1T31A

A dual inhibitor of the leukocyte proteases cathepsin g and chymase with therapeutic efficacy in animals models of inflammation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymase
publication title A novel, potent dual inhibitor of the leukocyte proteases cathepsin G and chymase: molecular mechanisms and anti-inflammatory activity in vivo.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1t31A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1t31A02
3DHKH 2UWPA 1NU7B 3KQEA 2BD7A 1XXFA 3Q3YA 4NA8A 5E2OA 3SQHE 4AX9H 4WXVA 4ZHAA 3TH4H 4Y10E 2GZ8A 2Z9GA 4INKA 2Z9JA 1SQOA 1Z7KA 3FFGA 7KMEH 4I8JA 2ZDLA 1GJ8B 2BDIA 4X2VA 2GP9B 1LVMA 2VWOA 6CHAB 1KDQB 2CGAA 3FZDA 2VGCB 3TK9A 1EP6A 2I6SA 4BTTB 1A0JA 1P2NA 1F5RA 2ANMH 2R3UA 4YM9A 1BZXE 5DP6A 2FI3E 2GKVE 1FONA 3BTEE 5AHGH 2ZHEH 1V2PT 2RA0A 3M3TA 5C2ZA 3E1XB 2J4IA 3FP8E 1SGNE 2EEKA 3F9HA 1AHTH 2WV5A 3LT3A 1L4ZA 1MCVA 2UWOA 1GL0E 2ZU4A 1HAVB 2BLOA 1S5SA 3F68H 1P01A 1ZJDA 2VIOA 4DIIH 1TRNA 2BXUH 5F8ZA 4OGXA 4YT7H 3QZQA 3NZIA 4NIXA 1CGIE 3DA9B 3I29A 1HB0B 5J4SA 2BD4A 2PGQB 4PROA 2BZ6H 3EDXB 4UEHH 1FLEE 5F8XA 1JWTA 1O3HA 2FOAA 4NZQA 2FXRA 2OLGA 5AFZH 4BAMB 2JETC 3TJOA 3F9EA 3PMBB 1XUIA 2V3HH 1QRZA 2VWMA 3SNEA 1C5RA 3AVZA 3L6PA 3SU6A 1A1RA 1ELBA 4JZEH 5DO4H 2BX4A 3FP6E 1UK4A 1UCYK 3PMJA 3CS7A 2SNWA 2OINA 2QXHA 3M5MA 1P02A 3MH4A 3OSYA 1SHYA 4INLA 1G2LA 3PLPA 3BTQE 1EX3A 2GCHF 2LPRA 1A2CH 4SGAE 1SGRE 2PKSB 1EATA 1BTXA 3VXEH 4B75A 1O3OA 4DG4A 1UK2A 1AVWA 4FUEA 2D2DA 1O36A 1IQJA 1RS0A 1UMAH 3EQ0H 1GBMA 4B2CA 3KIDU 1O2RA 3QTVH 1X7AC 2HNTE 1BTHH 3M37A 1GG6C 4MPVA 1GBLA 1O2SA 3FANA 2FM2A 2Y7ZA 4MPUA 1SQTA 4F49A 1O38A 1C9TA 1GJ7B 2FOFA 5DP3A 1G3BA 1O39A 8GCHG 1SMFE 1AZZA 4OS7A 4D9QA 1LVBA 1SI5H 1IOEA 4BTIB 3E90B 3NXPA 3P8GA 2XW9A 1GHXH 2KAIA 5LPRA 1WV7H 2W5EA 2G4UA 2PTCE 1OYQA 1KSNA 2ZU1A 5JBCS 1KYNA 4XFQA 1YCPK 1C2EA 4CREA 1O5CB 1ZRBA 1YPKH 3LPRA 1WQSA 2FYRA 4YO9A 1ZYOA 4NGAH 1FY8E 3LGVA 2J38A 2V6NA 2ZIQH 3N7OA 2PSXA 2XBWA 2F91A 1HDTH 1AIXH 2VIDA 2ZZUH 1TX6A 5BPEA 2BOHB 2BY6X 1SOTA 3BTHE 1C9PA 2FTLE 5E8EH 3TK6A 1O37A 4WH6A 7ESTE 1KDQA 3LGIA 5K0HA 3KHVA 2SGPE 1D6WA 1S0RA 4X8VH 3RMMH 1MTNC 4FU7A 4BAHB 1QBVH 5DP8A 4MNWA 4AB9A 1TNHA 1BJUA 4R8TB 4UD9H 2VH0A 3O8DA 2JH5D 2GGVB 3GY7A 4BXSA 4OS4A 1GDQA 4GSOA 1V2LT 1DWEH 1N8OC 2FOCA 1ELTA 1NZQH 3GISB 4X0WU 2HVXA 1MAXA 1P9UA 1UTQA 4HI3A 3HGPA 5SGAE 3SNCA 1GBFA 3GDUA 1CGJE 2FS9A 4TPIZ 1H9HE 1C4V2 1HAVA 1GI8B 2BD9A 2NU2E 1JRTA 1K1IA 4DOQA 2ZKSA 2BDCA 1ELFA 1Z71A 5E0JA 1UTOA 1TB6H 1C1VH 3A8DA 2C3SA 1DS2E 4K69A 3SUEA 2AIQA 1C4U2 1NRSH 4OGYA 3RDZA 1CU1A 4FVBA 1FY3A 3AW1A 2QF0A 3BN9A 4A1VA 1TNJA 1GJCB 1O2PA 2JETB 2ZFFH 2PUQH 3D65E 2GV7A 5FPYA 3Q77A 1V2MT 2CF9H 1TNGA 2ALPA 2PKAB 4F4OC 1JRSA 2TGPZ 3A7YA 3LC3A 3ZZ7A 1NY22 1YC0A 1C1RA 2SGFE 3QO6A 2V0BA 1HPGA 3RXEA 1HAOH 3NUMA 1DY9A 2B8OH 3RXCA 1O3KA 5FBIA 2A5IA 1NTPA 2BDHA 2FESH 4Q2KA 2Z9KA 2THFB 3ZZ6A 2TRMA 2BB4A 3BEFB 1NO9H 2DUCA 2OC8A 1IQNA 1MMJN 3GICB 1OWKA 1NS3A 2PV9B 1TOCB 7LPRA 1G37A 4B74A 3SO3A 1C2GA 2SFAA 3A7VA 1GG6B 4FUHA 4UFEH 4WJG2 5ESTE 2CF8H 3EE0B 4KGAA 4NA9H 1K1PA 3LJJA 3GDSA 1O2QA 1K1MA 1EJMA 2QXJA 1PPFE 5LH8A 1EKBB 4IGDA 1FAXA 3HKJB 2OTVA 1PQ7A 1Z8JB 2ODQA 1Y8TA 1GWAA 1O2TA 3TIUA 2ZPRA 5GCHG 2UUYA 4X1RU 1E36B 1NRQH 5L2ZH 1GDUA 3RXTA 1EZXC 1JMOH 4BANB 3RXLA 4B73A 4E06H 4XSKU 1TNKA 3SUGA 1FIZA 2BDYA 5JB9S 1P10A 3ZZBA 1WBGB 1O3PB 3UIRA 3MTYA 5TCCA 2BYAX 2A1DB 4GCHG 1ZPCA 3SJ8A 4J2YB 4MNYA 3M5NA 3MU0A 3KNXA 1RIWC 3ATWA 1MU8B 1C2DA 3VGCC 2OC1A 4MDSA 3VEQB 3TITA 1GMCG 3Q00A 2V35A 1P04A 5HYOA 1OWIA 2ZFPH 3SU0A 2FX6A 3QGNB 1GHBG 1HLTH 1SG8B 1IQLA 5E2PA 3QWCH 1F5LA 1O3JA 1F0TA 4TY6A 3RXGA 3MI4A 1V6DA 4XOJA 1C5SA 1XUJA 2Z9LA 3TH2H 1YF4A 1O2NA 3E16B 3PLBA 4ESTE 2B9LA 4IW4E 5GPIB 1JIRA 1MBMA 2VINA 1LQEA 5HM9A 1C5QA 2XRCA 3SZNA 1Z8IB 1OP8A 2VIQA 3DUXH 4NCYA 1GBIA 1KXAA 2P59A 3QK1A 1O34A 1PPCE 3E3TA 1F7ZA 3SU2A 1P11E 2FOHA 1DOJA 1NC6A 4KTSA 1D4PB 4Q7YA 2ODYB 1ZHRA 5FPSA 1AMHA 1K1JA 1IHSH 2GT8A 1EOLA 3A86A 1BHXB 4YTAA 4ISOA 3A80A 3L3TA 1BRBE 4ZAEA 3AASA 2ILNA 2F3CE 3QTOH 1P2KA 3A89A 1ZJKA 3ZVCA 3T28A 5A0AE 2PKAA 4U32A 1D9IA 2RDLA 1MKWH 2J9NA 3U8TH 1BBRK 3SNAA 2DE8A 1MU6B 3GCHB 3GDVA 2P94A 2AMQA 1VITH 3SHCH 2C8YB 3SU4A 3PB1E 5F8TA 2STAE 4NWLA 2F9NA 2BDAA 1FV9A 4ABDA 1GI6A 4I8KA 2SNVA 4Y8XA 3M7TA 2OP9A 2BDBA 1ORFA 1YLCA 2HNTF 1P12E 3I77A 2RCEA 1TX8A 2XC0A 1SC8U 1TLDA 2VGCC 3K65B 1UVPA 1BJVA 2FEQH 1BOQA 1P06A 1FAKH 4ZH8A 4ABAA 2FOBA 2WPIS 1H1BA 5AF9H 3TLOA 2R0KA 1EB1H 3NPSA 1UTJA 3SQEE 3SV9A 2ZGBH 1EAWA 3ZZ5A 1AGJA 4UFGH 3BTKE 1BTWA 1A3BH 1DWDH 2GT7A 4E7NA 1K1NA 2ZFSA 2VWNA 1A5HA 3QX5H 1W2KH 1V2KT 3SNDA 1DM4B 1FPCH 4U2WA 1TONA 1D3DB 1DT2A 2BX3A 1XKAC 4ZXXH 1YKTA 5L30H 1V2RT 1C2LA 1H9IE 4CBNA 1GVZA 1VCWA 5C5NA 2UUJB 1J14A 3S7KB 2A4OA 1TOMH 3DFLA 4MNXA 4LZ1H 5TCAA 1ACBE 3MNXA 3MU5A 1RIWB 4X1PU 3SN8A 4AYYB 1MQ6A 3F9FA 3SORA 1DY8A 1K22H 1C2FA 1MTWA 1EQ9A 1P2QA 2C8XB 1VZQH 3VPKA 1GL1A 2RA3A 3CP7A 3TH3H 4QT8C 2BZAA 3AW0A 1O5FH 5EXNA 5FHTA 3RC4A 5FAHA 1TYNA 4ABJA 1YPLH 3ITIA 1SGIB 4I8GA 3Q3KA 5DG6A 3EGKH 1BUIA 1QB6A 1ZPZA 1EASA 1P0SH 1E0FD 2AGGX 1HUTH 5E0GA 4DJZB 2AS9A 4DCDA 4YZUA 1C5UA 3MH5A 1O2KA 3M3VA 3UQVA 2ZU3A 1EAIA 2FI5E 1SLVB 1LHCH 1GI4A 4K8BA 2D8WA 2ZNKH 1HAYB 4D76A 1NT1A 2Y81A 4AG1A 1O5EH 4O03A 2BVRH 5EODA 4WY3A 1QGFA 1Y3VA 4XBCA 3SU5A 3TU7H 1LHGH 1FI8A 3ATIA 1ARCA 1DFPA 1O3NA 3RXJA 2IPHA 3W95A 3ZZAA 1PFXC 3TJUA 2KAIB 2R2WU 2GX4A 2BY9X 4M7GA 4X6NA 1TGNA 1MQ5A 2R9PA 3GY8A 1OP0A 1TPAE 4Y79A 3PTBA 1RJXB 5DKMA 1Y3YA 2G4TA 2GDEH 2QXGA 4HFPB 5EPNA 1O2JA 2W7UA 4TWYA 2QA9E 4BAOB 3QGJA 2J95A 2ZGCA 1ABIH 3UWIA 3LKWA 1ZTLA 2QC2A 1ZSLA 1BHXF 2BLQA 3M35A 3G01A 2AGEX 1DX5M 1T8LA 3A7WA 1O3DA 4X8UH 3SV6A 4ISHH 3OY6U 4OS5A 1ESBA 1RTLA 3TK5A 2ZG0H 3LIWA 1C1OA 1O0DH 1QURH 2FZZA 1XUHA 2J92A 3RP2A 1YPHE 1FQ3A 2J34A 2XBVA 3U9AH 2A4GA 3T5FH 4I8LA 4Y7AA 3E91A 3LGUA 3RXOA 4GLYA 3ENSB 2ZDAH 3S9AA 1C5WB 1MH0A 1G3DA 4CR5A 1EJAA 7GCHF 2IOTA 3UTUH 5ETXA 5HXFA 3MO6A 1ETTH 1V2UT 2ASUB 3ZZ8A 1E38B 2VIWA 3PROA 3M61U 1C5LH 4DURA 3MH7A 3MO9A 1YLDA 4AZ2B 2OC0A 3V3MA 3T25A 1HGTH 2OXSA 2CN0H 5T6DA 1WAYB 3O8RA 3SU3A 2ZDKA 1DICA 3ODFA 1F92A 1UO6A 1MKXK 3H7TA 4BNRA 5C1UA 4FUCA 2W3IA 1HRTH 3SGQE 5CHAC 5I46H 1S82A 1C5MD 4ZUHA 3PYHA 3ZYEA 4D9RA 3BSQA 3ZZ4A 1C1PA 5A8ZA 1O3CA 1AE8H 1DITH 1HXFH 1O2WA 1ZMLA 3RMNH 1TE0A 1IQIA 1GI2A 3UREA 2ZCKP 3K9XB 4IC5A 5HGGA 1O5GH 1VCPA 1BB0B 1GGDC 3MYWA 1WU1A 1THPB 3HK6B 3KEEA 5FXLA 1YPJH 4LZ4B 1GI7B 3MWIU 2CHAC 2OQ5A 2EI7A 2HNTC 3RLYH 4AFUA 5EQQA 1OSSA 1SFIA 1PQ5A 9LPRA 5EOKA 1FNIA 5E0HA 1E37B 2ZO3H 4XBBA 3ATKA 2FI4E 1FUJA 4CRAA 5FCKA 1QY6A 4Y8YA 3HPTB 3GY6A 2O9QA 5JB8S 2H9EH 1FY5A 3BIUH 3E0NB 4X2WA 4D7FA 1IQFA 2EI8A 1P57B 1ANBA 3FP7E 3S0NA 1IQKA 2P3TB 3RMOH 1C5NH 3BF6H 3BTDE 3QUMP 2Y5GA 1HAZB 1GBBA 4GVUA 4Y0YE 2AGIX 1OS8A 2FX4A 3ZV8A 1YCPH 1S83A 1SGPE 1GMDF 3RXMA 3LDXH 4UDWH 1BA8B 1BTZA 1O3FA 1G36A 2ZHFH 3RM0H 1P2OA 4WMFA 4JYUH 1CBWB 1TGCA 2SGQE 1IQHA 1MZAA 3A8AA 4CHAB 1P05A 1IHTH 2QCYA 2BVSH 2ZTXA 3IWMA 1EZQA 3ELAH 2O8TA 3A8CA 1V2OT 2TGTA 2HALA 2Y82A 4O97A 1TPOA 2GCTB 4ABIA 5I25A 1TPSA 1TGSZ 1U6QA 4SGBE 5DK1A 4ZHMU 5B6OA 2VNTA 1KXBA 3ZVFA 1N6XA 4CBOA 3BTME 4I8HA 1GI9B 1DDJA 3P8OA 2IJOB 1L4DA 4IMZA 3PMHB 1HAGE 4ASHA 2O8WA 1LPZB 2BMGB 2WINI 2XTTB 3UPEA 1O2GH 1P03A 1CA0B 3SUDA 3U98H 2G51A 2BY7X 3A7TA 5EXLA 2OUAA 1NN6A 2ANKH 8LPRA 2BQ7B 5C67A 3ODDA 1N6YA 3BTWE 4ABFA 1LO6A 1Z1IA 1ZPBA 2XCNA 2ZDNA 3KQCA 1YBWA 5GIBA 3EA9A 2BXTH 2ZGJA 1XX9A 3LH3A 1LDTT 1W3CA 2A7HA 1B0FA 1ZZZA 4IS5A 3UNQA 1PQ8A 1DXWA 3A8BA 1HJ9A 1THRH 1KXCA 1P3CA 1UHBB 3BEIB 4YOIA 1AKSA 1Z8GA 2B0FA 4Y11E 5CHAB 2EA3A 1ZHPA 1N1LA 4K1TA 3UUZA 1CSOE 1S84A 1O2XA 2ZHDA 1HFDA 2VIVA 3B23B 1SLWB 2VWLA 4TWWA 1O3EA 1OYTH 1C4Y2 1W11U 1PPEE 5JBAS 1GGDB 1JXPA 3MNBA 3RXRA 4ZROA 1LPGB 3V7TA 3A83A 2CHAB 4UFFH 1FMGA 1SB1H 4NA7A 2HWLB 1NROH 4HGCA 1ZSJA 2VH6A 3OYPA 4DGJA 1MZDA 3GCHC 4RKJB 3GCOA 3RXBA 2PR3A 1XXDA 1OOKB 3PV4A 1OWDA 2UUKB 2AIPA 4TPYA 5A8YA 1UVSH 3RM2H 2EC9H 5C5OA 3D23A 1J8AA 1NU9A 3NK8A 1T7CA 2GMTC 4ZHLU 1TBZH 3RLWH 1XUFA 2ZPQA 2GTBA 2ZDVH 1A3EH 2TGAA 1GBCA 1TBRH 3ZVEA 2SGAA 3UR9A 4E7RG 2QF3A 1SPJA 3DFJA 1P8VC 2C90B 3A88A 1TGTA 2Z9IA 1NFUA 4Y76A 1FIWA 4YLUA 1QIXB 1KLTA 1L1JA 1Z6JH 1Y5BT 1A0LA 2YNBA 5T6FA 3PWBA 4ISIH 4FUJA 1L0ZA 4INHA 4GUXA 3S9CA 2XWBI 1CHGA 4MVNA 3B9FH 5FX5A 3SNBA 4NSYA 4HTCH 2A4QA 3QDZB 1T8MA 4JK6A 1GJDB 2CMYA 1TBQH 1EOJA 3KN2A 3O8CA 3SOSA 1V2QT 3R0FA 5GJ4B 1SLXB 1ESAA 4WWYA 4JMYA 2A0QB 1O33A 1W13U 4Y7BA 5AFYH 1GJ6A 1NRRH 2ANWA 3GOVB 5JYIA 1S85A 2D26C 1BRUP 1SSXA 3M36A 4Y6DA 5BRRE 2NWNA 1P2JA 1EUFA 1W12U 2XC5A 4CRBA 2GD4B 1GPZA 1VITF 3UNSA 4THNH 2ZQ2A 3V0XA 1TPPA 2AYWA 1SLUB 3SU1A 2ODPA 1SL3A 1C1SA 3ESTA 1S6HA 1SGEE 3DD2H 1LCYA 3BV9B 1AU8A 1HJAC 4K60A 3WY8A 4Z0KA 2V3OH 1WOFA 3HK3B 1OPHB 2ESTE 1T8NA 1GDNA 3A7XA 1XMNB 1ZSKA 2QV1A 1CHOF 3RXUA 1F0UA 1XUKA 1QJ7B 4WF8A 1ELDE 2ZC9H 1O2IA 1YCPM 3RXVA 1C1MA 2TBSA 5JDUB 1BCUH 2P3UB 2R0LA 4UFDH 1DLKB 1O2HA 5DP5A 1BMMH 1UHBA 2Z7FE 4K8YA 4B76A 2Y5HA 1CVWH 1UTNA 3RXKA 3VB4A 2C8WB 1KTTB 4LXBH 1AVXA 1O3MA 1QCPA 1INCA 1J9CH 3BTGE 1DWBH 1H9LB 4O3UA 4AORA 1O3IA 1C1UH 3SGBE 4Q7ZA 2ULLA 2CV3A 4IBLH 3PLKA 4D7GA 1SGFG 3Q3XA 2DE9A 4H4FA 3SGAE 4NIYA 1A5GH 2GZ7A 2HOBA 3V12A 1D6RA 1V2VT 5EPYA 1P2IA 3EAJA 3U1IB 3ZZ9A 3LH1A 3UQOA 1FDPA 1GMHF 4JYTA 1G9IE 3GY2A 4BXWA 1GBHA 1QHRB 1UVTH 3SJIA 1O2OA 3SW2B 1TMBH 3LC5A 4X6PA 1CGHA 3OX7U 2H2ZA 4GHQA 2OCVB 2GMTB 2TPIZ 3DT0H 1VJ9U 2ZWLH 5A8XA 1E34B 2GV6A 4WVPE 1LHEH 3RXDA 1O3GA 2CJIA 2ZECA 3E0PB 1AWFH 1BMAA 4U30A 7GCHG 2FLRH 1FZZA 1TQ0B 2H9HA 4WXIA 3GCTF 1QL9A 2W26A 4H42U 4I33A 1CO7E 3RXAA 1V2JT 2PTNA 1HAIH 4RSPA 4UE7H 4CH8B 3GYLB 2XWAA 2D1JA 4DIHH 1KIGH 2BQ6B 4ABHA 1MAYA 1VJAU 1AB9C 3ZZCA 4KP0A 3MU1A 1C2MA 1KY9A 2A7JA 1ARBA 1EAXA 2P93A 4OS6A 2ZF0H 3VB5A 2QIQA 1WTGH 1S6FA 2SGEE 3ATLA 1GVLA 2C8ZB 3Q76A 3MO3A 1QBOA 2WPMS 2VVCA 2Z3CA 1XKBC 4I32A 2F83A 3HKIB 2HPPH 2K1QA 1C1WH 4DVAU 4XDEA 2ZQ1A 4LOYH 4YOGA 2Z3DA 3LOXA 3MMGA 1AD8H 2P3FH 1IQGA 1YPMH 3P6ZB 1DANH 2G81E 5DP4A 1BTYA 1BMLA 3LU9B 5JPMH 1AWHB 1P09A 4AN7A 1CT4E 9ESTA 1ABJH 4B2AA 3MOCA 4X6MA 1TABE 3BTFE 4A7IB 2PGBB 1MTVA 3JZ1B 1KTSB 2AEIH 4JZ1A 5HMAA 1RTKA 2BOKA 1HJAB 2PFEA 3BG4C 2A2QH 2O8UA 1ANCA 2BD2A 1T31A 1G3EA 1Z6EA 1ZMJA 4Y8ZA 1UK3A 4FUFA 2B5TB 1WCZA 1C5PA 4VGCB 4OS2A 4CR9A 5FX6A 1G32B 1ZTKA 2Q6GA 1GMDG 2AH4X 3K6ZA 4NG9H 2FYQA 1O2ZA 1HCGA 4K1SA 4Z6AH 2YOLA 3MNSA 2ZFRH 1GHAF 1C2HA 5H4IB 1O2UA 3A87A 1YPGH 2A4RA 3EA7A 1DPOA 1QJ1B 4CH2B 1AI8H 2VVVA 1J15A 2PUXB 1FN6A 4FUGA 2WUCA 1SGFA 1SHHB 1T4UH 2AERH 3FAOA 3GCNA 1CE5A 4JZFH 1CBWC 5GDSH 4MTBA 1Y3XA 3UOPA 2Q6DA 1O30A 4CHAC 5CE1A 4JCNA 1Q2WA 2WPHS 1NFYA 4B2BA 4KTUA 1YPHC 1TRYA 5DP9A 2GCTC 3PM3A 1S0QA 3VB7A 1LMWB 4X6OA 1OX1A 3RXQA 2AMDA 4RN6A 1S81A 3I78A 2XC4A 1HAPH 1D3TB 1ZHMA 4MPWA 5EW1H 2QAAA 3MHWU 1UVUH 5K7RA 1PPGE 4X8TH 2PHBA 4TYDA 1UTPA 2BM2A 2ZI2H 2C4FH 1KLIH 2F9BH 1QA7A 3RXIA 3BG8A 3M7QA 5C3NA 3MU8A 1BTUA 1C1QA 4J1YA 1CA0C 2ZPSA 1O3AA 3ZVBA 1EPTB 1PPBH 2OBQA 4ZXYH 1SQAA 2BLVA 1O2VA 3BEUA 3U8OH 1H4WA 5A0CA 5FCRA 3M7UA 1MKXH 5EGMA 1AB9B 2Y5FA 1NFXA 3SJ9A 3TNSA 2H5DA 1TNIA 1ELVA 1FPHH 1LKAA 2G55A 3IG6B 5DJ7A 1GHVH 1GVKB 1V2TT 3O8BA 4A6LA 2A31A 4IMQA 1VGCB 4NIWA 1GBEA 1GBJA 1OWEA 2QYIA 1EXFA 3GY3A 1AKSB 1HJ8A 3VXFH 1W0YH 2ZTYA 5A2MH 2VJ1A 1F0RA 5EG4A 2WPLS 2FS8A 4X1QU 4X1SU 3U69H 1ZTJA 3SBKA 2A5AA 2A7CA 1UCYH 5IYTA 1EZUC 4YOJA 1IAUA 2ANYA 3A7ZA 4X1NU 3ZV9A 3RC6A 2H5CA 4JK5A 1WSSH 4AYVB 3A82A 2OC7A 1W7GH 3URDA 2FOEA 4K3JA 3RXHA 6GCHF 3CS0A 3LGWA 4A5TS 1WTHD 1O5AB 2XBXA 3QZRA 5T3HA 3TGIE 1BITA 2ZU5A 1W8BH 3RXPA 1J16A 3NKKA 3BG4B 3TJVA 1ZGVA 2Y6TA 3RC5A 5FBEA 5GXPA 2YNAA 2NU4E 1GI1A 1EP5A 2BLWA 5G4BA 1TRMA 4WH8A 4OS1A 4H6SB 1YGCH 1W14U 1ZR0A 4H6TA 3M3SA 1KXEA 2G8TA 1C2KA 1P3EA 1RFNA 3KQBA 1JIMA 1EZSC 1AZ8A 2JH6D 2LNCA 4MNVA 1LQDB 4I7YH 3D49H 2NU3E 3QLPH 1V3XA 3SV7A 1DVAH 1WYKA 2F9OA 1Z8RA 4YESB 1LHFH 1MBQA 1UTMA 2OBOA 2A45B 1QNJA 3S69A 3TJNA 1W0ZU 3BTTE 3F9GA 2Q1JA 4ABGA 1KXFA 1ETRH 4X8SH 5LPFA 1DWCH 1O2YA 2PLXA 1O2MA 1SR5C 2HRVA 1AFQB 3PO1C 3TGJE 3U1JB 1GI3A 1KXDA 5L2YH 2RG3A 2PWXA 1PPZA 1AO5A 2BY5X 3F1SB 1DE7H 1L1GA 1MD8A 1VITG 4A1TA 1HV7A 1GJ9B 4WMEA 3K2UA 2C93B 1QRXA 3A81A 1WQVH 1PQAA 2STBE 4FUIA 4MQAA 4K2YA 1RD3B 2HGTH 5EW2H 4AG2A 1QJ6B 1BTPA 4X2XA 3P70B 1C5XB 1TA2A 2UUFB 1C2JA 1EPTA 1LTOA 3SI4H 1BIOA 1CHOG 1SGYE 3C1KA 3ATMA 3EA8A 2R2MB 1UVOA 4K1EA 4NZLA 1O2LA 1SGDE 1SGCA 1O3LA 1OWHA 3LJOA 1IQMA 4K5ZA 4ISLA 3HGNA 3OY5U 3KCGH 4YT6H 1H8IH 2F9PA 2VU8E 1OWJA 2Y80A 2FPZA 1M9UA 3RMLH 1G30B 2VIPA 4WMDA 4GAWA 1LHDH 1H8DH 2VB0A 1UTLM 2WYGA 2O8LA 2ZCHP 5DPAA 4BOHA 3GYMA 8ESTE 1L1NA 1Y59T 1SGTA 1LPKB 1HBTH 3A85A 3R3GB 1Q31A 1DSUA 2ZP0H 4IN2A 3KQDA 1GMHG 1NM6A 1FJSA 1TFXA 1Y5AT 4A1XA 3T26A 5EQRA 1QQ4A 5DP7A 4FVDA 2PW8H 2G5NA 4FU9A 3TPIZ 3LONA 2BHGA 1ID5H 2FOGA 3ZZDA 3T27A 1QL8A 1UCYE 2ZTZA 3SV8A 1HIAB 3OTJE 1TIOA 4JYVH 1FN8A 2G00A 1AY6H 1SBWA 4BTUB 1FY1A 2Q6FA 3TGKE 3E8LA 1QTFA 1CQQA 3GCTG 1MUEB 6LPRA 1AE5A 1V2WT 1UTKA 2BD3A 3UWJH 3UFAA 2FIRH 1MCTA 3K6YA 4X2YA 3W94A 3SUFA 2QGRA 3H7OA 2ZHQH 4XBDA 2G5VA 4UONA 4CRCA 3FVFB 2XBYA 4FXGH 3A84A 1TWXB 1SFQB 3BIVH 1O3BA 1WUNH 2GDDA 3NCLA 1CT2E 2NU0E 1C5ZB 1F5KU 1ETSH 1BT7A 2BVXH 2VVUA 1BMNH 3UR6A 1A61H 1XVMA 3P17H 4DT7B 1GHYH 4AFZA 1QL7A 3IITA 1ZOMA 2AMPA 2GVFA 1GJAB 1GI5A 1NESE 1DUEA 1SVPA 5EQSA 1QQUA 3C27B 1XM1A 2ZEBA 3PO1B 3M5LA 1VCQA 4Q80A 4BAQB 3CENA 1GJ4H 1LVOA 1K9OE 1MD7A 3D62A 3S9BA 2M5TA 2IN2A 3RUOA 1ESTA 8GCHF 3UNRA 1LVYA 1P2MA 1C5VA 1DXPA 4RKOB 2QXIA 1LKBA 2ZCLP 1QFKH 4LK4A 3ZVGA 4ZKNU 1TGBA 5JBBS 1K21H 2Z94A 2ZU2A 3F6UH 5JBTA 1GBTA 1K28D 2HLCA 1FXYA 2BD5A 2O8MA 3PMAB 3S7HB 1ELGA 3STJA 1ANDA 1OKXA 1NFWA 2XYAA 1YM0A 4KKDA 3ZYDA 1AQ7A 2W7SA 4DW2U 3TVJB 3VFEA 1TAWA 4IN1A 5AVDA 1B5GH 4D8NA 5FPTA 1W10U 1DLEA 2QN5T 1GHAG 3H5CB 1QB1A 4VGCC 3FZZA 3MNCA 3KL6A 1MTNB 1C2IA 3RXSA 5ABWA 1PYTC 1GCDA 5IDKA 3KGPA 4BAKB 2BQWB 3RU4E 1G2MA 1ANEA 4JZDH 1FY4A 3SJKA 3VB3A 1ZGIA 4A92A 1GCTC 2P8OC 1HNEE 2J2UA 3EYDA 4DY7B 1N8OB 2P16A 4AFQA 4CRDA 5A0BA 1O31A 4CRGA 1BRCE 1PPHE 1BBRH 3URCA 4FU8A 1Y5UT 3GY4A 4R0IA 1EJNA 1O5DH 1EAUA 1JOUB 2B7DH 2FP7B 5LGOA 2H9TH 5F03A 3T2NA 4NFEA 2XCFA 3JZ2B 3TNTA 2F9UA 3ZVAA 1K1LA 4ISNA 5GWZA 1GI0A 1Y3UA 3MH6A 4B71A 4NIVA 3PTNA 1HYLA 1UJ1A 1KLJH 1A46H 2W3KA 5CMXH 2ZFQH 1D3PB 1GBDA 1QBNA 2FWWA 1AUTC 1THSH 4TY7A 4ZKOU 5ESBA 1F2SE 1JBUH 5EU8A 1HIAA 2WYJA 1NRNH 2NU1E 1W7XH 1TMTH 3P8NA 4MLFB 2J94A 4NWKA 1A0HB 1A4WH 3E6PH 1DUAA 2XNIA 1TALA 1C1NA 1RRKA 4HZHA 4O3TA 1SOZA 1Q3XA 1AN1E 2JH0D 1AUJA 2UWLA 3AAVA 1TMUH 1J17T 3B8JA 3RU4T 4MPXA 3UY9A 2WV4A 1BQYA 1GJ5H 4ABBA 1RGQA 2HPQH 2CXVA 2BDGA 5EXMA 3VB6A 2Z6BD 4AB8A 4ZMAH 1HAXB 1XVOA 1O5BB 1QRWA 1EPTC 3UOUA 5PTPA 1GHWH 1MKWK 5T6GA 5A09A 2XXLA 1A7SA 1DSTA 2BD8A 1HXEH 4FUDA 1T4VH 4GPGA 1YYY1 2F9VA 4U01A 5J4QA 6CHAC 4E05H 5C20A 2FDAA 1EB2A 3V13A 4GHTA 4CRFA 4AGJA 3LGYA 2A5KA 1O32A 1V2ST 1ELCA 1QB9A 1VGCC 4NSVA 3T29A 3ZVDA 1SGQE 1BDAA 2ZA5A 4ZKSU 4I31A 1E35B 4AGKA 2Y7XA 2I6QA 4JZIA 8KME2 4Q7XA 1OP2A 3M5OA 3NWUA 1Y3WA 1CA8B 1O35A 1TX7A 4AFSA 4B1TA 2Z3EA 3T62A 2BTCE 4XE4A 3PWCA 1V2NT 2TGDA 6GCHG 2FTMA 1GBAA 3SV2H 1NRPH 2WPJS 1AFEH 1RXPA 1D3QB 1F0SA 6ESTA 3HATH 5C1XA 5GCHF 1B0EA 4O9VA 1MTSA 3SJOA 3AAUA 1TQ7B 1VR1H 2FMJA 2G52A 1YPEH 5C1YA 1C5YB 4NFFA 2ZFTA 3RU4D 1PJPA 2WUBA 4YLQH 3STIA 2FLBH 1MTUA 3VGCB 1TA6A 4GCHF 1L2EA 1Z1JA 1GBKA 4MG3A 4FUBA 1A5IA 1YP9A 1IQEA 1XUGA 1C1TA 2A2XH 2TIOA 2ZDMA 2GCHG 4KTCA 4ZKRU 3P92A 1ZLRA 1C5TA 3MFJA 5LPEA 5DGJA 2ZGXH 2JKHA 1ELAA 2EI6A 2FODA 3RXFA 1PYTD 3OU0A 4Y71A 1GMCF 2BY8X 2OD3B 5L6NH 3GY5A 1C5OH 1T32A 1RTFB 1GHZA 2FO9A 2A32A 2PKSC 1AVGH 1GCTB 1QA0A 1P9SA 2P8OB 2R3YA 2ZHWH 1GHBF 2H1UA 2FOMB 1K1OA 2SGDE 3SI3H 1NPMA 3LGTA 1B7XB 4AOQA 1QR3E 3P8FA 1K2I1 4KELA 4Y0ZE 1G3CA 2AFQB 3P95A 2ZGHA 2H6MA 2WPKS 3QN7A 2P95A 1HAHH 1CT0E 5F6MA 3SHAH 1BRAA 1AFQC 2PSYA 2OQUA 3ZZ3A 1BBRE 2ALVA 3KF2A 1OXGA 2QY0B 1ZRKA 3U8RH 5TJXA 5HM2A 3MU4A 4IC6A 1GJBB 1TNLA 1T8OA 4ABEA 1ELEE 1ZMNA 3L33A 2GZ9A
chains in the Genus database with same CATH superfamily
3DHKH 2UWPA 1NU7B 3KQEA 2BD7A 1XXFA 3Q3YA 4NA8A 5E2OA 3SQHE 4AX9H 4WXVA 4ZHAA 3TH4H 4Y10E 2GZ8A 2Z9GA 4INKA 2Z9JA 1SQOA 1Z7KA 2WSSD 3FFGA 7KMEH 4I8JA 2ZDLA 1GJ8B 2BDIA 4X2VA 2GP9B 1LVMA 2VWOA 6CHAB 1KDQB 2CGAA 3FZDA 2VGCB 3TK9A 1EP6A 2I6SA 4BTTB 1A0JA 1P2NA 1F5RA 2ANMH 2R3UA 4YM9A 1BZXE 5DP6A 2FI3E 2GKVE 1FONA 3BTEE 5AHGH 2ZHEH 1V2PT 2RA0A 3M3TA 5C2ZA 2W6JD 3E1XB 2J4IA 3FP8E 1SGNE 2EEKA 3F9HA 1AHTH 2WV5A 3LT3A 1L4ZA 1MCVA 2UWOA 5CDFE 1GL0E 2ZU4A 1HAVB 2BLOA 1S5SA 3F68H 1P01A 1ZJDA 2VIOA 4DIIH 1TRNA 2BXUH 5F8ZA 4OGXA 4YT7H 3QZQA 3NZIA 4NIXA 1CGIE 3DA9B 3I29A 1HB0B 5J4SA 2BD4A 2GJGA 2PGQB 4PROA 2JJ1D 2BZ6H 3EDXB 4UEHH 1FLEE 5F8XA 2W6ID 1JWTA 1O3HA 2FOAA 4NZQA 2FXRA 2OLGA 5AFZH 4BAMB 2JETC 3TJOA 3F9EA 3PMBB 1XUIA 2V3HH 1QRZA 2VWMA 3SNEA 1C5RA 3AVZA 3L6PA 3SU6A 1A1RA 1ELBA 4JZEH 5DO4H 2BX4A 3FP6E 1UK4A 1H8ED 1UCYK 3PMJA 3CS7A 2SNWA 2OINA 2QXHA 3M5MA 1P02A 3MH4A 3OSYA 1SHYA 4INLA 1G2LA 3PLPA 3BTQE 1EX3A 2GCHF 2LPRA 1A2CH 4SGAE 1SGRE 2PKSB 1EATA 1BTXA 3VXEH 4B75A 1O3OA 4DG4A 1UK2A 1AVWA 4FUEA 2D2DA 1O36A 1IQJA 1RS0A 1UMAH 3EQ0H 1GBMA 2RFKC 4B2CA 3KIDU 1O2RA 3QTVH 1X7AC 2HNTE 1BTHH 3M37A 1GG6C 4MPVA 1GBLA 1O2SA 3FANA 2FM2A 2Y7ZA 4MPUA 1SQTA 4F49A 1O38A 1C9TA 1GJ7B 2FOFA 5DP3A 1G3BA 1O39A 8GCHG 1SMFE 1AZZA 4OS7A 4D9QA 1LVBA 1SI5H 1IOEA 4BTIB 3E90B 3NXPA 3P8GA 2XW9A 1GHXH 2KAIA 5LPRA 1WV7H 2W5EA 2G4UA 2PTCE 1OYQA 1KSNA 2ZU1A 5JBCS 1KYNA 5KECA 4XFQA 1YCPK 1C2EA 4CREA 1O5CB 1ZRBA 1YPKH 3LPRA 1WQSA 2FYRA 4YO9A 1ZYOA 4NGAH 1FY8E 3LGVA 2J38A 2V6NA 2ZIQH 3N7OA 1S6LA 2PSXA 2XBWA 2F91A 1HDTH 3KQ5A 1K0HA 1AIXH 2VIDA 2ZZUH 1TX6A 5BPEA 2BOHB 2BY6X 1SOTA 3BTHE 1C9PA 2FTLE 5E8EH 3TK6A 1O37A 4WH6A 7ESTE 1KDQA 3LGIA 5K0HA 3KHVA 2SGPE 1D6WA 1S0RA 4X8VH 3RMMH 1MTNC 4FU7A 4BAHB 1QBVH 5DP8A 4MNWA 4AB9A 1TNHA 1BJUA 4R8TB 4UD9H 5HIZA 2VH0A 3O8DA 2JH5D 3N7DA 2GGVB 3GY7A 4BXSA 4OS4A 1GDQA 4TT3D 4GSOA 1V2LT 1DWEH 1N8OC 2FOCA 1E79D 1ELTA 1NZQH 3GISB 2HVXA 4X0WU 1MAXA 1P9UA 1UTQA 4HI3A 4XRNA 3HGPA 5SGAE 3SNCA 1GBFA 3GDUA 1CGJE 2FS9A 4TPIZ 1H9HE 1C4V2 1HAVA 1GI8B 2BD9A 2NU2E 1JRTA 1K1IA 4DOQA 2ZKSA 2BDCA 1ELFA 1Z71A 5E0JA 2HVYB 3AK5A 1UTOA 1TB6H 1C1VH 3A8DA 2C3SA 1DS2E 3PV5A 4K69A 3SUEA 2AIQA 1C4U2 1NRSH 4OGYA 3RDZA 1CU1A 4FVBA 1FY3A 3AW1A 2QF0A 3BN9A 4A1VA 1TNJA 1GJCB 1O2PA 2JETB 2ZFFH 2PUQH 3D65E 2GV7A 5FPYA 3Q77A 5EJLA 1V2MT 2CF9H 1TNGA 4Q4LA 2ALPA 2PKAB 4F4OC 1JRSA 2TGPZ 3A7YA 3LC3A 3ZZ7A 1NY22 1YC0A 1C1RA 2SGFE 3QO6A 2V0BA 1HPGA 3RXEA 1HAOH 3NUMA 1DY9A 2B8OH 3RXCA 4B6EA 1O3KA 5FBIA 2A5IA 1NTPA 2BDHA 2FESH 4Q2KA 2Z9KA 2THFB 3ZZ6A 2TRMA 2BB4A 3BEFB 1NBMD 1NO9H 2DUCA 2OC8A 1IQNA 1MMJN 3GICB 1OWKA 1NS3A 2PV9B 1TOCB 7LPRA 1G37A 4B74A 3SO3A 1C2GA 2SFAA 3A7VA 3WWBA 1GG6B 4FUHA 4UFEH 4WJG2 5ESTE 2CF8H 3EE0B 4KGAA 4NA9H 1K1PA 3LJJA 3GDSA 1O2QA 1K1MA 1EJMA 2QXJA 1PPFE 5LH8A 3N99A 1EKBB 4IGDA 1FAXA 3HKJB 2OTVA 1PQ7A 1Z8JB 2ODQA 1Y8TA 2L74A 1GWAA 1O2TA 2K8IA 3TIUA 2ZPRA 5GCHG 2UUYA 4X1RU 1E36B 1NRQH 5L2ZH 1GDUA 3RXTA 1EZXC 2IPQX 1JMOH 4BANB 3RXLA 4B73A 4E06H 4XSKU 1TNKA 3SUGA 1FIZA 2BDYA 5JB9S 1P10A 3ZZBA 1WBGB 1O3PB 3UIRA 3MTYA 4RT0A 5TCCA 2BYAX 2A1DB 4GCHG 1ZPCA 3SJ8A 4J2YB 4MNYA 3M5NA 3MU0A 3KNXA 1RIWC 4OM9A 3ATWA 1MU8B 1C2DA 3VGCC 2OC1A 4MDSA 3VEQB 3TITA 1GMCG 3Q00A 2V35A 1P04A 5HYOA 1OWIA 2ZFPH 3SU0A 2FX6A 3QGNB 1GHBG 1HLTH 1SG8B 1IQLA 5E2PA 3QWCH 1F5LA 1O3JA 1F0TA 4TY6A 3RXGA 3MI4A 1V6DA 4XOJA 1C5SA 1XUJA 2JIZD 2Z9LA 3TH2H 1YF4A 1O2NA 3E16B 3PLBA 4ESTE 2B9LA 4IW4E 5GPIB 1JIRA 1MBMA 2VINA 1LQEA 5HM9A 1C5QA 2XRCA 3SZNA 1Z8IB 1OP8A 2VIQA 3DUXH 4NCYA 1GBIA 1KXAA 2P59A 3QK1A 1O34A 1PPCE 3E3TA 1F7ZA 3SU2A 1P11E 2FOHA 1DOJA 1NC6A 4KTSA 1D4PB 4Q7YA 2ODYB 1ZHRA 5FPSA 1AMHA 1K1JA 1IHSH 2GT8A 1EOLA 3A86A 1BHXB 4YTAA 5EJ1A 4ISOA 2AHME 3A80A 3L3TA 1BRBE 4ZAEA 3AASA 2ILNA 2F3CE 3QTOH 1P2KA 3A89A 1ZJKA 3ZVCA 3T28A 5A0AE 2PKAA 4U32A 1D9IA 2RDLA 1MKWH 2J9NA 2KCOA 3U8TH 1BBRK 3SNAA 2F43B 2DE8A 3OEED 1MU6B 3GCHB 3GDVA 2P94A 2AMQA 4RT1A 1VITH 3SHCH 2KX4A 2C8YB 3SU4A 3OFND 3PB1E 5F8TA 2STAE 4NWLA 2F9NA 2BDAA 2LP6A 1FV9A 4ABDA 1GI6A 2QE7D 4I8KA 2SNVA 4Y8XA 3M7TA 2OP9A 2BDBA 1ORFA 1YLCA 2HNTF 1P12E 3I77A 2RCEA 1TX8A 2XC0A 1SC8U 1TLDA 2VGCC 3K65B 1UVPA 1BJVA 2FEQH 1BOQA 1P06A 1FAKH 4ZH8A 4ABAA 2FOBA 2WPIS 1H1BA 5AF9H 3TLOA 2R0KA 1EB1H 3NPSA 1UTJA 3SQEE 3SV9A 2ZGBH 1EAWA 3ZZ5A 1AGJA 4UFGH 3BTKE 1BTWA 1A3BH 1DWDH 2GT7A 4E7NA 1K1NA 2ZFSA 2VWNA 2L6OA 1A5HA 3QX5H 1W2KH 1V2KT 3SNDA 1DM4B 1FPCH 4U2WA 2KFWA 1TONA 2OK5A 1D3DB 1DT2A 2BX3A 1XKAC 4ZXXH 1YKTA 5L30H 1V2RT 1C2LA 1H9IE 4CBNA 1GVZA 1VCWA 5C5NA 2UUJB 1J14A 3S7KB 2A4OA 1TOMH 3DFLA 4MNXA 4LZ1H 5TCAA 1ACBE 3MNXA 3MU5A 1RIWB 4X1PU 3SN8A 4AYYB 1MQ6A 3F9FA 3SORA 1DY8A 1FX0B 1K22H 1C2FA 1MTWA 1EQ9A 1P2QA 2C8XB 1VZQH 3VPKA 1GL1A 2RA3A 3CP7A 3TH3H 4QT8C 2BZAA 3AW0A 1O5FH 5EXNA 5FHTA 3RC4A 5FAHA 1TYNA 4ABJA 1YPLH 3ITIA 1SGIB 4I8GA 3Q3KA 5DG6A 3EGKH 1BUIA 1QB6A 1ZPZA 1EASA 1P0SH 2IJD1 1E0FD 2AGGX 1HUTH 5E0GA 4DJZB 2AS9A 4DCDA 2EQNA 4YZUA 1C5UA 3MH5A 1O2KA 3M3VA 5HKKD 3UQVA 2ZU3A 1EAIA 2FI5E 1SLVB 1LHCH 1GI4A 4K8BA 5HIYA 2D8WA 2ZNKH 1HAYB 4D76A 1NT1A 2Y81A 4AG1A 1O5EH 4O03A 2BVRH 5EODA 4WY3A 1QGFA 2EY4C 1Y3VA 2JJ2D 4XBCA 3SU5A 3TU7H 1LHGH 1FI8A 3ATIA 1ARCA 1DFPA 1O3NA 3RXJA 2IPHA 3W95A 3ZZAA 1PFXC 2KCAA 3TJUA 2KAIB 2R2WU 2GX4A 2BY9X 4M7GA 4X6NA 1TGNA 1MQ5A 2R9PA 3GY8A 5CHBA 1OP0A 1TPAE 4Y79A 3SYJA 3PTBA 1RJXB 5DKMA 1Y3YA 2G4TA 2GDEH 2QXGA 4HFPB 5EPNA 1O2JA 2W7UA 4TWYA 2QA9E 4BAOB 3QGJA 2J95A 2ZGCA 1ABIH 3UWIA 3LKWA 1ZTLA 2QC2A 1ZSLA 1BHXF 2BLQA 3M35A 3G01A 2AGEX 1DX5M 5DN6D 1T8LA 3A7WA 1O3DA 4X8UH 3SV6A 4ISHH 3OY6U 4OS5A 1ESBA 1RTLA 3TK5A 2ZG0H 3LIWA 4TSFD 1C1OA 1O0DH 4DT4A 1QURH 2FZZA 1XUHA 2J92A 3RP2A 1YPHE 1FQ3A 2J34A 2XBVA 3U9AH 2A4GA 3T5FH 4I8LA 4Y7AA 3E91A 3LGUA 3RXOA 4GLYA 1YWUA 3ENSB 2ZDAH 3S9AA 1C5WB 1MH0A 1G3DA 4CR5A 2KM0A 1EJAA 7GCHF 2IOTA 3UTUH 5ETXA 5HXFA 3MO6A 1ETTH 1V2UT 2ASUB 3ZZ8A 1E38B 2VIWA 3PROA 3M61U 1C5LH 4DURA 3MH7A 3MO9A 1YLDA 4AZ2B 2OC0A 3V3MA 3T25A 1HGTH 2OXSA 2CN0H 2RDEA 5T6DA 3WW7A 1WAYB 3O8RA 3SU3A 2ZDKA 1DICA 3ODFA 1F92A 1UO6A 1MKXK 3H7TA 4BNRA 5C1UA 4FUCA 2W3IA 1HRTH 3SGQE 5CHAC 5I46H 1S82A 1C5MD 4ZUHA 3PYHA 3ZYEA 4D9RA 3BSQA 3ZZ4A 1C1PA 5A8ZA 1O3CA 1AE8H 1DITH 1HXFH 1O2WA 1ZMLA 3RMNH 1TE0A 1IQIA 1GI2A 3UREA 2ZCKP 3K9XB 4IC5A 5HGGA 1O5GH 1VCPA 1BB0B 1GGDC 3MYWA 1WU1A 1THPB 3HK6B 3KEEA 5FXLA 1YPJH 4LZ4B 1GI7B 3MWIU 3F2GA 2CHAC 2OQ5A 2EI7A 2HNTC 3RLYH 4AFUA 5EQQA 1OSSA 1SFIA 1PQ5A 9LPRA 5EOKA 1FNIA 5E0HA 1E37B 1KMHB 2ZO3H 4XBBA 3ATKA 2FI4E 1FUJA 4CRAA 5FCKA 1QY6A 4Y8YA 3HPTB 3GY6A 2O9QA 5JB8S 2LELA 2H9EH 1FY5A 3BIUH 3DSPA 3E0NB 4X2WA 4D7FA 1IQFA 2EI8A 1P57B 1ANBA 3FP7E 3S0NA 1IQKA 2P3TB 3RMOH 1C5NH 3BF6H 3BTDE 3H09A 3QUMP 2Y5GA 1HAZB 1GBBA 4GVUA 4Y0YE 2AGIX 1OS8A 2FX4A 3ZV8A 1YCPH 1S83A 1SGPE 1GMDF 3RXMA 3LDXH 4UDWH 1BA8B 1WDIA 1BTZA 5DSFA 1SQRA 1O3FA 1G36A 2ZHFH 3RM0H 1P2OA 4WMFA 4JYUH 1CBWB 1TGCA 2SGQE 1IQHA 1MZAA 3A8AA 4CHAB 1P05A 1IHTH 2QCYA 2BVSH 4RI0A 1UW7A 2ZTXA 3IWMA 1EZQA 3ELAH 2O8TA 3A8CA 1V2OT 2TGTA 2HALA 2Y82A 4O97A 1TPOA 2GCTB 4ABIA 5I25A 1TPSA 1TGSZ 1U6QA 4SGBE 5DK1A 4ZHMU 5B6OA 2VNTA 1KXBA 3ZVFA 2VBCA 1N6XA 4CBOA 3BTME 4I8HA 1GI9B 1DDJA 2YMSC 3P8OA 2IJOB 1L4DA 4IMZA 3PMHB 1H8HD 1HAGE 4ASHA 2O8WA 1LPZB 2BMGB 2WINI 3F2FA 2XTTB 3UPEA 1O2GH 1P03A 1CA0B 3SUDA 3U98H 2G51A 2BY7X 3A7TA 5EXLA 2OUAA 1NN6A 2ANKH 8LPRA 2BQ7B 5C67A 3ODDA 1N6YA 3BTWE 4ABFA 1LO6A 1Z1IA 1ZPBA 2XCNA 2ZDNA 3KQCA 1YBWA 5GIBA 3EA9A 2BXTH 2ZGJA 1XX9A 3LH3A 5C0TA 1LDTT 1W3CA 2A7HA 1B0FA 1ZZZA 4IS5A 3UNQA 1PQ8A 1DXWA 3A8BA 1HJ9A 1THRH 1KXCA 1P3CA 1UHBB 3BEIB 4YOIA 1AKSA 1Z8GA 2B0FA 4Y11E 5CHAB 2EA3A 1ZHPA 1N1LA 4K1TA 3UUZA 1CSOE 1S84A 1O2XA 2ZHDA 1HFDA 2VIVA 3B23B 3F0PA 1SLWB 2VWLA 4TWWA 1O3EA 1OYTH 1C4Y2 1W11U 1PPEE 5JBAS 1GGDB 1JXPA 3MNBA 3RXRA 4ZROA 1LPGB 3V7TA 3A83A 2CHAB 4UFFH 1FMGA 3MQKC 1SB1H 4NA7A 2HWLB 5EIYA 1NROH 4HGCA 1ZSJA 5F53A 2VH6A 3OYPA 3W1EA 4DGJA 1MZDA 3GCHC 4RKJB 4ACBA 3GCOA 3RXBA 2PR3A 1XXDA 1OOKB 3PV4A 1OWDA 2UUKB 2AIPA 4TPYA 5A8YA 1UVSH 3RM2H 2EC9H 5C5OA 3D23A 1J8AA 1NU9A 3NK8A 1T7CA 2GMTC 4ZHLU 1TBZH 3RLWH 1XUFA 2ZPQA 2GTBA 2ZDVH 1A3EH 2TGAA 1GBCA 1TBRH 3ZVEA 2SGAA 3UR9A 4E7RG 2QF3A 1SPJA 3DFJA 1P8VC 2C90B 3A88A 1TGTA 2Z9IA 1NFUA 4Y76A 2XOKD 1FIWA 4YLUA 1QIXB 1KLTA 1L1JA 1Z6JH 1Y5BT 1A0LA 2YNBA 5T6FA 3PWBA 4ISIH 4FUJA 1L0ZA 4INHA 4GUXA 3S9CA 2XWBI 1CHGA 4MVNA 3B9FH 5FX5A 3SNBA 4NSYA 4HTCH 2A4QA 3QDZB 1W0JD 1T8MA 4JK6A 2J97A 1GJDB 2CMYA 1TBQH 1EOJA 3KN2A 3O8CA 3SOSA 1V2QT 3R0FA 5GJ4B 1SLXB 1ESAA 4WWYA 2YMSD 2YMSB 4JMYA 2A0QB 1O33A 1W13U 4Y7BA 5AFYH 1GJ6A 1NRRH 2ANWA 3GOVB 5JYIA 1S85A 2D26C 1BRUP 1SSXA 3M36A 4Y6DA 5BRRE 2NWNA 5FL7D 1P2JA 1EUFA 1W12U 2XC5A 4CRBA 3UAIC 2GD4B 1GPZA 1VITF 3UNSA 4THNH 2ZQ2A 3V0XA 1TPPA 2AYWA 1SLUB 3SU1A 2ODPA 1SL3A 1C1SA 3ESTA 1S6HA 1SGEE 3DD2H 1LCYA 3BV9B 1AU8A 1HJAC 4K60A 3WY8A 4Z0KA 2V3OH 1WOFA 3HK3B 1OPHB 2ESTE 1T8NA 1GDNA 3A7XA 1XMNB 1ZSKA 2QV1A 1CHOF 3RXUA 1F0UA 1XUKA 1QJ7B 4WF8A 1ELDE 2ZC9H 1O2IA 1YCPM 3RXVA 1C1MA 2TBSA 5JDUB 1BCUH 2P3UB 2R0LA 4UFDH 1DLKB 1O2HA 5DP5A 1BMMH 1UHBA 2Z7FE 4K8YA 4B76A 2Y5HA 1CVWH 1UTNA 3RXKA 3UB0A 3VB4A 2C8WB 1KTTB 4LXBH 1AVXA 1O3MA 1QCPA 1INCA 1J9CH 3BTGE 1DWBH 1H9LB 4O3UA 4AORA 1O3IA 1C1UH 3SGBE 4Q7ZA 2ULLA 2CV3A 4IBLH 3PLKA 3EE7A 4D7GA 1SGFG 3Q3XA 2DE9A 4H4FA 3SGAE 4NIYA 1A5GH 2GZ7A 2HOBA 3V12A 1D6RA 1V2VT 5EPYA 1P2IA 3EAJA 3U1IB 3ZZ9A 3LH1A 3UQOA 1FDPA 1GMHF 4JYTA 1G9IE 3GY2A 4BXWA 1GBHA 1QHRB 1UVTH 3SJIA 1O2OA 3OEHD 3SW2B 1TMBH 3LC5A 4X6PA 1CGHA 3OX7U 2H2ZA 4GHQA 2OCVB 2GMTB 2TPIZ 3DT0H 1VJ9U 2ZWLH 5A8XA 1E34B 2GV6A 4WVPE 1LHEH 3RXDA 1O3GA 2CJIA 2ZECA 3E0PB 1AWFH 1BMAA 4U30A 7GCHG 1QZ8A 2FLRH 1FZZA 3N7EA 1TQ0B 2H9HA 4WXIA 3GCTF 1QL9A 2W26A 4H42U 4I33A 1CO7E 2WZQA 3RXAA 1V2JT 2PTNA 1HAIH 4RSPA 4UE7H 4ZCNA 4CH8B 1YY3A 3GYLB 2XWAA 2D1JA 4DIHH 4Q63A 1KIGH 2BQ6B 4ABHA 1MAYA 1VJAU 3VG8A 1AB9C 3ZZCA 4KP0A 3MU1A 1C2MA 1KY9A 2J5UA 2A7JA 1ARBA 1EAXA 2P93A 4OS6A 2ZF0H 3VB5A 5EJZA 2QIQA 1WTGH 1S6FA 2SGEE 3ATLA 1GVLA 2C8ZB 3Q76A 3WWFA 3MO3A 1QBOA 2WPMS 2VVCA 2Z3CA 1XKBC 4I32A 2F83A 3HKIB 2HPPH 3FO8D 2K1QA 1C1WH 4DVAU 4XDEA 2ZQ1A 4LOYH 4YOGA 2Z3DA 3LOXA 3MMGA 1AD8H 2P3FH 1IQGA 1YPMH 2KR7A 3P6ZB 1DANH 2G81E 5DP4A 1BTYA 1BMLA 3LU9B 5JPMH 1AWHB 1P09A 4AN7A 1CT4E 9ESTA 1ABJH 4B2AA 3MOCA 4X6MA 1TABE 3BTFE 4A7IB 2PGBB 1MTVA 3JZ1B 1KTSB 2AEIH 4JZ1A 5HMAA 1RTKA 2BOKA 1HJAB 2PFEA 3BG4C 2A2QH 2O8UA 1ANCA 2BD2A 1T31A 1G3EA 1Z6EA 1ZMJA 4Y8ZA 1UK3A 4FUFA 2B5TB 1WCZA 1C5PA 4VGCB 4OS2A 4CR9A 5FX6A 1G32B 1ZTKA 2Q6GA 1GMDG 2AH4X 3K6ZA 4NG9H 2FYQA 1O2ZA 1HCGA 4K1SA 4Z6AH 2YOLA 3MNSA 2ZFRH 1GHAF 1C2HA 5H4IB 1O2UA 3A87A 1YPGH 2A4RA 3EA7A 1DPOA 1QJ1B 4CH2B 1AI8H 2VVVA 1J15A 2J98B 2PUXB 1FN6A 4FUGA 2WUCA 1SGFA 1SHHB 1T4UH 2AERH 3FAOA 3GCNA 1CE5A 4JZFH 1CBWC 5GDSH 4MTBA 1Y3XA 3UOPA 2Q6DA 1O30A 4CHAC 2M2AA 4JCNA 5CE1A 1Q2WA 2WPHS 1NFYA 4B2BA 4KTUA 1YPHC 1TRYA 5DP9A 2GCTC 2HLDD 3ZIAD 3PM3A 1S0QA 3VB7A 1LMWB 4X6OA 1OX1A 3RXQA 2AMDA 4RN6A 1S81A 3I78A 2XC4A 1HAPH 1D3TB 1ZHMA 4MPWA 5EW1H 2QAAA 3MHWU 1UVUH 5K7RA 1PPGE 4X8TH 2PHBA 4TYDA 1UTPA 2BM2A 2ZI2H 2C4FH 1KLIH 2F9BH 1QA7A 3RXIA 2PP6A 3BG8A 3M7QA 5C3NA 3MU8A 1BTUA 1C1QA 5KEDA 4J1YA 1CA0C 2ZPSA 1O3AA 3ZVBA 1EPTB 1PPBH 2OBQA 4F55A 4ZXYH 1SQAA 4YXWD 2BLVA 1O2VA 3BEUA 3U8OH 1H4WA 5A0CA 5FCRA 3M7UA 1MKXH 2QF4A 5EGMA 1AB9B 2Y5FA 1NFXA 1VKYA 3SJ9A 3TNSA 2H5DA 1TNIA 1ELVA 1FPHH 1LKAA 2G55A 3IG6B 5DJ7A 1GHVH 1GVKB 1V2TT 3O8BA 4A6LA 2A31A 4IMQA 1VGCB 4NIWA 1GBEA 1GBJA 1OWEA 2QYIA 1EXFA 3GY3A 1AKSB 1HJ8A 3VXFH 1W0YH 2V3MA 2ZTYA 5A2MH 2VJ1A 1F0RA 5EG4A 2WPLS 2FS8A 4X1QU 4X1SU 3U69H 1ZTJA 3FOAA 3SBKA 2A5AA 2A7CA 1UCYH 5IYTA 1EZUC 4YOJA 1IAUA 2ANYA 3A7ZA 4X1NU 3U28C 3ZV9A 3RC6A 2H5CA 4JK5A 1WSSH 4AYVB 3A82A 2OC7A 1W7GH 3URDA 2FOEA 4K3JA 3FKSD 3RXHA 6GCHF 3CS0A 3LGWA 4A5TS 1WTHD 1O5AB 2XBXA 3QZRA 5T3HA 3TGIE 1BITA 2ZU5A 1W8BH 3RXPA 1J16A 3NKKA 3BG4B 3TJVA 1ZGVA 2Y6TA 3RC5A 5FBEA 5GXPA 2YNAA 2NU4E 2KCPA 1GI1A 1EP5A 2BLWA 5G4BA 1TRMA 4WH8A 4OS1A 4H6SB 1YGCH 1W14U 1ZR0A 4H6TA 3M3SA 1KXEA 2G8TA 1C2KA 3OE7D 1P3EA 3F3BA 1RFNA 3KQBA 1JIMA 1EZSC 1AZ8A 2JH6D 2LNCA 4MNVA 1LQDB 4I7YH 3D49H 2NU3E 3QLPH 1V3XA 3SV7A 1DVAH 1WYKA 2F9OA 3KYFA 1Z8RA 4YESB 1LHFH 1MBQA 1UTMA 2OBOA 2A45B 1QNJA 2J98A 3S69A 3TJNA 1W0ZU 3BTTE 3F9GA 2Q1JA 4ABGA 1KXFA 1ETRH 4X8SH 3CNRA 5LPFA 1DWCH 1O2YA 1NBME 2PLXA 1O2MA 1SR5C 2HRVA 3SZEA 1AFQB 3PO1C 3TGJE 5IK2D 3U1JB 1GI3A 1KXDA 5L2YH 2RG3A 2PWXA 1PPZA 1AO5A 2BY5X 3F1SB 1DE7H 1L1GA 1MD8A 1VITG 4A1TA 1HV7A 1GJ9B 4WMEA 3K2UA 2C93B 1QRXA 3A81A 3DSGA 1WQVH 1PQAA 2STBE 4FUIA 4MQAA 4K2YA 1RD3B 2HGTH 4F48B 5EW2H 4AG2A 1QJ6B 1BTPA 4X2XA 2WPDD 3P70B 1C5XB 1TA2A 2UUFB 1C2JA 1EPTA 1LTOA 3SI4H 1BIOA 1CHOG 1SGYE 3C1KA 3ATMA 3EA8A 2R2MB 1UVOA 4K1EA 4NZLA 1O2LA 1SGDE 1SGCA 1O3LA 1OWHA 3LJOA 1IQMA 4K5ZA 4ISLA 3HGNA 3OY5U 3KCGH 4YT6H 1H8IH 2F9PA 2VU8E 3PRBA 1OWJA 1MABB 2Y80A 2FPZA 1M9UA 3RMLH 1G30B 2VIPA 4WMDA 4GAWA 1LHDH 1SKYE 1H8DH 2VB0A 1UTLM 2WYGA 2O8LA 2ZCHP 5DPAA 4BOHA 3GYMA 8ESTE 1L1NA 1Y59T 1SGTA 1LPKB 1HBTH 3A85A 3R3GB 1Q31A 1DSUA 2ZP0H 4IN2A 3KQDA 1GMHG 1NM6A 1FJSA 1TFXA 1Y5AT 4A1XA 3T26A 5EQRA 1QQ4A 5DP7A 4FVDA 2PW8H 2G5NA 4FU9A 3TPIZ 3LONA 2BHGA 1ID5H 2FOGA 3ZZDA 3T27A 1QL8A 1UCYE 2ZTZA 3SV8A 1HIAB 3OTJE 1TIOA 4JYVH 1FN8A 2G00A 1AY6H 1SBWA 4BTUB 1WXRA 1FY1A 2Q6FA 5C94A 3TGKE 3E8LA 1QTFA 1CQQA 3GCTG 1MUEB 6LPRA 1AE5A 1V2WT 1UTKA 2BD3A 3UWJH 3UFAA 2FIRH 1MCTA 3K6YA 3KYGA 4X2YA 3W94A 3SUFA 2QGRA 3H7OA 2ZHQH 4XBDA 2G5VA 4UONA 3OTPA 4CRCA 4P00A 3FVFB 2XBYA 2WHXA 3FN8A 3A84A 4FXGH 1TWXB 1SFQB 3BIVH 1O3BA 1WUNH 2GDDA 3NCLA 1CT2E 2NU0E 2JDID 1C5ZB 1F5KU 1ETSH 1BT7A 2BVXH 2VVUA 1BMNH 3UR6A 1A61H 1XVMA 3P17H 4DT7B 1GHYH 4AFZA 1QL7A 3IITA 1ZOMA 2AMPA 2GVFA 1GJAB 1GI5A 1NESE 1DUEA 1SVPA 3F0OA 5EQSA 1QQUA 3C27B 1XM1A 2ZEBA 3PO1B 3M5LA 1E1RD 1VCQA 4Q80A 4BAQB 3CENA 1GJ4H 1LVOA 1K9OE 1MD7A 3D62A 3S9BA 2M5TA 2IN2A 3RUOA 1ESTA 8GCHF 3UNRA 1LVYA 1P2MA 1C5VA 1DXPA 4RKOB 2QXIA 1LKBA 2ZCLP 1QFKH 4LK4A 3ZVGA 4ZKNU 1TGBA 5C17A 5JBBS 1K21H 2Z94A 2ZU2A 3F6UH 5JBTA 3DSOA 1GBTA 1K28D 2HLCA 1FXYA 2BD5A 2O8MA 3PMAB 3S7HB 1ELGA 3STJA 1ANDA 1OKXA 1NFWA 2XYAA 1YM0A 4KKDA 3ZYDA 1AQ7A 2W7SA 4DW2U 3TVJB 3VFEA 1TAWA 4IN1A 5AVDA 1B5GH 4D8NA 5FPTA 1COWD 4ACAA 1W10U 1DLEA 2QN5T 1GHAG 3H5CB 1QB1A 4VGCC 3FZZA 3MNCA 3KL6A 1MTNB 1C2IA 3RXSA 5ABWA 1PYTC 4I86A 1GCDA 5IDKA 3KGPA 4BAKB 2BQWB 3RU4E 1G2MA 1ANEA 4JZDH 1FY4A 3SJKA 3VB3A 1ZGIA 4A92A 1GCTC 2P8OC 1HNEE 2J2UA 3EYDA 4DY7B 1N8OB 2P16A 4AFQA 4CRDA 5A0BA 1O31A 4CRGA 1BRCE 1PPHE 1BBRH 3URCA 4FU8A 1Y5UT 3GY4A 4R0IA 1OHHD 1EJNA 1EFRD 1O5DH 1EAUA 1JOUB 2B7DH 2FP7B 5GNDA 5LGOA 2H9TH 5F03A 3T2NA 4NFEA 2XCFA 3JZ2B 3TNTA 2F9UA 3ZVAA 1K1LA 4ISNA 5GWZA 1GI0A 1Y3UA 3MH6A 4B71A 4NIVA 3PTNA 1HYLA 1UJ1A 1KLJH 1A46H 2W3KA 5CMXH 4P02A 2ZFQH 3GS9A 1D3PB 1GBDA 1QBNA 2FWWA 1AUTC 1THSH 4TY7A 4ZKOU 5ESBA 1F2SE 1JBUH 5EU8A 1HIAA 2WYJA 1NRNH 2NU1E 1W7XH 3DCLA 1TMTH 3P8NA 4MLFB 2J94A 4NWKA 1A0HB 1A4WH 3E6PH 1DUAA 2XNIA 1W0KD 1TALA 1C1NA 1RRKA 5T1VA 4HZHA 4O3TA 1SOZA 2JH0D 1AN1E 1Q3XA 1AUJA 2UWLA 3AAVA 1TMUH 1J17T 3B8JA 3RU4T 4MPXA 3UY9A 2WV4A 1BQYA 1GJ5H 4ABBA 1RGQA 2HPQH 2CXVA 2BDGA 5EXMA 3VB6A 2Z6BD 4AB8A 4ZMAH 1HAXB 1XVOA 1O5BB 1QRWA 1EPTC 4B6FA 3UOUA 5PTPA 1GHWH 1MKWK 5T6GA 5A09A 2XXLA 1A7SA 1DSTA 2BD8A 1HXEH 4FUDA 1T4VH 4GPGA 1YYY1 2F9VA 4U01A 5J4QA 6CHAC 2CK3D 4E05H 5C20A 1E1QD 2FDAA 1EB2A 3V13A 4GHTA 4CRFA 4AGJA 3LGYA 2A5KA 1O32A 1V2ST 1ELCA 1QB9A 1VGCC 4NSVA 3T29A 3ZVDA 1SGQE 1BDAA 2ZA5A 4ZKSU 4I31A 1E35B 4AGKA 2Y7XA 2I6QA 4JZIA 8KME2 4Q7XA 1OP2A 2XNDD 3M5OA 3NWUA 1Y3WA 1CA8B 1O35A 2V7QD 1TX7A 4AFSA 4B1TA 2Z3EA 3T62A 2BTCE 4XE4A 3PWCA 1V2NT 2TGDA 6GCHG 2FTMA 1GBAA 3SV2H 2WV9A 1NRPH 2WPJS 1AFEH 1RXPA 1D3QB 1F0SA 6ESTA 3HATH 5C1XA 5GCHF 1B0EA 4O9VA 1MTSA 3SJOA 3AAUA 1TQ7B 1VR1H 2FMJA 2G52A 1YPEH 5C1YA 1C5YB 4NFFA 2ZFTA 3RU4D 1PJPA 2WUBA 4YLQH 3STIA 2FLBH 1MTUA 3VGCB 1TA6A 4GCHF 1L2EA 1Z1JA 1GBKA 4MG3A 4FUBA 1A5IA 1YP9A 1IQEA 1XUGA 1C1TA 2A2XH 2K0QA 2TIOA 2ZDMA 2GCHG 4KTCA 4ZKRU 3P92A 1ZLRA 1C5TA 3MFJA 5LPEA 5DGJA 2ZGXH 2JKHA 1ELAA 2EI6A 2FODA 3RXFA 1PYTD 3OU0A 4Y71A 1GMCF 2BY8X 2OD3B 5L6NH 3GY5A 1C5OH 5KGOA 1T32A 3F2HA 3PRDA 1RTFB 1GHZA 2FO9A 2A32A 2PKSC 1AVGH 1GCTB 1QA0A 1P9SA 2P8OB 2R3YA 2ZHWH 1GHBF 4XD7D 1YLNA 4Z1MD 3NRLA 2H1UA 5B6LA 2FOMB 3PV2A 1K1OA 2SGDE 3SI3H 1NPMA 3LGTA 1B7XB 4AOQA 1QR3E 2KCYA 3P8FA 2F4LA 1K2I1 4KELA 4Y0ZE 3OAAD 1G3CA 2AFQB 3P95A 2ZGHA 2H6MA 2WPKS 3QN7A 2P95A 1HAHH 1BMFD 1CT0E 4HG6A 5F6MA 3SHAH 1BRAA 4FOUC 1AFQC 2PSYA 2OQUA 3ZZ3A 1BBRE 2ALVA 3KF2A 1OXGA 2QY0B 1ZRKA 4FETA 3U8RH 5TJXA 5HM2A 3MU4A 4IC6A 1GJBB 5C0UA 2QF5A 1TNLA 1T8OA 4ABEA 1ELEE 4M9FA 4AC9A 1ZMNA 4ASUD 3L33A 2KZ4A 2GZ9A
chains in the Genus database with same CATH topology
3DHKH 2UWPA 1NU7B 3KQEA 2BD7A 1XXFA 3Q3YA 4NA8A 5E2OA 3SQHE 4AX9H 4WXVA 4ZHAA 3TH4H 4Y10E 2GZ8A 2Z9GA 4INKA 2Z9JA 1SQOA 1Z7KA 3FFGA 7KMEH 4I8JA 2ZDLA 1GJ8B 2BDIA 4X2VA 2GP9B 1LVMA 2VWOA 6CHAB 1KDQB 2CGAA 3FZDA 2VGCB 3TK9A 1EP6A 2I6SA 4BTTB 1A0JA 1P2NA 1F5RA 2ANMH 2R3UA 4YM9A 1BZXE 5DP6A 2FI3E 2GKVE 1FONA 3BTEE 5AHGH 2ZHEH 1V2PT 2RA0A 3M3TA 5C2ZA 3E1XB 2J4IA 3FP8E 1SGNE 2EEKA 3F9HA 1AHTH 2WV5A 3LT3A 1L4ZA 1MCVA 2UWOA 1GL0E 2ZU4A 1HAVB 2BLOA 1S5SA 3F68H 1P01A 1ZJDA 2VIOA 4DIIH 1TRNA 2BXUH 5F8ZA 4OGXA 4YT7H 3QZQA 3NZIA 4NIXA 1CGIE 3DA9B 3I29A 1HB0B 5J4SA 2BD4A 2PGQB 4PROA 2BZ6H 3EDXB 4UEHH 1FLEE 5F8XA 1JWTA 1O3HA 2FOAA 4NZQA 2FXRA 2OLGA 5AFZH 4BAMB 2JETC 3TJOA 3F9EA 3PMBB 1XUIA 2V3HH 1QRZA 2VWMA 3SNEA 1C5RA 3AVZA 3L6PA 3SU6A 1A1RA 1ELBA 4JZEH 5DO4H 2BX4A 3FP6E 1UK4A 1UCYK 3PMJA 3CS7A 2SNWA 2OINA 2QXHA 3M5MA 1P02A 3MH4A 3OSYA 1SHYA 4INLA 1G2LA 3PLPA 3BTQE 1EX3A 2GCHF 2LPRA 1A2CH 4SGAE 1SGRE 2PKSB 1EATA 1BTXA 3VXEH 4B75A 1O3OA 4DG4A 1UK2A 1AVWA 4FUEA 2D2DA 1O36A 1IQJA 1RS0A 1UMAH 3EQ0H 1GBMA 4B2CA 3KIDU 1O2RA 3QTVH 1X7AC 2HNTE 1BTHH 3M37A 1GG6C 4MPVA 1GBLA 1O2SA 3FANA 2FM2A 2Y7ZA 4MPUA 1SQTA 4F49A 1O38A 1C9TA 1GJ7B 2FOFA 5DP3A 1G3BA 1O39A 8GCHG 1SMFE 1AZZA 4OS7A 4D9QA 1LVBA 1SI5H 1IOEA 4BTIB 3E90B 3NXPA 3P8GA 2XW9A 1GHXH 2KAIA 5LPRA 1WV7H 2W5EA 2G4UA 2PTCE 1OYQA 1KSNA 2ZU1A 5JBCS 1KYNA 4XFQA 1YCPK 1C2EA 4CREA 1O5CB 1ZRBA 1YPKH 3LPRA 1WQSA 2FYRA 4YO9A 1ZYOA 4NGAH 1FY8E 3LGVA 2J38A 2V6NA 2ZIQH 3N7OA 2PSXA 2XBWA 2F91A 1HDTH 1AIXH 2VIDA 2ZZUH 1TX6A 5BPEA 2BOHB 2BY6X 1SOTA 3BTHE 1C9PA 2FTLE 5E8EH 3TK6A 1O37A 4WH6A 7ESTE 1KDQA 3LGIA 5K0HA 3KHVA 2SGPE 1D6WA 1S0RA 4X8VH 3RMMH 1MTNC 4FU7A 4BAHB 1QBVH 5DP8A 4MNWA 4AB9A 1TNHA 1BJUA 4R8TB 4UD9H 2VH0A 3O8DA 2JH5D 2GGVB 3GY7A 4BXSA 4OS4A 1GDQA 4GSOA 1V2LT 1DWEH 1N8OC 2FOCA 1ELTA 1NZQH 3GISB 4X0WU 2HVXA 1MAXA 1P9UA 1UTQA 4HI3A 3HGPA 5SGAE 3SNCA 1GBFA 3GDUA 1CGJE 2FS9A 4TPIZ 1H9HE 1C4V2 1HAVA 1GI8B 2BD9A 2NU2E 1JRTA 1K1IA 4DOQA 2ZKSA 2BDCA 1ELFA 1Z71A 5E0JA 1UTOA 1TB6H 1C1VH 3A8DA 2C3SA 1DS2E 4K69A 3SUEA 2AIQA 1C4U2 1NRSH 4OGYA 3RDZA 1CU1A 4FVBA 1FY3A 3AW1A 2QF0A 3BN9A 4A1VA 1TNJA 1GJCB 1O2PA 2JETB 2ZFFH 2PUQH 3D65E 2GV7A 5FPYA 3Q77A 1V2MT 2CF9H 1TNGA 2ALPA 2PKAB 4F4OC 1JRSA 2TGPZ 3A7YA 3LC3A 3ZZ7A 1NY22 1YC0A 1C1RA 2SGFE 3QO6A 2V0BA 1HPGA 3RXEA 1HAOH 3NUMA 1DY9A 2B8OH 3RXCA 1O3KA 5FBIA 2A5IA 1NTPA 2BDHA 2FESH 4Q2KA 2Z9KA 2THFB 3ZZ6A 2TRMA 2BB4A 3BEFB 1NO9H 2DUCA 2OC8A 1IQNA 1MMJN 3GICB 1OWKA 1NS3A 2PV9B 1TOCB 7LPRA 1G37A 4B74A 3SO3A 1C2GA 2SFAA 3A7VA 1GG6B 4FUHA 4UFEH 4WJG2 5ESTE 2CF8H 3EE0B 4KGAA 4NA9H 1K1PA 3LJJA 3GDSA 1O2QA 1K1MA 1EJMA 2QXJA 1PPFE 5LH8A 1EKBB 4IGDA 1FAXA 3HKJB 2OTVA 1PQ7A 1Z8JB 2ODQA 1Y8TA 1GWAA 1O2TA 3TIUA 2ZPRA 5GCHG 2UUYA 4X1RU 1E36B 1NRQH 5L2ZH 1GDUA 3RXTA 1EZXC 1JMOH 4BANB 3RXLA 4B73A 4E06H 4XSKU 1TNKA 3SUGA 1FIZA 2BDYA 5JB9S 1P10A 3ZZBA 1WBGB 1O3PB 3UIRA 3MTYA 5TCCA 2BYAX 2A1DB 4GCHG 1ZPCA 3SJ8A 4J2YB 4MNYA 3M5NA 3MU0A 3KNXA 1RIWC 3ATWA 1MU8B 1C2DA 3VGCC 2OC1A 4MDSA 3VEQB 3TITA 1GMCG 3Q00A 2V35A 1P04A 5HYOA 1OWIA 2ZFPH 3SU0A 2FX6A 3QGNB 1GHBG 1HLTH 1SG8B 1IQLA 5E2PA 3QWCH 1F5LA 1O3JA 1F0TA 4TY6A 3RXGA 3MI4A 1V6DA 4XOJA 1C5SA 1XUJA 2Z9LA 3TH2H 1YF4A 1O2NA 3E16B 3PLBA 4ESTE 2B9LA 4IW4E 5GPIB 1JIRA 1MBMA 2VINA 1LQEA 5HM9A 1C5QA 2XRCA 3SZNA 1Z8IB 1OP8A 2VIQA 3DUXH 4NCYA 1GBIA 1KXAA 2P59A 3QK1A 1O34A 1PPCE 3E3TA 1F7ZA 3SU2A 1P11E 2FOHA 1DOJA 1NC6A 4KTSA 1D4PB 4Q7YA 2ODYB 1ZHRA 5FPSA 1AMHA 1K1JA 1IHSH 2GT8A 1EOLA 3A86A 1BHXB 4YTAA 4ISOA 3A80A 3L3TA 1BRBE 4ZAEA 3AASA 2ILNA 2F3CE 3QTOH 1P2KA 3A89A 1ZJKA 3ZVCA 3T28A 5A0AE 2PKAA 4U32A 1D9IA 2RDLA 1MKWH 2J9NA 3U8TH 1BBRK 3SNAA 2DE8A 1MU6B 3GCHB 3GDVA 2P94A 2AMQA 1VITH 3SHCH 2C8YB 3SU4A 3PB1E 5F8TA 2STAE 4NWLA 2F9NA 2BDAA 1FV9A 4ABDA 1GI6A 4I8KA 2SNVA 4Y8XA 3M7TA 2OP9A 2BDBA 1ORFA 1YLCA 2HNTF 1P12E 3I77A 2RCEA 1TX8A 2XC0A 1SC8U 1TLDA 2VGCC 3K65B 1UVPA 1BJVA 2FEQH 1BOQA 1P06A 1FAKH 4ZH8A 4ABAA 2FOBA 2WPIS 1H1BA 5AF9H 3TLOA 2R0KA 1EB1H 3NPSA 1UTJA 3SQEE 3SV9A 2ZGBH 1EAWA 3ZZ5A 1AGJA 4UFGH 3BTKE 1BTWA 1A3BH 1DWDH 2GT7A 4E7NA 1K1NA 2ZFSA 2VWNA 1A5HA 3QX5H 1W2KH 1V2KT 3SNDA 1DM4B 1FPCH 4U2WA 1TONA 1D3DB 1DT2A 2BX3A 1XKAC 4ZXXH 1YKTA 5L30H 1V2RT 1C2LA 1H9IE 4CBNA 1GVZA 1VCWA 5C5NA 2UUJB 1J14A 3S7KB 2A4OA 1TOMH 3DFLA 4MNXA 4LZ1H 5TCAA 1ACBE 3MNXA 3MU5A 1RIWB 4X1PU 3SN8A 4AYYB 1MQ6A 3F9FA 3SORA 1DY8A 1K22H 1C2FA 1MTWA 1EQ9A 1P2QA 2C8XB 1VZQH 3VPKA 1GL1A 2RA3A 3CP7A 3TH3H 4QT8C 2BZAA 3AW0A 1O5FH 5EXNA 5FHTA 3RC4A 5FAHA 1TYNA 4ABJA 1YPLH 3ITIA 1SGIB 4I8GA 3Q3KA 5DG6A 3EGKH 1BUIA 1QB6A 1ZPZA 1EASA 1P0SH 1E0FD 2AGGX 1HUTH 5E0GA 4DJZB 2AS9A 4DCDA 4YZUA 1C5UA 3MH5A 1O2KA 3M3VA 3UQVA 2ZU3A 1EAIA 2FI5E 1SLVB 1LHCH 1GI4A 4K8BA 2D8WA 2ZNKH 1HAYB 4D76A 1NT1A 2Y81A 4AG1A 1O5EH 4O03A 2BVRH 5EODA 4WY3A 1QGFA 1Y3VA 4XBCA 3SU5A 3TU7H 1LHGH 1FI8A 3ATIA 1ARCA 1DFPA 1O3NA 3RXJA 2IPHA 3W95A 3ZZAA 1PFXC 3TJUA 2KAIB 2R2WU 2GX4A 2BY9X 4M7GA 4X6NA 1TGNA 1MQ5A 2R9PA 3GY8A 1OP0A 1TPAE 4Y79A 3PTBA 1RJXB 5DKMA 1Y3YA 2G4TA 2GDEH 2QXGA 4HFPB 5EPNA 1O2JA 2W7UA 4TWYA 2QA9E 4BAOB 3QGJA 2J95A 2ZGCA 1ABIH 3UWIA 3LKWA 1ZTLA 2QC2A 1ZSLA 1BHXF 2BLQA 3M35A 3G01A 2AGEX 1DX5M 1T8LA 3A7WA 1O3DA 4X8UH 3SV6A 4ISHH 3OY6U 4OS5A 1ESBA 1RTLA 3TK5A 2ZG0H 3LIWA 1C1OA 1O0DH 1QURH 2FZZA 1XUHA 2J92A 3RP2A 1YPHE 1FQ3A 2J34A 2XBVA 3U9AH 2A4GA 3T5FH 4I8LA 4Y7AA 3E91A 3LGUA 3RXOA 4GLYA 3ENSB 2ZDAH 3S9AA 1C5WB 1MH0A 1G3DA 4CR5A 1EJAA 7GCHF 2IOTA 3UTUH 5ETXA 5HXFA 3MO6A 1ETTH 1V2UT 2ASUB 3ZZ8A 1E38B 2VIWA 3PROA 3M61U 1C5LH 4DURA 3MH7A 3MO9A 1YLDA 4AZ2B 2OC0A 3V3MA 3T25A 1HGTH 2OXSA 2CN0H 5T6DA 1WAYB 3O8RA 3SU3A 2ZDKA 1DICA 3ODFA 1F92A 1UO6A 1MKXK 3H7TA 4BNRA 5C1UA 4FUCA 2W3IA 1HRTH 3SGQE 5CHAC 5I46H 1S82A 1C5MD 4ZUHA 3PYHA 3ZYEA 4D9RA 3BSQA 3ZZ4A 1C1PA 5A8ZA 1O3CA 1AE8H 1DITH 1HXFH 1O2WA 1ZMLA 3RMNH 1TE0A 1IQIA 1GI2A 3UREA 2ZCKP 3K9XB 4IC5A 5HGGA 1O5GH 1VCPA 1BB0B 1GGDC 3MYWA 1WU1A 1THPB 3HK6B 3KEEA 5FXLA 1YPJH 4LZ4B 1GI7B 3MWIU 2CHAC 2OQ5A 2EI7A 2HNTC 3RLYH 4AFUA 5EQQA 1OSSA 1SFIA 1PQ5A 9LPRA 5EOKA 1FNIA 5E0HA 1E37B 2ZO3H 4XBBA 3ATKA 2FI4E 1FUJA 4CRAA 5FCKA 1QY6A 4Y8YA 3HPTB 3GY6A 2O9QA 5JB8S 2H9EH 1FY5A 3BIUH 3E0NB 4X2WA 4D7FA 1IQFA 2EI8A 1P57B 1ANBA 3FP7E 3S0NA 1IQKA 2P3TB 3RMOH 1C5NH 3BF6H 3BTDE 3QUMP 2Y5GA 1HAZB 1GBBA 4GVUA 4Y0YE 2AGIX 1OS8A 2FX4A 3ZV8A 1YCPH 1S83A 1SGPE 1GMDF 3RXMA 3LDXH 4UDWH 1BA8B 1BTZA 1O3FA 1G36A 2ZHFH 3RM0H 1P2OA 4WMFA 4JYUH 1CBWB 1TGCA 2SGQE 1IQHA 1MZAA 3A8AA 4CHAB 1P05A 1IHTH 2QCYA 2BVSH 2ZTXA 3IWMA 1EZQA 3ELAH 2O8TA 3A8CA 1V2OT 2TGTA 2HALA 2Y82A 4O97A 1TPOA 2GCTB 4ABIA 5I25A 1TPSA 1TGSZ 1U6QA 4SGBE 5DK1A 4ZHMU 5B6OA 2VNTA 1KXBA 3ZVFA 1N6XA 4CBOA 3BTME 4I8HA 1GI9B 1DDJA 3P8OA 2IJOB 1L4DA 4IMZA 3PMHB 1HAGE 4ASHA 2O8WA 1LPZB 2BMGB 2WINI 2XTTB 3UPEA 1O2GH 1P03A 1CA0B 3SUDA 3U98H 2G51A 2BY7X 3A7TA 5EXLA 2OUAA 1NN6A 2ANKH 8LPRA 2BQ7B 5C67A 3ODDA 1N6YA 3BTWE 4ABFA 1LO6A 1Z1IA 1ZPBA 2XCNA 2ZDNA 3KQCA 1YBWA 5GIBA 3EA9A 2BXTH 2ZGJA 1XX9A 3LH3A 1LDTT 1W3CA 2A7HA 1B0FA 1ZZZA 4IS5A 3UNQA 1PQ8A 1DXWA 3A8BA 1HJ9A 1THRH 1KXCA 1P3CA 1UHBB 3BEIB 4YOIA 1AKSA 1Z8GA 2B0FA 4Y11E 5CHAB 2EA3A 1ZHPA 1N1LA 4K1TA 3UUZA 1CSOE 1S84A 1O2XA 2ZHDA 1HFDA 2VIVA 3B23B 1SLWB 2VWLA 4TWWA 1O3EA 1OYTH 1C4Y2 1W11U 1PPEE 5JBAS 1GGDB 1JXPA 3MNBA 3RXRA 4ZROA 1LPGB 3V7TA 3A83A 2CHAB 4UFFH 1FMGA 1SB1H 4NA7A 2HWLB 1NROH 4HGCA 1ZSJA 2VH6A 3OYPA 4DGJA 1MZDA 3GCHC 4RKJB 3GCOA 3RXBA 2PR3A 1XXDA 1OOKB 3PV4A 1OWDA 2UUKB 2AIPA 4TPYA 5A8YA 1UVSH 3RM2H 2EC9H 5C5OA 3D23A 1J8AA 1NU9A 3NK8A 1T7CA 2GMTC 4ZHLU 1TBZH 3RLWH 1XUFA 2ZPQA 2GTBA 2ZDVH 1A3EH 2TGAA 1GBCA 1TBRH 3ZVEA 2SGAA 3UR9A 4E7RG 2QF3A 1SPJA 3DFJA 1P8VC 2C90B 3A88A 1TGTA 2Z9IA 1NFUA 4Y76A 1FIWA 4YLUA 1QIXB 1KLTA 1L1JA 1Z6JH 1Y5BT 1A0LA 2YNBA 5T6FA 3PWBA 4ISIH 4FUJA 1L0ZA 4INHA 4GUXA 3S9CA 2XWBI 1CHGA 4MVNA 3B9FH 5FX5A 3SNBA 4NSYA 4HTCH 2A4QA 3QDZB 1T8MA 4JK6A 1GJDB 2CMYA 1TBQH 1EOJA