3PM3A

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
molecule tags Hydrolase/hydrolase inhibitor
source organism Bos taurus
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pm3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pm3A02
2R9PA 2FOGA 3BTTE 2BZ6H 2ZDKA 5DP4A 4CRFA 1OWIA 2ZO3H 2J2UA 3BTFE 2QV1A 2ZQ2A 4AGJA 2HVXA 1BTYA 1NT1A 2AS9A 3ODFA 1AWFH 1W11U 1NRQH 1O2SA 5E8EH 3SU1A 1GI3A 1O3NA 3UTUH 3QK1A 1D4PB 3LT3A 1BMNH 2WINI 2HOBA 3NWUA 3A87A 1QQ4A 2F9NA 1S83A 1C2HA 5L30H 2QC2A 5A8YA 1AQ7A 2GTBA 3GDVA 4IC5A 3KGPA 4CRDA 5AVDA 2STBE 3MNSA 1GDQA 1LVOA 1UTPA 3L6PA 2Y81A 3KQBA 1DY9A 5C1YA 3ZVAA 1KDQB 1UK3A 3ATLA 3TPIZ 1BMMH 1Q3XA 2BVXH 3RMMH 5CHAC 1QGFA 4LXBH 5HGGA 1BRCE 1A3BH 1A0HB 1O38A 1TBZH 1ANCA 2BQ6B 2BLWA 1ETRH 5L2ZH 5JYIA 1AFEH 4HFPB 4THNH 3PO1B 2I6SA 2Y7ZA 2ZDVH 4X6OA 2WV4A 2ZHWH 4WWYA 4Y11E 3RXLA 1YCPH 3AAVA 1FN6A 1LHFH 1F92A 3QZRA 4ZKOU 1OOKB 1TX6A 1ZPBA 3B8JA 1DITH 1HLTH 3LGIA 4D9RA 2ASUB 2Z6BD 1DWBH 1C2FA 2G5VA 3JZ2B 2JKHA 3L33A 1Y3WA 4ABGA 5A0BA 2ZF0H 1XVOA 4HGCA 3RMNH 4A1TA 3BN9A 1O2PA 4IMZA 2GV7A 4U01A 4BTUB 3P95A 3SV9A 2WPMS 2ODQA 3A7WA 3EDXB 5GPIB 1A1RA 1SGYE 1TAWA 1ZTLA 2JETB 1YPHE 1K21H 2VVVA 1UTQA 3MH5A 4WVPE 1GHZA 1DXWA 3GY8A 1OKXA 2BOHB 5E0GA 4Q80A 1VCPA 2ULLA 4B2CA 4FVDA 1T4VH 3LGYA 1FUJA 2VIWA 3RC6A 2V3HH 4CBOA 2BB4A 3M35A 4VGCC 1YCPM 1XKBC 3A89A 1P2KA 4AB9A 1O5CB 1OYTH 3S9CA 1EPTB 1AVXA 1O2YA 4B74A 1EASA 1ELDE 1GJ5H 2W3KA 2BOKA 3UIRA 1VITG 2ZDLA 3UOPA 2JETC 2WPHS 2DUCA 1BIOA 1P10A 4HI3A 4OGYA 4XBDA 1KLTA 1O2WA 1PQ7A 2PFEA 3EAJA 1O36A 4JYUH 2K1QA 3ZZ3A 2C90B 2BMGB 1FONA 1WQVH 6CHAC 3MI4A 3SU0A 2PTNA 1GI9B 4X8TH 4U30A 3SHCH 1AN1E 1C1WH 3SGQE 1Y5BT 1ZSJA 3I29A 1NFUA 2VWNA 2A0QB 1UTLM 1SQOA 1F5KU 1JOUB 2V3OH 3ZZDA 3ITIA 1FJSA 1ELBA 1FPHH 1UO6A 3OY6U 2VB0A 5DJ7A 4ZAEA 5GCHF 4XDEA 3ZVCA 3LDXH 4ISHH 1GMCF 4HTCH 4A1VA 2Y7XA 3ZZ6A 2P95A 1P3EA 1D3QB 1PPZA 4K1TA 1EB1H 1WSSH 2ZG0H 1XUGA 4NIWA 1LHEH 4Q7YA 2TGAA 1P03A 4X8VH 1GHXH 1NU9A 2G4TA 1F5RA 1DXPA 4ZROA 4BAMB 1MD7A 4YOJA 1OP0A 1AB9B 1V2WT 3AW0A 1HJ8A 1V2TT 1AD8H 3A7TA 3M7UA 4MPUA 2G4UA 4X8UH 5AFYH 5HMAA 2J92A 4NFEA 1B0FA 1MH0A 2GCHF 1C1NA 1O2XA 1O2OA 1SOTA 1NC6A 2BX4A 1HRTH 3M7TA 5K0HA 4CHAC 1PFXC 3SNDA 4GVUA 3U1JB 3HKIB 1PPEE 3MO9A 4IMQA 1HYLA 2STAE 1XXDA 3FFGA 3TIUA 2FI5E 1QRZA 1O3AA 4DW2U 2VIQA 3RXCA 1HCGA 1CT4E 3OU0A 2FX4A 4FUGA 4PROA 1QB6A 4ZHMU 1TYNA 2OCVB 1MMJN 2BDYA 1V2NT 4ASHA 1ELTA 1K1JA 2F9VA 4XSKU 3ZYEA 4TWYA 1SGCA 5HXFA 3PTNA 2IN2A 2ZTYA 5A8XA 3NXPA 2PHBA 4UE7H 4O9VA 1TX8A 1EJAA 5LH8A 4AX9H 5EXNA 1SB1H 1J17T 1SGRE 5GIBA 1HAPH 4BAOB 1QHRB 1SGIB 5HM9A 5F8XA 1AO5A 3P8GA 3EE0B 2GD4B 1HJ9A 1S0QA 2PTCE 4Z6AH 1GBEA 4X1RU 1CGIE 3AASA 1QA7A 5DP9A 1KIGH 1BBRE 6GCHF 4DOQA 2R2WU 4GLYA 3T62A 3A8CA 4OS5A 1BJVA 2P16A 2VIPA 5EPNA 1A5HA 1HFDA 1NRNH 3TK9A 3SGAE 3EA7A 2FOAA 3BIUH 3ZZCA 1GVZA 1QL7A 1DANH 5EPYA 1AFQC 3CP7A 1YKTA 2BY7X 1O2QA 3QDZB 1ZMLA 4D9QA 4ZXYH 1O3LA 1QB9A 1DE7H 3BG8A 1BTUA 1IHSH 1IHTH 1H8IH 1P2MA 2H1UA 1HPGA 4FUDA 1W7XH 1UTOA 1GHAF 2FOBA 1V2JT 4K8BA 1C1QA 3UNRA 1T8MA 1SFQB 1CT0E 2SGPE 4OS7A 1RD3B 1SI5H 2ANYA 3R3GB 2BM2A 3A8AA 1O3IA 1EUFA 3R0FA 1C2EA 1YPEH 3RLWH 1G2MA 1GBHA 2ZHDA 2ZU5A 4MNVA 1G3EA 5ABWA 1RXPA 1UCYK 1WU1A 4WMDA 5CHAB 1C1VH 2D1JA 3FVFB 1CE5A 4NA9H 3V0XA 2Q6DA 2SGQE 3UFAA 4X8SH 1C5XB 2FPZA 2GCTB 1SHYA 3F68H 1EXFA 4A92A 2G52A 3RDZA 2ZI2H 3HK6B 1QL8A 4WMEA 4XE4A 1LQDB 1MQ5A 4AOQA 3UQOA 3TK6A 1P57B 2GP9B 1QTFA 4AGKA 1TPPA 1B5GH 4Z0KA 3WY8A 4TPYA 3A7XA 3V13A 3A80A 3Q3KA 1C2MA 1CT2E 1W8BH 3U9AH 3UQVA 3SO3A 2XBWA 1BB0B 1Z1JA 4NWKA 5JB9S 2FS9A 1BRBE 2GKVE 2WPKS 2EI7A 3VB7A 1XUHA 3CENA 4X2WA 3UR9A 1C5VA 2AMDA 1V2ST 2F9UA 3NCLA 3MO6A 1MCTA 1KLIH 1KXFA 2GV6A 2ZU1A 2KAIA 5EGMA 1G3BA 2O8MA 3SUDA 2VWLA 4NZLA 2G55A 1JRSA 1ESAA 3FP7E 1VJAU 8GCHG 4AFQA 2ZPQA 1RS0A 1O3GA 4E7NA 3M61U 1MAYA 1QBOA 1AVGH 2KAIB 2TIOA 3BTEE 3S7KB 1BBRH 2SGAA 1ELAA 3SJ8A 4R8TB 4JZDH 2OP9A 3PMBB 3P92A 2P3TB 2VVUA 1UTKA 2OD3B 2ZU4A 2FX6A 4A5TS 4F49A 3S9BA 4TYDA 1BDAA 2ZKSA 4ABEA 1KXBA 3M7QA 1IQLA 3HK3B 4FXGH 1MKWH 1GI4A 2ZFSA 1ZPCA 2ZGHA 2BY6X 3Q00A 2J95A 3TNTA 5C3NA 1HAIH 3GDUA 2HPPH 3SQHE 3U1IB 2BD5A 1ZMNA 2ANMH 2C8XB 2YNAA 3QGNB 4Y6DA 2G5NA 1VITH 2OXSA 3PTBA 3Q3YA 3OTJE 3STJA 5ESBA 3RXDA 2AEIH 2EI6A 2PKAA 3RXHA 4B76A 3A7VA 1NPMA 1O3CA 1ZSKA 4ZHAA 3GOVB 4AORA 4MVNA 2VH0A 2WPLS 2H6MA 3RXTA 2F3CE 1C5PA 1G30B 4RKOB 2VIVA 4BAKB 2UUJB 3HGPA 2H9TH 4AYYB 3UNQA 1GI2A 4B71A 1YCPK 3UY9A 2XTTB 1SLVB 1NRPH 7ESTE 3LOXA 1QFKH 3W94A 2A45B 3BG4C 4X0WU 1NS3A 4WXIA 1O3KA 2WPJS 2Q6GA 1EKBB 1IQEA 1TABE 3E3TA 1YGCH 2EI8A 5FPSA 1LPGB 2AGEX 1GG6C 3GICB 1ZJDA 5EQSA 1QL9A 2FIRH 1ELFA 1T8NA 2R3UA 1TQ7B 3UWJH 1DVAH 2UWLA 3U8TH 3BEIB 1ID5H 3TH4H 2FTLE 3GCOA 3DUXH 1TB6H 1EAIA 2HLCA 3U69H 4FUIA 1V2KT 2C8YB 4OS4A 1SGFG 1ZYOA 2FXRA 1O0DH 4MPVA 1HAXB 1GBLA 8GCHF 1ZHRA 3ZVGA 4FUHA 1GJAB 3E90B 2ALVA 1TRNA 1KTSB 2CF8H 1BITA 2R2MB 3GCTF 1ABIH 1TGCA 1A5GH 3RU4T 1C1UH 2A2XH 3T27A 1YPLH 5FPTA 5SGAE 4MNYA 2C8WB 4VGCB 1GJ9B 1PPCE 4K5ZA 5DP3A 1G36A 3SUFA 1FIWA 1P8VC 3SU5A 1P12E 3RXBA 2ZGXH 1T32A 3A7ZA 1P0SH 1O5DH 1KTTB 3T25A 1V2VT 4GUXA 4O3TA 3MU4A 1YYY1 4I8LA 4WH6A 1SLUB 9LPRA 1GHBG 2OC1A 5TCCA 2ZQ1A 1TA6A 1BTZA 1MQ6A 1W12U 1WAYB 2FP7B 3M3VA 2Y5HA 2GCHG 2SNVA 2D26C 1GBMA 3T26A 2A5IA 1VGCC 2V6NA 3T28A 1D3DB 5CE1A 1K9OE 3SU3A 3A8DA 1YLDA 2ZGJA 1SBWA 4FUCA 2OC7A 1N6YA 3LPRA 2P59A 4GPGA 1XM1A 2VIDA 1FNIA 2Z9GA 4SGAE 4UFEH 2W7UA 3ENSB 1Y5UT 3QLPH 3TGJE 1N8OC 3BSQA 4ABDA 2W26A 2GCTC 1S6HA 3Q76A 1GHBF 1BT7A 2VIOA 3QTOH 1AIXH 3OY5U 3RXEA 1ACBE 1AFQB 4FUJA 3D23A 1OP2A 5L6NH 5EXLA 2BD9A 1HV7A 1BHXF 1YM0A 2BQ7B 3ZVFA 2A32A 1Z8GA 4YESB 1P02A 2OQUA 3RP2A 1O34A 1GBBA 2PLXA 5A09A 1GJCB 5GJ4B 3LC5A 1G3CA 1W0ZU 2DE9A 4RN6A 2W7SA 1SQTA 1ZOMA 3RMLH 1VZQH 1DDJA 1TNLA 2AMPA 2Y80A 3CS0A 4NZQA 3RC5A 3T2NA 1GI6A 3P70B 1AUTC 3OSYA 3P8FA 3UPEA 2AIQA 1AMHA 1AGJA 1V2OT 1TRYA 1TE0A 1GI0A 2UUKB 1Y3YA 2AH4X 2J94A 2ZEBA 2WYGA 5EXMA 1O3JA 3LKWA 1SLWB 1PYTC 1VGCB 3B9FH 1SC8U 1RTLA 3KNXA 2AFQB 1BOQA 3KF2A 4X2XA 1C2KA 2GMTB 1E35B 2BLVA 1BRUP 1S82A 1DS2E 3RLYH 1ZHMA 4FUBA 2ZZUH 4Q7ZA 3VGCB 3MNXA 4AN7A 2OBOA 1Y3VA 4YM9A 2VU8E 1KXDA 1C5LH 2B0FA 3GY2A 3LIWA 1NO9H 4DGJA 3RXPA 5IDKA 2HNTC 1GHAG 3SGBE 2FOCA 1C5UA 1O2TA 8ESTE 2AYWA 5EQQA 2HRVA 2BDHA 1T7CA 2NU3E 2I6QA 4CRAA 4MG3A 4WJG2 4MNXA 4DG4A 1EJNA 1HAVA 2F83A 2GT7A 1QB1A 1RTKA 2ZHFH 1FAKH 5JBTA 2CMYA 1Y3XA 1UTMA 1AVWA 3LH3A 5FCKA 4XOJA 3K2UA 1O35A 3F9EA 3VGCC 1F0RA 1GMCG 1Z6JH 4JYVH 1C5NH 4DJZB 1SR5C 4WY3A 1H9LB 3S7HB 3C27B 1MZAA 4INKA 5LPRA 1PPHE 1WUNH 1EZSC 1EZXC 1SSXA 1OWJA 4DIIH 3GCNA 4KKDA 4WH8A 5H4IB 1GBKA 1BMLA 4YLQH 1L1GA 2ZCHP 1EB2A 4FU7A 5G4BA 1QURH 1BA8B 2GGVB 2A5AA 4I8HA 5C1UA 1VR1H 1C5QA 1EATA 2TGPZ 4B1TA 4AFZA 4JZEH 1CA8B 1NTPA 1P9SA 2XBXA 1RJXB 5DP6A 1LDTT 1O32A 4X6MA 2QA9E 4D76A 1P2QA 3GDSA 1ZLRA 1CBWB 4NSYA 3GYLB 1ELCA 3ZZ9A 1TGSZ 1LVYA 1QIXB 1ANEA 1CQQA 1FV9A 3BEFB 1BCUH 1GI1A 1LKBA 4IS5A 2VH6A 1ANDA 1HBTH 2R3YA 1C1PA 2G51A 1UVTH 1NFWA 3SU2A 2NU1E 2G81E 1V2UT 1A46H 1Z8RA 1P11E 1XMNB 3QTVH 3ATKA 4Y7BA 1GBJA 2VNTA 3VB6A 2QXGA 4FUEA 5IYTA 2OTVA 4INLA 2THFB 3QO6A 4OS2A 5A0CA 1SFIA 1FI8A 1THPB 1WV7H 1OWDA 4E06H 3W95A 5L2YH 2BY9X 1Z1IA 3KIDU 1O3BA 2ZDMA 2AGIX 1QY6A 4LK4A 2P8OB 1PPFE 3M3TA 5HYOA 4RSPA 1GHVH 1ZTKA 1O3MA 2Q6FA 1D3PB 2XBYA 2OBQA 3P8OA 4OS6A 4UFDH 2HNTF 2RCEA 1XX9A 1W2KH 2BXTH 1PYTD 1O31A 3MFJA 4D8NA 1O2HA 1UK2A 3ODDA 4Y10E 4AG2A 2OQ5A 1FY5A 1P05A 2QCYA 3PMAB 7GCHG 3Q3XA 4CBNA 1QJ1B 2TRMA 3DT0H 1CBWC 1SHHB 4M7GA 3MO3A 3A84A 2XYAA 1TALA 2BD2A 2BXUH 3IWMA 1ZRBA 1NZQH 3GY5A 1O39A 3SV6A 1AUJA 2BHGA 3GY4A 3GISB 1ZZZA 1TGBA 2ZFTA 3EA9A 3T29A 3PLKA 2O8LA 4CR5A 1O3EA 2FO9A 3MNBA 4XBCA 5JBCS 1A5IA 2WUCA 3TGKE 1UVSH 4I33A 1Z7KA 3ZZ7A 1OSSA 1GI5A 2A4GA 2IPHA 1HUTH 3SHAH 2AIPA 2C4FH 2J38A 4JMYA 2HWLB 1RTFB 1D9IA 1GHWH 2H9EH 2ODYB 1OPHB 2J34A 1BBRK 1NFXA 3TH2H 2BX3A 2ZFQH 1UMAH 2H2ZA 2FOMB 3BEUA 1JBUH 3AAUA 5BPEA 2PKSC 3V12A 4BANB 4ISLA 4K8YA 2BY5X 2V35A 2WUBA 1NU7B 1EP5A 2PKAB 1QBNA 3BTQE 3H7OA 2XBVA 3K9XB 2XWAA 1ZMJA 4YO9A 4UEHH 2VJ1A 2P93A 4Y8YA 1OX1A 1ARCA 5AFZH 2OINA 1THSH 3FP8E 1B7XB 3ATMA 2FOFA 2CN0H 3E1XB 1GJ8B 1F5LA 5EW2H 1IQNA 1JIRA 1J14A 2FESH 1UVPA 4B2AA 5F8ZA 3GY7A 3A8BA 4ZH8A 1GWAA 2BDIA 5EODA 1IQKA 3M5NA 5GWZA 4LZ4B 2ANWA 5FAHA 4NFFA 1O3HA 4NCYA 1B0EA 4IW4E 2P8OC 3AW1A 2SGDE 2M5TA 2QXJA 3PLBA 3FZZA 2ILNA 1O2ZA 2RG3A 2FI3E 2J4IA 3RXVA 1LPKB 3MU1A 5FPYA 4BXSA 3SU4A 1SGDE 1O2MA 2OUAA 1TMUH 2WYJA 3SNBA 3SOSA 1FY4A 1TNGA 2O9QA 1GGDC 4K60A 1OWHA 2Q1JA 4TY7A 4FU9A 1LHCH 1KDQA 1RIWB 2FTMA 3TGIE 1TOCB 1TWXB 1C4V2 5DGJA 3A7YA 4AFSA 1E36B 4GHTA 1AHTH 1MTNB 1C1RA 2Y82A 1H9HE 4GCHG 2FWWA 1V2QT 2LPRA 2PGQB 1O2KA 5DKMA 5T6GA 3D65E 1Z71A 3TJNA 3ZYDA 3KQCA 3MH6A 4MTBA 4WXVA 4YOGA 2F9OA 1E37B 2QXIA 1CSOE 2QGRA 2UUFB 1C5YB 3URDA 1C5OH 1T8LA 2BDGA 4Y79A 4ISOA 3EGKH 1SGEE 4ESTE 1BUIA 1GDNA 4FVBA 4BOHA 1XUKA 1PJPA 4U32A 3NZIA 5B6OA 3PB1E 3Q77A 3NKKA 2GT8A 1GHYH 4NIYA 2FYQA 5F03A 1LHDH 5JDUB 1AU8A 3QN7A 5AHGH 3E8LA 3SNAA 3RXMA 1CHOG 3F6UH 3BG4B 4Y71A 2QXHA 1GBCA 1GI7B 3E91A 1HAVB 2D8WA 2CHAC 1DWCH 1MBQA 3A83A 1O5GH 1DLKB 4Y0ZE 2W5EA 4ABIA 1Y59T 1KYNA 1QRWA 3V3MA 1E0FD 1ZSLA 4I32A 1IOEA 2WV5A 4BAHB 1AKSB 1AY6H 1CGHA 3BTGE 2ZFFH 2A5KA 4NIXA 3OX7U 1WBGB 1LKAA 1OWEA 1P01A 3SBKA 1BQYA 1ZGVA 2Z7FE 3A85A 4ZUHA 5BRRE 1XKAC 3PWCA 4HZHA 1DY8A 1KXAA 1A4WH 2O8TA 4UFGH 4DCDA 2ZCKP 1P9UA 2ALPA 3PMJA 2Y5FA 3SJOA 1JXPA 4GAWA 3HATH 3TJVA 2FLBH 2SNWA 2QN5T 3BTKE 5HM2A 3FZDA 1YF4A 2F9PA 1P04A 2QF3A 1IQMA 3BTME 4X2YA 5C5OA 1TLDA 1IQIA 4QT8C 5DP5A 1KLJH 4IN2A 3VB3A 1TRMA 3MH7A 2BDAA 2ZTXA 1GBTA 2D2DA 4Y8ZA 1IQGA 1SLXB 2SGEE 4NGAH 3ZZ5A 4OGXA 4X1PU 1K22H 2P94A 1DOJA 2GX4A 3RU4D 1PQAA 3GCTG 3UREA 1K1LA 3F9GA 3F1SB 2XCFA 1P06A 2H9HA 3SU6A 5FXLA 1YLCA 3L3TA 1F7ZA 1BMAA 1MKWK 1SG8B 1FN8A 2C3SA 1QJ7B 3RXQA 3LJJA 3VPKA 4YT6H 1TPSA 1P09A 4ZKNU 4OS1A 2GMTC 3GY6A 4A7IB 3D49H 6ESTA 2FDAA 2HPQH 4Y76A 5C1XA 5EOKA 1J16A 1YP9A 2SFAA 2Z9LA 4ABFA 2BLQA 2F91A 1V2MT 1YPJH 2XRCA 2H5CA 5EG4A 3MH4A 2Z94A 4J1YA 1NRSH 1W3CA 2FODA 1QJ6B 4JZIA 3MOCA 1BTWA 4AG1A 6LPRA 4DIHH 5LGOA 1EP6A 3H5CB 3N7OA 5FBEA 2JH6D 1FMGA 5F8TA 2ZNKH 3IITA 1Y5AT 3M37A 3GYMA 5E0JA 1UJ1A 2ZDAH 2A2QH 1O5BB 1DSUA 1E34B 1H9IE 3IG6B 4E05H 1C1TA 1SOZA 1HJAC 2ZHEH 3MTYA 4INHA 1JRTA 2QYIA 2VWOA 3QUMP 3ZZ4A 4BAQB 1ELGA 1K1NA 3BV9B 2VWMA 4NG9H 3GCHC 5A8ZA 1MKXK 1OWKA 9ESTA 1GBFA 1C9TA 1TNHA 2TBSA 3ZZAA 5TJXA 3ATWA 1AKSA 4Y0YE 5J4SA 3OYPA 2A4QA 3MU8A 3TJUA 1O2GH 2C8ZB 1LCYA 4XBBA 3HKJB 3SI3H 1MTSA 1UTJA 1Q2WA 3FP6E 2LNCA 3K65B 1T8OA 4NA8A 3NK8A 8LPRA 3RXAA 5FHTA 3BTWE 1HAZB 1Z8JB 1X7AC 4I7YH 5AF9H 2FYRA 4KTUA 1BTHH 1HIAA 1G32B 1H1BA 3ZV8A 1SGFA 4TY6A 1DUAA 3SQEE 4H42U 1EZQA 1HGTH 3F9FA 3LJOA 4H6SB 4B75A 4CRCA 1QNJA 1LPZB 3SN8A 1UCYE 1MTVA 1S6FA 2UUYA 4NWLA 4I31A 3TNSA 1DUEA 5FX6A 1S81A 1VCQA 1K2I1 1NY22 1TMTH 1A2CH 3KN2A 3PV4A 1MU6B 1WQSA 4K69A 5C67A 5LPEA 1E38B 3SV2H 5F6MA 1FY8E 2CXVA 2XCNA 1TOMH 3ZV9A 1O30A 1TNKA 2BD3A 2O8WA 1G37A 1KSNA 1LTOA 2ZHQH 4IN1A 3EQ0H 1QA0A 1K1MA 5A0AE 4J2YB 4X6NA 1AE5A 5JBAS 1MZDA 1AZZA 1DLEA 1D3TB 1PPGE 5FBIA 1D6RA 1P2OA 1AE8H 3TK5A 4ISIH 2XXLA 1UVUH 1GGDB 3QX5H 1ZTJA 4MDSA 3URCA 4IC6A 1DPOA 4LOYH 1S84A 1FY1A 1BJUA 3FANA 3TITA 1C2GA 3ZZ8A 3KQEA 3RUOA 2Z3DA 2OC0A 2AMQA 4ZXXH 3MNCA 4CREA 1XUFA 1GJBB 2A4RA 2FS8A 1ELVA 1P2IA 3LC3A 1KXCA 1YC0A 3K6YA 1GCTB 2HALA 4YTAA 8KME2 3O8BA 1F0TA 3QWCH 4ZHLU 1MAXA 2A7CA 3M36A 4IGDA 2G8TA 1EJMA 4Q7XA 4WMFA 1YBWA 1GDUA 1Y3UA 3LGUA 4ABAA 2RA0A 5TCAA 2V0BA 1Z8IB 3RMOH 3SNEA 4K3JA 2ZCLP 4Q2KA 2CF9H 2BVRH 3A86A 1SQAA 1RFNA 3ESTA 2GZ9A 1LVMA 2CV3A 3PWBA 2SGFE 4FUFA 3KQDA 4FU8A 3UR6A 5K7RA 2Z9IA 3PO1C 4X1NU 1CHGA 3GCHB 1V2RT 3BTDE 1YPMH 1HAGE 2ZFPH 1TMBH 1MU8B 3VB4A 3DA9B 1GJ7B 3LONA 1CA0B 2BD8A 4O03A 2QIQA 3P17H 1H8DH 1HAOH 2ESTE 4CHAB 1W0YH 2ZP0H 4YLUA 1UHBA 1O2NA 1INCA 1C2JA 1GJ6A 3NPSA 1V6DA 1O2LA 1THRH 1TGNA 1LO6A 3E0NB 2QY0B 3UWIA 4NSVA 2BTCE 2FI4E 2UWOA 2XW9A 1UHBB 3DHKH 5E0HA 1HAHH 2BD7A 2O8UA 2PKSB 1TBRH 5GXPA 4GCHF 3VFEA 3DFLA 1L1JA 2NU4E 1ETSH 3LGTA 1EZUC 3SV7A 4D7FA 2GZ7A 4TPIZ 5DPAA 1S5SA 1P2JA 1QQUA 2NU2E 1UTNA 4IBLH 5GDSH 1S0RA 2Z3CA 1DSTA 3A82A 3SI4H 1C1SA 2NU0E 3B23B 1S85A 1P3CA 1TFXA 3SV8A 4ZKRU 1O2JA 1Y8TA 2Z3EA 1GJDB 2BZAA 2VVCA 5DG6A 3E16B 7GCHF 2ZPRA 1YPGH 1LVBA 1VITF 2TGDA 2ZPSA 2B5TB 1O3FA 1GMDF 1DWEH 1EPTA 2IOTA 1NROH 4MPXA 1V3XA 1TNIA 2BY8X 1T31A 3TJOA 1JWTA 3LU9B 3P8NA 1UVOA 2FOEA 1CHOF 2C93B 3O8CA 4NIVA 1O5AB 2ZECA 1SGNE 1IQHA 2A1DB 4CH2B 1C1OA 2A7HA 4R0IA 1C4U2 2XC0A 1HDTH 1ZHPA 3FAOA 4A1XA 3PROA 2ZIQH 1U6QA 1CGJE 1M9UA 1WTGH 2ODPA 2ANKH 2ZDNA 1GI8B 1KXEA 5I46H 1FZZA 4B2BA 3SNCA 1P2NA 2YOLA 4AB8A 1YPKH 4GHQA 2YNBA 4YOIA 3PLPA 1JMOH 2QAAA 4K1SA 1O3PB 2TGTA 4WF8A 3SJIA 1OXGA 1C2DA 4JCNA 2ZFRH 1D6WA 2BYAX 2XWBI 2VGCB 3MU5A 1LMWB 4MPWA 4Y7AA 1NFYA 3O8RA 2BDCA 3MU0A 1QCPA 4JK5A 1C5WB 2HGTH 1WCZA 1GBIA 2BVSH 3KCGH 1N6XA 3QZQA 1GJ4H 1ESTA 3LH1A 4ABJA 5EQRA 4A6LA 1ZPZA 5FX5A 4ZKSU 5EW1H 4KTCA 3ZVDA 1ZGIA 1O37A 1GMHG 5DP7A 1J15A 1SGQE 3KL6A 3AVZA 1EOLA 3RM0H 1FPCH 2R0KA 1DWDH 1O2IA 1NRRH 2RA3A 1NM6A 3BF6H 1FQ3A 1Q31A 1C1MA 1EX3A 5DP8A 2EC9H 2PR3A 1DM4B 1FLEE 1SMFE 4XFQA 2QF0A 3F9HA 1V2PT 3S69A 1SGTA 3E0PB 1C5SA 3M3SA 5JPMH 1J9CH 1L4ZA 3M5LA 1TGTA 1RGQA 1F0SA 1MTNC 1MTWA 2A31A 1MD8A 4U2WA 2CGAA 3HPTB 1UK4A 1O2VA 2EA3A 3TU7H 3UUZA 4BTIB 4ZMAH 4ISNA 1IQFA 3RU4E 4JZ1A 3VXFH 4UD9H 1DT2A 1AZ8A 4MNWA 1TA2A 4X6PA 3DFJA 3RXKA 1O3DA 2DE8A 4DURA 6CHAB 1HAYB 1RIWC 5C20A 2J9NA 3RXJA 2PSXA 2ZWLH 3VEQB 1TQ0B 1HXEH 1A7SA 1DX5M 5CMXH 2VINA 3KEEA 3UNSA 3T5FH 1H4WA 3VXEH 2FZZA 3U8RH 1MUEB 4YT7H 1A0JA 5LPFA 4JYTA 2ZA5A 1LHGH 1TPAE 4K2YA 5E2OA 3U98H 1K28D 4O97A 2GVFA 1A61H 2ZGCA 3UOUA 4BNRA 5JB8S 1O2UA 4AZ2B 1ZRKA 3U8OH 5DK1A 1T4UH 1F0UA 1MCVA 1QBVH 3PMHB 5ESTE 3P6ZB 1BZXE 2PWXA 2WPIS 1SPJA 1G3DA 3SUGA 1GG6B 3KHVA 1C4Y2 5C5NA 1XXFA 1TPOA 1N1LA 4H6TA 1FIZA 2BD4A 2FLRH 1GBDA 1C2LA 1W13U 3SW2B 2PUQH 3I77A 1GVKB 7KMEH 1FY3A 1KY9A 1A3EH 1AWHB 3SORA 5C2ZA 1YPHC 3EYDA 3ELAH 2IJOB 1HB0B 1IAUA 3MHWU 1EAWA 3MWIU 1EOJA 1O2RA 1WOFA 4DT7B 1TIOA 3RXIA 1N8OB 4D7GA 1AB9C 4CH8B 1JIMA 2XC5A 1TX7A 1GVLA 2BQWB 5GCHG 3LGVA 1G9IE 1F2SE 2ZC9H 1GL1A 1C9PA 2PUXB 1C5RA 1O5FH 1XUIA 4I8JA 3K6ZA 1CU1A 3D62A 3A88A 4ABHA 2BLOA 1GCTC 1NN6A 5J4QA 3M5MA 1A0LA 3SJKA 1Z6EA 1GMHF 1GL0E 2GZ8A 2ZGBH 3TH3H 1TBQH 1XVMA 2GDEH 3M5OA 1DICA 1ZR0A 3DD2H 5ETXA 5T6DA 2OC8A 3CS7A 4CR9A 2Z9KA 2NWNA 2B9LA 4NA7A 4Y8XA 2XNIA 2PV9B 4UFFH 4JK6A 4E7RG 2PSYA 1O3OA 1SL3A 2FM2A 1ETTH 3TVJB 2Z9JA 5EU8A 5FCRA 4KTSA 2FMJA 2W3IA 2RDLA 2BDBA 1FDPA 4TWWA 1OYQA 1C5TA 1TONA 4BXWA 3RXOA 1CVWH 3A81A 1V2LT 4KP0A 3EA8A 2ZTZA 1PQ5A 2Y5GA 1ESBA 1FXYA 3ZVBA 2R0LA 4DY7B 4MQAA 3MYWA 1MKXH 1HIAB 3SJ9A 1FAXA 2AERH 1HXFH 1BRAA 1GCDA 1BTPA 1L0ZA 5I25A 3GY3A 2OLGA 1WYKA 4DVAU 3MMGA 1EQ9A 1K1IA 4UDWH 1L1NA 1QR3E 1C5ZB 2EEKA 1GPZA 4KGAA 2XC4A 1BTXA 1L2EA 2FEQH 1ABJH 1VJ9U 1IQJA 5T3HA 3SZNA 1PQ8A 3O8DA 3HGNA 5JBBS 3RXGA 1K1OA 4GSOA 4I8GA 3BIVH 3ZVEA 3ZZBA 2VGCC 3NUMA 3STIA 4O3UA 1RRKA 4K1EA 4JZFH 1ZJKA 4F4OC 4RKJB 1WTHD 1MTUA 2JH5D 3SUEA 2AGGX 6GCHG 2JH0D 3H7TA 1CA0C 1PPBH 1W10U 3RXRA 1BHXB 1W14U 1OP8A 3JZ1B 4X1QU 2A4OA 1MBMA 1DFPA 2GDDA 3S9AA 3I78A 1QRXA 1ORFA 2ZU2A 3TLOA 1O5EH 3RXFA 4X1SU 1ARBA 1G2LA 1OS8A 3PYHA 4CRBA 3RM2H 1UCYH 5E2PA 1C5MD 1K1PA 4KELA 1HNEE 5PTPA 4CRGA 2G00A 2PW8H 1HJAB 3S0NA 2P3UB 3RXUA 1SGPE 2PGBB 3C1KA 2ZU3A 4LZ1H 2H5DA 3E6PH 5T6FA 1EAUA 4AFUA 4MLFB 1J8AA 1VCWA 3RXSA 4YZUA 2CHAB 4SGBE 1EPTC 4B73A 1SVPA 1C2IA 1L4DA 1NESE 4H4FA 2HNTE 1XUJA 4I8KA 1EAXA 4BTTB 4AYVB 2TPIZ 2P3FH 4UONA 5A2MH 2F9BH 4X2VA 2UWPA 1GBAA 1CO7E 3G01A 3PM3A 3BTHE 2FOHA 1TNJA 1LQEA 2B7DH 3V7TA 3VB5A 5DO4H 1AI8H 2CJIA 1O33A 1GMDG 7LPRA 2Y6TA 3LGWA 1W7GH 2B8OH 3RC4A 4ABBA 1ELEE 3QGJA 2A7JA 3ATIA 1ANBA
chains in the Genus database with same CATH superfamily
2R9PA 2FOGA 3BTTE 2BZ6H 2ZDKA 5DP4A 4CRFA 1OWIA 2ZO3H 2J2UA 3BTFE 4XD7D 2QV1A 2ZQ2A 4AGJA 2HVXA 1BTYA 1NT1A 2AS9A 3ODFA 1AWFH 1W11U 1NRQH 1O2SA 5E8EH 3SU1A 1GI3A 1O3NA 3UTUH 3QK1A 2K8IA 1D4PB 3LT3A 1BMNH 2WINI 2HOBA 3NWUA 3A87A 1QQ4A 2F9NA 1S83A 1C2HA 5L30H 2QC2A 5A8YA 1AQ7A 2GTBA 3GDVA 4IC5A 3KGPA 4CRDA 5AVDA 2STBE 4RT0A 3MNSA 1GDQA 1LVOA 1UTPA 3L6PA 2Y81A 3KQBA 1DY9A 5C1YA 3ZVAA 1KDQB 3OFND 1UK3A 3ATLA 3TPIZ 3MQKC 1BMMH 1Q3XA 2BVXH 3RMMH 5CHAC 1QGFA 4LXBH 5HGGA 1BRCE 1A3BH 1A0HB 1O38A 1TBZH 1ANCA 2BQ6B 2BLWA 1ETRH 5L2ZH 5JYIA 1AFEH 4HFPB 4THNH 3WWFA 3PO1B 2I6SA 2Y7ZA 2ZDVH 4X6OA 2WV4A 2ZHWH 4WWYA 4Y11E 3RXLA 1YCPH 3AAVA 1FN6A 1LHFH 5T1VA 1F92A 3QZRA 4ZKOU 1OOKB 1TX6A 1ZPBA 3B8JA 1DITH 1HLTH 3LGIA 4D9RA 2ASUB 2Z6BD 1DWBH 1C2FA 3PRDA 2G5VA 3JZ2B 2JKHA 3L33A 1Y3WA 4ABGA 5A0BA 2ZF0H 1XVOA 4HGCA 3RMNH 4A1TA 3BN9A 1O2PA 4IMZA 2GV7A 4U01A 4BTUB 3P95A 3SV9A 2WPMS 2ODQA 3A7WA 3EDXB 5GPIB 1A1RA 4FOUC 1SGYE 1TAWA 1ZTLA 2JETB 4TT3D 1YPHE 1K21H 2VVVA 1UTQA 3MH5A 5C0UA 2JDID 4WVPE 4ASUD 1GHZA 1DXWA 3GY8A 3FN8A 1OKXA 2BOHB 5E0GA 4Q80A 1VCPA 2ULLA 4B2CA 4FVDA 2HVYB 1T4VH 3LGYA 1FUJA 2KR7A 2VIWA 3RC6A 2V3HH 4CBOA 2BB4A 3M35A 4VGCC 1YCPM 1XKBC 3A89A 1P2KA 1E79D 4AB9A 1O5CB 1OYTH 3S9CA 1EPTB 1AVXA 1O2YA 4B74A 1EASA 1ELDE 1GJ5H 2W3KA 2BOKA 3UIRA 1VITG 2ZDLA 3UOPA 2JETC 2WPHS 2DUCA 1BIOA 1P10A 4HI3A 4OGYA 4XBDA 1KLTA 1O2WA 1PQ7A 2PFEA 3EAJA 1O36A 4JYUH 2K1QA 3ZZ3A 2C90B 2BMGB 1FONA 1WQVH 6CHAC 3MI4A 3SU0A 2PTNA 1GI9B 4X8TH 4U30A 3SHCH 1AN1E 1C1WH 3SGQE 1Y5BT 1ZSJA 3I29A 1NFUA 2VWNA 2A0QB 1UTLM 1SQOA 1F5KU 1JOUB 2V3OH 2CK3D 3ZZDA 3ITIA 1FJSA 3DCLA 1ELBA 1FPHH 1UO6A 3OY6U 2VB0A 5DJ7A 4ZAEA 5GCHF 4XDEA 3ZVCA 3LDXH 4ISHH 1GMCF 1WXRA 4HTCH 4A1VA 2Y7XA 3ZZ6A 2P95A 1P3EA 1D3QB 1PPZA 3F2HA 4K1TA 1EB1H 1WSSH 2ZG0H 1XUGA 4NIWA 1LHEH 4Q7YA 2TGAA 1P03A 4X8VH 1GHXH 1NU9A 2G4TA 1F5RA 1DXPA 4ZROA 4BAMB 1MD7A 4YOJA 1OP0A 1AB9B 4HG6A 1V2WT 3AW0A 1HJ8A 1V2TT 3F0PA 1AD8H 3A7TA 3M7UA 4MPUA 2G4UA 4X8UH 5AFYH 5HMAA 2J92A 4NFEA 1B0FA 1MH0A 2GCHF 1C1NA 1O2XA 1O2OA 1SOTA 1NC6A 2BX4A 1HRTH 3M7TA 5K0HA 4CHAC 1PFXC 4P00A 2JJ1D 3SNDA 4GVUA 3U1JB 3HKIB 4RT1A 1PPEE 2J97A 3MO9A 4IMQA 1HYLA 2STAE 1XXDA 3FFGA 3TIUA 2FI5E 1QRZA 1O3AA 4DW2U 2VIQA 3RXCA 1HCGA 1CT4E 3OU0A 2FX4A 3N7EA 4FUGA 4PROA 1QB6A 4ZHMU 1TYNA 2OCVB 1MMJN 2BDYA 1V2NT 4ASHA 1ELTA 1K1JA 2F9VA 4XSKU 3ZYEA 4TWYA 1SGCA 5HXFA 3PTNA 2IN2A 2ZTYA 5A8XA 3NXPA 2PHBA 4UE7H 2WZQA 4O9VA 1TX8A 1EJAA 5LH8A 4AX9H 5EXNA 1SB1H 1J17T 1SGRE 5GIBA 1HAPH 4BAOB 4B6FA 1QHRB 1SGIB 5HM9A 5F8XA 1AO5A 3P8GA 3EE0B 2GD4B 1HJ9A 1S0QA 2PTCE 4Z6AH 1GBEA 4X1RU 1CGIE 4M9FA 3AASA 1QA7A 5DP9A 1KIGH 1BBRE 6GCHF 4DOQA 2R2WU 3PV5A 4GLYA 3T62A 3A8CA 4OS5A 1BJVA 2P16A 2VIPA 1S6LA 5EPNA 1A5HA 1HFDA 1NRNH 3TK9A 3SGAE 3EA7A 2FOAA 2RDEA 3BIUH 3ZZCA 1GVZA 1QL7A 1DANH 5EPYA 1AFQC 3CP7A 1YKTA 2BY7X 1O2QA 3QDZB 1ZMLA 4D9QA 4ZXYH 1O3LA 1QB9A 1DE7H 3OAAD 3BG8A 1BTUA 1IHSH 1IHTH 1H8IH 2RFKC 1P2MA 2H1UA 1HPGA 4FUDA 1W7XH 1UTOA 1GHAF 2FOBA 1V2JT 4K8BA 1C1QA 5EJZA 3UNRA 1T8MA 1SFQB 1CT0E 3OEED 2SGPE 4OS7A 1RD3B 3DSOA 4P02A 1SI5H 2ANYA 3R3GB 2BM2A 3A8AA 1O3IA 1EUFA 3R0FA 1C2EA 1YPEH 3RLWH 1G2MA 1GBHA 2ZHDA 2ZU5A 4MNVA 1G3EA 5ABWA 1RXPA 1UCYK 1WU1A 4WMDA 5CHAB 1C1VH 2D1JA 3FVFB 1CE5A 4NA9H 3V0XA 2Q6DA 2SGQE 3UFAA 4X8SH 1C5XB 2FPZA 2GCTB 1SHYA 3F68H 1EXFA 4A92A 2G52A 3RDZA 2ZI2H 3HK6B 1QL8A 4WMEA 4XE4A 1LQDB 1MQ5A 4AOQA 3UQOA 3TK6A 1P57B 2GP9B 1QTFA 4AGKA 1TPPA 1B5GH 4Z0KA 3WY8A 4TPYA 3GS9A 3A7XA 3V13A 3A80A 3Q3KA 2EQNA 1C2MA 1CT2E 1W8BH 3U9AH 3UQVA 3SO3A 2XBWA 1BB0B 1Z1JA 4NWKA 5JB9S 2FS9A 1BRBE 2GKVE 2WPKS 2EI7A 3VB7A 1XUHA 3CENA 4X2WA 3UR9A 3UB0A 1C5VA 2AMDA 1V2ST 2F9UA 3NCLA 3MO6A 1MCTA 1KLIH 1KXFA 2GV6A 2ZU1A 2KAIA 5EGMA 1G3BA 2O8MA 3SUDA 2VWLA 4NZLA 2G55A 2KCOA 1JRSA 1ESAA 3FP7E 1VJAU 8GCHG 4AFQA 2ZPQA 1RS0A 1O3GA 4E7NA 3M61U 1MAYA 1QBOA 1AVGH 2KAIB 2TIOA 3BTEE 5HIYA 3S7KB 1BBRH 2SGAA 1ELAA 3SJ8A 4R8TB 4JZDH 2OP9A 3PMBB 3P92A 2P3TB 2VVUA 1UTKA 2OD3B 2ZU4A 2FX6A 4A5TS 4F49A 3S9BA 4TYDA 1BDAA 2ZKSA 4ABEA 1KXBA 3M7QA 1IQLA 3HK3B 3UAIC 4FXGH 2LELA 2KM0A 1MKWH 1GI4A 2ZFSA 1NBMD 1ZPCA 2ZGHA 2BY6X 3Q00A 2J95A 3TNTA 5C3NA 1HAIH 1YLNA 3GDUA 2HPPH 3SQHE 3U1IB 2BD5A 1ZMNA 2ANMH 2C8XB 2YNAA 3QGNB 5KEDA 4Y6DA 2G5NA 1VITH 2OXSA 3PTBA 3Q3YA 3OTJE 3STJA 5ESBA 3RXDA 2AEIH 2EI6A 2PKAA 3RXHA 4B76A 3A7VA 1NPMA 1O3CA 1ZSKA 4ZHAA 3GOVB 4AORA 4MVNA 2VH0A 2WPLS 2H6MA 3RXTA 2F3CE 1C5PA 1G30B 4RKOB 2VIVA 4BAKB 2UUJB 3HGPA 2H9TH 4AYYB 4Q4LA 3UNQA 1GI2A 4B71A 1YCPK 3UY9A 2XTTB 1SLVB 1NRPH 7ESTE 3LOXA 1QFKH 3W94A 2A45B 3BG4C 4X0WU 1NS3A 4WXIA 1O3KA 2WPJS 2Q6GA 1EKBB 1IQEA 2W6JD 1TABE 3E3TA 1YGCH 2EI8A 5FPSA 1LPGB 2AGEX 1GG6C 3GICB 2J98A 4RI0A 1ZJDA 5EQSA 1QL9A 2QF5A 2FIRH 1ELFA 1T8NA 2R3UA 1TQ7B 3UWJH 1DVAH 1BMFD 2UWLA 3U8TH 3BEIB 1ID5H 2J98B 3TH4H 2FTLE 3GCOA 3DUXH 1TB6H 1EAIA 2HLCA 3U69H 4FUIA 1V2KT 2C8YB 3NRLA 4OS4A 1SGFG 1ZYOA 2FXRA 1O0DH 4MPVA 1HAXB 1GBLA 8GCHF 1ZHRA 3ZVGA 4FUHA 1GJAB 3E90B 2ALVA 2KZ4A 1TRNA 1KTSB 2CF8H 1BITA 2R2MB 3GCTF 1ABIH 1TGCA 1A5GH 3RU4T 1C1UH 2A2XH 3T27A 2KCYA 1YPLH 5FPTA 5SGAE 4MNYA 3U28C 2C8WB 4VGCB 1GJ9B 1PPCE 4K5ZA 4I86A 5DP3A 1G36A 2QF4A 3SUFA 1FIWA 1P8VC 3SU5A 1P12E 3RXBA 2KCPA 2ZGXH 4Z1MD 1T32A 3A7ZA 1P0SH 1O5DH 1KTTB 3T25A 1V2VT 1W0KD 4GUXA 4O3TA 3MU4A 1YYY1 4I8LA 4WH6A 1SLUB 9LPRA 1GHBG 2OC1A 5TCCA 2KFWA 2ZQ1A 1TA6A 1BTZA 1MQ6A 1W12U 1WAYB 2FP7B 3M3VA 2Y5HA 2GCHG 2SNVA 2D26C 1GBMA 3T26A 2A5IA 1VGCC 2V6NA 3T28A 1D3DB 1W0JD 5CE1A 1K9OE 3SU3A 3A8DA 1YLDA 2ZGJA 1SBWA 4FUCA 2OC7A 1N6YA 3LPRA 2P59A 4GPGA 1XM1A 1FNIA 2VIDA 2Z9GA 4SGAE 4UFEH 2W7UA 3ENSB 1Y5UT 3QLPH 3TGJE 1N8OC 3BSQA 4ABDA 3EE7A 2W26A 2GCTC 1S6HA 3Q76A 1GHBF 1BT7A 2VIOA 3QTOH 3SYJA 1AIXH 3OY5U 2WV9A 1ACBE 1AFQB 3RXEA 4FUJA 3D23A 1OP2A 5L6NH 5EXLA 2BD9A 1HV7A 1BHXF 1YM0A 2BQ7B 3ZVFA 2A32A 1Z8GA 4YESB 1P02A 2OQUA 4F55A 3RP2A 1O34A 1GBBA 2PLXA 5A09A 1GJCB 5GJ4B 3LC5A 1G3CA 1W0ZU 5C0TA 2DE9A 4RN6A 2W7SA 1SQTA 1ZOMA 4YXWD 3RMLH 1VZQH 1DDJA 1TNLA 2AMPA 2Y80A 3CS0A 3KQ5A 4NZQA 3RC5A 1GI6A 3P70B 3T2NA 1AUTC 3OSYA 3P8FA 3UPEA 2AIQA 1AMHA 1AGJA 1V2OT 1TRYA 1TE0A 1GI0A 2UUKB 1Y3YA 2AH4X 2J94A 2ZEBA 2WYGA 5EXMA 1O3JA 3LKWA 1SLWB 1PYTC 1VGCB 3B9FH 1SC8U 1RTLA 3KNXA 2AFQB 1BOQA 3KF2A 4X2XA 1C2KA 2GMTB 5FL7D 1E35B 2BLVA 1BRUP 1S82A 1DS2E 3RLYH 1ZHMA 4FUBA 2ZZUH 4Q7ZA 3VGCB 3MNXA 4AN7A 2OBOA 1Y3VA 4YM9A 2VU8E 1KXDA 1C5LH 2B0FA 3GY2A 3LIWA 1NO9H 4DGJA 3RXPA 5IDKA 2HNTC 5KECA 1GHAG 3SGBE 2FOCA 1C5UA 1O2TA 8ESTE 2AYWA 5EQQA 2HRVA 2BDHA 1T7CA 2NU3E 2I6QA 4CRAA 4MG3A 4WJG2 4MNXA 4DG4A 1EJNA 1HAVA 2F83A 2GT7A 2K0QA 1QB1A 1RTKA 2ZHFH 5EJLA 1FAKH 5JBTA 2CMYA 1Y3XA 1UTMA 1AVWA 3LH3A 5FCKA 4XOJA 3K2UA 1O35A 5CHBA 3F9EA 3VGCC 1F0RA 1GMCG 1Z6JH 4JYVH 1C5NH 4DJZB 1SR5C 4WY3A 1H9LB 3S7HB 3C27B 1MZAA 4INKA 5LPRA 1PPHE 1WUNH 1EZSC 1EZXC 1SSXA 1OWJA 4DIIH 3GCNA 4KKDA 4AC9A 4WH8A 5H4IB 1GBKA 1BMLA 4YLQH 1L1GA 5EJ1A 2ZCHP 1EB2A 4FU7A 5G4BA 1QURH 1BA8B 2GGVB 2A5AA 4I8HA 5C1UA 3N99A 1VR1H 1C5QA 1EATA 2TGPZ 4B1TA 4AFZA 4JZEH 1CA8B 1NTPA 1P9SA 2XBXA 1RJXB 5DP6A 1LDTT 1O32A 4X6MA 2QA9E 1KMHB 4D76A 1P2QA 1VKYA 3GDSA 1ZLRA 1CBWB 4NSYA 3GYLB 1ELCA 3ZZ9A 1TGSZ 1LVYA 1QIXB 1ANEA 1CQQA 1FV9A 3BEFB 1BCUH 1GI1A 1LKBA 2WHXA 4IS5A 2VH6A 1ANDA 1HBTH 2R3YA 1C1PA 2G51A 1UVTH 5B6LA 1NFWA 3SU2A 2NU1E 2G81E 1V2UT 1A46H 1Z8RA 1P11E 2KCAA 1XMNB 3QTVH 3ATKA 4Y7BA 1GBJA 2OK5A 2VNTA 3VB6A 2QXGA 4FUEA 5IYTA 2OTVA 4INLA 2THFB 3QO6A 4OS2A 5A0CA 1SFIA 1FI8A 1THPB 1WV7H 1OWDA 4E06H 3W95A 5L2YH 4ACAA 2BY9X 1Z1IA 3KIDU 1O3BA 2ZDMA 2AGIX 1QY6A 4LK4A 2P8OB 5DSFA 1PPFE 5EIYA 3M3TA 5HYOA 4RSPA 1GHVH 1ZTKA 1O3MA 2Q6FA 1D3PB 2XBYA 2OBQA 2F4LA 3P8OA 4OS6A 4UFDH 2HNTF 2RCEA 1XX9A 1W2KH 2BXTH 1PYTD 1O31A 3MFJA 4D8NA 1O2HA 1UK2A 3ODDA 4Y10E 4AG2A 2OQ5A 1FY5A 1P05A 2QCYA 3PMAB 7GCHG 3Q3XA 4CBNA 1QJ1B 2TRMA 3DT0H 1CBWC 1SHHB 4M7GA 3MO3A 3A84A 2XYAA 1TALA 2BD2A 2BXUH 3IWMA 1ZRBA 1WDIA 1NZQH 3GY5A 5C94A 1O39A 3SV6A 1AUJA 2BHGA 3GY4A 3GISB 1ZZZA 1TGBA 2ZFTA 3EA9A 3T29A 3PLKA 2O8LA 4CR5A 1O3EA 3AK5A 2FO9A 3MNBA 4XBCA 5JBCS 1A5IA 2WUCA 3TGKE 1UVSH 1SQRA 4I33A 1Z7KA 3ZZ7A 1OSSA 1GI5A 2GJGA 2A4GA 2IPHA 1HUTH 3SHAH 2AIPA 2C4FH 2J38A 4JMYA 2HWLB 1RTFB 1D9IA 1GHWH 2H9EH 2ODYB 1OPHB 2J34A 1BBRK 1NFXA 3TH2H 2BX3A 2ZFQH 1UMAH 2H2ZA 2FOMB 3BEUA 1JBUH 3AAUA 5BPEA 2PKSC 3V12A 4BANB 4ISLA 4K8YA 2BY5X 2V35A 2WUBA 1NU7B 1EP5A 2PKAB 1QBNA 3BTQE 3H7OA 2XBVA 3K9XB 2XWAA 1ZMJA 5HIZA 4YO9A 4UEHH 2VJ1A 2P93A 4Y8YA 1OX1A 4TSFD 1ARCA 5AFZH 2OINA 1THSH 3FP8E 1B7XB 3ATMA 2FOFA 2CN0H 3E1XB 1NBME 1GJ8B 2HLDD 1F5LA 5EW2H 1IQNA 1JIRA 1J14A 2FESH 1UVPA 4B2AA 5F8ZA 3GY7A 3A8BA 4ZH8A 1GWAA 2BDIA 5EODA 1IQKA 3M5NA 5GWZA 4LZ4B 2ANWA 5FAHA 3PV2A 4NFFA 1O3HA 4NCYA 1B0EA 4IW4E 2P8OC 3AW1A 2SGDE 2M5TA 2QXJA 3PLBA 3FZZA 2ILNA 1K0HA 1O2ZA 2RG3A 2FI3E 2J4IA 3RXVA 1LPKB 5F53A 3MU1A 5FPYA 4BXSA 3SU4A 1SGDE 1O2MA 2OUAA 1TMUH 2WYJA 3SNBA 3SOSA 1FY4A 1TNGA 2O9QA 1GGDC 4K60A 1H8HD 3WWBA 1OWHA 2Q1JA 4TY7A 4FU9A 1LHCH 1KDQA 1RIWB 2FTMA 3TGIE 1TOCB 1TWXB 1C4V2 5DGJA 3A7YA 4AFSA 1E36B 4GHTA 1AHTH 1MTNB 1C1RA 2Y82A 1H9HE 4GCHG 2FWWA 1V2QT 2LPRA 2PGQB 1O2KA 5DKMA 5T6GA 3D65E 1Z71A 3TJNA 3ZYDA 3KQCA 3MH6A 4MTBA 4WXVA 4YOGA 2F9OA 1E37B 2QXIA 1CSOE 2QGRA 2UUFB 1C5YB 3URDA 1C5OH 1T8LA 2BDGA 4Y79A 3DSPA 4ISOA 3EGKH 1SGEE 4ESTE 1BUIA 1GDNA 4FVBA 4BOHA 1XUKA 3F2GA 1PJPA 4U32A 3NZIA 5B6OA 3PB1E 3Q77A 3NKKA 2GT8A 1GHYH 4NIYA 2FYQA 5F03A 3FKSD 1LHDH 1EFRD 5JDUB 1AU8A 3QN7A 3WW7A 5AHGH 3E8LA 3SNAA 3RXMA 1CHOG 3F6UH 3BG4B 4Y71A 2QXHA 1GBCA 1GI7B 3E91A 1HAVB 2D8WA 2CHAC 1DWCH 1MBQA 3A83A 1O5GH 1DLKB 4Y0ZE 2W5EA 4ABIA 1Y59T 1KYNA 1QRWA 3V3MA 1E0FD 1ZSLA 4I32A 1IOEA 2WV5A 4BAHB 1AKSB 1AY6H 1CGHA 3BTGE 2ZFFH 2A5KA 4NIXA 3OX7U 1WBGB 1LKAA 1OWEA 1P01A 3SBKA 1BQYA 1ZGVA 2Z7FE 3A85A 4ZUHA 5BRRE 1XKAC 3PWCA 4HZHA 5GNDA 1DY8A 1KXAA 1A4WH 2O8TA 4UFGH 4DCDA 2ZCKP 1P9UA 2ALPA 3PMJA 2Y5FA 3SJOA 1JXPA 4GAWA 3HATH 3TJVA 2FLBH 2SNWA 2QN5T 3BTKE 5HM2A 3FZDA 1YF4A 2F9PA 1P04A 2QF3A 1IQMA 3BTME 4X2YA 5C5OA 1TLDA 3CNRA 1IQIA 4QT8C 5DP5A 1KLJH 4IN2A 3VB3A 1TRMA 3MH7A 2BDAA 2ZTXA 1GBTA 3ZIAD 2D2DA 4Y8ZA 5CDFE 1IQGA 1SLXB 2SGEE 4NGAH 3ZZ5A 4OGXA 4X1PU 1K22H 2P94A 1DOJA 2GX4A 3RU4D 1PQAA 3GCTG 3UREA 1K1LA 3F9GA 3F1SB 3OTPA 2XCFA 1P06A 2H9HA 3SU6A 5FXLA 1YLCA 3L3TA 1F7ZA 1BMAA 1MKWK 1SG8B 1FN8A 2C3SA 1QJ7B 3RXQA 3LJJA 3VPKA 4YT6H 1TPSA 1P09A 4ZKNU 4OS1A 2GMTC 3GY6A 4A7IB 3D49H 6ESTA 2FDAA 2HPQH 4Y76A 5C1XA 3N7DA 5EOKA 1J16A 1YP9A 2SFAA 2Z9LA 4ABFA 2BLQA 2F91A 1V2MT 1YPJH 2XRCA 2H5CA 5EG4A 3MH4A 2Z94A 4J1YA 1NRSH 1W3CA 2FODA 1QJ6B 4JZIA 3MOCA 1BTWA 4AG1A 6LPRA 4DIHH 5LGOA 1EP6A 3H5CB 3N7OA 5FBEA 2JH6D 1FMGA 5F8TA 4DT4A 2ZNKH 3IITA 1Y5AT 3M37A 3GYMA 5E0JA 1UJ1A 2ZDAH 2A2QH 1O5BB 1DSUA 1E34B 1H9IE 3IG6B 4E05H 1C1TA 1SOZA 1HJAC 2ZHEH 3MTYA 4INHA 1JRTA 2QYIA 2VWOA 3QUMP 3ZZ4A 4BAQB 1ELGA 1K1NA 3BV9B 2VWMA 4NG9H 3GCHC 5A8ZA 1MKXK 1OWKA 9ESTA 1GBFA 1C9TA 1TNHA 2TBSA 3ZZAA 5TJXA 3ATWA 1AKSA 4Y0YE 5J4SA 3OYPA 2A4QA 3MU8A 3TJUA 1O2GH 2C8ZB 1LCYA 1OHHD 4XBBA 3HKJB 3SI3H 1MTSA 1UTJA 1Q2WA 3FP6E 2LNCA 3F2FA 3K65B 1T8OA 4NA8A 4ZCNA 3NK8A 8LPRA 3RXAA 5FHTA 3BTWE 1HAZB 1Z8JB 1X7AC 2JJ2D 4I7YH 5AF9H 2FYRA 4KTUA 1BTHH 1HIAA 1G32B 1H1BA 3ZV8A 1SGFA 4TY6A 1DUAA 3SQEE 4H42U 1EZQA 1HGTH 3F9FA 3LJOA 4H6SB 4B75A 4CRCA 1QNJA 1LPZB 3SN8A 1UCYE 1MTVA 1S6FA 2UUYA 4NWLA 4I31A 3TNSA 1DUEA 5FX6A 1S81A 1VCQA 1K2I1 1NY22 1TMTH 1A2CH 2QE7D 3KN2A 3PV4A 1MU6B 1WQSA 4K69A 5C67A 5LPEA 1E38B 3SV2H 5F6MA 1FY8E 1UW7A 2CXVA 2XCNA 1TOMH 3ZV9A 1O30A 1TNKA 2BD3A 2O8WA 5KGOA 1G37A 1KSNA 1LTOA 2ZHQH 4IN1A 3EQ0H 1QA0A 1K1MA 5A0AE 4J2YB 4X6NA 1AE5A 5JBAS 1MZDA 1AZZA 1DLEA 1D3TB 1PPGE 5FBIA 1D6RA 1P2OA 1AE8H 3TK5A 4ISIH 2XXLA 1UVUH 1GGDB 3QX5H 1ZTJA 4MDSA 5HKKD 3URCA 4IC6A 1DPOA 4LOYH 1S84A 1FY1A 1BJUA 3FANA 3TITA 1C2GA 3ZZ8A 3KQEA 3RUOA 2Z3DA 2OC0A 2AMQA 4ZXXH 3MNCA 4CREA 1XUFA 1GJBB 2A4RA 2FS8A 1ELVA 1P2IA 3LC3A 1KXCA 1YC0A 3K6YA 1GCTB 2HALA 4YTAA 8KME2 3O8BA 1F0TA 3QWCH 4ZHLU 1MAXA 2A7CA 3M36A 4IGDA 2G8TA 1EJMA 4Q7XA 4WMFA 1YBWA 3W1EA 1GDUA 1Y3UA 3LGUA 4ABAA 2RA0A 5TCAA 2V0BA 1Z8IB 3RMOH 3SNEA 4K3JA 2ZCLP 4Q2KA 2CF9H 2BVRH 3A86A 1SQAA 1RFNA 3ESTA 4OM9A 2GZ9A 1LVMA 2CV3A 3PWBA 2SGFE 4FUFA 3KQDA 4FU8A 3UR6A 5K7RA 2Z9IA 3PO1C 4X1NU 1CHGA 3GCHB 1V2RT 3BTDE 3SZEA 1YPMH 4ACBA 1HAGE 2ZFPH 1TMBH 1MU8B 3VB4A 3DA9B 1GJ7B 3LONA 1CA0B 2BD8A 4O03A 2QIQA 3P17H 1H8DH 1HAOH 2ESTE 4CHAB 1W0YH 2ZP0H 4YLUA 1UHBA 1O2NA 1INCA 1C2JA 1GJ6A 3NPSA 1V6DA 1O2LA 1THRH 1TGNA 1LO6A 3E0NB 2QY0B 3UWIA 4NSVA 2BTCE 2FI4E 2UWOA 2XW9A 1UHBB 3DHKH 5E0HA 1HAHH 2BD7A 2O8UA 2PKSB 1TBRH 5GXPA 4GCHF 3VFEA 3DFLA 1L1JA 2NU4E 1ETSH 3LGTA 1EZUC 3SV7A 4D7FA 2GZ7A 4TPIZ 5DPAA 1S5SA 1P2JA 1QQUA 3PRBA 2NU2E 1UTNA 4IBLH 2F43B 5GDSH 1S0RA 2Z3CA 1DSTA 3A82A 3SI4H 1C1SA 2NU0E 3B23B 1S85A 1P3CA 1TFXA 3SV8A 4ZKRU 2L6OA 1O2JA 1Y8TA 2Z3EA 1GJDB 2BZAA 2VVCA 5DG6A 3E16B 7GCHF 2ZPRA 1YPGH 2EY4C 1LVBA 1VITF 2TGDA 2ZPSA 1FX0B 2B5TB 1O3FA 2V7QD 1GMDF 1DWEH 5C17A 1EPTA 2IOTA 1NROH 4MPXA 1V3XA 2YMSD 1TNIA 2BY8X 1T31A 2YMSC 3TJOA 1JWTA 3LU9B 3P8NA 1UVOA 2FOEA 1CHOF 2C93B 3O8CA 4NIVA 1O5AB 2ZECA 1SGNE 1IQHA 2A1DB 4FETA 4CH2B 1C1OA 2A7HA 2JIZD 1C4U2 2LP6A 4R0IA 2XC0A 1HDTH 1ZHPA 3FAOA 4A1XA 3PROA 1H8ED 2ZIQH 1U6QA 1CGJE 1M9UA 2KX4A 1WTGH 2ODPA 2ANKH 2ZDNA 1GI8B 1KXEA 5I46H 1FZZA 4B2BA 2IJD1 3SNCA 1P2NA 2YOLA 4AB8A 1YPKH 4GHQA 2YNBA 4YOIA 3PLPA 1JMOH 2QAAA 4K1SA 3F0OA 1O3PB 2TGTA 4WF8A 3SJIA 1OXGA 1C2DA 2XOKD 4JCNA 2ZFRH 1D6WA 2BYAX 2XWBI 2VGCB 3MU5A 1LMWB 2V3MA 4MPWA 4Y7AA 1NFYA 3O8RA 2BDCA 3MU0A 1QCPA 4JK5A 2IPQX 1C5WB 2HGTH 1WCZA 1GBIA 2BVSH 3KCGH 1N6XA 3F3BA 3QZQA 1GJ4H 1ESTA 3LH1A 4ABJA 5EQRA 4A6LA 1ZPZA 5FX5A 4ZKSU 5EW1H 4KTCA 1COWD 3ZVDA 1YWUA 1ZGIA 1O37A 1GMHG 5DP7A 1J15A 1SGQE 3KL6A 3AVZA 1EOLA 3RM0H 1FPCH 2R0KA 1DWDH 1O2IA 2VBCA 1NRRH 2RA3A 1NM6A 3BF6H 1FQ3A 1Q31A 1C1MA 1EX3A 5DP8A 2EC9H 2PR3A 1DM4B 1FLEE 1SMFE 4XFQA 2QF0A 3F9HA 1V2PT 3S69A 1SGTA 3E0PB 1C5SA 3M3SA 5JPMH 1J9CH 1L4ZA 3M5LA 1TGTA 1RGQA 1F0SA 1MTNC 1MTWA 2A31A 1MD8A 4U2WA 2CGAA 3HPTB 1UK4A 1O2VA 2EA3A 3TU7H 3UUZA 4BTIB 4ZMAH 4ISNA 1IQFA 3RU4E 4JZ1A 3VXFH 4UD9H 1DT2A 1AZ8A 2J5UA 3DSGA 1TA2A 4MNWA 4X6PA 3DFJA 3RXKA 1O3DA 2DE8A 2WPDD 4DURA 1HAYB 6CHAB 1RIWC 5C20A 2J9NA 3RXJA 2PSXA 2ZWLH 3VEQB 1TQ0B 1HXEH 1A7SA 1DX5M 5CMXH 2VINA 3KEEA 5DN6D 3UNSA 3T5FH 1H4WA 3VXEH 2FZZA 3U8RH 2PP6A 1MUEB 4YT7H 1A0JA 5LPFA 4JYTA 2ZA5A 1LHGH 1TPAE 4K2YA 5E2OA 3U98H 1K28D 4O97A 2GVFA 1A61H 2ZGCA 3UOUA 4BNRA 5JB8S 1O2UA 4AZ2B 1ZRKA 3U8OH 5DK1A 1T4UH 1F0UA 1MCVA 1QBVH 3PMHB 5ESTE 3P6ZB 1BZXE 2PWXA 2WPIS 1SPJA 1G3DA 3SUGA 1GG6B 3KHVA 1C4Y2 5C5NA 1XXFA 1TPOA 1N1LA 4H6TA 1FIZA 2BD4A 2FLRH 1GBDA 1C2LA 1W13U 4XRNA 3SW2B 2PUQH 3I77A 1GVKB 7KMEH 1FY3A 1KY9A 1A3EH 1AWHB 3SORA 5C2ZA 3KYFA 1YPHC 3EYDA 3ELAH 3FOAA 2IJOB 1HB0B 1IAUA 3MHWU 1EAWA 3MWIU 1EOJA 1O2RA 1WOFA 4DT7B 1TIOA 3RXIA 1N8OB 4D7GA 1AB9C 4CH8B 1JIMA 2XC5A 1TX7A 1GVLA 2BQWB 5GCHG 3LGVA 1G9IE 1F2SE 2ZC9H 1GL1A 1C9PA 2PUXB 3OE7D 1C5RA 1O5FH 2M2AA 5IK2D 1XUIA 4I8JA 3K6ZA 1CU1A 3D62A 1MABB 3A88A 4ABHA 2BLOA 1GCTC 1NN6A 1E1QD 5J4QA 3M5MA 1A0LA 3SJKA 1Z6EA 1GMHF 1GL0E 2GZ8A 2ZGBH 3TH3H 1TBQH 1XVMA 2GDEH 3M5OA 1DICA 1ZR0A 3DD2H 5ETXA 5T6DA 2OC8A 3CS7A 1QZ8A 4CR9A 2Z9KA 2NWNA 2B9LA 4NA7A 4Y8XA 2XNIA 2PV9B 4UFFH 4JK6A 4E7RG 2YMSB 2PSYA 1O3OA 1SL3A 2FM2A 1ETTH 1YY3A 3TVJB 2Z9JA 3OEHD 5EU8A 4KTSA 5FCRA 2FMJA 2W3IA 4Q63A 2RDLA 2BDBA 1FDPA 4TWWA 1OYQA 2XNDD 1C5TA 1TONA 4BXWA 3RXOA 1CVWH 3A81A 1V2LT 4KP0A 3EA8A 2ZTZA 1PQ5A 2Y5GA 1ESBA 1FXYA 3ZVBA 2R0LA 4DY7B 4MQAA 3MYWA 1MKXH 1HIAB 3SJ9A 1FAXA 2AERH 1HXFH 1BRAA 1GCDA 2AHME 1E1RD 1BTPA 1L0ZA 5I25A 3GY3A 2OLGA 1WYKA 4DVAU 3MMGA 1EQ9A 1K1IA 4UDWH 1L1NA 1QR3E 1C5ZB 2EEKA 1GPZA 4KGAA 2XC4A 1BTXA 1L2EA 2FEQH 4B6EA 1ABJH 2W6ID 1VJ9U 1IQJA 5T3HA 3SZNA 1PQ8A 3O8DA 3HGNA 5JBBS 3RXGA 1K1OA 4GSOA 4I8GA 3BIVH 3VG8A 3ZVEA 2VGCC 3NUMA 3STIA 3ZZBA 4O3UA 1RRKA 4K1EA 4JZFH 1ZJKA 4F4OC 4RKJB 1WTHD 1MTUA 2JH5D 3SUEA 2AGGX 6GCHG 2JH0D 3H7TA 1CA0C 1PPBH 1W10U 3RXRA 1BHXB 1W14U 1OP8A 3JZ1B 4X1QU 2A4OA 1MBMA 1DFPA 2GDDA 3S9AA 3I78A 1QRXA 1ORFA 2ZU2A 3TLOA 1O5EH 3RXFA 2WSSD 4X1SU 1ARBA 1G2LA 1OS8A 3PYHA 4CRBA 3RM2H 1UCYH 5E2PA 1C5MD 1K1PA 4KELA 1HNEE 5PTPA 4CRGA 2G00A 4F48B 2PW8H 1HJAB 3S0NA 2P3UB 3RXUA 1SGPE 2PGBB 3C1KA 2ZU3A 4LZ1H 2H5DA 3E6PH 5T6FA 1EAUA 4AFUA 3FO8D 4MLFB 1J8AA 1VCWA 3RXSA 4YZUA 2CHAB 4SGBE 1EPTC 4B73A 1SVPA 3KYGA 1C2IA 1L4DA 1NESE 4H4FA 2HNTE 1XUJA 4I8KA 1EAXA 4BTTB 4AYVB 2TPIZ 2P3FH 1SKYE 4UONA 5A2MH 2F9BH 4X2VA 2UWPA 1GBAA 1CO7E 3G01A 3PM3A 2L74A 3BTHE 2FOHA 1TNJA 1LQEA 2B7DH 3V7TA 3VB5A 5DO4H 1AI8H 2CJIA 3H09A 1O33A 1GMDG 7LPRA 2Y6TA 3LGWA 1W7GH 2B8OH 3RC4A 4ABBA 1ELEE 3QGJA 2A7JA 3ATIA 1ANBA
chains in the Genus database with same CATH topology
2R9PA 2FOGA 3BTTE 2BZ6H 2ZDKA 5DP4A 4CRFA 1OWIA 2ZO3H 2J2UA 3BTFE 2QV1A 2ZQ2A 4AGJA 2HVXA 1BTYA 1NT1A 2AS9A 3ODFA 1AWFH 1W11U 1NRQH 1O2SA 5E8EH 3SU1A 1GI3A 1O3NA 3UTUH 3QK1A 1D4PB 3LT3A 1BMNH 2WINI 2HOBA 3NWUA 3A87A 1QQ4A 2F9NA 1S83A 1C2HA 5L30H 2QC2A 5A8YA 1AQ7A 2GTBA 3GDVA 4IC5A 3KGPA 4CRDA 5AVDA 2STBE 3MNSA 1GDQA 1LVOA 1UTPA 3L6PA 2Y81A 3KQBA 1DY9A 5C1YA 3ZVAA 1KDQB 1UK3A 3ATLA 3TPIZ 1BMMH 1Q3XA 2BVXH 3RMMH 5CHAC 1QGFA 4LXBH 5HGGA 1BRCE 1A3BH 1A0HB 1O38A 1TBZH 1ANCA 2BQ6B 2BLWA 1ETRH 5L2ZH 5JYIA 1AFEH 4HFPB 4THNH 3PO1B 2I6SA 2Y7ZA 2ZDVH 4X6OA 2WV4A 2ZHWH 4WWYA 4Y11E 3RXLA 1YCPH 3AAVA 1FN6A 1LHFH 1F92A 3QZRA 4ZKOU 1OOKB 1TX6A 1ZPBA 3B8JA 1DITH 1HLTH 3LGIA 4D9RA 2ASUB 2Z6BD 1DWBH 1C2FA 2G5VA 3JZ2B 2JKHA 3L33A 1Y3WA 4ABGA 5A0BA 2ZF0H 1XVOA 4HGCA 3RMNH 4A1TA 3BN9A 1O2PA 4IMZA 2GV7A 4U01A 4BTUB 3P95A 3SV9A 2WPMS 2ODQA 3A7WA 3EDXB 5GPIB 1A1RA 1SGYE 1TAWA 1ZTLA 2JETB 1YPHE 1K21H 2VVVA 1UTQA 3MH5A 4WVPE 1GHZA 1DXWA 3GY8A 1OKXA 2BOHB 5E0GA 4Q80A 1VCPA 2ULLA 4B2CA 4FVDA 1T4VH 3LGYA 1FUJA 2VIWA 3RC6A 2V3HH 4CBOA 2BB4A 3M35A 4VGCC 1YCPM 1XKBC 3A89A 1P2KA 4AB9A 1O5CB 1OYTH 3S9CA 1EPTB 1AVXA 1O2YA 4B74A 1EASA 1ELDE 1GJ5H 2W3KA 2BOKA 3UIRA 1VITG 2ZDLA 3UOPA 2JETC 2WPHS 2DUCA 1BIOA 1P10A 4HI3A 4OGYA 4XBDA 1KLTA 1O2WA 1PQ7A 2PFEA 3EAJA 1O36A 4JYUH 2K1QA 3ZZ3A 2C90B 2BMGB 1FONA 1WQVH 6CHAC 3MI4A 3SU0A 2PTNA 1GI9B 4X8TH 4U30A 3SHCH 1AN1E 1C1WH 3SGQE 1Y5BT 1ZSJA 3I29A 1NFUA 2VWNA 2A0QB 1UTLM 1SQOA 1F5KU 1JOUB 2V3OH 3ZZDA 3ITIA 1FJSA 1ELBA 1FPHH 1UO6A 3OY6U 2VB0A 5DJ7A 4ZAEA 5GCHF 4XDEA 3ZVCA 3LDXH 4ISHH 1GMCF 4HTCH 4A1VA 2Y7XA 3ZZ6A 2P95A 1P3EA 1D3QB 1PPZA 4K1TA 1EB1H 1WSSH 2ZG0H 1XUGA 4NIWA 1LHEH 4Q7YA 2TGAA 1P03A 4X8VH 1GHXH 1NU9A 2G4TA 1F5RA 1DXPA 4ZROA 4BAMB 1MD7A 4YOJA 1OP0A 1AB9B 1V2WT 3AW0A 1HJ8A 1V2TT 1AD8H 3A7TA 3M7UA 4MPUA 2G4UA 4X8UH 5AFYH 5HMAA 2J92A 4NFEA 1B0FA 1MH0A 2GCHF 1C1NA 1O2XA 1O2OA 1SOTA 1NC6A 2BX4A 1HRTH 3M7TA 5K0HA 4CHAC 1PFXC 3SNDA 4GVUA 3U1JB 3HKIB 1PPEE 3MO9A 4IMQA 1HYLA 2STAE 1XXDA 3FFGA 3TIUA 2FI5E 1QRZA 1O3AA 4DW2U 2VIQA 3RXCA 1HCGA 1CT4E 3OU0A 2FX4A 4FUGA 4PROA 1QB6A 4ZHMU 1TYNA 2OCVB 1MMJN 2BDYA 1V2NT 4ASHA 1ELTA 1K1JA 2F9VA 4XSKU 3ZYEA 4TWYA 1SGCA 5HXFA 3PTNA 2IN2A 2ZTYA 5A8XA 3NXPA 2PHBA 4UE7H 4O9VA 1TX8A 1EJAA 5LH8A 4AX9H 5EXNA 1SB1H 1J17T 1SGRE 5GIBA 1HAPH 4BAOB 1QHRB 1SGIB 5HM9A 5F8XA 1AO5A 3P8GA 3EE0B 2GD4B 1HJ9A 1S0QA 2PTCE 4Z6AH 1GBEA 4X1RU 1CGIE 3AASA 1QA7A 5DP9A 1KIGH 1BBRE 6GCHF 4DOQA 2R2WU 4GLYA 3T62A 3A8CA 4OS5A 1BJVA 2P16A 2VIPA 5EPNA 1A5HA 1HFDA 1NRNH 3TK9A 3SGAE 3EA7A 2FOAA 3BIUH 3ZZCA 1GVZA 1QL7A 1DANH 5EPYA 1AFQC 3CP7A 1YKTA 2BY7X 1O2QA 3QDZB 1ZMLA 4D9QA 4ZXYH 1O3LA 1QB9A 1DE7H 3BG8A 1BTUA 1IHSH 1IHTH 1H8IH 1P2MA 2H1UA 1HPGA 4FUDA 1W7XH 1UTOA 1GHAF 2FOBA 1V2JT 4K8BA 1C1QA 3UNRA 1T8MA 1SFQB 1CT0E 2SGPE 4OS7A 1RD3B 1SI5H 2ANYA 3R3GB 2BM2A 3A8AA 1O3IA 1EUFA 3R0FA 1C2EA 1YPEH 3RLWH 1G2MA 1GBHA 2ZHDA 2ZU5A 4MNVA 1G3EA 5ABWA 1RXPA 1UCYK 1WU1A 4WMDA 5CHAB 1C1VH 2D1JA 3FVFB 1CE5A 4NA9H 3V0XA 2Q6DA 2SGQE 3UFAA 4X8SH 1C5XB 2FPZA 2GCTB 1SHYA 3F68H 1EXFA 4A92A 2G52A 3RDZA 2ZI2H 3HK6B 1QL8A 4WMEA 4XE4A 1LQDB 1MQ5A 4AOQA 3UQOA 3TK6A 1P57B 2GP9B 1QTFA 4AGKA 1TPPA 1B5GH 4Z0KA 3WY8A 4TPYA 3A7XA 3V13A 3A80A 3Q3KA 1C2MA 1CT2E 1W8BH 3U9AH 3UQVA 3SO3A 2XBWA 1BB0B 1Z1JA 4NWKA 5JB9S 2FS9A 1BRBE 2GKVE 2WPKS 2EI7A 3VB7A 1XUHA 3CENA 4X2WA 3UR9A 1C5VA 2AMDA 1V2ST 2F9UA 3NCLA 3MO6A 1MCTA 1KLIH 1KXFA 2GV6A 2ZU1A 2KAIA 5EGMA 1G3BA 2O8MA 3SUDA 2VWLA 4NZLA 2G55A 1JRSA 1ESAA 3FP7E 1VJAU 8GCHG 4AFQA 2ZPQA 1RS0A 1O3GA 4E7NA 3M61U 1MAYA 1QBOA 1AVGH 2KAIB 2TIOA 3BTEE 3S7KB 1BBRH 2SGAA 1ELAA 3SJ8A 4R8TB 4JZDH 2OP9A 3PMBB 3P92A 2P3TB 2VVUA 1UTKA 2OD3B 2ZU4A 2FX6A 4A5TS 4F49A 3S9BA 4TYDA 1BDAA 2ZKSA 4ABEA 1KXBA 3M7QA 1IQLA 3HK3B 4FXGH 1MKWH 1GI4A 2ZFSA 1ZPCA 2ZGHA 2BY6X 3Q00A 2J95A 3TNTA 5C3NA 1HAIH 3GDUA 2HPPH 3SQHE 3U1IB 2BD5A 1ZMNA 2ANMH 2C8XB 2YNAA 3QGNB 4Y6DA 2G5NA 1VITH 2OXSA 3PTBA 3Q3YA 3OTJE 3STJA 5ESBA 3RXDA 2AEIH 2EI6A 2PKAA 3RXHA 4B76A 3A7VA 1NPMA 1O3CA 1ZSKA 4ZHAA 3GOVB 4AORA 4MVNA 2VH0A 2WPLS 2H6MA 3RXTA 2F3CE 1C5PA 1G30B 4RKOB 2VIVA 4BAKB 2UUJB 3HGPA 2H9TH 4AYYB 3UNQA 1GI2A 4B71A 1YCPK 3UY9A 2XTTB 1SLVB 1NRPH 7ESTE 3LOXA 1QFKH 3W94A 2A45B 3BG4C 4X0WU 1NS3A 4WXIA 1O3KA 2WPJS 2Q6GA 1EKBB 1IQEA 1TABE 3E3TA 1YGCH 2EI8A 5FPSA 1LPGB 2AGEX 1GG6C 3GICB 1ZJDA 5EQSA 1QL9A 2FIRH 1ELFA 1T8NA 2R3UA 1TQ7B 3UWJH 1DVAH 2UWLA 3U8TH 3BEIB 1ID5H 3TH4H 2FTLE 3GCOA 3DUXH 1TB6H 1EAIA 2HLCA 3U69H 4FUIA 1V2KT 2C8YB 4OS4A 1SGFG 1ZYOA 2FXRA 1O0DH 4MPVA 1HAXB 1GBLA 8GCHF 1ZHRA 3ZVGA 4FUHA 1GJAB 3E90B 2ALVA 1TRNA 1KTSB 2CF8H 1BITA 2R2MB 3GCTF 1ABIH 1TGCA 1A5GH 3RU4T 1C1UH 2A2XH 3T27A 1YPLH 5FPTA 5SGAE 4MNYA 2C8WB 4VGCB 1GJ9B 1PPCE 4K5ZA 5DP3A 1G36A 3SUFA 1FIWA 1P8VC 3SU5A 1P12E 3RXBA 2ZGXH 1T32A 3A7ZA 1P0SH 1O5DH 1KTTB 3T25A 1V2VT 4GUXA 4O3TA 3MU4A 1YYY1 4I8LA 4WH6A 1SLUB 9LPRA 1GHBG 2OC1A 5TCCA 2ZQ1A 1TA6A 1BTZA 1MQ6A 1W12U 1WAYB 2FP7B 3M3VA 2Y5HA 2GCHG 2SNVA 2D26C 1GBMA 3T26A 2A5IA 1VGCC 2V6NA 3T28A 1D3DB 5CE1A 1K9OE 3SU3A 3A8DA 1YLDA 2ZGJA 1SBWA 4FUCA 2OC7A 1N6YA 3LPRA 2P59A 4GPGA 1XM1A 2VIDA 1FNIA 2Z9GA 4SGAE 4UFEH 2W7UA 3ENSB 1Y5UT 3QLPH 3TGJE 1N8OC 3BSQA 4ABDA 2W26A 2GCTC 1S6HA 3Q76A 1GHBF 1BT7A 2VIOA 3QTOH 1AIXH 3OY5U 3RXEA 1ACBE 1AFQB 4FUJA 3D23A 1OP2A 5L6NH 5EXLA 2BD9A 1HV7A 1BHXF 1YM0A 2BQ7B 3ZVFA 2A32A 1Z8GA 4YESB 1P02A 2OQUA 3RP2A 1O34A 1GBBA 2PLXA 5A09A 1GJCB 5GJ4B 3LC5A 1G3CA 1W0ZU 2DE9A 4RN6A 2W7SA 1SQTA 1ZOMA 3RMLH 1VZQH 1DDJA 1TNLA 2AMPA 2Y80A 3CS0A 4NZQA 3RC5A 3T2NA 1GI6A 3P70B 1AUTC 3OSYA 3P8FA 3UPEA 2AIQA 1AMHA 1AGJA 1V2OT 1TRYA 1TE0A 1GI0A 2UUKB 1Y3YA 2AH4X 2J94A 2ZEBA 2WYGA 5EXMA 1O3JA 3LKWA 1SLWB 1PYTC 1VGCB 3B9FH 1SC8U 1RTLA 3KNXA 2AFQB 1BOQA 3KF2A 4X2XA 1C2KA 2GMTB 1E35B 2BLVA 1BRUP 1S82A 1DS2E 3RLYH 1ZHMA 4FUBA 2ZZUH 4Q7ZA 3VGCB 3MNXA 4AN7A 2OBOA 1Y3VA 4YM9A 2VU8E 1KXDA 1C5LH 2B0FA 3GY2A 3LIWA 1NO9H 4DGJA 3RXPA 5IDKA 2HNTC 1GHAG 3SGBE 2FOCA 1C5UA 1O2TA 8ESTE 2AYWA 5EQQA 2HRVA 2BDHA 1T7CA 2NU3E 2I6QA 4CRAA 4MG3A 4WJG2 4MNXA 4DG4A 1EJNA 1HAVA 2F83A 2GT7A 1QB1A 1RTKA 2ZHFH 1FAKH 5JBTA 2CMYA 1Y3XA 1UTMA 1AVWA 3LH3A 5FCKA 4XOJA 3K2UA 1O35A 3F9EA 3VGCC 1F0RA 1GMCG 1Z6JH 4JYVH 1C5NH 4DJZB 1SR5C 4WY3A 1H9LB 3S7HB 3C27B 1MZAA 4INKA 5LPRA 1PPHE 1WUNH 1EZSC 1EZXC 1SSXA 1OWJA 4DIIH 3GCNA 4KKDA 4WH8A 5H4IB 1GBKA 1BMLA 4YLQH 1L1GA 2ZCHP 1EB2A 4FU7A 5G4BA 1QURH 1BA8B 2GGVB 2A5AA 4I8HA 5C1UA 1VR1H 1C5QA 1EATA 2TGPZ 4B1TA 4AFZA 4JZEH 1CA8B 1NTPA 1P9SA 2XBXA 1RJXB 5DP6A 1LDTT 1O32A 4X6MA 2QA9E 4D76A 1P2QA 3GDSA 1ZLRA 1CBWB 4NSYA 3GYLB 1ELCA 3ZZ9A 1TGSZ 1LVYA 1QIXB 1ANEA 1CQQA 1FV9A 3BEFB 1BCUH 1GI1A 1LKBA 4IS5A 2VH6A 1ANDA 1HBTH 2R3YA 1C1PA 2G51A 1UVTH 1NFWA 3SU2A 2NU1E 2G81E 1V2UT 1A46H 1Z8RA 1P11E 1XMNB 3QTVH 3ATKA 4Y7BA 1GBJA 2VNTA 3VB6A 2QXGA 4FUEA 5IYTA 2OTVA 4INLA 2THFB 3QO6A 4OS2A 5A0CA 1SFIA 1FI8A 1THPB 1WV7H 1OWDA 4E06H 3W95A 5L2YH 2BY9X 1Z1IA 3KIDU 1O3BA 2ZDMA 2AGIX 1QY6A 4LK4A 2P8OB 1PPFE 3M3TA 5HYOA 4RSPA 1GHVH 1ZTKA 1O3MA 2Q6FA 1D3PB 2XBYA 2OBQA 3P8OA 4OS6A 4UFDH 2HNTF 2RCEA 1XX9A 1W2KH 2BXTH 1PYTD 1O31A 3MFJA 4D8NA 1O2HA 1UK2A 3ODDA 4Y10E 4AG2A 2OQ5A 1FY5A 1P05A 2QCYA 3PMAB 7GCHG 3Q3XA 4CBNA 1QJ1B 2TRMA 3DT0H 1CBWC 1SHHB 4M7GA 3MO3A 3A84A 2XYAA 1TALA 2BD2A 2BXUH 3IWMA 1ZRBA 1NZQH 3GY5A 1O39A 3SV6A 1AUJA 2BHGA 3GY4A 3GISB 1ZZZA 1TGBA 2ZFTA 3EA9A 3T29A 3PLKA 2O8LA 4CR5A 1O3EA 2FO9A 3MNBA 4XBCA 5JBCS 1A5IA 2WUCA 3TGKE 1UVSH 4I33A 1Z7KA 3ZZ7A 1OSSA 1GI5A 2A4GA 2IPHA 1HUTH 3SHAH 2AIPA 2C4FH 2J38A 4JMYA 2HWLB 1RTFB 1D9IA 1GHWH 2H9EH 2ODYB 1OPHB 2J34A 1BBRK 1NFXA 3TH2H 2BX3A 2ZFQH 1UMAH 2H2ZA 2FOMB 3BEUA 1JBUH 3AAUA 5BPEA 2PKSC 3V12A 4BANB 4ISLA 4K8YA 2BY5X 2V35A 2WUBA 1NU7B 1EP5A 2PKAB 1QBNA 3BTQE 3H7OA 2XBVA 3K9XB 2XWAA 1ZMJA 4YO9A 4UEHH 2VJ1A 2P93A 4Y8YA 1OX1A 1ARCA 5AFZH 2OINA 1THSH 3FP8E 1B7XB 3ATMA 2FOFA 2CN0H 3E1XB 1GJ8B 1F5LA 5EW2H 1IQNA 1JIRA