T5FH 1EJNA 2G52A 5BPEA 1CT0E 4ASHA 1G2MA 1TOMH 1Y8TA 3HK3B 2FMJA 4BAKB 5FHTA 4MQAA 3SN8A 3ZZDA 2SFAA 1PQAA 2G4TA 3K6ZA 1V2PT 2Y5GA 2SNVA 1KTSB 5F6MA 4VGCB 5EW1H 1WV7H 1SQTA 2ZA5A 4WH6A 4U01A 2VWOA 3MU8A 2P59A 4Y0ZE 1O3OA 2P94A 4WF8A 2ZGJA 3F9HA 1UTNA 1ELVA 1DM4B 1GCTC 4AGJA 2HRVA 4MTBA 3JZ1B 3UR6A 3GY6A 3DD2H 1CHGA 1EAIA 1ZZZA 2BD9A 1FY3A 1F0RA 3CENA 2J92A 1TBQH 2BQ6B 1B0FA 2FOGA 4BOHA 4Y71A 3U9AH 2QCYA 4I8HA 1SPJA 2G8TA 3QDZB 1C9PA 3RXFA 2GDDA 3U8TH 1WAYB 2OC8A 1KXDA 3LC3A 4TPYA 3SI4H 3VB6A 1ZMNA 1C5VA 1Z8JB 2ZDAH 3MU5A 3BTHE 4ISLA 3TK6A 4NIWA 5G4BA 4NA7A 4HZHA 3H5CB 3SNBA 4A6LA 1XUIA 2BDAA 5L2YH 1DANH 1Y5UT 4AB9A 2H9EH 1EASA 2R0KA 5K7RA 1YCPK 1YLDA 3ELAH 2YNAA 4INKA 3Q77A 3RXGA 3UREA 1IQGA 4WXIA 1P0SH 3A7VA 2A0QB 1O35A 2RA3A 1NRPH 1FONA 5DP3A 1DUEA 2BOKA 5JBTA 1PQ8A 3SGAE 1THRH 2V35A 3SUGA 2ZKSA 3EA9A 2HGTH 3RU4E 1ZSKA 3PWBA 4JK6A 2BD8A 1ELAA 2BDCA 3SHCH 1QRXA 2FOFA 4NZLA 3TJNA 1LQDB 4ZAEA 3RDZA 5LGOA 3V0XA 1WU1A 2C93B 1O3AA 3E8LA 1VCQA 2ZFQH 3SORA 1HAIH 2OLGA 4NFEA 4Q2KA 2ZFSA 5EOKA 1SMFE 1B5GH 1YPGH 1L1JA 1IQJA 1H9LB 1J8AA 2ANMH 1OP8A 1A2CH 1YC0A 3GY3A 2Z7FE 2NU1E 2WUCA 1LPZB 2R9PA 4D9RA 1HJ8A 3M37A 3UPEA 1J14A 2NU2E 1OP2A 5LH8A 2CJIA 4R0IA 5EODA 4CRFA 5CE1A 4BAOB 4ISHH 1O3PB 2ULLA 4TYDA 1GCTB 1BRAA 2VIPA 2Z6BD 4B76A 1SLWB 3EA8A 1SVPA 1QL7A 2A4RA 1Y3WA 1IQEA 2FO9A 4K3JA 1O2ZA 3DFLA 4CBNA 4HI3A 1CT4E 2XRCA 1TQ0B 2W3IA 5E0JA 3TGJE 1C5NH 4AB8A 1MCTA 2BLQA 1P12E 3SJKA 3RXKA 3ZZ9A 4IC5A 3TU7H 1C4Y2 2WPMS 2HOBA 1JIRA 1F92A 3LGIA 3EA7A 1T8OA 3A7YA 3GY7A 1ABJH 1OXGA 9ESTA 4FU8A 3T28A 1A46H 1O3BA 3HATH 3OY5U 3K9XB 1HDTH 2TGAA 4I8KA 1LVBA 3MHWU 1UVTH 1MD7A 3P8GA 4NG9H 2H9TH 3BG4B 1O2QA 1MH0A 2VH0A 3MYWA 4B2BA 1DY9A 4JYVH 1E37B 2IN2A 2OC1A 3OU0A 1QL9A 1MQ5A 1LMWB 4JZ1A 3OX7U 1Z1IA 3S9CA 2A7CA 1W13U 1FAKH 2FI4E 1IQNA 4K1SA 2BYAX 1VZQH 1GI8B 4FUHA 1TPSA 3KNXA 3TPIZ 1TMTH 3GDVA 1W7GH 4MNYA 4AFQA 5EW2H 1HAHH 2DE8A 2PKSB 4X1QU 3ZZCA 4D76A 4MPWA 5L30H 1C1RA 3HGPA 1GJ5H 2VVVA 2ZP0H 3ZZBA 1AUJA 3BEUA 3MWIU 3EYDA 4YT7H 1BRUP 4WH8A 4WXVA 1YPLH 2RG3A 4CRCA 2RDLA 3OSYA 4O3TA 1FZZA 4YO9A 3ZYEA 4GPGA 1ETSH 4BXSA 4UONA 2FX6A 1HGTH 1TPOA 3S9AA 4E05H 5JBCS 2EC9H 3ZVAA 3A86A 1RIWC 1K1IA 1TNHA 3EQ0H 4WMFA 2W26A 1FY5A 1TX6A 4OGYA 3ZVDA 1GHYH 1RD3B 2BD3A 3M7QA 5BRRE 2D1JA 1DWCH 1V2WT 2H5DA 2TGTA 3PO1C 4K8BA 5DP8A 2BY5X 4E7NA 2PGQB 1CHOF 2R0LA 1HLTH 3W95A 4A1XA 1ZPCA 3OTJE 5JB9S 2BOHB 1GI1A 1DDJA 1EAWA 5FPTA 2VWMA 3P8OA 3BSQA 1XUJA 1BHXB 1AY6H 3GICB 2Q6DA 3PV4A 2R3YA 1EP6A 2UUYA 1LVMA 3RUOA 2OP9A 5DP6A 1BCUH 3BIUH 1MKXK 1RFNA 1V2NT 1P05A 3TK9A 1NZQH 3U69H 1YPEH 2RA0A 1G2LA 4MNVA 4WWYA 1QB9A 1ZYOA 2TBSA 1AZZA 1PPBH 3RM2H 1O3EA 2B0FA 1XXDA 2G5NA 1O2KA 3PM3A 2FYRA 1W8BH 4ABBA 4Y79A 1AU8A 1C5ZB 1YGCH 1MKWH 2A31A 2A4OA 4MG3A 3BTWE 3P6ZB 1A5GH 2Z3CA 2ANKH 1EJAA 1XUGA 2WYGA 1ZPZA 1O3DA 1OOKB 1LVYA 3QX5H 3SJIA 4AYVB 1O2RA 1GMHF 1O2TA 1IQLA 4AYYB 2BDIA 1O5DH 1NROH 1GHAG 2ALPA 4INLA 4JCNA 3HGNA 3SU5A 4H42U 3PMHB 1GI2A 4D7FA 1O3CA 1F2SE 4GCHG 2UUFB 3M61U 1GMCF 1MQ6A 1DVAH 3P17H 4Y7BA 3SV2H 1BTHH 1TX7A 2IJOB 1OSSA 1FUJA 1FPCH 2OINA 3UWJH 4BANB 2F9BH 3V13A 3UOUA 1GBIA 3L6PA 4FUDA 2XBYA 5DK1A 1JXPA 1VCWA 2WV4A 2ANYA 2PW8H 3UFAA 3RMOH 2PR3A 1S83A 3SV6A 3UIRA 2ODQA 1OWDA 3ODFA 2BY6X 1NM6A 3WY8A 1V2KT 1ELDE 1LPGB 4THNH 1MTUA 3MH4A 1Z8GA 1J9CH 4DURA 1NPMA 1QB6A 2ZDNA 4NA9H 1RIWB 5I46H 1GI6A 1O3LA 2W5EA 1Q3XA 1BUIA 3MU4A 2XW9A 4ABGA 1CSOE 2QA9E 4H6TA 1ZOMA 1LHDH 1HV7A 4Y8XA 1CGIE 1G32B 4HGCA 3PO1B 3GCNA 1BTYA 1XX9A 1A0JA 1YPMH 1ZGIA 1DLKB 3O8CA 1LPKB 4BAQB 1OWKA 1F5LA 5EXLA 1AVGH 2AIQA 5C1UA 1A0LA 4O97A 4ZKOU 2GP9B 2AGEX 4NGAH 1SGFA 4FUGA 1MUEB 4K69A 4AFZA 3I78A 4FVBA 5HXFA 2FOMB 1BQYA 2TGPZ 3TJOA 1AB9C 2W3KA 1L4ZA 5K0HA 2BY7X 1EPTC 3AAUA 4FUCA 5TCCA 4YTAA 2B5TB 2CV3A 3TK5A 1XXFA 4A5TS 3E0PB 1NO9H 1GI7B 3NWUA 1GI5A 1SLVB 1XUKA 1PPFE 2G00A 3FP6E 3P8NA 1BTXA 1L0ZA 1S85A 1DWEH 1QA7A 1P2JA 2IOTA 3NZIA 3RXAA 4YOIA 4RN6A 3UQVA 1UTKA 2Y80A 3LPRA 1DE7H 3GOVB 1VGCC 3A80A 3PLPA 1F5RA 1BMNH 1QY6A 3KQBA 1T8NA 2B8OH 1K1LA 3AW0A 2THFB 2F9VA 2G51A 2FS9A 1ETTH 3RXOA 2HNTE 3T62A 3M3TA 7GCHG 1MBQA 1GBFA 3GY5A 2WPKS 2ZPSA 4Q7YA 1SOZA 5JB8S 2ZFPH 1GJCB 4WY3A 1NC6A 3C1KA 2PGBB 7KMEH 1C1QA 1Z71A 3RXLA 1YCPM 2J2UA 1TB6H 4TY6A 1LHCH 1C1UH 1C2LA 3W94A 2CGAA 3P92A 1O2MA 1DUAA 1DX5M 1YLCA 4I8GA 2BD4A 4Y8YA 1D9IA 1SBWA 1O2PA 3M5OA 2FOBA 1ZMLA 1GBDA 2VU8E 4BAHB 2ZTYA 3R3GB 2W7SA 3BTFE 1C5MD 4B1TA 1V2LT 2Z9IA 4NZQA 1K1MA 1AKSB 2NU4E 4ABIA 2FOCA 2GCHF 2XBXA 5T6GA 4F49A 2F9NA 1GI3A 1Z8RA 4XFQA 3ZVBA 3MH5A 4M7GA 4MVNA 2G5VA 1SI5H 1YPKH 4J1YA 5EQRA 3BF6H 3SU3A 1CT2E 3SJOA 1ID5H 1D3PB 4CRDA 1EQ9A 1TNJA 2JKHA 3A7XA 3FP7E 3TLOA 2C8YB 2BD7A 1AFEH 3RXCA 4NIXA 1ZR0A 1C4V2 1E34B 3A7TA 1LHFH 3ZVEA 1IQFA 4IS5A 5E0HA 3KN2A 2XWBI 3O8BA 4U32A 2WYJA 3QLPH 5DG6A 3HKJB 1YM0A 2F9PA 1AB9B 5EQQA 5F8TA 1EPTB 1EAUA 4Y76A 2DE9A 1QFKH 2GD4B 1G37A 3A8BA 1QL8A 3SV8A 4LZ1H 3UUZA 2ZCHP 2FOAA 3KF2A 1SL3A 1U6QA 1HAZB 2Y81A 2FXRA 3A8DA 1WQSA 2R2MB 1TNKA 4WMDA 1HB0B 3AASA 1K1NA 2XNIA 3M7UA 1QA0A 2OBQA 4I7YH 2Q6GA 2GMTC 1QJ1B 3PMJA 1C2KA 2ZTZA 3M3SA 1EOJA 1N8OC 4NIYA 1AO5A 1NRNH 1GWAA 2Q1JA 5EXNA 3M5NA 4K1TA 1TGTA 1Z1JA 4ZROA 5CHAC 4Y8ZA 1O30A 2VVCA 3SUFA 3T29A 5L2ZH 4A1TA 1RS0A 2AMQA 5C5OA 3GY2A 4Q7XA 3DT0H 1ZJDA 2W7UA 3MNBA 2Z9GA 5T6FA 4XOJA 3SW2B 3PTNA 4CR9A 4E06H 1E38B 1XVOA 3BTGE 1UHBA 1QGFA 1C5RA 1GDNA 1P04A 3LIWA 1W11U 1TA6A 6LPRA 1O2HA 3RXJA 1TMUH 3F68H 2VH6A 3T25A 4IN2A 3CP7A 5C3NA 3TIUA 2ZHFH 3LGVA 1EKBB 5E0GA 1DICA 2FODA 2GTBA 1EOLA 2M5TA 1ETRH 1F0UA 1NU9A 1LDTT 1E36B 2ZCKP 4ABEA 2QC2A 1DXPA 1GHZA 5F8ZA 4X6MA 3O8DA 1YKTA 2O9QA 2ZHEH 2QXHA 3NUMA 3SU6A 2ANWA 5AHGH 4ABDA 2PHBA 3SJ8A 1DITH 1GVKB 3A7ZA 2Z3DA 1BHXF 1MZAA 5C1XA 2BZ6H 3SU4A 2J94A 3BTME 3RC6A 3U8RH 1PYTD 3V3MA 8LPRA 4BXWA 1KDQB 4XBCA 3SU1A 1MAXA 4CRGA 1MTSA 1DSTA 1IOEA 3ZZAA 1X7AC 2FM2A 1AVWA 2OXSA 2HNTC 3SNDA 1ELGA 2TRMA 4KELA 4MNXA 3V7TA 4IBLH 1O33A 1KSNA 1EAXA 1VJAU 4DOQA 3A89A 3ATIA 1KY9A 5E2PA 1GJ7B 1KTTB 1FI8A 1GI0A 1MU6B 1V2OT 2KAIB 4NFFA 5FXLA 4JK5A 2ZFRH 3B8JA 1UTQA 1RTLA 2FOEA 5F8XA
chains in the Genus database with same CATH superfamily
2WINI 3GCOA 1UCYH 3K6YA 3STIA 1S81A 3F3BA 3RMLH 1Z6EA 3CS0A 5DP5A 2FPZA 2R3UA 1QBVH 5HIZA 1MTWA 1IQIA 1AE5A 2GMTB 1BZXE 3NPSA 4ZXYH 3T2NA 2K8IA 1HUTH 1P8VC 4JMYA 1FMGA 2KZ4A 3F9FA 3KEEA 1PYTC 4Q80A 5E8EH 2EEKA 2Y5FA 1OX1A 1A4WH 1G30B 1P01A 3Q00A 1NBMD 3A84A 1LQEA 1O5GH 1AWFH 1D4PB 5CHAB 4ZUHA 4DW2U 1EXFA 1F0SA 3TVJB 2H5CA 3BTEE 4WJG2 2A5AA 1G36A 2ASUB 2ZGHA 2WPIS 4FUJA 3ZVGA 1GDUA 3MH7A 4AGKA 2QXIA 1GBBA 1GBAA 2ODPA 3K2UA 2Q6FA 3MMGA 2AYWA 1GHWH 1TGCA 4FUIA 1BBRE 1K22H 2LPRA 3RC4A 3GCTG 1J16A 4JYTA 3MO6A 2KCAA 1HAVA 4JZEH 3B9FH 3F1SB 2V3MA 3UNQA 1GHAF 3EE0B 2PLXA 2BLWA 2ZFFH 4D8NA 2Y7ZA 2FYQA 4GCHF 1H1BA 4BNRA 1Y3XA 1UVSH 3RXSA 1Y59T 6GCHG 2GT8A 1T8LA 1EP5A 2OK5A 1P10A 1T7CA 3M35A 2FEQH 2QXJA 1H8ED 3RXEA 3BTQE 1O3KA 1D3QB 3ZVFA 1XUHA 3FZDA 1GG6C 1GL1A 3KQCA 2F91A 1SOTA 4UFFH 4ZHLU 2EI6A 2GZ7A 3PB1E 4AOQA 1P2NA 5JYIA 4GVUA 1HJ9A 2ZDVH 3N7OA 3D49H 4XSKU 1ABIH 2TPIZ 2CN0H 1ZHRA 1GCDA 1C1TA 1DT2A 2ZO3H 1T4UH 1GJ8B 2BD5A 2ZPQA 1O3FA 1JWTA 1K2I1 1PQ5A 1OPHB 2O8LA 5FBEA 1Y3VA 3QTOH 2ZU4A 1GHBF 5GPIB 4YESB 3WWBA 1A7SA 4NWLA 2BY8X 4Y10E 3SZNA 3OTPA 2PSXA 3MO3A 1C5YB 1FN6A 1L2EA 1RRKA 2AS9A 1O3IA 1TRMA 2P3TB 1SGIB 2ZU5A 4B2CA 3S7HB 1PQ7A 4O03A 1GBLA 1SHYA 1LHGH 4Z6AH 5A0BA 4RI0A 1EUFA 1SC8U 4I32A 5JBBS 2KCYA 1AIXH 4OS2A 8GCHG 3MNXA 2PTNA 1KLJH 1YF4A 4TPIZ 1WXRA 1N6YA 3RXRA 3A7WA 5IYTA 3QK1A 5DP4A 3SGQE 1EB2A 5H4IB 4TWYA 1UMAH 3RU4D 1IQHA 4DIIH 1A5IA 2AIPA 2OQUA 3ZZ7A 3IITA 1OKXA 5GCHG 3SHAH 3TH3H 2A32A 1Q31A 3I77A 1UK2A 2BZAA 3LJOA 4AFUA 1HIAA 2VINA 2BLOA 3SU2A 3TJUA 1XVMA 2YOLA 1SLXB 4I31A 1S6LA 2K0QA 3TGKE 5C20A 1FDPA 4DJZB 1P2IA 4KTUA 1BTZA 3F0OA 1YLNA 4OS4A 3S69A 4GHTA 1BBRK 4Z1MD 1HJAC 4FXGH 1BRCE 3LH1A 1IAUA 2G4UA 1V3XA 2FX4A 2XBVA 1P2OA 4OS7A 3ATKA 4IN1A 1ZLRA 3MNCA 1D3TB 3FAOA 3EGKH 1T32A 4ZKSU 1NFYA 1QRWA 3H7TA 3LOXA 2ZHWH 4MDSA 3F9GA 4F55A 1HFDA 5A8XA 1NFWA 4X2YA 3RXQA 5EGMA 4X6OA 2XBWA 7GCHF 2O8TA 2FI3E 2P3FH 4GLYA 1QNJA 1JMOH 3VB7A 2F43B 1PPEE 1PPZA 1AFQC 1FXYA 2NU0E 3S7KB 5JBAS 4KGAA 2Z94A 1ZGVA 1FN8A 2V6NA 3SU0A 3PLKA 1NESE 3CNRA 4KTSA 2VIDA 1O32A 5T6DA 3EE7A 2QAAA 3VFEA 5TCAA 3DHKH 4RKJB 2ODYB 3OEHD 1LKAA 1SR5C 4KP0A 1ELBA 5HKKD 1WBGB 3TNSA 1NFXA 5FAHA 1B0EA 4UFEH 5GJ4B 1W12U 1HCGA 1P3CA 4ZKRU 4ZKNU 1QQ4A 1C5XB 4X8TH 1TYNA 3LGUA 1LHEH 1NU7B 1O3NA 2FWWA 1KLTA 1Q2WA 1TABE 1W7XH 4YZUA 1ELFA 4ZCNA 8KME2 1QJ6B 3G01A 4BAMB 1C2GA 3QGNB 2VVUA 1QQUA 3BIVH 1NFUA 1PFXC 4X1PU 4AZ2B 9LPRA 1KXFA 3PMBB 1C1OA 4U30A 1SQOA 2PKAB 2NU3E 4XBBA 1OS8A 1ZRKA 1ANEA 1AZ8A 2R2WU 4D7GA 1FPHH 3FP8E 4MPUA 3BG8A 1H8DH 1EZQA 1SGCA 2EA3A 3PROA 3FFGA 1C5LH 3QZQA 3OAAD 2KCOA 5EXMA 2ZFTA 3MU1A 1TOCB 2C4FH 3NXPA 4JZIA 1P03A 1SLUB 2BVXH 3P70B 6CHAC 4CBOA 2OC0A 2F9UA 2G81E 2ZIQH 4IMQA 2UUKB 4XD7D 2GKVE 1QZ8A 1GMDG 1A61H 1GHXH 3S0NA 4TT3D 1A1RA 1ESBA 3RXTA 2BM2A 1KXCA 3P8FA 2P3UB 2P16A 3BTKE 4KKDA 3LH3A 1O2OA 3R0FA 1O3GA 2JETC 2FOHA 3E6PH 2Y82A 2YMSD 4INHA 3ZV9A 1KXAA 2BVRH 4CRBA 1O3MA 2A1DB 3LC5A 1A0HB 5GWZA 1MMJN 1D3DB 1O2SA 3AK5A 2W6ID 1MKXH 1D6RA 2V7QD 2J98B 2QGRA 3HK6B 1QRZA 2ILNA 4UE7H 2J5UA 2GZ8A 4O9VA 4K60A 4UDWH 4ABAA 5A8ZA 1MABB 1ARBA 1EJMA 2QY0B 1ESAA 1NTPA 1TX8A 1ZSJA 3OFND 3PLBA 2HLDD 3BEFB 4FUEA 1QCPA 1TWXB 1W0ZU 3PMAB 5EPNA 1P3EA 4MLFB 3SNAA 3MH6A 4OS6A 1YYY1 5DO4H 1TGSZ 3L3TA 5PTPA 2GCTC 1O2WA 1AFQB 3VPKA 2ESTE 3ITIA 2J9NA 4X1NU 1QR3E 4YLUA 1C2JA 1CHOG 2OD3B 2D2DA 1A3EH 3OY6U 3WWFA 1V2QT 2Z3EA 3LONA 1AWHB 4X6PA 2PV9B 4Y0YE 1QB1A 1THSH 2STAE 2FP7B 1Z6JH 1DWDH 2YNBA 1BMFD 4MNWA 2ALVA 1YPHE 4FETA 4MPXA 3E0NB 1MBMA 4ABJA 2SGQE 2SGEE 1O2LA 3ZZ6A 1UTMA 4X2VA 1NRRH 1UTJA 1Y5AT 4FU9A 1IQMA 4LOYH 1TLDA 3KGPA 4B2AA 1O31A 3VB5A 4WMEA 3OE7D 1CA8B 1CQQA 1SGTA 2PSYA 3A82A 2JH6D 1FJSA 1GHVH 1O5EH 1K21H 2AMPA 3KIDU 1AN1E 2IJD1 1M9UA 4CREA 2CF9H 3ZZ5A 4TWWA 1RJXB 1N1LA 3AVZA 1BMMH 1DFPA 2J38A 5GIBA 3E91A 3ZYDA 3ODDA 4AG1A 1C2IA 2ZDMA 4UEHH 1F5KU 3KQDA 3F2HA 1XMNB 3VGCC 1G9IE 1JBUH 2J95A 2A4QA 2H6MA 1UW7A 6CHAB 1JIMA 2XYAA 1P06A 3A8AA 5FL7D 1C5QA 1C1MA 4XBDA 3Q3YA 2UUJB 3SQEE 5EPYA 2PFEA 2Z9JA 1SB1H 2F83A 3URDA 4DVAU 1VCPA 3GYMA 1FLEE 2GV7A 1TIOA 4NSYA 2AH4X 5A8YA 1C9TA 1ANDA 1ELEE 1J15A 5DSFA 3SZEA 1IHTH 5J4QA 3SO3A 3E3TA 4IW4E 3RP2A 3SUEA 3URCA 4BTUB 2JETB 1K28D 1WCZA 1H9IE 3PYHA 3KCGH 4BTIB 1FY8E 1DOJA 2XCFA 3C27B 2FZZA 5JDUB 2VWLA 2UWLA 1K1JA 1TMBH 1DPOA 2QXGA 2PUXB 3M36A 1GBTA 2A7JA 3PV2A 1O2YA 4YXWD 3PRDA 4Y11E 1C1SA 1RXPA 2VIVA 2XWAA 1TE0A 2B7DH 3V12A 2ZTXA 1GJBB 1W2KH 1P57B 2GCTB 5CMXH 1TALA 1UCYK 1FAXA 5DGJA 2HVXA 2VB0A 2BDYA 2A5KA 2BDBA 1ZTJA 3FN8A 3Q3XA 2TGDA 2V3HH 2BDGA 3SI3H 1VGCB 3UWIA 5HM2A 4YT6H 2HNTF 1UTPA 4KTCA 5L6NH 2GV6A 1HBTH 1CA0C 1KDQA 2J34A 3K65B 4UD9H 3U1JB 1C2MA 3HKIB 1GBMA 1O2JA 1G3EA 2BQ7B 2GDEH 6GCHF 1O2UA 3VB3A 4Z0KA 1C1PA 1C5SA 2KR7A 1BRBE 1O34A 2PUQH 4GUXA 3UTUH 1MTVA 2HALA 3FVFB 1YBWA 1GVLA 3P95A 1L1NA 2ZU1A 2OUAA 3OEED 2A4GA 4CR5A 1TPPA 1MTNC 2KAIA 5B6OA 1DXWA 2FS8A 5AFYH 1VITH 1C1WH 1SG8B 1S6FA 1WDIA 5I25A 1K0HA 1VITG 1UVOA 1QBOA 2VJ1A 1SGNE 5F03A 1O2GH 2BQWB 5AF9H 3T27A 3MFJA 1V2RT 3VGCB 2J97A 3LKWA 2XCNA 4A92A 1SQAA 4OS5A 2FDAA 1FIZA 2ZGCA 2IPHA 2CHAC 5ESTE 3SQHE 1GI9B 1V2JT 4ZMAH 2XC5A 2ZCLP 5C2ZA 3BEIB 1E79D 1JRTA 1BIOA 1FV9A 2PTCE 3A88A 1BB0B 2AHME 2J4IA 2BMGB 3RXDA 1QIXB 3BG4C 1XKAC 2W6JD 8GCHF 1OYTH 2QN5T 2JJ2D 1WSSH 5EG4A 3LGTA 4AN7A 3D62A 1GBHA 5C0UA 1YPHC 5LPFA 1C2FA 1UK4A 2WPJS 4Y6DA 3EAJA 1EB1H 2QIQA 1ZSLA 1QBNA 5GCHF 4NIVA 1BTWA 3RXIA 1HXEH 4Q63A 3T26A 1BT7A 3RMNH 1DLEA 1UHBB 3VG8A 2VGCC 3KL6A 1OWJA 3GISB 2D26C 2GCHG 4SGBE 3LJJA 2PKSC 1UJ1A 5EQSA 1ELTA 1P9UA 1NN6A 2XXLA 4P00A 2ZNKH 3QO6A 2F9OA 4CHAC 1N8OB 2V3OH 2XC4A 1NT1A 1CU1A 4D9QA 2AGIX 1GJ4H 3A83A 2ZECA 2WPHS 4YOGA 1RTFB 2ZDKA 4IGDA 1CA0B 2P93A 2H2ZA 5C67A 5HMAA 1C5TA 1O5BB 3M5MA 5ABWA 3QGJA 4ZHAA 3STJA 4ZH8A 2SGPE 2ZF0H 2WHXA 2CK3D 3ESTA 1KLIH 5FCKA 1XM1A 3A85A 4J2YB 2STBE 1OHHD 3UOPA 1QHRB 2VWNA 1H8IH 1TGNA 4HTCH 1WUNH 5KGOA 3M7TA 4WVPE 1DWBH 1MTNB 2SNWA 3ZZ4A 4X8SH 2O8WA 1D6WA 1ZRBA 1E1QD 1HAPH 1T31A 1Z7KA 1EZSC 3H7OA 4X1RU 3BTTE 3NCLA 1GI4A 3ZZ8A 3FANA 3ENSB 1Y3UA 2H1UA 1BTPA 3DSOA 3E1XB 3PWCA 4Q7ZA 5J4SA 4X6NA 2B9LA 4I86A 3RC5A 3A87A 1GBEA 1T8MA 3SV9A 4JZFH 3TH4H 2C8WB 1C5OH 1TGBA 5A0AE 3RXMA 4I8LA 4H6SB 1ZPBA 2BXUH 2JIZD 4A7IB 1MKWK 1PJPA 2CHAB 4DCDA 1O37A 1C5UA 3W1EA 2FTMA 1DSUA 1P02A 2FIRH 2VIQA 3M3VA 1BOQA 4X8UH 3I29A 4X0WU 1C5WB 4FUBA 1UO6A 4HG6A 4YM9A 3SOSA 4Y7AA 5AFZH 1V2UT 3DA9B 3UNSA 4TSFD 3SJ9A 3L33A 2WPLS 1SFQB 3M5LA 3MTYA 3ZVCA 1O39A 3GS9A 2VIWA 1YCPH 1AHTH 1JRSA 4LZ4B 8ESTE 1E35B 3A81A 3CS7A 4X2XA 5FCRA 5C17A 5C5NA 2FLRH 1S6HA 3AW1A 5CHBA 1OP0A 1UK3A 1E0FD 1VR1H 3KHVA 3N7DA 3WW7A 1QURH 4RKOB 1P2MA 4NA8A 3BTDE 2FLBH 2O8UA 4I8JA 2ZU3A 4DT7B 2GX4A 1MZDA 1GMDF 2VGCB 3NKKA 2RDEA 5HGGA 1K1OA 2SGAA 3BN9A 3RLWH 5ETXA 5IK2D 1WTHD 1W3CA 1WQVH 4MPVA 2QF3A 1O2XA 3ZZ3A 1C5PA 1HPGA 3MU0A 4K5ZA 3SYJA 4ABFA 1TONA 5C0TA 4CHAB 1CGHA 1ACBE 1HAVB 4CH8B 1AD8H 1F7ZA 5A09A 3NK8A 1TNGA 4DGJA 5FBIA 1ORFA 1SGEE 5GDSH 3RXPA 5FPSA 2L6OA 1TAWA 1YWUA 1S0QA 2D8WA 1ANBA 1EX3A 1ZHPA 3D65E 1ZHMA 1GPZA 1GJDB 4TY7A 4FU7A 1G3CA 2BY9X 2ZG0H 2C90B 3UB0A 1T4VH 4AX9H 1C2EA 2ZEBA 2A2XH 2LNCA 1O36A 1NY22 2FTLE 1SGDE 1HAXB 4B75A 1OWIA 1WYKA 5FX6A 1BMAA 1W0JD 1S5SA 2BX3A 1BMLA 1AMHA 1TRNA 4ZHMU 1O38A 2BHGA 2Y6TA 1H4WA 3KQEA 1H8HD 1BTUA 4ESTE 1SGYE 2Z9KA 3VEQB 3QN7A 1ELCA 3TNTA 2F3CE 1SGRE 2HWLB 1W10U 1B7XB 1BITA 2SGFE 3GYLB 3RXUA 2QF4A 1NRSH 1TQ7B 1UTOA 4JZDH 1O2VA 2ZI2H 4H4FA 4K1EA 3B23B 4OGXA 3DSGA 2PKAA 1HAYB 4ABHA 4LXBH 4U2WA 1GVZA 1P9SA 3GDUA 7LPRA 2EI7A 2OC7A 1XKBC 4BTTB 4A1VA 2BVSH 2BD2A 4B74A 3U98H 1RTKA 2JH0D 1GG6B 2HPPH 3TJVA 5LPEA 4QT8C 5GXPA 3FZZA 1G3DA 4OS1A 3Q3KA 2I6SA 1TNLA 3E16B 1CE5A 1GBKA 1BJVA 3E90B 2AERH 2KX4A 2V0BA 1HXFH 3MOCA 5SGAE 1GJAB 2WPDD 4K2YA 1UVUH 2ZWLH 1KIGH 2LP6A 2ZDLA 1PPGE 4PROA 1P2QA 3S9BA 1L4DA 4B6FA 5DJ7A 1GDQA 1C1NA 1HIAB 2EY4C 3UY9A 2CF8H 3TH2H 5C1YA 1LVOA 4YLQH 3D23A 2GT7A 1O5FH 4I33A 4CH2B 1TPAE 4JYUH 4K8YA 3RXVA 2A7HA 2XC0A 1C2HA 1IHSH 1FY4A 3RM0H 2I6QA 3LGWA 4UFDH 2NWNA 1K1PA 4B73A 3SNCA 4O3UA 4X2WA 2A45B 3SBKA 4GAWA 1P09A 3ZIAD 2FESH 1DY8A 1AI8H 4CRAA 3IG6B 3PTBA 4ISOA 5FX5A 1J17T 2H9HA 1C1VH 3QUMP 2QV1A 1TBRH 2AFQB 3GCHC 1GBCA 1GGDC 1P2KA 3EDXB 1O3HA 1PPHE 1YPJH 2ZHDA 4UFGH 2C8ZB 1GL0E 3IWMA 3SGBE 5JPMH 1S82A 2EI8A 3ATLA 2TIOA 1HAOH 4IMZA 3RXHA 4FUFA 3TGIE 1GHBG 3RXBA 1FY1A 2GGVB 1CGJE 2ZC9H 5DKMA 2BTCE 1P11E 1HJAB 1QJ7B 2G55A 1GJ6A 1VJ9U 1W0YH 3LU9B 5T3HA 3MO9A 4DY7B 1WTGH 1V2MT 1CBWC 2VNTA 1HNEE 2WUBA 1BBRH 3LGYA 7ESTE 3RLYH 1O5CB 2RCEA 1ESTA 2AMDA 2OTVA 1TNIA 1AUTC 1LO6A 1O2NA 1TBZH 4IC6A 3U1IB 1W14U 4HFPB 3OYPA 1TA2A 2UWPA 2FI5E 1EZXC 2ZQ1A 3QWCH 4AG2A 1XUFA 1UCYE 1Z8IB 2ZGBH 2ZPRA 3Q76A 1AKSA 2CMYA 4AORA 4NCYA 5DPAA 1SGFG 1ZTKA 1TRYA 2VIOA 3MI4A 1MAYA 3GDSA 5FPYA 3QZRA 1NRQH 4OM9A 1IQKA 2A5IA 2P8OC 5LPRA 5DP9A 1Y3YA 1ARCA 1SFIA 3VB4A 1MU8B 3ATWA 2OBOA 1THPB 3AAVA 1A3BH 3LT3A 1O2IA 1VITF 3NRLA 1AQ7A 1BA8B 1BJUA 1AVXA 3QTVH 5HM9A 5EU8A 1HAGE 4XDEA 4VGCC 1EPTA 1AGJA 1QTFA 1O3JA 3DUXH 2XTTB 1GBJA 1SGPE 3MNSA 3SV7A 1K9OE 1V2ST 1FIWA 1KXBA 3ATMA 3TITA 3RU4T 2BLVA 1ANCA 1INCA 1C2DA 1SGQE 4X8VH 3SUDA 2IPQX 3VXFH 1H9HE 4GHQA 2RFKC 1BDAA 4LK4A 1G3BA 1OYQA 1O5AB 2GVFA 2BB4A 1GMHG 3VXEH 1A5HA 1MCVA 1JOUB 1FNIA 1O0DH 1ZMJA 1LKBA 4FVDA 5A0CA 4RSPA 1C4U2 3DFJA 2BX4A 2WV5A 2JDID 3RMMH 2ZU2A 1HRTH 2GZ9A 1GMCG 1V6DA 2A2QH 2Z9LA 1F0TA 3GCHB 2QYIA 1GGDB 2AEIH 5E2OA 4DT4A 3A8CA 2ZQ2A 3UQOA 2OCVB 4ISNA 4AFSA 4X1SU 1N6XA 1V2VT 1MD8A 5TJXA 2DUCA 3GY4A 4R8TB 1V2TT 4ISIH 4DG4A 2HLCA 1CVWH 1UVPA 1OWHA 2SGDE 6ESTA 2ZHQH 2HPQH 1RGQA 2CXVA 2PWXA 1YP9A 2Y5HA 5ESBA 1KXEA 1LCYA 1S0RA 1NS3A 1SHHB 4DIHH 2OQ5A 5IDKA 1DS2E 3SNEA 2UWOA 2AGGX 5DP7A 5C94A 1CBWB 4NSVA 3U8OH 5A2MH 1HYLA 3UR9A 1L1GA 1KYNA 3UNRA 4XE4A 3JZ2B 3ZV8A 1CO7E 2QF5A 1GJ9B 3O8RA 2C8XB 4SGAE 1WOFA 2ZGXH 1OWEA 4NWKA 4YOJA 1ZJKA 3HPTB 2ZZUH 1Y5BT 2Y7XA 1AE8H 5DN6D 3GY8A 1LTOA 3BV9B 1ZTLA 2C3SA 3LDXH 2QF0A 1TFXA 1PPCE 2BDHA 3GCTF 4GSOA 2P95A 4E7RG 2LELA 1UTLM 4ZXXH 2JH5D 1S84A 3F9EA 1EATA 3F6UH 1SSXA 5HYOA 4B71A 4F4OC 5AVDA 1EFRD 1EZUC 2O8MA 2P8OB 1FQ3A 2BXTH 2K1QA 3T5FH 1EJNA 2G52A 1SKYE 5BPEA 5HIYA 1CT0E 4ASHA 1G2MA 1TOMH 1Y8TA 3HK3B 2FMJA 4BAKB 5FHTA 4MQAA 3SN8A 2KFWA 3ZZDA 2SFAA 1PQAA 1VKYA 2G4TA 3K6ZA 1V2PT 2Y5GA 2SNVA 1KTSB 5F6MA 4VGCB 5EW1H 1WV7H 1SQTA 2ZA5A 5B6LA 4WH6A 4U01A 2HVYB 2VWOA 3MU8A 2P59A 2JJ1D 4Y0ZE 1O3OA 2P94A 4WF8A 2ZGJA 3F9HA 4ASUD 1UTNA 1ELVA 1DM4B 1GCTC 4AGJA 2HRVA 4MTBA 3JZ1B 3UR6A 3GY6A 3DD2H 1CHGA 1EAIA 1ZZZA 2BD9A 3PV5A 1FY3A 1F0RA 3CENA 4M9FA 2J92A 1TBQH 2BQ6B 1B0FA 2FOGA 4BOHA 4Y71A 3U9AH 2QCYA 4I8HA 1SPJA 2EQNA 2G8TA 1SQRA 1C9PA 3QDZB 2L74A 3RXFA 2GDDA 3U8TH 1WAYB 2OC8A 1KXDA 3LC3A 4TPYA 3SI4H 3VB6A 1ZMNA 1C5VA 1Z8JB 2ZDAH 3MU5A 3BTHE 4ISLA 3TK6A 4NIWA 5G4BA 4NA7A 4HZHA 3H5CB 3SNBA 4A6LA 1XUIA 2BDAA 3F2FA 5L2YH 1DANH 1Y5UT 4AB9A 2H9EH 1EASA 2R0KA 5K7RA 1YCPK 1YLDA 3ELAH 2YNAA 4INKA 3Q77A 3RXGA 3UREA 1IQGA 4WXIA 1P0SH 3A7VA 2A0QB 1O35A 2RA3A 1NRPH 1FONA 5DP3A 1DUEA 2BOKA 5JBTA 1PQ8A 3SGAE 3U28C 1THRH 2V35A 3SUGA 2ZKSA 3EA9A 2HGTH 3RU4E 1ZSKA 3PWBA 4JK6A 2BD8A 1ELAA 2BDCA 4ACAA 3N99A 3SHCH 1QRXA 2FOFA 4NZLA 3TJNA 1LQDB 4ZAEA 3RDZA 5LGOA 3V0XA 1WU1A 2C93B 1O3AA 3E8LA 1VCQA 2ZFQH 3SORA 1HAIH 2OLGA 4NFEA 4Q2KA 2ZFSA 1YY3A 5EOKA 1SMFE 1B5GH 1YPGH 3FOAA 1L1JA 2ANMH 1IQJA 1J8AA 1H9LB 1OP8A 1A2CH 1YC0A 3GY3A 2Z7FE 2NU1E 2WUCA 5F53A 1LPZB 2R9PA 4D9RA 1HJ8A 3KYFA 3M37A 3UPEA 1J14A 2NU2E 1OP2A 5LH8A 2CJIA 4R0IA 5EODA 4CRFA 5CE1A 4BAOB 4ISHH 1O3PB 2ULLA 4TYDA 1GCTB 1BRAA 2VIPA 2Z6BD 4B76A 1SLWB 3EA8A 1SVPA 1QL7A 2A4RA 1Y3WA 1IQEA 2FO9A 4AC9A 4K3JA 1O2ZA 3DFLA 4CBNA 4HI3A 1CT4E 2XRCA 1TQ0B 2W3IA 5E0JA 3TGJE 1C5NH 4AB8A 1MCTA 2BLQA 1P12E 3SJKA 3RXKA 3ZZ9A 4IC5A 3TU7H 1C4Y2 2WPMS 2HOBA 1JIRA 1F92A 1W0KD 3LGIA 3EA7A 1T8OA 3A7YA 3GY7A 1ABJH 5EJZA 1OXGA 2WV9A 4FU8A 9ESTA 3T28A 1A46H 1O3BA 3HATH 3OY5U 3K9XB 1HDTH 2TGAA 4I8KA 1LVBA 3MHWU 1UVTH 1MD7A 3P8GA 4NG9H 2H9TH 3BG4B 1O2QA 1MH0A 2VH0A 3MYWA 4B2BA 1DY9A 4JYVH 1E37B 2IN2A 2OC1A 3OU0A 1QL9A 1MQ5A 1LMWB 4JZ1A 3OX7U 1Z1IA 3S9CA 2A7CA 1W13U 1FAKH 2FI4E 1IQNA 4K1SA 2BYAX 1VZQH 1GI8B 4FUHA 1TPSA 3KNXA 3TPIZ 1TMTH 3GDVA 1W7GH 4MNYA 4AFQA 3UAIC 5EW2H 1HAHH 2DE8A 2PKSB 4X1QU 3ZZCA 4D76A 4MPWA 5L30H 1C1RA 3HGPA 1GJ5H 2VVVA 2ZP0H 3ZZBA 1AUJA 3BEUA 4B6EA 3MWIU 3EYDA 4YT7H 1BRUP 4WH8A 3KQ5A 4WXVA 1YPLH 2RG3A 4CRCA 2RDLA 3OSYA 4O3TA 1FZZA 4YO9A 3ZYEA 4GPGA 1ETSH 4BXSA 4UONA 2FX6A 1HGTH 1TPOA 3S9AA 4E05H 5JBCS 2EC9H 3ZVAA 3A86A 1RIWC 1K1IA 1TNHA 5T1VA 3EQ0H 4WMFA 2W26A 1FY5A 1TX6A 4OGYA 3ZVDA 1GHYH 1RD3B 2BD3A 3M7QA 5BRRE 2D1JA 1DWCH 1V2WT 2H5DA 2TGTA 3PO1C 4K8BA 5DP8A 2BY5X 4E7NA 2PGQB 1CHOF 2R0LA 1HLTH 3W95A 4A1XA 1ZPCA 3OTJE 5JB9S 5EIYA 2BOHB 1GI1A 1DDJA 1EAWA 5FPTA 2VWMA 3P8OA 3BSQA 1XUJA 1BHXB 1AY6H 3N7EA 3GICB 2Q6DA 3PV4A 2R3YA 1EP6A 2UUYA 3F2GA 1LVMA 3RUOA 2OP9A 5DP6A 1BCUH 3BIUH 1MKXK 1RFNA 1V2NT 1P05A 3TK9A 1NZQH 3U69H 2PP6A 1YPEH 2RA0A 1G2LA 4MNVA 4WWYA 1QB9A 1ZYOA 2TBSA 1AZZA 1PPBH 3RM2H 1O3EA 2B0FA 1XXDA 2G5NA 1O2KA 3PM3A 2FYRA 1W8BH 4ABBA 2WSSD 4Y79A 1AU8A 1C5ZB 1YGCH 1MKWH 2A31A 2A4OA 4MG3A 3BTWE 3P6ZB 1A5GH 2Z3CA 2ANKH 1EJAA 1XUGA 2WYGA 1ZPZA 1O3DA 4RT1A 1OOKB 1LVYA 3H09A 3QX5H 3SJIA 4AYVB 1O2RA 1GMHF 1O2TA 1IQLA 4AYYB 2BDIA 1O5DH 1NROH 1GHAG 2ALPA 4INLA 4JCNA 3HGNA 3SU5A 4H42U 3PMHB 1GI2A 4D7FA 1O3CA 1F2SE 4GCHG 2UUFB 3M61U 1GMCF 5EJ1A 1MQ6A 3PRBA 1DVAH 3P17H 4Y7BA 3SV2H 1BTHH 1TX7A 2XOKD 2IJOB 2J98A 1OSSA 1FUJA 1FPCH 2OINA 3UWJH 4BANB 2F9BH 3V13A 3UOUA 1GBIA 3L6PA 4FUDA 2XBYA 5DK1A 1JXPA 1VCWA 2WV4A 2ANYA 2PW8H 3UFAA 3RMOH 2PR3A 1S83A 3SV6A 3UIRA 2ODQA 1OWDA 2QE7D 3ODFA 2BY6X 1NM6A 3WY8A 1V2KT 1ELDE 1LPGB 4THNH 1MTUA 3MH4A 1Z8GA 1J9CH 4DURA 1NPMA 1QB6A 2ZDNA 4NA9H 1RIWB 5I46H 1GI6A 1O3LA 4ACBA 3DCLA 2W5EA 1Q3XA 1BUIA 3MU4A 2XW9A 5CDFE 4ABGA 1CSOE 2QA9E 4H6TA 1ZOMA 1LHDH 1HV7A 4Y8XA 1CGIE 1G32B 4HGCA 3PO1B 3GCNA 1BTYA 1XX9A 1A0JA 1YPMH 1ZGIA 1DLKB 3O8CA 1LPKB 4BAQB 1OWKA 1F5LA 2VBCA 5EXLA 1AVGH 2AIQA 5C1UA 1A0LA 4O97A 4ZKOU 2GP9B 2AGEX 4NGAH 1SGFA 4FUGA 1MUEB 4K69A 4AFZA 3I78A 4FVBA 5HXFA 2FOMB 4RT0A 1BQYA 2TGPZ 3TJOA 1AB9C 1COWD 2W3KA 1L4ZA 5K0HA 2BY7X 1EPTC 3AAUA 4FUCA 5TCCA 4YTAA 2B5TB 2CV3A 3TK5A 1XXFA 4A5TS 3E0PB 1NO9H 1GI7B 3NWUA 1GI5A 1SLVB 1XUKA 1PPFE 2GJGA 2G00A 3FP6E 3P8NA 1BTXA 1L0ZA 1S85A 1DWEH 1QA7A 1P2JA 3FKSD 2IOTA 3NZIA 3RXAA 4YOIA 5KEDA 3KYGA 4P02A 4RN6A 3UQVA 1UTKA 2Y80A 3LPRA 1DE7H 3GOVB 1VGCC 3A80A 3PLPA 1F5RA 1BMNH 1QY6A 3KQBA 1T8NA 2B8OH 1K1LA 3AW0A 2THFB 2F9VA 2G51A 2FS9A 1ETTH 3RXOA 2HNTE 2YMSC 3T62A 3M3TA 7GCHG 1MBQA 1GBFA 3GY5A 2WPKS 2ZPSA 4Q7YA 1SOZA 5JB8S 2ZFPH 3DSPA 1GJCB 4WY3A 1NC6A 3C1KA 2KM0A 2PGBB 7KMEH 1C1QA 1Z71A 3RXLA 1YCPM 2J2UA 1TB6H 4TY6A 1LHCH 1C1UH 1C2LA 3W94A 2CGAA 3P92A 1O2MA 1DUAA 1DX5M 1YLCA 4I8GA 2BD4A 4Y8YA 1D9IA 1SBWA 1O2PA 3M5OA 2FOBA 1ZMLA 1GBDA 2VU8E 4BAHB 2ZTYA 3R3GB 2W7SA 3BTFE 1C5MD 4B1TA 4F48B 1V2LT 2KCPA 2M2AA 2Z9IA 4NZQA 1K1MA 1FX0B 1AKSB 2NU4E 4ABIA 2FOCA 2GCHF 2XBXA 5T6GA 4F49A 2F9NA 1GI3A 1Z8RA 4XFQA 3F0PA 3ZVBA 3MH5A 4M7GA 4MVNA 2G5VA 5GNDA 1SI5H 1YPKH 4J1YA 5EQRA 3BF6H 3SU3A 1CT2E 3SJOA 1ID5H 1D3PB 4CRDA 1EQ9A 1TNJA 2JKHA 3A7XA 3FP7E 3TLOA 2C8YB 2BD7A 1AFEH 3RXCA 4NIXA 1ZR0A 1C4V2 1E34B 3A7TA 1LHFH 3ZVEA 1IQFA 1KMHB 4IS5A 5E0HA 3KN2A 2XWBI 3O8BA 4U32A 2WYJA 3QLPH 5DG6A 3HKJB 1YM0A 2F9PA 3FO8D 1AB9B 5EQQA 5F8TA 1EPTB 1EAUA 4Y76A 2DE9A 1QFKH 2GD4B 1G37A 3A8BA 1QL8A 3SV8A 4LZ1H 3UUZA 1NBME 2ZCHP 2FOAA 3KF2A 1SL3A 1U6QA 1HAZB 2Y81A 2FXRA 3A8DA 1WQSA 2R2MB 1TNKA 4WMDA 1HB0B 3AASA 1K1NA 2XNIA 3M7UA 1QA0A 2OBQA 4I7YH 2Q6GA 2GMTC 1QJ1B 3PMJA 4XRNA 1C2KA 2ZTZA 3M3SA 1EOJA 1N8OC 4NIYA 1AO5A 1NRNH 1GWAA 2Q1JA 5EXNA 3M5NA 4K1TA 1TGTA 1Z1JA 4ZROA 5CHAC 4Y8ZA 1O30A 2VVCA 3SUFA 3T29A 5L2ZH 4A1TA 1RS0A 2AMQA 5C5OA 3GY2A 4Q7XA 3DT0H 1ZJDA 2W7UA 3MNBA 4Q4LA 2Z9GA 5T6FA 2YMSB 4XOJA 3SW2B 1E1RD 3PTNA 4CR9A 4E06H 1E38B 1XVOA 3BTGE 1UHBA 1QGFA 1C5RA 1GDNA 1P04A 3LIWA 1W11U 1TA6A 6LPRA 1O2HA 3RXJA 1TMUH 3F68H 2VH6A 3T25A 4IN2A 3CP7A 5C3NA 3TIUA 2ZHFH 3LGVA 2F4LA 1EKBB 5E0GA 1DICA 2FODA 2GTBA 1EOLA 2M5TA 1ETRH 1F0UA 3MQKC 1NU9A 1LDTT 1E36B 2ZCKP 4ABEA 2QC2A 1DXPA 1GHZA 5F8ZA 4X6MA 4FOUC 3O8DA 1YKTA 2O9QA 2ZHEH 2QXHA 3NUMA 3SU6A 2ANWA 5AHGH 4ABDA 2PHBA 3SJ8A 1DITH 1GVKB 3A7ZA 2Z3DA 1BHXF 1MZAA 5C1XA 2BZ6H 3SU4A 2J94A 3BTME 3RC6A 3U8RH 1PYTD 3V3MA 8LPRA 4BXWA 1KDQB 4XBCA 3SU1A 1MAXA 4CRGA 5EJLA 2XNDD 1MTSA 1DSTA 1IOEA 3ZZAA 1X7AC 2FM2A 1AVWA 2OXSA 2HNTC 3SNDA 1ELGA 2TRMA 4KELA 4MNXA 3V7TA 4IBLH 1O33A 1KSNA 1EAXA 1VJAU 4DOQA 5KECA 3A89A 3ATIA 1KY9A 5E2PA 1GJ7B 1KTTB 1FI8A 1GI0A 1MU6B 1V2OT 2KAIB 4NFFA 5FXLA 4JK5A 2ZFRH 3B8JA 1UTQA 1RTLA 2WZQA 2FOEA 5F8XA
chains in the Genus database with same CATH topology
2WINI 3GCOA 1UCYH 3K6YA 3STIA 1S81A 3RMLH 1Z6EA 3CS0A 5DP5A 2FPZA 2R3UA 1QBVH 1MTWA 1IQIA 1AE5A 2GMTB 1BZXE 3NPSA 4ZXYH 3T2NA 1HUTH 1P8VC 4JMYA 1FMGA 3F9FA 3KEEA 1PYTC 4Q80A 5E8EH 2EEKA 2Y5FA 1OX1A 1A4WH 1G30B 1P01A 3Q00A 3A84A 1LQEA 1O5GH 1AWFH 1D4PB 5CHAB 4ZUHA 4DW2U 1EXFA 1F0SA 3TVJB 2H5CA 3BTEE 4WJG2 2A5AA 1G36A 2ASUB 2ZGHA 2WPIS 4FUJA 3ZVGA 1GDUA 3MH7A 4AGKA 2QXIA 1GBBA 1GBAA 2ODPA 3K2UA 2Q6FA 3MMGA 2AYWA 1GHWH 1TGCA 4FUIA 1BBRE 1K22H 2LPRA 3RC4A 3GCTG 1J16A 4JYTA 3MO6A 1HAVA 4JZEH 3B9FH 3F1SB 3UNQA 1GHAF 3EE0B 2PLXA 2BLWA 2ZFFH 4D8NA 2Y7ZA 2FYQA 4GCHF 1H1BA 4BNRA 1Y3XA 1UVSH 3RXSA 1Y59T 6GCHG 2GT8A 1T8LA 1EP5A 1P10A 1T7CA 3M35A 2FEQH 2QXJA 3RXEA 3BTQE 1O3KA 1D3QB 3ZVFA 1XUHA 3FZDA 1GG6C 1GL1A 3KQCA 2F91A 1SOTA 4UFFH 4ZHLU 2EI6A 2GZ7A 3PB1E 4AOQA 1P2NA 5JYIA 4GVUA 1HJ9A 2ZDVH 3N7OA 3D49H 4XSKU 1ABIH 2TPIZ 2CN0H 1ZHRA 1GCDA 1C1TA 1DT2A 2ZO3H 1T4UH 1GJ8B 2BD5A 2ZPQA 1O3FA 1JWTA 1K2I1 1PQ5A 1OPHB 2O8LA 5FBEA 1Y3VA 3QTOH 2ZU4A 1GHBF 5GPIB 4YESB 1A7SA 4NWLA 2BY8X 4Y10E 3SZNA 2PSXA 3MO3A 1C5YB 1FN6A 1L2EA 1RRKA 2AS9A 1O3IA 1TRMA 2P3TB 1SGIB 2ZU5A 4B2CA 3S7HB 1PQ7A 4O03A 1GBLA 1SHYA 1LHGH 4Z6AH 5A0BA 1EUFA 1SC8U 4I32A 5JBBS 8GCHG 1AIXH 4OS2A 3MNXA 2PTNA 1KLJH 1YF4A 4TPIZ 1N6YA 3RXRA 3A7WA 5IYTA 3QK1A 5DP4A 3SGQE 1EB2A 5H4IB 4TWYA 1UMAH 3RU4D 1IQHA 4DIIH 1A5IA 2AIPA 2OQUA 3ZZ7A 3IITA 1OKXA 5GCHG 3SHAH 3TH3H 2A32A 1Q31A 3I77A 1UK2A 2BZAA 3LJOA 4AFUA 1HIAA 2VINA 2BLOA 3SU2A 3TJUA 1XVMA 2YOLA 1SLXB 4I31A 3TGKE 5C20A 1FDPA 4DJZB 1P2IA 4KTUA 1BTZA 4OS4A 3S69A 4GHTA 1BBRK 1HJAC 4FXGH 1BRCE 3LH1A 1IAUA 2G4UA 1V3XA 2FX4A 2XBVA 1P2OA 4OS7A 3ATKA 4IN1A 1ZLRA 3MNCA 1D3TB 3FAOA 3EGKH 1T32A 4ZKSU 1NFYA 1QRWA 3H7TA 3LOXA 2ZHWH 4MDSA 3F9GA 1HFDA 5A8XA 1NFWA 4X2YA 3RXQA 5EGMA 4X6OA 2XBWA 7GCHF 2O8TA 2FI3E 2P3FH 4GLYA 1QNJA 1JMOH 3VB7A 1PPEE 1PPZA 1AFQC 1FXYA 2NU0E 3S7KB 5JBAS 4KGAA 2Z94A 1ZGVA 1FN8A 2V6NA 3SU0A 3PLKA 1NESE 4KTSA 2VIDA 1O32A 5T6DA 2QAAA 3VFEA 5TCAA 3DHKH 4RKJB 2ODYB 1LKAA 1SR5C 4KP0A 1ELBA 1WBGB 3TNSA 1NFXA 5FAHA 1B0EA 4UFEH 5GJ4B 1W12U 1HCGA 1P3CA 4ZKRU 4ZKNU 1QQ4A 1C5XB 4X8TH 1TYNA 3LGUA 1LHEH 1NU7B 1O3NA 2FWWA 1KLTA 1Q2WA 1TABE 1W7XH 4YZUA 1ELFA 8KME2 1QJ6B 3G01A 4BAMB 1C2GA 3QGNB 2VVUA 1QQUA 3BIVH 1NFUA 1PFXC 4X1PU 4AZ2B 9LPRA 1KXFA 3PMBB 1C1OA 4U30A 1SQOA 2PKAB 2NU3E 4XBBA 1OS8A 1ZRKA 1ANEA 1AZ8A 2R2WU 4D7GA 1FPHH 3FP8E 4MPUA 3BG8A 1H8DH 1EZQA 1SGCA 2EA3A 3PROA 3FFGA 1C5LH 3QZQA 5EXMA 2ZFTA 3MU1A 1TOCB 2C4FH 3NXPA 4JZIA 1P03A 1SLUB 2BVXH 3P70B 6CHAC 4CBOA 2OC0A 2F9UA 2G81E 2ZIQH 4IMQA 2UUKB 2GKVE 1GMDG 1A61H 1GHXH 3S0NA 1A1RA 1ESBA 3RXTA 2BM2A 1KXCA 3P8FA 2P3UB 2P16A 3BTKE 4KKDA 3LH3A 1O2OA 3R0FA 1O3GA 2JETC 2FOHA 3E6PH 2Y82A 4INHA 3ZV9A 1KXAA 2BVRH 4CRBA 1O3MA 2A1DB 3LC5A 1A0HB 5GWZA 1MMJN 1D3DB 1O2SA 1MKXH 1D6RA 3HK6B 2QGRA 1QRZA 2ILNA 4UE7H 4O9VA 2GZ8A 4UDWH 4K60A 4ABAA 5A8ZA 1ARBA 1EJMA 2QY0B 1ESAA 1NTPA 1TX8A 1ZSJA 3PLBA 3BEFB 4FUEA 1QCPA 1TWXB 1W0ZU 3PMAB 5EPNA 1P3EA 4MLFB 3SNAA 3MH6A 4OS6A 1YYY1 5DO4H 1TGSZ 3L3TA 5PTPA 2GCTC 1O2WA 1AFQB 3VPKA 2ESTE 3ITIA 2J9NA 4X1NU 1QR3E 4YLUA 1C2JA 1CHOG 2OD3B 2D2DA 1A3EH 3OY6U 1V2QT 2Z3EA 3LONA 1AWHB 4X6PA 2PV9B 4Y0YE 1QB1A 1THSH 2STAE 2FP7B 1Z6JH 1DWDH 2YNBA 4MNWA 2ALVA 1YPHE 4MPXA 3E0NB 1MBMA 4ABJA 2SGQE 2SGEE 1O2LA 3ZZ6A 1UTMA 4X2VA 1NRRH 1UTJA 1Y5AT 4FU9A 1IQMA 4LOYH 1TLDA 3KGPA 4B2AA 1O31A 3VB5A 4WMEA 1CA8B 1CQQA 1SGTA 2PSYA 3A82A 2JH6D 1FJSA 1GHVH 1O5EH 1K21H 2AMPA 3KIDU 1AN1E 1M9UA 4CREA 2CF9H 3ZZ5A 4TWWA 1RJXB 1N1LA 3AVZA 1BMMH 1DFPA 2J38A 5GIBA 3E91A 3ZYDA 3ODDA 4AG1A 1C2IA 2ZDMA 4UEHH 1F5KU 3KQDA 1XMNB 3VGCC 1G9IE 1JBUH 2J95A 2A4QA 2H6MA 6CHAB 1JIMA 2XYAA 1P06A 3A8AA 1C5QA 1C1MA 4XBDA 3Q3YA 2UUJB 3SQEE 5EPYA 2PFEA 2Z9JA 1SB1H 2F83A 3URDA 4DVAU 1VCPA 3GYMA 1FLEE 2GV7A 1TIOA 4NSYA 2AH4X 5A8YA 1C9TA 1ANDA 1ELEE 1J15A 1IHTH 5J4QA 3SO3A 3E3TA 4IW4E 3RP2A 3SUEA 3URCA 4BTUB 2JETB 1K28D 1WCZA 1H9IE 3PYHA 3KCGH 4BTIB 1FY8E 1DOJA 2XCFA 3C27B 2FZZA 5JDUB 2VWLA 2UWLA 1K1JA 1TMBH 1DPOA 2QXGA 2PUXB 3M36A 1GBTA 2A7JA 1O2YA 4Y11E 1C1SA 1RXPA 2VIVA 2XWAA 1TE0A 2B7DH 3V12A 2ZTXA 1GJBB 1W2KH 1P57B 2GCTB 5CMXH 1TALA 1UCYK 1FAXA 5DGJA 2HVXA 2VB0A 2BDYA 2A5KA 2BDBA 1ZTJA 3Q3XA 2TGDA 2V3HH 2BDGA 3SI3H 1VGCB 3UWIA 5HM2A 4YT6H 2HNTF 1UTPA 4KTCA 5L6NH 2GV6A 1HBTH 1CA0C 1KDQA 2J34A 3K65B 4UD9H 3U1JB 1C2MA 3HKIB 1GBMA 1O2JA 1G3EA 2BQ7B 2GDEH 6GCHF 1O2UA 3VB3A 4Z0KA 1C1PA 1C5SA 1BRBE 1O34A 2PUQH 4GUXA 3UTUH 1MTVA 2HALA 3FVFB 1YBWA 1GVLA 3P95A 1L1NA 2ZU1A 2OUAA 2A4GA 4CR5A 1TPPA 1MTNC 2KAIA 5B6OA 1DXWA 2FS8A 5AFYH 1VITH 1C1WH 1SG8B 1S6FA 5I25A 1VITG 1UVOA 1QBOA 2VJ1A 1SGNE 5F03A 1O2GH 2BQWB 5AF9H 3T27A 3MFJA 1V2RT 3VGCB 3LKWA 2XCNA 4A92A 1SQAA 4OS5A 2FDAA 1FIZA 2ZGCA 2IPHA 2CHAC 5ESTE 3SQHE 1GI9B 1V2JT 4ZMAH 2XC5A 2ZCLP 5C2ZA 3BEIB 1JRTA 1BIOA 1FV9A 2PTCE 3A88A 1BB0B 2J4IA 2BMGB 3RXDA 1QIXB 3BG4C 1XKAC 8GCHF 1OYTH 2QN5T 1WSSH 5EG4A 3LGTA 4AN7A 3D62A 1GBHA 1YPHC 5LPFA 1C2FA 1UK4A 2WPJS 4Y6DA 3EAJA 1EB1H 2QIQA 1ZSLA 1QBNA 5GCHF 4NIVA 1BTWA 3RXIA 1HXEH 3T26A 1BT7A 3RMNH 1DLEA 1UHBB 2VGCC 3KL6A 1OWJA 3GISB 2D26C 2GCHG 4SGBE 3LJJA 2PKSC 1UJ1A 5EQSA 1ELTA 1P9UA 1NN6A 2XXLA 2ZNKH 3QO6A 2F9OA 4CHAC 1N8OB 2V3OH 2XC4A 1NT1A 1CU1A 4D9QA 2AGIX 1GJ4H 3A83A 2ZECA 2WPHS 4YOGA 1RTFB 2ZDKA 4IGDA 1CA0B 2P93A 2H2ZA 5C67A 5HMAA 1C5TA 1O5BB 3M5MA 5ABWA 3QGJA 4ZHAA 3STJA 4ZH8A 2SGPE 2ZF0H 3ESTA 1KLIH 5FCKA 1XM1A 3A85A 4J2YB 2STBE 3UOPA 1QHRB 2VWNA 1H8IH 1TGNA 4HTCH 1WUNH 3M7TA 4WVPE 1DWBH 1MTNB 2SNWA 3ZZ4A 4X8SH 2O8WA 1D6WA 1ZRBA 1HAPH 1T31A 1Z7KA 1EZSC 3H7OA 4X1RU 3BTTE 3NCLA 1GI4A 3ZZ8A 3FANA 3ENSB 1Y3UA 2H1UA 1BTPA 3E1XB 3PWCA 4Q7ZA 5J4SA 4X6NA 2B9LA 3RC5A 3A87A 1GBEA 1T8MA 3SV9A 4JZFH 3TH4H 2C8WB 1C5OH 1TGBA 5A0AE 3RXMA 4I8LA 4H6SB 1ZPBA 2BXUH 4A7IB 1MKWK 1PJPA 2CHAB 4DCDA 1O37A 1C5UA 2FTMA 1DSUA 1P02A 2FIRH 2VIQA 3M3VA 1BOQA 4X8UH 3I29A 4X0WU 1C5WB 4FUBA 1UO6A 4YM9A 3SOSA 4Y7AA 5AFZH 1V2UT 3DA9B 3UNSA 3SJ9A 3L33A 2WPLS 1SFQB 3M5LA 3MTYA 3ZVCA 1O39A 2VIWA 1YCPH 1AHTH 1JRSA 4LZ4B 8ESTE 1E35B 3A81A 3CS7A 4X2XA 5FCRA 5C5NA 2FLRH 1S6HA 3AW1A 1OP0A 1UK3A 1E0FD 1VR1H 3KHVA 1QURH 4RKOB 1P2MA 4NA8A 3BTDE 2FLBH 2O8UA 4I8JA 2ZU3A 4DT7B 2GX4A 1MZDA 1GMDF 2VGCB 3NKKA 5HGGA 1K1OA 2SGAA 3BN9A 3RLWH 5ETXA 1WTHD 1W3CA 1WQVH 4MPVA 2QF3A 1O2XA 3ZZ3A 1C5PA 1HPGA 3MU0A 4K5ZA 4ABFA 1TONA 4CHAB 1CGHA 1ACBE 1HAVB 4CH8B 1AD8H 1F7ZA 5A09A 3NK8A 1TNGA 4DGJA 5FBIA 1ORFA 1SGEE 5GDSH 3RXPA 5FPSA 1TAWA 1S0QA 2D8WA 1ANBA 1EX3A 1ZHPA 3D65E 1ZHMA 1GPZA 1GJDB 4TY7A 4FU7A 1G3CA 2BY9X 2ZG0H 2C90B 4AX9H 1T4VH 1C2EA 2ZEBA 2A2XH 2LNCA 1O36A 1NY22 2FTLE 1SGDE 1HAXB 4B75A 1OWIA 1WYKA 5FX6A 1BMAA 1S5SA 2BX3A 1BMLA 1AMHA 1TRNA 4ZHMU 1O38A 2BHGA 2Y6TA 1H4WA 3KQEA 1BTUA 4ESTE 1SGYE 2Z9KA 3VEQB 3QN7A 1ELCA 3TNTA 2F3CE 1SGRE 2HWLB 1W10U 1B7XB 1BITA 2SGFE 3GYLB 3RXUA 1NRSH 1TQ7B 1UTOA 4JZDH 1O2VA 2ZI2H 4H4FA 4K1EA 3B23B 4OGXA 2PKAA 1HAYB 4ABHA 4LXBH 4U2WA 1GVZA 1P9SA 3GDUA 7LPRA 2EI7A 2OC7A 1XKBC 4BTTB 4A1VA 2BVSH 2BD2A 4B74A 3U98H 1RTKA 2JH0D 1GG6B 2HPPH 3TJVA 5LPEA 4QT8C 5GXPA 3FZZA 1G3DA 4OS1A 3Q3KA 2I6SA 1TNLA 3E16B 1CE5A 1GBKA 1BJVA 3E90B 2AERH 2V0BA 1HXFH 3MOCA 5SGAE 1GJAB 4K2YA 1UVUH 2ZWLH 1KIGH 2ZDLA 1PPGE 4PROA 1P2QA 3S9BA 1L4DA 5DJ7A 1GDQA 1C1NA 1HIAB 3UY9A 2CF8H 3TH2H 5C1YA 1LVOA 4YLQH 3D23A 2GT7A 1O5FH 4I33A 4CH2B 1TPAE 4JYUH 4K8YA 3RXVA 2A7HA 2XC0A 1C2HA 1IHSH 1FY4A 3RM0H 2I6QA 3LGWA 4UFDH 2NWNA 1K1PA 4B73A 3SNCA 4O3UA 4X2WA 2A45B 3SBKA 4GAWA 1P09A 2FESH 1DY8A 1AI8H 4CRAA 3IG6B 3PTBA 4ISOA 5FX5A 1J17T 2H9HA 1C1VH 3QUMP 2QV1A 1TBRH 2AFQB 3GCHC 1GBCA 1GGDC 1P2KA 3EDXB 1O3HA 1PPHE 1YPJH 2ZHDA 4UFGH 2C8ZB 1GL0E 3IWMA 3SGBE 5JPMH 1S82A 2EI8A 3ATLA 2TIOA 1HAOH 4IMZA 3RXHA 4FUFA 3TGIE 1GHBG 3RXBA 1FY1A 2GGVB 1CGJE 2ZC9H 5DKMA 2BTCE 1P11E 1HJAB 1QJ7B 2G55A 1GJ6A 1VJ9U 1W0YH 3LU9B 5T3HA 3MO9A 4DY7B 1WTGH 1V2MT 1CBWC 2VNTA 1HNEE 2WUBA 1BBRH 3LGYA 7ESTE 3RLYH 1O5CB 2RCEA 1ESTA 2AMDA