3PM3A

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pm3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pm3A02
2ZU2A 4NFEA 3QTOH 4TYDA 4H6SB 1C5SA 5AVDA 4FUGA 1O5AB 3ZVEA 5DGJA 1G30B 1KY9A 5C3NA 4F49A 2CV3A 1V2NT 2PKSB 3GY2A 1K21H 2OTVA 1TONA 1GHWH 3N7OA 2FIRH 1Z6EA 1L1JA 2G4UA 3RM0H 4X6MA 3E3TA 1NZQH 3RLYH 3RLWH 2BMGB 2GP9B 1GHYH 2WUBA 1O2UA 4E7NA 3DA9B 1O5GH 1P09A 4B2BA 2BB4A 2V0BA 1P2IA 3LOXA 2A4RA 3EA9A 3WY8A 4OS7A 2J2UA 2FO9A 3MO6A 3U8RH 1A46H 1IHSH 4X6NA 1O2WA 3RC6A 1TQ7B 2QYIA 2W7UA 4HZHA 1GBFA 1PQ8A 3M5NA 1O3PB 1NRNH 3SUDA 1HGTH 1CVWH 3W95A 4WH6A 5C1XA 1KTTB 2ZFFH 1DUAA 4KTSA 2FS9A 1CA0B 1CE5A 3LC3A 2PWXA 3U8TH 1C1PA 3V0XA 4ABAA 1P9SA 1L1GA 4Y76A 5C2ZA 2A2QH 1GMDF 1UVTH 3D23A 1P2OA 4J1YA 2HOBA 1AWHB 1AKSB 2XNIA 4X8SH 2HPPH 1GGDB 2ZC9H 3TGKE 3UTUH 1MZAA 1S6HA 1EJMA 1SVPA 5K7RA 1QQ4A 1GBKA 1LKBA 2BLQA 1FAKH 3AAUA 1A0LA 3A80A 4Y0YE 2ZDKA 1K1NA 2GDEH 4YOIA 1XX9A 2AH4X 2JH0D 4X6OA 1WSSH 4X8VH 2BVSH 1HBTH 1QJ6B 1TNKA 2EC9H 1C2KA 2V3HH 4GCHG 1BRUP 2H5DA 3GCTG 4DCDA 1PPGE 4I8JA 2STAE 5K0HA 2PKAA 3W94A 3BTQE 1MD7A 1FJSA 2P94A 4X1NU 7LPRA 1C1UH 1DE7H 2BD7A 4CRBA 5BPEA 1IQJA 1SGYE 3F68H 1MZDA 2ZPQA 3FP8E 4MDSA 2V3OH 1J8AA 1MU6B 3UQVA 4TY6A 1TX7A 1LCYA 3ATIA 5DJ7A 2G55A 4OS5A 1SI5H 4Z0KA 2ZGJA 4B71A 1YPHE 1Z1JA 1KDQB 3OYPA 3SV2H 1ZPZA 2Y82A 2VH6A 1SPJA 1YP9A 3RXFA 1UTMA 3MH5A 1L2EA 1BMAA 2WUCA 3SV9A 3D62A 1TGNA 1O5CB 3DUXH 1GBAA 1CA0C 3A8CA 1ACBE 2D2DA 1H8DH 1P2NA 1NRRH 4A92A 3RM2H 2BDGA 1G2LA 1D9IA 2VIQA 3D49H 1AVWA 1MKXH 2VWNA 1O5FH 1MTNB 3QUMP 3MNXA 1UHBA 2UUFB 3BTKE 3LJJA 2OC8A 2TGPZ 2VVUA 1UCYH 1X7AC 4B75A 1GHAF 4GLYA 3MTYA 5EOKA 1A5IA 2HNTE 1TAWA 2O8LA 3SU0A 3RU4T 3L33A 4AB9A 1BJVA 2GDDA 2GVFA 1DWBH 4U2WA 6GCHG 1ANEA 3A87A 3BEFB 3LGYA 1JMOH 2VJ1A 1P11E 3QX5H 5GDSH 4UD9H 2B7DH 1H9LB 3PWBA 4UFEH 3TIUA 2VIVA 2TGAA 5FCKA 4I8HA 1FQ3A 1O34A 3TITA 3MNCA 1AO5A 1C5YB 4I32A 1N6XA 1VZQH 5AF9H 4CRCA 1FUJA 1HAPH 2BVRH 1O2RA 1CBWC 1CHOG 1V2QT 1GJCB 1KIGH 1P02A 1YKTA 1O3DA 3Q00A 3E0NB 3NK8A 4DVAU 1QL7A 1SQAA 5C67A 5ABWA 2H1UA 1IQHA 1JWTA 3FP6E 4NZLA 2G00A 2CHAB 1C2IA 3B23B 5HYOA 3BEUA 3A8DA 2G81E 2BD3A 3URDA 1EP6A 1TPPA 2BDCA 1ELAA 3H7TA 1SGEE 4Y71A 4FVDA 4NIXA 1Q31A 5GJ4B 1RS0A 2W3IA 2DE9A 1BMNH 1C5TA 1BUIA 2YOLA 1TOMH 3RXEA 3SUFA 2BLVA 1G3BA 3Q3XA 4AOQA 4Q2KA 5L2ZH 4IC6A 1EPTB 2XWBI 5F03A 1YYY1 2A7JA 3T5FH 2J94A 2P3TB 2VIDA 4IMQA 1P3CA 1T32A 2G4TA 1ZGVA 3Q3YA 3PM3A 2HALA 3MO9A 2R0LA 3O8RA 2HGTH 1BB0B 1C5UA 2RG3A 3MU5A 1TALA 4X1SU 4ZH8A 1GJ6A 1Z1IA 4LZ4B 1GCTC 1CGIE 1ZMNA 2BQ7B 1ELVA 1GL1A 1H9HE 4WH8A 5T3HA 4B73A 2ILNA 3CENA 1EZUC 3MU0A 4E05H 1SFQB 2VH0A 3EE0B 2B9LA 1V2ST 4NA9H 2BM2A 1VCWA 5EW1H 1BBRE 2CXVA 2FOHA 2ZPSA 3PMBB 1PPHE 3RXLA 5CHAB 3VB6A 1FI8A 2ZEBA 3P92A 5EQRA 2AMQA 3TJNA 1EQ9A 1PPEE 3A89A 1FXYA 1UHBB 1KLTA 4LK4A 3RUOA 1P0SH 1H4WA 5DP8A 3PMAB 3LGUA 1WBGB 4CR5A 5CMXH 1O0DH 1O3FA 2PHBA 4U30A 3M5MA 5IYTA 1IHTH 2XXLA 3S7KB 4CBNA 3K6ZA 4IN1A 3QZQA 5DP5A 5IDKA 3ZZ5A 1LPKB 3SJOA 3CS0A 1GBIA 2ZU4A 1RJXB 1JRTA 1KLIH 3SUGA 1ZTLA 1AQ7A 2DE8A 3ATKA 3LT3A 6LPRA 3SNAA 4XSKU 1D3QB 3UWIA 1P2MA 4UEHH 1YPJH 4FUDA 2FODA 1DXWA 1G3DA 1C1VH 1ESAA 3HPTB 3KEEA 2Z9GA 1HUTH 1TLDA 3A83A 1A3BH 4A1TA 2ZQ2A 2VGCC 2QXJA 2WYJA 3ZV8A 1AFEH 1C9PA 3E0PB 4NSVA 1WU1A 9ESTA 2Q1JA 1C5ZB 1ZYOA 5T6FA 2GMTB 2W3KA 3ZZDA 2PUXB 3KHVA 3CS7A 4ZAEA 5E0HA 4O97A 1GI0A 5A8XA 2Y5HA 5DO4H 3KF2A 4NFFA 1HNEE 5E0GA 1ZSLA 3EDXB 1GMCG 1LO6A 4UE7H 3LGTA 5FX6A 1D3DB 2VNTA 3M35A 3KQBA 2AGGX 3P6ZB 4YLUA 5DK1A 5EU8A 1GI9B 3VGCC 1KXAA 1JXPA 1J15A 1Z8RA 1TPSA 2FX6A 1LDTT 2JH6D 4AZ2B 1GMHF 1A7SA 3MWIU 2H5CA 1VITG 3EAJA 1RXPA 1RTLA 3NXPA 3PTBA 1HAYB 1BTWA 2ZU3A 1YPMH 1K2I1 1F0SA 3SU4A 1F0RA 1Z6JH 2BDBA 2C8WB 2YNAA 1TPOA 4MPWA 3A7VA 2ZGHA 2ZHWH 2FOGA 1T8MA 1TYNA 3GYLB 5DPAA 1K1LA 3NPSA 1G36A 2P93A 1P2QA 4K3JA 3SO3A 2EA3A 1K1PA 1HDTH 4TY7A 3ZVCA 4X2VA 1SC8U 2QCYA 3KN2A 3ODDA 2I6QA 4X8UH 3LU9B 1WTHD 1CQQA 4INHA 1AVGH 5C5NA 1O3HA 3MNBA 3T26A 1OP0A 1C1SA 1AMHA 1SOZA 4DGJA 3LPRA 1MKXK 2Y7ZA 3BTDE 1HB0B 1C5RA 2TGDA 3RXTA 4ISHH 1GHXH 5GCHF 1P57B 1BQYA 1E37B 1UCYK 2WV4A 4ZKSU 1BIOA 1QY6A 4XBCA 1GI3A 1UTPA 3QGJA 1NFYA 4KELA 1ARBA 3EQ0H 1FAXA 1NFXA 5F8ZA 5E8EH 3UQOA 1JIRA 4GPGA 3KQCA 2BDAA 2UUKB 1MCTA 1SB1H 2NWNA 2FOBA 1OPHB 1SQOA 1OWEA 1P8VC 1GI7B 3F9HA 5H4IB 2SGEE 1PJPA 1IQFA 1UTNA 4ZUHA 4D7GA 1UTKA 5HM9A 3RXPA 2QXIA 3QWCH 1C5PA 2ZNKH 2JETB 1OYTH 4MNVA 3OTJE 3SQHE 2BD2A 1ANCA 4O9VA 2P3UB 1CT0E 4XOJA 2BX3A 2PW8H 4ABJA 5ESTE 2VB0A 3MH6A 1P9UA 1W11U 2VIPA 1GI1A 2AGEX 2BY6X 2FOMB 3IWMA 2HNTF 3M7UA 4IC5A 1UCYE 1UTJA 3UOUA 2QN5T 4AG1A 3LH1A 1W0ZU 3KCGH 1C5XB 2C8ZB 3HK3B 5I46H 1GJBB 1C1QA 3VEQB 2PLXA 1EZXC 8GCHG 1O2OA 2ZGBH 1NY22 2ZKSA 1LQEA 8LPRA 1P06A 2BOKA 2AGIX 6CHAB 5HXFA 3IG6B 3TLOA 1EAXA 2UUJB 5DG6A 1OYQA 2BYAX 3M7TA 5TJXA 3U1IB 1SR5C 2A0QB 5JB9S 3SV8A 1WTGH 2GT8A 2A5KA 3TU7H 4YOJA 2H9EH 2XC5A 4OS1A 3GY5A 1DT2A 2UWOA 4RN6A 1DLKB 1BITA 1YCPM 1GI6A 3MNSA 1VJAU 4ESTE 2J9NA 1SQTA 2VINA 4LZ1H 5EXNA 4XDEA 2G5VA 2D26C 1LKAA 2FTLE 2O9QA 1RTFB 1F92A 2ALPA 1OS8A 2DUCA 3I29A 3F1SB 1J9CH 1HAVB 1C5LH 1V2PT 2CMYA 5GCHG 1SGFG 1GBEA 3SJKA 1MU8B 4ZKRU 4MNWA 2VVCA 2ZU1A 2GZ9A 4Y8YA 5TCAA 1AUJA 2PTCE 2D1JA 1NTPA 1GL0E 4GCHF 2PTNA 1DY9A 3GCTF 2BDHA 2XCNA 1SBWA 2ZQ1A 2QGRA 1A5GH 3TGIE 4U01A 1BJUA 1TGSZ 3ZVAA 4IS5A 2QA9E 5A8YA 5HGGA 3V7TA 4JZFH 1O5DH 3LONA 3R0FA 1G37A 1ELFA 5JBCS 4CH2B 4NIVA 1TBRH 3SUEA 3TNTA 2QV1A 2CF8H 2OINA 2WPKS 3QTVH 3RDZA 3E91A 1TE0A 1HIAB 1YBWA 2ANMH 2NU0E 3B8JA 4WWYA 4CREA 4X1PU 5DP9A 1MQ5A 1GI4A 6CHAC 1Y3UA 2P3FH 2QY0B 4B2AA 1YC0A 1ARCA 1ELEE 2FLRH 2OQ5A 4M7GA 1HFDA 1EASA 2VU8E 1O3JA 1P04A 3A7ZA 4I33A 3ZZBA 1MKWH 2Q6GA 5A0BA 1IQMA 2XC0A 1ORFA 7ESTE 1K9OE 4ZROA 1S6FA 2ZFPH 1DPOA 6ESTA 4CRFA 2FP7B 2PSYA 2XCFA 4BTUB 2XRCA 3R3GB 3NWUA 1D4PB 4DOQA 1AFQC 3S7HB 1GG6C 2HLCA 2ZHEH 3U8OH 5B6OA 1ID5H 4LXBH 3O8DA 2P16A 3VXFH 2BTCE 1JOUB 6GCHF 4Y79A 1AUTC 1ETSH 1QRXA 1GHVH 1AGJA 1IOEA 1THRH 4WMEA 1T8NA 3RXMA 3ZZCA 1FIZA 5ESBA 4A5TS 1ZLRA 3F6UH 2BD4A 1KYNA 3MHWU 1LVYA 2BY7X 5F8TA 1FONA 1HXFH 2OD3B 4INLA 1GWAA 1S85A 4BOHA 1CT4E 3QLPH 4UFGH 4MPVA 1Y5AT 1CHOF 1HXEH 1CHGA 3B9FH 1S0RA 4ABFA 2FZZA 4YT6H 2M5TA 1TRMA 1F2SE 2Z9JA 4MTBA 3S9BA 3MMGA 4NIYA 1C2HA 1H8IH 1YLDA 1O2IA 1QHRB 3RMNH 5FX5A 2P59A 2TRMA 3I78A 4K8YA 3ZZAA 1TGCA 1K1MA 1O31A 2Z3DA 5T6DA 2PUQH 1EPTA 1V2TT 1TNGA 2ESTE 1TQ0B 1MTSA 1NFUA 3RXAA 3RMOH 1W2KH 4H4FA 5DP7A 3STJA 2OBOA 1EX3A 1O2XA 1CBWB 3ZZ4A 3HK6B 1K1JA 4AFZA 2SGAA 1V6DA 3QZRA 3PWCA 1ELBA 3GDVA 4FUFA 1NM6A 1LHFH 2CGAA 3FAOA 3P8FA 1A4WH 2GCTC 1IQIA 4GHTA 2XYAA 1TNIA 3ZZ6A 3A81A 3MFJA 3FZDA 1LQDB 2ZFTA 1GBLA 5FPSA 1YPLH 3GY6A 1SGFA 2EI6A 4AGJA 4AYYB 2R2MB 1W7GH 2AFQB 3RXHA 2PSXA 4ISOA 2A7CA 2ZF0H 2FLBH 1CT2E 1C5WB 1ABIH 2SGFE 2ZFRH 2AYWA 5EG4A 1FPHH 1B0FA 2ZTYA 1DLEA 1O2HA 5FXLA 1ELDE 1NRSH 2FXRA 1F5LA 1AB9C 2BY8X 4Y7BA 4DG4A 1QTFA 4K5ZA 3VFEA 2ANYA 2IJOB 2P95A 1W13U 4OS4A 4IN2A 3AW0A 1AD8H 4FUIA 3DFJA 1GCTB 1C5OH 1SGNE 3V3MA 3HKJB 1KXEA 2ZU5A 3A7YA 1HV7A 1BHXB 1W3CA 2QAAA 3RMLH 2EI8A 1FV9A 1VITH 1TRYA 1OWHA 3E8LA 1O2SA 5JYIA 1O2TA 2F91A 3T27A 3ZV9A 2THFB 3MYWA 5PTPA 1DSUA 2HPQH 1O36A 1OP8A 2W7SA 2Y5GA 3UWJH 1TNLA 1KXBA 4DW2U 4IGDA 4ZMAH 1C1WH 1O35A 1FY4A 2KAIA 1W7XH 1BBRK 5F6MA 1NRPH 1UK2A 2ZDNA 3M3VA 1MD8A 3BTHE 5L6NH 3SNCA 4D9QA 2OP9A 5BRRE 1GHBG 3M36A 3ZVDA 1S0QA 1O3GA 2V35A 1HAIH 3TJUA 1AHTH 2RA3A 2FESH 1MCVA 1S81A 1DITH 3P17H 3UIRA 1GMCF 5LPEA 1V2MT 1N8OC 1SGTA 4HTCH 1KSNA 1THPB 3TJVA 3O8CA 2VGCB 1XUHA 1LHCH 2Z3CA 4IMZA 1S83A 4H42U 3LGVA 1VITF 1O3EA 4JZIA 1UTLM 1A1RA 2ODQA 2NU2E 1QL9A 1NO9H 5J4QA 4HI3A 3ESTA 3OY5U 2FOFA 1LPZB 1UO6A 2C93B 1GJ8B 2ZI2H 1ZPBA 4Y8XA 4D9RA 4UDWH 2C8XB 1TGBA 3A8AA 3SHAH 4Y0ZE 3U69H 1Y8TA 4ABHA 4GHQA 1EP5A 2GGVB 1O2QA 2Z7FE 4YLQH 3A84A 3SNDA 5CE1A 4I8LA 1QB1A 1T7CA 1QQUA 3VGCB 5C20A 4GVUA 7KMEH 4TWWA 3ZZ7A 3M5LA 1LHGH 1HRTH 3EGKH 2WPLS 3QGNB 3JZ1B 3S9AA 1YM0A 3EA7A 1FNIA 4D8NA 3PLPA 1C2EA 3E16B 1GBTA 1O30A 2FYQA 1UVOA 2ZTZA 3U1JB 1HLTH 3RU4D 1CU1A 3QDZB 3F9EA 2A4GA 1A0JA 4CHAB 4DIIH 1AE8H 1THSH 2Y6TA 3Q3KA 2FI5E 1HPGA 1E34B 5LGOA 1EKBB 4WXIA 2PGQB 1QFKH 3TPIZ 2W26A 1CO7E 3GYMA 1MAYA 1NROH 3SBKA 4HFPB 1YGCH 2ZDAH 2FDAA 1UVSH 2LNCA 3D65E 5LH8A 4GAWA 3C27B 1ESTA 3RC5A 1AVXA 1TOCB 4FU7A 3SU6A 1PPBH 3HGPA 2ALVA 1BHXF 1NPMA 1UVPA 1VR1H 2O8TA 3ZZ3A 1C5VA 1C5MD 3RMMH 2BY5X 2A2XH 2KAIB 3MH7A 1EUFA 3T29A 3UREA 1O5BB 1BTYA 2XC4A 5FCRA 1G3EA 2FM2A 2A4QA 2F9NA 3AASA 1EAUA 3PLBA 1PPZA 8KME2 3ZVFA 1TA2A 4X1QU 4Y7AA 1SLVB 4WJG2 3A85A 4ZHAA 2ZG0H 3HKIB 2EEKA 1D6RA 1A61H 2QC2A 2Y81A 3VB5A 2XWAA 2ZECA 2BDIA 4INKA 1EAWA 2QF0A 3T28A 1OKXA 1EZSC 3KIDU 3UY9A 5EW2H 1FN8A 1O39A 1U6QA 8GCHF 2VIWA 2ZTXA 2UWPA 1VCPA 1XUJA 3BIUH 4ZHLU 5A0AE 4YM9A 1YPHC 1SSXA 1TWXB 4X8TH 2F9VA 2VVVA 4UONA 4CHAC 1F5RA 2WINI 1ELCA 3RXIA 1ZSKA 5SGAE 3BTGE 5JDUB 1BRBE 2ZP0H 1QNJA 4H6TA 4JZDH 4AFUA 3M5OA 4AB8A 5DKMA 1NC6A 1L4ZA 1MTVA 1AI8H 1AY6H 4FU8A 5EQQA 1HAVA 5DP6A 3UNSA 1C5QA 4Q7YA 2P8OC 2Z9IA 2ZDVH 3TJOA 1MBMA 2SGPE 1GVKB 2SGDE 1F0TA 2O8MA 1YPGH 4CRDA 1UTOA 1H1BA 1SGQE 4LOYH 1P10A 2IN2A 4YESB 1O37A 4VGCC 4NCYA 1TBZH 1VGCB 1ZPCA 1J14A 1HAOH 1DS2E 3GY3A 1TB6H 4O3UA 3DFLA 2BDYA 4A1VA 5EODA 3UR6A 1WYKA 4KTCA 3RXCA 1HIAA 1BMLA 2UWLA 1Y3VA 2B0FA 2FEQH 5EXLA 4ABIA 4AFQA 1V2OT 1EB1H 1OWJA 1WV7H 3QN7A 2WPHS 1C2FA 2QXGA 1QJ1B 1T31A 4BNRA 2XBXA 2AMDA 2QXHA 5EXMA 3BG4C 1SGIB 2B5TB 1C5NH 2H6MA 3ITIA 2ZFQH 3GDUA 1IQEA 3RXGA 2SFAA 2F9PA 4JMYA 3EYDA 4BXWA 3LKWA 1GDQA 4WY3A 1QBNA 1O2NA 1HJ8A 4ZXXH 3TK9A 1HJAC 3EA8A 1BTPA 2GD4B 3NUMA 1HAHH 1XUIA 1VCQA 2C4FH 1UVUH 1C2GA 2PFEA 5FBIA 1OWKA 2GT7A 1DWCH 1ZSJA 5FPTA 1BMMH 4WF8A 4YZUA 1P01A 1DICA 3OSYA 4YOGA 5HM2A 3SNEA 1SGCA 1JBUH 1BTXA 1FDPA 3S9CA 1F5KU 3CP7A 1G9IE 2WPIS 3SOSA 2BD9A 2FPZA 2R2WU 1MTWA 4O03A 1S84A 3MH4A 1YCPH 1TX6A 1VGCC 2GV6A 2BQ6B 1E36B 4WMFA 1Q2WA 2TBSA 1E35B 4K69A 1ZJKA 2BLOA 3OX7U 9LPRA 2BZ6H 3A7XA 3SQEE 5FPYA 3P8NA 1O3MA 1TRNA 1OWDA 1C4U2 3KL6A 1TNHA 4RSPA 4MG3A 1HAGE 3KGPA 1C4Y2 4FVBA 5C1YA 3GY8A 4K2YA 1BT7A 1DANH 4CBOA 2BXUH 4DIHH 1LVOA 1KXFA 3MU4A 1QA7A 3UNQA 1AFQB 1GG6B 1K1IA 1B0EA 1ZTJA 4OGYA 4BAMB 2STBE 4NWLA 1SOTA 1DWDH 4ISLA 2FOEA 4ABDA 1TMTH 1EXFA 1TIOA 1O2PA 4ZKNU 2BLWA 3RXSA 2J34A 4YTAA 1PYTD 4MLFB 4Z6AH 3FZZA 3MU8A 3V12A 4KTUA 1NU9A 2ULLA 4SGAE 3L6PA 1SGPE 2G51A 2NU3E 1QGFA 4E7RG 3S69A 5E0JA 1PPFE 1KTSB 4XBBA 2AIQA 1J16A 2PR3A 1L0ZA 1GJ7B 2F3CE 1W12U 2J38A 4Q80A 1ZR0A 5I25A 1DM4B 1A0HB 3PV4A 1W0YH 1BTHH 7GCHG 1LVMA 1O3BA 5DP3A 3SGQE 1Z8JB 3K6YA 1C2MA 2R3UA 4ABBA 1O2VA 1ABJH 1TA6A 5GWZA 2WV5A 1W8BH 1G3CA 4FU9A 3GDSA 1PQ7A 4SGBE 2FMJA 3M61U 1BA8B 4MPUA 4JK6A 4U32A 1V2JT 1SG8B 4BXSA 3H5CB 4THNH 4JYTA 2VIOA 2O8UA 2GCTB 2ZZUH 3SJ9A 3PMJA 3BIVH 2A5IA 3GY7A 3TH4H 4J2YB 3RXOA 4X1RU 2J92A 1T8OA 3BSQA 4A6LA 3TK5A 1LHEH 1PPCE 2A5AA 1YPKH 5JPMH 2Y7XA 2VWMA 1J17T 3IITA 2GZ8A 3ENSB 2ZGCA 1C1TA 3DHKH 2OXSA 1XXFA 4DT7B 2BQWB 3GY4A 4D76A 1EZQA 3BTFE 2IOTA 1O5EH 3BN9A 4ZHMU 4XFQA 2OC0A 1ESBA 1AB9B 4BAKB 1DWEH 3SI4H 1D3PB 2C3SA 4RKOB 2RCEA 1TPAE 2GCHG 3GCNA 1A5HA 1TX8A 3ATWA 3UR9A 3GCHB 2F9BH 5A0CA 3SJ8A 1P05A 1OWIA 1OXGA 2WPJS 4NA7A 1B5GH 3E6PH 5GIBA 1DY8A 1N1LA 1V2LT 1EJAA 3C1KA 3SZNA 1GHBF 1ELGA 2BOHB 1Z8IB 2CF9H 1B7XB 4AG2A 2Z9LA 2BVXH 2G52A 1ZMLA 2PKSC 4FXGH 1GPZA 1C1OA 1GBMA 2UUYA 2AIPA 1K22H 2GKVE 3SJIA 4AFSA 4NA8A 1HAZB 2OCVB 1EJNA 3I77A 3ZZ8A 1ETTH 2Z6BD 1RIWB 3M3TA 4NSYA 1ZRKA 1JIMA 4ZKOU 5T6GA 1S5SA 3SU5A 3QK1A 2LPRA 1AZ8A 1ANDA 1V2UT 2AMPA 1TGTA 2JKHA 4FUBA 3SGBE 2FX4A 2Y5FA 1O3IA 3ATLA 3A8BA 3UUZA 1FLEE 4JZ1A 3PMHB 1PYTC 4B1TA 1NU7B 1KXDA 2GTBA 1GVLA 3F9GA 3P95A 1UMAH 2I6SA 1NESE 2D8WA 4CRAA 4BANB 3AVZA 1N8OB 3LGWA 1Y3YA 3A7WA 3ZVGA 3RXJA 2FS8A 1BTZA 2ZPRA 1GHZA 3UOPA 4IBLH 1OSSA 4X6PA 1UK4A 2ZCHP 3GCHC 2A31A 4B2CA 1GGDC 3HATH 3VXEH 5JBAS 4RKJB 4FUHA 3LJOA 4DURA 3A88A 2BX4A 2HVXA 1WQSA 1RGQA 5L30H 1DUEA 1PQAA 3M3SA 2OC1A 2ASUB 4FUEA 1FN6A 1PFXC 1QA0A 4MNYA 4F4OC 1Y3WA 3GOVB 1FY3A 2Q6DA 1KXCA 1QCPA 3SV7A 2J95A 1BZXE 2SGQE 3L3TA 1UK3A 1YCPK 1G32B 2Z9KA 1GMDG 3RXRA 1E0FD 5DP4A 3PTNA 1RIWC 1OX1A 3NKKA 3TH2H 4KP0A 1C2DA 3NCLA 1QB6A 4NG9H 4O3TA 4X2YA 4X2XA 1VJ9U 2Z3EA 5G4BA 3DT0H 2OQUA 2XBWA 3RXUA 4E06H 1XVMA 5FHTA 4Y6DA 3A7TA 3FP7E 1T4UH 5AHGH 5GPIB 1P03A 4B76A 3TNSA 1P2KA 1UJ1A 3GCOA 1ZMJA 2NU4E 2GZ7A 2ZHQH 2WPMS 1D6WA 1NFWA 2Z94A 3KQEA 3KQDA 1S82A 1MBQA 3RXKA 1ETRH 3RU4E 1NN6A 2RDLA 1CA8B 1MTNC 2ZHFH 4MVNA 1SMFE 1LMWB 4AYVB 3P8GA 2PKAB 3ODFA 3MOCA 3PO1B 4UFDH 4I8KA 4PROA 1QJ7B 1BRCE 1ZRBA 1ZTKA 3OY6U 3V13A 2HWLB 1TMUH 1F7ZA 3MO3A 3RXBA 4YT7H 5A2MH 3VB3A 1NRQH 3O8BA 4CH8B 3TVJB 4NGAH 5EGMA 1C4V2 4Y10E 1DX5M 1SHHB 2Y80A 1XM1A 4JZEH 2OC7A 2HRVA 1BDAA 3SU3A 2CJIA 2FWWA 1QRWA 1M9UA 2BD5A 5AFZH 4BAOB 2AERH 1CSOE 1O2JA 5F8XA 5JB8S 2TPIZ 1SHYA 1ZZZA 4K1SA 1QRZA 4K8BA 5EPYA 3A82A 3AAVA 1FMGA 1MTUA 1O2KA 1C2LA 1MMJN 4ABGA 5AFYH 1FPCH 2GV7A 1BCUH 3RXVA 1GHAG 4K60A 1MKWK 3UFAA 3ZZ9A 1GDUA 4R8TB 1V3XA 5A09A 2CHAC 1H9IE 2A1DB 1O3LA 2ZCLP 1BOQA 1GBDA 1SFIA 4XBDA 2FYRA 1O32A 1RTKA 1YLCA 1C9TA 3MU1A 4Q7ZA 4I31A 1OOKB 3ZYEA 3SW2B 1BTUA 3E1XB 5C5OA 4BTTB 1Q3XA 5FBEA 2F9UA 1HCGA 3P8OA 3PO1C 1EPTC 1LPGB 1HJ9A 4A7IB 1TABE 3K2UA 1SGDE 3HGNA 3LGIA 1CGJE 3T62A 1L4DA 4X0WU 2P8OB 1C1MA 5LPRA 2XW9A 1GBBA 1O2LA 1FY1A 2BZAA 1W10U 1XUFA 2R0KA 3A86A 1XVOA 1INCA 2O8WA 1V2KT 1AIXH 1W14U 4NIWA 2J4IA 2A4OA 4ISIH 1T4VH 1C2JA 1DFPA 4VGCB 1GBJA 3E90B 1A3EH 1XMNB 2IPHA 1SLWB 4IW4E 1T8LA 1JRSA 4D7FA 3VB7A 1DXPA 5TCCA 4DJZB 1TFXA 1L1NA 3ELAH 5GXPA 5FAHA 2OLGA 1MQ6A 1ZHMA 3RXDA 5CHAC 1MAXA 1IAUA 2BD8A 2ANWA 2FTMA 1GJDB 3SV6A 3BG4B 2Q6FA 4CRGA 3BTTE 1LTOA 3M7QA 1DSTA 2VWLA 2YNBA 2QF3A 3GISB 2R3YA 4Q7XA 2CN0H 2A32A 4MPXA 3SN8A 1WCZA 1PQ5A 3BEIB 2ANKH 4UFFH 1EOJA 4ISNA 1K1OA 4OGXA 1EB2A 2FOCA 4A1XA 2ZWLH 4TPYA 1Y5BT 4BAQB 4OS6A 1C1NA 1HJAB 3PROA 4TWYA 3VB4A 2EI7A 2XTTB 3LC5A 1O38A 3PLKA 3OU0A 2TIOA 1P3EA 1TMBH 1O2MA 1WUNH 4X2WA 4Y11E 5A8ZA 1QB9A 1ZGIA 2ZGXH 4JYVH 1GI2A 1KLJH 3FANA 3VPKA 2HNTC 5JBBS 3TGJE 1XUGA 3GICB 3LDXH 3RXQA 3M37A 4I7YH 4AGKA 1SGRE 1GJAB 4GSOA 3BF6H 2BHGA 1C1RA 3KNXA 5L2YH 1YF4A 3NZIA 1QIXB 2H2ZA 3UNRA 3LH3A 1AZZA 2FI3E 4Y8ZA 3ZVBA 2XBVA 2GMTC 3MI4A 2ZDLA 3SU2A 3URCA 2XBYA 1WAYB 3FFGA 4KGAA 1G2MA 1ANBA 4NWKA 1QBVH 1QR3E 1OP2A 2TGTA 4AX9H 3K9XB 4XE4A 2ZIQH 4JYUH 4CR9A 2SNWA 1FZZA 3RP2A 2H9HA 2VWOA 5E2OA 4QT8C 1E38B 2ODYB 1P2JA 3FVFB 2ZHDA 1TNJA 5LPFA 4K1TA 2H9TH 2ZCKP 1XKBC 7GCHF 1HAXB 1F0UA 1SLXB 5EQSA 1XXDA 4DY7B 2FI4E 2ZA5A 4WXVA 2B8OH 1EOLA 1FY8E 1ZJDA 2NU1E 3LIWA 4GUXA 4TPIZ 3U98H 3TH3H 2SNVA 1GJ4H 3QO6A 3TK6A 2ZDMA 4I8GA 3T25A 1GVZA 1P12E 1ELTA 4ASHA 1RD3B 3F9FA 5EPNA 4KKDA 4WVPE 1Y5UT 3SU1A 1A2CH 1RRKA 4B74A 1QL8A 1EAIA 2OBQA 2ZFSA 3ZYDA 1Y59T 3AW1A 4R0IA 1DOJA 1GI5A 2F83A 1IQNA 1GI8B 1GMHG 2R9PA 5C1UA 2C8YB 1SL3A 1DVAH 1XUKA 2C90B 4OS2A 3H7OA 1WOFA 2OUAA 5HMAA 3BTWE 2GX4A 1QURH 3T2NA 2QIQA 4ABEA 2FOAA 1O3OA 1V2RT 3U9AH 2AS9A 3BTEE 1CGHA 1D3TB 5JBTA 1O2GH 1NT1A 1XKAC 3JZ2B 1Z71A 3PYHA 4NZQA 2K1QA 3BV9B 1FIWA 2G5NA 1WQVH 2G8TA 1EATA 3STIA 2RA0A 1BBRH 1AKSA 2V6NA 3K65B 1GJ9B 1LHDH 1V2VT 3SI3H 1DDJA 3UPEA 4FUJA 1Y3XA 4HGCA 1O3KA 8ESTE 1O2ZA 1AN1E 1FY5A 2GCHF 1O3AA 1AU8A 2A45B 2ODPA 2JETC 4FUCA 2PGBB 3SGAE 2BY9X 2JH5D 4K1EA 2A7HA 1Z8GA 1GDNA 1O3NA 2F9OA 3RC4A 1BRAA 1LVBA 1TBQH 3BTME 1HYLA 1NS3A 1K28D 4WMDA 1O33A 2WYGA 5ETXA 1AWFH 1SLUB 1V2WT 1GBCA 1MH0A 1RFNA 3SORA 5E2PA 1IQLA 3ATMA 4AN7A 1AE5A 1MUEB 1IQGA 1O3CA 2W5EA 1GJ5H 1ZOMA 3SNBA 3G01A 4BAHB 3DD2H 4YO9A 4JCNA 2ZO3H 1GCDA 3S0NA 2BXTH 3Q77A 2AEIH 1O2YA 1UTQA 1IQKA 3PB1E 1QBOA 1N6YA 4MQAA 1ZHPA 1GBHA 3SHCH 4MNXA 4ZXYH 4JK5A 3BG8A 1KDQA 2PV9B 1ZHRA 4AORA 4BTIB 5J4SA 1YPEH 3Q76A 3P70B 1Z7KA
chains in the Genus database with same CATH superfamily
2ZU2A 4NFEA 3QTOH 4TYDA 4H6SB 1E1QD 1C5SA 5AVDA 4FUGA 1O5AB 3ZVEA 5DGJA 1G30B 1KY9A 5C3NA 4F49A 2CV3A 1V2NT 2PKSB 3GY2A 1K21H 2OTVA 1TONA 1GHWH 3N7OA 4AC9A 2FIRH 1Z6EA 1L1JA 3KYFA 2G4UA 3RM0H 4X6MA 3E3TA 1NZQH 3RLYH 3RLWH 3ZIAD 2BMGB 2GP9B 1GHYH 2WUBA 1O2UA 4E7NA 3DA9B 1O5GH 1P09A 4B2BA 2BB4A 2V0BA 1P2IA 3LOXA 2A4RA 3EA9A 3WY8A 4OS7A 2J2UA 2FO9A 3MO6A 3U8RH 1A46H 1IHSH 4X6NA 1O2WA 2J5UA 3RC6A 1TQ7B 2QYIA 2W7UA 4HZHA 1GBFA 1PQ8A 3M5NA 1O3PB 1NRNH 3SUDA 3MQKC 1HGTH 1CVWH 3W95A 4WH6A 5C1XA 1KTTB 2ZFFH 1DUAA 4KTSA 2FS9A 1CA0B 1CE5A 3LC3A 2PWXA 3U8TH 5KGOA 1C1PA 3V0XA 4ABAA 1P9SA 1L1GA 4Y76A 5C2ZA 2A2QH 2V3MA 1GMDF 1UVTH 3D23A 1P2OA 4J1YA 2HOBA 1AWHB 1AKSB 2XNIA 4X8SH 2HPPH 1GGDB 2ZC9H 3TGKE 3UTUH 1MZAA 1S6HA 1EJMA 1SVPA 4ACAA 5K7RA 1QQ4A 1GBKA 1WDIA 5GNDA 1LKBA 2BLQA 1FAKH 2WHXA 3AAUA 1A0LA 3A80A 4Y0YE 2ZDKA 1K1NA 2GDEH 4YOIA 1XX9A 2AH4X 2JH0D 4X6OA 1WSSH 4X8VH 2BVSH 1HBTH 1QJ6B 1TNKA 2EC9H 1C2KA 2V3HH 4GCHG 1BRUP 2H5DA 3GCTG 4DCDA 1PPGE 4I8JA 2STAE 5K0HA 2PKAA 3W94A 3BTQE 1MD7A 1FJSA 2P94A 4X1NU 7LPRA 1C1UH 1DE7H 2BD7A 4CRBA 5BPEA 1IQJA 1SGYE 3F68H 1MZDA 2ZPQA 3FP8E 4MDSA 2V3OH 1J8AA 1MU6B 3UQVA 4TY6A 1TX7A 1LCYA 3ATIA 5DJ7A 2G55A 4OS5A 1SI5H 4Z0KA 2ZGJA 4P00A 4B71A 1YPHE 1Z1JA 1KDQB 3OYPA 3SV2H 1ZPZA 2Y82A 2VH6A 1SPJA 1YP9A 3RXFA 1UTMA 3MH5A 1L2EA 1BMAA 2WUCA 3SV9A 3D62A 1TGNA 1O5CB 3DUXH 1GBAA 1CA0C 3A8CA 1ACBE 2D2DA 1H8DH 1P2NA 1NRRH 4A92A 3RM2H 2BDGA 1G2LA 1D9IA 2VIQA 3D49H 3FKSD 1AVWA 1MKXH 2VWNA 1O5FH 1MTNB 3QUMP 3MNXA 1UHBA 3DSGA 2UUFB 3BTKE 3LJJA 2OC8A 2TGPZ 2VVUA 1UCYH 1X7AC 4B75A 1GHAF 4GLYA 3MTYA 5EOKA 1A5IA 2J97A 2HNTE 1TAWA 2O8LA 3SU0A 3RU4T 3L33A 4AB9A 1BJVA 2GDDA 2GVFA 5HKKD 1DWBH 4U2WA 6GCHG 1ANEA 3A87A 3BEFB 3LGYA 1JMOH 2VJ1A 1P11E 3QX5H 5GDSH 4UD9H 2B7DH 1H9LB 3PWBA 4UFEH 3TIUA 2VIVA 2TGAA 5FCKA 4I8HA 1FQ3A 1O34A 3TITA 3MNCA 1AO5A 1C5YB 4I32A 1N6XA 1VZQH 5AF9H 4CRCA 1FUJA 1HAPH 2BVRH 1O2RA 1CBWC 1CHOG 1V2QT 1GJCB 1KIGH 1P02A 2M2AA 1YKTA 1O3DA 3Q00A 3E0NB 3NK8A 4DVAU 1QL7A 1SQAA 5C67A 5ABWA 2H1UA 1IQHA 1JWTA 3FP6E 2J98A 3CNRA 4NZLA 2G00A 2CHAB 1C2IA 3B23B 5HYOA 5HIYA 2QE7D 3BEUA 3A8DA 2G81E 2BD3A 3URDA 1EP6A 1TPPA 2BDCA 1ELAA 3H7TA 1SGEE 4Y71A 4FVDA 4NIXA 1Q31A 5GJ4B 1RS0A 2W3IA 2DE9A 1BMNH 1C5TA 1BUIA 2YOLA 1TOMH 3RXEA 3SUFA 2BLVA 1G3BA 3Q3XA 5HIZA 4AOQA 4Q2KA 5L2ZH 4IC6A 1EPTB 2XWBI 5F03A 1YYY1 2A7JA 3T5FH 2J94A 5C0TA 2P3TB 2VIDA 4IMQA 1P3CA 1T32A 2G4TA 1ZGVA 3Q3YA 3PM3A 2HALA 3MO9A 2R0LA 3O8RA 2HGTH 1BB0B 1C5UA 2RG3A 3MU5A 1TALA 4X1SU 4ZH8A 1GJ6A 1Z1IA 4I86A 4LZ4B 1GCTC 1CGIE 1ZMNA 2BQ7B 1ELVA 1GL1A 1H9HE 4WH8A 5T3HA 4B73A 2ILNA 3CENA 1EZUC 3MU0A 4E05H 1SFQB 2VH0A 3EE0B 2B9LA 1V2ST 4NA9H 2BM2A 1VCWA 5EW1H 1OHHD 2KX4A 1BBRE 2CXVA 2FOHA 2ZPSA 3PMBB 1PPHE 3RXLA 5CHAB 3VB6A 1FI8A 2ZEBA 3P92A 5EQRA 2AMQA 5C94A 3TJNA 1EQ9A 1PPEE 3A89A 1FXYA 1UHBB 1KLTA 4LK4A 3RUOA 1P0SH 3U28C 1H4WA 5DP8A 3PMAB 3LGUA 1WBGB 4CR5A 5CMXH 1O0DH 1O3FA 2PHBA 4U30A 3M5MA 5IYTA 1IHTH 2XXLA 3S7KB 4CBNA 3K6ZA 4IN1A 3QZQA 5DP5A 5IDKA 3ZZ5A 1LPKB 3SJOA 3CS0A 1GBIA 2ZU4A 1RJXB 1JRTA 1KLIH 3SUGA 1ZTLA 1AQ7A 2DE8A 3ATKA 3LT3A 4P02A 6LPRA 3SNAA 4XSKU 1D3QB 3UWIA 1P2MA 4UEHH 1YPJH 4FUDA 2FODA 1DXWA 1G3DA 1C1VH 1ESAA 3HPTB 3KEEA 2Z9GA 1HUTH 1TLDA 3A83A 1A3BH 4A1TA 4M9FA 2ZQ2A 2VGCC 2QXJA 5B6LA 2WYJA 3ZV8A 1AFEH 1C9PA 3E0PB 4NSVA 2J98B 1WU1A 9ESTA 2Q1JA 1C5ZB 1ZYOA 5T6FA 2GMTB 2W3KA 3ZZDA 2PUXB 3KHVA 3CS7A 4ZAEA 5E0HA 4O97A 1GI0A 3SYJA 5A8XA 2Y5HA 5DO4H 3KF2A 4NFFA 1HNEE 5E0GA 1ZSLA 3EDXB 1GMCG 1LO6A 4UE7H 3LGTA 5FX6A 3AK5A 1D3DB 2VNTA 3M35A 3KQBA 2AGGX 3P6ZB 4YLUA 5DK1A 5EU8A 1GI9B 3VGCC 1KXAA 5EJLA 2HLDD 1JXPA 1J15A 1Z8RA 1TPSA 2FX6A 1LDTT 2JH6D 4AZ2B 1GMHF 1A7SA 3MWIU 2H5CA 1VITG 3EAJA 1RXPA 1RTLA 3NXPA 3PTBA 1HAYB 1BTWA 2ZU3A 1YPMH 1K2I1 1F0SA 3SU4A 1F0RA 1Z6JH 2BDBA 2C8WB 2YNAA 1TPOA 4MPWA 3A7VA 2ZGHA 2ZHWH 2FOGA 1T8MA 1TYNA 3GYLB 5DPAA 1K1LA 3NPSA 1G36A 2P93A 1P2QA 4K3JA 3SO3A 2EA3A 1K1PA 1HDTH 4TY7A 3ZVCA 2GJGA 4X2VA 1SC8U 2QCYA 3KN2A 3ODDA 2F43B 2I6QA 4X8UH 3LU9B 1WTHD 1CQQA 4INHA 1AVGH 5C5NA 1O3HA 3MNBA 3T26A 1OP0A 1C1SA 1AMHA 1SOZA 4DGJA 3LPRA 1MKXK 2Y7ZA 3BTDE 1HB0B 1C5RA 2TGDA 3RXTA 4ISHH 1GHXH 3DSOA 5GCHF 1P57B 1BQYA 1E37B 1UCYK 2WV4A 4ZKSU 1BIOA 1QY6A 4XBCA 1GI3A 1UTPA 3QGJA 1NFYA 4KELA 1ARBA 3EQ0H 1FAXA 1NFXA 5F8ZA 5E8EH 3UQOA 1JIRA 4GPGA 3KQCA 2BDAA 2UUKB 1MCTA 1SB1H 2NWNA 2FOBA 1OPHB 1SQOA 1OWEA 1P8VC 3FO8D 1GI7B 3F9HA 5H4IB 2SGEE 1PJPA 1IQFA 1UTNA 4ZUHA 4D7GA 1UTKA 5HM9A 3RXPA 2QXIA 3QWCH 1C5PA 2ZNKH 2JETB 1OYTH 4MNVA 4B6FA 3OTJE 3SQHE 2BD2A 1ANCA 4O9VA 2P3UB 2KCPA 1CT0E 4XOJA 2BX3A 2PW8H 4ABJA 5ESTE 2VB0A 2KCAA 3MH6A 2XOKD 1P9UA 1W11U 2VIPA 1GI1A 2AGEX 2BY6X 2FOMB 3IWMA 2HNTF 3M7UA 3F2GA 4IC5A 1UCYE 1UTJA 3UOUA 2QN5T 4AG1A 3LH1A 1W0ZU 3KCGH 1C5XB 2C8ZB 3HK3B 1NBMD 5I46H 1GJBB 1C1QA 3VEQB 2PLXA 1EZXC 2JIZD 8GCHG 1O2OA 2ZGBH 1NY22 2ZKSA 1LQEA 8LPRA 1P06A 2BOKA 2AGIX 6CHAB 5HXFA 3IG6B 3TLOA 1EAXA 2UUJB 5DG6A 1OYQA 2BYAX 3M7TA 5TJXA 3U1IB 1SR5C 3F0PA 2A0QB 5JB9S 3SV8A 1WTGH 2GT8A 2A5KA 3TU7H 4YOJA 2H9EH 2XC5A 4OS1A 3GY5A 2L6OA 1DT2A 2UWOA 4RN6A 5C17A 1DLKB 1BITA 1YCPM 1GI6A 3MNSA 1VJAU 4ESTE 2J9NA 1SQTA 2VINA 4LZ1H 5EXNA 4XDEA 2G5VA 2D26C 1LKAA 2FTLE 2O9QA 1RTFB 3WW7A 1F92A 2ALPA 1OS8A 2DUCA 3I29A 3F1SB 1J9CH 5FL7D 1HAVB 1C5LH 1V2PT 2CMYA 5GCHG 1SGFG 1GBEA 3SJKA 1MU8B 4ZKRU 4MNWA 2VVCA 2ZU1A 2GZ9A 4Y8YA 5TCAA 1AUJA 2PTCE 2D1JA 1NTPA 1GL0E 4GCHF 2PTNA 1DY9A 3GCTF 2BDHA 2XCNA 1SBWA 2ZQ1A 2QGRA 1A5GH 3TGIE 4U01A 1BJUA 1TGSZ 3ZVAA 4IS5A 2QA9E 5A8YA 5HGGA 3V7TA 4JZFH 1O5DH 3LONA 3R0FA 1G37A 1ELFA 5JBCS 4CH2B 4NIVA 1TBRH 3SUEA 3TNTA 2QV1A 2CF8H 2OINA 2WPKS 3N7DA 3QTVH 3E91A 3RDZA 1TE0A 1HIAB 1YBWA 2ANMH 2NU0E 3B8JA 4WWYA 4CREA 4X1PU 5DP9A 1MQ5A 1GI4A 6CHAC 1Y3UA 2P3FH 2QY0B 4Q4LA 4B2AA 1YC0A 1ARCA 1ELEE 2FLRH 2OQ5A 4M7GA 1HFDA 1EASA 2KZ4A 3OTPA 2VU8E 1O3JA 1P04A 3A7ZA 4I33A 3ZZBA 1MKWH 2Q6GA 5A0BA 1IQMA 2XC0A 1ORFA 7ESTE 1K9OE 4ZROA 1S6FA 2ZFPH 1DPOA 6ESTA 4CRFA 2FP7B 2PSYA 2QF4A 2XCFA 4BTUB 2XRCA 3R3GB 3NWUA 1D4PB 4DOQA 1AFQC 3S7HB 1GG6C 2HLCA 2ZHEH 3U8OH 5B6OA 1ID5H 4LXBH 3O8DA 2P16A 3VXFH 1WXRA 2BTCE 1JOUB 2W6JD 6GCHF 2RFKC 4Y79A 1AUTC 1ETSH 1QRXA 1GHVH 1AGJA 1IOEA 1THRH 4WMEA 1T8NA 3RXMA 3ZZCA 1FIZA 5ESBA 4A5TS 1ZLRA 3F6UH 2CK3D 2BD4A 1KYNA 3MHWU 1LVYA 2BY7X 5F8TA 1FONA 1HXFH 3EE7A 2OD3B 4INLA 1GWAA 1S85A 4BOHA 1CT4E 3QLPH 4UFGH 4MPVA 1Y5AT 1CHOF 1HXEH 1CHGA 3B9FH 1S0RA 4ABFA 2FZZA 4YT6H 2M5TA 1TRMA 1F2SE 2Z9JA 3OFND 4MTBA 3S9BA 3MMGA 4NIYA 1C2HA 1H8IH 1YLDA 1O2IA 1QHRB 3RMNH 5FX5A 2P59A 2TRMA 3I78A 2IJD1 4K8YA 4RT0A 3ZZAA 1TGCA 1K1MA 1O31A 2Z3DA 5T6DA 2PUQH 1EPTA 1V2TT 1TNGA 2ESTE 1TQ0B 4ASUD 1MTSA 1NFUA 3RXAA 3RMOH 1W2KH 4H4FA 5DP7A 3STJA 2OBOA 1EX3A 3SZEA 1O2XA 1CBWB 3ZZ4A 3HK6B 1K1JA 4AFZA 2SGAA 1V6DA 3QZRA 3PWCA 1ELBA 3GDVA 4FUFA 5DSFA 1NM6A 1LHFH 2CGAA 3FAOA 3P8FA 1A4WH 2GCTC 1IQIA 4GHTA 2XYAA 1TNIA 3ZZ6A 3A81A 3MFJA 3FZDA 1LQDB 2ZFTA 1GBLA 5FPSA 1YPLH 3GY6A 3KYGA 1SGFA 2EI6A 4AGJA 4AYYB 2R2MB 1W7GH 2AFQB 1SKYE 3RXHA 2PSXA 4ISOA 2A7CA 2ZF0H 2FLBH 1CT2E 1C5WB 1ABIH 2SGFE 2ZFRH 2AYWA 5EG4A 1FPHH 1B0FA 2ZTYA 1DLEA 1O2HA 5FXLA 1ELDE 1NRSH 2FXRA 1F5LA 1AB9C 2BY8X 4Y7BA 4DG4A 1QTFA 4K5ZA 3VFEA 2ANYA 2IJOB 2P95A 1W13U 4OS4A 4IN2A 3AW0A 1AD8H 4FUIA 3DFJA 1GCTB 1C5OH 1SGNE 3V3MA 3HKJB 1KXEA 3GS9A 2ZU5A 3A7YA 1HV7A 1BHXB 1W3CA 2QAAA 3RMLH 2EI8A 1FV9A 1VITH 1TRYA 1OWHA 3E8LA 1O2SA 5JYIA 1O2TA 2F91A 3T27A 1SQRA 3ZV9A 2THFB 3MYWA 5PTPA 1DSUA 2HPQH 1O36A 1OP8A 2W7SA 2Y5GA 3UWJH 1TNLA 1KXBA 4DW2U 4IGDA 4ZMAH 1C1WH 1O35A 1FY4A 2KAIA 1W7XH 5EJ1A 1BBRK 5F6MA 1NRPH 1UK2A 2ZDNA 3M3VA 1MD8A 3OE7D 3BTHE 5L6NH 3SNCA 2K8IA 2OP9A 4D9QA 5BRRE 1GHBG 2KM0A 3M36A 3ZVDA 1H8ED 1FX0B 1O3GA 1S0QA 2V35A 1HAIH 3TJUA 1AHTH 2RA3A 2FESH 2JJ1D 1MCVA 1S81A 1DITH 3P17H 3UIRA 1GMCF 2YMSD 5LPEA 1V2MT 1N8OC 1SGTA 4HTCH 1KSNA 1THPB 3TJVA 3O8CA 2VGCB 5EIYA 1XUHA 1LHCH 2Z3CA 4IMZA 1S83A 4H42U 3LGVA 1VITF 1O3EA 4JZIA 1UTLM 2WV9A 1A1RA 2ODQA 2NU2E 1QL9A 3F2FA 1NO9H 5J4QA 4HI3A 3ESTA 3OY5U 2FOFA 1LPZB 1UO6A 2C93B 2LP6A 1GJ8B 2ZI2H 1ZPBA 5F53A 4Y8XA 4D9RA 4UDWH 2C8XB 1TGBA 3A8AA 3SHAH 4Y0ZE 3U69H 1Y8TA 4ABHA 4GHQA 1EP5A 2GGVB 1O2QA 2Z7FE 4YLQH 3A84A 3SNDA 5CE1A 4I8LA 1QB1A 1T7CA 1QQUA 3VGCB 1H8HD 5C20A 4GVUA 7KMEH 4TWWA 3ZZ7A 3M5LA 1LHGH 1HRTH 3EGKH 2WPLS 2L74A 3QGNB 3JZ1B 3S9AA 1YM0A 3EA7A 1FNIA 4D8NA 3PLPA 1C2EA 3E16B 1GBTA 1O30A 2FYQA 1UVOA 2ZTZA 3U1JB 1HLTH 3RU4D 1CU1A 3QDZB 3F9EA 2A4GA 1A0JA 4CHAB 4DIIH 1AE8H 1THSH 2Y6TA 3Q3KA 2FI5E 1HPGA 1E34B 5LGOA 1EKBB 4WXIA 2PGQB 1QFKH 3TPIZ 2W26A 1CO7E 3GYMA 1MAYA 1NROH 3SBKA 4HFPB 1YGCH 2ZDAH 2FDAA 1UVSH 2LNCA 3D65E 5LH8A 4GAWA 3WWBA 3C27B 1ESTA 3RC5A 2YMSB 2WSSD 1AVXA 1TOCB 2OK5A 4FU7A 3SU6A 1PPBH 3HGPA 2ALVA 1BHXF 1NPMA 1UVPA 1VR1H 2O8TA 3ZZ3A 1C5VA 1C5MD 3RMMH 2BY5X 2A2XH 2KAIB 3MH7A 1EUFA 3T29A 3UREA 1O5BB 1BTYA 2XC4A 5FCRA 1G3EA 2FM2A 5EJZA 2A4QA 2F9NA 5CDFE 3AASA 1EAUA 3PLBA 1PPZA 8KME2 3ZVFA 1TA2A 4X1QU 4Y7AA 1SLVB 4WJG2 3A85A 4ZHAA 1COWD 2ZG0H 3HKIB 2EEKA 1D6RA 1A61H 2QC2A 2Y81A 3VB5A 2XWAA 2ZECA 2BDIA 4INKA 1EAWA 2QF0A 3T28A 1OKXA 3N7EA 1EZSC 3KIDU 3UY9A 5EW2H 1FN8A 1O39A 1U6QA 8GCHF 2VIWA 2ZTXA 2UWPA 3VG8A 1VCPA 1XUJA 3BIUH 4ZHLU 2KFWA 1W0KD 5A0AE 4YM9A 1YPHC 1SSXA 1TWXB 4X8TH 2F9VA 2VVVA 4UONA 4CHAC 1F5RA 2WINI 1ELCA 3RXIA 1ZSKA 5SGAE 3BTGE 5JDUB 1BRBE 2ZP0H 1QNJA 4H6TA 4JZDH 4AFUA 3M5OA 4AB8A 5DKMA 1NC6A 1L4ZA 1MTVA 1AI8H 1AY6H 4FU8A 5EQQA 1HAVA 5DP6A 3UNSA 2YMSC 1C5QA 4Q7YA 2P8OC 2Z9IA 2ZDVH 3TJOA 3DSPA 1MBMA 2SGPE 1NBME 4TT3D 1GVKB 2SGDE 1F0TA 2O8MA 1YPGH 4CRDA 1UTOA 1H1BA 1SGQE 4LOYH 1P10A 5DN6D 2IN2A 4YESB 1O37A 4VGCC 4NCYA 1TBZH 1VGCB 1ZPCA 1J14A 1HAOH 1DS2E 3GY3A 1TB6H 4O3UA 3DFLA 2BDYA 4A1VA 5EODA 3UR6A 1WYKA 5T1VA 4KTCA 3RXCA 1HIAA 1BMLA 2UWLA 1Y3VA 2B0FA 2FEQH 4FETA 5EXLA 4ABIA 1V2OT 1EB1H 4AFQA 1OWJA 1WV7H 3QN7A 2WPHS 1C2FA 2QXGA 1QJ1B 1T31A 4BNRA 2W6ID 2LELA 2XBXA 2JDID 2AMDA 2QXHA 5EXMA 3BG4C 1SGIB 2B5TB 1C5NH 2H6MA 3ITIA 2ZFQH 3GDUA 1IQEA 3RXGA 2SFAA 2F9PA 4JMYA 3EYDA 1K0HA 4BXWA 3LKWA 1GDQA 4WY3A 1QBNA 1O2NA 1HJ8A 4ZXXH 3TK9A 1HJAC 4OM9A 3EA8A 1BTPA 2GD4B 3FN8A 3NUMA 1HAHH 1XUIA 1VCQA 2C4FH 2WZQA 1UVUH 1C2GA 2PFEA 5FBIA 1OWKA 2GT7A 1DWCH 1YWUA 1ZSJA 3OEED 5FPTA 1BMMH 4WF8A 4YZUA 1P01A 1S6LA 1DICA 3OSYA 4YOGA 5HM2A 3SNEA 1SGCA 1JBUH 1BTXA 1FDPA 3S9CA 1F5KU 3CP7A 1G9IE 2WPIS 3SOSA 2BD9A 2FPZA 2R2WU 1MTWA 4O03A 1S84A 3MH4A 1YCPH 1TX6A 1VGCC 2GV6A 2BQ6B 1E36B 4DT4A 4WMFA 1YY3A 1Q2WA 2TBSA 1E35B 4K69A 3WWFA 1ZJKA 2BLOA 3OX7U 9LPRA 2BZ6H 3A7XA 3SQEE 5FPYA 3P8NA 1O3MA 1TRNA 1OWDA 1C4U2 3KL6A 1TNHA 3UAIC 4RSPA 4MG3A 1HAGE 3KGPA 1C4Y2 4FVBA 5C1YA 3GY8A 4K2YA 4Q63A 1BT7A 1DANH 4ACBA 4CBOA 2BXUH 4DIHH 1YLNA 1LVOA 1KXFA 3MU4A 1QA7A 3UNQA 1AFQB 1GG6B 1K1IA 1B0EA 1ZTJA 4OGYA 4BAMB 3F0OA 2STBE 4NWLA 1SOTA 1DWDH 4ISLA 2FOEA 4ABDA 1TMTH 1EXFA 1TIOA 1O2PA 4ZKNU 2BLWA 3RXSA 2J34A 4YTAA 1BMFD 1PYTD 4MLFB 4Z6AH 3FZZA 3MU8A 3V12A 4KTUA 1NU9A 2ULLA 4SGAE 3L6PA 1SGPE 2G51A 2NU3E 1QGFA 4E7RG 3S69A 5E0JA 1PPFE 1KTSB 4XBBA 2AIQA 1J16A 2PR3A 1L0ZA 1GJ7B 2F3CE 1W12U 2J38A 4Q80A 1ZR0A 5I25A 1DM4B 1A0HB 3PV4A 1W0YH 1BTHH 7GCHG 1LVMA 1O3BA 5DP3A 3SGQE 1Z8JB 3K6YA 1C2MA 2R3UA 4ABBA 1O2VA 1ABJH 1TA6A 2XNDD 2KR7A 5GWZA 2WV5A 1W8BH 1G3CA 4HG6A 4FU9A 3GDSA 1PQ7A 3PV2A 4SGBE 2FMJA 3M61U 1BA8B 4MPUA 4JK6A 4U32A 1V2JT 1SG8B 4ZCNA 3FOAA 4BXSA 3H5CB 4THNH 4JYTA 4Z1MD 2VIOA 2O8UA 2GCTB 2ZZUH 3SJ9A 3PMJA 3BIVH 2A5IA 3GY7A 3TH4H 4J2YB 3RXOA 4X1RU 2J92A 1T8OA 3BSQA 4YXWD 4A6LA 3TK5A 1W0JD 1LHEH 1PPCE 2A5AA 1YPKH 3OEHD 5JPMH 2Y7XA 2VWMA 1J17T 3IITA 2GZ8A 3ENSB 2ZGCA 1C1TA 3DHKH 2OXSA 1XXFA 4DT7B 2BQWB 3GY4A 4D76A 1EZQA 3BTFE 2IOTA 1O5EH 3BN9A 4ZHMU 4XFQA 2OC0A 1ESBA 1AB9B 4BAKB 1DWEH 4XRNA 3SI4H 1D3PB 2C3SA 4RKOB 2RCEA 1TPAE 2GCHG 3GCNA 1A5HA 1TX8A 3ATWA 3UR9A 3GCHB 2F9BH 5A0CA 3SJ8A 3PRDA 1P05A 1OWIA 1OXGA 2WPJS 4NA7A 1B5GH 3E6PH 5GIBA 1DY8A 1N1LA 1V2LT 1EJAA 5KECA 3C1KA 3SZNA 1GHBF 1ELGA 2BOHB 1Z8IB 3F2HA 2CF9H 3KQ5A 2EY4C 1B7XB 2V7QD 4AG2A 2PP6A 2Z9LA 2BVXH 2G52A 1ZMLA 2PKSC 4FXGH 1GPZA 1C1OA 1GBMA 2UUYA 2AIPA 1K22H 3UB0A 2GKVE 3SJIA 4AFSA 4NA8A 1HAZB 2OCVB 1EJNA 3I77A 3ZZ8A 1ETTH 2Z6BD 1RIWB 3M3TA 4NSYA 1ZRKA 1JIMA 4ZKOU 5T6GA 1S5SA 3SU5A 3QK1A 2LPRA 1AZ8A 1ANDA 1V2UT 2AMPA 1TGTA 2JKHA 4FUBA 3SGBE 2FX4A 2Y5FA 1O3IA 3ATLA 3A8BA 3UUZA 1FLEE 4JZ1A 3PMHB 1PYTC 4B1TA 1NU7B 1KXDA 2GTBA 1GVLA 3F9GA 3P95A 1UMAH 2I6SA 1NESE 2D8WA 4CRAA 4BANB 4F55A 3AVZA 1N8OB 3LGWA 1Y3YA 3A7WA 3ZVGA 3RXJA 2FS8A 1BTZA 2EQNA 2ZPRA 1GHZA 3UOPA 4IBLH 1OSSA 4X6PA 1UK4A 2ZCHP 3GCHC 2A31A 4B2CA 1EFRD 1GGDC 3HATH 3VXEH 5JBAS 4RKJB 4FUHA 3LJOA 4DURA 3A88A 2BX4A 2HVXA 1WQSA 1RGQA 5L30H 1DUEA 1PQAA 3M3SA 2OC1A 2ASUB 4FUEA 1FN6A 1PFXC 1QA0A 2IPQX 4MNYA 4F4OC 1Y3WA 3GOVB 1FY3A 2Q6DA 1KXCA 1QCPA 3SV7A 2J95A 1BZXE 2SGQE 2F4LA 3L3TA 1UK3A 1YCPK 2RDEA 4RI0A 1G32B 2Z9KA 1GMDG 3RXRA 1E0FD 5DP4A 3PTNA 1RIWC 1OX1A 3NKKA 3TH2H 4KP0A 1C2DA 3NCLA 1QB6A 4NG9H 4O3TA 4X2YA 4X2XA 1VJ9U 2Z3EA 5G4BA 3DT0H 2OQUA 2XBWA 3RXUA 4E06H 1XVMA 5FHTA 4Y6DA 3A7TA 3FP7E 1T4UH 5AHGH 5GPIB 1P03A 4B76A 3TNSA 1P2KA 1UJ1A 3GCOA 1QZ8A 1ZMJA 2NU4E 2GZ7A 2ZHQH 2WPMS 1D6WA 1NFWA 2Z94A 3KQEA 3KQDA 1S82A 1MBQA 3RXKA 1ETRH 3RU4E 1NN6A 2RDLA 1CA8B 1MTNC 2ZHFH 4MVNA 1SMFE 1LMWB 4AYVB 3P8GA 2PKAB 3ODFA 3MOCA 3PO1B 4UFDH 4I8KA 4PROA 1QJ7B 1BRCE 1ZRBA 1ZTKA 4XD7D 3OY6U 3V13A 2HWLB 1TMUH 1F7ZA 3MO3A 3RXBA 4YT7H 5A2MH 3VB3A 1NRQH 3O8BA 2K0QA 4CH8B 3TVJB 4NGAH 5EGMA 1C4V2 1UW7A 4Y10E 1DX5M 1SHHB 2QF5A 2Y80A 1XM1A 4JZEH 2OC7A 2HRVA 3H09A 1BDAA 2JJ2D 3SU3A 2CJIA 2FWWA 1QRWA 1M9UA 2BD5A 5AFZH 4BAOB 2AERH 1CSOE 1O2JA 5F8XA 5JB8S 2TPIZ 1SHYA 1ZZZA 4K1SA 1QRZA 4K8BA 5EPYA 3A82A 3AAVA 1FMGA 1MTUA 1O2KA 1C2LA 1MMJN 4ABGA 5AFYH 1FPCH 2GV7A 1BCUH 5KEDA 3RXVA 1GHAG 4K60A 1MKWK 3UFAA 3ZZ9A 1GDUA 4R8TB 1V3XA 5A09A 2CHAC 1H9IE 1E79D 2A1DB 1O3LA 2ZCLP 1BOQA 1GBDA 1SFIA 4XBDA 2FYRA 1O32A 1RTKA 1YLCA 1C9TA 3MU1A 4Q7ZA 4I31A 1OOKB 3ZYEA 3SW2B 1BTUA 3E1XB 5C5OA 4BTTB 1Q3XA 5FBEA 2F9UA 1HCGA 3P8OA 3PO1C 1EPTC 1LPGB 1HJ9A 4A7IB 1TABE 3K2UA 1SGDE 3HGNA 3LGIA 1CGJE 3T62A 1L4DA 4X0WU 2P8OB 1C1MA 5LPRA 3NRLA 2XW9A 1GBBA 1O2LA 1FY1A 2BZAA 1W10U 1XUFA 2R0KA 3A86A 1XVOA 1INCA 2O8WA 1V2KT 1AIXH 2VBCA 1W14U 4NIWA 2J4IA 2A4OA 4ISIH 1T4VH 1C2JA 1DFPA 4VGCB 3PRBA 1GBJA 3E90B 1A3EH 1XMNB 2IPHA 1SLWB 4IW4E 1T8LA 1JRSA 4D7FA 3VB7A 1DXPA 5TCCA 4DJZB 1TFXA 1L1NA 3ELAH 5GXPA 5FAHA 2OLGA 1MQ6A 1ZHMA 3RXDA 5CHAC 1MAXA 1IAUA 2BD8A 2ANWA 2FTMA 1GJDB 3SV6A 3BG4B 2Q6FA 4CRGA 3BTTE 1LTOA 3M7QA 1DSTA 3N99A 2VWLA 2YNBA 2QF3A 3GISB 2R3YA 4Q7XA 2CN0H 2A32A 4MPXA 3SN8A 1WCZA 1PQ5A 3BEIB 2ANKH 4UFFH 1EOJA 4ISNA 1K1OA 4OGXA 1EB2A 4RT1A 2FOCA 4A1XA 2ZWLH 4TPYA 1Y5BT 4BAQB 4OS6A 1C1NA 1HJAB 3PROA 4TWYA 3VB4A 2EI7A 2XTTB 3LC5A 1O38A 3PLKA 3OU0A 2TIOA 1P3EA 1TMBH 1O2MA 1WUNH 4X2WA 4Y11E 5A8ZA 1QB9A 1ZGIA 2ZGXH 4JYVH 1KMHB 1GI2A 1KLJH 3FANA 3VPKA 2HNTC 5JBBS 3TGJE 1XUGA 3GICB 3LDXH 3RXQA 3M37A 4F48B 4I7YH 4AGKA 1SGRE 1GJAB 4GSOA 3BF6H 2BHGA 1C1RA 3KNXA 5L2YH 1YF4A 3NZIA 1QIXB 2H2ZA 3UNRA 3LH3A 1AZZA 2FI3E 4Y8ZA 3ZVBA 2XBVA 2GMTC 3MI4A 2ZDLA 3PV5A 3SU2A 3URCA 2XBYA 4TSFD 1WAYB 3FFGA 4KGAA 1G2MA 4FOUC 1ANBA 4NWKA 1QBVH 1QR3E 1OP2A 2TGTA 4AX9H 3K9XB 4XE4A 2ZIQH 4JYUH 4CR9A 2SNWA 1FZZA 3RP2A 2H9HA 2VWOA 5E2OA 4QT8C 1E38B 2AHME 2ODYB 1P2JA 3FVFB 2ZHDA 1TNJA 5LPFA 4K1TA 2H9TH 2ZCKP 1XKBC 2KCYA 7GCHF 1HAXB 1F0UA 1SLXB 5EQSA 1XXDA 4DY7B 5IK2D 5CHBA 2FI4E 2ZA5A 4WXVA 2B8OH 1EOLA 1FY8E 1ZJDA 2NU1E 3LIWA 4GUXA 4TPIZ 3U98H 3TH3H 1E1RD 1GJ4H 2SNVA 3QO6A 3TK6A 2ZDMA 3F3BA 4I8GA 3T25A 1GVZA 1P12E 1ELTA 4ASHA 1RD3B 3F9FA 5EPNA 4KKDA 3OAAD 4WVPE 1Y5UT 3SU1A 1A2CH 1RRKA 4B74A 1QL8A 1EAIA 2OBQA 2ZFSA 3ZYDA 1Y59T 3AW1A 4R0IA 1DOJA 1GI5A 2F83A 1IQNA 1GI8B 1GMHG 2R9PA 5C1UA 2C8YB 1SL3A 1DVAH 1XUKA 2C90B 4OS2A 3H7OA 1WOFA 2OUAA 5HMAA 3BTWE 2GX4A 1QURH 3T2NA 2QIQA 4ABEA 2FOAA 1O3OA 1V2RT 3U9AH 2AS9A 3BTEE 1CGHA 1D3TB 5JBTA 1O2GH 1NT1A 1XKAC 3JZ2B 1Z71A 3PYHA 4NZQA 2K1QA 3BV9B 1FIWA 2G5NA 1WQVH 2G8TA 1EATA 3STIA 2RA0A 1BBRH 1VKYA 2KCOA 1AKSA 2V6NA 3K65B 1GJ9B 1LHDH 1V2VT 3SI3H 1DDJA 3UPEA 4FUJA 1Y3XA 4HGCA 1O3KA 3W1EA 1O2ZA 8ESTE 1AN1E 1FY5A 5C0UA 2GCHF 1O3AA 2WPDD 1AU8A 2A45B 2ODPA 2JETC 4FUCA 2PGBB 3SGAE 2BY9X 2JH5D 4K1EA 2A7HA 1Z8GA 1GDNA 1O3NA 2F9OA 3RC4A 1BRAA 1LVBA 1TBQH 3BTME 1HYLA 1NS3A 1K28D 4WMDA 1O33A 2WYGA 5ETXA 1AWFH 1SLUB 1V2WT 1GBCA 1MH0A 1RFNA 3SORA 5E2PA 1IQLA 3ATMA 4AN7A 1AE5A 1MUEB 3DCLA 1IQGA 1O3CA 2W5EA 1GJ5H 1ZOMA 3SNBA 3G01A 4BAHB 3DD2H 4YO9A 4JCNA 2ZO3H 4B6EA 1GCDA 3S0NA 2BXTH 3Q77A 2AEIH 1O2YA 1MABB 1UTQA 1IQKA 3PB1E 1QBOA 1N6YA 4MQAA 1ZHPA 1GBHA 3SHCH 4MNXA 4ZXYH 4JK5A 3BG8A 1KDQA 2PV9B 1ZHRA 4AORA 4BTIB 5J4SA 2HVYB 1YPEH 3Q76A 3P70B 1Z7KA
chains in the Genus database with same CATH topology
2ZU2A 4NFEA 3QTOH 4TYDA 4H6SB 1C5SA 5AVDA 4FUGA 1O5AB 3ZVEA 5DGJA 1G30B 1KY9A 5C3NA 4F49A 2CV3A 1V2NT 2PKSB 3GY2A 1K21H 2OTVA 1TONA 1GHWH 3N7OA 2FIRH 1Z6EA 1L1JA 2G4UA 3RM0H 4X6MA 3E3TA 1NZQH 3RLYH 3RLWH 2BMGB 2GP9B 1GHYH 2WUBA 1O2UA 4E7NA 3DA9B 1O5GH 1P09A 4B2BA 2BB4A 2V0BA 1P2IA 3LOXA 2A4RA 3EA9A 3WY8A 4OS7A 2J2UA 2FO9A 3MO6A 3U8RH 1A46H 1IHSH 4X6NA 1O2WA 3RC6A 1TQ7B 2QYIA 2W7UA 4HZHA 1GBFA 1PQ8A 3M5NA 1O3PB 1NRNH 3SUDA 1HGTH 1CVWH 3W95A 4WH6A 5C1XA 1KTTB 2ZFFH 1DUAA 4KTSA 2FS9A 1CA0B 1CE5A 3LC3A 2PWXA 3U8TH 1C1PA 3V0XA 4ABAA 1P9SA 1L1GA 4Y76A 5C2ZA 2A2QH 1GMDF 1UVTH 3D23A 1P2OA 4J1YA 2HOBA 1AWHB 1AKSB 2XNIA 4X8SH 2HPPH 1GGDB 2ZC9H 3TGKE 3UTUH 1MZAA 1S6HA 1EJMA 1SVPA 5K7RA 1QQ4A 1GBKA 1LKBA 2BLQA 1FAKH 3AAUA 1A0LA 3A80A 4Y0YE 2ZDKA 1K1NA 2GDEH 4YOIA 1XX9A 2AH4X 2JH0D 4X6OA 1WSSH 4X8VH 2BVSH 1HBTH 1QJ6B 1TNKA 2EC9H 1C2KA 2V3HH 4GCHG 1BRUP 2H5DA 3GCTG 4DCDA 1PPGE 4I8JA 2STAE 5K0HA 2PKAA 3W94A 3BTQE 1MD7A 1FJSA 2P94A 4X1NU 7LPRA 1C1UH 1DE7H 2BD7A 4CRBA 5BPEA 1IQJA 1SGYE 3F68H 1MZDA 2ZPQA 3FP8E 4MDSA 2V3OH 1J8AA 1MU6B 3UQVA 4TY6A 1TX7A 1LCYA 3ATIA 5DJ7A 2G55A 4OS5A 1SI5H 4Z0KA 2ZGJA 4B71A 1YPHE 1Z1JA 1KDQB 3OYPA 3SV2H 1ZPZA 2Y82A 2VH6A 1SPJA 1YP9A 3RXFA 1UTMA 3MH5A 1L2EA 1BMAA 2WUCA 3SV9A 3D62A 1TGNA 1O5CB 3DUXH 1GBAA 1CA0C 3A8CA 1ACBE 2D2DA 1H8DH 1P2NA 1NRRH 4A92A 3RM2H 2BDGA 1G2LA 1D9IA 2VIQA 3D49H 1AVWA 1MKXH 2VWNA 1O5FH 1MTNB 3QUMP 3MNXA 1UHBA 2UUFB 3BTKE 3LJJA 2OC8A 2TGPZ 2VVUA 1UCYH 1X7AC 4B75A 1GHAF 4GLYA 3MTYA 5EOKA 1A5IA 2HNTE 1TAWA 2O8LA 3SU0A 3RU4T 3L33A 4AB9A 1BJVA 2GDDA 2GVFA 1DWBH 4U2WA 6GCHG 1ANEA 3A87A 3BEFB 3LGYA 1JMOH 2VJ1A 1P11E 3QX5H 5GDSH 4UD9H 2B7DH 1H9LB 3PWBA 4UFEH 3TIUA 2VIVA 2TGAA 5FCKA 4I8HA 1FQ3A 1O34A 3TITA 3MNCA 1AO5A 1C5YB 4I32A 1N6XA 1VZQH 5AF9H 4CRCA 1FUJA 1HAPH 2BVRH 1O2RA 1CBWC 1CHOG 1V2QT 1GJCB 1KIGH 1P02A 1YKTA 1O3DA 3Q00A 3E0NB 3NK8A 4DVAU 1QL7A 1SQAA 5C67A 5ABWA 2H1UA 1IQHA 1JWTA 3FP6E 4NZLA 2G00A 2CHAB 1C2IA 3B23B 5HYOA 3BEUA 3A8DA 2G81E 2BD3A 3URDA 1EP6A 1TPPA 2BDCA 1ELAA 3H7TA 1SGEE 4Y71A 4FVDA 4NIXA 1Q31A 5GJ4B 1RS0A 2W3IA 2DE9A 1BMNH 1C5TA 1BUIA 2YOLA 1TOMH 3RXEA 3SUFA 2BLVA 1G3BA 3Q3XA 4AOQA 4Q2KA 5L2ZH 4IC6A 1EPTB 2XWBI 5F03A 1YYY1 2A7JA 3T5FH 2J94A 2P3TB 2VIDA 4IMQA 1P3CA 1T32A 2G4TA 1ZGVA 3Q3YA 3PM3A 2HALA 3MO9A 2R0LA 3O8RA 2HGTH 1BB0B 1C5UA 2RG3A 3MU5A 1TALA 4X1SU 4ZH8A 1GJ6A 1Z1IA 4LZ4B 1GCTC 1CGIE 1ZMNA 2BQ7B 1ELVA 1GL1A 1H9HE 4WH8A 5T3HA 4B73A 2ILNA 3CENA 1EZUC 3MU0A 4E05H 1SFQB 2VH0A 3EE0B 2B9LA 1V2ST 4NA9H 2BM2A 1VCWA 5EW1H 1BBRE 2CXVA 2FOHA 2ZPSA 3PMBB 1PPHE 3RXLA 5CHAB 3VB6A 1FI8A 2ZEBA 3P92A 5EQRA 2AMQA 3TJNA 1EQ9A 1PPEE 3A89A 1FXYA 1UHBB 1KLTA 4LK4A 3RUOA 1P0SH 1H4WA 5DP8A 3PMAB 3LGUA 1WBGB 4CR5A 5CMXH 1O0DH 1O3FA 2PHBA 4U30A 3M5MA 5IYTA 1IHTH 2XXLA 3S7KB 4CBNA 3K6ZA 4IN1A 3QZQA 5DP5A 5IDKA 3ZZ5A 1LPKB 3SJOA 3CS0A 1GBIA 2ZU4A 1RJXB 1JRTA 1KLIH 3SUGA 1ZTLA 1AQ7A 2DE8A 3ATKA 3LT3A 6LPRA 3SNAA 4XSKU 1D3QB 3UWIA 1P2MA 4UEHH 1YPJH 4FUDA 2FODA 1DXWA 1G3DA 1C1VH 1ESAA 3HPTB 3KEEA 2Z9GA 1HUTH 1TLDA 3A83A 1A3BH 4A1TA 2ZQ2A 2VGCC 2QXJA 2WYJA 3ZV8A 1AFEH 1C9PA 3E0PB 4NSVA 1WU1A 9ESTA 2Q1JA 1C5ZB 1ZYOA 5T6FA 2GMTB 2W3KA 3ZZDA 2PUXB 3KHVA 3CS7A 4ZAEA 5E0HA 4O97A 1GI0A 5A8XA 2Y5HA 5DO4H 3KF2A 4NFFA 1HNEE 5E0GA 1ZSLA 3EDXB 1GMCG 1LO6A 4UE7H 3LGTA 5FX6A 1D3DB 2VNTA 3M35A 3KQBA 2AGGX 3P6ZB 4YLUA 5DK1A 5EU8A 1GI9B 3VGCC 1KXAA 1JXPA 1J15A 1Z8RA 1TPSA 2FX6A 1LDTT 2JH6D 4AZ2B 1GMHF 1A7SA 3MWIU 2H5CA 1VITG 3EAJA 1RXPA 1RTLA 3NXPA 3PTBA 1HAYB 1BTWA 2ZU3A 1YPMH 1K2I1 1F0SA 3SU4A 1F0RA 1Z6JH 2BDBA 2C8WB 2YNAA 1TPOA 4MPWA 3A7VA 2ZGHA 2ZHWH 2FOGA 1T8MA 1TYNA 3GYLB 5DPAA 1K1LA 3NPSA 1G36A 2P93A 1P2QA 4K3JA 3SO3A 2EA3A 1K1PA 1HDTH 4TY7A 3ZVCA 4X2VA 1SC8U 2QCYA 3KN2A 3ODDA 2I6QA 4X8UH 3LU9B 1WTHD 1CQQA 4INHA 1AVGH 5C5NA 1O3HA 3MNBA 3T26A 1OP0A 1C1SA 1AMHA 1SOZA 4DGJA 3LPRA 1MKXK 2Y7ZA 3BTDE 1HB0B 1C5RA 2TGDA 3RXTA 4ISHH 1GHXH 5GCHF 1P57B 1BQYA 1E37B 1UCYK 2WV4A 4ZKSU 1BIOA 1QY6A 4XBCA 1GI3A 1UTPA 3QGJA 1NFYA 4KELA 1ARBA 3EQ0H 1FAXA 1NFXA 5F8ZA 5E8EH 3UQOA 1JIRA 4GPGA 3KQCA 2BDAA 2UUKB 1MCTA 1SB1H 2NWNA 2FOBA 1OPHB 1SQOA 1OWEA 1P8VC 1GI7B 3F9HA 5H4IB 2SGEE 1PJPA 1IQFA 1UTNA 4ZUHA 4D7GA 1UTKA 5HM9A 3RXPA 2QXIA 3QWCH 1C5PA 2ZNKH 2JETB 1OYTH 4MNVA 3OTJE 3SQHE 2BD2A 1ANCA 4O9VA 2P3UB 1CT0E 4XOJA 2BX3A 2PW8H 4ABJA 5ESTE 2VB0A 3MH6A 1P9UA 1W11U 2VIPA 1GI1A 2AGEX 2BY6X 2FOMB 3IWMA 2HNTF 3M7UA 4IC5A 1UCYE 1UTJA 3UOUA 2QN5T 4AG1A 3LH1A 1W0ZU 3KCGH 1C5XB 2C8ZB 3HK3B 5I46H 1GJBB 1C1QA 3VEQB 2PLXA 1EZXC 8GCHG 1O2OA 2ZGBH 1NY22 2ZKSA 1LQEA 8LPRA 1P06A 2BOKA 2AGIX 6CHAB 5HXFA 3IG6B 3TLOA 1EAXA 2UUJB 5DG6A 1OYQA 2BYAX 3M7TA 5TJXA 3U1IB 1SR5C 2A0QB 5JB9S 3SV8A 1WTGH 2GT8A 2A5KA 3TU7H 4YOJA 2H9EH 2XC5A 4OS1A 3GY5A 1DT2A 2UWOA 4RN6A 1DLKB 1BITA 1YCPM 1GI6A 3MNSA 1VJAU 4ESTE 2J9NA 1SQTA 2VINA 4LZ1H 5EXNA 4XDEA 2G5VA 2D26C 1LKAA 2FTLE 2O9QA 1RTFB 1F92A 2ALPA 1OS8A 2DUCA 3I29A 3F1SB 1J9CH 1HAVB 1C5LH 1V2PT 2CMYA 5GCHG 1SGFG 1GBEA 3SJKA 1MU8B 4ZKRU 4MNWA 2VVCA 2ZU1A 2GZ9A 4Y8YA 5TCAA 1AUJA 2PTCE 2D1JA 1NTPA 1GL0E 4GCHF 2PTNA 1DY9A 3GCTF 2BDHA 2XCNA 1SBWA 2ZQ1A 2QGRA 1A5GH 3TGIE 4U01A 1BJUA 1TGSZ 3ZVAA 4IS5A 2QA9E 5A8YA 5HGGA 3V7TA 4JZFH 1O5DH 3LONA 3R0FA 1G37A 1ELFA 5JBCS 4CH2B 4NIVA 1TBRH 3SUEA 3TNTA 2QV1A 2CF8H 2OINA 2WPKS 3QTVH 3RDZA 3E91A 1TE0A 1HIAB 1YBWA 2ANMH 2NU0E 3B8JA 4WWYA 4CREA 4X1PU 5DP9A 1MQ5A 1GI4A 6CHAC 1Y3UA 2P3FH 2QY0B 4B2AA 1YC0A 1ARCA 1ELEE 2FLRH 2OQ5A 4M7GA 1HFDA 1EASA 2VU8E 1O3JA 1P04A 3A7ZA 4I33A 3ZZBA 1MKWH 2Q6GA 5A0BA 1IQMA 2XC0A 1ORFA 7ESTE 1K9OE 4ZROA 1S6FA 2ZFPH 1DPOA 6ESTA 4CRFA 2FP7B 2PSYA 2XCFA 4BTUB 2XRCA 3R3GB 3NWUA 1D4PB 4DOQA 1AFQC 3S7HB 1GG6C 2HLCA 2ZHEH 3U8OH 5B6OA 1ID5H 4LXBH 3O8DA 2P16A 3VXFH 2BTCE 1JOUB 6GCHF 4Y79A 1AUTC 1ETSH 1QRXA 1GHVH 1AGJA 1IOEA 1THRH 4WMEA 1T8NA 3RXMA 3ZZCA 1FIZA 5ESBA 4A5TS 1ZLRA 3F6UH 2BD4A 1KYNA 3MHWU 1LVYA 2BY7X 5F8TA 1FONA 1HXFH 2OD3B 4INLA 1GWAA 1S85A 4BOHA 1CT4E 3QLPH 4UFGH 4MPVA 1Y5AT 1CHOF 1HXEH 1CHGA 3B9FH 1S0RA 4ABFA 2FZZA 4YT6H 2M5TA 1TRMA 1F2SE 2Z9JA 4MTBA 3S9BA 3MMGA 4NIYA 1C2HA 1H8IH 1YLDA 1O2IA 1QHRB 3RMNH 5FX5A 2P59A 2TRMA 3I78A 4K8YA 3ZZAA 1TGCA 1K1MA 1O31A 2Z3DA 5T6DA 2PUQH 1EPTA 1V2TT 1TNGA 2ESTE 1TQ0B 1MTSA 1NFUA 3RXAA 3RMOH 1W2KH 4H4FA 5DP7A 3STJA 2OBOA 1EX3A 1O2XA 1CBWB 3ZZ4A 3HK6B 1K1JA 4AFZA 2SGAA 1V6DA 3QZRA 3PWCA 1ELBA 3GDVA 4FUFA 1NM6A 1LHFH 2CGAA 3FAOA 3P8FA 1A4WH 2GCTC 1IQIA 4GHTA 2XYAA 1TNIA 3ZZ6A 3A81A 3MFJA 3FZDA 1LQDB 2ZFTA 1GBLA 5FPSA 1YPLH 3GY6A 1SGFA 2EI6A 4AGJA 4AYYB 2R2MB 1W7GH 2AFQB 3RXHA 2PSXA 4ISOA 2A7CA 2ZF0H 2FLBH 1CT2E 1C5WB 1ABIH 2SGFE 2ZFRH 2AYWA 5EG4A 1FPHH 1B0FA 2ZTYA 1DLEA 1O2HA 5FXLA 1ELDE 1NRSH 2FXRA 1F5LA 1AB9C 2BY8X 4Y7BA 4DG4A 1QTFA 4K5ZA 3VFEA 2ANYA 2IJOB 2P95A 1W13U 4OS4A 4IN2A 3AW0A 1AD8H 4FUIA 3DFJA 1GCTB 1C5OH 1SGNE 3V3MA 3HKJB 1KXEA 2ZU5A 3A7YA 1HV7A 1BHXB 1W3CA 2QAAA 3RMLH 2EI8A 1FV9A 1VITH 1TRYA 1OWHA 3E8LA 1O2SA 5JYIA 1O2TA 2F91A 3T27A 3ZV9A 2THFB 3MYWA 5PTPA 1DSUA 2HPQH 1O36A 1OP8A 2W7SA 2Y5GA 3UWJH 1TNLA 1KXBA 4DW2U 4IGDA 4ZMAH 1C1WH 1O35A 1FY4A 2KAIA 1W7XH 1BBRK 5F6MA 1NRPH 1UK2A 2ZDNA 3M3VA 1MD8A 3BTHE 5L6NH 3SNCA 4D9QA 2OP9A 5BRRE 1GHBG 3M36A 3ZVDA 1S0QA 1O3GA 2V35A 1HAIH 3TJUA 1AHTH 2RA3A 2FESH 1MCVA 1S81A 1DITH 3P17H 3UIRA 1GMCF 5LPEA 1V2MT 1N8OC 1SGTA 4HTCH 1KSNA 1THPB 3TJVA 3O8CA 2VGCB 1XUHA 1LHCH 2Z3CA 4IMZA 1S83A 4H42U 3LGVA 1VITF 1O3EA 4JZIA 1UTLM 1A1RA 2ODQA 2NU2E 1QL9A 1NO9H 5J4QA 4HI3A 3ESTA 3OY5U 2FOFA 1LPZB 1UO6A 2C93B 1GJ8B 2ZI2H 1ZPBA 4Y8XA 4D9RA 4UDWH 2C8XB 1TGBA 3A8AA 3SHAH 4Y0ZE 3U69H 1Y8TA 4ABHA 4GHQA 1EP5A 2GGVB 1O2QA 2Z7FE 4YLQH 3A84A 3SNDA 5CE1A 4I8LA 1QB1A 1T7CA 1QQUA 3VGCB 5C20A 4GVUA 7KMEH 4TWWA 3ZZ7A 3M5LA 1LHGH 1HRTH 3EGKH 2WPLS 3QGNB 3JZ1B 3S9AA 1YM0A 3EA7A 1FNIA 4D8NA 3PLPA 1C2EA 3E16B 1GBTA 1O30A 2FYQA 1UVOA 2ZTZA 3U1JB 1HLTH 3RU4D 1CU1A 3QDZB 3F9EA 2A4GA 1A0JA 4CHAB 4DIIH 1AE8H 1THSH