1T31A

A dual inhibitor of the leukocyte proteases cathepsin g and chymase with therapeutic efficacy in animals models of inflammation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel, potent dual inhibitor of the leukocyte proteases cathepsin G and chymase: molecular mechanisms and anti-inflammatory activity in vivo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chymase
total genus 49
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1t31A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1t31A02
1SLVB 1C1SA 2ZPSA 1MQ6A 2W7UA 1GHZA 3BG4B 2JH0D 4ZXYH 1GMHF 2AEIH 3GCHC 3SNCA 3HPTB 1ZGIA 3A80A 4YZUA 1NU9A 3S9AA 2AIPA 3SV8A 3LPRA 4GCHF 1N6YA 1OP0A 1ZMLA 3A81A 1KXBA 1PPFE 1CGJE 1O2UA 1PFXC 1Z1JA 4ZKRU 4WY3A 2RDLA 1V2ST 1TGTA 1CGHA 4Y76A 3ATLA 2BHGA 1KDQA 2O8UA 5C67A 1QIXB 1Y3UA 2FTMA 4BAQB 3PWCA 3A8AA 2SNWA 1ETSH 1HXFH 4Y10E 2BLVA 1SR5C 1GHBF 1UTNA 1ACBE 4AYYB 5CMXH 1O2NA 4Z6AH 1AKSA 1GBMA 1WV7H 3QO6A 1PPGE 4FUBA 4U2WA 5A0CA 4IMQA 3KL6A 5JYIA 1HJAC 1KSNA 1O2JA 1C5TA 1LDTT 3PMAB 1B7XB 2UWLA 3MWIU 3RMMH 4SGAE 1OKXA 2ZHDA 3M7TA 1ARCA 9ESTA 1FONA 2FDAA 1YPMH 8GCHF 2HNTE 1AUJA 1O3LA 4ISNA 3UTUH 1BRAA 4CH8B 5C1UA 1ZSKA 3QLPH 2UUJB 4NIVA 2V3OH 3SNDA 3LOXA 1AFQC 2A4GA 3SZNA 2AERH 1W0YH 1P2KA 1DE7H 1IQHA 2CMYA 1MTVA 4U30A 5AFZH 3SU1A 2B7DH 5HYOA 3PTBA 1P2MA 1TMTH 3ODFA 2VWNA 2IJOB 4B75A 3MTYA 4FUFA 3O8BA 1GWAA 1E38B 3RXGA 5BRRE 2XXLA 3NKKA 1F5KU 3MU1A 5FBEA 1SGYE 5TJXA 1PQ5A 4JMYA 1GL1A 1SGDE 1T8NA 4R8TB 4NSYA 3BTQE 4JYUH 1CA8B 4DURA 1UCYK 3K6YA 3F6UH 4BAKB 2YNAA 3AAVA 2ZU5A 1ZPCA 1SGQE 1L2EA 1KIGH 4GVUA 2PHBA 4Y71A 1IQFA 1AB9C 1E36B 3LGIA 3PWBA 2P3TB 4BANB 3AVZA 3MNCA 2FX6A 3SGAE 5H4IB 3UOPA 1AO5A 2ZNKH 1FZZA 1ZLRA 2UWPA 4UFGH 1AFQB 1O3IA 1H1BA 3I29A 3LT3A 4J2YB 1VGCB 3QTOH 2BD8A 1HAHH 1JOUB 2BZ6H 4X6PA 3OYPA 2VJ1A 3EE0B 2ALPA 2GX4A 2BX3A 5DP4A 2WV4A 1ZPBA 1KXCA 2OTVA 4FUJA 4Q2KA 3TJUA 3ZZ3A 1J8AA 4KTCA 5TCAA 1S81A 2A31A 3QWCH 1T8MA 2QXHA 3P8FA 1H4WA 2WYJA 4AORA 3E0NB 1DWEH 2A32A 1O3KA 1HRTH 2BVSH 1FXYA 2V35A 2QF0A 2ZCLP 2ZHWH 4FU8A 1QCPA 2FPZA 1SGEE 1TBZH 1PPCE 2F3CE 2Z3DA 4XDEA 4FU9A 5E2OA 2A5AA 3FP6E 1A46H 4NFFA 3KQDA 2WPIS 1W0ZU 3TGJE 1O3JA 2NU4E 2W26A 1RRKA 3A83A 2PTNA 1DLEA 3PM3A 4I31A 4ZKNU 3RXEA 4D8NA 1GBCA 2P93A 4B2BA 4D9RA 2PTCE 2QCYA 3T26A 2OCVB 1WBGB 3U8OH 5CHAB 1GHAF 1O2OA 1O3AA 1GBTA 2GV7A 2GT7A 3HGNA 2NU3E 2JKHA 1AE5A 1TABE 1HDTH 1GJ5H 4BXWA 3A87A 4UFDH 4ZKSU 1SQTA 1V2NT 3KF2A 2BXUH 3SV9A 1DY9A 1ZYOA 4DJZB 1G3EA 1P0SH 2HOBA 4D7FA 2A5KA 1O3MA 1L1JA 5A0BA 2P94A 4I32A 4JYTA 3D62A 2BD7A 3M3VA 2ZU3A 1GGDB 2FS9A 3HK3B 2D8WA 1JRTA 4INKA 3UOUA 1TQ7B 1HJ8A 4GUXA 4A7IB 1QTFA 4U32A 3S0NA 1MKWH 3RP2A 1KTSB 4ABIA 1VITG 1VR1H 4FVDA 7GCHF 1KYNA 4D9QA 2I6QA 1MH0A 3KHVA 4ABEA 3GY2A 1S84A 2PGBB 2ZFTA 3K6ZA 1BBRH 4MTBA 1SVPA 1C4U2 2OC8A 2BDHA 1TRNA 1OWJA 1GG6C 4X2VA 1V2OT 1BITA 3T62A 3A86A 1UVSH 1NN6A 1NU7B 3IITA 1QA7A 2ZTZA 1EX3A 3O8CA 2ZPQA 3MU4A 5I25A 4B76A 2A45B 3L33A 3BTGE 1TONA 2HPPH 3H5CB 2FOEA 1O3CA 1TGNA 2ZKSA 2ZDVH 1MU6B 1XUFA 1SGPE 1GJ7B 3QUMP 4JZ1A 4NFEA 3EGKH 3A85A 1TNHA 1LVYA 3TNTA 1GI6A 4AG1A 2TPIZ 3SGBE 2Y6TA 8GCHG 3TGKE 1O3GA 2B0FA 4Y7AA 2A7HA 1TE0A 5JBTA 1P2NA 2OBOA 2FO9A 5E0GA 1GHAG 1CHOG 4AZ2B 1UK2A 1QQ4A 1GJ9B 5GCHG 2ZZUH 4IMZA 1K1LA 5EW2H 1RD3B 2J95A 1P02A 3RXDA 1AY6H 4E06H 4GHQA 1ZRKA 2W7SA 5C20A 1V2WT 4ZHMU 2H9TH 1E0FD 1TBQH 3MNXA 3U8RH 2VIPA 4A1TA 2ZDKA 2VWMA 2LNCA 1O2XA 4CRCA 1ANBA 4H4FA 2ZCKP 2BD2A 1CA0B 1P2QA 2BY9X 1ESAA 2AGIX 1QRZA 4Y7BA 1QJ1B 5DPAA 1XUHA 2QF3A 4WWYA 3OX7U 1GI5A 1GVZA 1XUGA 1BTWA 2Z9JA 2HALA 3SGQE 2NWNA 2GMTC 1FY3A 3NCLA 1XUJA 5L6NH 2V0BA 3SN8A 4TWYA 1SFQB 1W13U 4Y11E 1XX9A 1DSTA 1ABJH 1P10A 4NIXA 4I8LA 2BDCA 1TNLA 1ZHMA 1J17T 1Y5AT 2ZGHA 1AFEH 4MPXA 1PPBH 1NZQH 2GDDA 1TNKA 3RXUA 5L2YH 2FOGA 4MVNA 4ZUHA 2G4TA 3BEFB 1JIMA 1NO9H 1MUEB 2H1UA 1D3QB 1G36A 4NZLA 2PKAA 4K5ZA 4OGXA 3QZRA 5GJ4B 3SJKA 1BMLA 2GGVB 3LIWA 1G2LA 1C5PA 4NA7A 4X6MA 1EKBB 1YBWA 1C4Y2 1C2DA 2WINI 1CVWH 1CE5A 1QL9A 1D3PB 2HNTC 1UMAH 2P95A 2ZGXH 2QA9E 1HAOH 2A5IA 4NG9H 3SJ9A 1XKAC 3VB7A 2FP7B 1GBAA 1HJAB 1C1RA 1IHSH 3PTNA 1SG8B 2ZIQH 4FUEA 4K3JA 1CHOF 1HNEE 1HAVA 2C8WB 1DUEA 3EA7A 1GHWH 1PQ8A 4Y6DA 1BMAA 2AIQA 4IS5A 1G9IE 1SBWA 2ZGJA 1D6WA 1LKBA 3P92A 1MKWK 1IQJA 1BRCE 2Z9LA 2A7JA 1OYQA 1NPMA 3RXSA 4ZROA 1GBEA 1GJ8B 1Y3YA 2J94A 1A5IA 1CO7E 1D3TB 2Z9GA 4ISIH 2STBE 5E0JA 1A2CH 1FQ3A 4HZHA 1U6QA 2KAIB 1ZHRA 1O36A 4O3TA 1L1GA 4YESB 4ZHAA 1EZQA 1XKBC 1LHGH 4WMDA 1YF4A 1SGCA 4YOIA 4ISHH 1GDNA 2WUBA 4WMFA 3K2UA 1NRQH 1V6DA 1KXAA 2YNBA 4FXGH 5SGAE 3BTKE 1RGQA 3RXLA 2P59A 3CP7A 3V13A 2CF9H 1F0TA 1VITF 3GY3A 1QFKH 2BDBA 4DT7B 4TYDA 4ZKOU 1YP9A 1WQSA 1GCTC 4WH8A 4B2CA 1QGFA 3MU8A 3NWUA 3RC5A 3U1JB 2TRMA 1FUJA 1O32A 2W5EA 4BTIB 4X1SU 3DD2H 1CSOE 1GBIA 5AVDA 1ZTJA 2G5VA 3MOCA 1C2JA 1AZZA 1BIOA 1MD8A 4THNH 3M5MA 4MPWA 2ZCHP 2FLRH 5DGJA 1SB1H 2FYQA 4U01A 2OQUA 4Y79A 1C1VH 1MU8B 3BN9A 3ITIA 1KDQB 1O35A 4F4OC 2YOLA 1QQUA 4X2WA 4XE4A 1A5HA 1FAXA 1C5ZB 1J16A 1V2UT 2CHAB 3PLBA 3Q76A 3A84A 3F9HA 1OP2A 3STIA 3V12A 3RXCA 3RM2H 3LGWA 1SC8U 2G81E 4ISLA 3BTWE 1DUAA 1HAXB 4BOHA 3GICB 1Y3XA 3LGYA 3P95A 7LPRA 1BRUP 2FI5E 4A1XA 1BTYA 1BBRK 3SI3H 5HXFA 1YGCH 1THPB 4ABJA 3SU5A 1ABIH 5FPTA 5JB9S 1P09A 4DIHH 3ZZ4A 3RU4T 5LGOA 1UVOA 3RXRA 1BTUA 3SJIA 5CE1A 2Z3CA 3PLPA 1GMDG 2XC0A 3O8RA 2GCHG 5K7RA 3SNEA 3BTFE 2ZGCA 1GVLA 3UWJH 1GI1A 1G2MA 2PKAB 1F2SE 3A7XA 1MAXA 1Q2WA 3ZZ5A 4X6OA 3TITA 1TNIA 1X7AC 3BIVH 5DP3A 1Z6JH 3LGTA 1WSSH 5EXLA 1O5GH 3GOVB 4UD9H 3MYWA 1O2KA 4DOQA 4BAHB 1IQIA 5T6GA 1ELDE 4H42U 2FOMB 3GDVA 3NPSA 1MBQA 1UHBB 3GISB 3KQBA 5DP7A 4LZ1H 2P16A 4RKJB 4ZMAH 3UWIA 1P12E 5C2ZA 1RFNA 1F0RA 2FMJA 1K1MA 2Z3EA 1P04A 3BG4C 2ANWA 2FIRH 3P6ZB 2GDEH 1D9IA 2TGAA 3ZV8A 2AGGX 4Y0YE 6CHAB 3TH4H 3RXHA 1CBWC 1DY8A 1UJ1A 3MMGA 1OOKB 2BOKA 4K1SA 3SUDA 4CH2B 5DP9A 4HGCA 1SGFG 3GCTG 3UNQA 1A5GH 2STAE 1C1TA 1W12U 1AI8H 3ATWA 3P70B 2VGCB 1EZSC 3EDXB 4A92A 4JZEH 2D26C 4OS2A 4AFQA 2HRVA 1ZPZA 1LVOA 4FUIA 2Y5FA 5JDUB 1O5EH 1GI4A 2FLBH 4NA9H 5C3NA 4BTUB 1C2GA 2A4OA 1BMNH 5HGGA 1BUIA 1GHVH 3GY4A 1G3DA 5J4SA 2PLXA 3A7TA 4X8UH 1K1OA 4I7YH 1NRSH 4NIYA 5E0HA 1GCDA 1TMBH 1DDJA 3C27B 1TX8A 2ZHFH 1Y59T 1AKSB 3BTHE 3SU6A 3DA9B 2A2XH 2F9NA 1QR3E 1ZGVA 1TAWA 1QB9A 2F83A 4KELA 5EW1H 1P3CA 2XYAA 5JBAS 1GBBA 2BTCE 2ZFSA 1C2LA 3FP7E 2Y5GA 5EG4A 1F5LA 4IN1A 2FZZA 1QL8A 2BD5A 3KN2A 3UFAA 4I8JA 1IAUA 1HB0B 4Z0KA 1A3EH 4VGCC 2G5NA 1TFXA 1P9SA 3QK1A 2Q6FA 3SHCH 2XCNA 1BOQA 4K1EA 5AFYH 1T8OA 3P8GA 4WMEA 2ZQ2A 3UNSA 5DKMA 1O3EA 5EU8A 3VGCC 3GY5A 4CRBA 3MNSA 3LC5A 3SU0A 2ILNA 2ZPRA 1LQEA 2WPHS 2M5TA 2VIQA 2BVXH 3E90B 1FAKH 3G01A 2A4RA 3SJ8A 3PV4A 3PYHA 1TX7A 3ZVCA 1QBVH 3V0XA 1K1NA 2BY8X 1ZR0A 1OWDA 2H2ZA 2ANKH 1FV9A 3T29A 1Q3XA 1QNJA 3B23B 2WV5A 1ELVA 1MAYA 1ZSLA 2ZU1A 2J34A 2GCTB 5C5OA 1GL0E 2BB4A 1AIXH 1O37A 5DJ7A 1BRBE 1MTNC 5FCRA 1IQNA 1DOJA 1YPHE 1BMMH 1HYLA 4WVPE 2AMQA 3URDA 2OC0A 3FAOA 5HM9A 4ZXXH 1UVUH 1WOFA 2CXVA 3OTJE 1VCQA 1JMOH 1GJ6A 1C1MA 1QB6A 4QT8C 3HGPA 1SMFE 3LKWA 4KTSA 1ZOMA 2SGQE 4ZHLU 1HJ9A 3SORA 1ZSJA 4Y0ZE 2ODYB 1KTTB 1QBOA 1NFWA 2GKVE 1TA2A 3RMNH 3SV6A 2Z7FE 1HXEH 2ODQA 2K1QA 4Q80A 3ZZAA 5C1XA 2DE9A 4HTCH 4AOQA 1PQAA 1QL7A 1BA8B 2Z9KA 2KAIA 3K65B 3AASA 1HLTH 1T32A 3FANA 3ENSB 1HFDA 3U9AH 2XBWA 1O2VA 1W10U 4GPGA 4ABGA 1PYTD 3UR6A 3GCHB 1QJ7B 3RXBA 2BX4A 4Y8YA 1D6RA 2WYGA 5T6DA 3ZV9A 1DXWA 1YCPH 4DW2U 5JBBS 1P05A 3U8TH 1BHXB 5JBCS 1P06A 2OD3B 3RXAA 1P8VC 3A88A 3S69A 1FDPA 1LPZB 2CJIA 3M61U 2FI4E 1XXFA 1RTKA 1C5YB 1GMCF 2ZU2A 3VGCB 1C5OH 2ZC9H 4JZFH 3VB5A 3QTVH 2RG3A 4I33A 1K1JA 2VH0A 2QV1A 2BY6X 1O2HA 3BTEE 1SGNE 1G3BA 1RIWB 1V2PT 2C3SA 3EA9A 5A2MH 2UUKB 5G4BA 1C9TA 2C4FH 1VZQH 1GHYH 1WYKA 3W94A 3CS7A 2BLOA 4FVBA 1A61H 1N1LA 4UFFH 1O2WA 1NFYA 1H9IE 4DVAU 2FTLE 1C2HA 1S85A 5EQSA 2VINA 2R0KA 3I77A 3RXIA 1K1IA 1TGBA 3ZVGA 2AYWA 5FHTA 1HAIH 2Z9IA 2O8MA 1O38A 1TNJA 2HWLB 4RN6A 1UTKA 1L4DA 2OLGA 1H8IH 2XTTB 1H9HE 2GZ7A 1UO6A 1JBUH 1G32B 1GI9B 4A6LA 1V2JT 3MO9A 3GY6A 3A7YA 1SGFA 3E16B 1EQ9A 4JZIA 3UPEA 1EPTC 3L6PA 2CV3A 3LDXH 5BPEA 2VVUA 3RC4A 2BDAA 2EI8A 1UVPA 1K2I1 1O3FA 1NESE 1CT2E 2TIOA 1GBHA 4B2AA 1HAVB 1SHHB 2J4IA 4XBDA 3TVJB 4YTAA 3UQVA 1P01A 1GMCG 5FXLA 1ELCA 2XW9A 4D7GA 1OS8A 1BJUA 3RXQA 3F9FA 1IQGA 2TGPZ 2ZP0H 4CR9A 3QGJA 1C9PA 3PMHB 4YLUA 1NC6A 5DP6A 3LJJA 4OS1A 1QA0A 1GBKA 8KME2 1YM0A 4NZQA 2WPMS 1EB1H 2GD4B 3PLKA 4GCHG 4B73A 1SLUB 1O33A 2THFB 1VJAU 3OU0A 1GI3A 2HGTH 1EZXC 2BQWB 2SFAA 4CR5A 5F6MA 1GMHG 3A7VA 1AVGH 3TK5A 4GAWA 4WH6A 1A0JA 5FAHA 1TNGA 1O2PA 3SNBA 1BTHH 1ZZZA 3E8LA 6LPRA 1LO6A 1FLEE 1BTPA 3R3GB 1RTFB 3VXFH 3AW0A 2VIDA 2XWAA 1LQDB 1OWIA 4UDWH 1YC0A 2HNTF 1DSUA 1EASA 2FOFA 1D3DB 4SGBE 1ELBA 1TOMH 4CBNA 1K22H 1SHYA 1AE8H 3RXOA 1TB6H 2C93B 1WTHD 6ESTA 8LPRA 1BJVA 5L2ZH 3RXVA 1ZTKA 2Y7XA 4O03A 1MCVA 7KMEH 3UQOA 2Y7ZA 1KXFA 1A4WH 3ATMA 1MD7A 3FZZA 4E7NA 1OX1A 2VH6A 2F9PA 4MLFB 3TH3H 3K9XB 1GPZA 1GJAB 3SNAA 1BZXE 1O5FH 2JETB 4Q7ZA 1GJBB 3B8JA 3SUEA 1ESTA 1TMUH 3QN7A 1MBMA 1K21H 1HAGE 1JWTA 4MNYA 5EOKA 2ZFPH 5LH8A 1CA0C 1C5NH 4OS5A 1PJPA 1BQYA 1VJ9U 3VFEA 1HV7A 1ELEE 3V7TA 2P3UB 1DM4B 4B71A 1TX6A 4AFSA 2WPLS 3GY8A 2BQ7B 2GP9B 3RXPA 1O3BA 1M9UA 1SQAA 2CF8H 1HAYB 3PMBB 4IGDA 2VU8E 1OWKA 2J2UA 1AVWA 2VIWA 3TIUA 2BM2A 2Y82A 5FBIA 4YLQH 1V2KT 4IC5A 4NA8A 2J38A 1PQ7A 2OC1A 2HLCA 1GGDC 2XC4A 1LTOA 4D76A 2JH6D 2R2WU 3T2NA 3R0FA 2XNIA 2O8TA 1SFIA 1EOJA 1O3HA 1AMHA 3QZQA 1KXEA 1H8DH 1XMNB 4ZH8A 3H7OA 3BTTE 2A1DB 1QJ6B 1AUTC 3CENA 1MKXK 2BOHB 7GCHG 1RS0A 1MCTA 3C1KA 3NK8A 1WAYB 3BF6H 5IYTA 3BEIB 4AFZA 1UCYE 1Y5UT 2FYRA 4I8HA 3QGNB 1NRNH 3T25A 2QXIA 1LHFH 5HM2A 2BDYA 2F9UA 4AGJA 4CRFA 1YLCA 1CU1A 5E2PA 4WXVA 2TGTA 2FXRA 2ZDAH 5EXMA 1C5MD 1FNIA 2ZU4A 5EXNA 1XUIA 1RTLA 4ABAA 4PROA 1J15A 4AGKA 1S6HA 6GCHG 1LVBA 1L1NA 5EGMA 1EPTA 3RXKA 3BIUH 2GCHF 2OQ5A 3DT0H 2ZEBA 4BXSA 1QY6A 1C2MA 1XVOA 2G8TA 5EQRA 4HI3A 3ZYDA 4AG2A 4IW4E 3SOSA 3VB4A 1B0FA 1OSSA 4A1VA 4BAMB 3UR9A 2FX4A 3ZYEA 3N7OA 2AGEX 4MNWA 2ZA5A 3MH4A 1WU1A 2FODA 2VWOA 3IG6B 2VIVA 5GIBA 1NROH 1WUNH 2GVFA 4K8YA 1AU8A 1T4VH 1ZHPA 1DT2A 2B8OH 1ARBA 2CHAC 2TBSA 3MU5A 2FOBA 3O8DA 1YPJH 3I78A 1KY9A 2OC7A 2PV9B 1THSH 3BSQA 2EC9H 5F03A 1FIWA 1AN1E 5PTPA 1W2KH 2FWWA 3AAUA 1Z1IA 2G55A 1KXDA 4O3UA 1P11E 1EJMA 4UE7H 2VVVA 6GCHF 4BAOB 2VIOA 2Y5HA 1DXPA 1OP8A 1H9LB 1DWCH 2QIQA 2C90B 1UTQA 1QRXA 1EJAA 1YPHC 2UWOA 4ASHA 3ZZDA 3SUFA 4RSPA 3MO6A 2BLQA 2ULLA 5E8EH 1V2TT 2VB0A 3NXPA 2UUFB 1YPKH 1W7XH 1DLKB 1DPOA 1YCPK 1IOEA 2ZF0H 3P8NA 3MH6A 3EAJA 1EOLA 1ELFA 4AX9H 3DFLA 2H5CA 4OGYA 2FESH 1NRPH 3NUMA 4JZDH 4X1QU 2ZGBH 5FX5A 4K60A 1HAZB 2BQ6B 3CS0A 4VGCB 2NU0E 3PMJA 2Q1JA 4AFUA 3SQHE 1C1NA 1S82A 3S7KB 1C1PA 4JK6A 2AS9A 1E34B 1FMGA 4E7RG 2NU1E 2ODPA 1QURH 2RA0A 1A1RA 2QN5T 4DCDA 1MZAA 4RKOB 3E91A 1OYTH 1AWHB 1UTOA 3SU2A 5IDKA 1TPSA 3FP8E 4K69A 1UTPA 5GCHF 1OPHB 3UY9A 2PUQH 2CGAA 1LHDH 4AN7A 2A2QH 1UCYH 4XBBA 1TPOA 5ETXA 1LPKB 1NM6A 2B9LA 1CT0E 1CQQA 2GZ8A 1F92A 3RMLH 1O2RA 6CHAC 4LOYH 1PPEE 3UUZA 1V3XA 3SV7A 3VB3A 2QC2A 3MNBA 1O2TA 2G52A 2ZQ1A 2ZTXA 1DWBH 2ZO3H 5L30H 1AQ7A 1RXPA 1ETTH 2ZDLA 3OY5U 5LPRA 4I8KA 1EATA 5FPYA 1O2MA 1N8OC 2WUCA 1GDUA 1S5SA 3VB6A 4X2YA 4A5TS 2QGRA 1GBLA 3RXMA 4CRAA 2ANMH 2H6MA 5FX6A 1BB0B 1J14A 1VCWA 1O2IA 1MQ5A 4J1YA 1FIZA 1FY8E 1HBTH 1QRWA 3GDSA 4FUHA 1SGRE 2R3YA 1UK3A 3SU4A 2AFQB 4INHA 3PO1C 1TA6A 2FOCA 1HIAB 4CREA 4I8GA 1JRSA 2VVCA 4NCYA 1HIAA 1SI5H 4XOJA 1CHGA 3RXFA 2OUAA 1BDAA 5I46H 3MI4A 1FPHH 3WY8A 4FU7A 1SLWB 1CBWB 2P3FH 3RXTA 2SNVA 2SGAA 1B5GH 1CGIE 4K1TA 3DUXH 4MQAA 1UVTH 1YKTA 4KGAA 1C5SA 2FOAA 2BZAA 4F49A 2BD3A 1MTWA 1ORFA 1O2QA 1TYNA 2TGDA 4CHAC 1SGIB 4ISOA 3TK9A 4XFQA 3M5NA 5GWZA 1UHBA 1HGTH 1GMDF 2QXJA 3W95A 1V2LT 5A8ZA 3GCTF 1EZUC 1LPGB 3SHAH 3BV9B 1WCZA 1YPGH 1LKAA 1MTNB 2BMGB 5C5NA 2WPKS 1GJCB 3S9CA 2PW8H 3URCA 4FUDA 4MPUA 2ANYA 2BVRH 1ZJKA 1GBFA 4O97A 4JYVH 2OP9A 3HKJB 5DO4H 2A4QA 3EQ0H 2J92A 2B5TB 2R3UA 1V2VT 2GCTC 3VEQB 3TU7H 1S6FA 1VGCC 3PB1E 4AB9A 3A89A 3F1SB 3SBKA 1C4V2 1AVXA 1NTPA 1SL3A 3UNRA 2ZTYA 1V2QT 1MTUA 3TH2H 1AWFH 2A0QB 9LPRA 1Y3WA 2SGFE 1P2IA 1C1QA 1ZMNA 2OINA 4IBLH 1HPGA 1S0QA 5F8TA 1O2YA 3UIRA 2ZECA 3FFGA 3STJA 1A7SA 1SLXB 3NZIA 2VNTA 5EPYA 1ZTLA 4X1PU 1C2FA 1FY5A 1OWHA 1YCPM 4DG4A 1GI7B 3ODDA 3RMOH 2G4UA 1AB9B 1O39A 3ZVBA 4CBOA 2P8OB 1FN8A 3F68H 3H7TA 4YT7H 2ZFRH 5HMAA 4LXBH 1EP6A 1GJDB 2ALVA 3KQCA 3RM0H 3SW2B 4IC6A 1O2GH 2ZFQH 3OSYA 1GBJA 2Y81A 1DFPA 1SOTA 1C2IA 2C8YB 3P8OA 3M7UA 2PGQB 3P17H 3U1IB 2XBVA 1G30B 4X1RU 1T31A 4KTUA 1DICA 1GG6B 1UK4A 3RXJA 3ZVAA 4HFPB 3EA8A 1LCYA 4FUCA 3KNXA 3TJVA 3ZZ9A 5JPMH 2PSXA 1QHRB 2Y80A 3A8DA 3LC3A 4X8TH 1Z6EA 4X8SH 1C5QA 2ASUB 4O9VA 2F91A 1GVKB 3TPIZ 2H9HA 3A7ZA 4Y8XA 2ESTE 3SQEE 3E0PB 3M36A 4MG3A 1GHXH 1TPAE 1LVMA 1OWEA 4MPVA 5T3HA 1EAXA 1ZJDA 1EAIA 4YOGA 3M7QA 3RU4E 5JB8S 4TPIZ 3TJNA 1NFUA 1O3OA 2GV6A 1S83A 1Y3VA 1DVAH 5DP8A 1SGTA 3D49H 5CHAC 1NY22 5A8YA 2O8LA 2P8OC 1L4ZA 1SQOA 3A7WA 5TCCA 4JK5A 3F9EA 5A09A 7ESTE 3ATIA 1ZRBA 1GI2A 3V3MA 4H6TA 4X0WU 3ZVFA 2W3KA 3M37A 1IQEA 4X8VH 2JETC 1RJXB 3A8CA 4XSKU 3TGIE 4TPYA 4M7GA 5EQQA 1VCPA 3SUGA 4YM9A 2V3HH 5AHGH 2XRCA 1DWDH 2DE8A 2GZ9A 3EYDA 1TWXB 1IQMA 5F8XA 3TK6A 1HAPH 1YPLH 1BT7A 4TY7A 3E3TA 1TPPA 5EPNA 1DANH 3ATKA 3PO1B 4OS7A 4TY6A 1FY4A 3S9BA 3E1XB 3Q77A 1ANEA 3QX5H 1IQLA 1G37A 2G00A 2PKSC 1P9UA 2IPHA 1MMJN 1ELTA 3B9FH 1ANCA 2FM2A 2AH4X 1A0HB 4FUGA 1Y8TA 4LK4A 1SOZA 2BXTH 3BTDE 4DY7B 1QBNA 2EEKA 1NS3A 3BTME 1TRMA 4R0IA 3MHWU 4UEHH 3TLOA 1J9CH 5AF9H 1C5RA 1N8OB 3MU0A 1AGJA 2EI7A 8ESTE 1WQVH 1Z8RA 3LH1A 3LONA 2NU2E 2ZDNA 3ZZ7A 5A0AE 5EODA 3JZ1B 2R2MB 1ZMJA 2BY7X 2H5DA 5C1YA 1O3NA 2PWXA 2W3IA 4GLYA 1FY1A 1FJSA 1O31A 1EPTB 4YOJA 5ABWA 4ESTE 5GDSH 3HKIB 1Z71A 3ESTA 2ZFFH 3ZZ8A 3KEEA 1BCUH 1MKXH 1O5AB 2XBYA 4BTTB 4INLA 2FOHA 2SGPE 4DGJA 1GCTB 1UTLM 3M35A 5T6FA 2ZI2H 4YT6H 2PFEA 3GDUA 5F8ZA 4MNXA 4B1TA 4CRDA 4OS6A 4ABBA 1W3CA 3KGPA 2XWBI 1C5WB 1ANDA 2H9EH 2QXGA 2AMDA 4KP0A 1FN6A 2BD9A 1YLDA 2AMPA 1FPCH 1E37B 1C2EA 1NRRH 1C5LH 1K1PA 2J9NA 1C5XB 2Z6BD 4NGAH 5K0HA 1P3EA 2BDIA 1O30A 4UFEH 1C2KA 1EAUA 3JZ2B 1C1WH 5LPEA 1KLJH 1C1UH 2ZHEH 1THRH 3E6PH 4K8BA 3RLYH 1K9OE 4X6NA 2LPRA 2EA3A 2F9OA 5J4QA 2D1JA 1BTXA 2XC5A 2SGDE 1DS2E 2ZG0H 3LGVA 2C8ZB 5DP5A 2FI3E 4CHAB 1F7ZA 1P2OA 1F0UA 1TALA 1SSXA 2GTBA 1O2SA 2F9BH 5ESBA 2BD4A 2IOTA 1MTSA 4K2YA 3ZZBA 2FEQH 1S0RA 1DITH 3MO3A 3GYLB 3M5LA 3LJOA 4WF8A 1L0ZA 3F9GA 1O5DH 1T4UH 1P03A 1ETRH 1N6XA 5FCKA 1HUTH 1Y5BT 1TRYA 2HPQH 1BHXF 2PKSB 2PUXB 1LHEH 1HCGA 1PYTC 2PR3A 2Z94A 2F9VA 1O5CB 3SV2H 2OBQA 3MH7A 2G51A 3KCGH 1IQKA 1CT4E 1AZ8A 1MZDA 3SU3A 3BG8A 1WTGH 3UREA 4ABHA 1GHBG 1Z7KA 4JCNA 1ELGA 1F0SA 3DFJA 4TWWA 2VWLA 5DG6A 2I6SA 1E35B 1W14U 4AB8A 4CRGA 1O34A 5DK1A 1W8BH 3FVFB 4GHTA 5B6OA 1O5BB 4LZ4B 4Y8ZA 2RA3A 2GMTB 1DX5M 1EB2A 4DIIH 4MDSA 2JH5D 1EP5A 3Q00A 1O0DH 3U98H 2O9QA 1JIRA 4OS4A 3MH5A 1PPZA 1JXPA 1TLDA 2FS8A 3FZDA 3HATH 1W11U 1EAWA 3VPKA 3QDZB 1ID5H 3RDZA 1AD8H 1LMWB 3L3TA 1YPEH 1ELAA 1C5VA 2VGCC 2XBXA 1F5RA 1EXFA 4KKDA 1NT1A 4B74A 1XXDA 3KQEA 4WJG2 1YYY1 4YO9A 4GSOA 3SJOA 3SI4H 1TBRH 1EUFA 3ZVEA 1Q31A 3AW1A 4ABDA 5A8XA 1XUKA 3RC6A 2Q6DA 5FPSA 3T27A 3LGUA 4NSVA 3OY6U 1FI8A 1GI8B 1GDQA 2R9PA 2SGEE 2V6NA 4NWLA 1A0LA 1G3CA 2C8XB 2GT8A 1RIWC 1O3PB 3D65E 1SPJA 1VITH 2DUCA 2XCFA 3Q3XA 1O2LA 1INCA 3T28A 1TIOA 1BBRE 4NWKA 3LU9B 1O3DA 4ZAEA 3DHKH 1KLTA 1P57B 1B0EA 1PPHE 5LPFA 3ZZCA 1O2ZA 3ZZ6A 3D23A 2QY0B 1T8LA 1QB1A 3M3TA 3RLWH 5ESTE 1W7GH 2Q6GA 3S7HB 1AHTH 4H6SB 3RUOA 1XVMA 3A82A 1TGSZ 1Z8GA 2O8WA 1Z8IB 2QYIA 5GXPA 3LH3A 2RCEA 4UONA 3M3SA 1UTMA 3IWMA 3RU4D 2PSYA 1KLIH 1TGCA 2WPJS 1NFXA 1K28D 2HVXA 1GI0A 4X2XA 3SO3A 3TJOA 1BTZA 2BY5X 2EI6A 2CN0H 3T5FH 1OXGA 4IN2A 3ELAH 3KIDU 1D4PB 2QAAA 2ZDMA 2BDGA 3GCNA 3ZVDA 1EJNA 1Z8JB 1P2JA 3M5OA 3VXEH 1C5UA 2D2DA 1V2MT 4WXIA 5GPIB 1A3BH 1UTJA 4Q7YA 4MNVA 4Q7XA 1GJ4H 3GY7A 4BNRA 1XM1A 4NIWA 3Q3KA 1TQ0B 1TOCB 3TNSA 3PROA 2ZHQH 4XBCA 3U69H 2BLWA 3Q3YA 3A8BA 3HK6B 2BYAX 2ZWLH 2UUYA 3GYMA 2A7CA 1V2RT 3MFJA 4X1NU 1LHCH 2IN2A 1GBDA 2R0LA 1C1OA 1T7CA 3BEUA 4AYVB 1ESBA 2OXSA 3GCOA 4E05H 4ABFA 1IHTH
chains in the Genus database with same CATH superfamily
1SLVB 2EY4C 1C1SA 2ZPSA 1MQ6A 2W7UA 1GHZA 3BG4B 2JH0D 4ZXYH 1GMHF 1OHHD 4OM9A 2AEIH 3GCHC 3SNCA 3HPTB 1ZGIA 3A80A 1W0KD 4YZUA 1NU9A 3S9AA 2AIPA 3SV8A 3LPRA 4GCHF 1N6YA 1OP0A 1ZMLA 3A81A 1KXBA 1PPFE 1CGJE 1O2UA 1PFXC 1Z1JA 4ZKRU 4WY3A 2RDLA 1V2ST 1TGTA 1CGHA 4Y76A 3ATLA 2BHGA 1KDQA 2O8UA 5F53A 5C67A 1QIXB 1Y3UA 2FTMA 4BAQB 3PWCA 3A8AA 2SNWA 1ETSH 1HXFH 4Y10E 2BLVA 1SR5C 1GHBF 1UTNA 1ACBE 4AYYB 5CMXH 1O2NA 4Z6AH 1AKSA 1GBMA 1WV7H 3QO6A 1PPGE 4FUBA 4U2WA 5A0CA 4TSFD 4IMQA 3KL6A 5JYIA 1HJAC 1KSNA 1O2JA 1C5TA 1LDTT 2KCOA 3PMAB 1B7XB 2UWLA 3MWIU 3RMMH 4SGAE 1OKXA 2ZHDA 3M7TA 1ARCA 9ESTA 1FONA 2FDAA 1YPMH 8GCHF 2HNTE 1AUJA 1O3LA 4ISNA 3UTUH 1BRAA 4CH8B 1MABB 5C1UA 1ZSKA 3QLPH 2UUJB 4NIVA 2V3OH 3SNDA 3LOXA 1AFQC 2A4GA 3SZNA 2AERH 1W0YH 1P2KA 1DE7H 1IQHA 2CMYA 1MTVA 4U30A 5AFZH 3SU1A 2B7DH 5HYOA 3PTBA 1P2MA 1TMTH 3ODFA 2VWNA 2KR7A 2IJOB 4B75A 3MTYA 4FUFA 3O8BA 1GWAA 1E38B 3RXGA 5BRRE 2XXLA 3NKKA 3WW7A 1F5KU 3MU1A 5FBEA 1SGYE 5TJXA 1PQ5A 4JMYA 1GL1A 1SGDE 1T8NA 4R8TB 4NSYA 3BTQE 4JYUH 1CA8B 4DURA 1UCYK 3K6YA 3F6UH 4BAKB 2YNAA 3AAVA 2ZU5A 1ZPCA 1SGQE 1L2EA 3DSOA 1KIGH 4GVUA 2PHBA 4Y71A 1IQFA 3DCLA 1AB9C 1E36B 2AHME 3LGIA 3PWBA 2P3TB 5EJZA 4BANB 3AVZA 3MNCA 2FX6A 4Q4LA 3SGAE 5H4IB 3UOPA 1AO5A 5T1VA 2ZNKH 1FZZA 1ZLRA 2UWPA 4UFGH 1AFQB 1O3IA 1H1BA 3I29A 3LT3A 4J2YB 1VGCB 3QTOH 2BD8A 1HAHH 1JOUB 2BZ6H 4X6PA 3OYPA 2VJ1A 3EE0B 2ALPA 2GX4A 2GJGA 2BX3A 5DP4A 2WV4A 1ZPBA 1KXCA 2KCAA 2OTVA 4FUJA 4Q2KA 3TJUA 3ZZ3A 1J8AA 4KTCA 5TCAA 1S81A 2A31A 3QWCH 1T8MA 2QXHA 3P8FA 1H4WA 2WYJA 4AORA 3E0NB 1DWEH 2A32A 1O3KA 1HRTH 2BVSH 1FXYA 2V35A 2QF0A 2ZCLP 2ZHWH 4FU8A 1QCPA 2FPZA 1SGEE 1TBZH 1PPCE 2F3CE 2Z3DA 4XDEA 4FU9A 5E2OA 2A5AA 2WPDD 3FP6E 1A46H 4NFFA 2KCPA 3KQDA 2WPIS 1W0ZU 3TGJE 1O3JA 2NU4E 4XD7D 1RRKA 2W26A 3A83A 2PTNA 1DLEA 3PM3A 4I31A 4ZKNU 3RXEA 4D8NA 1GBCA 2P93A 4B2BA 4D9RA 2PTCE 2QCYA 3T26A 2OCVB 1WBGB 3U8OH 5CHAB 1GHAF 1O2OA 1O3AA 1GBTA 2GV7A 2GT7A 3HGNA 2NU3E 2JKHA 1AE5A 1TABE 1HDTH 3F2GA 1GJ5H 4BXWA 3A87A 4UFDH 4ZKSU 1SQTA 1V2NT 3KF2A 2BXUH 3SV9A 2WHXA 1DY9A 1ZYOA 4F55A 4DJZB 1G3EA 1P0SH 2HOBA 4D7FA 2A5KA 1O3MA 1L1JA 5A0BA 2P94A 4I32A 4JYTA 3D62A 2BD7A 3M3VA 2ZU3A 1GGDB 2FS9A 3HK3B 2D8WA 1JRTA 5FL7D 4INKA 3UOUA 1TQ7B 1HJ8A 3OE7D 4GUXA 4A7IB 1QTFA 4U32A 3S0NA 1MKWH 3RP2A 1KTSB 4ABIA 1VITG 1VR1H 4FVDA 7GCHF 1KYNA 4D9QA 2I6QA 1MH0A 3KHVA 4ABEA 3GY2A 1S84A 2PGBB 2ZFTA 3K6ZA 1BBRH 4MTBA 1SVPA 1C4U2 2OC8A 2BDHA 1TRNA 1OWJA 1GG6C 4X2VA 1V2OT 1BITA 3T62A 3A86A 1UVSH 1NN6A 1NU7B 3IITA 1QA7A 2ZTZA 1EX3A 3O8CA 2ZPQA 3MU4A 5I25A 4B76A 2A45B 3L33A 3BTGE 5C0UA 1TONA 2HPPH 5CHBA 3H5CB 2FOEA 1O3CA 1TGNA 2ZKSA 2ZDVH 1MU6B 1XUFA 1SGPE 1GJ7B 3QUMP 4JZ1A 4NFEA 3EGKH 3A85A 1TNHA 1LVYA 3TNTA 1GI6A 4AG1A 2TPIZ 2YMSD 3SGBE 2Y6TA 8GCHG 3TGKE 1O3GA 2B0FA 4Y7AA 2A7HA 5B6LA 1TE0A 5JBTA 1P2NA 2OBOA 2FO9A 5E0GA 1GHAG 1CHOG 4AZ2B 1UK2A 1QQ4A 1GJ9B 5GCHG 2ZZUH 4IMZA 1K1LA 5EW2H 1RD3B 2J95A 1P02A 3RXDA 1AY6H 4E06H 4GHQA 1ZRKA 2W7SA 5C20A 1V2WT 1H8ED 4ZHMU 2H9TH 1E0FD 1TBQH 3MNXA 3U8RH 2VIPA 4A1TA 2ZDKA 2VWMA 2LNCA 1O2XA 4CRCA 1ANBA 4H4FA 2ZCKP 2BD2A 1CA0B 1P2QA 2BY9X 1ESAA 2AGIX 1QRZA 4Y7BA 1QJ1B 5DPAA 1XUHA 2QF3A 4WWYA 3OX7U 1GI5A 1GVZA 1XUGA 1BTWA 2Z9JA 2HALA 3SGQE 4M9FA 2NWNA 2GMTC 1FY3A 3NCLA 1XUJA 5L6NH 2V0BA 3SN8A 4TWYA 1SFQB 1W13U 4Y11E 1XX9A 1DSTA 1ABJH 1P10A 4NIXA 4I8LA 2BDCA 1TNLA 1ZHMA 1J17T 1Y5AT 2ZGHA 1AFEH 4MPXA 1PPBH 1NZQH 2GDDA 1TNKA 3RXUA 5L2YH 2FOGA 4MVNA 4ZUHA 2G4TA 3BEFB 1JIMA 1NO9H 1MUEB 2H1UA 1D3QB 1G36A 4NZLA 2PKAA 4K5ZA 4P02A 4OGXA 3QZRA 5GJ4B 3SJKA 1BMLA 2GGVB 3LIWA 1G2LA 1C5PA 4NA7A 4X6MA 1EKBB 1YBWA 2KM0A 1C4Y2 1C2DA 2WINI 1CVWH 1CE5A 1QL9A 3FO8D 1D3PB 2HNTC 1UMAH 2P95A 3VG8A 2ZGXH 2QA9E 1HAOH 3KQ5A 2A5IA 4NG9H 3SJ9A 1XKAC 3VB7A 2FP7B 1GBAA 1BMFD 1HJAB 1C1RA 1IHSH 3PTNA 1SG8B 2ZIQH 4FUEA 4K3JA 1CHOF 1HNEE 1HAVA 2C8WB 1DUEA 3EA7A 1GHWH 1PQ8A 4Y6DA 1BMAA 2AIQA 4IS5A 1G9IE 2VBCA 1SBWA 2ZGJA 1D6WA 1LKBA 3P92A 1MKWK 1IQJA 1BRCE 2Z9LA 2A7JA 1OYQA 1NPMA 3RXSA 4ZROA 1GBEA 5CDFE 1GJ8B 1Y3YA 2J94A 1A5IA 1CO7E 1D3TB 2Z9GA 2RFKC 4ISIH 2STBE 5E0JA 1A2CH 1FQ3A 4HZHA 1U6QA 4ZCNA 2KAIB 1ZHRA 1O36A 4O3TA 1L1GA 4YESB 4ZHAA 1EZQA 1XKBC 1LHGH 4WMDA 1YF4A 1SGCA 4YOIA 4ISHH 1GDNA 2WUBA 4WMFA 3K2UA 1NRQH 1V6DA 1KXAA 2YNBA 4FXGH 5SGAE 3BTKE 1RGQA 3RXLA 2P59A 3CP7A 3V13A 2CF9H 3ZIAD 1F0TA 1VITF 3GY3A 1QFKH 2BDBA 4DT7B 4TYDA 4ZKOU 1YP9A 1WQSA 1GCTC 4WH8A 4B2CA 1QGFA 3MU8A 3NWUA 3RC5A 3U1JB 2TRMA 1FUJA 1O32A 2W5EA 4BTIB 4X1SU 3DD2H 1CSOE 1GBIA 5AVDA 1ZTJA 2G5VA 3MOCA 1C2JA 1AZZA 1BIOA 1MD8A 4THNH 3M5MA 4MPWA 2ZCHP 2FLRH 5DGJA 1SB1H 2FYQA 4U01A 2OQUA 4Y79A 1C1VH 1MU8B 3BN9A 3ITIA 3PV2A 1KDQB 1O35A 3SYJA 4F4OC 4HG6A 1WDIA 2YOLA 1QQUA 4X2WA 4XE4A 1A5HA 1FAXA 1C5ZB 1J16A 1V2UT 2CHAB 3PLBA 3Q76A 3A84A 3F9HA 1OP2A 3STIA 3V12A 3RXCA 3RM2H 3LGWA 1SC8U 2G81E 4ISLA 3BTWE 1DUAA 1HAXB 4BOHA 3GICB 1Y3XA 2EQNA 3LGYA 3P95A 1YWUA 7LPRA 1BRUP 2FI5E 4A1XA 1BTYA 1BBRK 3SI3H 5HXFA 1YGCH 1THPB 4ABJA 3SU5A 1ABIH 5FPTA 5JB9S 1P09A 4DIHH 3ZZ4A 3RU4T 5LGOA 1UVOA 3DSGA 3RXRA 1BTUA 3SJIA 5CE1A 2Z3CA 3PLPA 1GMDG 2XC0A 3O8RA 2GCHG 5K7RA 3SNEA 1UW7A 3BTFE 2ZGCA 1GVLA 3UWJH 1GI1A 1G2MA 2PKAB 1F2SE 3A7XA 1MAXA 1Q2WA 3ZZ5A 4X6OA 3TITA 1TNIA 1X7AC 3BIVH 5DP3A 1Z6JH 3LGTA 1WSSH 5EXLA 1O5GH 3GOVB 4UD9H 3MYWA 1O2KA 4DOQA 4BAHB 4ASUD 1IQIA 5T6GA 1ELDE 4H42U 2FOMB 3GDVA 3NPSA 1MBQA 1UHBB 3GISB 3KQBA 5DP7A 4LZ1H 2P16A 4RKJB 4ZMAH 3UWIA 1P12E 5C2ZA 1RFNA 1F0RA 2FMJA 1K1MA 2Z3EA 1P04A 3BG4C 3KYFA 2ANWA 2FIRH 3UAIC 3P6ZB 2GDEH 1D9IA 2TGAA 3ZV8A 2AGGX 4Y0YE 6CHAB 3TH4H 3RXHA 1CBWC 4B6EA 1DY8A 1UJ1A 3MMGA 1OOKB 2BOKA 4K1SA 3SUDA 4CH2B 5DP9A 4HGCA 1SGFG 3GCTG 3UNQA 1A5GH 2STAE 1WXRA 1C1TA 1W12U 1AI8H 3ATWA 3P70B 2VGCB 1EZSC 3EDXB 4A92A 4JZEH 2D26C 4OS2A 5EJLA 4AFQA 2HRVA 1ZPZA 1LVOA 4FUIA 2Y5FA 5JDUB 1O5EH 1GI4A 2FLBH 4NA9H 5C3NA 4BTUB 1C2GA 2A4OA 3OEHD 1BMNH 5HGGA 1BUIA 1GHVH 3GY4A 1G3DA 5J4SA 2PLXA 3A7TA 4X8UH 1K1OA 4I7YH 1NRSH 2IPQX 4NIYA 5E0HA 1GCDA 1TMBH 1DDJA 3C27B 1TX8A 2ZHFH 1Y59T 1AKSB 3BTHE 3SU6A 3DA9B 2A2XH 2F9NA 3F0OA 1QR3E 1ZGVA 1TAWA 3PRDA 1QB9A 2F83A 4KELA 5EW1H 1P3CA 2XYAA 5JBAS 1GBBA 2BTCE 2ZFSA 1C2LA 3FP7E 2Y5GA 5EG4A 1F5LA 4IN1A 2FZZA 1QL8A 2BD5A 3KN2A 3UFAA 4I8JA 4Q63A 1IAUA 1HB0B 4Z0KA 1A3EH 4VGCC 2G5NA 1TFXA 1P9SA 3QK1A 2Q6FA 3SHCH 2XCNA 1BOQA 4K1EA 5AFYH 1T8OA 3P8GA 4WMEA 2ZQ2A 3UNSA 5DKMA 1O3EA 5EU8A 3VGCC 3GY5A 4CRBA 3MNSA 3LC5A 3SU0A 2ILNA 2ZPRA 1LQEA 2WPHS 2M5TA 2VIQA 5GNDA 2BVXH 3E90B 1FAKH 3G01A 2A4RA 3SJ8A 3PV4A 3PYHA 1TX7A 3ZVCA 1QBVH 3V0XA 1K1NA 2HLDD 2BY8X 1ZR0A 1OWDA 2H2ZA 5C17A 2ANKH 1FV9A 3T29A 1Q3XA 1QNJA 3B23B 2WV5A 1ELVA 1MAYA 1ZSLA 2ZU1A 4XRNA 1QZ8A 2J34A 2GCTB 5C5OA 1GL0E 2BB4A 1AIXH 1O37A 5DJ7A 1BRBE 1MTNC 5FCRA 1IQNA 1DOJA 1YPHE 1BMMH 1HYLA 4WVPE 2AMQA 3URDA 2OC0A 3FAOA 5HM9A 4ZXXH 1UVUH 3OEED 1WOFA 2CXVA 3OTJE 1VCQA 1JMOH 1GJ6A 1C1MA 1QB6A 4QT8C 3HGPA 1SMFE 3OAAD 3LKWA 4KTSA 1ZOMA 2SGQE 4ZHLU 1HJ9A 3SORA 1ZSJA 4Y0ZE 2ODYB 1KTTB 1QBOA 1NFWA 2GKVE 1TA2A 3RMNH 3SV6A 2Z7FE 1HXEH 2ODQA 2K1QA 4Q80A 3ZZAA 5C1XA 1NBMD 2DE9A 4HTCH 4AOQA 4RT1A 1PQAA 1QL7A 1BA8B 3N7DA 2Z9KA 2KAIA 3K65B 3AASA 1HLTH 1T32A 3FANA 3ENSB 1HFDA 3U9AH 2XBWA 1O2VA 1W10U 4GPGA 4ABGA 1PYTD 3UR6A 3GCHB 1QJ7B 3RXBA 2BX4A 4Y8YA 1D6RA 2WYGA 5T6DA 3ZV9A 1DXWA 1YCPH 4DW2U 5JBBS 1P05A 3U8TH 1BHXB 5JBCS 1P06A 2OD3B 3RXAA 1P8VC 3A88A 3S69A 1FDPA 1LPZB 2CJIA 3M61U 2FI4E 1XXFA 1RTKA 1C5YB 1GMCF 2ZU2A 3VGCB 1C5OH 2ZC9H 4JZFH 3VB5A 3QTVH 2RG3A 4I33A 1K1JA 2VH0A 2QV1A 2BY6X 1O2HA 3BTEE 1SGNE 1G3BA 1RIWB 1V2PT 2C3SA 3EA9A 5A2MH 5EJ1A 2UUKB 5G4BA 1C9TA 3NRLA 2C4FH 1VZQH 1GHYH 1WYKA 3W94A 3CS7A 2BLOA 4FVBA 1A61H 1N1LA 4UFFH 1O2WA 1NFYA 1H9IE 4DVAU 2FTLE 1C2HA 1S85A 5EQSA 2VINA 2R0KA 3I77A 3RXIA 1K1IA 1TGBA 3ZVGA 2AYWA 5FHTA 1HAIH 2Z9IA 2O8MA 1O38A 1TNJA 2HWLB 4RN6A 1UTKA 1L4DA 2OLGA 1H8IH 1H9HE 2XTTB 2GZ7A 1UO6A 1JBUH 1G32B 1GI9B 4A6LA 1V2JT 1FX0B 3MO9A 3GY6A 3A7YA 1SGFA 3E16B 1EQ9A 2WSSD 4JZIA 3FKSD 3UPEA 1EPTC 3L6PA 3U28C 2CV3A 3LDXH 5BPEA 2VVUA 3RC4A 2BDAA 2EI8A 1UVPA 1K2I1 1O3FA 1NESE 1CT2E 2TIOA 1GBHA 4B2AA 5C94A 1HAVB 1SHHB 2J4IA 4XBDA 3TVJB 4YTAA 3UQVA 1P01A 1GMCG 5FXLA 1ELCA 2XW9A 4D7GA 1OS8A 1BJUA 3RXQA 3F9FA 1IQGA 2TGPZ 2ZP0H 4CR9A 3QGJA 1C9PA 3PMHB 4YLUA 1NC6A 5DP6A 3LJJA 4OS1A 1QA0A 1GBKA 8KME2 1YM0A 4NZQA 1EFRD 2WPMS 1EB1H 2GD4B 3PLKA 4GCHG 4B73A 2CK3D 1SLUB 1O33A 2JIZD 2THFB 1VJAU 3N99A 3OU0A 1GI3A 2HGTH 1EZXC 2BQWB 2SFAA 4CR5A 5F6MA 1GMHG 3A7VA 1AVGH 3TK5A 4GAWA 4WH6A 1A0JA 5FAHA 3OTPA 1TNGA 1O2PA 3SNBA 1BTHH 1ZZZA 3E8LA 6LPRA 1LO6A 1FLEE 1BTPA 3R3GB 1RTFB 3VXFH 3AW0A 2VIDA 2XWAA 1LQDB 1OWIA 4UDWH 1YC0A 2HNTF 1DSUA 1EASA 2FOFA 1D3DB 4SGBE 1ELBA 1TOMH 4CBNA 1K22H 1SHYA 1AE8H 3RXOA 1TB6H 2C93B 1WTHD 6ESTA 8LPRA 1BJVA 5L2ZH 3RXVA 1ZTKA 2W6JD 2Y7XA 4O03A 1MCVA 7KMEH 3UQOA 2Y7ZA 1KXFA 1A4WH 3ATMA 1MD7A 3FZZA 4E7NA 1OX1A 2VH6A 2F9PA 4MLFB 3TH3H 3K9XB 1GPZA 1GJAB 3SNAA 1BZXE 1O5FH 2JETB 4Q7ZA 3PRBA 1GJBB 3B8JA 1E1RD 3SUEA 1ESTA 1TMUH 3QN7A 1MBMA 1K21H 1HAGE 5KECA 1JWTA 2J5UA 4MNYA 5EOKA 2ZFPH 5LH8A 1CA0C 1C5NH 4OS5A 3SZEA 1PJPA 1BQYA 1VJ9U 3VFEA 1HV7A 1ELEE 3V7TA 2P3UB 1DM4B 4B71A 1TX6A 4AFSA 2WPLS 3GY8A 2BQ7B 2GP9B 3RXPA 1O3BA 1M9UA 1SQAA 2CF8H 1HAYB 3PMBB 4IGDA 2VU8E 1OWKA 2J2UA 1AVWA 2VIWA 3TIUA 2BM2A 2Y82A 5FBIA 4YLQH 1V2KT 4IC5A 4NA8A 2J38A 1PQ7A 2OC1A 2HLCA 1GGDC 2XC4A 1LTOA 4D76A 2JH6D 2R2WU 3T2NA 3R0FA 2XNIA 2O8TA 1SFIA 1EOJA 1O3HA 1AMHA 3QZQA 1KXEA 1H8DH 1XMNB 4ZH8A 3H7OA 3BTTE 2A1DB 1QJ6B 1AUTC 3CENA 1MKXK 2BOHB 2L6OA 7GCHG 1RS0A 1MCTA 3C1KA 3EE7A 3NK8A 1WAYB 3BF6H 5IYTA 3BEIB 3F2FA 4AFZA 1UCYE 1Y5UT 2FYRA 4I8HA 3QGNB 1NRNH 3T25A 4RT0A 2YMSC 2QXIA 1LHFH 3DSPA 5HM2A 2BDYA 2F9UA 4AGJA 4CRFA 1YLCA 2KCYA 1CU1A 5E2PA 4WXVA 2TGTA 2FXRA 2ZDAH 5EXMA 1C5MD 1FNIA 2ZU4A 5EXNA 1XUIA 1RTLA 4ABAA 4PROA 1J15A 4AGKA 1S6HA 6GCHG 1H8HD 1LVBA 1L1NA 5EGMA 1EPTA 1VKYA 3RXKA 3BIUH 2GCHF 2OQ5A 3DT0H 2ZEBA 4BXSA 1QY6A 1C2MA 1XVOA 2G8TA 5EQRA 4HI3A 3ZYDA 4AG2A 4IW4E 3SOSA 3VB4A 1B0FA 1OSSA 2KZ4A 2WV9A 4A1VA 4BAMB 3UR9A 2FX4A 3ZYEA 3N7OA 3PV5A 2AGEX 4MNWA 2ZA5A 3MH4A 1WU1A 2FODA 2VWOA 3IG6B 2VIVA 5GIBA 1NROH 2IJD1 1WUNH 2GVFA 3N7EA 4K8YA 1AU8A 1T4VH 1ZHPA 1DT2A 2B8OH 1ARBA 2CHAC 2TBSA 3MU5A 2FOBA 3O8DA 1YPJH 3I78A 1KY9A 2OC7A 2PV9B 1THSH 3BSQA 2EC9H 5F03A 1FIWA 1AN1E 5PTPA 1W2KH 2FWWA 3AAUA 1Z1IA 2G55A 1KXDA 4O3UA 1P11E 1EJMA 2V7QD 4UE7H 2VVVA 6GCHF 4BAOB 2VIOA 2Y5HA 5HKKD 1DXPA 2QF4A 1OP8A 1H9LB 1DWCH 2QIQA 5DSFA 2C90B 1UTQA 1QRXA 1EJAA 1YPHC 2UWOA 4ASHA 3ZZDA 3SUFA 4RSPA 3MO6A 2BLQA 2ULLA 5E8EH 1V2TT 2VB0A 3NXPA 2UUFB 1YPKH 1W7XH 1DLKB 1DPOA 1YCPK 1IOEA 2ZF0H 3P8NA 3MH6A 3EAJA 1EOLA 1ELFA 4AX9H 3DFLA 2H5CA 4OGYA 2FESH 1NRPH 4DT4A 3NUMA 4JZDH 4X1QU 2ZGBH 5FX5A 4K60A 1HAZB 2BQ6B 3CS0A 4VGCB 2NU0E 3PMJA 2Q1JA 2RDEA 4AFUA 3SQHE 1C1NA 1S82A 3S7KB 1C1PA 4JK6A 2AS9A 1E34B 1FMGA 2WZQA 2LP6A 4E7RG 2NU1E 2ODPA 1QURH 2RA0A 1A1RA 2QN5T 3F0PA 4DCDA 1MZAA 4RKOB 3E91A 1OYTH 1AWHB 1UTOA 3SU2A 5IDKA 1TPSA 3FP8E 4K69A 1UTPA 5GCHF 1OPHB 3UY9A 2F4LA 2PUQH 2CGAA 1LHDH 4AN7A 5DN6D 2A2QH 1UCYH 4XBBA 1TPOA 5ETXA 1LPKB 1NM6A 2B9LA 1CT0E 1CQQA 2GZ8A 1F92A 2XNDD 3RMLH 1O2RA 6CHAC 4LOYH 1PPEE 3UUZA 4ACAA 1V3XA 3SV7A 3VB3A 2QC2A 3WWFA 3MNBA 1O2TA 2G52A 5C0TA 2ZQ1A 2ZTXA 1DWBH 2ZO3H 5L30H 1AQ7A 1RXPA 1ETTH 2ZDLA 3OY5U 3H09A 5LPRA 4I8KA 1EATA 5FPYA 1YY3A 1O2MA 1N8OC 2WUCA 1GDUA 1S5SA 3VB6A 4X2YA 4A5TS 2QGRA 1GBLA 3RXMA 4CRAA 2ANMH 2H6MA 2XOKD 5FX6A 1BB0B 1J14A 1VCWA 1O2IA 1MQ5A 4J1YA 1FIZA 1FY8E 1HBTH 1QRWA 3GDSA 5IK2D 4FUHA 1SGRE 2R3YA 1UK3A 3SU4A 2AFQB 4INHA 3PO1C 1TA6A 2FOCA 1HIAB 3FN8A 4CREA 4I8GA 1JRSA 2VVCA 4NCYA 1HIAA 1SI5H 4XOJA 1CHGA 3RXFA 2OUAA 1BDAA 5I46H 2K0QA 1FPHH 3MI4A 3WY8A 4FU7A 1SLWB 1CBWB 2P3FH 2QF5A 2SNVA 3RXTA 2SGAA 1B5GH 1CGIE 4K1TA 3DUXH 4MQAA 1UVTH 1YKTA 4KGAA 1C5SA 2FOAA 2BZAA 4F49A 2BD3A 1MTWA 1ORFA 1O2QA 1TYNA 2TGDA 4CHAC 1SGIB 4ISOA 3TK9A 4XFQA 3M5NA 5GWZA 1UHBA 1HGTH 1GMDF 2QXJA 3W95A 1V2LT 5A8ZA 3GCTF 1EZUC 2PP6A 1LPGB 1S6LA 4RI0A 3BV9B 3SHAH 3KYGA 1WCZA 1YPGH 1LKAA 1MTNB 2BMGB 5C5NA 2WPKS 1GJCB 3S9CA 2PW8H 3URCA 4FUDA 4MPUA 2ANYA 2BVRH 1ZJKA 1GBFA 4O97A 1YLNA 4JYVH 2OP9A 3HKJB 5KEDA 5DO4H 2A4QA 3EQ0H 2J92A 2B5TB 2R3UA 1V2VT 2GCTC 3VEQB 3TU7H 1S6FA 1VGCC 3PB1E 4P00A 4AB9A 3A89A 3F1SB 3SBKA 1C4V2 1AVXA 1NTPA 4FOUC 1SL3A 3UNRA 2ZTYA 1V2QT 1MTUA 2QE7D 3TH2H 1AWFH 2A0QB 9LPRA 1Y3WA 2SGFE 1P2IA 1C1QA 1ZMNA 1E79D 2OINA 4IBLH 1HPGA 1S0QA 5F8TA 1O2YA 3UIRA 2ZECA 3F3BA 3FFGA 3STJA 1A7SA 3OFND 1SLXB 3NZIA 2VNTA 5EPYA 1ZTLA 4X1PU 1C2FA 1FY5A 1OWHA 1YCPM 4DG4A 1GI7B 3ODDA 3RMOH 2G4UA 1AB9B 1O39A 3ZVBA 4CBOA 2P8OB 1FN8A 3F68H 3FOAA 3H7TA 4YT7H 2ZFRH 5HMAA 4LXBH 1EP6A 1GJDB 2ALVA 3KQCA 4Z1MD 3RM0H 3SW2B 4IC6A 1O2GH 2ZFQH 3OSYA 1GBJA 2Y81A 1DFPA 1SOTA 1C2IA 2C8YB 3P8OA 4ACBA 3M7UA 2PGQB 3P17H 3U1IB 2XBVA 1G30B 4X1RU 1T31A 4KTUA 1DICA 1GG6B 1UK4A 3RXJA 3ZVAA 4HFPB 3EA8A 1LCYA 4FUCA 3KNXA 3TJVA 3ZZ9A 5JPMH 2PSXA 1K0HA 1QHRB 2Y80A 3A8DA 3LC3A 4X8TH 1Z6EA 4X8SH 1C5QA 2ASUB 4O9VA 2F91A 1GVKB 1KMHB 3TPIZ 2H9HA 3A7ZA 4Y8XA 2ESTE 3SQEE 3E0PB 3CNRA 1COWD 3M36A 4MG3A 1GHXH 1TPAE 1LVMA 1OWEA 4MPVA 5T3HA 4B6FA 1EAXA 1ZJDA 1EAIA 4YOGA 3M7QA 3RU4E 5JB8S 4TPIZ 3TJNA 1NFUA 1O3OA 2GV6A 1S83A 1Y3VA 2KX4A 1DVAH 5DP8A 1SGTA 3D49H 5CHAC 1NY22 5A8YA 2O8LA 2P8OC 1L4ZA 1SQOA 3A7WA 5TCCA 4JK5A 3F9EA 5A09A 7ESTE 3ATIA 1ZRBA 1GI2A 3V3MA 4H6TA 3MQKC 4X0WU 3ZVFA 2W3KA 3M37A 4F48B 1IQEA 4X8VH 2JETC 1RJXB 3A8CA 4XSKU 3TGIE 4TPYA 4M7GA 5EQQA 1SKYE 1VCPA 3SUGA 4YM9A 2V3HH 5AHGH 2XRCA 1DWDH 2DE8A 2GZ9A 3EYDA 1TWXB 1IQMA 5F8XA 3TK6A 1HAPH 1YPLH 1BT7A 4TY7A 3E3TA 1TPPA 5EPNA 1DANH 3ATKA 2K8IA 5KGOA 3PO1B 4OS7A 4TY6A 1FY4A 3S9BA 3E1XB 3Q77A 1ANEA 2J98A 3QX5H 1IQLA 1G37A 2G00A 2PKSC 1P9UA 2IPHA 1MMJN 1ELTA 3B9FH 1ANCA 2FM2A 2AH4X 1A0HB 4FUGA 1Y8TA 4LK4A 1SOZA 2BXTH 3BTDE 4DY7B 1QBNA 2EEKA 1NS3A 3BTME 1TRMA 4R0IA 3MHWU 5HIYA 4UEHH 1NBME 3TLOA 1J9CH 5AF9H 1C5RA 1N8OB 4AC9A 3MU0A 1AGJA 2EI7A 8ESTE 1WQVH 1Z8RA 3LH1A 3LONA 2NU2E 2ZDNA 3ZZ7A 5A0AE 5EODA 3JZ1B 2JJ2D 2R2MB 1ZMJA 2BY7X 2H5DA 5C1YA 1O3NA 2PWXA 2W3IA 4GLYA 1FY1A 1FJSA 1O31A 2JJ1D 1W0JD 1EPTB 4YOJA 5ABWA 4ESTE 5GDSH 3HKIB 1Z71A 3ESTA 2ZFFH 3ZZ8A 3KEEA 1BCUH 1MKXH 1O5AB 2XBYA 4BTTB 4INLA 2FOHA 2SGPE 4DGJA 1GCTB 1UTLM 3M35A 5T6FA 2ZI2H 4YT6H 2PFEA 3GDUA 5F8ZA 4MNXA 4B1TA 4CRDA 4OS6A 4ABBA 1W3CA 3KGPA 2XWBI 1C5WB 1ANDA 2H9EH 2QXGA 2AMDA 4KP0A 1FN6A 2BD9A 1YLDA 2AMPA 1FPCH 1E37B 1C2EA 1NRRH 1C5LH 1K1PA 2J9NA 1C5XB 2Z6BD 4NGAH 5K0HA 1P3EA 2BDIA 1O30A 4UFEH 1C2KA 1EAUA 3JZ2B 1C1WH 5LPEA 1KLJH 1C1UH 2ZHEH 1THRH 3E6PH 4K8BA 3RLYH 1K9OE 4X6NA 2V3MA 2LPRA 2EA3A 2F9OA 5J4QA 2D1JA 1BTXA 2XC5A 2SGDE 1DS2E 2ZG0H 3LGVA 2C8ZB 5DP5A 2FI3E 4CHAB 1F7ZA 1P2OA 1F0UA 1TALA 1SQRA 1SSXA 2GTBA 1O2SA 2F9BH 2LELA 5ESBA 2BD4A 2IOTA 1MTSA 4K2YA 4TT3D 3ZZBA 2FEQH 1S0RA 1DITH 3MO3A 3GYLB 3M5LA 3LJOA 4WF8A 1L0ZA 3F9GA 1O5DH 1T4UH 1P03A 1ETRH 1N6XA 5FCKA 1HUTH 1Y5BT 1TRYA 2HPQH 1BHXF 2PKSB 2PUXB 1LHEH 1HCGA 1PYTC 2PR3A 2Z94A 2F9VA 1O5CB 3SV2H 2OBQA 3MH7A 2G51A 3KCGH 1IQKA 1CT4E 1AZ8A 1MZDA 3SU3A 3BG8A 1WTGH 3UREA 4ABHA 2L74A 1GHBG 1Z7KA 4JCNA 1ELGA 1F0SA 3DFJA 4TWWA 3W1EA 2VWLA 5DG6A 2I6SA 1E35B 1W14U 4AB8A 4CRGA 1O34A 5DK1A 1W8BH 3FVFB 4GHTA 5B6OA 1O5BB 4LZ4B 4Y8ZA 2RA3A 2GMTB 2M2AA 1DX5M 1EB2A 2HVYB 4DIIH 4MDSA 2JH5D 5EIYA 1EP5A 3Q00A 3F2HA 1O0DH 3U98H 2O9QA 1JIRA 4OS4A 3MH5A 1PPZA 1JXPA 1TLDA 2FS8A 3FZDA 3HATH 1W11U 1EAWA 3VPKA 3QDZB 1ID5H 3RDZA 1AD8H 1LMWB 3L3TA 1YPEH 4I86A 1ELAA 1C5VA 2VGCC 2XBXA 1F5RA 1EXFA 4KKDA 1NT1A 4B74A 1XXDA 3KQEA 4WJG2 2KFWA 1YYY1 4YO9A 4GSOA 3SJOA 3SI4H 2W6ID 1TBRH 1EUFA 3ZVEA 1Q31A 3AW1A 4ABDA 5A8XA 1XUKA 3RC6A 2Q6DA 3AK5A 5FPSA 3T27A 3LGUA 4NSVA 3OY6U 2YMSB 1FI8A 1GI8B 1GDQA 2R9PA 2SGEE 2V6NA 4NWLA 1A0LA 1G3CA 2C8XB 2GT8A 1RIWC 1O3PB 3D65E 1SPJA 1VITH 2DUCA 2XCFA 3Q3XA 1O2LA 1INCA 3T28A 1TIOA 1BBRE 4NWKA 3LU9B 4YXWD 1O3DA 4ZAEA 3DHKH 1KLTA 1P57B 1B0EA 1PPHE 5LPFA 3ZZCA 1O2ZA 3ZZ6A 3D23A 2QY0B 1T8LA 1QB1A 3M3TA 3RLWH 5ESTE 1W7GH 2Q6GA 3S7HB 1AHTH 4H6SB 3RUOA 1XVMA 3A82A 1TGSZ 1Z8GA 2O8WA 1Z8IB 2QYIA 5GXPA 2F43B 3LH3A 2RCEA 4UONA 3M3SA 1UTMA 3IWMA 3RU4D 2PSYA 1KLIH 1TGCA 2WPJS 1NFXA 1K28D 2HVXA 1GI0A 4X2XA 3SO3A 3TJOA 1BTZA 2BY5X 4FETA 2EI6A 2CN0H 3T5FH 1OXGA 4IN2A 3ELAH 3KIDU 5HIZA 1D4PB 2QAAA 2ZDMA 2BDGA 3GCNA 3ZVDA 1EJNA 1Z8JB 1P2JA 3M5OA 2OK5A 3VXEH 1C5UA 2D2DA 1V2MT 4WXIA 5GPIB 1A3BH 1UTJA 4Q7YA 4MNVA 4Q7XA 1GJ4H 3UB0A 3GY7A 4BNRA 1XM1A 4NIWA 3Q3KA 1TQ0B 1TOCB 3TNSA 3PROA 2ZHQH 4XBCA 3U69H 2BLWA 3Q3YA 3A8BA 3HK6B 2BYAX 2ZWLH 2UUYA 3GYMA 2A7CA 1V2RT 3MFJA 3GS9A 1E1QD 4X1NU 3WWBA 1LHCH 2IN2A 2J98B 1GBDA 2J97A 2R0LA 1C1OA 1T7CA 3BEUA 4AYVB 1ESBA 2OXSA 3GCOA 2JDID 4E05H 4ABFA 1IHTH
chains in the Genus database with same CATH topology
1SLVB 1C1SA 2ZPSA 1MQ6A 2W7UA 1GHZA 3BG4B 2JH0D 4ZXYH 1GMHF 2AEIH 3GCHC 3SNCA 3HPTB 1ZGIA 3A80A 4YZUA 1NU9A 3S9AA 2AIPA 3SV8A 3LPRA 4GCHF 1N6YA 1OP0A 1ZMLA 3A81A 1KXBA 1PPFE 1CGJE 1O2UA 1PFXC 1Z1JA 4ZKRU 4WY3A 2RDLA 1V2ST 1TGTA 1CGHA 4Y76A 3ATLA 2BHGA 1KDQA 2O8UA 5C67A 1QIXB 1Y3UA 2FTMA 4BAQB 3PWCA 3A8AA 2SNWA 1ETSH 1HXFH 4Y10E 2BLVA 1SR5C 1GHBF 1UTNA 1ACBE 4AYYB 5CMXH 1O2NA 4Z6AH 1AKSA 1GBMA 1WV7H 3QO6A 1PPGE 4FUBA 4U2WA 5A0CA 4IMQA 3KL6A 5JYIA 1HJAC 1KSNA 1O2JA 1C5TA 1LDTT 3PMAB 1B7XB 2UWLA 3MWIU 3RMMH 4SGAE 1OKXA 2ZHDA 3M7TA 1ARCA 9ESTA 1FONA 2FDAA 1YPMH 8GCHF 2HNTE 1AUJA 1O3LA 4ISNA 3UTUH 1BRAA 4CH8B 5C1UA 1ZSKA 3QLPH 2UUJB 4NIVA 2V3OH 3SNDA 3LOXA 1AFQC 2A4GA 3SZNA 2AERH 1W0YH 1P2KA 1DE7H 1IQHA 2CMYA 1MTVA 4U30A 5AFZH 3SU1A 2B7DH 5HYOA 3PTBA 1P2MA 1TMTH 3ODFA 2VWNA 2IJOB 4B75A 3MTYA 4FUFA 3O8BA 1GWAA 1E38B 3RXGA 5BRRE 2XXLA 3NKKA 1F5KU 3MU1A 5FBEA 1SGYE 5TJXA 1PQ5A 4JMYA 1GL1A 1SGDE 1T8NA 4R8TB 4NSYA 3BTQE 4JYUH 1CA8B 4DURA 1UCYK 3K6YA 3F6UH 4BAKB 2YNAA 3AAVA 2ZU5A 1ZPCA 1SGQE 1L2EA 1KIGH 4GVUA 2PHBA 4Y71A 1IQFA 1AB9C 1E36B 3LGIA 3PWBA 2P3TB 4BANB 3AVZA 3MNCA 2FX6A 3SGAE 5H4IB 3UOPA 1AO5A 2ZNKH 1FZZA 1ZLRA 2UWPA 4UFGH 1AFQB 1O3IA 1H1BA 3I29A 3LT3A 4J2YB 1VGCB 3QTOH 2BD8A 1HAHH 1JOUB 2BZ6H 4X6PA 3OYPA 2VJ1A 3EE0B 2ALPA 2GX4A 2BX3A 5DP4A 2WV4A 1ZPBA 1KXCA 2OTVA 4FUJA 4Q2KA 3TJUA 3ZZ3A 1J8AA 4KTCA 5TCAA 1S81A 2A31A 3QWCH 1T8MA 2QXHA 3P8FA 1H4WA 2WYJA 4AORA 3E0NB 1DWEH 2A32A 1O3KA 1HRTH 2BVSH 1FXYA 2V35A 2QF0A 2ZCLP 2ZHWH 4FU8A 1QCPA 2FPZA 1SGEE 1TBZH 1PPCE 2F3CE 2Z3DA 4XDEA 4FU9A 5E2OA 2A5AA 3FP6E 1A46H 4NFFA 3KQDA 2WPIS 1W0ZU 3TGJE 1O3JA 2NU4E 2W26A 1RRKA 3A83A 2PTNA 1DLEA 3PM3A 4I31A 4ZKNU 3RXEA 4D8NA 1GBCA 2P93A 4B2BA 4D9RA 2PTCE 2QCYA 3T26A 2OCVB 1WBGB 3U8OH 5CHAB 1GHAF 1O2OA 1O3AA 1GBTA 2GV7A 2GT7A 3HGNA 2NU3E 2JKHA 1AE5A 1TABE 1HDTH 1GJ5H 4BXWA 3A87A 4UFDH 4ZKSU 1SQTA 1V2NT 3KF2A 2BXUH 3SV9A 1DY9A 1ZYOA 4DJZB 1G3EA 1P0SH 2HOBA 4D7FA 2A5KA 1O3MA 1L1JA 5A0BA 2P94A 4I32A 4JYTA 3D62A 2BD7A 3M3VA 2ZU3A 1GGDB 2FS9A 3HK3B 2D8WA 1JRTA 4INKA 3UOUA 1TQ7B 1HJ8A 4GUXA 4A7IB 1QTFA 4U32A 3S0NA 1MKWH 3RP2A 1KTSB 4ABIA 1VITG 1VR1H 4FVDA 7GCHF 1KYNA 4D9QA 2I6QA 1MH0A 3KHVA 4ABEA 3GY2A 1S84A 2PGBB 2ZFTA 3K6ZA 1BBRH 4MTBA 1SVPA 1C4U2 2OC8A 2BDHA 1TRNA 1OWJA 1GG6C 4X2VA 1V2OT 1BITA 3T62A 3A86A 1UVSH 1NN6A 1NU7B 3IITA 1QA7A 2ZTZA 1EX3A 3O8CA 2ZPQA 3MU4A 5I25A 4B76A 2A45B 3L33A 3BTGE 1TONA 2HPPH 3H5CB 2FOEA 1O3CA 1TGNA 2ZKSA 2ZDVH 1MU6B 1XUFA 1SGPE 1GJ7B 3QUMP 4JZ1A 4NFEA 3EGKH 3A85A 1TNHA 1LVYA 3TNTA 1GI6A 4AG1A 2TPIZ 3SGBE 2Y6TA 8GCHG 3TGKE 1O3GA 2B0FA 4Y7AA 2A7HA 1TE0A 5JBTA 1P2NA 2OBOA 2FO9A 5E0GA 1GHAG 1CHOG 4AZ2B 1UK2A 1QQ4A 1GJ9B 5GCHG 2ZZUH 4IMZA 1K1LA 5EW2H 1RD3B 2J95A 1P02A 3RXDA 1AY6H 4E06H 4GHQA 1ZRKA 2W7SA 5C20A 1V2WT 4ZHMU 2H9TH 1E0FD 1TBQH 3MNXA 3U8RH 2VIPA 4A1TA 2ZDKA 2VWMA 2LNCA 1O2XA 4CRCA 1ANBA 4H4FA 2ZCKP 2BD2A 1CA0B 1P2QA 2BY9X 1ESAA 2AGIX 1QRZA 4Y7BA 1QJ1B 5DPAA 1XUHA 2QF3A 4WWYA 3OX7U 1GI5A 1GVZA 1XUGA 1BTWA 2Z9JA 2HALA 3SGQE 2NWNA 2GMTC 1FY3A 3NCLA 1XUJA 5L6NH 2V0BA 3SN8A 4TWYA 1SFQB 1W13U 4Y11E 1XX9A 1DSTA 1ABJH 1P10A 4NIXA 4I8LA 2BDCA 1TNLA 1ZHMA 1J17T 1Y5AT 2ZGHA 1AFEH 4MPXA 1PPBH 1NZQH 2GDDA 1TNKA 3RXUA 5L2YH 2FOGA 4MVNA 4ZUHA 2G4TA 3BEFB 1JIMA 1NO9H 1MUEB 2H1UA 1D3QB 1G36A 4NZLA 2PKAA 4K5ZA 4OGXA 3QZRA 5GJ4B 3SJKA 1BMLA 2GGVB 3LIWA 1G2LA 1C5PA 4NA7A 4X6MA 1EKBB 1YBWA 1C4Y2 1C2DA 2WINI 1CVWH 1CE5A 1QL9A 1D3PB 2HNTC 1UMAH 2P95A 2ZGXH 2QA9E 1HAOH 2A5IA 4NG9H 3SJ9A 1XKAC 3VB7A 2FP7B 1GBAA 1HJAB 1C1RA 1IHSH 3PTNA 1SG8B 2ZIQH 4FUEA 4K3JA 1CHOF 1HNEE 1HAVA 2C8WB 1DUEA 3EA7A 1GHWH 1PQ8A 4Y6DA 1BMAA 2AIQA 4IS5A 1G9IE 1SBWA 2ZGJA 1D6WA 1LKBA 3P92A 1MKWK 1IQJA 1BRCE 2Z9LA 2A7JA 1OYQA 1NPMA 3RXSA 4ZROA 1GBEA 1GJ8B 1Y3YA 2J94A 1A5IA 1CO7E 1D3TB 2Z9GA 4ISIH 2STBE 5E0JA 1A2CH 1FQ3A 4HZHA 1U6QA 2KAIB 1ZHRA 1O36A 4O3TA 1L1GA 4YESB 4ZHAA 1EZQA 1XKBC 1LHGH 4WMDA 1YF4A 1SGCA 4YOIA 4ISHH 1GDNA 2WUBA 4WMFA 3K2UA 1NRQH 1V6DA 1KXAA 2YNBA 4FXGH 5SGAE 3BTKE 1RGQA 3RXLA 2P59A 3CP7A 3V13A 2CF9H 1F0TA 1VITF 3GY3A 1QFKH 2BDBA 4DT7B 4TYDA 4ZKOU 1YP9A 1WQSA 1GCTC 4WH8A 4B2CA 1QGFA 3MU8A 3NWUA 3RC5A 3U1JB 2TRMA 1FUJA 1O32A 2W5EA 4BTIB 4X1SU 3DD2H 1CSOE 1GBIA 5AVDA 1ZTJA 2G5VA 3MOCA 1C2JA 1AZZA 1BIOA 1MD8A 4THNH 3M5MA 4MPWA 2ZCHP 2FLRH 5DGJA 1SB1H 2FYQA 4U01A 2OQUA 4Y79A 1C1VH 1MU8B 3BN9A 3ITIA 1KDQB 1O35A 4F4OC 2YOLA 1QQUA 4X2WA 4XE4A 1A5HA 1FAXA 1C5ZB 1J16A 1V2UT 2CHAB 3PLBA 3Q76A 3A84A 3F9HA 1OP2A 3STIA 3V12A 3RXCA 3RM2H 3LGWA 1SC8U 2G81E 4ISLA 3BTWE 1DUAA 1HAXB 4BOHA 3GICB 1Y3XA 3LGYA 3P95A 7LPRA 1BRUP 2FI5E 4A1XA 1BTYA 1BBRK 3SI3H 5HXFA 1YGCH 1THPB 4ABJA 3SU5A 1ABIH 5FPTA 5JB9S 1P09A 4DIHH 3ZZ4A 3RU4T 5LGOA 1UVOA 3RXRA 1BTUA 3SJIA 5CE1A 2Z3CA 3PLPA 1GMDG 2XC0A 3O8RA 2GCHG 5K7RA 3SNEA 3BTFE 2ZGCA 1GVLA 3UWJH 1GI1A 1G2MA 2PKAB 1F2SE 3A7XA 1MAXA 1Q2WA 3ZZ5A 4X6OA 3TITA 1TNIA 1X7AC 3BIVH 5DP3A 1Z6JH 3LGTA 1WSSH 5EXLA 1O5GH 3GOVB 4UD9H 3MYWA 1O2KA 4DOQA 4BAHB 1IQIA 5T6GA 1ELDE 4H42U 2FOMB 3GDVA 3NPSA 1MBQA 1UHBB 3GISB 3KQBA 5DP7A 4LZ1H 2P16A 4RKJB 4ZMAH 3UWIA 1P12E 5C2ZA 1RFNA 1F0RA 2FMJA 1K1MA 2Z3EA 1P04A 3BG4C 2ANWA 2FIRH 3P6ZB 2GDEH 1D9IA 2TGAA 3ZV8A 2AGGX 4Y0YE 6CHAB 3TH4H 3RXHA 1CBWC 1DY8A 1UJ1A 3MMGA 1OOKB 2BOKA 4K1SA 3SUDA 4CH2B 5DP9A 4HGCA 1SGFG 3GCTG 3UNQA 1A5GH 2STAE 1C1TA 1W12U 1AI8H 3ATWA 3P70B 2VGCB 1EZSC 3EDXB 4A92A 4JZEH 2D26C 4OS2A 4AFQA 2HRVA 1ZPZA 1LVOA 4FUIA 2Y5FA 5JDUB 1O5EH 1GI4A 2FLBH 4NA9H 5C3NA 4BTUB 1C2GA 2A4OA 1BMNH 5HGGA 1BUIA 1GHVH 3GY4A 1G3DA 5J4SA 2PLXA 3A7TA 4X8UH 1K1OA 4I7YH 1NRSH 4NIYA 5E0HA 1GCDA 1TMBH 1DDJA 3C27B 1TX8A 2ZHFH 1Y59T 1AKSB 3BTHE 3SU6A 3DA9B 2A2XH 2F9NA 1QR3E 1ZGVA 1TAWA 1QB9A 2F83A 4KELA 5EW1H 1P3CA 2XYAA 5JBAS 1GBBA 2BTCE 2ZFSA 1C2LA 3FP7E 2Y5GA 5EG4A 1F5LA 4IN1A 2FZZA 1QL8A 2BD5A 3KN2A 3UFAA 4I8JA 1IAUA 1HB0B 4Z0KA 1A3EH 4VGCC 2G5NA 1TFXA 1P9SA 3QK1A 2Q6FA 3SHCH 2XCNA 1BOQA 4K1EA 5AFYH 1T8OA 3P8GA 4WMEA 2ZQ2A 3UNSA 5DKMA 1O3EA 5EU8A 3VGCC 3GY5A 4CRBA 3MNSA 3LC5A 3SU0A 2ILNA 2ZPRA 1LQEA 2WPHS 2M5TA 2VIQA 2BVXH 3E90B 1FAKH 3G01A 2A4RA 3SJ8A 3PV4A 3PYHA 1TX7A 3ZVCA 1QBVH 3V0XA 1K1NA 2BY8X 1ZR0A 1OWDA 2H2ZA 2ANKH 1FV9A 3T29A 1Q3XA 1QNJA 3B23B 2WV5A 1ELVA 1MAYA 1ZSLA 2ZU1A 2J34A 2GCTB 5C5OA 1GL0E 2BB4A 1AIXH 1O37A 5DJ7A 1BRBE 1MTNC 5FCRA 1IQNA 1DOJA 1YPHE 1BMMH 1HYLA 4WVPE 2AMQA 3URDA 2OC0A 3FAOA 5HM9A 4ZXXH 1UVUH 1WOFA 2CXVA 3OTJE 1VCQA 1JMOH 1GJ6A 1C1MA 1QB6A 4QT8C 3HGPA 1SMFE 3LKWA 4KTSA 1ZOMA 2SGQE 4ZHLU 1HJ9A 3SORA 1ZSJA 4Y0ZE 2ODYB 1KTTB 1QBOA 1NFWA 2GKVE 1TA2A 3RMNH 3SV6A 2Z7FE 1HXEH 2ODQA 2K1QA 4Q80A 3ZZAA 5C1XA 2DE9A 4HTCH 4AOQA 1PQAA 1QL7A 1BA8B 2Z9KA 2KAIA 3K65B 3AASA 1HLTH 1T32A 3FANA 3ENSB 1HFDA 3U9AH 2XBWA 1O2VA 1W10U 4GPGA 4ABGA 1PYTD 3UR6A 3GCHB 1QJ7B 3RXBA 2BX4A 4Y8YA 1D6RA 2WYGA 5T6DA 3ZV9A 1DXWA 1YCPH 4DW2U 5JBBS 1P05A 3U8TH 1BHXB 5JBCS 1P06A 2OD3B 3RXAA 1P8VC 3A88A 3S69A 1FDPA 1LPZB 2CJIA 3M61U 2FI4E 1XXFA 1RTKA 1C5YB 1GMCF 2ZU2A 3VGCB 1C5OH 2ZC9H 4JZFH 3VB5A 3QTVH 2RG3A 4I33A 1K1JA 2VH0A 2QV1A 2BY6X 1O2HA 3BTEE 1SGNE 1G3BA 1RIWB 1V2PT 2C3SA 3EA9A 5A2MH 2UUKB 5G4BA 1C9TA 2C4FH 1VZQH 1GHYH 1WYKA 3W94A 3CS7A 2BLOA 4FVBA 1A61H 1N1LA 4UFFH 1O2WA 1NFYA 1H9IE 4DVAU 2FTLE 1C2HA 1S85A 5EQSA 2VINA 2R0KA 3I77A 3RXIA 1K1IA 1TGBA 3ZVGA 2AYWA 5FHTA 1HAIH 2Z9IA 2O8MA 1O38A 1TNJA 2HWLB 4RN6A 1UTKA 1L4DA 2OLGA 1H8IH 2XTTB 1H9HE 2GZ7A 1UO6A 1JBUH 1G32B 1GI9B 4A6LA 1V2JT 3MO9A 3GY6A 3A7YA 1SGFA 3E16B 1EQ9A 4JZIA 3UPEA 1EPTC 3L6PA 2CV3A 3LDXH 5BPEA 2VVUA 3RC4A 2BDAA 2EI8A 1UVPA 1K2I1 1O3FA 1NESE 1CT2E 2TIOA 1GBHA 4B2AA 1HAVB 1SHHB 2J4IA 4XBDA 3TVJB 4YTAA 3UQVA 1P01A 1GMCG 5FXLA 1ELCA 2XW9A 4D7GA 1OS8A 1BJUA 3RXQA 3F9FA 1IQGA 2TGPZ 2ZP0H 4CR9A 3QGJA 1C9PA 3PMHB 4YLUA 1NC6A 5DP6A 3LJJA 4OS1A 1QA0A 1GBKA 8KME2 1YM0A 4NZQA 2WPMS 1EB1H 2GD4B 3PLKA 4GCHG 4B73A 1SLUB 1O33A 2THFB 1VJAU 3OU0A 1GI3A 2HGTH 1EZXC 2BQWB 2SFAA 4CR5A