1T31A

A dual inhibitor of the leukocyte proteases cathepsin g and chymase with therapeutic efficacy in animals models of inflammation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel, potent dual inhibitor of the leukocyte proteases cathepsin G and chymase: molecular mechanisms and anti-inflammatory activity in vivo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chymase
total genus 49
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1t31A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1t31A02
4AG2A 1O38A 4WVPE 1NTPA 2HGTH 4UFGH 1MKXK 3A86A 3VB4A 1SGRE 4J1YA 1LHFH 2ZFRH 1WCZA 4B2AA 5A2MH 1C9TA 1UHBB 4X2YA 1H9IE 2QIQA 1C1UH 2XRCA 2PKAB 2VWLA 1ARCA 2VJ1A 4K69A 1OSSA 1QJ6B 2XXLA 1A3EH 4SGAE 1T8NA 1OOKB 1XKBC 1OWDA 1K28D 4ZHAA 2PGQB 3SI3H 4CRDA 2D2DA 1YP9A 3LKWA 5TCCA 5TJXA 3UOPA 4ZHMU 3ZZ9A 3NCLA 3LGWA 2QA9E 4HGCA 2VWOA 1Z1IA 2AFQB 1C2GA 1K1MA 1DUEA 1YPJH 7KMEH 2TGTA 1GI0A 2O8WA 4CHAC 1DXPA 1YLCA 4TY6A 1ESAA 2FODA 2ULLA 4NWLA 1CHOF 2A5AA 1DANH 4FUHA 3IWMA 1K2I1 1BMAA 2J2UA 4IMQA 1FPHH 2G5VA 1C5WB 1K1OA 4VGCB 5C67A 1O3LA 2VINA 4NG9H 4U01A 1QJ7B 1F5KU 2J38A 1KLTA 1G3CA 2C90B 1DPOA 1FI8A 1ZYOA 3GY4A 1OWIA 1FY8E 3RXLA 4RKOB 1DM4B 2WPIS 3MNBA 2SNWA 1N6YA 2V3HH 4ABEA 1L2EA 4Q7ZA 3O8BA 3ZVDA 3NZIA 5AVDA 5HM2A 2HNTF 4B74A 5CE1A 1IQEA 2FM2A 1TMTH 3UTUH 1V6DA 2G4TA 3H7TA 1SGNE 4FUDA 2BVRH 6CHAB 3SJ8A 2F3CE 3GCOA 3HATH 2NU4E 2G81E 4Q80A 2SGPE 3SJOA 2SNVA 2ZU4A 1RXPA 1J17T 1GBFA 4OS6A 1GBHA 2F9VA 5LH8A 1IQHA 1WSSH 1PJPA 1TNJA 2P3TB 2OXSA 4ISNA 3SUEA 1TIOA 1HUTH 1D3DB 2VU8E 2FO9A 1OWEA 1QQ4A 2QN5T 8ESTE 1KSNA 4ZAEA 1TLDA 1FDPA 2RCEA 3V12A 1SGPE 2TGDA 1GBLA 1NRQH 1RS0A 1UMAH 4MPWA 1TOMH 3GY6A 1F92A 2W7SA 1GI9B 1C5LH 4RKJB 1K22H 4AFQA 5DP9A 5F8TA 1BTYA 4ZHLU 4Y8XA 1TQ0B 5DP3A 3RXFA 2O8MA 2OBQA 3SU3A 1VZQH 3F9GA 2Y82A 3PMJA 1C4Y2 2Z3EA 4HI3A 3Q00A 1S84A 4O9VA 1V2JT 3A82A 1W7XH 2A32A 1SB1H 1PPHE 3DFLA 4Y10E 2WV4A 7ESTE 1HXEH 1OXGA 3S9CA 3SGQE 1GI3A 1EJAA 1W12U 2BVXH 1D6RA 2GMTB 1Z6JH 1ETTH 1NFUA 2RDLA 2BD3A 4JZFH 1KXBA 1IQMA 2Y7ZA 1ABIH 1H8DH 1YBWA 1HAIH 3P92A 1A1RA 4BTTB 3NPSA 5A0BA 2FESH 2SGQE 3C1KA 2ZHEH 1SGDE 1ESBA 1X7AC 4FVBA 2SGEE 3F68H 3SN8A 2FS9A 1TGBA 3U9AH 4Y0YE 1C1PA 4BXSA 3D65E 1HV7A 3EDXB 5DPAA 3BG8A 1ZHRA 1P04A 1WAYB 2WV5A 1G36A 3SGAE 3KCGH 1AO5A 1Z8RA 2TGPZ 4FUJA 2H5DA 1QY6A 4Y7AA 5GCHG 3RDZA 3KN2A 4O97A 3QK1A 2OTVA 3R0FA 1MTNC 1YCPM 3VGCB 4YLUA 4DOQA 4TPIZ 1F0TA 4UE7H 2QYIA 5EXMA 4K3JA 1HAVB 2ZHWH 2BLVA 1F5LA 2BDBA 4GCHF 4JZDH 2XC4A 3W94A 3FVFB 1H9HE 1O2JA 1XUIA 7LPRA 1O3MA 2HWLB 5K7RA 1JXPA 2Z6BD 1GBMA 3PLPA 1GCTB 1V2QT 3SV7A 4YOJA 2BDGA 5A0CA 2PLXA 1ANEA 1CE5A 1DSTA 3LH1A 3GY7A 1ELFA 1OWKA 1BUIA 4TYDA 1AE5A 1BBRE 3QZRA 5DG6A 1XUGA 1TX6A 5CHAC 3QLPH 5FAHA 2B7DH 3PM3A 3U1JB 3F9HA 1SLVB 4FUEA 2QAAA 3V3MA 3KQBA 2RA0A 4Q7YA 1RRKA 1Z6EA 2TPIZ 5C3NA 2ZFFH 4NA9H 4H4FA 3LONA 4F49A 3STJA 1ZSKA 5JBTA 2XCNA 1EP5A 3B9FH 3T29A 2BTCE 1Y3YA 1GDNA 3UQVA 1V3XA 1UVUH 4GLYA 4DCDA 3A88A 1ELGA 1Q2WA 1P9SA 3SQEE 5BRRE 5DP4A 1H1BA 2BOHB 1QL7A 1IQIA 4ZXXH 1TBRH 2HRVA 1MTNB 3UWJH 1FPCH 4OS2A 4HFPB 3AW0A 2F9BH 1GJ7B 1TAWA 1HPGA 2GV7A 4JZIA 3RM2H 1WUNH 2W7UA 1QHRB 4WH8A 3TGIE 4E05H 4U32A 1W10U 3MWIU 2ZDMA 5J4QA 1ZR0A 5JBBS 1C5TA 1BA8B 5F8ZA 1K1NA 2WUCA 1J8AA 3K6YA 4ISHH 4DG4A 3DA9B 2FXRA 3MH5A 4HZHA 5GWZA 3O8CA 1NN6A 5EPNA 2CN0H 4BTIB 1C5ZB 1GJAB 5LPEA 1GHYH 4Y76A 2PSXA 3UWIA 2Y5GA 3G01A 3PV4A 3L3TA 1ETSH 2ZF0H 4HTCH 3FP8E 2WYGA 1J9CH 3QWCH 2FOFA 4X6NA 6LPRA 4IBLH 2AMPA 2BYAX 1YCPK 2CMYA 3BTTE 1Z1JA 3RXGA 2ZGCA 1RGQA 5JYIA 2RA3A 1O5FH 3UR6A 4A7IB 1L1JA 5DO4H 1CGIE 1UTLM 3E91A 4YO9A 1F0RA 4TPYA 1P3EA 1ELCA 2CF9H 2FOCA 3M37A 1PPEE 1WTHD 4E7NA 1BMNH 3ZVFA 2PTNA 4CR9A 1GHVH 2XBVA 5EW2H 1QFKH 3DHKH 3I77A 2H9EH 1TNHA 4NIXA 2R9PA 2QF3A 3TLOA 4X2WA 2AEIH 1FUJA 4SGBE 1LVBA 1NRPH 1ZSLA 1HB0B 2AIPA 2UUFB 3FP7E 1E37B 3BTME 4LXBH 3TJUA 1C1SA 1BHXF 2ZWLH 5DP8A 1MD8A 1GVLA 3BTWE 5L30H 3JZ1B 1DSUA 1IQKA 4NCYA 2ZC9H 1JIRA 4K1TA 1G3EA 1GI8B 1A61H 2F91A 2BQ6B 5EQRA 1C1RA 3BTDE 3E6PH 2JETC 4B1TA 2A4QA 3A80A 1Y59T 1HIAB 1WU1A 1TGSZ 5C1YA 5AFZH 2FOAA 3R3GB 4CH2B 4JYUH 2CGAA 1MTUA 1F0SA 5JBCS 4B73A 1LPZB 4ISIH 3LIWA 2GCHG 5FBEA 3TIUA 3SNBA 2A2XH 5F6MA 5I46H 3P8GA 1O3DA 1V2VT 1ELVA 1H4WA 3FP6E 1AZ8A 1BJVA 1IQGA 3FANA 1AMHA 1AZZA 2BD4A 1ZPCA 1V2NT 1OP0A 3RXKA 2OLGA 2XC0A 2JKHA 1UK3A 1NFWA 1LO6A 1NRNH 3BTEE 3VGCC 4NGAH 1Y5BT 3SHCH 4U2WA 3DFJA 1E36B 1UJ1A 3I29A 4THNH 3RM0H 4D7GA 4YLQH 5FCRA 5LGOA 1UK4A 1Z8IB 4KTCA 1YGCH 4TWYA 1AQ7A 1C1QA 2Y5HA 2HNTE 1O2GH 2Z9JA 3PLKA 1D4PB 2NU1E 3CS0A 3URCA 1EB2A 1MU8B 3TGJE 1P02A 1ELEE 1UTOA 3MU8A 1HAVA 4R0IA 1HJ9A 3GY8A 4AFUA 1C5PA 2BX4A 3RC6A 1OP8A 2Y81A 1C4V2 1MTSA 3BSQA 2PKSC 3F1SB 1GG6B 1SFQB 3PTBA 3GY2A 1LPGB 1MQ5A 3ESTA 1ZLRA 1XUKA 2EA3A 1O34A 1P0SH 1D3PB 5PTPA 2WPLS 3S7KB 3F9EA 4DT7B 1O2RA 2FOGA 3LGYA 1GGDB 3E8LA 2BMGB 4BAOB 3IITA 4X6OA 1GBIA 2Q6FA 1NFXA 2C93B 1XKAC 4DGJA 5EG4A 1BJUA 1EAXA 2ALPA 2BHGA 2EI7A 3ZVBA 4XBBA 1FZZA 1TNLA 4K5ZA 1D3TB 2IJOB 1SGFG 3TITA 1WQSA 2ZFTA 3H5CB 1PQAA 1FONA 2BY9X 2SGFE 3BEIB 1L4ZA 1ZPBA 3SV9A 1CSOE 3BTQE 1CQQA 1YPHE 1K1LA 2HALA 2V0BA 2WPJS 3OX7U 2GTBA 3LJOA 5DP6A 2CHAB 1ZZZA 1O3AA 3RXOA 4X2XA 2WINI 1ZRKA 3KIDU 1SL3A 1NC6A 3SQHE 2BQWB 1MCVA 3H7OA 2ZHQH 3PMAB 4WWYA 1O2OA 1QBNA 2BY8X 1VITG 2KAIA 2EI6A 1XXDA 1QTFA 4INKA 3A83A 8KME2 1C5NH 1O31A 5EQQA 1Y8TA 1EZXC 1LVOA 2VIWA 2EEKA 2OC7A 1O3HA 1YPEH 4H6SB 2PW8H 1TRNA 1TE0A 1ZSJA 1OKXA 4Y0ZE 2GZ8A 3QTOH 4ZUHA 5EGMA 1G30B 3SGBE 1ZMJA 3Q76A 3UQOA 2A7CA 3MH7A 1O5BB 3T27A 2QGRA 1SGEE 3BTKE 4ZXYH 5C2ZA 5E2OA 4ASHA 1C5VA 1EAUA 1EATA 1EQ9A 1KIGH 2BD5A 1GCTC 1O37A 4MG3A 1AY6H 2WPKS 1GBDA 2WPMS 1GJ5H 3M3TA 5FPSA 2FOEA 4I7YH 3E3TA 1K1JA 1HIAA 2XCFA 3MU4A 2R0LA 1EJNA 1OWHA 4NZLA 1C1TA 1RFNA 4X1PU 3RXPA 1FIZA 3ATIA 4B2BA 3SJIA 1A0JA 1IQJA 1AWHB 3TVJB 2STAE 2QXJA 3MYWA 1EXFA 1EKBB 1N8OB 1HBTH 1GBCA 3RUOA 3L33A 1S85A 2ANYA 2P59A 1Y5UT 2VH0A 1RTKA 4K8BA 4ISOA 1T31A 1O2PA 4OS7A 2FOMB 2C8XB 3RXQA 1P2OA 5DKMA 2ZG0H 1HDTH 3GICB 5DJ7A 1EZSC 1B5GH 1HLTH 5ESBA 2WUBA 4BOHA 2ZI2H 1YC0A 1LHEH 1W14U 1SOZA 3SW2B 1YPLH 3GISB 1JMOH 1BOQA 2GP9B 1CHOG 1RTLA 2GDEH 1V2KT 3U1IB 4X6MA 2ZU2A 4MQAA 1KLIH 1T4VH 2AIQA 2C3SA 2QXGA 1BTWA 2QXIA 6GCHF 3Q77A 3SNAA 1S81A 5AFYH 4ZKRU 3LGTA 1O0DH 1ZOMA 2VH6A 3LPRA 2EI8A 3VB3A 3RXHA 4Y8ZA 3TGKE 1YM0A 4Z0KA 1QIXB 1ELBA 2XNIA 4GVUA 1NU7B 4AG1A 1DS2E 4VGCC 1G3DA 1TX7A 2FP7B 3LT3A 3PROA 3AAVA 1L1NA 1BRCE 4NSVA 1GJ8B 5FXLA 1TRYA 5HXFA 1FXYA 4MDSA 3NUMA 2OUAA 1XVMA 3NKKA 4X1RU 4LK4A 1GJ4H 1P12E 4FU7A 1NESE 1GI7B 3I78A 1XMNB 1P2JA 4DJZB 1ZPZA 3ODFA 3EA9A 1S6FA 1XX9A 4M7GA 5LPRA 1GHBG 4XBCA 2PR3A 1CA8B 2Z9LA 1EJMA 1GBKA 3HKIB 4JK5A 4INLA 1TMUH 2ODPA 3UPEA 1O3CA 5IYTA 2FMJA 1G3BA 1O2VA 4GHTA 4A1TA 2GV6A 2HPQH 1Q31A 1YF4A 4JCNA 1WQVH 3BF6H 2ANWA 3ZZ7A 1MQ6A 2B9LA 1U6QA 1TPSA 3A84A 4FU9A 5C20A 5T6DA 3GCHB 4AN7A 1RIWC 1O5GH 4AGKA 4X1QU 3A7VA 1D3QB 3OU0A 3DUXH 4AFSA 5C5NA 4CRCA 1GL0E 3LGUA 1LQEA 1BQYA 3EA7A 4I8HA 3ENSB 4AOQA 3KQEA 2FS8A 1PQ7A 1GPZA 1TYNA 3A8BA 4IC6A 1HJAB 3A87A 3VB5A 4B2CA 4CBOA 1V2LT 4NFFA 1VGCB 4Y7BA 1HAXB 2C4FH 1O3OA 3BTFE 2BY6X 1DLEA 1YKTA 3GY3A 1BTHH 1QURH 2R3YA 1YPHC 4IW4E 2VWMA 5GXPA 5EODA 2ZECA 3UNSA 3HK3B 2FIRH 1AKSA 2XYAA 1A5HA 1CBWB 1TGTA 5AF9H 1FJSA 4NFEA 2G55A 8GCHG 3NXPA 1CBWC 4NA8A 1AIXH 1FY1A 1K1IA 1DWCH 5CMXH 2CJIA 1AUJA 1O2YA 1SMFE 1TNGA 2ZHDA 3OYPA 4ZH8A 2Y80A 1O2ZA 2AERH 1BB0B 1NO9H 1ZHMA 3B23B 2AMQA 2G52A 1KTSB 2HNTC 3PO1B 1W13U 4INHA 4FU8A 3FZDA 2G00A 1HFDA 4WMDA 3M5MA 4X8VH 1AD8H 1JOUB 3PO1C 5GJ4B 1LVMA 5E8EH 4A1XA 1EPTC 1PPZA 4TY7A 3A7XA 3HK6B 1O2LA 3QUMP 2AYWA 2UUYA 1AFEH 1ZTJA 1GMDG 2FWWA 4WF8A 4Y79A 1AUTC 1GHWH 4UFFH 5C1UA 2W3KA 2A7HA 3PTNA 2BZAA 1SGQE 4ABIA 5G4BA 1BTPA 1RJXB 2GT7A 1AB9B 3RMMH 1P03A 1XUFA 2GCTB 4YOIA 1OP2A 2ANMH 1O3KA 1GVKB 3KGPA 1QB9A 1XVOA 1LHDH 1KLJH 4IGDA 1GHZA 4UFDH 3MO6A 1SLWB 1MAYA 1ZTLA 3ATKA 4GPGA 1HAPH 2GMTC 2Z7FE 5A0AE 4K60A 1MCTA 4ESTE 1SOTA 2ZDVH 1BRUP 1O3EA 2V6NA 1KDQA 2BY7X 4I8JA 2XW9A 1THRH 3ZVGA 1CA0B 3CENA 1GCDA 2B0FA 1JBUH 1V2MT 1DY9A 2ZA5A 2H9TH 1XUHA 2ZPQA 3UOUA 2PSYA 1P2MA 2F9UA 3RXDA 5HM9A 1TA6A 1VR1H 1ZGVA 1C2LA 1EAWA 4X8SH 5A09A 4D8NA 1ESTA 4O3TA 3ATLA 5JDUB 2SGAA 5DP5A 4D76A 3QZQA 5LPFA 3A8CA 1ANDA 4BAQB 1T4UH 1Y5AT 1FIWA 2VGCB 1HAOH 1C5RA 2UUJB 2P8OC 3SZNA 1UTMA 2GGVB 1NRRH 1P05A 1DICA 1IQLA 2PGBB 1C5SA 4I8LA 2H6MA 1CHGA 1K9OE 3BV9B 1QQUA 1EASA 1HGTH 1GBTA 2C8YB 2GCTC 2P95A 3RXMA 1GDQA 2Y6TA 2SGDE 3T26A 4B75A 1DY8A 4FVDA 1GI5A 1GBEA 7GCHG 3M35A 1LHGH 2AGIX 4LZ1H 1JIMA 2OQUA 1DDJA 1PFXC 3Q3XA 1F2SE 1BZXE 3BG4B 3QGNB 5HMAA 1GMHG 4DIHH 1FQ3A 1G32B 4CRGA 4E06H 1CU1A 1TWXB 4QT8C 5SGAE 2A7JA 1S0RA 1CT4E 2AS9A 2VIPA 3ZV9A 2GCHF 4JK6A 4AZ2B 2P3UB 1ZTKA 1VCPA 4KELA 4OGYA 1SPJA 1EX3A 2ZTXA 3K65B 3ZV8A 1Z8JB 2GZ7A 4O03A 3RP2A 4ABHA 3GDVA 1GL1A 5FX5A 1IHTH 1LHCH 2TRMA 2BDCA 1MD7A 1GMCG 3RMOH 2VVUA 1MZDA 1O2WA 3A8AA 1FAXA 5FHTA 2AGEX 3D49H 2JH0D 1NU9A 4JYTA 2GDDA 4CREA 3U8OH 2ZGJA 1C9PA 4I32A 2VGCC 1UTNA 2PWXA 1UTKA 3LGVA 1C5QA 1A46H 4YT6H 3RXBA 3SV8A 4AYYB 4AB8A 1TB6H 2GD4B 1FY4A 3MU5A 1SFIA 1UO6A 2BD2A 4ABDA 3C27B 3V13A 2A5IA 4I8GA 5EW1H 3P6ZB 3KEEA 3KHVA 3A8DA 5L6NH 3GCHC 3M5OA 1EZUC 3M7TA 4ZKNU 3RU4D 5FPYA 2F9PA 5JB9S 1S83A 2VWNA 4Y6DA 1QRXA 3PYHA 3SU1A 2Z9KA 4NSYA 2AGGX 4D7FA 1C1WH 1O2HA 1F7ZA 1AHTH 4I33A 1UTQA 3TNSA 2BDHA 3U8TH 1QNJA 1W0ZU 3MNSA 2XBWA 3PLBA 3S9AA 1VCQA 4X8TH 1NRSH 1JRSA 4UD9H 4MLFB 1O2QA 4X6PA 4WMFA 4ABJA 3RXRA 1EOJA 3F6UH 1ORFA 2BD7A 3O8DA 1TPOA 4YTAA 1KDQB 2THFB 3KF2A 1TX8A 2BLQA 2TIOA 4GHQA 3VFEA 4CR5A 2VIOA 5L2ZH 4FUGA 2YNBA 1BMMH 2PV9B 1TFXA 2LPRA 4H42U 4JYVH 3UY9A 3SOSA 1SQOA 5JPMH 2FYQA 1ANBA 1QL9A 6ESTA 1YYY1 2LNCA 3RC5A 3MFJA 2VIVA 4BAKB 3ZVAA 2R2MB 3Q3YA 1F5RA 1S0QA 2VNTA 1O35A 2FTMA 1KXDA 4FXGH 1GJCB 4Y8YA 4NIYA 3RXCA 1ANCA 1V2WT 1QGFA 5EOKA 4AX9H 1BTZA 3FFGA 3SU2A 4MNVA 5E0JA 2D8WA 3QGJA 2FX6A 5C5OA 1HJAC 1OYTH 2GKVE 2VVCA 3CS7A 3ZZ3A 2ZCKP 4CHAB 2YOLA 1E34B 1GVZA 1D9IA 4AYVB 3MOCA 1GHBF 1O2UA 2XWBI 2QY0B 1PYTC 1N6XA 2A5KA 2P94A 5BPEA 1FY5A 1UCYE 4RN6A 1O3GA 1P10A 1KXCA 2FI4E 2R3UA 1A3BH 2ZPSA 4F4OC 4YT7H 3LH3A 3MNCA 2BQ7B 3M3VA 3D23A 5K0HA 3RC4A 2Z94A 1C1VH 1GJDB 3OTJE 1WTGH 4U30A 1AKSB 2BX3A 5ETXA 5GPIB 1O33A 2BZ6H 4DURA 3RMLH 6GCHG 5JB8S 5FPTA 3ZZ6A 3E16B 2G4UA 2D1JA 1GMHF 3EQ0H 4ISLA 1SGTA 4B71A 1ZRBA 2D26C 4Z6AH 2Q6DA 3E1XB 1YLDA 1EP6A 3M7QA 1DX5M 2W3IA 7GCHF 2TGAA 2HLCA 3M36A 3MU1A 2ZHFH 2C8WB 1ZGIA 5EQSA 1NS3A 1GWAA 2KAIB 1SGFA 5DK1A 4IS5A 4DIIH 4YESB 2GX4A 1UVOA 2B5TB 1FMGA 4JZEH 3M61U 1QB1A 5GCHF 1O2TA 1QRZA 4X2VA 4CH8B 2TBSA 2OINA 1YPKH 1YCPH 2ZQ1A 3SUGA 3OY6U 2WYJA 3TJNA 1DLKB 3S69A 3GYMA 3RXUA 3MMGA 3SU6A 4KTUA 1BCUH 1OS8A 3GOVB 4ABFA 4NIWA 1TONA 3VPKA 1ABJH 3S7HB 2OCVB 2ZFQH 1P09A 3LDXH 3EYDA 1AFQC 4ABBA 3TK9A 2DE8A 1BTXA 1HNEE 4XOJA 1LCYA 1SGCA 1V2RT 1K1PA 4A92A 2ODYB 2B8OH 1J15A 4KP0A 1EB1H 1YPGH 1LTOA 5EXLA 3T5FH 5HGGA 1HAYB 3LU9B 3ODDA 2R2WU 4Y71A 1O30A 3T2NA 4JZ1A 1W2KH 1INCA 2BB4A 3Q3KA 1DE7H 1TBQH 1MAXA 5GDSH 3PWCA 2BLOA 1O3IA 2ZCLP 3PMBB 4WY3A 3ZZ4A 1AGJA 1UVSH 1BRAA 3B8JA 1FV9A 2EC9H 1ZJDA 3LJJA 3UFAA 2ESTE 2ZDNA 4UEHH 2ZO3H 1LMWB 1A0HB 1C5UA 1WV7H 1B7XB 1RIWB 2ZEBA 4YOGA 1P2NA 5EPYA 2A0QB 4XE4A 4K2YA 3RXAA 1ETRH 3P70B 2VB0A 2A31A 1BRBE 3P95A 1AE8H 1TBZH 1PPCE 1GG6C 1VITF 1P8VC 2FOBA 2GT8A 2I6QA 2A4RA 1THSH 1G9IE 1O3BA 1A7SA 4NWKA 1GHAF 4RSPA 2ZFPH 1S82A 1A5IA 1SI5H 1S5SA 3A7ZA 4Q7XA 3UREA 3MH4A 5EU8A 8LPRA 3PWBA 1A0LA 4ABAA 4X8UH 2Q6GA 2FI3E 1O2IA 3LC3A 1LQDB 1UCYK 1J16A 2J94A 4CRAA 1OX1A 3RLWH 2A4GA 1IQFA 2VIQA 1O3NA 1DT2A 2UWOA 2FPZA 1BIOA 1CO7E 4WXVA 1H8IH 1NT1A 1ACBE 1QBVH 1J14A 2ZIQH 2YNAA 2ZDLA 1FY3A 3BN9A 2QC2A 4LZ4B 1SQAA 4NZQA 2I6SA 1SHHB 2Z9IA 1OPHB 4JMYA 1UK2A 4D9QA 2IN2A 3MHWU 1C5YB 1NM6A 1GBAA 3MO3A 3SNDA 1C2FA 3LGIA 5ESTE 1YPMH 5HYOA 1FNIA 5A8XA 3VXEH 4WXIA 1Q3XA 4B76A 1TOCB 2V35A 1HCGA 1N1LA 2F9OA 1RTFB 2XC5A 3CP7A 1O3PB 2BDIA 2BD9A 2ZP0H 3SHAH 1TMBH 3EA8A 3L6PA 1ZJKA 2Y7XA 3URDA 2CF8H 5C1XA 3RMNH 2FTLE 4X1NU 1EZQA 4KKDA 1F0UA 4ZKSU 3HGNA 3A85A 1C5XB 1EPTB 3QX5H 2CV3A 1WYKA 1NFYA 1FN8A 1V2TT 1ELAA 3SUDA 2NWNA 4ZKOU 2PUQH 1B0EA 1GBBA 1C2HA 2ZDKA 1DFPA 3SJ9A 3U98H 2FYRA 1BMLA 2IPHA 3SU0A 1VGCC 1O32A 1EUFA 4H6TA 3TNTA 1ID5H 3TU7H 1EAIA 1GI4A 1V2OT 3TH3H 1HAGE 5T6FA 3SO3A 1KTTB 3S9BA 2OP9A 2Z3CA 3RU4E 4BAHB 1O2NA 1BBRK 3W95A 3VEQB 3SNCA 3ZZ8A 2UWPA 4A6LA 4X0WU 4CRFA 1VJ9U 4CRBA 2ASUB 1GJBB 2WPHS 1LVYA 2NU0E 1QCPA 1SGYE 1EOLA 4MPXA 1T8OA 2BLWA 1QL8A 4K1EA 1HJ8A 1VITH 2AH4X 1QRWA 1KYNA 1C1OA 3KL6A 3RXJA 1DWDH 3TH2H 3BEFB 3SORA 5FBIA 3RU4T 1DUAA 2ZNKH 3FAOA 3HPTB 1ARBA 3F9FA 3QN7A 1MKXH 1O2XA 1DXWA 2W5EA 9LPRA 2VIDA 3ITIA 4LOYH 2XBXA 1DITH 1TPPA 1JRTA 2ZU3A 2FOHA 2C8ZB 1GJ6A 3RXVA 1MBQA 4FUFA 4DY7B 3N7OA 3ZVCA 2ZQ2A 3E0NB 4WH6A 1C2KA 2Z9GA 3V7TA 2FLRH 1P11E 1UVPA 3SU5A 2O9QA 1L4DA 1P3CA 1P2QA 1C5MD 2HVXA 2H2ZA 3TK6A 1P06A 3BEUA 3ZYEA 2O8TA 4AB9A 4ABGA 2Y5FA 3LC5A 5T6GA 1LPKB 1G37A 3EE0B 2J34A 3QO6A 3U69H 4AFZA 3SUFA 1P9UA 3MTYA 1SG8B 4OS5A 1C1NA 1MU6B 2ZZUH 4DW2U 3MNXA 3STIA 3BTGE 3EGKH 1VCWA 3D62A 4UDWH 3V0XA 5I25A 1C2MA 2UWLA 1DOJA 2GVFA 2JETB 1OYQA 2A45B 1O2MA 1E35B 4OS1A 1WOFA 1UHBA 3OSYA 3UR9A 1H9LB 1O3JA 1GBJA 4IMZA 1O2SA 1TALA 3ZZDA 2QXHA 1S6HA 1PPBH 3E0PB 3UUZA 1GI2A 1A5GH 1C1MA 1IOEA 3HKJB 3SV6A 2QV1A 4I8KA 4GAWA 1W7GH 2ALVA 3BIVH 5J4SA 2P3FH 2GZ9A 2W26A 3K9XB 2ZFSA 2F9NA 3QDZB 2FEQH 1T32A 1O5EH 2BDAA 3A7TA 1GJ9B 2PTCE 4J2YB 4IN1A 1O5CB 3GDUA 2A2QH 3VB6A 1DWEH 3KQCA 1CGJE 4MTBA 3MU0A 1O2KA 3TPIZ 4Y11E 2JH6D 3K6ZA 1LKBA 2OD3B 3UIRA 2JH5D 2ZTYA 4MNWA 1KY9A 1ELDE 1T8MA 2BDYA 4PROA 3MH6A 1PPFE 2NU2E 1HAHH 1O3FA 2J9NA 3A81A 1Y3VA 2BY5X 2G8TA 1T8LA 3S0NA 1G2MA 3PB1E 4GCHG 1PPGE 4A1VA 5H4IB 2H5CA 1GMCF 1AU8A 1Y3XA 1QB6A 2Z3DA 1QA0A 3SBKA 3MI4A 2ZGBH 1MTWA 2ZCHP 2O8LA 5F03A 3QTVH 1TGCA 4XDEA 4BAMB 3P8NA 2XTTB 3SNEA 3PMHB 2CXVA 1HYLA 3TH4H 1GI6A 1KXFA 1UTPA 3BTHE 3U8RH 4BTUB 4K1SA 3DT0H 1MKWH 6CHAC 2DUCA 2ILNA 3RXTA 3UNRA 9ESTA 3DD2H 2K1QA 2QF0A 5FX6A 2ZU5A 1UCYH 1TPAE 1PQ5A 2HOBA 3E90B 2G5NA 1QBOA 5E0HA 5B6OA 2ZGXH 2BXTH 3M3SA 3HGPA 3GY5A 4MVNA 1XM1A 1O5DH 1C2EA 2A4OA 3GCNA 1Y3UA 2RG3A 1GHAG 2BD8A 3ZZBA 1JWTA 1AWFH 5T3HA 1BDAA 3GCTG 3NK8A 1XUJA 2OC8A 1G2LA 1TA2A 1C5OH 3T25A 4XBDA 3WY8A 2P8OB 4BANB 4UONA 2ZGHA 3JZ2B 3M5LA 3AAUA 1PYTD 4I31A 3RLYH 4XFQA 3P8FA 2P93A 3KNXA 4Q2KA 3BIUH 1W3CA 2G51A 3GCTF 3MO9A 3AASA 3AVZA 4FUCA 1RD3B 2A1DB 1C2JA 2J95A 4BXWA 2P16A 1PQ8A 2PKSB 1L0ZA 1BBRH 3RXIA 1SQTA 2XBYA 1O5AB 2BOKA 1HAZB 1MTVA 1K21H 1QJ1B 5CHAB 5F8XA 4MPVA 1Y3WA 1GDUA 1P2KA 1FAKH 3RXEA 1B0FA 3ZZAA 1HXFH 1UVTH 4BNRA 1Z71A 1GGDC 3A7WA 1AFQB 1W8BH 5JBAS 1D6WA 1V2ST 2ZDAH 1E38B 1VJAU 1P01A 1UTJA 1TABE 1TQ7B 1C2IA 4DVAU 1CA0C 1E0FD 4UFEH 1BT7A 4R8TB 3SI4H 1CT2E 4YZUA 4GUXA 1HRTH 2OC1A 1BTUA 1Z8GA 5L2YH 4XSKU 1SC8U 1CT0E 4KGAA 2V3OH 1FLEE 2UUKB 1ZMNA 2FDAA 1GMDF 2XWAA 2CHAC 2NU3E 4ZROA 4E7RG 3GYLB 1SR5C 2ODQA 1TNKA 2DE9A 1MUEB 5IDKA 4O3UA 1SGIB 2F83A 3EAJA 2PKAA 1IAUA 1IHSH 2PFEA 4IN2A 1AB9C 2IOTA 1TGNA 1V2PT 3LOXA 3IG6B 4AGJA 3GDSA 3ZVEA 4OGXA 1V2UT 2J4IA 2H9HA 4WJG2 3TJOA 1MBMA 2SFAA 4CBNA 1AVWA 4MNYA 2STBE 4FUBA 2QCYA 1THPB 3TJVA 2H1UA 2ZPRA 5ABWA 1SSXA 1SLUB 1DWBH 2M5TA 2ZTZA 3BG4C 4X1SU 5GIBA 3SU4A 2Q1JA 4IC5A 3UNQA 3ZZ5A 8GCHF 1NY22 4AORA 1L1GA 1NROH 3ZZCA 3M5NA 1GI1A 1BHXB 1O36A 1O39A 3T62A 1W0YH 1AI8H 1BITA 1AN1E 2BM2A 2BVSH 1AVXA 3RXSA 5A8ZA 3NWUA 3FZZA 3SJKA 2O8UA 3A89A 4NA7A 3ATMA 1A2CH 3OY5U 1C2DA 4OS4A 1ZHPA 2OBOA 4GSOA 3ZYDA 1W11U 1SLXB 1WBGB 1FN6A 1XXFA 1N8OC 2J92A 4WMEA 2OQ5A 3K2UA 3P17H 1MH0A 5E0GA 5E2PA 3TK5A 1P57B 3O8RA 1TRMA 4A5TS 2AMDA 2FX4A 3ATWA 1QA7A 2ZKSA 1QR3E 1NPMA 1GHXH 2BXUH 4NIVA 3ELAH 1ELTA 1LKAA 2PHBA 1CGHA 3A7YA 4KTSA 1MZAA 1EPTA 4FUIA 2FLBH 1SHYA 3T28A 3P8OA 3M7UA 1SBWA 1ZMLA 1C4U2 1T7CA 1SVPA 1P2IA 2R0KA 1MKWK 1KXAA 4MNXA 2FI5E 1CVWH 5A8YA 3SV2H 1M9UA 1Z7KA 2OC0A 4YM9A 5TCAA 2VVVA 3AW1A 3VXFH 2ZU1A 3KQDA 4MPUA 2PUXB 2ANKH 1MMJN 1A4WH 4D9RA 5DP7A 5EXNA 1KXEA 1OWJA 1NZQH 4TWWA 1IQNA 1TNIA 5FCKA 5AHGH 1AVGH 4ZMAH 5DGJA 1LDTT 2HPPH 1DVAH 2FZZA 4K8YA 3VB7A
chains in the Genus database with same CATH superfamily
4AG2A 1S6LA 1O38A 4WVPE 1NTPA 2HGTH 4UFGH 1MKXK 3A86A 3VB4A 1SGRE 4J1YA 1LHFH 2ZFRH 1WCZA 4B2AA 5A2MH 1C9TA 1UHBB 4X2YA 1H9IE 2QIQA 1C1UH 2XRCA 2PKAB 2AHME 2VWLA 1ARCA 2VJ1A 4K69A 1OSSA 1QJ6B 2XXLA 1A3EH 2V3MA 4SGAE 1T8NA 1OOKB 4F55A 1XKBC 1OWDA 1K28D 4ZHAA 2PGQB 3SI3H 4CRDA 2D2DA 1YP9A 3LKWA 5TCCA 5TJXA 3UOPA 4ZHMU 3ZZ9A 3NCLA 3LGWA 2F43B 2QA9E 4HGCA 2VWOA 1Z1IA 2AFQB 1C2GA 1K1MA 1DUEA 1YPJH 7KMEH 2TGTA 1GI0A 2O8WA 4RT0A 4CHAC 1DXPA 1YLCA 4TY6A 1ESAA 2FODA 2ULLA 4NWLA 1CHOF 2A5AA 1DANH 4FUHA 3IWMA 1K2I1 1BMAA 2J2UA 4IMQA 1FPHH 3OTPA 2G5VA 1C5WB 1K1OA 4VGCB 5C67A 1O3LA 2VINA 4NG9H 4U01A 1QJ7B 1F5KU 2J38A 1KLTA 5DN6D 1G3CA 2C90B 1DPOA 1FI8A 1ZYOA 3GY4A 1OWIA 1FY8E 3RXLA 4RKOB 1DM4B 2WPIS 3MNBA 2SNWA 1N6YA 2V3HH 4ABEA 1L2EA 4Q7ZA 3O8BA 3ZVDA 3NZIA 5AVDA 5HM2A 2HNTF 4B74A 5CE1A 1IQEA 2FM2A 1TMTH 3UTUH 1V6DA 2G4TA 3H7TA 1SGNE 4FUDA 2BVRH 6CHAB 3SJ8A 2F3CE 3GCOA 3HATH 2NU4E 2G81E 4Q80A 2SGPE 3SJOA 2SNVA 2ZU4A 1RXPA 1J17T 1GBFA 4OS6A 1GBHA 2F9VA 3DSPA 1IQHA 5LH8A 1WSSH 1PJPA 1TNJA 2P3TB 2OXSA 4ISNA 3SUEA 1TIOA 1HUTH 1D3DB 2VU8E 2FO9A 1OWEA 1QQ4A 3KYFA 2QN5T 8ESTE 1MABB 1KSNA 4ZAEA 1TLDA 1FDPA 2RCEA 3V12A 1SGPE 2TGDA 1GBLA 1NRQH 1RS0A 1UMAH 4MPWA 1TOMH 3GY6A 5C0UA 1F92A 2W7SA 1GI9B 1C5LH 4RKJB 1K22H 4AFQA 5DP9A 5F8TA 1BTYA 4ZHLU 4Y8XA 1TQ0B 5DP3A 3RXFA 2O8MA 2OBQA 3SU3A 1VZQH 3F9GA 2Y82A 3PMJA 1C4Y2 2Z3EA 4HI3A 3Q00A 1S84A 4DT4A 4O9VA 1V2JT 3A82A 1W7XH 2A32A 1SB1H 1PPHE 3DFLA 4Y10E 2WV4A 7ESTE 1HXEH 1OXGA 5EJ1A 3S9CA 3SGQE 1GI3A 1EJAA 1W12U 2BVXH 1D6RA 2GMTB 1Z6JH 1ETTH 1NFUA 2RDLA 2BD3A 4JZFH 1KXBA 1IQMA 2Y7ZA 1ABIH 1H8DH 1YBWA 1HAIH 3P92A 1A1RA 4BTTB 3NPSA 5A0BA 2FESH 2SGQE 3C1KA 2ZHEH 1SGDE 1ESBA 1X7AC 4FVBA 2SGEE 3F68H 3SN8A 2FS9A 1TGBA 3U9AH 4Y0YE 1C1PA 3AK5A 4BXSA 3D65E 1HV7A 3EDXB 5DPAA 3BG8A 1ZHRA 1P04A 1WAYB 2WV5A 1G36A 3SGAE 3KCGH 1AO5A 1Z8RA 2TGPZ 4FUJA 2H5DA 1QY6A 4Z1MD 4Y7AA 5GCHG 3RDZA 4P02A 3KN2A 4O97A 3QK1A 2OTVA 2L74A 3N7EA 5KECA 2L6OA 1MTNC 2KZ4A 3R0FA 1YCPM 3VGCB 4YLUA 4DOQA 4TPIZ 1F0TA 4UE7H 2QYIA 5EXMA 4K3JA 1HAVB 2ZHWH 2BLVA 1F5LA 2BDBA 4GCHF 4JZDH 3SZEA 2XC4A 3W94A 3FVFB 1H9HE 1O2JA 1XUIA 7LPRA 1O3MA 2HWLB 5K7RA 1JXPA 2Z6BD 1GBMA 3PLPA 1GCTB 1V2QT 3SV7A 4YOJA 2BDGA 5A0CA 2PLXA 3OEED 1ANEA 1CE5A 1DSTA 3LH1A 3GY7A 1ELFA 3N99A 1OWKA 1BUIA 4TYDA 1AE5A 1BBRE 3QZRA 5DG6A 1XUGA 1TX6A 5CHAC 3QLPH 5FAHA 2B7DH 3PM3A 3U1JB 3F9HA 1SLVB 4FUEA 2QAAA 3V3MA 3KQBA 2RA0A 4Q7YA 1RRKA 1Z6EA 2TPIZ 1H8ED 5C3NA 2ZFFH 4NA9H 4H4FA 3LONA 4F49A 3STJA 1ZSKA 5JBTA 2XCNA 1EP5A 3B9FH 3T29A 2BTCE 1Y3YA 1GDNA 3OEHD 3UQVA 4RI0A 3N7DA 1V3XA 3PRDA 1UVUH 4GLYA 4DCDA 3A88A 1ELGA 1Q2WA 1P9SA 3SQEE 5BRRE 5DP4A 1H1BA 2BOHB 1QL7A 1IQIA 4ZXXH 1TBRH 2HRVA 1MTNB 3UWJH 1FPCH 4OS2A 4HFPB 4XD7D 3AW0A 2F9BH 1GJ7B 1TAWA 1HPGA 2GV7A 4JZIA 3RM2H 1WUNH 2W7UA 1QHRB 4WH8A 3TGIE 4E05H 4U32A 1W10U 3MWIU 2ZDMA 5J4QA 1ZR0A 5JBBS 5C0TA 1C5TA 1BA8B 5F8ZA 1K1NA 2WUCA 1J8AA 3K6YA 4ISHH 4DG4A 3DA9B 2FXRA 3MH5A 4HZHA 5GWZA 3O8CA 2W6ID 1NN6A 5EPNA 2CN0H 4TT3D 4BTIB 1C5ZB 1GJAB 5LPEA 1GHYH 4Y76A 2PSXA 3UWIA 2Y5GA 3G01A 3PV4A 3L3TA 1ETSH 2ZF0H 4HTCH 3FP8E 2WYGA 1J9CH 3QWCH 2FOFA 4X6NA 6LPRA 4IBLH 2AMPA 2BYAX 1YCPK 2CMYA 3BTTE 1Z1JA 3RXGA 2ZGCA 1RGQA 5JYIA 2RA3A 1O5FH 3UR6A 4A7IB 1L1JA 5DO4H 1CGIE 1UTLM 3F2GA 3E91A 4YO9A 1F0RA 4TPYA 1P3EA 1ELCA 2CF9H 2FOCA 3M37A 3VG8A 1PPEE 1WTHD 4E7NA 1BMNH 3ZVFA 2PTNA 4CR9A 3GS9A 1GHVH 2XBVA 5EW2H 1QFKH 3DHKH 3I77A 2H9EH 1TNHA 4NIXA 2R9PA 2QF3A 3TLOA 4X2WA 2AEIH 1FUJA 4SGBE 1LVBA 1NRPH 1ZSLA 3FKSD 1HB0B 2AIPA 2UUFB 3FP7E 1E37B 3BTME 4LXBH 3TJUA 1C1SA 1BHXF 2ZWLH 4F48B 5DP8A 1MD8A 1GVLA 3BTWE 5L30H 3JZ1B 1DSUA 5IK2D 1IQKA 4NCYA 2ZC9H 1JIRA 4K1TA 1G3EA 1GI8B 1A61H 2F91A 2BQ6B 5EQRA 1C1RA 3BTDE 3E6PH 2JETC 4B1TA 2A4QA 3A80A 1Y59T 1HIAB 1WU1A 1TGSZ 5C1YA 5AFZH 2FOAA 3R3GB 4CH2B 2YMSC 4JYUH 2CGAA 4TSFD 1MTUA 1F0SA 5JBCS 4B73A 1LPZB 4ISIH 3LIWA 2GCHG 5FBEA 3TIUA 3SNBA 2A2XH 5F6MA 3FOAA 5I46H 3P8GA 1O3DA 1V2VT 1ELVA 1H4WA 3FP6E 1AZ8A 1BJVA 1IQGA 3FANA 1AMHA 1AZZA 2BD4A 1ZPCA 1V2NT 1OP0A 3RXKA 2OLGA 2JKHA 1UK3A 2XC0A 1NFWA 1LO6A 1NRNH 3BTEE 3VGCC 4NGAH 1Y5BT 3SHCH 4U2WA 3DFJA 1E36B 1UJ1A 3I29A 4THNH 3RM0H 4D7GA 4YLQH 5FCRA 5LGOA 1UK4A 1Z8IB 4KTCA 3F2HA 1YGCH 4TWYA 1AQ7A 1C1QA 2Y5HA 2HNTE 1O2GH 2Z9JA 3PLKA 1D4PB 2NU1E 3CS0A 3URCA 1EB2A 1MU8B 3TGJE 1P02A 1ELEE 1UTOA 3MU8A 1HAVA 4R0IA 1HJ9A 3GY8A 4AFUA 1C5PA 2BX4A 3RC6A 1OP8A 1E1RD 2Y81A 1C4V2 1MTSA 3BSQA 2PKSC 3F1SB 1GG6B 1SFQB 3PTBA 4M9FA 3GY2A 1LPGB 2YMSB 1MQ5A 3ESTA 1ZLRA 1XUKA 2EA3A 1O34A 1P0SH 1YWUA 1D3PB 5PTPA 2WPLS 3S7KB 3F9EA 4Q63A 4DT7B 1O2RA 2FOGA 3LGYA 1GGDB 3E8LA 2BMGB 4B6FA 4BAOB 3IITA 4X6OA 1GBIA 2Q6FA 1NFXA 2C93B 1XKAC 4DGJA 5EG4A 1BJUA 1EAXA 2ALPA 2BHGA 2EI7A 3ZVBA 4XBBA 1FZZA 1TNLA 4K5ZA 1D3TB 2IJOB 1SGFG 3TITA 1WQSA 2ZFTA 3H5CB 1PQAA 1FONA 2BY9X 2SGFE 3BEIB 1L4ZA 1ZPBA 3SV9A 1CSOE 3BTQE 1CQQA 1YPHE 1K1LA 2HALA 2V0BA 2WPJS 3OX7U 2GTBA 3LJOA 5DP6A 2CHAB 1ZZZA 1O3AA 3RXOA 4X2XA 2WINI 1ZRKA 3KIDU 1SL3A 1NC6A 3SQHE 2BQWB 1MCVA 3H7OA 2ZHQH 3PMAB 4WWYA 1O2OA 1QBNA 2BY8X 1VITG 2KAIA 2EI6A 1XXDA 1QTFA 4INKA 3A83A 8KME2 1C5NH 1O31A 5EQQA 1Y8TA 3F0PA 1EZXC 1LVOA 2VIWA 2EEKA 2OC7A 1O3HA 1YPEH 4H6SB 2PW8H 1TRNA 1TE0A 1ZSJA 1OKXA 4Y0ZE 2GZ8A 3QTOH 4ZUHA 5EGMA 1G30B 3SGBE 1ZMJA 3Q76A 3UQOA 2A7CA 3MH7A 1O5BB 3T27A 2QGRA 1SGEE 3BTKE 4ZXYH 5C2ZA 5E2OA 4ASHA 1C5VA 1EAUA 1EATA 1EQ9A 1KIGH 2BD5A 1GCTC 1O37A 4MG3A 1AY6H 2WPKS 1GBDA 2WPMS 1GJ5H 3M3TA 3UB0A 5FPSA 1VKYA 2FOEA 4I7YH 3E3TA 1K1JA 1HIAA 2XCFA 3MU4A 2R0LA 1EJNA 1OWHA 4NZLA 1C1TA 1RFNA 4X1PU 3RXPA 1FIZA 3ATIA 4B2BA 3SJIA 1A0JA 1IQJA 1AWHB 3TVJB 2STAE 2QXJA 3MYWA 1EXFA 1EKBB 1N8OB 1E1QD 1GBCA 1HBTH 3L33A 3RUOA 1S85A 2ANYA 2P59A 1Y5UT 2VH0A 1RTKA 4K8BA 4ISOA 1T31A 3KYGA 1O2PA 4OS7A 2FOMB 2C8XB 3RXQA 1P2OA 5DKMA 2ZG0H 1HDTH 3GICB 5DJ7A 1EZSC 1B5GH 1HLTH 5ESBA 2WUBA 4BOHA 3OAAD 2ZI2H 1YC0A 1LHEH 1W14U 1SOZA 3SW2B 1YPLH 3GISB 1JMOH 1BOQA 2GP9B 1CHOG 1RTLA 2GDEH 1V2KT 3U1IB 4X6MA 2ZU2A 4MQAA 1KLIH 1T4VH 2AIQA 2C3SA 2QXGA 1BTWA 2QXIA 6GCHF 3Q77A 3SNAA 1S81A 5AFYH 4ZKRU 3LGTA 1O0DH 1ZOMA 1H8HD 2VH6A 2EI8A 3LPRA 3VB3A 3RXHA 4Y8ZA 3TGKE 1YM0A 4Z0KA 1QIXB 1ELBA 2XNIA 4GVUA 1NU7B 4AG1A 1DS2E 4VGCC 1G3DA 1TX7A 2FP7B 3LT3A 3PROA 3AAVA 1L1NA 1BRCE 4NSVA 1GJ8B 5FXLA 1TRYA 5HXFA 1FXYA 4MDSA 3NUMA 2OUAA 1XVMA 3NKKA 4X1RU 4LK4A 1GJ4H 1P12E 2QF5A 4FU7A 1NESE 1GI7B 4RT1A 3I78A 1XMNB 1P2JA 4DJZB 1ZPZA 3ODFA 3EA9A 1S6FA 1XX9A 4M7GA 5LPRA 1GHBG 4XBCA 2PR3A 1CA8B 2Z9LA 1EJMA 1GBKA 3HKIB 4JK5A 4INLA 1TMUH 2ODPA 3UPEA 1O3CA 5IYTA 2FMJA 1G3BA 1O2VA 4GHTA 4A1TA 2GV6A 2HPQH 1Q31A 1K0HA 1YF4A 4JCNA 1WQVH 3BF6H 2ANWA 3ZZ7A 1MQ6A 2B9LA 1U6QA 1TPSA 3A84A 4FU9A 5C20A 5T6DA 5EJLA 3GCHB 4AN7A 1RIWC 1O5GH 4AGKA 4X1QU 3A7VA 1D3QB 3OU0A 3DUXH 3FN8A 4AFSA 5C5NA 4CRCA 1GL0E 3LGUA 1LQEA 1BQYA 3EA7A 4I8HA 3ENSB 4AOQA 4P00A 3KQEA 2FS8A 1PQ7A 1GPZA 1TYNA 3A8BA 4IC6A 1HJAB 3A87A 3VB5A 4B2CA 4CBOA 1V2LT 4NFFA 1VGCB 2YMSD 4Y7BA 1HAXB 2C4FH 1O3OA 5F53A 4B6EA 3BTFE 2BY6X 1DLEA 1YKTA 3GY3A 1BTHH 1QURH 2R3YA 1YPHC 4IW4E 2VWMA 5GXPA 5EODA 2ZECA 3UNSA 3HK3B 2FIRH 1AKSA 2XYAA 1A5HA 1CBWB 1TGTA 5AF9H 1FJSA 4NFEA 2G55A 8GCHG 3NXPA 2KM0A 1CBWC 4NA8A 1AIXH 1FY1A 1K1IA 2K0QA 1DWCH 5CMXH 2CJIA 1AUJA 1O2YA 1SMFE 1TNGA 2ZHDA 3CNRA 3OYPA 4ZH8A 2Y80A 1O2ZA 2AERH 1BB0B 1NO9H 1ZHMA 3B23B 2AMQA 2G52A 1KTSB 2HNTC 3PO1B 1W13U 4INHA 4FU8A 3FZDA 2G00A 1HFDA 4WMDA 3M5MA 4X8VH 1AD8H 1JOUB 3PO1C 5GJ4B 1LVMA 5E8EH 4A1XA 1EPTC 1PPZA 4TY7A 3A7XA 3HK6B 3OE7D 1O2LA 3QUMP 2AYWA 2CK3D 2UUYA 1AFEH 1ZTJA 3WW7A 1GMDG 2FWWA 4WF8A 4Y79A 1AUTC 1GHWH 4UFFH 5C1UA 5GNDA 2W3KA 4OM9A 2A7HA 3PTNA 2BZAA 1SGQE 1UW7A 4ABIA 5G4BA 1BTPA 1RJXB 2GT7A 1AB9B 3RMMH 1P03A 1XUFA 2GCTB 4YOIA 1OP2A 2ANMH 1O3KA 1GVKB 3KGPA 1QB9A 1XVOA 1LHDH 1KLJH 4IGDA 4AC9A 1GHZA 4UFDH 3MO6A 1SLWB 1MAYA 1ZTLA 3ATKA 4GPGA 1HAPH 2GMTC 1SKYE 2Z7FE 5A0AE 4K60A 1MCTA 4ESTE 1SOTA 2ZDVH 1BRUP 1O3EA 2V6NA 1KDQA 2BY7X 4I8JA 2XW9A 1THRH 3ZVGA 1CA0B 3CENA 1GCDA 2B0FA 1JBUH 1V2MT 1YY3A 1DY9A 2ZA5A 5EIYA 2H9TH 1XUHA 2ZPQA 3UOUA 2PSYA 3KQ5A 1P2MA 2F9UA 3RXDA 5HM9A 1TA6A 1VR1H 1ZGVA 1C2LA 1OHHD 1EAWA 4X8SH 5A09A 4D8NA 1ESTA 3DSOA 4O3TA 3ATLA 5JDUB 2SGAA 5DP5A 4D76A 3QZQA 2OK5A 5LPFA 3A8CA 1ANDA 4BAQB 1T4UH 1Y5AT 1FIWA 2VGCB 1HAOH 1C5RA 2UUJB 2WPDD 2P8OC 3SZNA 1UTMA 2GGVB 1NRRH 1P05A 1DICA 1IQLA 2PGBB 1C5SA 4I8LA 2H6MA 1CHGA 1K9OE 3BV9B 1QQUA 1EASA 1HGTH 1GBTA 2C8YB 2GCTC 2P95A 3RXMA 1GDQA 2Y6TA 2SGDE 1FX0B 3T26A 1DY8A 4B75A 4FVDA 1GI5A 1GBEA 7GCHG 3M35A 1LHGH 2AGIX 2JJ2D 4LZ1H 1JIMA 2OQUA 1DDJA 1PFXC 3Q3XA 1F2SE 1BZXE 3BG4B 2F4LA 3QGNB 2W6JD 5HMAA 1GMHG 4DIHH 1FQ3A 1G32B 2KX4A 4CRGA 4E06H 1CU1A 1TWXB 4QT8C 5SGAE 2A7JA 1S0RA 1NBMD 1CT4E 2AS9A 2VIPA 3ZV9A 2GCHF 4JK6A 4AZ2B 2P3UB 1ZTKA 1VCPA 4KELA 4OGYA 1SPJA 1EX3A 2ZTXA 3K65B 3ZV8A 1Z8JB 2GZ7A 4O03A 3RP2A 3F0OA 4ABHA 3F3BA 3GDVA 1GL1A 2KCAA 5FX5A 1IHTH 1LHCH 2TRMA 2BDCA 1MD7A 1GMCG 2EY4C 3RMOH 2VVUA 1MZDA 1O2WA 3A8AA 1FAXA 5FHTA 2AGEX 3D49H 2JH0D 1NU9A 4JYTA 2GDDA 4CREA 3U8OH 2ZGJA 1C9PA 4I32A 2VGCC 1UTNA 2PWXA 1UTKA 3LGVA 1C5QA 1A46H 4YT6H 3RXBA 3SV8A 4AYYB 4AB8A 1TB6H 2GD4B 1FY4A 3MU5A 1SFIA 1UO6A 2BD2A 4HG6A 4ABDA 3C27B 5FL7D 3V13A 2A5IA 3DCLA 4I8GA 3OFND 5EW1H 3P6ZB 3KEEA 3KHVA 3A8DA 2VBCA 5L6NH 3GCHC 3M5OA 1EZUC 3M7TA 4ZKNU 3RU4D 5FPYA 2F9PA 5JB9S 1S83A 2VWNA 4Y6DA 1QRXA 3PYHA 3SU1A 2Z9KA 4NSYA 2AGGX 4D7FA 1C1WH 1O2HA 1F7ZA 1AHTH 4I33A 1UTQA 3TNSA 3FO8D 2BDHA 1SQRA 2KR7A 3U8TH 1QNJA 1W0ZU 4XRNA 3MNSA 4ASUD 2XBWA 3PLBA 3S9AA 1VCQA 4X8TH 1NRSH 1JRSA 3H09A 4UD9H 4MLFB 1O2QA 4X6PA 4WMFA 4ABJA 3RXRA 1EOJA 3F6UH 1ORFA 2BD7A 3O8DA 1TPOA 4YTAA 1KDQB 2THFB 3KF2A 1TX8A 2BLQA 2TIOA 4GHQA 3VFEA 4CR5A 2VIOA 5L2ZH 4FUGA 2YNBA 1BMMH 2PV9B 1TFXA 2LPRA 4H42U 4JYVH 3UY9A 3SOSA 1SQOA 5JPMH 2FYQA 1ANBA 1QL9A 6ESTA 1YYY1 2LNCA 4ZCNA 3RC5A 3MFJA 2VIVA 4BAKB 3ZVAA 2R2MB 3Q3YA 1F5RA 1S0QA 2VNTA 1O35A 2FTMA 5C94A 1KXDA 4FXGH 1GJCB 4Y8YA 4NIYA 3RXCA 1ANCA 1V2WT 1QGFA 5EOKA 4AX9H 1BTZA 3FFGA 3SU2A 4MNVA 5E0JA 2D8WA 3QGJA 2FX6A 5C5OA 1HJAC 1OYTH 2GKVE 2VVCA 3CS7A 3ZZ3A 2ZCKP 4CHAB 2YOLA 1E34B 1GVZA 1KMHB 1D9IA 4AYVB 3MOCA 1GHBF 1O2UA 2XWBI 2QY0B 1PYTC 1N6XA 2A5KA 2P94A 5BPEA 1FY5A 1UCYE 4RN6A 2HLDD 1O3GA 1P10A 1KXCA 2FI4E 2R3UA 1A3BH 2ZPSA 4F4OC 4YT7H 3LH3A 3MNCA 2BQ7B 3M3VA 3D23A 5K0HA 3RC4A 2Z94A 1C1VH 1GJDB 3OTJE 1WTGH 4U30A 1AKSB 2BX3A 5ETXA 5GPIB 1O33A 2BZ6H 4DURA 3RMLH 6GCHG 2K8IA 5JB8S 5FPTA 3ZZ6A 3E16B 2G4UA 2D1JA 1GMHF 3EQ0H 4ISLA 1SGTA 4B71A 1ZRBA 2D26C 2EQNA 3W1EA 4Z6AH 2Q6DA 3E1XB 1YLDA 1EP6A 3M7QA 1DX5M 2W3IA 7GCHF 2TGAA 2HLCA 3M36A 3MU1A 2ZHFH 2C8WB 1ZGIA 5EQSA 1NS3A 1GWAA 2KAIB 1SGFA 5DK1A 4IS5A 4DIIH 4YESB 2GX4A 1UVOA 4Q4LA 2B5TB 1FMGA 4JZEH 3M61U 1QB1A 5GCHF 1O2TA 1QRZA 4X2VA 4CH8B 2TBSA 3SYJA 2OINA 4ACBA 1YPKH 1YCPH 2ZQ1A 3SUGA 3OY6U 2WYJA 3TJNA 2KCPA 1DLKB 3S69A 3GYMA 3RXUA 3MMGA 3SU6A 4KTUA 1BCUH 1OS8A 3GOVB 4ABFA 4NIWA 1TONA 3VPKA 1ABJH 3S7HB 2OCVB 2ZFQH 1P09A 3LDXH 3EYDA 1AFQC 4ABBA 1BMFD 3TK9A 2DE8A 1BTXA 1HNEE 4XOJA 1LCYA 1SGCA 1V2RT 1K1PA 4A92A 2ODYB 2B8OH 1J15A 4KP0A 1EB1H 1YPGH 1LTOA 5EXLA 3T5FH 5HGGA 1HAYB 3LU9B 3ODDA 2R2WU 4Y71A 1O30A 3T2NA 4JZ1A 1W2KH 1INCA 2BB4A 3Q3KA 5HKKD 1DE7H 1TBQH 1MAXA 5GDSH 4ACAA 3PWCA 2BLOA 4FOUC 1O3IA 2ZCLP 3PMBB 4WY3A 3ZZ4A 1AGJA 1UVSH 1BRAA 3B8JA 1FV9A 2EC9H 1ZJDA 4I86A 3LJJA 3UFAA 2ESTE 2ZDNA 4UEHH 2ZO3H 1LMWB 1A0HB 1C5UA 1WV7H 1B7XB 1RIWB 2ZEBA 4YOGA 1P2NA 5EPYA 2A0QB 4XE4A 4K2YA 3RXAA 1ETRH 3P70B 2V7QD 2VB0A 2A31A 1BRBE 3P95A 1AE8H 1TBZH 1PPCE 1GG6C 1VITF 1P8VC 2FOBA 2GT8A 2I6QA 2A4RA 1THSH 1G9IE 1O3BA 1A7SA 4NWKA 1GHAF 4RSPA 2ZFPH 1S82A 5T1VA 3PRBA 1A5IA 1SI5H 1S5SA 3A7ZA 4Q7XA 2J5UA 3UREA 3MH4A 5EU8A 8LPRA 3PWBA 1A0LA 4ABAA 4X8UH 2Q6GA 2FI3E 1O2IA 3LC3A 1LQDB 1UCYK 1J16A 2J94A 4CRAA 1OX1A 3RLWH 2A4GA 1IQFA 1O3NA 2VIQA 1DT2A 2UWOA 2FPZA 1BIOA 1CO7E 4WXVA 1H8IH 1NT1A 1ACBE 1QBVH 1J14A 2ZIQH 2YNAA 2ZDLA 1FY3A 3BN9A 2QC2A 4LZ4B 1SQAA 4NZQA 2I6SA 1NBME 1SHHB 2Z9IA 1OPHB 4JMYA 1UK2A 4D9QA 2IN2A 3MHWU 1C5YB 1NM6A 5KEDA 1GBAA 3MO3A 3SNDA 1C2FA 3LGIA 5ESTE 1YPMH 5HYOA 4YXWD 1FNIA 5A8XA 3VXEH 4WXIA 1Q3XA 4B76A 1TOCB 2V35A 1HCGA 3MQKC 1N1LA 2F9OA 1RTFB 2XC5A 3CP7A 1O3PB 2BDIA 2BD9A 2ZP0H 3SHAH 1TMBH 3EA8A 1COWD 3L6PA 1ZJKA 2Y7XA 3URDA 2CF8H 5C1XA 3RMNH 2FTLE 4X1NU 1EZQA 4KKDA 1F0UA 4ZKSU 3HGNA 3A85A 1C5XB 1EPTB 5KGOA 3QX5H 2CV3A 1WYKA 1NFYA 1FN8A 1V2TT 1ELAA 3SUDA 2NWNA 4ZKOU 2PUQH 1B0EA 1GBBA 1C2HA 2ZDKA 1DFPA 3SJ9A 3U98H 2FYRA 1BMLA 1WXRA 2IPHA 3SU0A 1VGCC 1O32A 1EUFA 4H6TA 3TNTA 1ID5H 3TU7H 1EAIA 1GI4A 5HIYA 1V2OT 3TH3H 1HAGE 5T6FA 3SO3A 1KTTB 3S9BA 2OP9A 2Z3CA 3RU4E 2WZQA 4BAHB 1O2NA 1BBRK 3W95A 3VEQB 3SNCA 3ZZ8A 2UWPA 4A6LA 4X0WU 4CRFA 1VJ9U 2GJGA 4CRBA 2ASUB 1GJBB 2WPHS 1LVYA 2NU0E 1QCPA 1SGYE 5C17A 1EOLA 4MPXA 1T8OA 2BLWA 1QL8A 4K1EA 1HJ8A 1VITH 2AH4X 1QRWA 1KYNA 1C1OA 3KL6A 3RXJA 1DWDH 3TH2H 3BEFB 3SORA 5FBIA 3RU4T 1DUAA 2ZNKH 3FAOA 3HPTB 1ARBA 3F9FA 3QN7A 1MKXH 1O2XA 1DXWA 2W5EA 9LPRA 2VIDA 3ITIA 4LOYH 2XBXA 1DITH 1TPPA 1JRTA 2ZU3A 2FOHA 2C8ZB 1GJ6A 3RXVA 1WDIA 1MBQA 4FUFA 4DY7B 2J98A 3N7OA 3ZVCA 2ZQ2A 3E0NB 4WH6A 1C2KA 1W0JD 2Z9GA 3V7TA 2FLRH 1P11E 1UVPA 3SU5A 2O9QA 2KCYA 1L4DA 1P3CA 1P2QA 1C5MD 2HVXA 2H2ZA 3TK6A 1P06A 3BEUA 3ZYEA 2O8TA 4AB9A 4ABGA 2Y5FA 3LC5A 5T6GA 2IPQX 1LPKB 1G37A 3EE0B 2J34A 3QO6A 3U69H 4AFZA 3SUFA 1P9UA 3MTYA 1SG8B 4OS5A 1C1NA 1MU6B 1W0KD 2ZZUH 2HVYB 4DW2U 3MNXA 3STIA 3BTGE 3EGKH 1VCWA 3D62A 4UDWH 3V0XA 5I25A 5CHBA 1C2MA 2UWLA 1DOJA 2GVFA 2JETB 5EJZA 1OYQA 2A45B 1O2MA 2LELA 1E35B 4OS1A 1WOFA 1UHBA 3OSYA 3UR9A 1H9LB 1O3JA 1GBJA 4IMZA 1O2SA 1TALA 3ZZDA 2QXHA 1S6HA 1PPBH 3E0PB 3UUZA 1GI2A 1A5GH 1C1MA 1IOEA 3HKJB 3SV6A 2QV1A 4I8KA 4GAWA 1W7GH 5HIZA 2ALVA 3BIVH 5J4SA 2P3FH 2LP6A 2GZ9A 2W26A 3K9XB 2ZFSA 2F9NA 3QDZB 2FEQH 1T32A 1O5EH 2BDAA 3A7TA 1GJ9B 2PTCE 2J98B 4J2YB 4IN1A 1O5CB 3GDUA 2A2QH 3VB6A 1DWEH 3KQCA 1CGJE 4MTBA 3MU0A 1O2KA 3TPIZ 4Y11E 2WSSD 2JH6D 3K6ZA 1LKBA 2OD3B 2JIZD 3UIRA 2JH5D 2ZTYA 4MNWA 1KY9A 3ZIAD 1ELDE 1T8MA 2BDYA 4PROA 3MH6A 1PPFE 2NU2E 1HAHH 1O3FA 2J9NA 3A81A 1Y3VA 2BY5X 2G8TA 1T8LA 3S0NA 1G2MA 3PB1E 4GCHG 1PPGE 4A1VA 5H4IB 2H5CA 1GMCF 1AU8A 2KFWA 1Y3XA 1QB6A 2Z3DA 1QA0A 1YLNA 3SBKA 3MI4A 2ZGBH 1MTWA 2ZCHP 2O8LA 5F03A 3QTVH 1TGCA 4XDEA 4BAMB 3P8NA 2XTTB 3SNEA 3PMHB 2CXVA 1HYLA 3TH4H 1GI6A 1KXFA 1UTPA 3BTHE 3U8RH 4BTUB 4K1SA 3DT0H 1MKWH 6CHAC 2DUCA 2ILNA 2RDEA 3RXTA 3UNRA 9ESTA 3DD2H 2K1QA 2QF0A 5FX6A 2ZU5A 1UCYH 2KCOA 1TPAE 1PQ5A 2HOBA 3E90B 2G5NA 1QBOA 5E0HA 5B6OA 2ZGXH 2BXTH 3M3SA 3HGPA 3GY5A 4MVNA 1XM1A 1O5DH 1C2EA 2A4OA 3GCNA 1Y3UA 2RG3A 1GHAG 3DSGA 2BD8A 3ZZBA 1JWTA 1AWFH 5T3HA 1BDAA 3GCTG 3NK8A 3WWBA 1XUJA 2J97A 2OC8A 1G2LA 1TA2A 1C5OH 3T25A 4XBDA 3WY8A 2P8OB 4BANB 4UONA 2ZGHA 3JZ2B 3M5LA 3AAUA 1PYTD 4I31A 3RLYH 5B6LA 4XFQA 3P8FA 2XOKD 2WV9A 2P93A 3KNXA 4Q2KA 3BIUH 1W3CA 2G51A 3GCTF 3MO9A 3AASA 3AVZA 4FUCA 1RD3B 2A1DB 1C2JA 3WWFA 2J95A 4BXWA 2P16A 1PQ8A 2PKSB 3EE7A 1L0ZA 1BBRH 3RXIA 1SQTA 2WHXA 2XBYA 1O5AB 2BOKA 1HAZB 1MTVA 1K21H 1QJ1B 5CHAB 2PP6A 5F8XA 4MPVA 1Y3WA 1GDUA 1P2KA 1FAKH 3RXEA 1B0FA 3ZZAA 1HXFH 1UVTH 4BNRA 1Z71A 1GGDC 3A7WA 1AFQB 1W8BH 5CDFE 5JBAS 1E79D 1D6WA 1V2ST 2ZDAH 1E38B 1VJAU 1P01A 1UTJA 1TABE 1TQ7B 1C2IA 4DVAU 1CA0C 1E0FD 3NRLA 4UFEH 1BT7A 4R8TB 3SI4H 1CT2E 4YZUA 4GUXA 1HRTH 2OC1A 1BTUA 1Z8GA 5L2YH 4XSKU 1SC8U 1CT0E 4KGAA 2V3OH 1EFRD 1FLEE 2UUKB 1ZMNA 2FDAA 1GMDF 2XWAA 2CHAC 2NU3E 2JDID 4ZROA 4E7RG 3GYLB 1SR5C 2ODQA 1TNKA 2DE9A 1MUEB 5IDKA 4O3UA 1SGIB 2F83A 3EAJA 2PKAA 1IAUA 1IHSH 2PFEA 4IN2A 1AB9C 2IOTA 1TGNA 2XNDD 1V2PT 3LOXA 3IG6B 4AGJA 3PV2A 3GDSA 4FETA 3ZVEA 4OGXA 1V2UT 2J4IA 2H9HA 4WJG2 3TJOA 1MBMA 2SFAA 4CBNA 2IJD1 1AVWA 2QF4A 2STBE 4MNYA 4FUBA 2QCYA 1THPB 3TJVA 2H1UA 2ZPRA 5ABWA 1SSXA 1SLUB 1DWBH 2M5TA 2ZTZA 3BG4C 4X1SU 5GIBA 3SU4A 2Q1JA 4IC5A 3UNQA 3ZZ5A 8GCHF 2JJ1D 1NY22 4AORA 1L1GA 1NROH 3ZZCA 3M5NA 1GI1A 1BHXB 1O36A 1O39A 1QZ8A 3T62A 3UAIC 3PV5A 1W0YH 1AI8H 1BITA 1AN1E 2BM2A 2BVSH 1AVXA 3RXSA 5A8ZA 3NWUA 3FZZA 3SJKA 2O8UA 3A89A 4NA7A 3ATMA 1A2CH 3OY5U 1C2DA 4OS4A 1ZHPA 2OBOA 4GSOA 3ZYDA 1W11U 1SLXB 1WBGB 1FN6A 1XXFA 1N8OC 2J92A 4WMEA 2OQ5A 3K2UA 3P17H 1MH0A 5E0GA 5E2PA 3TK5A 1P57B 2QE7D 3O8RA 1TRMA 2RFKC 4A5TS 2AMDA 2FX4A 3ATWA 1QA7A 2ZKSA 1QR3E 1NPMA 1GHXH 2BXUH 4NIVA 3ELAH 1ELTA 1LKAA 2PHBA 1CGHA 3A7YA 5DSFA 4KTSA 1MZAA 1EPTA 4FUIA 2FLBH 1SHYA 3T28A 3P8OA 3M7UA 1SBWA 1ZMLA 1C4U2 1T7CA 1SVPA 1P2IA 2R0KA 1MKWK 1KXAA 4MNXA 2FI5E 1CVWH 5A8YA 2M2AA 3SV2H 1M9UA 1Z7KA 2OC0A 4YM9A 5TCAA 2VVVA 3AW1A 3VXFH 2ZU1A 3KQDA 4MPUA 2PUXB 2ANKH 1MMJN 1A4WH 4D9RA 5DP7A 5EXNA 1KXEA 1OWJA 1NZQH 4TWWA 1IQNA 1TNIA 3F2FA 5FCKA 5AHGH 1AVGH 4ZMAH 5DGJA 1LDTT 2HPPH 1DVAH 2FZZA 4K8YA 3U28C 3VB7A
chains in the Genus database with same CATH topology
4AG2A 1O38A 4WVPE 1NTPA 2HGTH 4UFGH 1MKXK 3A86A 3VB4A 1SGRE 4J1YA 1LHFH 2ZFRH 1WCZA 4B2AA 5A2MH 1C9TA 1UHBB 4X2YA 1H9IE 2QIQA 1C1UH 2XRCA 2PKAB 2VWLA 1ARCA 2VJ1A 4K69A 1OSSA 1QJ6B 2XXLA 1A3EH 4SGAE 1T8NA 1OOKB 1XKBC 1OWDA 1K28D 4ZHAA 2PGQB 3SI3H 4CRDA 2D2DA 1YP9A 3LKWA 5TCCA 5TJXA 3UOPA 4ZHMU 3ZZ9A 3NCLA 3LGWA 2QA9E 4HGCA 2VWOA 1Z1IA 2AFQB 1C2GA 1K1MA 1DUEA 1YPJH 7KMEH 2TGTA 1GI0A 2O8WA 4CHAC 1DXPA 1YLCA 4TY6A 1ESAA 2FODA 2ULLA 4NWLA 1CHOF 2A5AA 1DANH 4FUHA 3IWMA 1K2I1 1BMAA 2J2UA 4IMQA 1FPHH 2G5VA 1C5WB 1K1OA 4VGCB 5C67A 1O3LA 2VINA 4NG9H 4U01A 1QJ7B 1F5KU 2J38A 1KLTA 1G3CA 2C90B 1DPOA 1FI8A 1ZYOA 3GY4A 1OWIA 1FY8E 3RXLA 4RKOB 1DM4B 2WPIS 3MNBA 2SNWA 1N6YA 2V3HH 4ABEA 1L2EA 4Q7ZA 3O8BA 3ZVDA 3NZIA 5AVDA 5HM2A 2HNTF 4B74A 5CE1A 1IQEA 2FM2A 1TMTH 3UTUH 1V6DA 2G4TA 3H7TA 1SGNE 4FUDA 2BVRH 6CHAB 3SJ8A 2F3CE 3GCOA 3HATH 2NU4E 2G81E 4Q80A 2SGPE 3SJOA 2SNVA 2ZU4A 1RXPA 1J17T 1GBFA 4OS6A 1GBHA 2F9VA 5LH8A 1IQHA 1WSSH 1PJPA 1TNJA 2P3TB 2OXSA 4ISNA 3SUEA 1TIOA 1HUTH 1D3DB 2VU8E 2FO9A 1OWEA 1QQ4A 2QN5T 8ESTE 1KSNA 4ZAEA 1TLDA 1FDPA 2RCEA 3V12A 1SGPE 2TGDA 1GBLA 1NRQH 1RS0A 1UMAH 4MPWA 1TOMH 3GY6A 1F92A 2W7SA 1GI9B 1C5LH 4RKJB 1K22H 4AFQA 5DP9A 5F8TA 1BTYA 4ZHLU 4Y8XA 1TQ0B 5DP3A 3RXFA 2O8MA 2OBQA 3SU3A 1VZQH 3F9GA 2Y82A 3PMJA 1C4Y2 2Z3EA 4HI3A 3Q00A 1S84A 4O9VA 1V2JT 3A82A 1W7XH 2A32A 1SB1H 1PPHE 3DFLA 4Y10E 2WV4A 7ESTE 1HXEH 1OXGA 3S9CA 3SGQE 1GI3A 1EJAA 1W12U 2BVXH 1D6RA 2GMTB 1Z6JH 1ETTH 1NFUA 2RDLA 2BD3A 4JZFH 1KXBA 1IQMA 2Y7ZA 1ABIH 1H8DH 1YBWA 1HAIH 3P92A 1A1RA 4BTTB 3NPSA 5A0BA 2FESH 2SGQE 3C1KA 2ZHEH 1SGDE 1ESBA 1X7AC 4FVBA 2SGEE 3F68H 3SN8A 2FS9A 1TGBA 3U9AH 4Y0YE 1C1PA 4BXSA 3D65E 1HV7A 3EDXB 5DPAA 3BG8A 1ZHRA 1P04A 1WAYB 2WV5A 1G36A 3SGAE 3KCGH 1AO5A 1Z8RA 2TGPZ 4FUJA 2H5DA 1QY6A 4Y7AA 5GCHG 3RDZA 3KN2A 4O97A 3QK1A 2OTVA 3R0FA 1MTNC 1YCPM 3VGCB 4YLUA 4DOQA 4TPIZ 1F0TA 4UE7H 2QYIA 5EXMA 4K3JA 1HAVB 2ZHWH 2BLVA 1F5LA 2BDBA 4GCHF 4JZDH 2XC4A 3W94A 3FVFB 1H9HE 1O2JA 1XUIA 7LPRA 1O3MA 2HWLB 5K7RA 1JXPA 2Z6BD 1GBMA 3PLPA 1GCTB 1V2QT 3SV7A 4YOJA 2BDGA 5A0CA 2PLXA 1ANEA 1CE5A 1DSTA 3LH1A 3GY7A 1ELFA 1OWKA 1BUIA 4TYDA 1AE5A 1BBRE 3QZRA 5DG6A 1XUGA 1TX6A 5CHAC 3QLPH 5FAHA 2B7DH 3PM3A 3U1JB 3F9HA 1SLVB 4FUEA 2QAAA 3V3MA 3KQBA 2RA0A 4Q7YA 1RRKA 1Z6EA 2TPIZ 5C3NA 2ZFFH 4NA9H 4H4FA 3LONA 4F49A 3STJA 1ZSKA 5JBTA 2XCNA 1EP5A 3B9FH 3T29A 2BTCE 1Y3YA 1GDNA 3UQVA 1V3XA 1UVUH 4GLYA 4DCDA 3A88A 1ELGA 1Q2WA 1P9SA 3SQEE 5BRRE 5DP4A 1H1BA 2BOHB 1QL7A 1IQIA 4ZXXH 1TBRH 2HRVA 1MTNB 3UWJH 1FPCH 4OS2A 4HFPB 3AW0A 2F9BH 1GJ7B 1TAWA 1HPGA 2GV7A 4JZIA 3RM2H 1WUNH 2W7UA 1QHRB 4WH8A 3TGIE 4E05H 4U32A 1W10U 3MWIU 2ZDMA 5J4QA 1ZR0A 5JBBS 1C5TA 1BA8B 5F8ZA 1K1NA 2WUCA 1J8AA 3K6YA 4ISHH 4DG4A 3DA9B 2FXRA 3MH5A 4HZHA 5GWZA 3O8CA 1NN6A 5EPNA 2CN0H 4BTIB 1C5ZB 1GJAB 5LPEA 1GHYH 4Y76A 2PSXA 3UWIA 2Y5GA 3G01A 3PV4A 3L3TA 1ETSH 2ZF0H 4HTCH 3FP8E 2WYGA 1J9CH 3QWCH 2FOFA 4X6NA 6LPRA 4IBLH 2AMPA 2BYAX 1YCPK 2CMYA 3BTTE 1Z1JA 3RXGA 2ZGCA 1RGQA 5JYIA 2RA3A 1O5FH 3UR6A 4A7IB 1L1JA 5DO4H 1CGIE 1UTLM 3E91A 4YO9A 1F0RA 4TPYA 1P3EA 1ELCA 2CF9H 2FOCA 3M37A 1PPEE 1WTHD 4E7NA 1BMNH 3ZVFA 2PTNA 4CR9A 1GHVH 2XBVA 5EW2H 1QFKH 3DHKH 3I77A 2H9EH 1TNHA 4NIXA 2R9PA 2QF3A 3TLOA 4X2WA 2AEIH 1FUJA 4SGBE 1LVBA 1NRPH 1ZSLA 1HB0B 2AIPA 2UUFB 3FP7E 1E37B 3BTME 4LXBH 3TJUA 1C1SA 1BHXF 2ZWLH 5DP8A 1MD8A 1GVLA 3BTWE 5L30H 3JZ1B 1DSUA 1IQKA 4NCYA 2ZC9H 1JIRA 4K1TA 1G3EA 1GI8B 1A61H 2F91A 2BQ6B 5EQRA 1C1RA 3BTDE 3E6PH 2JETC 4B1TA 2A4QA 3A80A 1Y59T 1HIAB 1WU1A 1TGSZ 5C1YA 5AFZH 2FOAA 3R3GB 4CH2B 4JYUH 2CGAA 1MTUA 1F0SA 5JBCS 4B73A 1LPZB 4ISIH 3LIWA 2GCHG 5FBEA 3TIUA 3SNBA 2A2XH 5F6MA 5I46H 3P8GA 1O3DA 1V2VT 1ELVA 1H4WA 3FP6E 1AZ8A 1BJVA 1IQGA 3FANA 1AMHA 1AZZA 2BD4A 1ZPCA 1V2NT 1OP0A 3RXKA 2OLGA 2XC0A 2JKHA 1UK3A 1NFWA 1LO6A 1NRNH 3BTEE 3VGCC 4NGAH 1Y5BT 3SHCH 4U2WA 3DFJA 1E36B 1UJ1A 3I29A 4THNH 3RM0H 4D7GA 4YLQH 5FCRA 5LGOA 1UK4A 1Z8IB 4KTCA 1YGCH 4TWYA 1AQ7A 1C1QA 2Y5HA 2HNTE 1O2GH 2Z9JA 3PLKA 1D4PB 2NU1E 3CS0A 3URCA 1EB2A 1MU8B 3TGJE 1P02A 1ELEE 1UTOA 3MU8A 1HAVA 4R0IA 1HJ9A 3GY8A 4AFUA 1C5PA 2BX4A 3RC6A 1OP8A 2Y81A 1C4V2 1MTSA 3BSQA 2PKSC 3F1SB 1GG6B 1SFQB 3PTBA 3GY2A 1LPGB 1MQ5A 3ESTA 1ZLRA 1XUKA 2EA3A 1O34A 1P0SH 1D3PB 5PTPA 2WPLS 3S7KB 3F9EA 4DT7B 1O2RA 2FOGA 3LGYA 1GGDB 3E8LA 2BMGB 4BAOB 3IITA 4X6OA 1GBIA 2Q6FA 1NFXA 2C93B 1XKAC 4DGJA 5EG4A 1BJUA 1EAXA 2ALPA 2BHGA 2EI7A 3ZVBA 4XBBA 1FZZA 1TNLA 4K5ZA 1D3TB 2IJOB 1SGFG 3TITA 1WQSA 2ZFTA 3H5CB 1PQAA 1FONA 2BY9X 2SGFE 3BEIB 1L4ZA 1ZPBA 3SV9A 1CSOE 3BTQE 1CQQA 1YPHE 1K1LA 2HALA 2V0BA 2WPJS 3OX7U 2GTBA 3LJOA 5DP6A 2CHAB 1ZZZA 1O3AA 3RXOA 4X2XA 2WINI 1ZRKA 3KIDU 1SL3A 1NC6A 3SQHE 2BQWB 1MCVA 3H7OA 2ZHQH 3PMAB 4WWYA 1O2OA 1QBNA 2BY8X 1VITG 2KAIA 2EI6A 1XXDA 1QTFA 4INKA 3A83A 8KME2 1C5NH 1O31A 5EQQA 1Y8TA 1EZXC 1LVOA 2VIWA 2EEKA 2OC7A 1O3HA 1YPEH 4H6SB 2PW8H 1TRNA 1TE0A 1ZSJA 1OKXA 4Y0ZE 2GZ8A 3QTOH 4ZUHA 5EGMA 1G30B 3SGBE 1ZMJA 3Q76A 3UQOA 2A7CA 3MH7A 1O5BB 3T27A 2QGRA 1SGEE 3BTKE 4ZXYH 5C2ZA 5E2OA 4ASHA 1C5VA 1EAUA 1EATA 1EQ9A 1KIGH 2BD5A 1GCTC 1O37A 4MG3A 1AY6H 2WPKS 1GBDA 2WPMS 1GJ5H 3M3TA 5FPSA 2FOEA 4I7YH 3E3TA 1K1JA 1HIAA 2XCFA 3MU4A 2R0LA 1EJNA 1OWHA 4NZLA 1C1TA 1RFNA 4X1PU 3RXPA 1FIZA 3ATIA 4B2BA 3SJIA 1A0JA 1IQJA 1AWHB 3TVJB 2STAE 2QXJA 3MYWA 1EXFA 1EKBB 1N8OB 1HBTH 1GBCA 3RUOA 3L33A 1S85A 2ANYA 2P59A 1Y5UT 2VH0A 1RTKA 4K8BA 4ISOA 1T31A 1O2PA 4OS7A 2FOMB 2C8XB 3RXQA 1P2OA 5DKMA 2ZG0H 1HDTH 3GICB 5DJ7A 1EZSC 1B5GH 1HLTH 5ESBA 2WUBA 4BOHA 2ZI2H 1YC0A 1LHEH 1W14U 1SOZA 3SW2B 1YPLH 3GISB 1JMOH 1BOQA 2GP9B 1CHOG 1RTLA 2GDEH 1V2KT 3U1IB 4X6MA 2ZU2A 4MQAA 1KLIH 1T4VH 2AIQA 2C3SA 2QXGA 1BTWA 2QXIA 6GCHF 3Q77A 3SNAA 1S81A 5AFYH 4ZKRU 3LGTA 1O0DH 1ZOMA 2VH6A 3LPRA 2EI8A 3VB3A 3RXHA 4Y8ZA 3TGKE 1YM0A 4Z0KA 1QIXB 1ELBA 2XNIA 4GVUA 1NU7B 4AG1A 1DS2E 4VGCC 1G3DA 1TX7A 2FP7B 3LT3A 3PROA 3AAVA 1L1NA 1BRCE 4NSVA 1GJ8B 5FXLA 1TRYA 5HXFA 1FXYA 4MDSA 3NUMA 2OUAA 1XVMA 3NKKA 4X1RU 4LK4A 1GJ4H 1P12E 4FU7A 1NESE 1GI7B 3I78A 1XMNB 1P2JA 4DJZB 1ZPZA 3ODFA 3EA9A 1S6FA 1XX9A 4M7GA 5LPRA 1GHBG 4XBCA 2PR3A 1CA8B 2Z9LA 1EJMA 1GBKA 3HKIB 4JK5A 4INLA 1TMUH 2ODPA 3UPEA 1O3CA 5IYTA 2FMJA 1G3BA 1O2VA 4GHTA 4A1TA 2GV6A 2HPQH 1Q31A 1YF4A 4JCNA 1WQVH 3BF6H 2ANWA 3ZZ7A 1MQ6A 2B9LA 1U6QA 1TPSA 3A84A 4FU9A 5C20A 5T6DA 3GCHB 4AN7A 1RIWC 1O5GH 4AGKA 4X1QU 3A7VA 1D3QB 3OU0A 3DUXH 4AFSA 5C5NA 4CRCA 1GL0E 3LGUA 1LQEA 1BQYA 3EA7A 4I8HA 3ENSB 4AOQA 3KQEA 2FS8A 1PQ7A 1GPZA 1TYNA 3A8BA 4IC6A 1HJAB 3A87A 3VB5A 4B2CA 4CBOA 1V2LT 4NFFA 1VGCB 4Y7BA 1HAXB 2C4FH 1O3OA 3BTFE 2BY6X 1DLEA 1YKTA 3GY3A 1BTHH 1QURH 2R3YA 1YPHC 4IW4E 2VWMA 5GXPA 5EODA 2ZECA 3UNSA 3HK3B 2FIRH 1AKSA 2XYAA 1A5HA 1CBWB 1TGTA 5AF9H 1FJSA 4NFEA 2G55A 8GCHG 3NXPA 1CBWC 4NA8A 1AIXH 1FY1A 1K1IA 1DWCH 5CMXH 2CJIA 1AUJA 1O2YA 1SMFE 1TNGA 2ZHDA 3OYPA 4ZH8A 2Y80A 1O2ZA 2AERH 1BB0B 1NO9H 1ZHMA 3B23B 2AMQA 2G52A 1KTSB 2HNTC 3PO1B 1W13U 4INHA 4FU8A 3FZDA 2G00A 1HFDA 4WMDA 3M5MA 4X8VH 1AD8H 1JOUB 3PO1C 5GJ4B 1LVMA 5E8EH 4A1XA 1EPTC 1PPZA 4TY7A 3A7XA 3HK6B 1O2LA 3QUMP 2AYWA 2UUYA 1AFEH 1ZTJA 1GMDG 2FWWA 4WF8A 4Y79A 1AUTC 1GHWH 4UFFH 5C1UA 2W3KA 2A7HA 3PTNA 2BZAA 1SGQE 4ABIA 5G4BA 1BTPA 1RJXB 2GT7A 1AB9B 3RMMH 1P03A 1XUFA 2GCTB 4YOIA 1OP2A 2ANMH 1O3KA 1GVKB 3KGPA 1QB9A 1XVOA 1LHDH 1KLJH 4IGDA 1GHZA 4UFDH 3MO6A 1SLWB 1MAYA 1ZTLA 3ATKA 4GPGA 1HAPH 2GMTC 2Z7FE 5A0AE 4K60A 1MCTA 4ESTE 1SOTA 2ZDVH 1BRUP 1O3EA 2V6NA 1KDQA 2BY7X 4I8JA 2XW9A 1THRH 3ZVGA 1CA0B 3CENA 1GCDA 2B0FA 1JBUH 1V2MT 1DY9A 2ZA5A 2H9TH 1XUHA 2ZPQA 3UOUA 2PSYA 1P2MA 2F9UA 3RXDA 5HM9A 1TA6A 1VR1H 1ZGVA 1C2LA 1EAWA 4X8SH 5A09A 4D8NA 1ESTA 4O3TA 3ATLA 5JDUB 2SGAA 5DP5A 4D76A 3QZQA 5LPFA 3A8CA 1ANDA 4BAQB 1T4UH 1Y5AT 1FIWA 2VGCB 1HAOH 1C5RA 2UUJB 2P8OC 3SZNA 1UTMA 2GGVB 1NRRH 1P05A 1DICA 1IQLA 2PGBB 1C5SA 4I8LA 2H6MA 1CHGA 1K9OE 3BV9B 1QQUA 1EASA 1HGTH 1GBTA 2C8YB 2GCTC 2P95A 3RXMA 1GDQA 2Y6TA 2SGDE