3PM3A

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pm3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pm3A02
2SNWA 2QF3A 4A7IB 1FPCH 3ZZ3A 1AN1E 2HLCA 1FIWA 2ZI2H 2F9UA 2THFB 5BPEA 3URDA 1P0SH 1C4U2 2FESH 3GY4A 1UVTH 4Q2KA 2P8OB 2WPMS 2ODYB 1W8BH 1YPHC 2QXIA 1S0RA 3L6PA 4YT6H 4GPGA 2FI5E 2H9HA 5JYIA 1C5ZB 1VITG 1N6XA 1NRRH 3P8GA 3RXOA 1O3GA 5FCKA 4I8KA 4AFSA 1KY9A 1TLDA 2TGTA 4FUGA 4TY7A 1RJXB 3SGBE 2Y6TA 1MBQA 1ZOMA 4LZ4B 1GHYH 2BOKA 3A8BA 1ANBA 3ITIA 5E8EH 3VPKA 2QF0A 1BMNH 2FOFA 1NO9H 1T8LA 3A81A 1UTOA 3QWCH 3SU2A 4B74A 3T5FH 1LCYA 2FZZA 1L2EA 2AS9A 3F9EA 2GT8A 2FLRH 1O2SA 1S85A 1XVOA 1AVGH 2J95A 2ZFQH 2RCEA 1SFQB 3PO1C 5C1XA 1DM4B 4GVUA 2XXLA 4AYYB 2BVSH 1WSSH 1ZJKA 3U9AH 1Y3XA 2ZQ1A 4YM9A 3UNSA 5C1YA 1D6WA 3PTBA 3V0XA 4CR5A 1Z71A 4NA9H 1QB6A 1JIMA 2PHBA 2C8YB 1MBMA 1C1OA 1F0RA 4X2XA 1M9UA 3BEUA 1CGHA 2BDYA 3PMHB 4IS5A 3U8TH 3RXKA 1VITF 1AD8H 3UUZA 1ZGVA 4ZXXH 1GJ9B 3PMBB 1FY4A 1P9SA 4HFPB 3O8CA 4K8BA 1F2SE 1HAHH 5B6OA 1GDUA 3GY7A 5HYOA 1JWTA 3RXTA 2VWOA 4JZIA 3V7TA 2Y5HA 1HYLA 2BVXH 1H9HE 1LHEH 8GCHG 3SJ9A 1XXFA 1KDQB 1EAXA 1QB9A 4I31A 2PUXB 2QY0B 4KKDA 1MCVA 3BEFB 4Z0KA 3SJOA 1ZRKA 3LGVA 1K2I1 2ZFTA 3CENA 1C2MA 1HXEH 1A5HA 3KQDA 3TPIZ 2O8UA 1FQ3A 2UWPA 3GISB 4XFQA 3UQVA 2M5TA 2ZFPH 4MPWA 1BRBE 1NFUA 2G5NA 4WMEA 4R0IA 1GI1A 2ZECA 3MWIU 4JCNA 2VVCA 2K1QA 4Y76A 1UTPA 2ZDAH 1B7XB 1LKAA 3ZVFA 3EA8A 1MTNB 1QURH 1UO6A 3RXRA 3KIDU 1IQIA 1BRCE 3LIWA 5A0BA 1GI9B 4A6LA 3MI4A 1KDQA 3GICB 1A5IA 4Y8YA 1C2KA 1PQ5A 3E1XB 1O2WA 1TOMH 1YCPM 2ZIQH 1MKXH 3FFGA 4X2WA 1DS2E 1P05A 2ZHEH 1ZSLA 3K6YA 1P2MA 2ULLA 2TGAA 4YESB 4O3UA 1ZHMA 2BD5A 3OY5U 5J4SA 1NPMA 1ZLRA 1Z8GA 1TGTA 8GCHF 2PSYA 1AUTC 3A7ZA 2XC5A 5DP5A 1IHSH 1H9IE 3VGCC 1SGIB 1CVWH 4IC5A 1LQDB 1NFWA 2GV6A 3HGPA 4I33A 3RMOH 3KCGH 3RC6A 4AB8A 2V3HH 3RLYH 2XBXA 4GHQA 2G00A 3ZV8A 4NA8A 3UREA 1XMNB 2BXUH 2HGTH 9ESTA 1EATA 4NCYA 1SLVB 4OS7A 1IQMA 4ABGA 1C2DA 1BTPA 2QN5T 3NXPA 2VH6A 3TH2H 1LVYA 4O9VA 4ABFA 1GI8B 2ZU1A 1AQ7A 1DY9A 8LPRA 4H4FA 1GHZA 1HIAB 2XBWA 3VB4A 3M35A 1NU9A 4KGAA 5T6FA 2VIWA 1VR1H 1AFQC 1XUGA 1GHBG 1GJ4H 2CN0H 1INCA 3SU6A 2HPPH 3MHWU 1SB1H 1MTWA 2PKSB 1BITA 1DSTA 2R3UA 4INHA 2BY5X 5L30H 1P12E 3A87A 1D3QB 1XKBC 1ID5H 2W3IA 3BEIB 1GHVH 1BHXB 4WH6A 3AW1A 1EKBB 4Q80A 1GBIA 5GJ4B 1C2HA 1ELFA 3RDZA 2ZDKA 4JK5A 2ZGXH 1IQFA 1O5BB 3RXVA 7GCHG 1PQ7A 2BLOA 2OXSA 3VB5A 4PROA 4CRCA 3RP2A 2Z9LA 1ORFA 3RXFA 3SV6A 3MO9A 1HIAA 2UUKB 1K9OE 4B75A 4ZAEA 2J9NA 5LPFA 1W13U 3PLPA 3VEQB 1MAXA 5T6DA 1J16A 5DP4A 3T62A 4ZHAA 2ANMH 3V3MA 4AX9H 3Q3XA 1ZPBA 3ODDA 3ZYDA 1KLIH 3M5NA 1G3CA 1S84A 5EODA 1BDAA 1A0JA 3MH6A 2R0LA 4ZMAH 3E91A 1VCQA 4KELA 1TNKA 1YKTA 3SOSA 1E0FD 1ARCA 2WPJS 1GHBF 1G36A 1IQHA 2HRVA 3QZQA 2VIQA 3DFLA 2WPIS 2G51A 3TNTA 5DK1A 3A89A 1SGDE 2RA0A 1O3LA 5EQSA 3GY6A 1YCPH 3M7QA 1YC0A 1ZZZA 4WVPE 4TYDA 1O31A 1UHBB 2F9PA 1HJAC 3P8FA 3HPTB 4AG1A 3KQBA 4ISHH 7GCHF 1CO7E 2WPKS 1Z8RA 2G4UA 3MYWA 3QTVH 5BRRE 1DT2A 1P2NA 1TX6A 1PPHE 1VZQH 3A80A 3H5CB 2P94A 1SGNE 3PLBA 4HTCH 2BDCA 1DUEA 2Y5GA 2G8TA 1HJ8A 1O2XA 1TMTH 2QAAA 5EPNA 1KXDA 1P11E 1GBBA 2C4FH 3GDSA 4IMQA 1TBQH 2DE8A 1AVWA 1WQVH 4UE7H 3S9AA 1V2TT 2ZPRA 2ZP0H 2EI6A 1YYY1 3HK3B 4X1QU 1O5DH 2D2DA 1ZTLA 1CHOG 5FCRA 3A7XA 3RMLH 3SBKA 1TPOA 1GJ7B 1GJ5H 2AMDA 1GHXH 2O8WA 3VB6A 1C1UH 2XTTB 1GBMA 2PTNA 4K1TA 1P8VC 1UHBA 4UFDH 4A1TA 1YPMH 4SGAE 1A46H 2WINI 3TNSA 1QIXB 1P06A 5E2OA 2GCTB 4M7GA 4WXVA 3BSQA 5ETXA 1FONA 2BLQA 1OP8A 1SGRE 3LGIA 4A1VA 2G52A 1NS3A 3PMJA 2SGAA 1C1NA 1J14A 1YLDA 3UWJH 1OWKA 1MTNC 2FYQA 3GCTG 1TYNA 2ZDMA 2QYIA 2ZGCA 4Y10E 1A61H 1GPZA 1Y3VA 4WY3A 8KME2 3F9FA 2UUJB 5TCCA 3ZZ8A 2A4OA 4DIHH 1J15A 3TK6A 3M7TA 4ISLA 4ABDA 1DWEH 1GVKB 2FS8A 1HPGA 2ZTYA 1K1LA 4E05H 1N6YA 1CHOF 5IDKA 2PSXA 1P2OA 3RU4D 5F8ZA 2Z9IA 1DWBH 1ESAA 2ZGJA 1C1RA 3MO3A 3A8DA 4CH8B 4YLQH 3ZVAA 4DJZB 1WAYB 1O2GH 2JH5D 4B2CA 3KQCA 3QLPH 3TJVA 3SUEA 1IQEA 1GBCA 1ACBE 3FP8E 2NU2E 3GYLB 3MFJA 3AVZA 4OS5A 3QUMP 1T32A 1C5SA 1VGCB 4X8SH 1C5XB 4A1XA 3GCTF 2BD2A 2VWNA 3STIA 3ZZCA 3SW2B 1TB6H 4NWKA 5HGGA 2SGPE 3GY3A 5A2MH 3A85A 2NU3E 2A5IA 3I77A 1MQ5A 2Y82A 3HATH 2ASUB 4CBOA 1EJMA 4ESTE 3P17H 1SGCA 3ZV9A 5CE1A 2P3TB 1O5EH 2LPRA 1JXPA 3GY5A 3PYHA 1QBNA 3T25A 1BA8B 4LZ1H 1L1JA 2WYJA 1LVBA 3P6ZB 1C2LA 1O2PA 3T2NA 3TK9A 5LPRA 1GGDB 1C5OH 1FDPA 3BG8A 4MLFB 1PPCE 4X6OA 2PKSC 3TITA 3ZZ9A 3SQHE 2BZ6H 1C5LH 3D62A 5FPYA 5ABWA 1S81A 2FO9A 4I8JA 3JZ1B 1C1TA 4NZLA 2J4IA 4MTBA 1HAVB 4CRGA 1T4UH 1V2UT 5K7RA 2B8OH 3MNBA 3BV9B 3U1JB 2VIDA 2GZ9A 2V35A 2FLBH 4YT7H 5FBIA 1V2RT 2OUAA 3RXSA 1ZJDA 3GY8A 3OYPA 1QTFA 1UTQA 2LNCA 1H1BA 1OWJA 3M5MA 3QGJA 1K1MA 1AB9B 1GJ6A 1A5GH 5EXMA 1K28D 2B9LA 3EDXB 3QK1A 3QX5H 1UVOA 2QV1A 3UTUH 1FXYA 1AFEH 3RLWH 1HFDA 1H9LB 3O8RA 4Q7XA 5ESBA 1QRZA 1ELTA 1TX7A 1HAGE 1G9IE 3QN7A 1THPB 2C3SA 1MKWK 3OX7U 1A3EH 1HAVA 1Z6JH 3GCHC 1P3CA 2RA3A 2VNTA 1LTOA 4AGJA 1MQ6A 1XUKA 3SNBA 1C5VA 3ZVEA 3ZVGA 4B2AA 3BTFE 1PPFE 3BTKE 1AZ8A 1NROH 2FS9A 1F5RA 1AUJA 3H7OA 1G30B 1GMCG 1S6HA 1V2JT 4BOHA 1PJPA 1C5RA 1TGCA 3NZIA 1JIRA 1O36A 2WV4A 1TMBH 1TALA 2EI8A 1C1QA 2FOEA 3SV8A 1G2MA 1F0UA 1SOTA 5EPYA 2VWLA 1HAPH 3SN8A 3FAOA 1QGFA 4ZKNU 1SC8U 2OC1A 2ANYA 4Q7YA 2BOHB 4DCDA 5C67A 3GDVA 2FXRA 2W7UA 2SNVA 2G55A 1RTFB 1ELBA 1AVXA 1FV9A 2PGBB 3BTQE 3C1KA 2Z3CA 5DKMA 2WUBA 1EOJA 4IBLH 4K60A 4U30A 2VU8E 3UOUA 3LC3A 4CHAB 1NRQH 1V2VT 3PLKA 2HNTE 2IN2A 3R0FA 2P3FH 3QTOH 5JBAS 1SFIA 3U1IB 4WXIA 2H9EH 1SI5H 2Z3DA 5LGOA 1QY6A 3M5LA 2YNBA 1P3EA 5ESTE 2HALA 1LPKB 1GMDF 2F9VA 4ABEA 4BTUB 3FP6E 3ZZAA 1DICA 2QXHA 3K6ZA 1EB2A 3RU4E 1GMCF 1TNIA 2Y7XA 2VGCB 1MTSA 1D6RA 4GCHG 4DT7B 1E34B 2AFQB 2A7CA 3MU8A 2D1JA 3B8JA 1HAXB 1SPJA 1EPTB 4GHTA 5EQQA 1TRMA 5HM2A 1EZUC 2BDHA 2XBVA 3UFAA 3KQEA 4J2YB 4XBCA 5FPTA 3ZZ5A 1P2KA 3TGKE 2XCNA 1SLXB 1ETSH 2FPZA 3MTYA 4BANB 5E2PA 5DPAA 3K65B 1AO5A 1EQ9A 1GDQA 2Y81A 2AH4X 4WMDA 5DO4H 3PM3A 1O2KA 2WV5A 1C5TA 1HAOH 1MU6B 1EASA 2FDAA 4JZFH 5JBBS 3PWCA 1DANH 5L2YH 1NY22 1QQ4A 4K5ZA 1GWAA 3SI3H 2O8TA 1HNEE 2R9PA 1GBEA 4AN7A 1F92A 2CF8H 1TPPA 2CMYA 1EPTA 3TIUA 2H5CA 2A5KA 3RM0H 3SZNA 1BUIA 1ELEE 2FOAA 3K2UA 1HAIH 1NM6A 4FUEA 1V2PT 4FUHA 3RXEA 3AASA 4GCHF 4J1YA 1GI7B 1YF4A 1E37B 1VGCC 2YOLA 1D3DB 2Z6BD 1TPSA 6ESTA 4H42U 4YOIA 1O3DA 1O3PB 2ZZUH 2AMPA 1ZSKA 5F8TA 4CRDA 4B73A 2CJIA 2RG3A 4TWYA 3TU7H 4IN2A 3F9GA 1C1MA 4NSVA 1GGDC 4KTUA 1NRNH 4XOJA 3NUMA 4B1TA 1UK3A 2TGPZ 2UUYA 3RXQA 1O2ZA 1GBHA 5AF9H 2C8XB 2BLWA 3O8DA 1ANCA 2GD4B 3SGQE 5DP7A 1MZDA 1ETRH 2J38A 3K9XB 4U2WA 4FUIA 3KNXA 3MU0A 6GCHF 2HOBA 3VFEA 1GBTA 2A4RA 2A7HA 3S9BA 1HB0B 1V2NT 3S7HB 3SUGA 3SU1A 1AB9C 2V3OH 1VCWA 2GCHG 3SUDA 3M3TA 2A2QH 4JK6A 2AIPA 3ZZ4A 1GL0E 1V2OT 2OQ5A 1V2QT 2QXGA 4HGCA 2KAIB 2ZEBA 3TK5A 3WY8A 3HKJB 3RC4A 4CREA 5L6NH 2CHAB 3BTTE 2ANKH 1QFKH 1KXCA 1N1LA 2BY8X 4YO9A 1EX3A 3M37A 1Y59T 3ODFA 1QR3E 3RXHA 5A0AE 3SORA 2AEIH 2F83A 4FUDA 3L33A 2BXTH 4Y0YE 3S9CA 2WYGA 4FUJA 1EJAA 2V0BA 3HGNA 1HDTH 1JMOH 3S69A 3S0NA 1UVPA 1UMAH 3DHKH 1GJDB 3A86A 1D4PB 1GI2A 3BG4C 1BRUP 3ATWA 2STAE 3F68H 2J92A 1CT4E 1BTUA 2KAIA 2GGVB 5I25A 2ZG0H 5AFZH 1FN8A 1W7XH 5DP9A 1C2JA 3T27A 1SGPE 1GJBB 1Q31A 2GCHF 4OS1A 2A31A 1W3CA 1GBDA 1NRSH 1QRWA 1ZHPA 2A2XH 4WJG2 4MPUA 3SNDA 4ASHA 3HK6B 3N7OA 3OU0A 1J17T 2GV7A 1BTZA 3TVJB 2FX6A 2IOTA 1Q3XA 1G3EA 1TFXA 3P95A 1C2FA 5EW2H 2A5AA 3TGJE 1P09A 2R2MB 1B0EA 1EXFA 1DFPA 2BD3A 3LGTA 4KP0A 1UTJA 5TCAA 4UEHH 3E8LA 1LKBA 1KTSB 1TNGA 4UDWH 2FTMA 4JZDH 3RXMA 3SJKA 2VIPA 4Y6DA 1GJAB 1YPLH 1O5FH 5HXFA 1EZSC 2R3YA 4K69A 1FY1A 1QNJA 1HAZB 2P8OC 1SHHB 1CA8B 3PROA 2VGCC 4BXWA 2FOMB 1NFXA 3SHAH 1GVLA 3GCNA 2G5VA 1SBWA 1NN6A 1DSUA 2BYAX 1W12U 4NIVA 4WWYA 1K22H 5DJ7A 4DW2U 2BD8A 1EPTC 1H8DH 3LC5A 1GMHF 2UUFB 3D65E 5DG6A 3SNAA 2Q6FA 2DUCA 1D9IA 4UFFH 3ZYEA 1IQJA 2PKAB 3LT3A 4BAMB 5T3HA 1O3AA 4Y0ZE 1AU8A 1LHCH 5HMAA 1Y5UT 1V2LT 4Y71A 1C5UA 4RSPA 1C2EA 5EOKA 1C4V2 1P2JA 1QCPA 4KTSA 1BMAA 3KHVA 2JH0D 1NU7B 3MOCA 1TQ0B 3R3GB 3PV4A 1BCUH 2ZNKH 1UTKA 1ZYOA 3BTEE 2IPHA 1ZTKA 3AAUA 2EA3A 1O2QA 2XC0A 4AYVB 4F4OC 1DX5M 1OS8A 1L4ZA 1FY8E 2BDGA 1RGQA 3Q00A 1CA0B 2SGFE 2ZCKP 4FUFA 3E3TA 4MQAA 4DG4A 1SVPA 1QBVH 1QBOA 1FNIA 2JETB 2PKAA 1CBWB 4MPXA 2A4GA 1OSSA 2A0QB 2ZDLA 3RXIA 2ODPA 1O37A 4ZHMU 2NU4E 4BXSA 1HCGA 2XNIA 1BJVA 1EAIA 3A88A 2ILNA 2OINA 4JYVH 3RXPA 1LMWB 2AERH 3E6PH 1O30A 1DXWA 3UR6A 2PW8H 3LONA 1J8AA 1OWDA 3C27B 4ABAA 2Z9KA 4Z6AH 1ANDA 4X8TH 2H6MA 4UFGH 1SLWB 1LHDH 5K0HA 3NK8A 4RKOB 1GHWH 2F3CE 6LPRA 1L1GA 2OBQA 1O39A 4IN1A 2R0KA 1WV7H 1IQGA 2SGEE 2W26A 3LDXH 1N8OB 3MU5A 1C5MD 1IHTH 1Z8JB 5CHAB 1UTLM 4H6SB 1O2HA 2TRMA 2P59A 2B7DH 1OXGA 4ISIH 2P93A 3DUXH 1RS0A 2ZHDA 1LPZB 2VINA 3RXJA 2XBYA 1BHXF 1AI8H 2ZF0H 1BMLA 1GBJA 1UVSH 4QT8C 1PPGE 4AFQA 2Z7FE 4XDEA 1BBRK 5I46H 4NGAH 3STJA 4UD9H 3EAJA 5AFYH 1C1VH 1O3EA 1O3FA 3A7VA 4I7YH 4CRBA 1DOJA 2ZGHA 4WH8A 1OPHB 4X8UH 3FVFB 1H8IH 4D9RA 2CHAC 3EA7A 2Q6DA 1G3BA 1G2LA 2H9TH 3ZZBA 1IQLA 3L3TA 1BB0B 5JBCS 2WPLS 1FY3A 1OP0A 1AKSB 2V6NA 1KXBA 3BN9A 1UCYK 2FTLE 3CS0A 1W0ZU 2VH0A 1PPEE 4I8GA 4THNH 1GCTB 1YLCA 3A8AA 3BTGE 1P04A 3PB1E 3OTJE 1LHGH 3SNEA 1TOCB 2GKVE 3DA9B 2FOCA 4DVAU 1O2RA 4OGXA 4DOQA 1SR5C 4CBNA 1GI0A 3URCA 1J9CH 1TMUH 5GDSH 3SJIA 2VVUA 2TIOA 2IJOB 2BB4A 2XW9A 4TPYA 4FU7A 1L0ZA 2H1UA 4ZKRU 3SNCA 2B0FA 2BDBA 1GBLA 1AKSA 1TX8A 4E06H 2F9NA 3ZVDA 2OQUA 1DLEA 1YPEH 2Z3EA 3EGKH 1ELAA 2DE9A 1ESBA 1X7AC 5FBEA 1WOFA 2P16A 3TGIE 4X2VA 1ZSJA 3P92A 2ZHFH 4B71A 1FJSA 1DPOA 3TJNA 5TJXA 1F0SA 1GL1A 3M61U 1THRH 5F6MA 2A7JA 4RKJB 2XRCA 1OP2A 1RD3B 2PLXA 3ZVBA 4BAHB 2B5TB 1CGIE 1WTGH 1NFYA 1ESTA 1DXPA 4GUXA 1GI6A 1TPAE 3SO3A 1O34A 2NU0E 2ESTE 2RDLA 4Y8XA 2Z9GA 5A0CA 1CT0E 1C5YB 1TONA 1O33A 1S82A 2ZCLP 5EXLA 1KLJH 5C20A 4GAWA 1FIZA 4BAQB 1O2TA 1XM1A 1HJ9A 1DY8A 1XX9A 1K1IA 2AGIX 2OC7A 1WBGB 2Z94A 1NRPH 2I6QA 1HXFH 1KXAA 5C3NA 2ZCHP 1TE0A 3SGAE 1BZXE 1DWDH 2BX4A 2SGDE 3KF2A 4LK4A 5EGMA 4U32A 4NIYA 1D3PB 1A0LA 2J2UA 2XWAA 1ZR0A 2HNTC 1Y3YA 1RRKA 4FVDA 1S6FA 3RXAA 3MMGA 1EP5A 3B23B 2WUCA 4FVBA 2FIRH 2UWOA 2QA9E 1RIWB 1AE8H 1OWIA 2EC9H 4TWWA 4YTAA 5A09A 2Z9JA 3F1SB 1BTWA 3PTNA 2OC0A 1F0TA 2A4QA 1C5QA 1WTHD 4GLYA 1QQUA 4NIXA 1O3JA 1TRYA 1TWXB 1AWFH 1GMDG 4UFEH 1SGFA 4DY7B 1CA0C 1O5GH 3VB7A 1NC6A 2OBOA 3T28A 1OX1A 1FY5A 2PWXA 1HV7A 2FM2A 4ABHA 5GWZA 1MH0A 1C5WB 2ZC9H 4RN6A 3ATMA 1CBWC 2OD3B 3F6UH 3UR9A 4XBDA 5G4BA 2W5EA 1HLTH 1EP6A 4OS6A 4NG9H 5JBTA 3VGCB 4OS4A 2ZTXA 3Q76A 2F9BH 3V13A 4F49A 1QL9A 3RXCA 2QGRA 5A8ZA 3EA9A 5E0HA 3M36A 4X1PU 4AFZA 3LU9B 1P02A 4MNVA 1QB1A 4O03A 2A1DB 2W3KA 3RXUA 1V2MT 1Z6EA 1QA0A 1K21H 1Q2WA 3UWIA 1DITH 1TGSZ 4JMYA 2AMQA 1UTMA 1C1WH 2ZFRH 2GVFA 3UNQA 1S0QA 1K1PA 1ZMNA 2JKHA 3I29A 5C5OA 2OC8A 1E38B 5CHAC 2GCTC 3CP7A 5EQRA 1BOQA 3ATLA 1XKAC 4VGCB 4NSYA 2ZPSA 2ALVA 1OKXA 1DWCH 4X6NA 3ATIA 1GI4A 3NWUA 4INKA 1T7CA 1FAXA 4A92A 3Q77A 1YPGH 4IMZA 2PR3A 1BRAA 3ELAH 5GIBA 2TBSA 4LOYH 1MU8B 3FANA 4D76A 4ABBA 1ELGA 1P57B 1GJCB 1ZGIA 2ALPA 4Y11E 1O5AB 3A7TA 4E7RG 5C2ZA 1FI8A 1TBZH 4CH2B 1V2KT 4ISNA 1O35A 5C5NA 1P10A 1MKXK 1O3BA 3TJOA 2ZU2A 1GG6B 3SUFA 4DURA 4FU9A 2GX4A 1GCTC 3EYDA 2QCYA 1PPZA 1GDNA 1BQYA 2VWMA 4FU8A 2CXVA 3UPEA 4K3JA 1XUJA 1ABJH 4ZKOU 1UK4A 2CV3A 6GCHG 1Y5AT 1OWHA 4XE4A 2D8WA 3GOVB 1B0FA 1O2YA 1PFXC 3E0PB 3MH4A 2FYRA 5AVDA 3LPRA 1MKWH 1P2IA 4TPIZ 1KLTA 5DP3A 4MNWA 3RXDA 4ZROA 1H4WA 3A83A 1CHGA 1O2NA 1C4Y2 3M7UA 1QHRB 2ZFFH 1YGCH 1L1NA 1YM0A 1SGTA 1XVMA 2FOHA 4MPVA 1TABE 5LH8A 3UY9A 3IWMA 2GZ8A 1ARBA 1HJAB 2SFAA 2ZFSA 5GCHG 2BD9A 1SMFE 4K1EA 3S7KB 2VB0A 4D8NA 3JZ2B 4NFFA 4JZ1A 1FLEE 2C93B 4WMFA 1YPHE 2BHGA 2NU1E 5F8XA 4O97A 4MG3A 1WCZA 2GT7A 4SGBE 1EZXC 4X6PA 1C2IA 1DLKB 1HBTH 4AZ2B 2FI4E 1DDJA 3QDZB 4X1RU 2PGQB 1A3BH 1ETTH 1BIOA 1SGEE 2ZPQA 4NIWA 3LH1A 1C1SA 5FXLA 1HAYB 3U8OH 4ZKSU 5DP6A 5AHGH 2BZAA 2ZU3A 4D9QA 2C8ZB 4FXGH 1GHAG 4YZUA 2FOBA 1ELDE 3ESTA 2FODA 3A7YA 5EXNA 1NESE 1RIWC 5GCHF 1GBKA 3M5OA 3BIUH 3P70B 1S83A 1SGQE 2BDIA 1W11U 1Y3WA 2FI3E 4H6TA 1SGYE 5EG4A 5SGAE 2ZQ2A 3HKIB 2ZA5A 1V3XA 1EOLA 1WYKA 3SU0A 1LQEA 1RXPA 1YCPK 4CRAA 1MAYA 2FEQH 4O3TA 1RTKA 1TQ7B 2JH6D 1KXFA 2GTBA 6CHAB 1C5NH 1VJAU 1ELVA 5LPEA 1O3NA 5IYTA 2BQ7B 3KEEA 4Y8ZA 4AOQA 2O9QA 1WUNH 2A32A 2R2WU 3UOPA 2ZDVH 2BM2A 3AW0A 2OCVB 3SQEE 1O3CA 1GMHG 2HVXA 1GCDA 3W95A 3MNXA 3LKWA 4IC6A 3A8CA 5EW1H 1GHAF 1F5LA 4BAKB 1W7GH 1TNJA 4ZH8A 3EQ0H 3U69H 2ZGBH 1YBWA 3U8RH 1W2KH 2H5DA 1TA6A 5JDUB 3B9FH 4D7GA 4E7NA 3VXEH 4CHAC 1GBFA 1ZMLA 5H4IB 4K1SA 4IW4E 2AGGX 2Q6GA 3NPSA 4LXBH 2ZHWH 1NZQH 4X0WU 4MVNA 4VGCC 5T6GA 1A4WH 1C2GA 5FPSA 2BY9X 1C1PA 2OP9A 4INLA 2GMTB 5J4QA 4Y7BA 1W0YH 1CE5A 1XUHA 2A45B 2FMJA 1K1JA 3SJ8A 3MH7A 2AYWA 2BQ6B 1KXEA 1JRSA 2BD7A 1ELCA 2FP7B 4MDSA 3TLOA 1O3OA 2BY6X 1K1OA 1MD8A 5DP8A 3W94A 4DIIH 1Y8TA 3SU5A 4BNRA 1C5PA 3G01A 1ZTJA 3ZZDA 1FUJA 4OGYA 3FP7E 1QJ7B 3ATKA 1MD7A 1AZZA 1O2MA 3ZZ6A 4BTTB 5E0GA 1SG8B 1GG6C 2J94A 1O3IA 3BF6H 1D3TB 4CR9A 1EJNA 1LDTT 3ZZ7A 1GJ8B 5JB9S 1Z1JA 4I8HA 1SQOA 1QJ6B 1MUEB 3LGYA 1Z1IA 2AIQA 4AFUA 1DE7H 3RXLA 1YPJH 1XUFA 1HRTH 2HWLB 2O8LA 1T31A 3A84A 1TA2A 2XCFA 4CRFA 1WQSA 2VIVA 2BVRH 1GI3A 1KIGH 1UTNA 3GY2A 1C9TA 2D26C 3FZDA 3GCHB 3LGWA 3VXFH 3RXGA 1ZHRA 2GP9B 3KGPA 1NT1A 3TH3H 4B2BA 3FZZA 1G32B 3PWBA 7LPRA 2STBE 5HM9A 1IQKA 4I8LA 2BMGB 4X6MA 2C90B 2NWNA 3DFJA 3RMNH 3VB3A 2ZU4A 1JOUB 1TBRH 1BJUA 1XUIA 4IGDA 1SLUB 1PQ8A 3RXBA 4B76A 1Z7KA 5F03A 3H7TA 3ZVCA 4X1SU 2I6SA 3SHCH 5L2ZH 1P01A 1EB1H 1P9UA 2EEKA 2AGEX 1PPBH 1AE5A 1LO6A 2OLGA 2XYAA 3GDUA 1FPHH 3UIRA 5JPMH 4K8YA 4BAOB 3SV2H 2BX3A 4OS2A 1Y5BT 2GDEH 3A82A 3RU4T 3OY6U 2WPHS 2F9OA 3V12A 1O3KA 4JYTA 3F9HA 2PV9B 2ZTZA 3UQOA 2H2ZA 4AORA 1E36B 1BTXA 1FZZA 1EAUA 1G37A 1SSXA 2Y5FA 1O5CB 2G4TA 5A8XA 3BTWE 3QGNB 1F5KU 2HPQH 1TRNA 4MNYA 1O2JA 2P95A 4ISOA 3DT0H 1ZPZA 1RTLA 9LPRA 4NA7A 2PTCE 3E0NB 5DGJA 1A1RA 3MU4A 3Q3YA 1BBRE 2G81E 4XBBA 1Y3UA 4ABJA 4AB9A 2PFEA 3T29A 1O2VA 1TNLA 1KTTB 2HNTF 1V2ST 1EZQA 2BTCE 1O38A 1SOZA 1IQNA 1T4VH 3BTHE 1A7SA 1V6DA 1BTYA 3EE0B 3SU4A 5A8YA 5CMXH 3KL6A 2O8MA 3QO6A 3E90B 1JRTA 2QXJA 1YPKH 4NFEA 1VCPA 4NWLA 1MTUA 1C9PA 1VITH 1L4DA 1UCYE 4YOGA 6CHAC 1PYTD 5FHTA 2VIOA 1CT2E 3LOXA 3SV9A 2GDDA 3D23A 3E16B 3T26A 1AWHB 3MNSA 2Y7ZA 3MNCA 1LPGB 2ZHQH 3SI4H 1BT7A 1IOEA 3MO6A 1LVMA 5JB8S 1A0HB 1TAWA 2XC4A 8ESTE 1B5GH 1OYTH 2XWBI 3RM2H 1SHYA 4FUCA 3PO1B 2BD4A 1DVAH 1EAWA 2ZDNA 2QC2A 1JBUH 1EUFA 1QRXA 4Y7AA 3LGUA 1AGJA 3DD2H 3LJJA 1UJ1A 1ABIH 1FAKH 4D7FA 3PMAB 1TNHA 3M3SA 1P03A 3TJUA 3OSYA 1DUAA 2BDAA 4R8TB 4AGKA 3IG6B 1V2WT 1W10U 1LHFH 1KSNA 3BTME 1UVUH 2SGQE 3GYMA 2C8WB 1P2QA 2W7SA 4HZHA 3MU1A 4WF8A 1T8OA 1O2IA 4Q7ZA 2GMTC 1VJ9U 1O3HA 1BMMH 3CS7A 1W14U 1OWEA 2FOGA 2PUQH 2ZWLH 2YNAA 3D49H 2FX4A 1QL8A 4TY6A 5GPIB 4YOJA 2BLVA 1K1NA 4X8VH 4X1NU 3BTDE 4ABIA 2J34A 4FUBA 5FAHA 1KYNA 2VJ1A 3BIVH 1O32A 2Q1JA 1HGTH 1IAUA 2ANWA 1T8MA 5E0JA 1GBAA 2Y80A 3RMMH 1OOKB 5GXPA 1O2LA 5C1UA 1Z8IB 3TH4H 2FWWA 4ZXYH 3NKKA 1T8NA 1TGBA 1TIOA 3GCOA 1CQQA 2EI7A 2ZU5A 4ZHLU 4A5TS 1HUTH 2CF9H 1BBRH 7ESTE 3P8OA 1QJ1B 2F91A 1CGJE 1GVZA 1RFNA 4XSKU 2BQWB 3RC5A 4MNXA 1O2OA 1SQAA 1AY6H 1MMJN 4I32A 1WU1A 3RUOA 4HI3A 1O0DH 1ZPCA 3IITA 1PYTC 1LVOA 2BY7X 1UCYH 1MCTA 1O3MA 1GI5A 4AG2A 2ZO3H 2JETC 2TPIZ 5PTPA 2UWLA 2OTVA 3P8NA 1FMGA 1BTHH 1MZAA 1SGFG 3A7WA 3I78A 3MH5A 1ANEA 1YP9A 4YLUA 3U98H 4UONA 4Y79A 1O2UA 1UK2A 2ODQA 1THSH 1TGNA 1ZRBA 1NTPA 3BG4B 1SL3A 5FX5A 1AMHA 1E35B 3SU3A 4BTIB 1A2CH 1CU1A 5FX6A 2CGAA 1QA7A 4JYUH 2ZKSA 4JZEH 4KTCA 3LJOA 3QZRA 4K2YA 5EU8A 1U6QA 1XXDA 7KMEH 3KN2A 2VVVA 3Q3KA 2QIQA 2TGDA 2GZ7A 1F7ZA 3M3VA 1N8OC 1S5SA 3UNRA 2P3UB 3NCLA 1QL7A 3LH3A 3SV7A 1PQAA 1AIXH 1FN6A 4X2YA 1OYQA 4ZUHA 3AAVA 3O8BA 1SQTA 4GSOA 1AHTH 1AFQB 4DGJA 1ZMJA 1G3DA 3ENSB 4NZQA 1MTVA 4U01A 1CSOE
chains in the Genus database with same CATH superfamily
2SNWA 2QF3A 4A7IB 1FPCH 3ZZ3A 1AN1E 1WDIA 2HLCA 1FIWA 2ZI2H 2F9UA 2THFB 5BPEA 3URDA 4B6FA 1P0SH 1C4U2 2FESH 3GY4A 1UVTH 4Q2KA 2P8OB 2WPMS 2ODYB 1W8BH 1YPHC 2QXIA 1S0RA 3L6PA 4YT6H 4GPGA 2FI5E 2H9HA 5JYIA 1C5ZB 1VITG 1N6XA 1NRRH 3WWBA 3P8GA 3RXOA 1O3GA 5FCKA 4I8KA 4AFSA 1KY9A 1TLDA 2TGTA 4FUGA 4TY7A 1RJXB 3SGBE 4P00A 2Y6TA 1MBQA 1ZOMA 4LZ4B 1GHYH 2BOKA 3A8BA 1ANBA 3ITIA 5E8EH 3VPKA 4FOUC 2QF0A 1BMNH 2FOFA 1NO9H 1T8LA 3OAAD 3A81A 1UTOA 3QWCH 3SU2A 4B74A 3T5FH 1LCYA 2FZZA 1L2EA 2AS9A 3F9EA 2GT8A 2FLRH 1O2SA 1S85A 1XVOA 1AVGH 2J95A 2KX4A 2ZFQH 2RCEA 1SFQB 3PO1C 5C1XA 1DM4B 4GVUA 2XXLA 4AYYB 2BVSH 1WSSH 1ZJKA 3U9AH 1Y3XA 2ZQ1A 4YM9A 3UNSA 5C1YA 1D6WA 3PTBA 3V0XA 4CR5A 1Z71A 4NA9H 1QB6A 1JIMA 2PHBA 2C8YB 1MBMA 1C1OA 1F0RA 4X2XA 1M9UA 3BEUA 1CGHA 2BDYA 3PMHB 4IS5A 3U8TH 2XNDD 1K0HA 3RXKA 1VITF 1AD8H 3F0PA 3UUZA 1ZGVA 4ZXXH 1GJ9B 3PMBB 1FY4A 1P9SA 4HFPB 4TT3D 4K8BA 3O8CA 1F2SE 1HAHH 2QF4A 5B6OA 1GDUA 3GY7A 5HYOA 1JWTA 3RXTA 2VWOA 4JZIA 3V7TA 2Y5HA 1HYLA 2BVXH 1H9HE 1LHEH 8GCHG 3SJ9A 1XXFA 1KDQB 1EAXA 1QB9A 4I31A 5FL7D 2PUXB 2QY0B 4KKDA 1MCVA 3BEFB 4Z0KA 3SJOA 1ZRKA 3LGVA 1K2I1 2ZFTA 3CENA 1C2MA 1HXEH 1A5HA 3KQDA 3TPIZ 2O8UA 1FQ3A 2UWPA 3GISB 4XFQA 3UQVA 2M5TA 2ZFPH 4MPWA 1BRBE 5GNDA 1NFUA 2G5NA 4WMEA 4R0IA 1GI1A 2ZECA 3MWIU 4JCNA 2VVCA 2K1QA 4Y76A 1UTPA 2ZDAH 1B7XB 1LKAA 3ZVFA 3EA8A 1MTNB 1QURH 1UO6A 3AK5A 3RXRA 3KIDU 1IQIA 1BRCE 3LIWA 5A0BA 1GI9B 4A6LA 5IK2D 3MI4A 1KDQA 3GICB 1A5IA 4Y8YA 1C2KA 1PQ5A 3E1XB 1O2WA 1TOMH 1YCPM 2ZIQH 1MKXH 3F0OA 3FFGA 4X2WA 1DS2E 1P05A 2ZHEH 1ZSLA 3K6YA 1P2MA 2ULLA 2TGAA 4YESB 4O3UA 1ZHMA 2BD5A 3OY5U 5J4SA 1NPMA 1ZLRA 1Z8GA 1TGTA 8GCHF 2PSYA 1AUTC 3A7ZA 2XC5A 5DP5A 1IHSH 1H9IE 3VGCC 1SGIB 1CVWH 4IC5A 1LQDB 1NFWA 2GV6A 3HGPA 4I33A 3RMOH 2JIZD 3KCGH 3RC6A 4AB8A 2V3HH 3RLYH 2XBXA 4GHQA 2G00A 3ZV8A 4NA8A 3UREA 3SZEA 1XMNB 2BXUH 2HGTH 9ESTA 1EATA 4NCYA 1SLVB 4OS7A 1IQMA 4ABGA 1C2DA 1BTPA 2QN5T 3NXPA 2VH6A 3TH2H 1LVYA 4O9VA 4ABFA 1GI8B 2ZU1A 1AQ7A 1DY9A 8LPRA 4H4FA 5HKKD 1GHZA 1HIAB 2XBWA 3VB4A 3M35A 1NU9A 4KGAA 5T6FA 2VIWA 1VR1H 1AFQC 1XUGA 1GHBG 2JJ1D 1GJ4H 2CN0H 1INCA 3SU6A 2HPPH 3MHWU 1SB1H 3WW7A 1MTWA 2PKSB 1BITA 1DSTA 2R3UA 4INHA 2BY5X 5L30H 1P12E 3A87A 1D3QB 1XKBC 1ID5H 2W3IA 3BEIB 1GHVH 1BHXB 4WH6A 3AW1A 1EKBB 4Q80A 1GBIA 5GJ4B 1C2HA 1ELFA 3RDZA 2ZDKA 4JK5A 2ZGXH 1IQFA 1O5BB 3RXVA 7GCHG 2J5UA 1PQ7A 2BLOA 2OXSA 3VB5A 4PROA 4CRCA 3RP2A 2Z9LA 1ORFA 3RXFA 3SV6A 3MO9A 1HIAA 2UUKB 1K9OE 4B75A 4ZAEA 2J9NA 5LPFA 1W13U 3PLPA 4I86A 3VEQB 1MAXA 5T6DA 1J16A 5DP4A 3T62A 4ZHAA 2ANMH 3V3MA 4AX9H 3Q3XA 1ZPBA 3ODDA 3ZYDA 1KLIH 3M5NA 1G3CA 1S84A 5EODA 1BDAA 1A0JA 3MH6A 2R0LA 4ZMAH 3E91A 1VCQA 4KELA 1TNKA 1YKTA 3SOSA 1E0FD 1ARCA 2WPJS 1GHBF 1G36A 1IQHA 2HRVA 3QZQA 2VIQA 3DFLA 2WPIS 2G51A 3TNTA 5DK1A 3A89A 2YMSB 1SGDE 2RA0A 1O3LA 5EQSA 3GY6A 1YCPH 3M7QA 1YC0A 1ZZZA 4WVPE 4TYDA 1O31A 1UHBB 2F9PA 1HJAC 3P8FA 3HPTB 4AG1A 3KQBA 4ISHH 7GCHF 1CO7E 2WPKS 1Z8RA 2G4UA 2KZ4A 3MYWA 3QTVH 5BRRE 1DT2A 1P2NA 1TX6A 1PPHE 1VZQH 3A80A 3H5CB 2P94A 1SGNE 3PLBA 4HTCH 2BDCA 1DUEA 2Y5GA 2G8TA 1HJ8A 1O2XA 1TMTH 2QAAA 5EPNA 1KXDA 1P11E 1GBBA 2C4FH 3GDSA 4IMQA 1TBQH 2DE8A 1AVWA 1WQVH 4UE7H 3S9AA 1V2TT 2ZPRA 2ZP0H 2EI6A 1YYY1 3HK3B 4X1QU 1O5DH 2D2DA 1ZTLA 1CHOG 5FCRA 3A7XA 3RMLH 3SBKA 1TPOA 1GJ7B 1GJ5H 2AMDA 1GHXH 2O8WA 3VB6A 1C1UH 2XTTB 1GBMA 2PTNA 4K1TA 4P02A 1P8VC 1UHBA 4UFDH 4A1TA 1YPMH 4SGAE 1A46H 2WINI 3TNSA 1QIXB 1P06A 5E2OA 2GCTB 4M7GA 4WXVA 3BSQA 5ETXA 1FONA 2BLQA 1OP8A 1SGRE 3LGIA 4A1VA 2G52A 1NS3A 3PMJA 2SGAA 1C1NA 1J14A 1YLDA 3FOAA 3UWJH 1OWKA 1MTNC 2FYQA 3GCTG 1TYNA 2ZDMA 2QYIA 2ZGCA 4Y10E 1A61H 1GPZA 1Y3VA 4WY3A 8KME2 3F9FA 2UUJB 5TCCA 3ZZ8A 2A4OA 4DIHH 1J15A 3TK6A 3M7TA 4ISLA 4ABDA 1DWEH 1GVKB 2FS8A 1HPGA 2ZTYA 1K1LA 4E05H 1N6YA 1CHOF 5IDKA 2PSXA 1P2OA 3RU4D 5F8ZA 2Z9IA 1DWBH 3H09A 1ESAA 2ZGJA 2YMSD 1C1RA 3MO3A 3A8DA 4CH8B 4YLQH 3ZVAA 4DJZB 1WAYB 1O2GH 2JH5D 4B2CA 3KQCA 3QLPH 3TJVA 3SUEA 1IQEA 1GBCA 1ACBE 3FP8E 2NU2E 5KECA 3GYLB 3MFJA 3AVZA 4OS5A 3QUMP 1T32A 1C5SA 3KQ5A 1WXRA 1VGCB 4X8SH 1C5XB 4A1XA 3GCTF 4DT4A 2BD2A 2VWNA 3STIA 3ZZCA 3SW2B 1TB6H 4NWKA 5HGGA 2SGPE 3GY3A 5A2MH 2CK3D 3A85A 2NU3E 2A5IA 1BMFD 3I77A 1MQ5A 2Y82A 3HATH 2ASUB 4CBOA 1EJMA 4ESTE 3P17H 1SGCA 3ZV9A 5CE1A 3OEHD 2P3TB 1O5EH 2LPRA 1JXPA 3GY5A 3PYHA 1QBNA 3T25A 1BA8B 4LZ1H 3SYJA 1L1JA 4AC9A 2WYJA 1LVBA 3P6ZB 1C2LA 1O2PA 3T2NA 3TK9A 5CDFE 5LPRA 1GGDB 1C5OH 1FDPA 3BG8A 4MLFB 1PPCE 4FETA 2PKSC 4X6OA 3TITA 3ZZ9A 1QZ8A 3SQHE 2BZ6H 1C5LH 3D62A 5FPYA 5ABWA 1S81A 2FO9A 4I8JA 3JZ1B 1C1TA 4NZLA 2J4IA 4MTBA 1HAVB 4CRGA 1T4UH 1V2UT 5K7RA 2B8OH 3MNBA 3BV9B 3U1JB 2VIDA 2GZ9A 2V35A 2FLBH 4YT7H 5FBIA 1V2RT 2OUAA 3RXSA 1ZJDA 3FO8D 3GY8A 3OYPA 1QTFA 1UTQA 2LNCA 1H1BA 5EIYA 1OWJA 3M5MA 3QGJA 1K1MA 1AB9B 1GJ6A 1A5GH 5EXMA 1K28D 2B9LA 3EDXB 3QK1A 3QX5H 1W0KD 1UVOA 2QV1A 3UTUH 1FXYA 1AFEH 3RLWH 3FKSD 1HFDA 1H9LB 3O8RA 4Q7XA 5ESBA 1QRZA 1ELTA 1TX7A 1HAGE 1G9IE 3QN7A 1THPB 2C3SA 1MKWK 3OX7U 1A3EH 1HAVA 1Z6JH 3GCHC 1P3CA 2RA3A 2VNTA 1LTOA 4AGJA 1MQ6A 1XUKA 3SNBA 1C5VA 2YMSC 3ZVEA 3ZVGA 3N7DA 4B2AA 3BTFE 1PPFE 3BTKE 1AZ8A 1NROH 2FS9A 1F5RA 1AUJA 3H7OA 1G30B 1GMCG 1S6HA 1V2JT 4BOHA 1PJPA 1C5RA 1TGCA 3NZIA 1JIRA 1O36A 2WV4A 1TMBH 3PRBA 1TALA 2EI8A 1C1QA 2FOEA 3SV8A 1G2MA 1F0UA 2JDID 1SOTA 5EPYA 2VWLA 3KYGA 1HAPH 3SN8A 3FAOA 1QGFA 4ZKNU 1SC8U 2OC1A 2ANYA 4Q7YA 2BOHB 4DCDA 5C67A 3GDVA 2V7QD 3PV5A 2FXRA 2W7UA 2SNVA 2G55A 1RTFB 1ELBA 1AVXA 1FV9A 2PGBB 3BTQE 3C1KA 2Z3CA 5DKMA 2WUBA 1EOJA 4IBLH 4K60A 4U30A 2VU8E 3UOUA 3LC3A 4CHAB 1NRQH 1V2VT 3PLKA 2HNTE 2IN2A 3R0FA 2P3FH 4F48B 3QTOH 2J98B 1SFIA 3U1IB 3OEED 5JBAS 4WXIA 2H9EH 1SI5H 2Z3DA 5LGOA 1QY6A 3M5LA 2YNBA 1P3EA 5ESTE 2HALA 1LPKB 1GMDF 2F9VA 4ABEA 4BTUB 3FP6E 2J97A 3ZZAA 1DICA 2QXHA 3F2FA 3K6ZA 1EB2A 3RU4E 1GMCF 1TNIA 2Y7XA 2VGCB 1MTSA 1D6RA 2LELA 4GCHG 4DT7B 1E34B 2AFQB 5EJ1A 2A7CA 3MU8A 2D1JA 3B8JA 1HAXB 1SPJA 1EPTB 4GHTA 2WV9A 1TRMA 5EQQA 5HM2A 2EQNA 1EZUC 3N99A 2BDHA 2XBVA 3UFAA 3KQEA 4J2YB 4XBCA 5FPTA 3ZZ5A 1P2KA 5CHBA 3TGKE 2XCNA 1SLXB 2J98A 1ETSH 2FPZA 3MTYA 4BANB 5E2PA 5DPAA 3K65B 1AO5A 3ZIAD 1EQ9A 1GDQA 2Y81A 2AH4X 4WMDA 5DO4H 2IPQX 3PM3A 1O2KA 4Q63A 2WV5A 1C5TA 1HAOH 1MU6B 1EASA 2FDAA 4JZFH 5JBBS 3PWCA 1DANH 5L2YH 1NY22 1QQ4A 4K5ZA 1GWAA 3SI3H 2O8TA 1HNEE 2R9PA 1GBEA 4AN7A 1F92A 2CF8H 1TPPA 2CMYA 1EPTA 3TIUA 2H5CA 2A5KA 3RM0H 3SZNA 1BUIA 1ELEE 2FOAA 3K2UA 1HAIH 1NM6A 4FUEA 1V2PT 4FUHA 3RXEA 3AASA 4GCHF 4J1YA 1GI7B 1YF4A 1E37B 1VGCC 2YOLA 1D3DB 2Z6BD 1TPSA 6ESTA 4H42U 4YOIA 1O3DA 1O3PB 2ZZUH 2AMPA 2KCYA 1ZSKA 5F8TA 4CRDA 4B73A 2CJIA 2RG3A 4TWYA 3TU7H 4IN2A 3F9GA 1C1MA 4NSVA 1GGDC 4KTUA 1NRNH 4XOJA 3NUMA 4B1TA 2GJGA 1UK3A 2TGPZ 2UUYA 3RXQA 1O2ZA 1GBHA 5AF9H 2C8XB 2BLWA 3O8DA 1ANCA 2GD4B 3SGQE 5DP7A 1MZDA 1ETRH 2J38A 2W6ID 3K9XB 4FUIA 4U2WA 3KNXA 3MU0A 6GCHF 2HOBA 3VFEA 1GBTA 2A4RA 2A7HA 3S9BA 1HB0B 1V2NT 3S7HB 3SUGA 3SU1A 1AB9C 2V3OH 1VCWA 2GCHG 3SUDA 3M3TA 2A2QH 4JK6A 2AIPA 3ZZ4A 1GL0E 1V2OT 2OQ5A 1V2QT 1H8HD 2QXGA 4HGCA 2KAIB 2ZEBA 3TK5A 3WY8A 3HKJB 3RC4A 4CREA 5L6NH 2CHAB 3BTTE 2ANKH 2Z94A 1QFKH 1KXCA 1N1LA 2BY8X 4YO9A 1EX3A 3M37A 1Y59T 3ODFA 1YWUA 1QR3E 3RXHA 5A0AE 3SORA 2AEIH 2F83A 4FUDA 3L33A 2BXTH 4Y0YE 3S9CA 2WYGA 4FUJA 1EJAA 2V0BA 3HGNA 1HDTH 1JMOH 3S69A 3S0NA 1UVPA 1UMAH 3DHKH 2PP6A 1GJDB 4RI0A 3A86A 1D4PB 1GI2A 3BG4C 1BRUP 3ATWA 2STAE 3F68H 2J92A 1CT4E 1BTUA 2KAIA 2GGVB 5I25A 2ZG0H 5AFZH 1FN8A 1W7XH 5DP9A 1C2JA 3T27A 1SGPE 1GJBB 1Q31A 2GCHF 4OS1A 2A31A 1W3CA 1GBDA 1NRSH 1QRWA 1ZHPA 2A2XH 2L6OA 4MPUA 4WJG2 3SNDA 3HK6B 4ASHA 3N7OA 3OU0A 1J17T 2GV7A 1BTZA 1VKYA 3TVJB 2FX6A 2IOTA 1Q3XA 1G3EA 1TFXA 3P95A 2F4LA 1C2FA 5EW2H 2A5AA 3TGJE 2WHXA 1P09A 2R2MB 1B0EA 1EXFA 1DFPA 2BD3A 3LGTA 4KP0A 1UTJA 5TCAA 4UEHH 3E8LA 1LKBA 1KTSB 1TNGA 4UDWH 2FTMA 3DSOA 4JZDH 3RXMA 3SJKA 2VIPA 4ACAA 4Y6DA 1GJAB 1YPLH 1O5FH 4OM9A 5HXFA 1EZSC 2R3YA 4K69A 1FY1A 1QNJA 1HAZB 2P8OC 1SHHB 1CA8B 3PROA 2VGCC 4BXWA 2FOMB 1NFXA 3SHAH 1GVLA 3GCNA 2G5VA 1SBWA 1NN6A 1DSUA 2BYAX 1W12U 4NIVA 4WWYA 1K22H 5DJ7A 4DW2U 2BD8A 1EPTC 1H8DH 3LC5A 1GMHF 2UUFB 2VBCA 3D65E 1UW7A 5DG6A 3SNAA 2Q6FA 2DUCA 1D9IA 4UFFH 3ZYEA 1IQJA 2PKAB 3LT3A 4BAMB 5T3HA 2KR7A 1O3AA 4Y0ZE 1AU8A 1LHCH 5HMAA 2K8IA 1E1RD 1Y5UT 1V2LT 4Y71A 1C5UA 4RSPA 2M2AA 3UAIC 1C2EA 5EOKA 1C4V2 1P2JA 1QCPA 4KTSA 1BMAA 3KHVA 2JH0D 1NU7B 3MOCA 1TQ0B 3R3GB 3PV4A 1BCUH 2ZNKH 1UTKA 1ZYOA 3BTEE 2IPHA 1ZTKA 3AAUA 2EA3A 1O2QA 2XC0A 4AYVB 4F4OC 1DX5M 1OS8A 1L4ZA 1FY8E 2BDGA 1RGQA 3Q00A 1CA0B 2SGFE 2ZCKP 4FUFA 3E3TA 4MQAA 4DG4A 1SVPA 1QBVH 1QBOA 1FNIA 2JETB 2PKAA 1CBWB 4MPXA 2KM0A 2A4GA 1OSSA 2A0QB 2ZDLA 3RXIA 2ODPA 5C0UA 1O37A 4ZHMU 2NU4E 4BXSA 1HCGA 2XNIA 1BJVA 1EAIA 1OHHD 3A88A 2ILNA 2OINA 3DSPA 1H8ED 4JYVH 3RXPA 5DSFA 1LMWB 2AERH 3E6PH 1O30A 1DXWA 3UR6A 2PW8H 3LONA 1J8AA 1OWDA 3C27B 4ABAA 2Z9KA 4Z6AH 1ANDA 4X8TH 2H6MA 4UFGH 1SLWB 1LHDH 3F2HA 3NK8A 4RKOB 5K0HA 1GHWH 2F3CE 6LPRA 1L1GA 2OBQA 1O39A 4IN1A 2R0KA 1WV7H 1IQGA 2SGEE 2W26A 3LDXH 1N8OB 3MU5A 1C5MD 1IHTH 1Z8JB 5CHAB 1UTLM 4H6SB 1O2HA 2TRMA 2P59A 2B7DH 1OXGA 4ISIH 2P93A 3DUXH 4ZCNA 1RS0A 2ZHDA 1LPZB 2VINA 3RXJA 2XBYA 1BHXF 1AI8H 2ZF0H 1BMLA 1GBJA 1UVSH 4QT8C 1PPGE 4AFQA 2Z7FE 3OFND 1BBRK 4XDEA 5I46H 4NGAH 3STJA 4UD9H 3EAJA 5AFYH 1C1VH 1O3EA 1O3FA 3A7VA 4I7YH 4CRBA 1DOJA 2ZGHA 4WH8A 1OPHB 4X8UH 3FVFB 1H8IH 4D9RA 2CHAC 3EA7A 2Q6DA 1G3BA 1G2LA 2H9TH 3ZZBA 3EE7A 1IQLA 5EJZA 3L3TA 1BB0B 5JBCS 2WPLS 1FY3A 1OP0A 1AKSB 2V6NA 1KXBA 3BN9A 1UCYK 2FTLE 3CS0A 1W0ZU 2VH0A 1PPEE 4I8GA 4THNH 1GCTB 1YLCA 3A8AA 3BTGE 1P04A 3PB1E 3OTJE 1LHGH 3SNEA 1TOCB 2GKVE 3DA9B 2FOCA 4DVAU 1O2RA 4OGXA 4DOQA 1SR5C 4CBNA 1GI0A 3URCA 1J9CH 1TMUH 4YXWD 5GDSH 3SJIA 2VVUA 2TIOA 2IJOB 2BB4A 2XW9A 4TPYA 4FU7A 1L0ZA 2H1UA 4ZKRU 3SNCA 2B0FA 2BDBA 1GBLA 1AKSA 1TX8A 4E06H 2F9NA 3ZVDA 2OQUA 1DLEA 1YPEH 2Z3EA 3EGKH 1ELAA 2DE9A 1ESBA 1X7AC 5FBEA 1WOFA 2P16A 3TGIE 4X2VA 1ZSJA 3P92A 2ZHFH 4B71A 1FJSA 1FX0B 3OTPA 1DPOA 2HVYB 3TJNA 5TJXA 1F0SA 1GL1A 3M61U 1THRH 5F6MA 1YY3A 2A7JA 4RKJB 2XRCA 1OP2A 1RD3B 3F3BA 2PLXA 3OE7D 3ZVBA 4BAHB 2B5TB 1CGIE 1WTGH 1NFYA 1ESTA 1DXPA 4GUXA 1GI6A 1TPAE 3SO3A 1O34A 2NU0E 2ESTE 2RDLA 2EY4C 2Z9GA 4Y8XA 5A0CA 1CT0E 1C5YB 1TONA 1O33A 1S82A 2ZCLP 2KCAA 5EXLA 1KLJH 5C20A 4GAWA 1FIZA 4BAQB 1O2TA 1XM1A 1HJ9A 1DY8A 1XX9A 1K1IA 2AGIX 2OC7A 1WBGB 2W6JD 1NRPH 2I6QA 1HXFH 1KXAA 5C3NA 2ZCHP 1TE0A 3SGAE 1BZXE 1DWDH 2BX4A 2SGDE 3KF2A 4LK4A 5EGMA 4U32A 4NIYA 1D3PB 1A0LA 2J2UA 2XWAA 1ZR0A 2HNTC 4F55A 1Y3YA 1RRKA 4FVDA 1S6FA 3RXAA 3MMGA 1EP5A 3B23B 2WUCA 4FVBA 2FIRH 2UWOA 2QA9E 1RIWB 1AE8H 1OWIA 2EC9H 4TWWA 4YTAA 5A09A 2Z9JA 3F1SB 1BTWA 3PTNA 2OC0A 1F0TA 2A4QA 4RT1A 1C5QA 1WTHD 4GLYA 1QQUA 4NIXA 1O3JA 1TRYA 1TWXB 1AWFH 1GMDG 4UFEH 1SGFA 4DY7B 1CA0C 1O5GH 3VB7A 1NC6A 2OBOA 3T28A 1OX1A 4XD7D 1FY5A 2PWXA 1HV7A 2FM2A 4ABHA 5GWZA 1MH0A 1C5WB 2ZC9H 4RN6A 3ATMA 1CBWC 2OD3B 1EFRD 5C94A 3F6UH 3UR9A 4XBDA 5G4BA 2W5EA 1HLTH 1EP6A 4OS6A 4NG9H 5JBTA 3VGCB 4OS4A 2ZTXA 3Q76A 2F9BH 3V13A 4F49A 1QL9A 3RXCA 2QGRA 5A8ZA 3KYFA 3EA9A 5E0HA 3M36A 4X1PU 4AFZA 3LU9B 1P02A 4MNVA 1QB1A 4O03A 2A1DB 2W3KA 3RXUA 1V2MT 1Z6EA 1QA0A 1K21H 1Q2WA 5HIYA 1DITH 1TGSZ 4JMYA 3UWIA 2AMQA 1COWD 1UTMA 1C1WH 2ZFRH 2GVFA 3UNQA 1S0QA 1K1PA 1ZMNA 2JKHA 3I29A 5C5OA 2OC8A 1E38B 5CHAC 2GCTC 3CP7A 5EQRA 1BOQA 3VG8A 3ATLA 1XKAC 4VGCB 4NSYA 2ZPSA 2ALVA 1OKXA 1DWCH 4X6NA 3ATIA 1GI4A 3NWUA 4INKA 1T7CA 1FAXA 4A92A 3Q77A 1YPGH 4IMZA 2PR3A 1BRAA 3ELAH 5GIBA 2TBSA 4LOYH 1MU8B 3FANA 4D76A 4ABBA 1ELGA 1P57B 4HG6A 1GJCB 1ZGIA 2ALPA 4Y11E 1O5AB 3A7TA 4E7RG 5C2ZA 1FI8A 1TBZH 4CH2B 1V2KT 4ISNA 1O35A 5C5NA 1P10A 1MKXK 1O3BA 3TJOA 2ZU2A 1GG6B 3SUFA 4DURA 4FU9A 2LP6A 2GX4A 1GCTC 2QE7D 3EYDA 2QCYA 1PPZA 1GDNA 1BQYA 2VWMA 4FU8A 2CXVA 3UPEA 4K3JA 1XUJA 1ABJH 4ZKOU 1UK4A 2CV3A 6GCHG 1Y5AT 1OWHA 4XE4A 5T1VA 2D8WA 3GOVB 1B0FA 1O2YA 1PFXC 3E0PB 3MH4A 2FYRA 5AVDA 2KCPA 5HIZA 3LPRA 4XRNA 1MKWH 1P2IA 4TPIZ 1KLTA 5DP3A 4MNWA 3RXDA 4ZROA 1H4WA 3A83A 2WZQA 1CHGA 1O2NA 1C4Y2 3M7UA 1QHRB 2ZFFH 1YGCH 1L1NA 1YM0A 1SGTA 1XVMA 2FOHA 4MPVA 1TABE 5LH8A 3UY9A 3IWMA 2GZ8A 1ARBA 1HJAB 2SFAA 2ZFSA 5GCHG 2BD9A 1SMFE 4K1EA 3S7KB 2VB0A 4D8NA 3JZ2B 4NFFA 4JZ1A 1FLEE 1SKYE 2HLDD 2C93B 4WMFA 1YPHE 2BHGA 2NU1E 5F8XA 5KGOA 4O97A 4MG3A 1WCZA 2GT7A 4SGBE 1EZXC 4X6PA 1C2IA 1DLKB 1HBTH 4AZ2B 2FI4E 1DDJA 3QDZB 4X1RU 2PGQB 1A3BH 1ETTH 1BIOA 1SGEE 2ZPQA 4NIWA 3LH1A 1C1SA 5FXLA 1NBME 1HAYB 2XOKD 3U8OH 4ZKSU 5DP6A 5AHGH 2BZAA 2KCOA 2ZU3A 4D9QA 2C8ZB 4FXGH 1GHAG 4YZUA 2FOBA 1ELDE 3ESTA 3MQKC 2FODA 3A7YA 5EXNA 1NESE 1RIWC 5GCHF 1GBKA 3M5OA 3BIUH 3P70B 1S83A 1SGQE 2BDIA 1W11U 1Y3WA 2FI3E 4H6TA 1SGYE 5EG4A 5SGAE 2RDEA 2ZQ2A 3HKIB 2ZA5A 1V3XA 1EOLA 1WYKA 3SU0A 1LQEA 1RXPA 1YCPK 5DN6D 4CRAA 1MAYA 2FEQH 4O3TA 1RTKA 1TQ7B 2JH6D 1KXFA 2GTBA 6CHAB 1C5NH 1VJAU 1ELVA 5LPEA 1O3NA 5F53A 2WSSD 5IYTA 2BQ7B 3KEEA 4Y8ZA 4AOQA 2O9QA 1WUNH 2A32A 2R2WU 3UOPA 2ZDVH 2BM2A 3AW0A 2OCVB 4ASUD 3SQEE 1O3CA 1GMHG 2HVXA 1GCDA 3W95A 3MNXA 3LKWA 4IC6A 3A8CA 5EW1H 1GHAF 1F5LA 4BAKB 1W7GH 1TNJA 4ZH8A 3EQ0H 3U69H 2ZGBH 1YBWA 2IJD1 3U8RH 1W2KH 2H5DA 1TA6A 5JDUB 3B9FH 4D7GA 4E7NA 3VXEH 4CHAC 1GBFA 1ZMLA 5H4IB 4K1SA 4IW4E 2AGGX 2Q6GA 3NPSA 4LXBH 2ZHWH 1NZQH 4X0WU 4MVNA 4VGCC 5T6GA 1A4WH 1C2GA 5FPSA 2BY9X 1C1PA 2OP9A 4INLA 2GMTB 5J4QA 4Y7BA 1W0YH 1CE5A 1XUHA 2A45B 2FMJA 1K1JA 2KFWA 1E1QD 3MH7A 2AYWA 2BQ6B 1KXEA 3SJ8A 1JRSA 2BD7A 1ELCA 2FP7B 4MDSA 3TLOA 1O3OA 2L74A 2BY6X 1K1OA 1MD8A 5DP8A 3W94A 3CNRA 4TSFD 4DIIH 1Y8TA 3SU5A 4BNRA 1C5PA 3G01A 1ZTJA 3ZZDA 1FUJA 4OGYA 3FP7E 1QJ7B 3ATKA 3F2GA 1MD7A 1AZZA 1O2MA 3ZZ6A 4BTTB 5E0GA 1SG8B 1GG6C 2J94A 1O3IA 3BF6H 1D3TB 4CR9A 1EJNA 2V3MA 1LDTT 3ZZ7A 1GJ8B 5JB9S 1Z1JA 3UB0A 4I8HA 1SQOA 1QJ6B 1MUEB 3LGYA 1Z1IA 2AIQA 4AFUA 1DE7H 3RXLA 1YPJH 1XUFA 1HRTH 2HWLB 2O8LA 1T31A 3A84A 1TA2A 2XCFA 4CRFA 1WQSA 2VIVA 2BVRH 1GI3A 1KIGH 1UTNA 3GY2A 2AHME 2OK5A 1C9TA 2D26C 3FZDA 3GCHB 3LGWA 3VXFH 3RXGA 1ZHRA 2GP9B 3KGPA 1NT1A 3TH3H 4B2BA 3FZZA 1G32B 3PWBA 7LPRA 2STBE 5HM9A 1IQKA 4I8LA 2BMGB 4X6MA 2C90B 2NWNA 3DFJA 3RMNH 3VB3A 2ZU4A 1JOUB 1TBRH 1BJUA 1XUIA 4IGDA 1SLUB 1PQ8A 3RXBA 4B76A 1Z7KA 5F03A 3H7TA 3ZVCA 4X1SU 2I6SA 3SHCH 5L2ZH 1P01A 1EB1H 2F43B 1P9UA 2EEKA 2AGEX 4B6EA 1PPBH 1AE5A 1LO6A 2OLGA 2XYAA 3GDUA 1FPHH 3UIRA 5JPMH 4K8YA 4BAOB 3SV2H 2BX3A 4OS2A 1Y5BT 2GDEH 3A82A 3RU4T 3OY6U 1YLNA 2F9OA 2WPHS 3V12A 1O3KA 4JYTA 3F9HA 2PV9B 2ZTZA 3UQOA 2H2ZA 4AORA 1E36B 1BTXA 1FZZA 1EAUA 1G37A 1SSXA 2Y5FA 1O5CB 2G4TA 5A8XA 3BTWE 3QGNB 1F5KU 2HPQH 1TRNA 4MNYA 1O2JA 2P95A 4ISOA 3DT0H 1ZPZA 1RTLA 9LPRA 4NA7A 2PTCE 3E0NB 5DGJA 1A1RA 3MU4A 3Q3YA 3WWFA 1BBRE 2G81E 4XBBA 1Y3UA 4ABJA 4AB9A 2PFEA 3T29A 1O2VA 1TNLA 1KTTB 2HNTF 1V2ST 1EZQA 2BTCE 1O38A 1SOZA 1IQNA 1T4VH 3BTHE 1A7SA 1V6DA 1BTYA 3EE0B 3SU4A 5A8YA 5CMXH 3KL6A 2O8MA 3QO6A 3E90B 1JRTA 2QXJA 1YPKH 4NFEA 1VCPA 4NWLA 1MTUA 1C9PA 1VITH 1L4DA 1UCYE 4YOGA 6CHAC 1PYTD 5FHTA 5B6LA 2VIOA 2WPDD 1CT2E 3LOXA 3SV9A 2GDDA 3D23A 4RT0A 3E16B 3PV2A 3T26A 1AWHB 3MNSA 5C0TA 2Y7ZA 3DSGA 3MNCA 1LPGB 2ZHQH 3SI4H 1E79D 1BT7A 1IOEA 3MO6A 1LVMA 5JB8S 5C17A 2QF5A 1A0HB 1TAWA 2XC4A 8ESTE 1B5GH 1OYTH 2XWBI 3RM2H 1SHYA 4FUCA 3PO1B 2BD4A 4Q4LA 1DVAH 1EAWA 2ZDNA 2QC2A 1JBUH 1EUFA 1QRXA 4Y7AA 3LGUA 1AGJA 3DD2H 3LJJA 4Z1MD 1UJ1A 1ABIH 1FAKH 4D7FA 3PMAB 1TNHA 3M3SA 1P03A 3TJUA 3OSYA 1DUAA 2BDAA 4R8TB 4AGKA 3IG6B 1V2WT 1W10U 1LHFH 1KSNA 3BTME 1UVUH 2SGQE 3GYMA 2C8WB 1P2QA 2W7SA 4HZHA 2K0QA 3MU1A 4WF8A 1T8OA 1O2IA 4Q7ZA 2GMTC 1VJ9U 1O3HA 1BMMH 3CS7A 1W14U 1OWEA 2FOGA 3DCLA 2PUQH 2ZWLH 2YNAA 3D49H 2FX4A 1QL8A 4TY6A 5GPIB 4YOJA 2BLVA 1K1NA 4X8VH 4X1NU 4ACBA 1S6LA 3BTDE 4ABIA 3N7EA 2J34A 4FUBA 5FAHA 1KYNA 2VJ1A 3BIVH 1O32A 2Q1JA 1HGTH 1IAUA 2ANWA 1T8MA 5E0JA 1GBAA 2Y80A 3RMMH 1OOKB 5GXPA 1O2LA 5C1UA 1Z8IB 3TH4H 2FWWA 4ZXYH 1KMHB 3NKKA 1T8NA 3W1EA 1TGBA 1TIOA 3GCOA 1CQQA 1SQRA 2EI7A 2ZU5A 4ZHLU 4A5TS 1HUTH 2CF9H 1BBRH 7ESTE 3P8OA 1QJ1B 3U28C 2F91A 1CGJE 4M9FA 1GVZA 1RFNA 4XSKU 2BQWB 3RC5A 1NBMD 2JJ2D 2RFKC 4MNXA 1O2OA 3NRLA 1SQAA 1AY6H 1MMJN 4I32A 1WU1A 3RUOA 4HI3A 1O0DH 1ZPCA 3IITA 1PYTC 3FN8A 1LVOA 2BY7X 1UCYH 1MCTA 3GS9A 1O3MA 1GI5A 4AG2A 2ZO3H 2JETC 2TPIZ 5PTPA 2UWLA 2OTVA 3P8NA 1FMGA 1BTHH 1MZAA 1W0JD 1MABB 1SGFG 3A7WA 3I78A 3MH5A 1ANEA 1YP9A 4YLUA 3U98H 4UONA 4Y79A 1O2UA 1UK2A 2ODQA 1THSH 1TGNA 1ZRBA 1NTPA 3BG4B 1SL3A 5FX5A 1AMHA 1E35B 3SU3A 4BTIB 5KEDA 1A2CH 1CU1A 5FX6A 2CGAA 1QA7A 4JYUH 2ZKSA 4JZEH 4KTCA 3LJOA 3QZRA 4K2YA 5EU8A 1U6QA 1XXDA 7KMEH 3KN2A 2VVVA 3Q3KA 2QIQA 2TGDA 2GZ7A 1F7ZA 3M3VA 1N8OC 1S5SA 3UNRA 2P3UB 3NCLA 1QL7A 3LH3A 3SV7A 1PQAA 1AIXH 1FN6A 4X2YA 1OYQA 4ZUHA 3AAVA 3PRDA 3O8BA 1SQTA 4GSOA 1AHTH 1AFQB 4DGJA 1ZMJA 1G3DA 5EJLA 3ENSB 4NZQA 1MTVA 4U01A 1CSOE
chains in the Genus database with same CATH topology
2SNWA 2QF3A 4A7IB 1FPCH 3ZZ3A 1AN1E 2HLCA 1FIWA 2ZI2H 2F9UA 2THFB 5BPEA 3URDA 1P0SH 1C4U2 2FESH 3GY4A 1UVTH 4Q2KA 2P8OB 2WPMS 2ODYB 1W8BH 1YPHC 2QXIA 1S0RA 3L6PA 4YT6H 4GPGA 2FI5E 2H9HA 5JYIA 1C5ZB 1VITG 1N6XA 1NRRH 3P8GA 3RXOA 1O3GA 5FCKA 4I8KA 4AFSA 1KY9A 1TLDA 2TGTA 4FUGA 4TY7A 1RJXB 3SGBE 2Y6TA 1MBQA 1ZOMA 4LZ4B 1GHYH 2BOKA 3A8BA 1ANBA 3ITIA 5E8EH 3VPKA 2QF0A 1BMNH 2FOFA 1NO9H 1T8LA 3A81A 1UTOA 3QWCH 3SU2A 4B74A 3T5FH 1LCYA 2FZZA 1L2EA 2AS9A 3F9EA 2GT8A 2FLRH 1O2SA 1S85A 1XVOA 1AVGH 2J95A 2ZFQH 2RCEA 1SFQB 3PO1C 5C1XA 1DM4B 4GVUA 2XXLA 4AYYB 2BVSH 1WSSH 1ZJKA 3U9AH 1Y3XA 2ZQ1A 4YM9A 3UNSA 5C1YA 1D6WA 3PTBA 3V0XA 4CR5A 1Z71A 4NA9H 1QB6A 1JIMA 2PHBA 2C8YB 1MBMA 1C1OA 1F0RA 4X2XA 1M9UA 3BEUA 1CGHA 2BDYA 3PMHB 4IS5A 3U8TH 3RXKA 1VITF 1AD8H 3UUZA 1ZGVA 4ZXXH 1GJ9B 3PMBB 1FY4A 1P9SA 4HFPB 3O8CA 4K8BA 1F2SE 1HAHH 5B6OA 1GDUA 3GY7A 5HYOA 1JWTA 3RXTA 2VWOA 4JZIA 3V7TA 2Y5HA 1HYLA 2BVXH 1H9HE 1LHEH 8GCHG 3SJ9A 1XXFA 1KDQB 1EAXA 1QB9A 4I31A 2PUXB 2QY0B 4KKDA 1MCVA 3BEFB 4Z0KA 3SJOA 1ZRKA 3LGVA 1K2I1 2ZFTA 3CENA 1C2MA 1HXEH 1A5HA 3KQDA 3TPIZ 2O8UA 1FQ3A 2UWPA 3GISB 4XFQA 3UQVA 2M5TA 2ZFPH 4MPWA 1BRBE 1NFUA 2G5NA 4WMEA 4R0IA 1GI1A 2ZECA 3MWIU 4JCNA 2VVCA 2K1QA 4Y76A 1UTPA 2ZDAH 1B7XB 1LKAA 3ZVFA 3EA8A 1MTNB 1QURH 1UO6A 3RXRA 3KIDU 1IQIA 1BRCE 3LIWA 5A0BA 1GI9B 4A6LA 3MI4A 1KDQA 3GICB 1A5IA 4Y8YA 1C2KA 1PQ5A 3E1XB 1O2WA 1TOMH 1YCPM 2ZIQH 1MKXH 3FFGA 4X2WA 1DS2E 1P05A 2ZHEH 1ZSLA 3K6YA 1P2MA 2ULLA 2TGAA 4YESB 4O3UA 1ZHMA 2BD5A 3OY5U 5J4SA 1NPMA 1ZLRA 1Z8GA 1TGTA 8GCHF 2PSYA 1AUTC 3A7ZA 2XC5A 5DP5A 1IHSH 1H9IE 3VGCC 1SGIB 1CVWH 4IC5A 1LQDB 1NFWA 2GV6A 3HGPA 4I33A 3RMOH 3KCGH 3RC6A 4AB8A 2V3HH 3RLYH 2XBXA 4GHQA 2G00A 3ZV8A 4NA8A 3UREA 1XMNB 2BXUH 2HGTH 9ESTA 1EATA 4NCYA 1SLVB 4OS7A 1IQMA 4ABGA 1C2DA 1BTPA 2QN5T 3NXPA 2VH6A 3TH2H 1LVYA 4O9VA 4ABFA 1GI8B 2ZU1A 1AQ7A 1DY9A 8LPRA 4H4FA 1GHZA 1HIAB 2XBWA 3VB4A 3M35A 1NU9A 4KGAA 5T6FA 2VIWA 1VR1H 1AFQC 1XUGA 1GHBG 1GJ4H 2CN0H 1INCA 3SU6A 2HPPH 3MHWU 1SB1H 1MTWA 2PKSB 1BITA 1DSTA 2R3UA 4INHA 2BY5X 5L30H 1P12E 3A87A 1D3QB 1XKBC 1ID5H 2W3IA 3BEIB 1GHVH 1BHXB 4WH6A 3AW1A 1EKBB 4Q80A 1GBIA 5GJ4B 1C2HA 1ELFA 3RDZA 2ZDKA 4JK5A 2ZGXH 1IQFA 1O5BB 3RXVA 7GCHG 1PQ7A 2BLOA 2OXSA 3VB5A 4PROA 4CRCA 3RP2A 2Z9LA 1ORFA 3RXFA 3SV6A 3MO9A 1HIAA 2UUKB 1K9OE 4B75A 4ZAEA 2J9NA 5LPFA 1W13U 3PLPA 3VEQB 1MAXA 5T6DA 1J16A 5DP4A 3T62A 4ZHAA 2ANMH 3V3MA 4AX9H 3Q3XA 1ZPBA 3ODDA 3ZYDA 1KLIH 3M5NA 1G3CA 1S84A 5EODA 1BDAA 1A0JA 3MH6A 2R0LA 4ZMAH 3E91A 1VCQA 4KELA 1TNKA 1YKTA 3SOSA 1E0FD 1ARCA 2WPJS 1GHBF 1G36A 1IQHA 2HRVA 3QZQA 2VIQA 3DFLA 2WPIS 2G51A 3TNTA 5DK1A 3A89A 1SGDE 2RA0A 1O3LA 5EQSA 3GY6A 1YCPH 3M7QA 1YC0A 1ZZZA 4WVPE 4TYDA 1O31A 1UHBB 2F9PA 1HJAC 3P8FA 3HPTB 4AG1A 3KQBA 4ISHH 7GCHF 1CO7E 2WPKS 1Z8RA 2G4UA 3MYWA 3QTVH 5BRRE 1DT2A 1P2NA 1TX6A 1PPHE 1VZQH 3A80A 3H5CB 2P94A 1SGNE 3PLBA 4HTCH 2BDCA 1DUEA 2Y5GA 2G8TA 1HJ8A 1O2XA 1TMTH 2QAAA 5EPNA 1KXDA 1P11E 1GBBA 2C4FH 3GDSA 4IMQA 1TBQH 2DE8A 1AVWA 1WQVH 4UE7H 3S9AA 1V2TT 2ZPRA 2ZP0H 2EI6A 1YYY1 3HK3B 4X1QU 1O5DH 2D2DA 1ZTLA 1CHOG 5FCRA 3A7XA 3RMLH 3SBKA 1TPOA 1GJ7B 1GJ5H 2AMDA 1GHXH 2O8WA 3VB6A 1C1UH 2XTTB 1GBMA 2PTNA 4K1TA 1P8VC 1UHBA 4UFDH 4A1TA 1YPMH 4SGAE 1A46H 2WINI 3TNSA 1QIXB 1P06A 5E2OA 2GCTB 4M7GA 4WXVA 3BSQA 5ETXA 1FONA 2BLQA 1OP8A 1SGRE 3LGIA 4A1VA 2G52A 1NS3A 3PMJA 2SGAA 1C1NA 1J14A 1YLDA 3UWJH 1OWKA 1MTNC 2FYQA 3GCTG 1TYNA 2ZDMA 2QYIA 2ZGCA 4Y10E 1A61H 1GPZA 1Y3VA 4WY3A 8KME2 3F9FA 2UUJB 5TCCA 3ZZ8A 2A4OA 4DIHH 1J15A 3TK6A 3M7TA 4ISLA 4ABDA 1DWEH 1GVKB 2FS8A 1HPGA 2ZTYA 1K1LA 4E05H 1N6YA 1CHOF 5IDKA 2PSXA 1P2OA 3RU4D 5F8ZA 2Z9IA 1DWBH 1ESAA 2ZGJA 1C1RA 3MO3A 3A8DA 4CH8B 4YLQH 3ZVAA 4DJZB 1WAYB 1O2GH 2JH5D 4B2CA 3KQCA 3QLPH 3TJVA 3SUEA 1IQEA 1GBCA 1ACBE 3FP8E 2NU2E 3GYLB 3MFJA 3AVZA 4OS5A 3QUMP 1T32A 1C5SA 1VGCB 4X8SH 1C5XB 4A1XA 3GCTF 2BD2A 2VWNA 3STIA 3ZZCA 3SW2B 1TB6H 4NWKA 5HGGA 2SGPE 3GY3A 5A2MH 3A85A 2NU3E 2A5IA 3I77A 1MQ5A 2Y82A 3HATH 2ASUB 4CBOA 1EJMA 4ESTE 3P17H 1SGCA 3ZV9A 5CE1A 2P3TB 1O5EH 2LPRA 1JXPA 3GY5A 3PYHA 1QBNA 3T25A 1BA8B 4LZ1H 1L1JA 2WYJA 1LVBA 3P6ZB 1C2LA 1O2PA 3T2NA 3TK9A 5LPRA 1GGDB 1C5OH 1FDPA 3BG8A 4MLFB 1PPCE 4X6OA 2PKSC 3TITA 3ZZ9A 3SQHE 2BZ6H 1C5LH 3D62A 5FPYA 5ABWA 1S81A 2FO9A 4I8JA 3JZ1B 1C1TA 4NZLA 2J4IA 4MTBA 1HAVB 4CRGA 1T4UH 1V2UT 5K7RA 2B8OH 3MNBA 3BV9B 3U1JB 2VIDA 2GZ9A 2V35A 2FLBH 4YT7H 5FBIA 1V2RT 2OUAA 3RXSA 1ZJDA 3GY8A 3OYPA 1QTFA 1UTQA 2LNCA 1H1BA 1OWJA 3M5MA 3QGJA 1K1MA 1AB9B 1GJ6A 1A5GH 5EXMA 1K28D 2B9LA 3EDXB 3QK1A 3QX5H 1UVOA 2QV1A 3UTUH 1FXYA 1AFEH 3RLWH 1HFDA 1H9LB 3O8RA 4Q7XA 5ESBA 1QRZA 1ELTA 1TX7A 1HAGE 1G9IE 3QN7A 1THPB 2C3SA 1MKWK 3OX7U 1A3EH 1HAVA 1Z6JH 3GCHC 1P3CA 2RA3A 2VNTA 1LTOA 4AGJA 1MQ6A 1XUKA 3SNBA 1C5VA 3ZVEA 3ZVGA 4B2AA 3BTFE 1PPFE 3BTKE 1AZ8A 1NROH 2FS9A 1F5RA 1AUJA 3H7OA 1G30B 1GMCG 1S6HA 1V2JT 4BOHA 1PJPA 1C5RA 1TGCA 3NZIA 1JIRA 1O36A 2WV4A 1TMBH 1TALA 2EI8A 1C1QA 2FOEA 3SV8A 1G2MA 1F0UA 1SOTA 5EPYA 2VWLA 1HAPH 3SN8A 3FAOA 1QGFA 4ZKNU 1SC8U 2OC1A 2ANYA 4Q7YA 2BOHB 4DCDA 5C67A 3GDVA 2FXRA 2W7UA 2SNVA 2G55A 1RTFB 1ELBA 1AVXA 1FV9A 2PGBB 3BTQE 3C1KA 2Z3CA 5DKMA 2WUBA 1EOJA 4IBLH 4K60A 4U30A 2VU8E 3UOUA 3LC3A 4CHAB 1NRQH 1V2VT 3PLKA 2HNTE 2IN2A 3R0FA 2P3FH 3QTOH 5JBAS 1SFIA 3U1IB 4WXIA 2H9EH 1SI5H 2Z3DA 5LGOA 1QY6A 3M5LA 2YNBA 1P3EA 5ESTE 2HALA 1LPKB 1GMDF 2F9VA 4ABEA 4BTUB 3FP6E 3ZZAA 1DICA 2QXHA 3K6ZA 1EB2A 3RU4E 1GMCF 1TNIA 2Y7XA 2VGCB 1MTSA 1D6RA 4GCHG 4DT7B 1E34B 2AFQB 2A7CA 3MU8A 2D1JA 3B8JA 1HAXB 1SPJA 1EPTB 4GHTA 5EQQA 1TRMA 5HM2A 1EZUC 2BDHA 2XBVA 3UFAA 3KQEA 4J2YB 4XBCA 5FPTA 3ZZ5A 1P2KA 3TGKE 2XCNA 1SLXB 1ETSH 2FPZA 3MTYA 4BANB 5E2PA 5DPAA 3K65B 1AO5A 1EQ9A 1GDQA 2Y81A 2AH4X 4WMDA 5DO4H 3PM3A 1O2KA 2WV5A 1C5TA 1HAOH 1MU6B 1EASA 2FDAA 4JZFH 5JBBS 3PWCA 1DANH 5L2YH 1NY22 1QQ4A 4K5ZA 1GWAA 3SI3H 2O8TA 1HNEE 2R9PA 1GBEA 4AN7A 1F92A 2CF8H 1TPPA 2CMYA 1EPTA 3TIUA 2H5CA 2A5KA 3RM0H 3SZNA 1BUIA 1ELEE 2FOAA 3K2UA 1HAIH 1NM6A 4FUEA 1V2PT 4FUHA 3RXEA 3AASA 4GCHF 4J1YA 1GI7B 1YF4A 1E37B 1VGCC 2YOLA 1D3DB 2Z6BD 1TPSA 6ESTA 4H42U 4YOIA 1O3DA 1O3PB 2ZZUH 2AMPA 1ZSKA 5F8TA 4CRDA 4B73A 2CJIA 2RG3A 4TWYA 3TU7H 4IN2A 3F9GA 1C1MA 4NSVA 1GGDC 4KTUA 1NRNH 4XOJA 3NUMA 4B1TA 1UK3A 2TGPZ 2UUYA 3RXQA 1O2ZA 1GBHA 5AF9H 2C8XB 2BLWA 3O8DA 1ANCA 2GD4B 3SGQE 5DP7A 1MZDA 1ETRH 2J38A 3K9XB 4U2WA 4FUIA 3KNXA 3MU0A 6GCHF 2HOBA 3VFEA 1GBTA 2A4RA 2A7HA 3S9BA 1HB0B 1V2NT 3S7HB 3SUGA 3SU1A 1AB9C 2V3OH 1VCWA 2GCHG 3SUDA 3M3TA 2A2QH 4JK6A 2AIPA 3ZZ4A 1GL0E 1V2OT 2OQ5A 1V2QT 2QXGA 4HGCA 2KAIB 2ZEBA 3TK5A 3WY8A 3HKJB 3RC4A 4CREA 5L6NH 2CHAB 3BTTE 2ANKH 1QFKH 1KXCA 1N1LA 2BY8X 4YO9A 1EX3A 3M37A 1Y59T 3ODFA 1QR3E 3RXHA 5A0AE 3SORA 2AEIH 2F83A 4FUDA 3L33A 2BXTH 4Y0YE 3S9CA 2WYGA 4FUJA 1EJAA 2V0BA 3HGNA 1HDTH 1JMOH 3S69A 3S0NA 1UVPA 1UMAH 3DHKH 1GJDB 3A86A 1D4PB 1GI2A 3BG4C 1BRUP 3ATWA 2STAE 3F68H 2J92A 1CT4E 1BTUA 2KAIA 2GGVB 5I25A 2ZG0H 5AFZH 1FN8A 1W7XH 5DP9A 1C2JA 3T27A 1SGPE 1GJBB 1Q31A 2GCHF 4OS1A 2A31A 1W3CA 1GBDA 1NRSH 1QRWA 1ZHPA 2A2XH 4WJG2 4MPUA 3SNDA 4ASHA 3HK6B 3N7OA 3OU0A 1J17T 2GV7A 1BTZA 3TVJB 2FX6A 2IOTA 1Q3XA 1G3EA 1TFXA 3P95A 1C2FA 5EW2H 2A5AA 3TGJE 1P09A 2R2MB 1B0EA 1EXFA 1DFPA 2BD3A 3LGTA 4KP0A 1UTJA 5TCAA 4UEHH 3E8LA 1LKBA 1KTSB 1TNGA 4UDWH 2FTMA 4JZDH 3RXMA 3SJKA 2VIPA 4Y6DA 1GJAB 1YPLH 1O5FH 5HXFA 1EZSC 2R3YA 4K69A 1FY1A 1QNJA 1HAZB 2P8OC 1SHHB 1CA8B 3PROA 2VGCC 4BXWA 2FOMB 1NFXA 3SHAH 1GVLA 3GCNA 2G5VA 1SBWA 1NN6A 1DSUA 2BYAX 1W12U 4NIVA 4WWYA 1K22H 5DJ7A 4DW2U 2BD8A 1EPTC 1H8DH 3LC5A 1GMHF 2UUFB 3D65E 5DG6A 3SNAA 2Q6FA 2DUCA 1D9IA 4UFFH 3ZYEA 1IQJA 2PKAB 3LT3A 4BAMB 5T3HA 1O3AA 4Y0ZE 1AU8A 1LHCH 5HMAA 1Y5UT 1V2LT 4Y71A 1C5UA 4RSPA 1C2EA 5EOKA 1C4V2 1P2JA 1QCPA 4KTSA 1BMAA 3KHVA 2JH0D 1NU7B 3MOCA 1TQ0B 3R3GB 3PV4A 1BCUH 2ZNKH 1UTKA 1ZYOA 3BTEE 2IPHA 1ZTKA 3AAUA 2EA3A 1O2QA 2XC0A 4AYVB 4F4OC 1DX5M 1OS8A 1L4ZA 1FY8E 2BDGA 1RGQA