1T31A

A dual inhibitor of the leukocyte proteases cathepsin g and chymase with therapeutic efficacy in animals models of inflammation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel, potent dual inhibitor of the leukocyte proteases cathepsin G and chymase: molecular mechanisms and anti-inflammatory activity in vivo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chymase
total genus 49
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1t31A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1t31A02
2Q6FA 4MPUA 2BD5A 1THPB 3R0FA 3VB7A 1O2KA 1N8OB 3KGPA 1TBRH 1GMHF 1ANCA 1UTMA 4X8UH 4YTAA 1EPTA 2FTLE 1DXPA 1HAPH 1EXFA 1UTLM 3GCHC 4GCHF 4AFSA 2ZGBH 2A1DB 1SGIB 2BD4A 3DUXH 4X2YA 3QWCH 2GDEH 1ZMNA 4Y0ZE 3RXHA 1TGTA 4K1TA 3P17H 1Y5UT 2QGRA 3KIDU 1TFXA 5G4BA 4E7RG 1P05A 1Q31A 2VWLA 3LPRA 2GT7A 1A61H 1YPGH 6CHAC 1KDQA 1VGCC 1NC6A 4BTTB 2B9LA 1VITG 3U8TH 1IHTH 1O2OA 1MQ5A 2ILNA 1O0DH 2PR3A 3F9GA 1C1RA 1DSTA 2BXUH 2OXSA 5F8XA 2ZDVH 4CBNA 4NZLA 3M35A 1RIWB 2BQWB 3SUFA 2FTMA 3JZ2B 2O8LA 2XCNA 2SGDE 5FX5A 1Z8RA 4BAKB 4IC5A 3SU1A 4O3TA 3VGCC 1TMBH 2R9PA 1B5GH 1DUAA 1XVMA 3A85A 3HKJB 3L6PA 4B74A 3PTNA 4ABDA 3P8NA 1FNIA 3HATH 1QCPA 5FBEA 1MCVA 1GHWH 3KQEA 4D8NA 2W3KA 3LT3A 4WH6A 1AFQC 5K0HA 1QA0A 4KTUA 4XDEA 1GBCA 1VITF 4KTCA 3SJIA 3AW0A 4A92A 1QIXB 1ZMJA 3U98H 1MU8B 3OY5U 4ESTE 4GVUA 1HAXB 8ESTE 2YOLA 1TQ0B 1QRWA 3M5NA 1E38B 4X8VH 2UUJB 1O2TA 1O5BB 5JBTA 1L1NA 1V2QT 1UHBA 1FI8A 3FZDA 2QF0A 1O2YA 2J92A 4CRFA 1VJAU 2JETB 4WY3A 2GCTC 4U30A 1O2WA 2G52A 1IHSH 1O2RA 4YLQH 1TMTH 1BTWA 4J1YA 2JETC 3F9EA 1DXWA 1A5IA 2QC2A 3EAJA 4NZQA 4Z0KA 3C27B 1P12E 2WPJS 1FY3A 1P3EA 1Y3UA 3LH1A 4X6PA 1OWDA 1TWXB 3UPEA 1TAWA 3A7ZA 4JK5A 2FX6A 4H42U 3SOSA 1VCPA 4ABGA 4A1TA 1HXFH 1O3FA 1GCTC 3TITA 3SU5A 1Z6EA 1AIXH 2ZDAH 2BY9X 1NY22 5IDKA 1DANH 1YCPH 2ZDKA 1V2TT 2M5TA 4X6OA 3EYDA 5AVDA 3OX7U 1LHFH 1SFQB 1AD8H 1ELCA 1JBUH 2Z94A 3SU2A 1E36B 1D4PB 2IPHA 1AU8A 1RGQA 2BZ6H 4KELA 1TBQH 2AH4X 4UFDH 2GMTC 3CS7A 1ETTH 1W8BH 3E8LA 1VGCB 2FI5E 2FWWA 3MU4A 1C2JA 1A5GH 3LOXA 4DJZB 3ZZ9A 3D65E 3B9FH 3AW1A 1SGPE 1GPZA 2W26A 4INHA 1HAVA 1PQ5A 3A7VA 3LKWA 1OP0A 3A88A 1FIWA 4LK4A 1OWKA 3QUMP 4CHAB 4U2WA 3ENSB 1Z1IA 2I6QA 2A4RA 1CA8B 1O2MA 1FLEE 1V2WT 1QJ1B 1K1OA 3P92A 4LXBH 1BTZA 1W7XH 2ZDLA 1IOEA 3OSYA 3MO3A 1V2RT 1Z8IB 2Y5FA 2A0QB 2ULLA 1O31A 1FQ3A 1QL9A 1ZMLA 3I78A 2SGAA 5GXPA 4UD9H 1A5HA 3PB1E 1NFUA 2HRVA 3UOPA 2DE8A 3E0PB 1IQGA 2P95A 2SGPE 1SQOA 3PM3A 3GY4A 4NFFA 3NCLA 1MH0A 4JMYA 5I46H 1MBMA 3QZRA 4BTIB 4BTUB 3GY8A 4K5ZA 4OS1A 2O8TA 4CH8B 3MH5A 3RC6A 1EZSC 1TPOA 2R2WU 4KP0A 1PPFE 3TK5A 1P09A 3RXOA 2GX4A 1OXGA 1Y3VA 3ZZ7A 1GBLA 3GDSA 1FY4A 2Z9KA 2BDYA 3TK6A 3FAOA 2CGAA 1EOLA 1NFWA 1BITA 3H7OA 3SJ8A 1SLVB 4IW4E 4I32A 4E05H 1L4DA 3KEEA 1P57B 1GHAF 1YLCA 1LHDH 2BM2A 2O8WA 5L30H 1O2SA 2RG3A 2ZTZA 5DP6A 2FOBA 4X1RU 2GCTB 3BTGE 3F6UH 1IQJA 4WMEA 1UK2A 1LMWB 2W3IA 2C8ZB 1SGEE 3SU0A 2Q6GA 3F9FA 2FOAA 1TRMA 1JRTA 2SNVA 1JWTA 4NIWA 3VB4A 2FOFA 2BDGA 1BMMH 3M7TA 1NRSH 3FVFB 2RCEA 1UTNA 1YCPK 2GTBA 2Z9LA 4MVNA 1TALA 5PTPA 4NA9H 1GJ5H 2FMJA 1XUJA 1ZJKA 3A8BA 1DSUA 1W3CA 3RXAA 3ATLA 3EA8A 3Q3KA 1HJAC 1AMHA 2ZC9H 1W12U 5DP4A 4OGYA 3K6YA 2VJ1A 2PGQB 5EW1H 1WTGH 2D8WA 1O2QA 5FPSA 9ESTA 3RXMA 1O2ZA 5ESTE 1PYTC 3RXUA 1NM6A 3LGIA 5CMXH 3S7HB 5C5OA 1TYNA 2VH6A 4VGCC 1O5AB 1YKTA 1UK3A 2A45B 1SQTA 1TRYA 3P95A 3QK1A 5FPYA 1BTUA 2ODQA 3SV8A 4ISHH 1LHGH 4FUEA 1A4WH 1AI8H 1UCYK 2VGCB 3A7WA 1MKWK 2AFQB 4X6MA 2ZO3H 3RXFA 1NS3A 1XUIA 3SV6A 3A8DA 3OY6U 5GWZA 2FDAA 2JH0D 2YNBA 2A5AA 2OBQA 4CREA 3UOUA 1O2UA 2JH6D 1AE8H 1ABJH 3HGNA 1DPOA 1TRNA 5CHAC 1G3BA 5FCRA 1NN6A 1OPHB 2TBSA 1CHOG 1FAXA 3B8JA 1RTFB 1XKAC 2VWNA 1UHBB 3P70B 2XC5A 4FUBA 3RM0H 6ESTA 1DICA 1ZLRA 3VGCB 3SGAE 4Z6AH 4ISNA 1ESTA 3O8BA 1AKSA 1RTKA 2FPZA 3PTBA 2BLVA 2ZGHA 4K1SA 2ANMH 1O3LA 1HLTH 1MZDA 3GYMA 2Y81A 1Y8TA 1C5OH 1Q2WA 1C5PA 3DFJA 2J2UA 4ZKOU 2AIPA 1FONA 2OC8A 4TPYA 1RRKA 1P11E 1N8OC 1WQSA 2ANYA 4WMFA 1NESE 1P03A 2A2QH 3QO6A 1GBFA 1MKWH 1RD3B 1H8DH 2XTTB 4AB8A 1SBWA 4IMZA 1LCYA 3PMJA 2ANWA 1V2ST 1TMUH 5LPFA 1FZZA 2TIOA 1IQNA 2BY7X 1HRTH 1UVUH 4I7YH 1OYTH 3ZZBA 1PPGE 2XC0A 1YPKH 3GCTG 1P8VC 1UCYH 2AMQA 2ZKSA 1WTHD 3SGBE 4WVPE 1NFYA 4DG4A 3FP7E 2ZDNA 3A83A 4BAHB 2ZHWH 1SGYE 5E0HA 1EUFA 3NWUA 1S84A 1SGFG 2DUCA 1HCGA 1GMCG 5F8TA 3ZZ8A 4AFUA 4NGAH 3LGUA 1QY6A 4GCHG 5GIBA 1ZJDA 5DPAA 1QL8A 4MNWA 1C1TA 1GBAA 1QGFA 3M3TA 2VVVA 4K8YA 2CV3A 4LOYH 3A89A 4HZHA 4Y71A 3N7OA 1KY9A 4F49A 3RXJA 1CT4E 4YT7H 2G4UA 2BY8X 3TNSA 2ZCKP 4TPIZ 1O3EA 1TA2A 1GBKA 3R3GB 3BN9A 2Y7XA 4Q7YA 1HAVB 3PLBA 1KTTB 1C5RA 1H8IH 1P2MA 2FOHA 5EQQA 2BDHA 2AGIX 4Y0YE 1GL0E 4X2VA 3HPTB 1C1PA 1BDAA 4FVDA 4O3UA 4DW2U 1D3DB 2BD8A 1QURH 5C1YA 1EPTC 1GJ4H 2NU2E 3T28A 2F91A 1BA8B 2D1JA 1GMCF 1GI6A 5H4IB 1PPEE 2BTCE 1VJ9U 3ELAH 1GMDG 3SJOA 3SQEE 4ABAA 4B2BA 4AYYB 3SO3A 2VINA 1ACBE 1TA6A 2CF8H 1HAZB 3NZIA 1O5FH 2ASUB 1LO6A 1TOMH 1P06A 2WUBA 2HLCA 2XW9A 1SGCA 1AFQB 3U8RH 2I6SA 3UREA 1JOUB 1C2IA 1YPHE 3MNBA 3UQOA 1J14A 1DS2E 2FLRH 2FS9A 1THRH 2C8WB 2VVCA 4I31A 3SUGA 4ZROA 4NWLA 4FUHA 1OWHA 5SGAE 4AFZA 1QR3E 1K1NA 3Q3YA 3Q76A 1Y5BT 1Z8JB 1V3XA 2EEKA 4YT6H 1MTNB 4ZH8A 3TGKE 1HNEE 1TPAE 1O30A 3GOVB 1C2GA 1XUFA 4B1TA 1YP9A 1F5KU 4ABEA 1V2NT 3A80A 1UCYE 1W11U 1RTLA 2SGFE 1TE0A 4UEHH 1GJBB 1NRQH 3M7UA 1C5VA 2P93A 1EP6A 1A3EH 2ESTE 1P10A 5TCCA 1GHVH 2XWBI 1SOZA 1LQEA 3BSQA 3C1KA 2O8MA 4OS2A 3BTWE 2NU3E 1K2I1 4D9RA 4MNXA 4X1SU 3UWIA 4WH8A 1Z8GA 2AYWA 2Y80A 1F0RA 1WV7H 1C1NA 4A5TS 4AG2A 4FUCA 5GJ4B 1T4VH 1BTHH 1O3GA 3W95A 4R8TB 1SHYA 5EPNA 3LC3A 2FODA 4IS5A 2UWOA 5FBIA 2EC9H 1KYNA 1FMGA 2DE9A 3SJ9A 3DA9B 3SQHE 3UY9A 4BXWA 4YESB 1QL7A 1ELFA 3GISB 2SFAA 4JZIA 2OP9A 1D6WA 4JYTA 5LGOA 2FLBH 1PYTD 2QXIA 2BXTH 2GMTB 5T6FA 5GDSH 4AG1A 1SG8B 4GHQA 2BQ7B 3K2UA 3L3TA 1LPGB 4JCNA 3KCGH 3T26A 1FV9A 2BHGA 1ESBA 2C90B 5EXLA 2STBE 2BOKA 2Y6TA 1K21H 4K60A 5BPEA 1G32B 1BZXE 1CO7E 1HJAB 3LGWA 1TQ7B 1UTOA 2C4FH 1J9CH 1ELBA 1ESAA 2F9PA 3M7QA 1ZZZA 3TIUA 4TY7A 4UFEH 2VVUA 3STIA 5F6MA 5AHGH 3SBKA 4TYDA 2CHAC 1A7SA 3RU4D 1BTYA 4ISLA 3RXIA 3A8CA 2BD3A 1BJVA 2K1QA 3BTEE 1X7AC 3RXLA 1SSXA 3GY6A 4DIHH 3PYHA 1F0SA 1OWEA 2O9QA 4BAMB 4FU9A 1K1PA 2QCYA 3ZZ4A 4JYUH 1BRBE 1GCDA 1QFKH 1GHYH 1C5MD 3GICB 5FAHA 1QQUA 1BRAA 4CRAA 2CN0H 1HAHH 3BG4C 2R3UA 1G9IE 5AFYH 3V0XA 1O5EH 1CHOF 3O8CA 2A7CA 2QIQA 2NWNA 5TCAA 4SGAE 2HPPH 1PQAA 1GVZA 1FY8E 1VCQA 1ZYOA 2HVXA 5GCHG 1NU7B 1M9UA 5DGJA 1B0FA 1CHGA 2P94A 2UWLA 1G3EA 1XM1A 2OD3B 2OTVA 4IN2A 1AVGH 1WOFA 1TGSZ 1ELGA 2Z9JA 3ITIA 2G5VA 3BTFE 1DWCH 1EZUC 2TGAA 4TWYA 1A0HB 4RKJB 1DOJA 1BT7A 1AWFH 3ZVFA 5L6NH 1RJXB 2WUCA 1GMHG 5FHTA 2QF3A 1TGNA 2ZPQA 2ZU1A 1CQQA 1JXPA 1C2EA 1ZPBA 4GPGA 5L2ZH 3GYLB 1C2LA 1E37B 1K1JA 3VB3A 2VNTA 1D3QB 3LIWA 1SGQE 2F9OA 4UONA 1S6HA 4NA7A 4XBDA 3SI3H 2ZPRA 1SL3A 2BOHB 5E8EH 2SNWA 1G37A 1AUJA 2QYIA 2WV5A 1BCUH 3E1XB 1E35B 3GCTF 1TNHA 1GI3A 1T31A 3QLPH 2WPLS 2ZI2H 1ELVA 2JKHA 2VH0A 1A3BH 1TNGA 3K6ZA 1A1RA 2ZZUH 1QBNA 3SU4A 1O2VA 1TB6H 5A09A 4NIVA 1SPJA 4ABBA 1TNJA 4GSOA 1TBZH 1DY9A 5FXLA 1GDUA 4AB9A 2GGVB 3SW2B 1N6YA 4H6TA 1S82A 2VIOA 1U6QA 2WYGA 3NXPA 1ELAA 5EOKA 1Y3YA 1EAUA 2XBWA 1TOCB 1AZ8A 1C1SA 2PW8H 1AE5A 1G3DA 1SGDE 4FUFA 1FXYA 3TH4H 4AYVB 1BRCE 5C2ZA 3GCOA 2Z3EA 4MQAA 1O3KA 3U1IB 3SI4H 2GZ9A 1O2JA 3TJNA 3E16B 5EXMA 1EKBB 2A5IA 2D2DA 3ODDA 4Y8YA 2CJIA 1ZGVA 1C2HA 3KQBA 1W7GH 4I8KA 1YBWA 3RMLH 1GJ9B 2ZTXA 4NCYA 2R3YA 2W7SA 4I8JA 1YC0A 2PTNA 1NZQH 5K7RA 4INLA 2Y5GA 2ZDMA 1EJMA 2VWOA 4YOIA 2B8OH 3UTUH 2Y5HA 2XBVA 3HKIB 2PV9B 2A2XH 3A8AA 3DT0H 1O3BA 3BTDE 1F0UA 3M3VA 1ZSLA 4AORA 1UVOA 3K9XB 2ZHFH 1TNKA 2WPHS 8GCHF 2Z7FE 1O3CA 2XXLA 1TNIA 3DHKH 3SNBA 3ZV8A 1XX9A 2PTCE 2ZFFH 4WJG2 2ZCLP 3SORA 1HV7A 4JYVH 1GHBG 1NT1A 1SFIA 1N1LA 4TWWA 1HPGA 4Y8XA 5E2PA 1TGCA 1XMNB 3SGQE 1MAYA 1AB9B 1C1OA 1GI1A 2IJOB 1EZQA 1HAYB 2XYAA 1F0TA 2FEQH 3P8FA 5LPEA 2ZP0H 3LONA 3KHVA 1KXAA 1GJAB 1MTWA 2BDIA 1K1MA 2FOGA 5T3HA 3HK3B 1YLDA 3BIUH 2W7UA 3S0NA 3BTQE 2PSXA 1J15A 2ZTYA 1QB9A 1L1GA 3SZNA 1ARCA 5B6OA 5CE1A 2ZGJA 1TX7A 4ISOA 4ZXYH 1MZAA 3KL6A 4I8LA 1PJPA 3LGYA 3MU8A 2W5EA 3LJOA 3ZVAA 1O39A 3VB6A 2BY6X 1GBMA 3SV9A 4AGKA 1GJ6A 1OP8A 2V6NA 3MTYA 4OS7A 1FN6A 7ESTE 2FOEA 1SLUB 3SN8A 2J95A 1XUGA 2KAIB 4LZ4B 1SI5H 1WU1A 4AX9H 1O3JA 1GG6B 3RDZA 5DJ7A 2AS9A 3ZVBA 1CGHA 1JIMA 3M36A 2ZFPH 5HGGA 3E3TA 4CRCA 3RUOA 2VIPA 2P3FH 3MU5A 4RN6A 3TVJB 4DY7B 5E0JA 1MD8A 1NRPH 1XVOA 2R0LA 2Z3DA 1UJ1A 1HXEH 5A8ZA 4XBCA 1BOQA 5EPYA 1SGFA 2BYAX 3U1JB 1IQEA 5A8XA 1V2JT 1GBIA 3BEUA 1YPEH 3TJVA 1HYLA 1P0SH 3ZVCA 1MTSA 1SLWB 1Y5AT 4D7FA 2CXVA 1NRRH 3VXEH 2BVSH 1HIAB 3VFEA 1MD7A 2A32A 2BDAA 1TGBA 2ODPA 1HDTH 2H9HA 2FI4E 1OSSA 1SMFE 1OP2A 2PGBB 3M3SA 4ZAEA 1EAWA 4J2YB 3RMMH 3UUZA 3KF2A 3S69A 1AQ7A 1Z1JA 4CRGA 1THSH 3TNTA 3CP7A 1GI5A 3IITA 2WPMS 1O34A 1ZHMA 3SU6A 3LC5A 3FZZA 2O8UA 3TGJE 1TPSA 1NU9A 1C9TA 4B75A 1YM0A 4MTBA 1O5CB 1QJ6B 1GJDB 1GCTB 2F83A 2LNCA 4XSKU 2HPQH 5JBCS 3LDXH 1A0JA 1EP5A 1GI9B 3MO6A 2ALVA 3VXFH 5A0BA 3OTJE 3BTTE 5C1UA 3GY2A 5LH8A 4ZHAA 1GBBA 1KDQB 2V3OH 2ODYB 3GY3A 3MHWU 2ZQ2A 1O2GH 4B71A 3GDUA 1FUJA 1UMAH 2ZGCA 1MBQA 1PPBH 7KMEH 2BLWA 1C5NH 1C5XB 4B76A 2ZFRH 2BZAA 1O33A 2Y7ZA 3ESTA 4DOQA 1LKAA 3MYWA 4I33A 1W10U 3Q77A 3U9AH 5A0AE 2PSYA 2TGDA 2FS8A 1AVWA 1FY1A 1IQLA 3S9BA 1NROH 1L2EA 5E0GA 3I29A 1SGNE 3P6ZB 3HGPA 4Y7AA 1SHHB 2FM2A 3A87A 2ZHDA 5JBBS 4BOHA 1GJ7B 1BRUP 1HJ8A 1BMLA 4XBBA 1EJAA 2VWMA 4X0WU 3RP2A 4Q7ZA 1C5UA 4ZMAH 1HGTH 1BJUA 4NWKA 1V2PT 2C8XB 1ANBA 1UVPA 3VEQB 2EI8A 3GDVA 3TH3H 1DVAH 4O97A 2TPIZ 4X8SH 1AKSB 1ZOMA 2ZFQH 4B73A 2OQ5A 1DT2A 1KXBA 1G3CA 4NSYA 4DT7B 1IQMA 1O3OA 4O03A 3RXDA 5HXFA 2A31A 3CENA 4ZHMU 1ANDA 2VB0A 4XOJA 2ZHEH 5DK1A 3T62A 2PLXA 1O5DH 2XC4A 2Z3CA 4FUDA 3PO1C 1QBVH 2G00A 2WPIS 5ETXA 3T27A 4Y6DA 1O2XA 5IYTA 1V2UT 1KIGH 4AN7A 3T25A 2QXJA 3H5CB 3SNEA 2HNTF 1QQ4A 2CMYA 5E2OA 3I77A 1ZPCA 1P2IA 3BF6H 1C5ZB 2BQ6B 2GZ7A 3ZVGA 1OYQA 1HAIH 2BDBA 4UFFH 5J4QA 1L0ZA 1CT2E 1TIOA 1GBEA 2J34A 4Q2KA 1GBTA 3E90B 3RXGA 4A7IB 4MLFB 2H5CA 3F68H 3RC4A 1UK4A 2RDLA 2ZWLH 1T4UH 2PKSC 1BTPA 1Y3WA 1EASA 2G4TA 1WBGB 2V0BA 4Y79A 2ZHQH 1GVKB 1KTSB 2ZG0H 1FAKH 1RFNA 2G55A 2PFEA 8GCHG 2FYQA 3AAUA 2OC1A 4H4FA 4AZ2B 2H5DA 2A4OA 2QN5T 3ZYEA 1JIRA 2ZNKH 1C5YB 2XBXA 3A81A 1YPLH 1D6RA 4X1NU 1GI4A 3ZZ5A 4CHAC 3URDA 2CHAB 2ZFSA 1QRZA 3RXQA 3LGTA 3MNXA 5JYIA 1O37A 1HBTH 2PKAA 1P01A 1T7CA 1MTUA 2H9EH 1C2MA 2P3TB 1WQVH 3PWCA 3HK6B 4K3JA 3E91A 3MMGA 4WF8A 1ZR0A 4IC6A 3UFAA 4VGCB 3O8RA 2BD9A 1OWIA 1FJSA 4YOGA 3ZV9A 5DG6A 1GDQA 2ANKH 1FN8A 1GI2A 3EGKH 1O2NA 1HFDA 2GKVE 5A0CA 2HGTH 1H9LB 3MO9A 1K22H 4OS4A 3OYPA 2A4QA 3BEIB 4MNYA 1NO9H 3NUMA 3MH4A 3ZZ6A 1GVLA 3D49H 1Y59T 4RSPA 1W13U 4NA8A 4AOQA 4K1EA 2QV1A 2XNIA 3RLWH 2QAAA 4FU8A 1GJ8B 2HNTE 4KTSA 4D9QA 1C4V2 1E34B 5T6GA 5ABWA 4JZFH 1GHBF 2PUXB 4Q7XA 2FP7B 1P9UA 2WYJA 1KXDA 3ZYDA 2B5TB 5I25A 2P59A 2Z9IA 1GHXH 3L33A 4D76A 1YPMH 2PHBA 1F2SE 2P8OC 3MH7A 1AN1E 2EA3A 4OGXA 3TU7H 4K8BA 4JK6A 5DO4H 3FFGA 2H2ZA 3MNSA 2OQUA 1V2MT 2GV6A 1O2LA 1IQHA 4X6NA 1FPHH 5C1XA 8LPRA 4KKDA 1LVYA 1D3PB 2ZQ1A 1XXDA 4IN1A 4KGAA 3A84A 1VCWA 1P2KA 3UWJH 3FP8E 3SHCH 3QZQA 1K28D 3PMHB 1EOJA 1FIZA 2BLQA 2BY5X 4GUXA 2BLOA 1J17T 3LH3A 3E0NB 3RLYH 4THNH 1CGJE 5EXNA 1L1JA 1QTFA 5L2YH 4TY6A 4WMDA 1FY5A 2NU4E 1Z6JH 2JH5D 2A7HA 3SJKA 3QTVH 4A6LA 2GD4B 4HI3A 5TJXA 3QX5H 3A82A 2Z9GA 1BBRH 5C3NA 1GJCB 1LTOA 4E06H 1O2HA 2IN2A 1OWJA 1Z71A 2QY0B 1V2OT 4FUIA 5ESBA 5F8ZA 1QA7A 4NG9H 4DCDA 1S83A 1D3TB 1MKXK 1ZTLA 1LQDB 1DLKB 1ZRBA 2THFB 1ZHRA 2HOBA 2QXHA 4YZUA 1ELEE 1B7XB 1E0FD 2AMPA 3EDXB 2FXRA 1LKBA 3QGNB 1BTXA 4MDSA 1WCZA 3OU0A 1L4ZA 1V6DA 3SUEA 1C1QA 4JZ1A 2QXGA 4O9VA 1AZZA 4AFQA 1ZGIA 2A7JA 1KLJH 1XKBC 3AASA 4ZHLU 1ZSJA 1S0QA 5HMAA 1AGJA 2FESH 1DY8A 2J4IA 2GZ8A 5CHAB 5C20A 1MMJN 2FI3E 1DUEA 2Q6DA 5HYOA 2AEIH 1TABE 2Q1JA 1EPTB 1BBRK 5FCKA 1DE7H 1DFPA 3SU3A 1ORFA 5HM9A 3ATMA 1GWAA 3URCA 1RS0A 1ABIH 2AIQA 4INKA 4MNVA 1C5TA 2OUAA 1MKXH 2BB4A 2FIRH 1CA0B 1GI8B 3SV7A 3MU0A 1SVPA 2PWXA 1VITH 4AGJA 2BVRH 2F9NA 3RMNH 1INCA 4ABFA 2FOMB 1C2FA 1KSNA 1CU1A 3EE0B 1CA0C 1BMAA 2FX4A 1UVSH 2ZF0H 2EI7A 2OLGA 3TJOA 3V7TA 4B2AA 3RMOH 2FO9A 2ZPSA 4U32A 4F4OC 1XUHA 1P2NA 2OBOA 1PQ7A 3VB5A 3EA9A 2AMDA 1RIWC 1C5LH 3A7TA 3SHAH 1BHXF 1AFEH 1ETSH 1AB9C 1O3PB 1EX3A 2FYRA 4BNRA 1Y3XA 3MI4A 4NIXA 2SGQE 1WSSH 2R0KA 1CT0E 4GAWA 1LDTT 3RXTA 4BAOB 1O3MA 1AWHB 4DGJA 1G36A 2EI6A 3H7TA 3F9HA 5A2MH 5DKMA 4UE7H 1LVBA 2V35A 5C5NA 1PPCE 2IOTA 2WV4A 1EJNA 2XWAA 1C1VH 4BAQB 1SR5C 5EQSA 1F5RA 2VIVA 4OS6A 3RU4T 3V12A 3W94A 4ZXXH 5DP5A 1O38A 1K1LA 1O3AA 1EATA 1A0LA 2G51A 1YF4A 1ZTKA 2QA9E 4ZKRU 1N6XA 1HAOH 2F9VA 3ATKA 4HTCH 5JB9S 3BG8A 1SLXB 1EAXA 4ISIH 3PMAB 4MPWA 1EB2A 1O32A 5HM2A 1UO6A 2ZGXH 1J8AA 1QRXA 4Y8ZA 1QB6A 1T8LA 2BMGB 3RXSA 4ABHA 1TONA 4NIYA 2ZU3A 1GL1A 1F7ZA 3U69H 2NU0E 1C9PA 3QTOH 1VR1H 1LVMA 4WXVA 4X8TH 1BIOA 1WUNH 1OS8A 3S9AA 1ARBA 3VPKA 3UNQA 1GBJA 3QGJA 1AY6H 1QBOA 1Z7KA 1EAIA 2P3UB 2FZZA 3A7YA 1O36A 3RM2H 2OCVB 1P02A 2A5KA 3SUDA 4I8HA 5DP7A 1MCTA 1P2OA 3M5LA 3SNAA 3ATIA 2F9UA 1C5SA 2VGCC 4DVAU 4HGCA 1H9HE 4MG3A 1V2KT 4FUJA 3GCNA 3ODFA 5EQRA 1DITH 1SC8U 4UFGH 2C93B 1S81A 3S7KB 3EQ0H 3ZZ3A 4FXGH 5AF9H 3BG4B 2VIDA 6LPRA 1P3CA 2VU8E 3TPIZ 4ASHA 3NK8A 1G2MA 2UWPA 6GCHF 1S0RA 4Y7BA 1AO5A 3BIVH 4RKOB 5FX6A 4NFEA 1GI0A 1O35A 3F1SB 2PUQH 3MFJA 3UIRA 1DWBH 3M5OA 1PFXC 2AERH 3BEFB 3P8OA 1W0YH 5JPMH 2SGEE 4E7NA 1NPMA 2UUKB 3KQDA 1C1UH 1IQKA 1BQYA 1C5WB 1T8NA 1AHTH 1O5GH 1YGCH 1IAUA 1C4U2 1P04A 3PWBA 2D26C 2ZA5A 3MNCA 3PLKA 1C1MA 2H9TH 3KN2A 2TRMA 1PPZA 1QB1A 2XCFA 1F5LA 3MOCA 2PKAB 1GBDA 4FU7A 1T8OA 1BBRE 1MQ6A 1ELDE 5C67A 1MTVA 1LVOA 1DDJA 3BTHE 3M61U 3SV2H 7GCHG 2B7DH 4DIIH 4Y76A 1A2CH 1CE5A 4D7GA 2PKSB 2R2MB 1CSOE 1HAGE 3MWIU 2G8TA 3JZ1B 3RXPA 3P8GA 4JZEH 7LPRA 3EA7A 2J38A 2TGPZ 1KXEA 1ZSKA 1TLDA 3D23A 1YYY1 3RXKA 2J94A 5T6DA 1SGRE 2XRCA 3RC5A 1RXPA 2V3HH 3AAVA 4OS5A 1GGDC 3LGVA 1HIAA 4YM9A 3STJA 1K9OE 1KXCA 4Y11E 3UR6A 1V2VT 1VZQH 2KAIA 5DP8A 4X1PU 3O8DA 3QDZB 1NTPA 1B0EA 1EQ9A 2OC0A 3T5FH 3UNRA 1ELTA 2ZU5A 3LU9B 5EODA 4JZDH 3RU4E 2VIQA 3FP6E 4CRDA 4LZ1H 2NU1E 1GBHA 2GT8A 1F92A 1AVXA 3AVZA 1P2JA 1C5QA 1O3NA 4H6SB 2LPRA 3M5MA 2YNAA 1JMOH 1GG6C 1O2IA 1HUTH 4IGDA 4CR5A 4GHTA 5DP9A 1S85A 6GCHG 4BXSA 3FANA 2ZIQH 1OX1A 1C1WH 3PROA 1WYKA 1OOKB 2ZU4A 2UUYA 1LPZB 1ZPZA 3WY8A 1SB1H 1XXFA 4DURA 3B23B 1BUIA 1HJ9A 5EGMA 4ABJA 4YO9A 2GCHF 3V13A 3A7XA 3SNDA 1H9IE 2ZU2A 3S9CA 1A46H 2STAE 1UTPA 2H6MA 5BRRE 2OINA 3PMBB 5J4SA 2BX3A 4XE4A 4CR9A 1C2KA 1D9IA 1DWDH 4WXIA 1TPPA 3T2NA 1OKXA 5LPRA 1JRSA 4YOJA 1UTQA 5JB8S 2FOCA 1O3HA 2P16A 2ZCHP 2VIWA 3ZZCA 1GI7B 1TNLA 1H4WA 4BANB 3UQVA 2WPKS 1HB0B 1Q3XA 3BTKE 2C8YB 1QNJA 4A1XA 1XUKA 1ZHPA 2F3CE 4FUGA 3PLPA 1FPCH 1K1IA 3PV4A 1ID5H 3ATWA 4X2XA 3K65B 4IMQA 4NSVA 1UTKA 3ZVDA 3M37A 5DP3A 5EW2H 2BVXH 1WAYB 1O3DA 1PPHE 4MPVA 1V2LT 4SGBE 5A8YA 2GVFA 1MU6B 3ZZAA 3Q3XA 4GLYA 2HWLB 1W0ZU 4A1VA 2HNTC 1DLEA 3DFLA 3TGIE 3G01A 1O2PA 9LPRA 3D62A 3RXVA 1DWEH 1CBWC 5F03A 3UR9A 4CRBA 1ANEA 1W2KH 4PROA 1LHCH 2GDDA 1GHAG 1MUEB 1GGDB 2AGGX 2ZEBA 1DX5M 1G30B 4K2YA 1YCPM 4M7GA 5JDUB 3LJJA 1ETRH 1EB1H 3GCHB 2BX4A 3V3MA 3MU1A 1NFXA 4XFQA 2ZFTA 3RXEA 3IWMA 1C2DA 2H1UA 2HALA 2UUFB 1EZXC 3TK9A 5JBAS 2BD2A 3BTME 3MH6A 2F9BH 1O3IA 3GY5A 4ZUHA 3RXCA 2B0FA 2TGTA 3SNCA 1H1BA 6CHAB 1YPHC 2ZECA 1KLIH 5GPIB 3T29A 1TX8A 3NKKA 5GCHF 1S5SA 4B2CA 4I8GA 1NRNH 2GV7A 3U8OH 2CF9H 3A86A 3TH2H 2AGEX 1FDPA 5EG4A 1MAXA 4QT8C 3TLOA 4UDWH 3QN7A 1TX6A 3KNXA 4MPXA 2RA3A 4YLUA 1KXFA 1CGIE 2ALPA 2RA0A 1SQAA 5EU8A 1LHEH 1AUTC 1MTNC 3BV9B 2J9NA 2BD7A 5FPTA 1SGTA 2WINI 3PO1B 2G5NA 1IQFA 3CS0A 3GY7A 4U01A 2A4GA 1BMNH 2OC7A 3UNSA 1CVWH 4K69A 4ZKNU 3ZZDA 8KME2 1YPJH 7GCHF 1GMDF 4Q80A 1QJ7B 4R0IA 3E6PH 4CBOA 1PQ8A 3IG6B 1GDNA 2BDCA 1BHXB 1P2QA 4IBLH 1BB0B 2P8OB 1C4Y2 3Q00A 2Y82A 4FVBA 4Y10E 1S6FA 1ZTJA 3ZVEA 4WWYA 3TJUA 1DM4B 1UTJA 4HFPB 3DD2H 1KLTA 3RXRA 1QHRB 2Z6BD 2G81E 1T8MA 1ZRKA 4X1QU 2GP9B 3NPSA 4ABIA 1SOTA 1LPKB 1G2LA 5AFZH 2XBYA 4CH2B 1T32A 1P9SA 4ZKSU 1W14U 1CBWB 2GCHG 1UVTH 1IQIA 4X2WA 3RXBA 3KQCA 2C3SA 1J16A 1GHZA
chains in the Genus database with same CATH superfamily
2Q6FA 4MPUA 2BD5A 1THPB 3R0FA 3VB7A 1O2KA 1N8OB 3KGPA 1TBRH 3CNRA 1GMHF 1ANCA 1UTMA 4X8UH 4YTAA 1EPTA 2FTLE 1DXPA 1HAPH 1EXFA 1UTLM 3GCHC 4GCHF 4AFSA 2ZGBH 2A1DB 1SGIB 2BD4A 3DUXH 4X2YA 3QWCH 4RT0A 4FOUC 2GDEH 1ZMNA 4Y0ZE 3RXHA 1TGTA 4K1TA 3P17H 1Y5UT 2QGRA 3KIDU 1TFXA 5G4BA 4E7RG 1P05A 1Q31A 2VWLA 3LPRA 2GT7A 4ACBA 1A61H 1YPGH 6CHAC 1KDQA 1VGCC 1NC6A 4BTTB 2B9LA 1VITG 2YMSD 1IHTH 1O2OA 3U8TH 1MQ5A 2ILNA 1O0DH 2PR3A 3F9GA 1C1RA 1DSTA 2BXUH 2OXSA 5F8XA 2ZDVH 4CBNA 4NZLA 3M35A 1RIWB 2BQWB 3SUFA 2FTMA 3JZ2B 2O8LA 2XCNA 2SGDE 5FX5A 1Z8RA 4BAKB 4IC5A 5T1VA 3SU1A 4O3TA 3VGCC 1TMBH 4Q4LA 2R9PA 1B5GH 1DUAA 1XVMA 3A85A 3HKJB 3L6PA 4B74A 3W1EA 3PTNA 4ABDA 3VG8A 3P8NA 1FNIA 3HATH 1QCPA 5FBEA 1MCVA 1GHWH 3KQEA 4D8NA 2W3KA 3LT3A 4WH6A 1AFQC 5K0HA 1QA0A 4KTUA 4XDEA 1GBCA 1VITF 4KTCA 3SJIA 3AW0A 4A92A 1QIXB 1ZMJA 3U98H 1MU8B 3OY5U 4ESTE 4GVUA 1HAXB 8ESTE 2YOLA 1TQ0B 1QRWA 3M5NA 1E38B 4X8VH 2UUJB 1O2TA 1O5BB 5JBTA 1L1NA 1V2QT 1UHBA 1FI8A 3FZDA 2QF0A 3WW7A 1O2YA 2J92A 4CRFA 1VJAU 2JETB 4WY3A 2GCTC 4U30A 1O2WA 2G52A 1IHSH 1O2RA 4YLQH 1TMTH 1BTWA 4J1YA 2JETC 3F9EA 1DXWA 1A5IA 2QC2A 3EAJA 4Z1MD 4NZQA 4Z0KA 3C27B 1P12E 2WPJS 1FY3A 1P3EA 1Y3UA 3LH1A 4X6PA 1OWDA 1TWXB 3UPEA 1TAWA 3A7ZA 4JK5A 2FX6A 5FL7D 4H42U 3SOSA 1VCPA 4ABGA 4A1TA 1HXFH 1O3FA 1GCTC 3TITA 3SU5A 1Z6EA 1AIXH 2ZDAH 2BY9X 1NY22 5IDKA 1DANH 1YCPH 2ZDKA 1V2TT 2M5TA 4X6OA 3EYDA 5AVDA 3OX7U 1LHFH 1SFQB 1AD8H 1ELCA 1JBUH 2Z94A 3SU2A 1E36B 1D4PB 2IPHA 4XD7D 1AU8A 1H8HD 1RGQA 2BZ6H 2L6OA 4KELA 1TBQH 2AH4X 4UFDH 2GMTC 3CS7A 1ETTH 1W8BH 3E8LA 1VGCB 2FI5E 2FWWA 5IK2D 3MU4A 1C2JA 2K0QA 1A5GH 3LOXA 4DJZB 3ZZ9A 3D65E 3B9FH 3AW1A 1SGPE 1GPZA 2W26A 4INHA 1HAVA 1PQ5A 3A7VA 3LKWA 1OP0A 3A88A 1FIWA 2YMSC 4LK4A 1OWKA 3QUMP 4CHAB 4U2WA 3ENSB 1Z1IA 2I6QA 2A4RA 1CA8B 1O2MA 1FLEE 1V2WT 1QJ1B 1K1OA 3P92A 4LXBH 1BTZA 1W7XH 2ZDLA 1IOEA 3OSYA 5F53A 3MO3A 1V2RT 4P00A 1Z8IB 2Y5FA 2A0QB 2ULLA 1O31A 1FQ3A 1QL9A 1ZMLA 2L74A 3I78A 2SGAA 5GXPA 4UD9H 1A5HA 3PB1E 1NFUA 2HRVA 3UOPA 2DE8A 3E0PB 1IQGA 2P95A 2SGPE 1SQOA 3PM3A 1OHHD 3GY4A 5C0UA 4NFFA 3NCLA 1MH0A 4JMYA 5I46H 1MBMA 3QZRA 4BTIB 4BTUB 3GY8A 4K5ZA 4OS1A 2O8TA 4CH8B 3MH5A 3RC6A 2XNDD 1EZSC 1TPOA 2R2WU 4KP0A 1PPFE 3TK5A 1P09A 3KYGA 2GX4A 3RXOA 1OXGA 3H09A 3AK5A 1Y3VA 3ZZ7A 1GBLA 3GDSA 1FY4A 2Z9KA 2BDYA 3FKSD 3TK6A 3FAOA 2CGAA 1EOLA 1NFWA 1BITA 3H7OA 3SJ8A 1SLVB 4IW4E 4I32A 4E05H 1L4DA 3KEEA 1P57B 1GHAF 1YLCA 1LHDH 2BM2A 2O8WA 4ASUD 5L30H 1O2SA 2RG3A 2ZTZA 5DP6A 2FOBA 4X1RU 2GCTB 3BTGE 3F6UH 1IQJA 4WMEA 1UK2A 1LMWB 5GNDA 2W3IA 2C8ZB 1SGEE 3SU0A 2Q6GA 3F9FA 2FOAA 1TRMA 1JRTA 2SNVA 1JWTA 4NIWA 3VB4A 2FOFA 2BDGA 1BMMH 3M7TA 1NRSH 3FVFB 2RCEA 1UTNA 1YCPK 2GTBA 2Z9LA 4MVNA 1TALA 5PTPA 4NA9H 1GJ5H 2FMJA 1XUJA 1ZJKA 3A8BA 1DSUA 1W3CA 3RXAA 3ATLA 3EA8A 3PV2A 3Q3KA 1HJAC 1AMHA 2J5UA 2ZC9H 1W12U 5DP4A 4OGYA 3K6YA 2VJ1A 2PGQB 5EW1H 1WTGH 2D8WA 1O2QA 5FPSA 9ESTA 3RXMA 1O2ZA 2VBCA 5ESTE 1PYTC 3RXUA 1NM6A 3LGIA 5CMXH 3S7HB 5C5OA 1TYNA 2VH6A 4VGCC 1O5AB 1YKTA 1UK3A 2A45B 1SQTA 4YXWD 1TRYA 3P95A 3QK1A 5FPYA 1BTUA 2ODQA 3SV8A 4ISHH 1LHGH 4FUEA 1A4WH 1AI8H 1UCYK 2VGCB 3A7WA 1MKWK 2AFQB 3N7EA 4X6MA 2ZO3H 3RXFA 1NS3A 1XUIA 3SV6A 3A8DA 3OY6U 5GWZA 2FDAA 2JH0D 2YNBA 2A5AA 2OBQA 4CREA 3UOUA 1O2UA 2JH6D 1AE8H 1ABJH 3HGNA 1DPOA 5EJZA 1TRNA 5CHAC 1G3BA 5FCRA 2EY4C 1NN6A 1OPHB 2TBSA 1CHOG 1FAXA 3B8JA 1RTFB 1XKAC 2VWNA 1UHBB 3P70B 2XC5A 4FUBA 3RM0H 6ESTA 1DICA 1ZLRA 3VGCB 4DT4A 3SGAE 4Z6AH 4ISNA 1ESTA 3O8BA 1AKSA 1RTKA 2FPZA 3PTBA 2BLVA 2ZGHA 4K1SA 2ANMH 1O3LA 1HLTH 1MZDA 3GYMA 2Y81A 1Y8TA 1C5OH 1Q2WA 1C5PA 3DFJA 2J2UA 4ZKOU 2AIPA 1FONA 2OC8A 4TPYA 1RRKA 1P11E 1N8OC 1WQSA 2ANYA 4WMFA 1NESE 1P03A 1H8ED 2A2QH 3QO6A 1GBFA 1MKWH 1RD3B 1H8DH 4RI0A 2KFWA 2XTTB 4AB8A 1SBWA 3NRLA 4IMZA 1LCYA 3PMJA 2ANWA 1V2ST 1TMUH 5LPFA 1FZZA 2TIOA 1IQNA 2BY7X 1HRTH 1UVUH 4I7YH 1OYTH 3ZZBA 1PPGE 2XC0A 1YPKH 3GCTG 1P8VC 1UCYH 2AMQA 2ZKSA 1WTHD 3SGBE 4WVPE 1NFYA 4DG4A 3FP7E 2ZDNA 3A83A 4BAHB 2ZHWH 1SGYE 5E0HA 1EUFA 3NWUA 1S84A 1SGFG 2DUCA 1HCGA 1GMCG 5F8TA 3ZZ8A 4AFUA 4NGAH 3LGUA 1QY6A 4GCHG 5GIBA 1ZJDA 5DPAA 1QL8A 4MNWA 1C1TA 4ACAA 1GBAA 1QGFA 3M3TA 3PRBA 2VVVA 4K8YA 2CV3A 4LOYH 3A89A 2KCOA 4HZHA 4Y71A 3N7OA 1KY9A 1WDIA 4F49A 1CT4E 3FOAA 3RXJA 2G4UA 4YT7H 3MQKC 2BY8X 3TNSA 2ZCKP 4TPIZ 1O3EA 1TA2A 1GBKA 2WHXA 3R3GB 3BN9A 2Y7XA 4Q7YA 1HAVB 3PLBA 2JJ2D 1SKYE 1KTTB 1C5RA 1H8IH 1P2MA 2HVYB 2FOHA 5EQQA 2BDHA 2AGIX 4Y0YE 1GL0E 4X2VA 3HPTB 5EJ1A 1C1PA 1BDAA 4FVDA 4O3UA 4DW2U 1D3DB 2BD8A 1QURH 5C1YA 1EPTC 1GJ4H 2NU2E 2KZ4A 3T28A 2F91A 1BA8B 2D1JA 1GMCF 1GI6A 5H4IB 3FO8D 1PPEE 2BTCE 1VJ9U 3ELAH 1GMDG 3SJOA 3SQEE 4ABAA 4B2BA 4AYYB 3F2GA 3SO3A 2VINA 1ACBE 1TA6A 2CF8H 1HAZB 3NZIA 2KM0A 1O5FH 2ASUB 1LO6A 1TOMH 1P06A 2WUBA 2HLCA 2XW9A 1SGCA 1AFQB 3U8RH 2I6SA 3UREA 5DSFA 1JOUB 1C2IA 1YPHE 3MNBA 3UQOA 3F0OA 1J14A 1DS2E 2FLRH 2FS9A 1THRH 2C8WB 2VVCA 4I31A 3SUGA 4ZROA 4NWLA 4FUHA 1OWHA 5SGAE 4AFZA 1QR3E 1K1NA 3Q3YA 3Q76A 1Y5BT 1Z8JB 1V3XA 2EEKA 4YT6H 1MTNB 4ZH8A 3TGKE 1HNEE 1TPAE 1O30A 3GOVB 3N99A 2WPDD 1C2GA 1XUFA 4B1TA 1YP9A 1F5KU 4ABEA 1V2NT 3A80A 1UCYE 1W11U 3F2FA 1RTLA 2SGFE 1TE0A 4UEHH 1GJBB 1NRQH 3M7UA 3PRDA 1C5VA 2P93A 5KEDA 1EP6A 1A3EH 2ESTE 1P10A 5TCCA 1GHVH 2XWBI 1SOZA 1LQEA 3BSQA 3C1KA 2O8MA 4OS2A 3BTWE 2NU3E 1K2I1 4D9RA 4MNXA 4X1SU 3UWIA 4WH8A 1Z8GA 2AYWA 2Y80A 1F0RA 1WV7H 1C1NA 4A5TS 4AG2A 4FUCA 5GJ4B 1T4VH 1BTHH 2IJD1 3OEHD 1O3GA 3W95A 4R8TB 2XOKD 1SHYA 5EPNA 3LC3A 2FODA 4IS5A 2UWOA 5FBIA 2EC9H 1KYNA 4I86A 1FMGA 2DE9A 3SJ9A 3DA9B 4FETA 3SQHE 3UY9A 4YESB 4BXWA 1QL7A 1ELFA 5C17A 3GISB 2SFAA 4JZIA 2OP9A 1D6WA 4JYTA 5LGOA 2FLBH 1PYTD 2WZQA 2QXIA 2BXTH 2GMTB 5T6FA 5GDSH 4AG1A 1SG8B 4GHQA 2BQ7B 3K2UA 3L3TA 1LPGB 4JCNA 3KCGH 3T26A 1FV9A 2BHGA 1ESBA 2C90B 5EXLA 2STBE 2BOKA 1E79D 1K21H 2Y6TA 4K60A 1G32B 5BPEA 1BZXE 1CO7E 1HJAB 3LGWA 1TQ7B 1UTOA 2C4FH 1J9CH 1ELBA 1ESAA 2F9PA 3M7QA 1ZZZA 3TIUA 4TY7A 4UFEH 2VVUA 3STIA 5F6MA 5AHGH 3SBKA 4TYDA 2CHAC 1A7SA 3RU4D 1BTYA 4ISLA 3RXIA 3A8CA 2BD3A 1BJVA 2K1QA 3BTEE 1X7AC 3RXLA 1SSXA 3GY6A 4DIHH 3PYHA 1F0SA 1OWEA 2O9QA 4BAMB 4FU9A 1K1PA 2QCYA 3ZZ4A 4JYUH 1BRBE 1GCDA 1QFKH 1GHYH 1C5MD 3GICB 5FAHA 1QQUA 1BRAA 4CRAA 2CN0H 1HAHH 3BG4C 2R3UA 1G9IE 5AFYH 3V0XA 1O5EH 1CHOF 3O8CA 2A7CA 2QIQA 2NWNA 3KYFA 5TCAA 4SGAE 2HPPH 1PQAA 1GVZA 1FY8E 1VCQA 1ZYOA 2HVXA 5GCHG 2JJ1D 1NU7B 1M9UA 5DGJA 1B0FA 1CHGA 2AHME 2P94A 3WWBA 2UWLA 1G3EA 3F3BA 1XM1A 2OD3B 2OTVA 4IN2A 1AVGH 1WOFA 1TGSZ 1ELGA 2Z9JA 3ITIA 4AC9A 2G5VA 3BTFE 1DWCH 1EZUC 2TGAA 4TWYA 1A0HB 4RKJB 1DOJA 1BT7A 1AWFH 3ZVFA 5L6NH 1RJXB 2WUCA 1GMHG 5FHTA 2QF3A 1TGNA 2ZPQA 2ZU1A 1CQQA 1JXPA 3PV5A 1C2EA 1ZPBA 4GPGA 5L2ZH 3GYLB 1C2LA 1E37B 1K1JA 3VB3A 2VNTA 1D3QB 3LIWA 1SGQE 2F9OA 4UONA 5HKKD 1S6HA 4NA7A 4XBDA 3SI3H 2ZPRA 1SL3A 5DN6D 1YY3A 2BOHB 5E8EH 2SNWA 1G37A 1AUJA 2QYIA 2WV5A 1BCUH 3E1XB 1E35B 3GCTF 2PP6A 1TNHA 3DSGA 1GI3A 1T31A 3QLPH 2WPLS 2ZI2H 1ELVA 2JKHA 2VH0A 1A3BH 1TNGA 3K6ZA 1A1RA 2ZZUH 1QBNA 3SU4A 1O2VA 1TB6H 5A09A 4NIVA 1SPJA 4ABBA 1TNJA 4GSOA 1TBZH 1DY9A 5FXLA 1GDUA 5HIZA 4AB9A 2GGVB 3SW2B 1N6YA 4H6TA 1S82A 2VIOA 1U6QA 2CK3D 2WYGA 3NXPA 1ELAA 5EOKA 1Y3YA 1EAUA 2XBWA 1TOCB 1AZ8A 1C1SA 2PW8H 2KCYA 1AE5A 1G3DA 1SGDE 4FUFA 1FXYA 3SYJA 3TH4H 4AYVB 1BRCE 5C2ZA 3GCOA 2Z3EA 4MQAA 1O3KA 3U1IB 3SI4H 2GZ9A 1O2JA 3TJNA 3E16B 5EXMA 1EKBB 2A5IA 2D2DA 3ODDA 4Y8YA 2CJIA 1ZGVA 2YMSB 1C2HA 3KQBA 1SQRA 1W7GH 4I8KA 1YBWA 2K8IA 3RMLH 1GJ9B 2ZTXA 4NCYA 2R3YA 2W7SA 4I8JA 1YC0A 2PTNA 1NZQH 5K7RA 4INLA 2Y5GA 2ZDMA 1EJMA 2VWOA 5EIYA 4YOIA 2B8OH 3UTUH 1YLNA 2QF5A 2Y5HA 2XBVA 3HKIB 2PV9B 2A2XH 3A8AA 3DT0H 1O3BA 3BTDE 1F0UA 3M3VA 1ZSLA 4AORA 1UVOA 3K9XB 2ZHFH 1TNKA 2LELA 2WPHS 8GCHF 2Z7FE 1O3CA 2XXLA 1TNIA 3DHKH 3SNBA 3ZV8A 1XX9A 2PTCE 2ZFFH 4WJG2 2ZCLP 3SORA 1HV7A 4JYVH 1GHBG 1NT1A 1SFIA 5KECA 1N1LA 4TWWA 1HPGA 4Y8XA 5E2PA 1TGCA 1YWUA 1XMNB 3SGQE 1MAYA 1AB9B 1C1OA 1GI1A 2IJOB 1EZQA 1HAYB 2XYAA 1F0TA 2FEQH 3P8FA 5LPEA 2ZP0H 3LONA 3KHVA 1KXAA 1GJAB 1MTWA 2BDIA 1K1MA 2FOGA 5T3HA 3HK3B 1YLDA 3BIUH 2W7UA 3S0NA 3BTQE 2PSXA 1J15A 2ZTYA 1QB9A 1L1GA 3SZNA 1ARCA 5B6OA 5CE1A 2WV9A 2ZGJA 1TX7A 4ISOA 4ZXYH 1MZAA 3KL6A 4I8LA 1PJPA 3LGYA 3MU8A 2W5EA 3LJOA 3ZVAA 1O39A 3UAIC 3VB6A 2BY6X 1GBMA 3SV9A 4AGKA 1GJ6A 1OP8A 2V6NA 3MTYA 4OS7A 1FN6A 7ESTE 2FOEA 1SLUB 3SN8A 2J95A 1XUGA 2KAIB 4LZ4B 3OFND 4OM9A 1SI5H 1WU1A 3KQ5A 4AX9H 1O3JA 1GG6B 3RDZA 4F48B 5DJ7A 2AS9A 3ZVBA 1CGHA 1JIMA 3M36A 2ZFPH 5HGGA 3E3TA 4CRCA 3OEED 3RUOA 2VIPA 2P3FH 3MU5A 4RN6A 3TVJB 4DY7B 5E0JA 1MD8A 1NRPH 1XVOA 2R0LA 2Z3DA 1UJ1A 1HXEH 5A8ZA 4XBCA 5B6LA 1BOQA 5EPYA 1SGFA 2BYAX 3U1JB 1IQEA 5A8XA 2J97A 1V2JT 1GBIA 3BEUA 1YPEH 4F55A 3TJVA 1HYLA 1P0SH 3ZVCA 1MTSA 1SLWB 1Y5AT 4D7FA 3OTPA 2CXVA 2IPQX 1NRRH 3VXEH 2BVSH 1HIAB 3VFEA 1MD7A 2A32A 2BDAA 1TGBA 2ODPA 1HDTH 2H9HA 2FI4E 1OSSA 1SMFE 1OP2A 2PGBB 3M3SA 4ZAEA 1EAWA 4J2YB 3RMMH 3UUZA 3KF2A 3S69A 1AQ7A 2KCPA 1Z1JA 2LP6A 4CRGA 1THSH 3TNTA 3CP7A 1GI5A 2JDID 2WPMS 3IITA 1O34A 1COWD 1ZHMA 3SU6A 3LC5A 3FZZA 2O8UA 3TGJE 1TPSA 1NU9A 1C9TA 4B75A 1YM0A 5CDFE 4MTBA 1O5CB 1QJ6B 1GJDB 1GCTB 2F83A 2LNCA 4XSKU 2HPQH 5JBCS 3LDXH 1A0JA 1EP5A 1GI9B 5KGOA 3MO6A 2ALVA 3VXFH 5A0BA 3OTJE 3BTTE 5C1UA 3GY2A 5LH8A 4ZHAA 1GBBA 1KDQB 2V3OH 2ODYB 3GY3A 3MHWU 2ZQ2A 1O2GH 4B71A 3GDUA 1FUJA 1UMAH 2ZGCA 1MBQA 1PPBH 7KMEH 2BLWA 1C5NH 1C5XB 4B76A 2ZFRH 2BZAA 1O33A 2Y7ZA 3ESTA 4DOQA 1LKAA 3MYWA 4I33A 1W10U 3Q77A 3U9AH 5A0AE 2PSYA 2TGDA 2FS8A 5HIYA 1AVWA 1FY1A 1IQLA 1NBME 3S9BA 1NROH 1L2EA 5E0GA 3I29A 1SGNE 3P6ZB 3HGPA 4Y7AA 1SHHB 2FM2A 3A87A 2ZHDA 5JBBS 4BOHA 1GJ7B 1BRUP 1HJ8A 1BMLA 4XBBA 2WSSD 1EJAA 2VWMA 4X0WU 3RP2A 4Q7ZA 1C5UA 4ZMAH 1HGTH 1K0HA 1BJUA 4NWKA 1V2PT 2C8XB 1ANBA 1UVPA 3VEQB 2EI8A 3GDVA 3TH3H 1DVAH 4O97A 2TPIZ 4X8SH 1AKSB 1ZOMA 2ZFQH 4B73A 2OQ5A 1DT2A 1KXBA 1G3CA 4NSYA 4DT7B 1IQMA 1O3OA 4O03A 3RXDA 5HXFA 2A31A 3CENA 4ZHMU 1ANDA 2VB0A 4XOJA 2ZHEH 5DK1A 2J98B 3T62A 2PLXA 1O5DH 2XC4A 2Z3CA 4FUDA 3PO1C 1QBVH 2G00A 2WPIS 5ETXA 3T27A 4Y6DA 1O2XA 5IYTA 1V2UT 1KIGH 4AN7A 3T25A 2QXJA 1E1QD 3H5CB 3SNEA 2HNTF 1QQ4A 2CMYA 5E2OA 3I77A 1ZPCA 1P2IA 2HLDD 3BF6H 1C5ZB 2BQ6B 2GZ7A 3ZVGA 1OYQA 1HAIH 2BDBA 4UFFH 5J4QA 1L0ZA 1CT2E 1TIOA 1GBEA 2J34A 4Q2KA 1GBTA 3E90B 3RXGA 4A7IB 4MLFB 2H5CA 3F68H 3RC4A 1UK4A 2RDLA 2ZWLH 1T4UH 2PKSC 1BTPA 1Y3WA 1EASA 2EQNA 2G4TA 1WBGB 2V0BA 4Y79A 2ZHQH 1GVKB 1KTSB 2ZG0H 1FAKH 1RFNA 2G55A 2PFEA 8GCHG 2FYQA 3AAUA 2OC1A 4H4FA 4AZ2B 2H5DA 2A4OA 2QN5T 3ZYEA 1JIRA 2ZNKH 1C5YB 2XBXA 3A81A 2F4LA 1YPLH 1D6RA 4X1NU 1GI4A 3ZZ5A 4CHAC 3URDA 2CHAB 2ZFSA 1KMHB 1QRZA 3RXQA 1WXRA 3LGTA 3MNXA 5JYIA 1O37A 1HBTH 2PKAA 1P01A 1T7CA 1MTUA 2H9EH 1C2MA 2P3TB 1WQVH 3PWCA 3HK6B 4K3JA 3E91A 3MMGA 4WF8A 1ZR0A 4IC6A 3UFAA 4VGCB 3O8RA 2BD9A 1OWIA 1FJSA 4YOGA 3ZV9A 3F2HA 5DG6A 1GDQA 2W6JD 2ANKH 1FN8A 1GI2A 3EGKH 1O2NA 1HFDA 2KCAA 2GKVE 5A0CA 2HGTH 1H9LB 3SZEA 3MO9A 1K22H 4OS4A 3OYPA 2A4QA 3BEIB 4MNYA 1NO9H 1NBMD 3NUMA 3MH4A 3ZZ6A 1GVLA 3D49H 1Y59T 4RSPA 1W13U 4NA8A 4AOQA 4K1EA 2QV1A 2XNIA 3RLWH 2QAAA 4FU8A 1GJ8B 2HNTE 4KTSA 4D9QA 1C4V2 1E34B 5T6GA 5ABWA 5C0TA 4JZFH 1GHBF 2PUXB 4Q7XA 2FP7B 1P9UA 2WYJA 1KXDA 3ZYDA 2B5TB 5I25A 2P59A 2Z9IA 1GHXH 3L33A 4D76A 1YPMH 2PHBA 1F2SE 2P8OC 3MH7A 1AN1E 2EA3A 4OGXA 3TU7H 4K8BA 4JK6A 5DO4H 3FFGA 2H2ZA 3MNSA 2OQUA 1V2MT 2GV6A 1O2LA 1IQHA 4X6NA 1FPHH 5C1XA 8LPRA 4KKDA 1LVYA 1D3PB 2ZQ1A 1XXDA 4IN1A 4KGAA 3A84A 1VCWA 3N7DA 1P2KA 3UWJH 3FP8E 3SHCH 3QZQA 1K28D 3PMHB 1EOJA 1FIZA 2BLQA 2BY5X 4GUXA 4RT1A 2BLOA 1J17T 3LH3A 3E0NB 3RLYH 4THNH 1CGJE 5EXNA 1L1JA 1QTFA 5L2YH 4TY6A 4WMDA 1FY5A 2NU4E 2OK5A 1Z6JH 2JH5D 2A7HA 3SJKA 3QTVH 4A6LA 2GD4B 4HI3A 5TJXA 3QX5H 3A82A 2Z9GA 1BBRH 5C3NA 2J98A 1GJCB 1LTOA 4E06H 1O2HA 2IN2A 1OWJA 1Z71A 1S6LA 2QY0B 1V2OT 4FUIA 5ESBA 5F8ZA 4ZCNA 1QA7A 4NG9H 4DCDA 1S83A 1D3TB 1MKXK 1ZTLA 1LQDB 1DLKB 1ZRBA 2M2AA 2THFB 1ZHRA 2HOBA 2QXHA 4YZUA 1ELEE 1B7XB 1E0FD 2AMPA 3EDXB 1FX0B 2FXRA 1LKBA 3QGNB 4B6EA 1BTXA 4MDSA 1WCZA 3OU0A 1L4ZA 1V6DA 3SUEA 1C1QA 4JZ1A 2QXGA 4O9VA 1AZZA 4AFQA 1ZGIA 2A7JA 3U28C 1KLJH 1XKBC 3AASA 4ZHLU 1ZSJA 1S0QA 5HMAA 1AGJA 2FESH 1DY8A 2J4IA 2GZ8A 5CHAB 5C20A 1MMJN 2FI3E 5C94A 1DUEA 2Q6DA 5HYOA 2AEIH 1TABE 3DSOA 2Q1JA 1EPTB 1BBRK 5FCKA 1DE7H 1DFPA 3SU3A 1ORFA 5HM9A 3ATMA 1GWAA 3FN8A 3URCA 1RS0A 1ABIH 2AIQA 4INKA 4MNVA 1C5TA 2W6ID 2OUAA 4Q63A 1MKXH 2BB4A 2FIRH 1CA0B 1GI8B 3SV7A 3MU0A 1SVPA 2PWXA 1VITH 4AGJA 2BVRH 2F9NA 3RMNH 1INCA 4ABFA 2FOMB 1C2FA 1KSNA 1BMFD 1CU1A 1CA0C 1BMAA 2FX4A 3EE0B 1UVSH 2ZF0H 2EI7A 2OLGA 3TJOA 3V7TA 4B2AA 3RMOH 2FO9A 2ZPSA 4U32A 4F4OC 1XUHA 3OE7D 1P2NA 2OBOA 1PQ7A 2F43B 1EFRD 3VB5A 3EA9A 2AMDA 1RIWC 1C5LH 3A7TA 3SHAH 1BHXF 1AFEH 1ETSH 1AB9C 1O3PB 1EX3A 2FYRA 4BNRA 1Y3XA 3MI4A 4NIXA 2SGQE 4TT3D 1WSSH 2R0KA 1CT0E 4GAWA 1LDTT 3RXTA 4BAOB 1O3MA 1AWHB 4DGJA 1G36A 2EI6A 3H7TA 3F9HA 5A2MH 5DKMA 4UE7H 1LVBA 2V35A 5C5NA 1MABB 1PPCE 2IOTA 2QE7D 5CHBA 2WV4A 1EJNA 2XWAA 1C1VH 4BAQB 1SR5C 5EQSA 1F5RA 2VIVA 4OS6A 3RU4T 3V12A 3W94A 4ZXXH 5DP5A 1O38A 1K1LA 1O3AA 1EATA 1A0LA 2G51A 1YF4A 1ZTKA 2QA9E 4ZKRU 1N6XA 1HAOH 2F9VA 3ATKA 4HTCH 5JB9S 3BG8A 1SLXB 1EAXA 3GS9A 4ISIH 3PMAB 4MPWA 1EB2A 1O32A 5HM2A 1UO6A 2ZGXH 1J8AA 1QRXA 4Y8ZA 1QB6A 1T8LA 2BMGB 3RXSA 4ABHA 1TONA 4NIYA 2ZU3A 1GL1A 1F7ZA 3U69H 2NU0E 1C9PA 3QTOH 1VR1H 1LVMA 4WXVA 1E1RD 3ZIAD 1W0JD 4X8TH 1BIOA 1WUNH 1OS8A 3DCLA 3S9AA 1QZ8A 1ARBA 3VPKA 3UNQA 1GBJA 3UB0A 3QGJA 1AY6H 1QBOA 1Z7KA 1EAIA 2P3UB 2FZZA 3A7YA 1O36A 5EJLA 3RM2H 2OCVB 1P02A 2A5KA 3SUDA 4I8HA 5DP7A 1MCTA 1P2OA 3M5LA 3SNAA 3ATIA 2F9UA 1C5SA 2VGCC 4DVAU 2KR7A 4HGCA 1H9HE 4MG3A 1V2KT 4FUJA 3GCNA 3ODFA 5EQRA 1DITH 1SC8U 4UFGH 2C93B 1S81A 3S7KB 3EQ0H 3EE7A 3ZZ3A 4FXGH 5AF9H 3BG4B 2VIDA 6LPRA 1P3CA 2VU8E 3TPIZ 4ASHA 3NK8A 1G2MA 2UWPA 6GCHF 1S0RA 4Y7BA 1AO5A 3BIVH 4RKOB 5FX6A 4NFEA 1GI0A 1O35A 3F1SB 2PUQH 3MFJA 3UIRA 1DWBH 3M5OA 2KX4A 1PFXC 2AERH 3BEFB 3P8OA 1VKYA 1W0YH 5JPMH 2SGEE 4E7NA 1NPMA 2UUKB 3KQDA 1C1UH 1IQKA 4P02A 1BQYA 1C5WB 1T8NA 1AHTH 1O5GH 1YGCH 1IAUA 1C4U2 1P04A 3PWBA 2D26C 2ZA5A 3MNCA 3PLKA 1C1MA 2H9TH 3KN2A 2TRMA 1PPZA 1QB1A 2XCFA 1F5LA 3MOCA 2PKAB 1GBDA 4FU7A 1T8OA 1BBRE 1MQ6A 1ELDE 5C67A 1MTVA 1LVOA 1DDJA 3BTHE 3M61U 3SV2H 2GJGA 7GCHG 2B7DH 4DIIH 4Y76A 1A2CH 1CE5A 3F0PA 4D7GA 2PKSB 2R2MB 4B6FA 1CSOE 1HAGE 3MWIU 2G8TA 3JZ1B 3RXPA 3P8GA 4JZEH 7LPRA 3EA7A 2J38A 2TGPZ 1KXEA 1ZSKA 1TLDA 3D23A 1YYY1 3RXKA 2J94A 5T6DA 1SGRE 2XRCA 3RC5A 1RXPA 2RDEA 2V3HH 3AAVA 4OS5A 1GGDC 3LGVA 1HIAA 4YM9A 3STJA 1K9OE 1KXCA 4Y11E 3UR6A 1V2VT 1VZQH 2KAIA 5DP8A 4X1PU 3O8DA 3QDZB 1NTPA 1B0EA 1EQ9A 2OC0A 3T5FH 2JIZD 3UNRA 1ELTA 2ZU5A 3LU9B 5EODA 4JZDH 3RU4E 2VIQA 3FP6E 4CRDA 4LZ1H 2NU1E 1GBHA 2GT8A 1F92A 1AVXA 3AVZA 1P2JA 1C5QA 1O3NA 4H6SB 2LPRA 3M5MA 2YNAA 1JMOH 1GG6C 1O2IA 1HUTH 4IGDA 4CR5A 4GHTA 5DP9A 1S85A 6GCHG 4BXSA 3FANA 2ZIQH 1OX1A 1C1WH 3PROA 1WYKA 1OOKB 2ZU4A 2UUYA 1LPZB 1ZPZA 3WY8A 1SB1H 4XRNA 1XXFA 4DURA 3B23B 1BUIA 1HJ9A 5EGMA 4ABJA 4YO9A 3WWFA 2QF4A 2GCHF 3V13A 3A7XA 3SNDA 1H9IE 2ZU2A 3S9CA 1A46H 2STAE 1UTPA 2H6MA 5BRRE 2OINA 3PMBB 5J4SA 2BX3A 4XE4A 4CR9A 1C2KA 1D9IA 1DWDH 4WXIA 1TPPA 3T2NA 1OKXA 5LPRA 1JRSA 4YOJA 1UTQA 5JB8S 2FOCA 1O3HA 2P16A 2ZCHP 2VIWA 3ZZCA 1GI7B 1TNLA 1H4WA 4BANB 3UQVA 2WPKS 1HB0B 1Q3XA 2V3MA 3BTKE 2C8YB 1QNJA 4A1XA 1XUKA 1ZHPA 2F3CE 4FUGA 3PLPA 1FPCH 1K1IA 3PV4A 1ID5H 3ATWA 4X2XA 3K65B 4IMQA 4NSVA 1UTKA 3ZVDA 3M37A 5DP3A 5EW2H 2BVXH 1WAYB 1O3DA 1PPHE 4MPVA 1V2LT 4SGBE 5A8YA 2GVFA 1MU6B 3ZZAA 3Q3XA 4GLYA 1UW7A 2HWLB 1W0ZU 4A1VA 3OAAD 2HNTC 1DLEA 3DFLA 3TGIE 3G01A 1O2PA 9LPRA 3D62A 3RXVA 1DWEH 1CBWC 5F03A 4M9FA 3UR9A 4CRBA 1ANEA 1W2KH 4PROA 1LHCH 2GDDA 1GHAG 1MUEB 1GGDB 2AGGX 2ZEBA 1DX5M 1G30B 4K2YA 1YCPM 4M7GA 5JDUB 3LJJA 1ETRH 1EB1H 3GCHB 2BX4A 3V3MA 3MU1A 1NFXA 4XFQA 2ZFTA 3RXEA 3IWMA 1C2DA 2H1UA 2HALA 2UUFB 1EZXC 3TK9A 2RFKC 5JBAS 2BD2A 3BTME 3MH6A 2V7QD 2F9BH 1O3IA 3GY5A 4ZUHA 3RXCA 2B0FA 2TGTA 3SNCA 1H1BA 6CHAB 1YPHC 2ZECA 1KLIH 5GPIB 3T29A 1TX8A 3NKKA 5GCHF 1S5SA 4B2CA 4TSFD 1W0KD 4I8GA 1NRNH 2GV7A 3U8OH 2CF9H 3A86A 3TH2H 2AGEX 1FDPA 5EG4A 1MAXA 4QT8C 3TLOA 4UDWH 3QN7A 1TX6A 3KNXA 4MPXA 2RA3A 4YLUA 1KXFA 1CGIE 2ALPA 2RA0A 1SQAA 5EU8A 1LHEH 1AUTC 1MTNC 3BV9B 2J9NA 2BD7A 5FPTA 1SGTA 2WINI 3PO1B 2G5NA 1IQFA 3CS0A 3GY7A 4U01A 2A4GA 1BMNH 2OC7A 3UNSA 1CVWH 4HG6A 4K69A 4ZKNU 3ZZDA 8KME2 1YPJH 7GCHF 1GMDF 4Q80A 1QJ7B 4R0IA 3E6PH 4CBOA 1PQ8A 3IG6B 3DSPA 1GDNA 2BDCA 1BHXB 1P2QA 4IBLH 1BB0B 2P8OB 1C4Y2 3Q00A 2Y82A 4FVBA 4Y10E 1S6FA 1ZTJA 3ZVEA 4WWYA 3TJUA 1DM4B 1UTJA 4HFPB 3DD2H 1KLTA 3RXRA 1QHRB 2Z6BD 2G81E 1T8MA 1ZRKA 4X1QU 2GP9B 3NPSA 4ABIA 1SOTA 1LPKB 1G2LA 5AFZH 2XBYA 4CH2B 1T32A 1P9SA 4ZKSU 1W14U 1CBWB 2GCHG 1UVTH 1IQIA 4X2WA 3RXBA 3KQCA 2C3SA 1J16A 1GHZA
chains in the Genus database with same CATH topology
2Q6FA 4MPUA 2BD5A 1THPB 3R0FA 3VB7A 1O2KA 1N8OB 3KGPA 1TBRH 1GMHF 1ANCA 1UTMA 4X8UH 4YTAA 1EPTA 2FTLE 1DXPA 1HAPH 1EXFA 1UTLM 3GCHC 4GCHF 4AFSA 2ZGBH 2A1DB 1SGIB 2BD4A 3DUXH 4X2YA 3QWCH 2GDEH 1ZMNA 4Y0ZE 3RXHA 1TGTA 4K1TA 3P17H 1Y5UT 2QGRA 3KIDU 1TFXA 5G4BA 4E7RG 1P05A 1Q31A 2VWLA 3LPRA 2GT7A 1A61H 1YPGH 6CHAC 1KDQA 1VGCC 1NC6A 4BTTB 2B9LA 1VITG 3U8TH 1IHTH 1O2OA 1MQ5A 2ILNA 1O0DH 2PR3A 3F9GA 1C1RA 1DSTA 2BXUH 2OXSA 5F8XA 2ZDVH 4CBNA 4NZLA 3M35A 1RIWB 2BQWB 3SUFA 2FTMA 3JZ2B 2O8LA 2XCNA 2SGDE 5FX5A 1Z8RA 4BAKB 4IC5A 3SU1A 4O3TA 3VGCC 1TMBH 2R9PA 1B5GH 1DUAA 1XVMA 3A85A 3HKJB 3L6PA 4B74A 3PTNA 4ABDA 3P8NA 1FNIA 3HATH 1QCPA 5FBEA 1MCVA 1GHWH 3KQEA 4D8NA 2W3KA 3LT3A 4WH6A 1AFQC 5K0HA 1QA0A 4KTUA 4XDEA 1GBCA 1VITF 4KTCA 3SJIA 3AW0A 4A92A 1QIXB 1ZMJA 3U98H 1MU8B 3OY5U 4ESTE 4GVUA 1HAXB 8ESTE 2YOLA 1TQ0B 1QRWA 3M5NA 1E38B 4X8VH 2UUJB 1O2TA 1O5BB 5JBTA 1L1NA 1V2QT 1UHBA 1FI8A 3FZDA 2QF0A 1O2YA 2J92A 4CRFA 1VJAU 2JETB 4WY3A 2GCTC 4U30A 1O2WA 2G52A 1IHSH 1O2RA 4YLQH 1TMTH 1BTWA 4J1YA 2JETC 3F9EA 1DXWA 1A5IA 2QC2A 3EAJA 4NZQA 4Z0KA 3C27B 1P12E 2WPJS 1FY3A 1P3EA 1Y3UA 3LH1A 4X6PA 1OWDA 1TWXB 3UPEA 1TAWA 3A7ZA 4JK5A 2FX6A 4H42U 3SOSA 1VCPA 4ABGA 4A1TA 1HXFH 1O3FA 1GCTC 3TITA 3SU5A 1Z6EA 1AIXH 2ZDAH 2BY9X 1NY22 5IDKA 1DANH 1YCPH 2ZDKA 1V2TT 2M5TA 4X6OA 3EYDA 5AVDA 3OX7U 1LHFH 1SFQB 1AD8H 1ELCA 1JBUH 2Z94A 3SU2A 1E36B 1D4PB 2IPHA 1AU8A 1RGQA 2BZ6H 4KELA 1TBQH 2AH4X 4UFDH 2GMTC 3CS7A 1ETTH 1W8BH 3E8LA 1VGCB 2FI5E 2FWWA 3MU4A 1C2JA 1A5GH 3LOXA 4DJZB 3ZZ9A 3D65E 3B9FH 3AW1A 1SGPE 1GPZA 2W26A 4INHA 1HAVA 1PQ5A 3A7VA 3LKWA 1OP0A 3A88A 1FIWA 4LK4A 1OWKA 3QUMP 4CHAB 4U2WA 3ENSB 1Z1IA 2I6QA 2A4RA 1CA8B 1O2MA 1FLEE 1V2WT 1QJ1B 1K1OA 3P92A 4LXBH 1BTZA 1W7XH 2ZDLA 1IOEA 3OSYA 3MO3A 1V2RT 1Z8IB 2Y5FA 2A0QB 2ULLA 1O31A 1FQ3A 1QL9A 1ZMLA 3I78A 2SGAA 5GXPA 4UD9H 1A5HA 3PB1E 1NFUA 2HRVA 3UOPA 2DE8A 3E0PB 1IQGA 2P95A 2SGPE 1SQOA 3PM3A 3GY4A 4NFFA 3NCLA 1MH0A 4JMYA 5I46H 1MBMA 3QZRA 4BTIB 4BTUB 3GY8A 4K5ZA 4OS1A 2O8TA 4CH8B 3MH5A 3RC6A 1EZSC 1TPOA 2R2WU 4KP0A 1PPFE 3TK5A 1P09A 3RXOA 2GX4A 1OXGA 1Y3VA 3ZZ7A 1GBLA 3GDSA 1FY4A 2Z9KA 2BDYA 3TK6A 3FAOA 2CGAA 1EOLA 1NFWA 1BITA 3H7OA 3SJ8A 1SLVB 4IW4E 4I32A 4E05H 1L4DA 3KEEA 1P57B 1GHAF 1YLCA 1LHDH 2BM2A 2O8WA 5L30H 1O2SA 2RG3A 2ZTZA 5DP6A 2FOBA 4X1RU 2GCTB 3BTGE 3F6UH 1IQJA 4WMEA 1UK2A 1LMWB 2W3IA 2C8ZB 1SGEE 3SU0A 2Q6GA 3F9FA 2FOAA 1TRMA 1JRTA 2SNVA 1JWTA 4NIWA 3VB4A 2FOFA 2BDGA 1BMMH 3M7TA 1NRSH 3FVFB 2RCEA 1UTNA 1YCPK 2GTBA 2Z9LA 4MVNA 1TALA 5PTPA 4NA9H 1GJ5H 2FMJA 1XUJA 1ZJKA 3A8BA 1DSUA 1W3CA 3RXAA 3ATLA 3EA8A 3Q3KA 1HJAC 1AMHA 2ZC9H 1W12U 5DP4A 4OGYA 3K6YA 2VJ1A 2PGQB 5EW1H 1WTGH 2D8WA 1O2QA 5FPSA 9ESTA 3RXMA 1O2ZA 5ESTE 1PYTC 3RXUA 1NM6A 3LGIA 5CMXH 3S7HB 5C5OA 1TYNA 2VH6A 4VGCC 1O5AB 1YKTA 1UK3A 2A45B 1SQTA 1TRYA 3P95A 3QK1A 5FPYA 1BTUA 2ODQA 3SV8A 4ISHH 1LHGH 4FUEA 1A4WH 1AI8H 1UCYK 2VGCB 3A7WA 1MKWK 2AFQB 4X6MA 2ZO3H 3RXFA 1NS3A 1XUIA 3SV6A 3A8DA 3OY6U 5GWZA 2FDAA 2JH0D 2YNBA 2A5AA 2OBQA 4CREA 3UOUA 1O2UA 2JH6D 1AE8H 1ABJH 3HGNA 1DPOA 1TRNA 5CHAC 1G3BA 5FCRA 1NN6A 1OPHB 2TBSA 1CHOG 1FAXA 3B8JA 1RTFB 1XKAC 2VWNA 1UHBB 3P70B 2XC5A 4FUBA 3RM0H 6ESTA 1DICA 1ZLRA 3VGCB 3SGAE 4Z6AH 4ISNA 1ESTA 3O8BA 1AKSA 1RTKA 2FPZA 3PTBA 2BLVA 2ZGHA 4K1SA 2ANMH 1O3LA 1HLTH 1MZDA 3GYMA 2Y81A 1Y8TA 1C5OH 1Q2WA 1C5PA 3DFJA 2J2UA 4ZKOU 2AIPA 1FONA 2OC8A 4TPYA 1RRKA 1P11E 1N8OC 1WQSA 2ANYA 4WMFA 1NESE 1P03A 2A2QH 3QO6A 1GBFA 1MKWH 1RD3B 1H8DH 2XTTB 4AB8A 1SBWA 4IMZA 1LCYA 3PMJA 2ANWA 1V2ST 1TMUH 5LPFA 1FZZA 2TIOA 1IQNA 2BY7X 1HRTH 1UVUH 4I7YH 1OYTH 3ZZBA 1PPGE 2XC0A 1YPKH 3GCTG 1P8VC 1UCYH 2AMQA 2ZKSA 1WTHD 3SGBE 4WVPE 1NFYA 4DG4A 3FP7E 2ZDNA 3A83A 4BAHB 2ZHWH 1SGYE 5E0HA 1EUFA 3NWUA 1S84A 1SGFG 2DUCA 1HCGA 1GMCG 5F8TA 3ZZ8A 4AFUA 4NGAH 3LGUA 1QY6A 4GCHG 5GIBA 1ZJDA 5DPAA 1QL8A 4MNWA 1C1TA 1GBAA 1QGFA 3M3TA 2VVVA 4K8YA 2CV3A 4LOYH 3A89A 4HZHA 4Y71A 3N7OA 1KY9A 4F49A 3RXJA 1CT4E 4YT7H 2G4UA 2BY8X 3TNSA 2ZCKP 4TPIZ 1O3EA 1TA2A 1GBKA 3R3GB 3BN9A 2Y7XA 4Q7YA 1HAVB 3PLBA 1KTTB 1C5RA 1H8IH 1P2MA 2FOHA 5EQQA 2BDHA 2AGIX 4Y0YE 1GL0E 4X2VA 3HPTB 1C1PA 1BDAA 4FVDA 4O3UA 4DW2U 1D3DB 2BD8A 1QURH 5C1YA 1EPTC 1GJ4H 2NU2E 3T28A 2F91A 1BA8B 2D1JA 1GMCF 1GI6A 5H4IB 1PPEE 2BTCE 1VJ9U 3ELAH 1GMDG 3SJOA 3SQEE 4ABAA 4B2BA 4AYYB 3SO3A 2VINA 1ACBE 1TA6A 2CF8H 1HAZB 3NZIA 1O5FH 2ASUB 1LO6A 1TOMH 1P06A 2WUBA 2HLCA 2XW9A 1SGCA 1AFQB 3U8RH 2I6SA 3UREA 1JOUB 1C2IA 1YPHE 3MNBA 3UQOA 1J14A 1DS2E 2FLRH 2FS9A 1THRH 2C8WB 2VVCA 4I31A 3SUGA 4ZROA 4NWLA 4FUHA 1OWHA 5SGAE 4AFZA 1QR3E 1K1NA 3Q3YA 3Q76A 1Y5BT 1Z8JB 1V3XA 2EEKA 4YT6H 1MTNB 4ZH8A 3TGKE 1HNEE 1TPAE 1O30A 3GOVB 1C2GA 1XUFA 4B1TA 1YP9A 1F5KU 4ABEA 1V2NT 3A80A 1UCYE 1W11U 1RTLA 2SGFE 1TE0A 4UEHH 1GJBB 1NRQH 3M7UA 1C5VA 2P93A 1EP6A 1A3EH 2ESTE 1P10A 5TCCA 1GHVH 2XWBI 1SOZA 1LQEA 3BSQA 3C1KA 2O8MA 4OS2A 3BTWE 2NU3E 1K2I1 4D9RA 4MNXA 4X1SU 3UWIA 4WH8A 1Z8GA 2AYWA 2Y80A 1F0RA 1WV7H 1C1NA 4A5TS 4AG2A 4FUCA 5GJ4B 1T4VH 1BTHH 1O3GA 3W95A 4R8TB 1SHYA 5EPNA 3LC3A 2FODA 4IS5A 2UWOA 5FBIA 2EC9H 1KYNA 1FMGA 2DE9A 3SJ9A 3DA9B 3SQHE 3UY9A 4BXWA 4YESB 1QL7A 1ELFA 3GISB 2SFAA 4JZIA 2OP9A 1D6WA 4JYTA 5LGOA 2FLBH 1PYTD 2QXIA 2BXTH 2GMTB 5T6FA 5GDSH 4AG1A 1SG8B 4GHQA 2BQ7B 3K2UA 3L3TA 1LPGB 4JCNA 3KCGH 3T26A 1FV9A 2BHGA 1ESBA 2C90B 5EXLA 2STBE 2BOKA 2Y6TA 1K21H 4K60A 5BPEA 1G32B 1BZXE 1CO7E 1HJAB 3LGWA 1TQ7B 1UTOA 2C4FH 1J9CH 1ELBA 1ESAA 2F9PA 3M7QA 1ZZZA 3TIUA 4TY7A 4UFEH 2VVUA 3STIA 5F6MA 5AHGH 3SBKA 4TYDA 2CHAC 1A7SA 3RU4D 1BTYA 4ISLA 3RXIA 3A8CA 2BD3A 1BJVA 2K1QA 3BTEE 1X7AC 3RXLA 1SSXA 3GY6A 4DIHH 3PYHA 1F0SA 1OWEA 2O9QA 4BAMB 4FU9A 1K1PA 2QCYA 3ZZ4A 4JYUH 1BRBE 1GCDA 1QFKH 1GHYH 1C5MD 3GICB 5FAHA 1QQUA 1BRAA 4CRAA 2CN0H 1HAHH 3BG4C 2R3UA 1G9IE 5AFYH 3V0XA 1O5EH 1CHOF 3O8CA 2A7CA 2QIQA 2NWNA 5TCAA 4SGAE 2HPPH 1PQAA 1GVZA 1FY8E 1VCQA 1ZYOA 2HVXA 5GCHG 1NU7B 1M9UA 5DGJA 1B0FA 1CHGA 2P94A 2UWLA 1G3EA 1XM1A 2OD3B 2OTVA 4IN2A 1AVGH 1WOFA 1TGSZ 1ELGA 2Z9JA 3ITIA 2G5VA 3BTFE 1DWCH 1EZUC 2TGAA 4TWYA 1A0HB 4RKJB 1DOJA 1BT7A 1AWFH 3ZVFA 5L6NH 1RJXB 2WUCA 1GMHG 5FHTA 2QF3A 1TGNA 2ZPQA 2ZU1A 1CQQA 1JXPA 1C2EA 1ZPBA 4GPGA 5L2ZH 3GYLB 1C2LA 1E37B 1K1JA 3VB3A 2VNTA 1D3QB 3LIWA 1SGQE 2F9OA 4UONA 1S6HA 4NA7A 4XBDA 3SI3H 2ZPRA 1SL3A 2BOHB 5E8EH 2SNWA 1G37A 1AUJA 2QYIA 2WV5A 1BCUH 3E1XB 1E35B 3GCTF 1TNHA 1GI3A 1T31A 3QLPH 2WPLS 2ZI2H 1ELVA 2JKHA 2VH0A 1A3BH 1TNGA 3K6ZA 1A1RA 2ZZUH 1QBNA 3SU4A 1O2VA 1TB6H 5A09A 4NIVA 1SPJA 4ABBA 1TNJA 4GSOA 1TBZH 1DY9A 5FXLA 1GDUA 4AB9A 2GGVB 3SW2B 1N6YA 4H6TA 1S82A 2VIOA 1U6QA 2WYGA 3NXPA 1ELAA 5EOKA 1Y3YA 1EAUA 2XBWA 1TOCB 1AZ8A 1C1SA 2PW8H 1AE5A 1G3DA 1SGDE 4FUFA 1FXYA 3TH4H 4AYVB 1BRCE 5C2ZA 3GCOA 2Z3EA 4MQAA 1O3KA 3U1IB 3SI4H 2GZ9A 1O2JA 3TJNA 3E16B 5EXMA 1EKBB 2A5IA 2D2DA 3ODDA 4Y8YA 2CJIA 1ZGVA 1C2HA 3KQBA 1W7GH 4I8KA 1YBWA 3RMLH 1GJ9B 2ZTXA 4NCYA 2R3YA 2W7SA 4I8JA 1YC0A 2PTNA 1NZQH 5K7RA 4INLA 2Y5GA 2ZDMA 1EJMA 2VWOA 4YOIA 2B8OH 3UTUH 2Y5HA 2XBVA 3HKIB 2PV9B 2A2XH 3A8AA 3DT0H 1O3BA 3BTDE 1F0UA 3M3VA 1ZSLA 4AORA 1UVOA 3K9XB 2ZHFH 1TNKA 2WPHS 8GCHF 2Z7FE 1O3CA 2XXLA 1TNIA 3DHKH 3SNBA 3ZV8A 1XX9A 2PTCE 2ZFFH 4WJG2 2ZCLP 3SORA 1HV7A 4JYVH 1GHBG 1NT1A 1SFIA 1N1LA 4TWWA 1HPGA 4Y8XA 5E2PA 1TGCA 1XMNB 3SGQE 1MAYA 1AB9B 1C1OA 1GI1A 2IJOB 1EZQA 1HAYB 2XYAA 1F0TA 2FEQH 3P8FA 5LPEA 2ZP0H 3LONA 3KHVA 1KXAA 1GJAB 1MTWA 2BDIA 1K1MA 2FOGA 5T3HA 3HK3B 1YLDA 3BIUH 2W7UA 3S0NA 3BTQE 2PSXA 1J15A 2ZTYA 1QB9A 1L1GA 3SZNA 1ARCA 5B6OA 5CE1A 2ZGJA 1TX7A 4ISOA 4ZXYH 1MZAA 3KL6A 4I8LA 1PJPA 3LGYA 3MU8A 2W5EA 3LJOA 3ZVAA 1O39A 3VB6A 2BY6X 1GBMA 3SV9A 4AGKA 1GJ6A 1OP8A 2V6NA 3MTYA 4OS7A 1FN6A 7ESTE 2FOEA 1SLUB 3SN8A 2J95A 1XUGA 2KAIB 4LZ4B 1SI5H 1WU1A 4AX9H 1O3JA 1GG6B 3RDZA 5DJ7A 2AS9A 3ZVBA 1CGHA 1JIMA 3M36A 2ZFPH 5HGGA 3E3TA 4CRCA 3RUOA 2VIPA 2P3FH 3MU5A 4RN6A 3TVJB 4DY7B 5E0JA 1MD8A 1NRPH 1XVOA 2R0LA 2Z3DA 1UJ1A 1HXEH 5A8ZA 4XBCA 1BOQA 5EPYA