3PM3A

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pm3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pm3A02
4NCYA 2FS9A 2GMTB 1A3EH 4X0WU 3SV7A 4X1SU 1O2QA 1BTZA 1O5CB 1FI8A 4OS4A 4I8LA 4BTUB 3GY7A 3QWCH 3SJKA 1NRRH 2ASUB 4K8YA 1C1OA 1HNEE 2FI4E 4B73A 2GGVB 3T29A 4BANB 1C2GA 1F2SE 1GJ4H 3CP7A 5HXFA 2FX6A 5J4QA 3UWIA 1NFYA 3UTUH 3M5OA 1KXEA 5FX5A 1SLWB 3RXFA 1KYNA 4X8VH 1NRQH 2PKAA 2FOHA 4ZAEA 2QF3A 4ZHAA 1EB1H 5DGJA 5EQSA 2Z7FE 2ZU2A 4NWKA 1HDTH 4I8JA 1C1QA 3A83A 3TITA 3TH3H 2GCTC 3GCNA 3RXDA 3RXSA 2ZGCA 3ATIA 1S6HA 1Y3WA 1TONA 3ZZ4A 1KIGH 1THRH 1GMHF 3TK6A 1ZHMA 2PR3A 4LXBH 3RC4A 4NG9H 2FODA 3A87A 1O3PB 1E35B 4UFGH 1QHRB 2B7DH 1BJUA 2XTTB 1OPHB 4Y7AA 3UOUA 5LGOA 1NO9H 1FLEE 1RIWB 1EP6A 3S7HB 3SU2A 1QIXB 1YPHC 1G3DA 1O5DH 1UMAH 1QNJA 1ZPBA 4MVNA 2FS8A 2XNIA 4ABBA 1QL7A 3A7TA 2WPKS 1DITH 2ZCKP 1BZXE 3L6PA 2H9HA 1ESTA 2BXTH 1C5TA 3PMJA 5C20A 3SUGA 1Z8GA 3RXKA 4ISOA 3GDUA 4CBOA 4TYDA 3RMLH 3HK6B 1Z1IA 1JXPA 1FAKH 2GT7A 3E0NB 3MNXA 3LGVA 1D9IA 4X2YA 3SJ8A 1PPEE 1NRPH 2B9LA 1MQ6A 1F5LA 1LQEA 3MO3A 2FI3E 1SHHB 3Q3YA 5DP7A 1VR1H 1HJ8A 3AW1A 2ILNA 1CGHA 2QY0B 4MPXA 4F49A 3UNQA 1BMNH 1MQ5A 2BY9X 2OINA 1DWBH 1PJPA 1GHBG 3GDSA 3SNAA 1GBDA 1EZQA 2CXVA 3SJ9A 4I7YH 1O37A 2HLCA 3ZVFA 4YTAA 1T8NA 3V0XA 2HPQH 3SU6A 1FY1A 1TALA 1MAXA 4O3UA 2Z9LA 1TMBH 1TQ0B 2H9EH 3ELAH 2XRCA 1ZMNA 4ZUHA 2UUFB 1HV7A 3FAOA 1C1WH 1OWDA 1TX6A 4DURA 3A7XA 1ARCA 2PHBA 4FUJA 4X8SH 4TY7A 3ZVEA 1O2YA 3UQOA 5A0AE 2ZKSA 1TBQH 4AFSA 1ELAA 1HXFH 1LHEH 1SVPA 3KN2A 4AB8A 3ZZ8A 1XUJA 3KQCA 2FP7B 2JH5D 5EG4A 2A4RA 3LKWA 3RXLA 3SORA 4AG2A 1O3GA 4IW4E 1F0UA 3ZZCA 2SGQE 3TJOA 3F9HA 1G9IE 1O2IA 5FPSA 3ZVBA 2ZCHP 1C5NH 1IQNA 2ZGHA 2ZGXH 1EPTC 4TPYA 3ZYEA 3BF6H 1BMMH 1C1NA 1P3CA 1MCTA 1AD8H 4YOJA 4AB9A 1SGQE 1TQ7B 1C5MD 1NFWA 2J2UA 1GVLA 1TNKA 2ZPRA 2ZZUH 4VGCC 5K7RA 1OYTH 3A7ZA 4CHAC 3QLPH 5K0HA 2J9NA 2ZECA 2ZU5A 3A84A 1HAXB 1P3EA 1P09A 1N6YA 1G37A 3SNDA 1O35A 2WYGA 3P95A 2ZDNA 1GBCA 3B23B 4DW2U 2W26A 1NU7B 1NESE 1FDPA 1C1MA 2C8WB 1B5GH 4AFUA 2BQ7B 1NS3A 1XVOA 2BLQA 2OC0A 4NSYA 3N7OA 3HPTB 2FMJA 1O2UA 1H8DH 1KDQB 1FMGA 1T8MA 2ZG0H 4Q2KA 1J17T 1GBIA 1J14A 5EPYA 4JCNA 3BIUH 2OBOA 1ZHPA 1C2DA 2G51A 4GCHG 3RU4T 3V3MA 1B0FA 1DUAA 2Q6FA 4RKOB 4NIVA 2F9UA 2Q6DA 1ZYOA 1CBWB 4GLYA 3TGJE 1C9TA 3Q3KA 3P70B 5L6NH 3UOPA 4FUFA 1VCPA 3VGCB 1RTLA 3MH6A 4OS5A 2UWLA 2OC7A 1V2UT 3OTJE 2A31A 1AVXA 1O3NA 4LZ4B 2ZFRH 1FIZA 4IMQA 2BVRH 1EAIA 2ZNKH 4FU8A 3RXAA 2JH0D 3QDZB 4H6SB 1GI4A 4YOGA 2NU4E 3SGQE 2BB4A 3ITIA 1IQGA 2ODYB 3GYLB 3M5LA 1IQEA 4WF8A 2H5CA 3RC5A 1J9CH 3TJVA 4NGAH 5L2YH 1BTHH 3NK8A 3LH3A 1RTFB 2YOLA 1GBKA 1XUGA 3HGNA 2ALPA 1EJNA 2C8ZB 7GCHF 3V7TA 5GDSH 1NFXA 1XUFA 1F0RA 4ABDA 1NRNH 2PKAB 1BIOA 3DD2H 3F9EA 1C5WB 2JETB 1C2IA 2CHAC 2SFAA 6GCHF 2PSYA 1P11E 4Y11E 1O3AA 4CR5A 3BIVH 1GBFA 1GI1A 1GMCG 1QQUA 3S0NA 1UTJA 1T8LA 3SNCA 1O3EA 2H1UA 2BZAA 1O3HA 1A61H 1CQQA 1H1BA 1PFXC 3QN7A 1K9OE 1O2ZA 2B0FA 4TPIZ 1M9UA 1K28D 1EOLA 5DP5A 1JRTA 1GBEA 1EKBB 1TNHA 3M3SA 5AFZH 1O33A 3LT3A 1L4ZA 1AGJA 5AFYH 3SU0A 4BTIB 2GCHF 5A8XA 4AFQA 4Y8ZA 1GMDF 2FESH 3BTDE 1ZPZA 2ZCLP 3T28A 3V13A 3Q00A 5TCCA 3GCOA 3MU0A 2F9PA 1EZUC 2BLOA 3RC6A 1KLTA 2VWLA 3UPEA 1YPEH 4Q7YA 1C5YB 1ELFA 1XVMA 1UVSH 2GVFA 2WINI 4BTTB 1T32A 1T4VH 1ID5H 2G00A 5GXPA 1RJXB 1N1LA 2AEIH 1KXAA 3RU4E 1J15A 1SG8B 3MNBA 1P01A 2A32A 1O3LA 4MNVA 3SUEA 8ESTE 1SGFA 4OS2A 4BNRA 5JBTA 5LPFA 3MNCA 1ZTJA 2FXRA 7KMEH 1BHXB 1WBGB 4ZKNU 5EPNA 2FX4A 1AUTC 1W11U 1MU6B 4WMEA 5ESBA 1ZHRA 2F91A 2HVXA 3I78A 4H4FA 5F8TA 3BEIB 2DE9A 1SGTA 4X2WA 3ATMA 2F9OA 1FY3A 1QCPA 1DICA 1MU8B 3PM3A 1AU8A 2R0KA 3IWMA 4ISIH 3RXPA 2A4GA 3F9GA 1ZGIA 1C1UH 1AFQB 1GCDA 4FUBA 1TABE 4Q7XA 3TJUA 1WYKA 2VIVA 3K2UA 1SPJA 4WVPE 1N6XA 2FIRH 1C9PA 1ETTH 1P2JA 2QXHA 2LPRA 4CH2B 1TX7A 2IJOB 1ZMLA 2ANKH 2R2WU 2C3SA 3KIDU 1W12U 1NZQH 2IOTA 2HNTC 2ODPA 4BAOB 2ZWLH 1DFPA 1O36A 1RGQA 2PUQH 3PWBA 2FM2A 4JZ1A 4INHA 1ELTA 4Y7BA 3LGTA 1VGCB 4D8NA 1BBRK 1TWXB 2DE8A 1ESAA 4PROA 5SGAE 1GJ8B 1ZSJA 1O3CA 2PFEA 1HB0B 2HOBA 1Y59T 5IDKA 1O5BB 5T3HA 1TRMA 3LOXA 4JYUH 3SN8A 3NPSA 1O3DA 1ANEA 1K1LA 5JPMH 1KTSB 1BUIA 1HAGE 2PUXB 2FOMB 2ZFSA 2ZHWH 2A2XH 4NA8A 1LKAA 2HWLB 2PKSC 3EAJA 4WWYA 1BHXF 1D3TB 4FUCA 1S5SA 3BEFB 4FUEA 1EAUA 3QUMP 3TGKE 1DPOA 2PLXA 3MH4A 1LO6A 2Y5GA 2BM2A 3A88A 4CRFA 3MU4A 1BMAA 5FCRA 3U1IB 9ESTA 1O3BA 5HM2A 1G3BA 1B7XB 4ZH8A 2NWNA 4B75A 3GCTG 1CGIE 1LVYA 2AYWA 2UUYA 3IITA 4B74A 4JK5A 4ABHA 1L0ZA 2OP9A 1RFNA 1VJAU 2QYIA 4E06H 2FOCA 3L3TA 1K2I1 4NWLA 1VITH 4AFZA 1OYQA 1EJAA 3M3TA 3RXMA 3T27A 5JB8S 1Q3XA 1H9IE 1AQ7A 1THPB 1XUIA 5CHAB 4YM9A 1YPKH 1CHOG 3RXHA 4CRBA 5EQQA 2FOFA 1YLDA 2BYAX 5HM9A 1VCWA 4B2AA 3VB5A 1TE0A 2WYJA 1ELDE 5C2ZA 1HJAC 1FY8E 2PGBB 2VH6A 3KQEA 2VWNA 1C5QA 1TPSA 5C1UA 2OD3B 1C4U2 1CGJE 3PO1C 1W10U 3QZRA 2AMPA 3MU5A 2A7HA 3C1KA 1GBBA 4E05H 1O2WA 4MDSA 4YOIA 3BG4B 1KTTB 1Z71A 4XFQA 1DT2A 1PPHE 3FZDA 3UQVA 1LHFH 2P3UB 2ZHDA 3ATLA 1Q2WA 2A5IA 5ESTE 4JZIA 5EXMA 1CA0C 1EPTA 3FANA 3SJIA 4YO9A 3JZ1B 2XBWA 5FPYA 3M3VA 2TRMA 5E0GA 1MTSA 7LPRA 1C4V2 1ZR0A 2I6SA 5JDUB 5B6OA 1TLDA 2XCFA 1SQTA 2GX4A 2PWXA 3T62A 3PMAB 2OQ5A 1O2NA 3MO6A 2PTNA 2HNTF 4B71A 1BT7A 1P10A 2BDGA 4Y76A 1CT4E 2ZDLA 3SV2H 1IOEA 1LHDH 1GHAG 1VITF 1W0YH 2FWWA 4JZEH 4ABIA 1MKWH 4Y79A 5HYOA 2FEQH 2BQ6B 1ANBA 3A82A 1D6RA 3T26A 1Y5UT 1VCQA 3D65E 1MKWK 2G81E 1BRUP 5A2MH 3TLOA 3UWJH 3GY5A 3Q77A 4IN2A 3U1JB 1V2NT 5FCKA 2QV1A 1GG6B 1PYTD 2BOKA 4K8BA 4OS7A 1C2LA 6LPRA 2BY7X 3OU0A 3M7QA 3E3TA 1V2VT 2FOGA 1A7SA 6CHAC 3M61U 3LJOA 4WMFA 1F0TA 9LPRA 1SR5C 2W7SA 4B2BA 4BXWA 1GMHG 1HCGA 1S85A 1JIMA 3I77A 5C1YA 2A5AA 4CBNA 1LMWB 1O38A 1OSSA 4X6PA 5E2OA 2P3TB 2VVCA 4ISLA 1IHTH 2VIOA 2F9NA 4NA9H 2ZQ1A 2AERH 4CR9A 1IAUA 4AG1A 4R8TB 1BJVA 2VVVA 1CVWH 2HRVA 3UREA 3EGKH 1YGCH 1CE5A 1GI8B 1YPGH 2Q6GA 1ANDA 1QTFA 2BXUH 1EQ9A 2ZI2H 4KELA 5ABWA 1GHZA 1QBOA 3TIUA 4GPGA 4KTUA 3VEQB 2F83A 1UK4A 2Z3CA 3RMOH 1TNGA 1ANCA 4JZDH 1DM4B 5EW1H 4ABJA 3ZZ3A 2NU2E 2TIOA 1MTNC 2QA9E 5EODA 4GHTA 1C5XB 2GZ8A 1ARBA 2R0LA 4ESTE 1IQIA 1C2MA 5JB9S 4DIIH 3TH4H 2TGAA 1HBTH 4O03A 2R2MB 3FZZA 1FN8A 4GUXA 1SGPE 4Q7ZA 1J8AA 1C5UA 3KEEA 4U30A 1GBMA 1A1RA 3ODDA 2VU8E 1UJ1A 2GCTB 1IQJA 5T6GA 1O32A 2BD8A 3W94A 1LKBA 1TFXA 1UTKA 3U8RH 1E37B 1GHBF 5CE1A 5E8EH 1H8IH 1O30A 2P93A 2Y5HA 2QXIA 2Z9KA 3DFLA 3ZZAA 1AO5A 3S7KB 5EXNA 1XX9A 4AGJA 2I6QA 3I29A 2YNBA 3VB7A 3V12A 2GD4B 4FVBA 2J94A 4GHQA 1GJDB 1ETRH 2A5KA 3GISB 3RUOA 3RXUA 1PPBH 3PV4A 1QA0A 1J16A 3A86A 3UNRA 1FAXA 2PTCE 1GDQA 5H4IB 2Z94A 4FVDA 1WV7H 4D76A 4ZXXH 3MH5A 2A0QB 1DX5M 1XUHA 3U98H 3GY6A 2QXJA 3URCA 2QF0A 3M7UA 5FX6A 1SGDE 3MYWA 1FJSA 1UTOA 2O9QA 4MPWA 2XBYA 2WV5A 4FXGH 1C5OH 1IQFA 8GCHG 1C1SA 3SHAH 1SHYA 5AHGH 5T6DA 3S69A 1W13U 1P2KA 1SBWA 1NM6A 4XBDA 1C1VH 4ZKSU 1UVTH 4K1EA 4WXVA 1SLXB 2R3YA 1YYY1 1YPHE 1MH0A 2C90B 1ABJH 2ZU3A 4X1NU 2AGEX 2J4IA 1DXPA 1AY6H 2XCNA 2BVXH 1TOMH 2FOBA 1ZMJA 2BX4A 3LGIA 4X1PU 4RN6A 1KY9A 1LTOA 1V2JT 2H6MA 3KHVA 1YBWA 3ODFA 1LHGH 5C3NA 4K1SA 2VVUA 1OX1A 3SQHE 2C8YB 1FPCH 2A1DB 2R3UA 1OOKB 5LH8A 2Y82A 3MMGA 3VXEH 4H42U 1BDAA 3H5CB 1GBJA 2XXLA 2ZPSA 1AIXH 2AGIX 1BTPA 2FO9A 3STJA 3GY3A 4KKDA 4ISNA 2WPJS 5A0BA 2RG3A 2BDIA 4WY3A 2FOEA 1SL3A 2FLRH 1QRXA 2VGCC 3GCHC 4MNWA 4WH6A 2BY6X 1G3EA 2Z9GA 1T4UH 2TBSA 4ABGA 3URDA 1MCVA 2EI8A 1C5SA 2RA3A 2BDHA 2V0BA 2A4OA 3U8OH 1UTLM 1EPTB 1JRSA 1FUJA 1TNIA 4I8KA 1KXBA 5EGMA 2JH6D 1WSSH 3K6YA 4K2YA 4O97A 1SLVB 3FP6E 1Z6JH 5AVDA 1CO7E 3ZVCA 1UTNA 1Z8IB 1CT2E 2ZIQH 3H7TA 4KTSA 5E0HA 1V2WT 2EC9H 1IQHA 4ZKOU 1N8OC 1TGCA 3PLKA 1AMHA 1ZSKA 2CJIA 3GYMA 1OKXA 2IPHA 4MPVA 2F9BH 4CHAB 5F8ZA 3ESTA 1ZJKA 4Y0ZE 3O8DA 1SGNE 2F9VA 1AB9C 5EOKA 3O8RA 1VJ9U 1UTQA 4K3JA 1RXPA 2O8WA 3A8BA 2ZFPH 2G5NA 4LK4A 1MZDA 3BSQA 2OCVB 1AE5A 2BTCE 2FDAA 1Y3XA 1P9SA 3HATH 2XWAA 3K6ZA 1V2ST 2F3CE 3BTQE 5F6MA 4FU7A 1P57B 2Y7XA 2GT8A 5TJXA 1SFQB 3M7TA 1D3DB 1X7AC 1SGCA 2ZTZA 4NFFA 3BTME 4ZHMU 2ZF0H 4X6NA 3T5FH 5PTPA 2ZC9H 1G32B 1LVOA 1RD3B 1C5PA 1O5EH 1GHYH 1V2OT 2ODQA 1YKTA 4JYTA 4FUGA 1SQAA 1GI9B 3MFJA 2VWMA 3LC3A 3SO3A 1UK3A 1K1MA 3GICB 4UFEH 4IC6A 1K1IA 2ZGBH 3A8CA 1SB1H 3R0FA 1OS8A 3ZZ7A 2ZEBA 2R9PA 2BZ6H 1MD7A 1THSH 2D1JA 1EASA 1FQ3A 4QT8C 3LPRA 3PWCA 4U2WA 1TPOA 1AZZA 1GVZA 4NSVA 3D62A 2QGRA 1AVWA 4Y8XA 2J92A 1O3IA 1G36A 3DT0H 3SGBE 1JWTA 1WAYB 3SW2B 2ESTE 1D3PB 1EAXA 1E0FD 1F7ZA 2QN5T 3SU4A 1XMNB 1EP5A 4B1TA 1HAYB 2QXGA 2BMGB 4Z6AH 2P3FH 3EA9A 1O2HA 1O2OA 2XC0A 2CHAB 2VNTA 2W3IA 4A5TS 4MTBA 3BTGE 3UR9A 3LH1A 4A1TA 3ZZ6A 1MUEB 1TNJA 1AWFH 2SGDE 4YLQH 5DKMA 5EU8A 1O3FA 2BLWA 4YT6H 2A7JA 1SMFE 2FYQA 1DOJA 2UUKB 3QTVH 4DGJA 2OC1A 4INLA 3RXOA 4AN7A 1W7XH 3OY6U 2BY5X 3PB1E 1OWIA 2Y5FA 4NZLA 2Z3EA 1HPGA 3PYHA 1U6QA 2QCYA 3A89A 5HGGA 2XYAA 1DLKB 1GBAA 4D9RA 1SOZA 1XXFA 4YT7H 1C1RA 2ZPQA 5GJ4B 4IS5A 2CF9H 4A1XA 3ZVGA 2SNVA 3UFAA 2CN0H 4Y0YE 3BTKE 1SFIA 4JK6A 5A0CA 5AF9H 1G30B 4NA7A 3LJJA 3QTOH 2ZO3H 1D3QB 1O3KA 1K1JA 2H5DA 1GJBB 1ZZZA 4X1RU 3SUFA 5CHAC 4JZFH 2C4FH 4I31A 4CRDA 1MZAA 1YLCA 2BX3A 5I46H 4O9VA 2FZZA 1BTUA 3HKJB 4ZXYH 4LOYH 1P2QA 3ZYDA 3KF2A 1GI2A 1ORFA 5DO4H 2Z9IA 4MNXA 1HXEH 1HAZB 1XM1A 1Z6EA 1GCTC 2GZ7A 1GBTA 1PQ5A 1AKSA 3RM0H 2B5TB 1GI3A 3E6PH 3KGPA 2YNAA 2O8UA 1YF4A 2RCEA 1GHXH 1QL9A 2OTVA 4MLFB 3EQ0H 1YC0A 1HAPH 2V3HH 4CRGA 3F6UH 1GGDC 3OY5U 4BAHB 3QX5H 3EA7A 3HKIB 4Z0KA 5GCHG 1KSNA 4CRCA 3M37A 5LPEA 2IN2A 3UUZA 5BRRE 2O8MA 1EOJA 1DVAH 3MO9A 3VXFH 2J34A 1DE7H 3RXQA 2SGEE 2VIWA 3GCTF 1JOUB 2QAAA 3BG8A 4R0IA 5JBCS 2P8OC 1TMTH 4HTCH 2GV7A 5FHTA 1TPAE 2P16A 4ZHLU 2GMTC 1HFDA 1WTHD 1S82A 4SGAE 1Z7KA 1E38B 1ELCA 3PMBB 2XBVA 3BN9A 3R3GB 4SGBE 2A7CA 3P8NA 1DSTA 1CHOF 1O31A 1O2JA 5DP9A 1QA7A 1GL1A 3S9BA 1WCZA 1TGNA 3NUMA 1O2LA 1MKXH 1O3JA 5DP6A 3ZV9A 1SLUB 3K9XB 3STIA 3CS7A 5G4BA 3FFGA 4X6OA 2KAIB 1TA6A 3PTNA 4BOHA 1IQMA 1RRKA 3ZV8A 4XOJA 1BRBE 2AGGX 2HNTE 2WPLS 2PKSB 1SQOA 4AYVB 1QFKH 1QRWA 1V6DA 1H9HE 3ATWA 3RDZA 1V2KT 1BB0B 2EEKA 2VINA 3UIRA 1O0DH 1UVUH 4IN1A 4AORA 1LPGB 2XC5A 4CREA 4X2XA 3SV6A 1YCPH 1OXGA 1P9UA 3A80A 1DXWA 5FBEA 3TU7H 1ZGVA 3QGJA 3P8FA 2Z6BD 1W3CA 3AAVA 4DG4A 1A5HA 1F5KU 1YCPK 4FUIA 2G5VA 4E7RG 3DUXH 1XXDA 4X8UH 1W0ZU 1BMLA 3EE0B 1NN6A 4MNYA 3IG6B 2WPHS 1FXYA 4ZKRU 1UTPA 1BTYA 2Y7ZA 3PMHB 4UE7H 2PW8H 1GI7B 4JMYA 3BTFE 4WH8A 3AVZA 5DPAA 1D6WA 1RIWC 1GJ5H 1ZRKA 2JKHA 4I32A 3C27B 4TWWA 1KXCA 1AZ8A 4DOQA 1MMJN 1WQSA 3P6ZB 3ZZ9A 5FBIA 1VITG 2G8TA 2OBQA 1HJAB 1S84A 3KQBA 3AW0A 3T2NA 1C2KA 4BAKB 4LZ1H 5DP8A 3E0PB 3EDXB 4HI3A 1LPKB 2AMDA 1W7GH 3LDXH 3PO1B 1GHAF 1DUEA 2ANWA 2ZDKA 3SV8A 2GP9B 1T8OA 1GJAB 2H9TH 3SNEA 1HIAA 2GKVE 4K1TA 1TBRH 1EZSC 1F0SA 5C5OA 3B8JA 3VFEA 2RA0A 4NIYA 4RSPA 1TYNA 1Z8JB 1ESBA 2NU1E 1GPZA 4UFFH 5A8ZA 3SQEE 2VJ1A 1S0QA 1QJ7B 1L1GA 2TPIZ 2GDEH 4AOQA 4X8TH 4GSOA 2FOAA 4OS6A 3ATKA 3P92A 1S83A 3M35A 2ZHEH 3FP7E 1CA0B 2TGDA 3M36A 1G2LA 1DY8A 3TGIE 4Y71A 3VB3A 3MTYA 2NU3E 1QJ1B 1E34B 1SGEE 4AYYB 1O2TA 1AWHB 2V6NA 2XWBI 3PTBA 2LNCA 1FPHH 1DWEH 2WV4A 1ETSH 3AAUA 2W3KA 3RLYH 5JYIA 2W7UA 3MH7A 2BDCA 4TY6A 3BTTE 1K21H 3RLWH 2STBE 4X6MA 5F8XA 4CH8B 4NIWA 1QQ4A 1BOQA 1TRYA 1WUNH 1WQVH 1FY4A 1ACBE 1PQ7A 1P04A 1SGRE 2ZDMA 1GDUA 3UY9A 5EXLA 4HGCA 2OXSA 4B76A 3SV9A 1V2QT 1TMUH 3F68H 4UFDH 3WY8A 1C1TA 3RXEA 3TJNA 1GJ7B 3E1XB 1TOCB 1C5LH 1IQLA 2ZFQH 3SBKA 1P06A 1SI5H 1O34A 4XE4A 4DIHH 2PGQB 1O2MA 3E8LA 2ZDVH 1TA2A 3RXIA 5LPRA 3A81A 1GVKB 2O8LA 2ZQ2A 3A85A 3TVJB 1GJCB 3LGWA 1PYTC 1P2MA 4K69A 3SU1A 1QGFA 1PPFE 1O2XA 2BD4A 2P59A 1JIRA 3A8AA 3H7OA 3TK9A 2OC8A 1LPZB 1MBQA 3ZVDA 6CHAB 1E36B 2ZU4A 1K1NA 3QK1A 1HYLA 3NCLA 1L4DA 1LVBA 1HGTH 4GAWA 2Y6TA 2CV3A 2BOHB 2EI7A 4IBLH 1FV9A 1UVPA 1TPPA 1C5VA 3D23A 2VIQA 3SOSA 4A6LA 1TGTA 1AI8H 3RXJA 3SGAE 1QR3E 3EA8A 1AVGH 2UWPA 2HGTH 3FVFB 5DP3A 4M7GA 1QRZA 3PROA 1CU1A 2SGPE 6ESTA 3MI4A 3SU3A 3SZNA 5L30H 3TNTA 3ZVAA 3QO6A 1LDTT 4RKJB 1S0RA 1SGFG 1O2PA 1DS2E 3SI4H 1P03A 1AKSB 3PLBA 3TK5A 3BV9B 4WJG2 4HZHA 1YPJH 2TGTA 1FY5A 2Y81A 4NZQA 2WPIS 1C5RA 1O2GH 1BITA 1MTVA 4K5ZA 2BD5A 1LVMA 3RU4D 3RXBA 1HAVB 1MTNB 1O2VA 1V2LT 2OLGA 2Y80A 3BTHE 3LGUA 1DWCH 1C4Y2 4DT7B 1TRNA 3MU8A 1CBWC 1CSOE 3L33A 2BD3A 4ISHH 4HFPB 2BD9A 1ZSLA 3VGCC 5C5NA 5FAHA 4INKA 1EXFA 2STAE 3RMNH 4H6TA 3SUDA 1PPGE 8GCHF 1GBHA 1H9LB 4A92A 4AGKA 1ZTKA 4YESB 1YPLH 1OWEA 1UHBA 1P02A 2DUCA 1AFEH 3EYDA 2GV6A 3E90B 3TPIZ 4Q80A 3RM2H 2VIDA 1L2EA 1AE8H 1SGYE 1K1OA 3M5NA 5F03A 3W95A 4B2CA 2GTBA 2PV9B 4WXIA 1O2RA 1NU9A 3QZQA 2Z3DA 1RTKA 3BTWE 3NWUA 5A8YA 2ZP0H 3LGYA 5BPEA 1QL8A 2SGFE 1Y3UA 1ZTLA 1A5IA 2OUAA 1XUKA 1Z8RA 5HMAA 2FYRA 1UCYH 1QB9A 2UUJB 3KCGH 3E16B 4ABEA 1CA8B 4BAQB 4THNH 2FLBH 2JETC 1OP0A 1TBZH 1UCYK 5DK1A 2C93B 1AN1E 1NRSH 3F9FA 2D26C 1NROH 3NXPA 1OWJA 2WUBA 1UVOA 4U01A 2FTLE 1NY22 1PQ8A 1TIOA 3NKKA 2KAIA 1O5AB 3JZ2B 4GCHF 4DY7B 1G3CA 2TGPZ 1A46H 4KGAA 1EAWA 1PQAA 3TNSA 5GPIB 1ZOMA 5GWZA 1ZJDA 1GBLA 4KTCA 2Q1JA 1BTWA 1F92A 1B0EA 2AMQA 1DDJA 1ABIH 4AZ2B 2BQWB 2ANMH 1ELVA 4VGCB 4WMDA 1ELEE 1L1JA 1P0SH 5C67A 2C8XB 1TNLA 2BD7A 3SJOA 1V2PT 4Y10E 2AIQA 4IMZA 3GY8A 5C1XA 1BCUH 1GDNA 3NZIA 1O3OA 2ZFFH 3B9FH 2SGAA 1A2CH 4JYVH 1FZZA 1UCYE 2RDLA 4BXSA 1T7CA 2ZFTA 3A7WA 2CGAA 1QJ6B 1NC6A 1W8BH 7GCHG 1DY9A 2HPPH 3LIWA 1OP2A 1K1PA 3MNSA 1Y8TA 1IHSH 1NFUA 3KQDA 4BAMB 1WU1A 1SGIB 1H4WA 1EJMA 1GI0A 3U8TH 1MTWA 3SNBA 2FI5E 3OYPA 3LC5A 4D9QA 1FIWA 1GL0E 6GCHG 3VB4A 1EUFA 3RMMH 1P2OA 1Y5AT 1SSXA 1A0LA 1HIAB 3D49H 4K60A 1O39A 2XBXA 2G52A 2VGCB 3GCHB 2BD2A 1EATA 1HJ9A 3S9AA 2ZTXA 3AASA 5ETXA 2EI6A 5TCAA 3E91A 3K65B 1GMCF 3VB6A 1QBVH 1BA8B 2QC2A 3ZZ5A 2K1QA 1AFQC 2ZA5A 2G4UA 2PSXA 4OGXA 4OS1A 2SNWA 1FONA 1AHTH 2W5EA 5EW2H 1KXDA 2GCHG 1FNIA 4IC5A 1NPMA 1QURH 1GMDG 1GWAA 2BDAA 2D8WA 2GDDA 3Q3XA 1DWDH 1GJ6A 1ZPCA 3QGNB 1P8VC 1UO6A 2WPMS 5JBAS 1EB2A 2G4TA 4GVUA 5FXLA 1JMOH 5L2ZH 3RXVA 2P95A 1JBUH 5JBBS 4NIXA 1N8OB 1DSUA 3SU5A 2THFB 1BTXA 3FP8E 4ABAA 2ULLA 4TWYA 1NT1A 2J95A 3SI3H 1UK2A 1EZXC 1GI6A 3MU1A 1AB9B 1VGCC 2CMYA 1HAOH 3RXRA 1C2HA 1O3MA 4J2YB 3U9AH 2WUCA 1GHVH 4E7NA 1LCYA 1XKBC 4XDEA 1A0HB 2CF8H 1O2KA 5EQRA 1GHWH 5FPTA 4I33A 2P94A 1P2IA 3PLPA 4MG3A 3HK3B 1TGBA 1NTPA 1YP9A 1Y3YA 2FPZA 4A7IB 2VWOA 1KLJH 1A3BH 2FTMA 1PPZA 3G01A 4ABFA 3A7YA 1WTGH 1QBNA 1V2TT 5DP4A 2BY8X 1ZRBA 1W14U 4ASHA 3CENA 1A5GH 1DANH 2ZTYA 2EA3A 2G55A 3O8BA 1O5FH 1W2KH 2XW9A 1O5GH 3UNSA 1HAHH 1OWKA 1L1NA 3DFJA 2BLVA 3ZZBA 1Q31A 4NFEA 3GDVA 3BTEE 2A45B 1Y5BT 3A8DA 4UDWH 1DLEA 1CHGA 1HUTH 4I8GA 4Y8YA 3RXCA 5DJ7A 2BHGA 4ZROA 3LONA 8LPRA 1TAWA 2VH0A 1V3XA 1BBRH 4MQAA 1Y3VA 4O3TA 4DVAU 3GOVB 4IGDA 4UONA 1FN6A 2Z9JA 3Q76A 1K22H 3RXTA 8KME2 1VZQH 3SHCH 2XC4A 1LHCH 1HAIH 1YPMH 4ZMAH 1UTMA 2VIPA 3F1SB 4AX9H 1P12E 2A2QH 1MTUA 4XBCA 1SOTA 4DJZB 4OGYA 2AFQB 1AUJA 4I8HA 5J4SA 2M5TA 1ELBA 1A0JA 1G2MA 4KP0A 3ENSB 3HGPA 1MBMA 1SC8U 2ZGJA 3KNXA 3P8GA 3BG4C 1S81A 3RXGA 4UD9H 3VPKA 1HAVA 3TH2H 4U32A 5E0JA 3DA9B 3U69H 1LQDB 2ANYA 1TGSZ 1UHBB 3MHWU 4YZUA 1INCA 2D2DA 1GI5A 1EX3A 1C2JA 1BRCE 5DG6A 1KLIH 4F4OC 1XKAC 1BBRE 3CS0A 5GCHF 4X1QU 1HLTH 2HALA 3RP2A 1P2NA 3MOCA 1ZLRA 1C5ZB 2BDYA 5A09A 4MPUA 1C2FA 4X2VA 2A4QA 3S9CA 1YCPM 3GY4A 1V2RT 2ZHQH 1MAYA 2AIPA 2B8OH 4Y6DA 3M5MA 2QIQA 1WOFA 2ZHFH 3P8OA 1D4PB 1QB6A 2VB0A 4D7FA 3OSYA 1S6FA 1TB6H 3A7VA 4A1VA 2V35A 4UEHH 1BQYA 1T31A 4DCDA 1C2EA 1MKXK 4XSKU 5IYTA 1CT0E 4D7GA 3GY2A 2OQUA 3UR6A 1IQKA 4YLUA 2H2ZA 3ZZDA 1QB1A 1TX8A 2UWOA 2ZDAH 2BVSH 4J1YA 1GCTB 1KDQA 1MD8A 1RS0A 1O2SA 1C1PA 5E2PA 3T25A 3MWIU 5T6FA 1Z1JA 2AH4X 1GG6C 3OX7U 1QY6A 2GZ9A 1P05A 2V3OH 5CMXH 4FU9A 4FUDA 1HRTH 2NU0E 1ELGA 1GGDB 2ZU1A 3BEUA 4XBBA 1A4WH 3DHKH 2J38A 1KXFA 3P17H 4FUHA 7ESTE 3LU9B 1PPCE 1F5RA 3O8CA 2AS9A 2BDBA 5I25A 1YM0A 3KL6A 1GJ9B 4CRAA 2O8TA 2ALVA 1OWHA 1OP8A 1V2MT 5GIBA 1BRAA 2P8OB
chains in the Genus database with same CATH superfamily
4NCYA 2FS9A 2GMTB 1A3EH 4X0WU 3SV7A 4X1SU 1O2QA 1BTZA 1O5CB 1FI8A 1FX0B 4OS4A 4I8LA 2JJ1D 4BTUB 3GY7A 3QWCH 3SJKA 1NRRH 2ASUB 4K8YA 1C1OA 1HNEE 2FI4E 4B73A 2GGVB 3T29A 4BANB 1C2GA 1F2SE 1GJ4H 3CP7A 2KZ4A 5HXFA 2FX6A 5J4QA 3UWIA 1NFYA 3UTUH 3M5OA 1KXEA 5FX5A 4RT0A 2RDEA 1SLWB 3RXFA 4ZCNA 1KYNA 4X8VH 1NRQH 2PKAA 2FOHA 4TSFD 4ZAEA 2QF3A 4ZHAA 1EB1H 5DGJA 5EQSA 2W6ID 3ZIAD 2Z7FE 2ZU2A 4NWKA 1HDTH 4I8JA 1C1QA 2F4LA 3A83A 3NRLA 3TH3H 3TITA 2GCTC 3GCNA 3RXDA 3RXSA 2ZGCA 3ATIA 1S6HA 1Y3WA 1TONA 3ZZ4A 1KIGH 1THRH 1GMHF 3TK6A 1ZHMA 2PR3A 4LXBH 3RC4A 4NG9H 2FODA 3A87A 1O3PB 1E35B 4UFGH 1QHRB 2B7DH 1BJUA 2XTTB 1OPHB 4Y7AA 3UOUA 5C17A 5LGOA 1NO9H 1FLEE 1RIWB 1EP6A 3S7HB 3F0PA 3SU2A 1QIXB 1YPHC 1G3DA 3N7DA 1O5DH 1UMAH 1QNJA 1ZPBA 4MVNA 2FS8A 2XNIA 4ABBA 1QL7A 3A7TA 2WPKS 1DITH 2ZCKP 1BZXE 3L6PA 2H9HA 1ESTA 2BXTH 1C5TA 3PMJA 5C20A 3SUGA 1Z8GA 3RXKA 4ISOA 3GDUA 4CBOA 4TYDA 3RMLH 3HK6B 1Z1IA 1JXPA 1FAKH 2GT7A 3E0NB 3MNXA 3LGVA 1D9IA 4X2YA 3SJ8A 1PPEE 1NRPH 2B9LA 1MQ6A 1F5LA 1LQEA 3MO3A 3EE7A 2FI3E 1SHHB 3Q3YA 5DP7A 1VR1H 1HJ8A 3AW1A 2ILNA 1CGHA 2QY0B 4RT1A 4MPXA 4F49A 3UNQA 1BMNH 1MQ5A 2BY9X 2OINA 1DWBH 1PJPA 1GHBG 3GDSA 3SNAA 1GBDA 1EZQA 2CXVA 2KX4A 3SJ9A 4I7YH 1O37A 2HLCA 3ZVFA 4YTAA 1T8NA 3V0XA 2HPQH 3SU6A 1FY1A 1TALA 1MAXA 4O3UA 2Z9LA 1TMBH 1TQ0B 4RI0A 2H9EH 3ELAH 2XRCA 1ZMNA 4ZUHA 2UUFB 1HV7A 4I86A 3FAOA 1C1WH 1OWDA 1TX6A 2J5UA 4DURA 3A7XA 1ARCA 2PHBA 4FUJA 4X8SH 4TY7A 3ZVEA 1O2YA 3UQOA 5A0AE 2ZKSA 1TBQH 4AFSA 1ELAA 1HXFH 1LHEH 1SVPA 3KN2A 4AB8A 3ZZ8A 1XUJA 3KQCA 2FP7B 2JH5D 5EG4A 2A4RA 3LKWA 3RXLA 3SORA 4AG2A 1O3GA 4IW4E 1F0UA 3ZZCA 2SGQE 3TJOA 3F9HA 1G9IE 1O2IA 5FPSA 3ZVBA 2ZCHP 1C5NH 1IQNA 2ZGHA 2ZGXH 1EPTC 4TPYA 2JJ2D 3ZYEA 3BF6H 1BMMH 1C1NA 1P3CA 2K0QA 2KCAA 1MCTA 5KGOA 1AD8H 4YOJA 4AB9A 1SGQE 1TQ7B 1C5MD 1NFWA 2J2UA 1GVLA 5C0TA 1TNKA 2ZPRA 2ZZUH 4VGCC 5K7RA 1OYTH 3DCLA 3A7ZA 4CHAC 3QLPH 5K0HA 2J9NA 2ZECA 2ZU5A 3A84A 1HAXB 1P3EA 1P09A 1N6YA 1G37A 3SNDA 1O35A 2WYGA 3P95A 4FETA 2ZDNA 1GBCA 3B23B 4DW2U 2W26A 1NU7B 1NESE 1FDPA 1C1MA 2C8WB 1YY3A 1B5GH 4AFUA 2BQ7B 1NS3A 1XVOA 2BLQA 2OC0A 4NSYA 3N7OA 3HPTB 2FMJA 1O2UA 1H8DH 1KDQB 1FMGA 1T8MA 2ZG0H 4Q2KA 1J17T 1GBIA 1J14A 5EPYA 4JCNA 3BIUH 2OBOA 1ZHPA 1C2DA 2G51A 4GCHG 2V7QD 3RU4T 3V3MA 1B0FA 1DUAA 2Q6FA 4RKOB 4NIVA 2WPDD 2F9UA 2Q6DA 1ZYOA 1CBWB 4GLYA 3TGJE 2WZQA 1C9TA 3Q3KA 3P70B 5L6NH 3UOPA 4FUFA 1VCPA 3VGCB 1RTLA 3MH6A 4OS5A 2UWLA 2OC7A 1V2UT 3OTJE 2A31A 1AVXA 1O3NA 4LZ4B 1W0KD 2ZFRH 1FIZA 4IMQA 2BVRH 1EAIA 2ZNKH 4FU8A 3RXAA 2JH0D 3QDZB 4H6SB 1GI4A 4YOGA 2NU4E 3SGQE 2BB4A 3ITIA 1IQGA 2ODYB 3GYLB 3M5LA 1IQEA 4WF8A 2H5CA 3RC5A 1J9CH 3TJVA 4NGAH 5L2YH 1BTHH 3NK8A 3LH3A 1RTFB 2YOLA 1GBKA 1XUGA 3HGNA 2ALPA 1EJNA 2C8ZB 7GCHF 3V7TA 5GDSH 1NFXA 1XUFA 1F0RA 4ABDA 1NRNH 2PKAB 1BIOA 3DD2H 3F9EA 1C5WB 2JETB 1C2IA 2CHAC 2SFAA 6GCHF 2PSYA 1P11E 4Y11E 1O3AA 4CR5A 3BIVH 1GBFA 1GI1A 1GMCG 1QQUA 3S0NA 1UTJA 3FOAA 1T8LA 3SNCA 1O3EA 2H1UA 2BZAA 1O3HA 1A61H 1CQQA 1H1BA 1PFXC 3QN7A 1K9OE 1O2ZA 2B0FA 4TPIZ 1M9UA 1K28D 1EOLA 5DP5A 1JRTA 1GBEA 1EKBB 1TNHA 3M3SA 5AFZH 1O33A 3LT3A 1L4ZA 1AGJA 5AFYH 3SU0A 4BTIB 2GCHF 5A8XA 4AFQA 4Y8ZA 1GMDF 2FESH 3BTDE 1WXRA 1ZPZA 2ZCLP 3T28A 3V13A 3Q00A 5TCCA 3GCOA 3MU0A 2F9PA 1EZUC 2BLOA 3RC6A 1KLTA 2VWLA 3UPEA 3DSGA 1YPEH 4Q7YA 1C5YB 1ELFA 1XVMA 1UVSH 2GVFA 2WINI 3OAAD 4BTTB 1T32A 1T4VH 1ID5H 2G00A 5GXPA 2V3MA 3GS9A 1RJXB 1N1LA 2AEIH 1KXAA 3RU4E 1J15A 1SG8B 3MNBA 1P01A 2A32A 1O3LA 4MNVA 3SUEA 8ESTE 1SGFA 4OS2A 4BNRA 5JBTA 5LPFA 3MNCA 1ZTJA 2FXRA 7KMEH 1BHXB 1WBGB 4ZKNU 2JIZD 5EPNA 2FX4A 1AUTC 1W11U 1MU6B 4WMEA 5ESBA 1ZHRA 2F91A 2HVXA 3I78A 4H4FA 5F8TA 3BEIB 2DE9A 1SGTA 4X2WA 1QZ8A 3ATMA 2F9OA 4TT3D 1FY3A 1QCPA 1DICA 1MU8B 3PM3A 1AU8A 2R0KA 3IWMA 4ISIH 3RXPA 2A4GA 3F9GA 1ZGIA 1C1UH 1AFQB 1GCDA 4FUBA 1TABE 4Q7XA 3TJUA 1WYKA 2VIVA 3K2UA 1SPJA 4WVPE 1N6XA 2FIRH 1C9PA 1ETTH 1P2JA 2QXHA 2LPRA 4CH2B 1TX7A 3FN8A 2IJOB 1ZMLA 2ANKH 2R2WU 2C3SA 3KIDU 1W12U 1NZQH 2IOTA 2HNTC 2ODPA 4BAOB 2ZWLH 1DFPA 1O36A 1RGQA 2PUQH 3PWBA 2FM2A 4JZ1A 4INHA 1ELTA 4Y7BA 3LGTA 1VGCB 4D8NA 1BBRK 1TWXB 2DE8A 1ESAA 1OHHD 2VBCA 4PROA 5SGAE 1GJ8B 1ZSJA 3SZEA 1O3CA 2PFEA 1HB0B 2HOBA 1Y59T 5IDKA 1O5BB 5T3HA 1TRMA 3LOXA 4XD7D 4JYUH 3SN8A 3NPSA 1O3DA 1ANEA 1K1LA 5JPMH 1KTSB 1BUIA 1HAGE 2PUXB 2FOMB 2ZFSA 2ZHWH 2A2XH 1E1QD 1LKAA 4NA8A 2HWLB 2PKSC 3EAJA 4WWYA 1BHXF 1D3TB 4FUCA 1S5SA 3BEFB 4FUEA 1EAUA 3QUMP 3TGKE 1DPOA 2PLXA 3MH4A 1LO6A 2Y5GA 2BM2A 3A88A 4CRFA 3MU4A 1BMAA 5FCRA 3U1IB 9ESTA 1O3BA 5HM2A 1G3BA 1B7XB 4ZH8A 2NWNA 4B75A 3GCTG 1CGIE 1LVYA 2AYWA 2UUYA 3IITA 4B74A 4JK5A 4ABHA 5IK2D 1L0ZA 2OP9A 1RFNA 1VJAU 2QYIA 4E06H 2FOCA 4FOUC 3L3TA 1K2I1 4NWLA 1VITH 4AFZA 1OYQA 1EJAA 3M3TA 3RXMA 3T27A 5JB8S 1Q3XA 3OFND 1H9IE 1AQ7A 2J98A 1THPB 1XUIA 5CHAB 4YM9A 1YPKH 1CHOG 2M2AA 3RXHA 4CRBA 1H8HD 5EQQA 2FOFA 1YLDA 2BYAX 5HM9A 1VCWA 5T1VA 4B2AA 3VB5A 1TE0A 3MQKC 2WYJA 1ELDE 5C2ZA 1HJAC 1FY8E 2WSSD 2PGBB 2VH6A 3KQEA 3U28C 2VWNA 1C5QA 1TPSA 5C0UA 2OD3B 3F2FA 1C4U2 5C1UA 1CGJE 1SKYE 3PO1C 1W10U 3QZRA 2AMPA 3MU5A 2A7HA 3C1KA 1GBBA 4E05H 2OK5A 1O2WA 4MDSA 4YOIA 3BG4B 1KTTB 1Z71A 3FKSD 4XFQA 1DT2A 3WW7A 1PPHE 3FZDA 3UQVA 1LHFH 1VKYA 2P3UB 2ZHDA 3ATLA 1Q2WA 2A5IA 5ESTE 2IPQX 4JZIA 5EXMA 3WWBA 1CA0C 1EPTA 3FANA 3SJIA 4YO9A 3JZ1B 2XBWA 5FPYA 3M3VA 2TRMA 2L74A 5E0GA 1MTSA 7LPRA 1C4V2 1ZR0A 2I6SA 5JDUB 2YMSB 3F2GA 5B6OA 1TLDA 2XCFA 1SQTA 2GX4A 2PWXA 3T62A 3PMAB 2XNDD 2OQ5A 1O2NA 3MO6A 2PTNA 2HNTF 4B71A 1BT7A 1P10A 2BDGA 4Y76A 1CT4E 2ZDLA 3SV2H 1IOEA 1LHDH 1GHAG 1VITF 1W0YH 2FWWA 4JZEH 4ABIA 1MKWH 4Y79A 5HYOA 5EIYA 2FEQH 2BQ6B 1ANBA 3A82A 1D6RA 3T26A 1Y5UT 1VCQA 3D65E 1MKWK 2G81E 1BRUP 5A2MH 3TLOA 3UWJH 3GY5A 3Q77A 4IN2A 3U1JB 1V2NT 5FCKA 2QV1A 1GG6B 1PYTD 2BOKA 4K8BA 4OS7A 1NBME 1C2LA 6LPRA 2BY7X 3OU0A 3M7QA 3E3TA 4DT4A 1V2VT 2FOGA 1A7SA 6CHAC 3M61U 3LJOA 4WMFA 1F0TA 9LPRA 1SR5C 2W7SA 4B2BA 4BXWA 1GMHG 1HCGA 1S85A 1JIMA 3I77A 5C1YA 2A5AA 4CBNA 1LMWB 1O38A 1OSSA 4X6PA 5E2OA 2P3TB 2VVCA 4ISLA 1IHTH 2VIOA 2F9NA 4NA9H 2ZQ1A 2AERH 1COWD 4CR9A 1IAUA 4AG1A 4R8TB 1BJVA 2VVVA 1CVWH 2HRVA 4OM9A 4F48B 3UREA 3EGKH 1YGCH 1CE5A 1GI8B 1YPGH 2Q6GA 5KECA 1ANDA 1QTFA 2BXUH 1EQ9A 2ZI2H 4KELA 5ABWA 1GHZA 1QBOA 3TIUA 4GPGA 4KTUA 3VEQB 5F53A 2F83A 1UK4A 2Z3CA 3RMOH 1TNGA 1ANCA 4JZDH 1DM4B 5EW1H 4ABJA 3ZZ3A 2NU2E 1S6LA 2TIOA 1MTNC 2QA9E 5EODA 4GHTA 1C5XB 2GZ8A 1ARBA 2R0LA 4ESTE 1IQIA 1C2MA 5JB9S 4DIIH 3TH4H 2TGAA 1HBTH 4O03A 2R2MB 3FZZA 1FN8A 4GUXA 1SGPE 4Q7ZA 1J8AA 1C5UA 3KEEA 4U30A 1GBMA 1A1RA 3ODDA 2VU8E 1UJ1A 2GCTB 1IQJA 2HVYB 5T6GA 1O32A 2BD8A 3W94A 1LKBA 1TFXA 1UTKA 3U8RH 1E37B 1GHBF 5CE1A 3N99A 5E8EH 1H8IH 1O30A 2P93A 2Y5HA 2QXIA 2Z9KA 3DFLA 3ZZAA 1AO5A 2AHME 3S7KB 5EXNA 1XX9A 4AGJA 2I6QA 3I29A 2YNBA 3VB7A 3V12A 2GD4B 4FVBA 2J94A 5C94A 4GHQA 1GJDB 1ETRH 2A5KA 3GISB 3RUOA 3RXUA 2KR7A 1PPBH 3PV4A 1QA0A 1J16A 3A86A 3UNRA 1FAXA 2PTCE 1GDQA 5H4IB 2Z94A 4FVDA 1WV7H 4D76A 4ZXXH 3MH5A 2A0QB 1DX5M 1XUHA 3U98H 3GY6A 2QXJA 3URCA 2QF0A 3M7UA 5FX6A 1SGDE 3MYWA 1FJSA 1UTOA 2O9QA 4MPWA 2XBYA 2WV5A 4FXGH 1C5OH 1IQFA 8GCHG 1C1SA 3SHAH 1SHYA 5AHGH 5T6DA 3S69A 1W13U 1P2KA 1SBWA 1NM6A 4XBDA 1C1VH 4ZKSU 1UVTH 4K1EA 4WXVA 1SLXB 1K0HA 2R3YA 1YYY1 1YPHE 1MH0A 2C90B 1ABJH 2ZU3A 4X1NU 2AGEX 2J4IA 1DXPA 1AY6H 2J98B 2BVXH 2XCNA 1TOMH 2FOBA 1ZMJA 2BX4A 3LGIA 4X1PU 4ACAA 4RN6A 1KY9A 1LTOA 1V2JT 2H6MA 3KHVA 1YBWA 3ODFA 1LHGH 5C3NA 4K1SA 2VVUA 1OX1A 3SQHE 2C8YB 1FPCH 2A1DB 2R3UA 1OOKB 5LH8A 2Y82A 3MMGA 3VXEH 4H42U 1BDAA 3H5CB 1GBJA 2XXLA 2ZPSA 1AIXH 2AGIX 1BTPA 2FO9A 3STJA 3GY3A 4KKDA 5GNDA 4ISNA 2WPJS 5A0BA 2RG3A 2BDIA 4WY3A 2FOEA 1SL3A 2FLRH 1QRXA 2VGCC 3GCHC 4MNWA 4WH6A 2BY6X 1G3EA 2Z9GA 1T4UH 2TBSA 4ABGA 3URDA 1MCVA 2EI8A 1C5SA 2RA3A 2BDHA 2V0BA 2F43B 2A4OA 3U8OH 1UTLM 1EPTB 1JRSA 1FUJA 1TNIA 4I8KA 1KXBA 5EGMA 2JH6D 1WSSH 3K6YA 4K2YA 4O97A 1SLVB 3FP6E 1Z6JH 5AVDA 1CO7E 3ZVCA 1UTNA 4AC9A 1Z8IB 2EY4C 1CT2E 2ZIQH 3H7TA 4KTSA 5E0HA 1V2WT 2EC9H 1IQHA 4ZKOU 1N8OC 1TGCA 3PLKA 1AMHA 1ZSKA 2CJIA 3GYMA 1OKXA 2IPHA 4MPVA 2F9BH 4CHAB 2WV9A 4B6EA 5F8ZA 3ESTA 1ZJKA 4Y0ZE 2CK3D 3O8DA 1SGNE 2F9VA 1AB9C 2KCYA 5EOKA 3O8RA 1VJ9U 1UTQA 4K3JA 1RXPA 2O8WA 3A8BA 2ZFPH 2G5NA 4LK4A 1MZDA 3BSQA 2OCVB 1AE5A 1BMFD 2BTCE 2LP6A 2FDAA 1Y3XA 1P9SA 3HATH 2XWAA 3K6ZA 1V2ST 2F3CE 5B6LA 3BTQE 5F6MA 4FU7A 1P57B 2Y7XA 2GT8A 1E79D 5TJXA 1SFQB 3M7TA 1D3DB 1X7AC 1SGCA 2ZTZA 4NFFA 3BTME 4ZHMU 2ZF0H 4X6NA 3T5FH 5PTPA 2ZC9H 1G32B 1LVOA 1RD3B 1C5PA 1O5EH 1GHYH 1V2OT 2ODQA 5EJ1A 3AK5A 1YKTA 4JYTA 4FUGA 1SQAA 1GI9B 3MFJA 2VWMA 3LC3A 3SO3A 1UK3A 1K1MA 3GICB 4UFEH 4IC6A 1K1IA 2ZGBH 3A8CA 1SB1H 5CDFE 2K8IA 3R0FA 1OS8A 3ZZ7A 2ZEBA 2R9PA 2BZ6H 1MD7A 1THSH 2D1JA 1EASA 1FQ3A 3KYFA 3LPRA 3PWCA 4QT8C 4U2WA 1W0JD 1TPOA 1AZZA 1GVZA 4NSVA 3D62A 2QGRA 1AVWA 4Y8XA 2J92A 2W6JD 1O3IA 1G36A 3DT0H 3SGBE 1JWTA 1WAYB 3SW2B 2ESTE 1D3PB 1EAXA 1E0FD 1F7ZA 2QN5T 3SU4A 1XMNB 1EP5A 4B1TA 1HAYB 2QXGA 2BMGB 4Z6AH 2P3FH 3EA9A 1O2HA 1O2OA 2XC0A 2CHAB 2VNTA 2W3IA 4A5TS 4MTBA 3BTGE 3UR9A 3LH1A 4A1TA 3ZZ6A 1MUEB 1TNJA 1AWFH 2SGDE 4YLQH 5DSFA 5DKMA 5EU8A 1O3FA 2BLWA 4YT6H 2A7JA 4B6FA 1SMFE 2FYQA 1DOJA 2UUKB 3QTVH 4DGJA 2OC1A 4INLA 3RXOA 4AN7A 1W7XH 3OY6U 2BY5X 3PB1E 1OWIA 2Y5FA 2YMSD 4NZLA 2Z3EA 1HPGA 3PYHA 1U6QA 2QCYA 3A89A 3FO8D 5HGGA 2XYAA 1DLKB 1GBAA 3DSOA 1SOZA 1XXFA 4D9RA 4YT7H 1C1RA 2ZPQA 5GJ4B 4IS5A 2CF9H 4A1XA 2PP6A 3ZVGA 2SNVA 3UFAA 2CN0H 4Y0YE 3BTKE 1SFIA 4JK6A 5A0CA 5AF9H 1G30B 4NA7A 3LJJA 3QTOH 2ZO3H 1D3QB 1O3KA 1K1JA 2H5DA 1GJBB 1ZZZA 4X1RU 3SUFA 4HG6A 5CHAC 4JZFH 2C4FH 1WDIA 4I31A 4CRDA 1MZAA 1YLCA 2BX3A 5I46H 4O9VA 2FZZA 1BTUA 3HKJB 4ZXYH 4LOYH 1P2QA 3ZYDA 3KF2A 1GI2A 1ORFA 5DO4H 2Z9IA 4MNXA 1HXEH 1HAZB 1XM1A 1Z6EA 1GCTC 2GZ7A 1GBTA 1PQ5A 1AKSA 3RM0H 2B5TB 1GI3A 3E6PH 3KGPA 2YNAA 2O8UA 1YF4A 2RCEA 1GHXH 1QL9A 2OTVA 4MLFB 3EQ0H 1YC0A 3PV5A 1HAPH 2V3HH 4CRGA 3F6UH 1GGDC 3OY5U 4BAHB 3QX5H 3EA7A 3HKIB 4Z0KA 5GCHG 1KSNA 4CRCA 3M37A 5LPEA 2IN2A 3UUZA 5BRRE 2O8MA 5KEDA 1EOJA 1DVAH 3MO9A 3VXFH 3W1EA 3WWFA 2J34A 1DE7H 3RXQA 3UB0A 2SGEE 2VIWA 3GCTF 1JOUB 2QAAA 3BG8A 4R0IA 5JBCS 2P8OC 1TMTH 4HTCH 2GV7A 5FHTA 1TPAE 2P16A 4ZHLU 2GMTC 1HFDA 1WTHD 1S82A 4SGAE 1Z7KA 1E38B 1ELCA 3PMBB 2XBVA 3BN9A 3OTPA 5EJZA 3R3GB 2IJD1 4SGBE 2A7CA 3P8NA 2RFKC 1DSTA 1CHOF 1O31A 1O2JA 5DP9A 1QA7A 1GL1A 3S9BA 1WCZA 1TGNA 3NUMA 1O2LA 1MKXH 1O3JA 5DP6A 3ZV9A 1SLUB 3K9XB 5EJLA 3STIA 3CS7A 5G4BA 3FFGA 4X6OA 2KAIB 1TA6A 3PTNA 4BOHA 2QF4A 1IQMA 1RRKA 3ZV8A 4XOJA 1BRBE 2AGGX 2HNTE 2WPLS 2PKSB 1SQOA 2LELA 4AYVB 1QFKH 1QRWA 1V6DA 1H9HE 3ATWA 3VG8A 3RDZA 1V2KT 1BB0B 2EEKA 2VINA 3UIRA 1O0DH 1UVUH 4IN1A 4AORA 1LPGB 2XC5A 1MABB 4X2XA 4CREA 3SV6A 1YCPH 1OXGA 1P9UA 3A80A 1DXWA 1E1RD 5FBEA 3TU7H 1ZGVA 3QGJA 3P8FA 2Z6BD 1W3CA 3AAVA 4DG4A 1A5HA 1F5KU 1YCPK 4FUIA 2G5VA 4E7RG 3DUXH 1XXDA 4X8UH 1W0ZU 1BMLA 3EE0B 5HKKD 1NN6A 4MNYA 3IG6B 2WPHS 1FXYA 4Q63A 4ZKRU 1UTPA 1BTYA 2Y7ZA 3PMHB 4UE7H 2PW8H 1GI7B 4JMYA 3BTFE 4WH8A 3AVZA 5DPAA 1D6WA 1RIWC 1GJ5H 1ZRKA 2JKHA 4I32A 3C27B 4TWWA 1KXCA 1AZ8A 4DOQA 1MMJN 1WQSA 3P6ZB 3ZZ9A 5FBIA 1VITG 2G8TA 2OBQA 1HJAB 1S84A 3KQBA 3AW0A 3T2NA 1C2KA 4BAKB 4LZ1H 5DP8A 3E0PB 3EDXB 4HI3A 1LPKB 2AMDA 1W7GH 3LDXH 3PO1B 1GHAF 1DUEA 2ANWA 2ZDKA 3SV8A 2GP9B 1T8OA 1GJAB 2H9TH 3SNEA 1HIAA 2GKVE 4K1TA 1TBRH 1EZSC 1F0SA 4M9FA 5C5OA 3B8JA 3VFEA 2RA0A 4NIYA 4RSPA 1TYNA 1Z8JB 1ESBA 2NU1E 1GPZA 4UFFH 5A8ZA 3SQEE 2VJ1A 1S0QA 3H09A 1QJ7B 1L1GA 2TPIZ 2GDEH 4AOQA 4X8TH 4GSOA 2FOAA 4OS6A 3ATKA 3P92A 1S83A 3M35A 2ZHEH 3FP7E 1CA0B 2TGDA 3M36A 1G2LA 1DY8A 4Q4LA 3TGIE 4Y71A 3VB3A 3MTYA 3OEHD 2NU3E 1QJ1B 1E34B 1SGEE 4AYYB 1O2TA 1AWHB 2V6NA 2XWBI 3PTBA 2LNCA 1FPHH 1DWEH 3CNRA 2WV4A 1ETSH 3AAUA 2W3KA 3RLYH 5JYIA 2W7UA 3MH7A 2BDCA 4TY6A 3BTTE 1K21H 3RLWH 2STBE 4X6MA 5F8XA 4CH8B 4NIWA 1QQ4A 1BOQA 1TRYA 3KQ5A 1WUNH 1WQVH 1FY4A 1ACBE 1PQ7A 1P04A 1SGRE 2ZDMA 1GDUA 3UY9A 5EXLA 4HGCA 2OXSA 4B76A 3SV9A 1V2QT 1TMUH 2HLDD 3F68H 3KYGA 4UFDH 3WY8A 1C1TA 3RXEA 3TJNA 5CHBA 1GJ7B 3E1XB 1TOCB 1C5LH 1IQLA 2ZFQH 3SBKA 1P06A 1SI5H 1O34A 4XE4A 4DIHH 2PGQB 1O2MA 3E8LA 2ZDVH 1TA2A 3RXIA 5LPRA 3A81A 1GVKB 2O8LA 2ZQ2A 3A85A 3TVJB 1GJCB 3LGWA 1PYTC 1P2MA 4K69A 3SU1A 1QGFA 2WHXA 1PPFE 1O2XA 2BD4A 2P59A 1JIRA 3A8AA 3H7OA 3TK9A 2OC8A 1LPZB 1MBQA 3ZVDA 6CHAB 1E36B 2ZU4A 1K1NA 3QK1A 1HYLA 3DSPA 3NCLA 1L4DA 1LVBA 1HGTH 4GAWA 2Y6TA 5HIYA 2CV3A 2BOHB 2EI7A 2KCPA 4IBLH 1FV9A 1UVPA 1TPPA 1C5VA 3D23A 2VIQA 3SOSA 4A6LA 1TGTA 1AI8H 3RXJA 3SGAE 1EFRD 1QR3E 3EA8A 1AVGH 2UWPA 2HGTH 3FVFB 4XRNA 5DP3A 4M7GA 1QRZA 3PROA 1CU1A 2SGPE 6ESTA 3MI4A 2KM0A 3SU3A 3SZNA 5L30H 3TNTA 3ZVAA 3QO6A 1LDTT 4RKJB 1S0RA 1SGFG 1O2PA 1DS2E 3SI4H 1P03A 1AKSB 3PLBA 3TK5A 3BV9B 4WJG2 4HZHA 1YPJH 2TGTA 1FY5A 2Y81A 4NZQA 2WPIS 1C5RA 1O2GH 1BITA 1MTVA 4K5ZA 2BD5A 1LVMA 3RU4D 3RXBA 1HAVB 1MTNB 1O2VA 1V2LT 2OLGA 2Y80A 3BTHE 3LGUA 1DWCH 1C4Y2 4DT7B 1TRNA 3MU8A 1CBWC 1CSOE 3L33A 2BD3A 4ISHH 4HFPB 2BD9A 1ZSLA 3VGCC 5C5NA 5FAHA 4INKA 1EXFA 2STAE 3RMNH 4H6TA 3SUDA 1PPGE 8GCHF 1GBHA 1H9LB 4A92A 4AGKA 1ZTKA 4YESB 1YPLH 1OWEA 1UHBA 1P02A 2DUCA 1AFEH 3EYDA 2GV6A 3E90B 3TPIZ 4Q80A 3RM2H 2VIDA 1L2EA 1AE8H 1SGYE 1K1OA 3M5NA 5F03A 3W95A 4B2CA 2GTBA 2PV9B 4WXIA 1O2RA 1NU9A 3QZQA 2Z3DA 1RTKA 3BTWE 3NWUA 5A8YA 2ZP0H 3LGYA 5BPEA 1QL8A 2SGFE 1Y3UA 1ZTLA 1A5IA 2OUAA 1XUKA 1Z8RA 5HMAA 2FYRA 1UCYH 1QB9A 2UUJB 3KCGH 3OEED 4YXWD 3E16B 4ABEA 1CA8B 4BAQB 4THNH 2FLBH 2JETC 1OP0A 1TBZH 1UCYK 5DK1A 3F0OA 2C93B 1AN1E 1NRSH 3F9FA 2D26C 1NROH 3NXPA 1OWJA 2WUBA 1UVOA 2GJGA 4U01A 2FTLE 1NY22 1PQ8A 1TIOA 3NKKA 2KAIA 1O5AB 3JZ2B 4GCHF 4DY7B 1G3CA 2TGPZ 1A46H 4KGAA 1EAWA 2JDID 1PQAA 3TNSA 5GPIB 1ZOMA 5GWZA 1ZJDA 1GBLA 4KTCA 2Q1JA 1BTWA 1F92A 1B0EA 2AMQA 1DDJA 1ABIH 4AZ2B 2BQWB 2ANMH 1ELVA 4VGCB 4WMDA 1ELEE 1L1JA 1P0SH 5C67A 2C8XB 1TNLA 2BD7A 3SJOA 1V2PT 4Y10E 2AIQA 4IMZA 3GY8A 2XOKD 5C1XA 1BCUH 1GDNA 3NZIA 1O3OA 2ZFFH 3B9FH 2SGAA 1A2CH 4JYVH 1FZZA 1UCYE 2RDLA 4BXSA 1T7CA 2ZFTA 3A7WA 2CGAA 1QJ6B 1NC6A 1W8BH 7GCHG 1DY9A 2HPPH 3LIWA 1KMHB 1OP2A 1K1PA 3MNSA 1Y8TA 1IHSH 1NFUA 3KQDA 4BAMB 1WU1A 1SGIB 1H4WA 1EJMA 1GI0A 3U8TH 1MTWA 3SNBA 2FI5E 3OYPA 3LC5A 4D9QA 1FIWA 1GL0E 6GCHG 2EQNA 5HIZA 3VB4A 1EUFA 3RMMH 1P2OA 3PV2A 1Y5AT 4Z1MD 1SSXA 1A0LA 1HIAB 3D49H 5FL7D 1UW7A 4K60A 1O39A 2XBXA 2G52A 2VGCB 3GCHB 2BD2A 1EATA 1HJ9A 3S9AA 2ZTXA 3AASA 5ETXA 2EI6A 5TCAA 3E91A 3K65B 1GMCF 3VB6A 1QBVH 1BA8B 2QC2A 3ZZ5A 2K1QA 1AFQC 2ZA5A 2G4UA 2PSXA 4OGXA 4OS1A 2SNWA 1FONA 1AHTH 2W5EA 5EW2H 1KXDA 2GCHG 1FNIA 4IC5A 1NPMA 1QURH 1GMDG 1GWAA 2BDAA 2D8WA 2GDDA 3Q3XA 1H8ED 1DWDH 1GJ6A 1ZPCA 3QGNB 1P8VC 1UO6A 2WPMS 5JBAS 1EB2A 2G4TA 4GVUA 5FXLA 1JMOH 5L2ZH 3RXVA 2P95A 1JBUH 5JBBS 4NIXA 1N8OB 1DSUA 3SU5A 2THFB 2QF5A 1BTXA 3FP8E 4ABAA 2ULLA 4TWYA 1NT1A 2J95A 3SI3H 1UK2A 1EZXC 1GI6A 3MU1A 1AB9B 1VGCC 2CMYA 1HAOH 2L6OA 3RXRA 1C2HA 1O3MA 4J2YB 3U9AH 2WUCA 1GHVH 4E7NA 1LCYA 1XKBC 4XDEA 1A0HB 4F55A 1YWUA 2CF8H 1O2KA 5EQRA 1GHWH 5FPTA 4I33A 2P94A 1P2IA 3PLPA 4MG3A 3HK3B 1TGBA 1NTPA 1YP9A 1Y3YA 2FPZA 3SYJA 2VWOA 4A7IB 1KLJH 1A3BH 2FTMA 1PPZA 3G01A 4ABFA 3A7YA 1WTGH 1QBNA 1V2TT 5DP4A 5DN6D 2BY8X 1ZRBA 1W14U 4ASHA 3CENA 1A5GH 1DANH 3PRBA 2ZTYA 2EA3A 2KCOA 2G55A 3O8BA 1O5FH 1W2KH 2XW9A 1O5GH 3UAIC 3UNSA 1HAHH 1OWKA 1L1NA 3DFJA 2BLVA 3ZZBA 1Q31A 4NFEA 3GDVA 3BTEE 2A45B 1Y5BT 3A8DA 4UDWH 1NBMD 1DLEA 1CHGA 1HUTH 4I8GA 3F2HA 4Y8YA 3RXCA 5DJ7A 2BHGA 4ZROA 3LONA 8LPRA 1TAWA 2VH0A 1V3XA 1BBRH 4MQAA 1Y3VA 4O3TA 4DVAU 3GOVB 4IGDA 4UONA 1FN6A 2Z9JA 3Q76A 1K22H 2J97A 3RXTA 8KME2 1VZQH 3SHCH 2XC4A 1LHCH 1HAIH 1YPMH 4ZMAH 1UTMA 2VIPA 3F1SB 4AX9H 1P12E 2A2QH 1MTUA 4XBCA 1SOTA 4DJZB 4OGYA 2AFQB 1AUJA 4I8HA 5J4SA 2M5TA 1ELBA 1A0JA 1G2MA 4KP0A 4ACBA 3ENSB 3HGPA 1MBMA 1SC8U 2ZGJA 3KNXA 3N7EA 3P8GA 3BG4C 1S81A 3RXGA 4UD9H 3VPKA 4P00A 1HAVA 3TH2H 4U32A 5E0JA 3DA9B 3U69H 1LQDB 2ANYA 1TGSZ 1UHBB 3MHWU 4YZUA 1INCA 2D2DA 1GI5A 1EX3A 1C2JA 1BRCE 5DG6A 1KLIH 4F4OC 1XKAC 1BBRE 3CS0A 5GCHF 4X1QU 1HLTH 2HALA 3F3BA 3RP2A 1P2NA 3MOCA 1ZLRA 2YMSC 1C5ZB 2BDYA 5A09A 4MPUA 1C2FA 4X2VA 2A4QA 3S9CA 1YCPM 3GY4A 1V2RT 2ZHQH 1YLNA 1MAYA 2AIPA 2B8OH 4Y6DA 3M5MA 2QIQA 1WOFA 2ZHFH 3P8OA 1D4PB 1QB6A 4P02A 4ASUD 2VB0A 4D7FA 3OSYA 1S6FA 1TB6H 3A7VA 4A1VA 2V35A 4UEHH 1BQYA 1T31A 4DCDA 1C2EA 1MKXK 4XSKU 5IYTA 1CT0E 4D7GA 3GY2A 2OQUA 3UR6A 1IQKA 4YLUA 2H2ZA 3ZZDA 1QB1A 1SQRA 2KFWA 1TX8A 2UWOA 2ZDAH 2BVSH 4J1YA 1GCTB 1KDQA 1MD8A 1RS0A 1O2SA 1C1PA 5E2PA 3OE7D 3T25A 3MWIU 5T6FA 1Z1JA 2AH4X 1GG6C 3OX7U 1QY6A 2GZ9A 1P05A 2V3OH 5CMXH 4FU9A 4FUDA 1HRTH 2NU0E 1ELGA 1GGDB 2ZU1A 3BEUA 2QE7D 4XBBA 1A4WH 3DHKH 2J38A 1KXFA 3P17H 4FUHA 7ESTE 3LU9B 1PPCE 1F5RA 3PRDA 3O8CA 2AS9A 2BDBA 5I25A 1YM0A 3KL6A 1GJ9B 4CRAA 2O8TA 2ALVA 1OWHA 1OP8A 1V2MT 5GIBA 1BRAA 2P8OB
chains in the Genus database with same CATH topology
4NCYA 2FS9A 2GMTB 1A3EH 4X0WU 3SV7A 4X1SU 1O2QA 1BTZA 1O5CB 1FI8A 4OS4A 4I8LA 4BTUB 3GY7A 3QWCH 3SJKA 1NRRH 2ASUB 4K8YA 1C1OA 1HNEE 2FI4E 4B73A 2GGVB 3T29A 4BANB 1C2GA 1F2SE 1GJ4H 3CP7A 5HXFA 2FX6A 5J4QA 3UWIA 1NFYA 3UTUH 3M5OA 1KXEA 5FX5A 1SLWB 3RXFA 1KYNA 4X8VH 1NRQH 2PKAA 2FOHA 4ZAEA 2QF3A 4ZHAA 1EB1H 5DGJA 5EQSA 2Z7FE 2ZU2A 4NWKA 1HDTH 4I8JA 1C1QA 3A83A 3TITA 3TH3H 2GCTC 3GCNA 3RXDA 3RXSA 2ZGCA 3ATIA 1S6HA 1Y3WA 1TONA 3ZZ4A 1KIGH 1THRH 1GMHF 3TK6A 1ZHMA 2PR3A 4LXBH 3RC4A 4NG9H 2FODA 3A87A 1O3PB 1E35B 4UFGH 1QHRB 2B7DH 1BJUA 2XTTB 1OPHB 4Y7AA 3UOUA 5LGOA 1NO9H 1FLEE 1RIWB 1EP6A 3S7HB 3SU2A 1QIXB 1YPHC 1G3DA 1O5DH 1UMAH 1QNJA 1ZPBA 4MVNA 2FS8A 2XNIA 4ABBA 1QL7A 3A7TA 2WPKS 1DITH 2ZCKP 1BZXE 3L6PA 2H9HA 1ESTA 2BXTH 1C5TA 3PMJA 5C20A 3SUGA 1Z8GA 3RXKA 4ISOA 3GDUA 4CBOA 4TYDA 3RMLH 3HK6B 1Z1IA 1JXPA 1FAKH 2GT7A 3E0NB 3MNXA 3LGVA 1D9IA 4X2YA 3SJ8A 1PPEE 1NRPH 2B9LA 1MQ6A 1F5LA 1LQEA 3MO3A 2FI3E 1SHHB 3Q3YA 5DP7A 1VR1H 1HJ8A 3AW1A 2ILNA 1CGHA 2QY0B 4MPXA 4F49A 3UNQA 1BMNH 1MQ5A 2BY9X 2OINA 1DWBH 1PJPA 1GHBG 3GDSA 3SNAA 1GBDA 1EZQA 2CXVA 3SJ9A 4I7YH 1O37A 2HLCA 3ZVFA 4YTAA 1T8NA 3V0XA 2HPQH 3SU6A 1FY1A 1TALA 1MAXA 4O3UA 2Z9LA 1TMBH 1TQ0B 2H9EH 3ELAH 2XRCA 1ZMNA 4ZUHA 2UUFB 1HV7A 3FAOA 1C1WH 1OWDA 1TX6A 4DURA 3A7XA 1ARCA 2PHBA 4FUJA 4X8SH 4TY7A 3ZVEA 1O2YA 3UQOA 5A0AE 2ZKSA 1TBQH 4AFSA 1ELAA 1HXFH 1LHEH 1SVPA 3KN2A 4AB8A 3ZZ8A 1XUJA 3KQCA 2FP7B 2JH5D 5EG4A 2A4RA 3LKWA 3RXLA 3SORA 4AG2A 1O3GA 4IW4E 1F0UA 3ZZCA 2SGQE 3TJOA 3F9HA 1G9IE 1O2IA 5FPSA 3ZVBA 2ZCHP 1C5NH 1IQNA 2ZGHA 2ZGXH 1EPTC 4TPYA 3ZYEA 3BF6H 1BMMH 1C1NA 1P3CA 1MCTA 1AD8H 4YOJA 4AB9A 1SGQE 1TQ7B 1C5MD 1NFWA 2J2UA 1GVLA 1TNKA 2ZPRA 2ZZUH 4VGCC 5K7RA 1OYTH 3A7ZA 4CHAC 3QLPH 5K0HA 2J9NA 2ZECA 2ZU5A 3A84A 1HAXB 1P3EA 1P09A 1N6YA 1G37A 3SNDA 1O35A 2WYGA 3P95A 2ZDNA 1GBCA 3B23B 4DW2U 2W26A 1NU7B 1NESE 1FDPA 1C1MA 2C8WB 1B5GH 4AFUA 2BQ7B 1NS3A 1XVOA 2BLQA 2OC0A 4NSYA 3N7OA 3HPTB 2FMJA 1O2UA 1H8DH 1KDQB 1FMGA 1T8MA 2ZG0H 4Q2KA 1J17T 1GBIA 1J14A 5EPYA 4JCNA 3BIUH 2OBOA 1ZHPA 1C2DA 2G51A 4GCHG 3RU4T 3V3MA 1B0FA 1DUAA 2Q6FA 4RKOB 4NIVA 2F9UA 2Q6DA 1ZYOA 1CBWB 4GLYA 3TGJE 1C9TA 3Q3KA 3P70B 5L6NH 3UOPA 4FUFA 1VCPA 3VGCB 1RTLA 3MH6A 4OS5A 2UWLA 2OC7A 1V2UT 3OTJE 2A31A 1AVXA 1O3NA 4LZ4B 2ZFRH 1FIZA 4IMQA 2BVRH 1EAIA 2ZNKH 4FU8A 3RXAA 2JH0D 3QDZB 4H6SB 1GI4A 4YOGA 2NU4E 3SGQE 2BB4A 3ITIA 1IQGA 2ODYB 3GYLB 3M5LA 1IQEA 4WF8A 2H5CA 3RC5A 1J9CH 3TJVA 4NGAH 5L2YH 1BTHH 3NK8A 3LH3A 1RTFB 2YOLA 1GBKA 1XUGA 3HGNA 2ALPA 1EJNA 2C8ZB 7GCHF 3V7TA 5GDSH 1NFXA 1XUFA 1F0RA 4ABDA 1NRNH 2PKAB 1BIOA 3DD2H 3F9EA 1C5WB 2JETB 1C2IA 2CHAC 2SFAA 6GCHF 2PSYA 1P11E 4Y11E 1O3AA 4CR5A 3BIVH 1GBFA 1GI1A 1GMCG 1QQUA 3S0NA 1UTJA 1T8LA 3SNCA 1O3EA 2H1UA 2BZAA 1O3HA 1A61H 1CQQA 1H1BA 1PFXC 3QN7A 1K9OE 1O2ZA 2B0FA 4TPIZ 1M9UA 1K28D 1EOLA 5DP5A 1JRTA 1GBEA 1EKBB 1TNHA 3M3SA 5AFZH 1O33A 3LT3A 1L4ZA 1AGJA 5AFYH 3SU0A 4BTIB 2GCHF 5A8XA 4AFQA 4Y8ZA 1GMDF 2FESH 3BTDE 1ZPZA 2ZCLP 3T28A 3V13A 3Q00A 5TCCA 3GCOA 3MU0A 2F9PA 1EZUC 2BLOA 3RC6A 1KLTA 2VWLA 3UPEA 1YPEH 4Q7YA 1C5YB 1ELFA 1XVMA 1UVSH 2GVFA 2WINI 4BTTB 1T32A 1T4VH 1ID5H 2G00A 5GXPA 1RJXB 1N1LA 2AEIH 1KXAA 3RU4E 1J15A 1SG8B 3MNBA 1P01A 2A32A 1O3LA 4MNVA 3SUEA 8ESTE 1SGFA 4OS2A 4BNRA 5JBTA 5LPFA 3MNCA 1ZTJA 2FXRA 7KMEH 1BHXB 1WBGB 4ZKNU 5EPNA 2FX4A 1AUTC 1W11U 1MU6B 4WMEA 5ESBA 1ZHRA 2F91A 2HVXA 3I78A 4H4FA 5F8TA 3BEIB 2DE9A 1SGTA 4X2WA 3ATMA 2F9OA 1FY3A 1QCPA 1DICA 1MU8B 3PM3A 1AU8A 2R0KA 3IWMA 4ISIH 3RXPA 2A4GA 3F9GA 1ZGIA 1C1UH 1AFQB 1GCDA 4FUBA 1TABE 4Q7XA 3TJUA 1WYKA 2VIVA 3K2UA 1SPJA 4WVPE 1N6XA 2FIRH 1C9PA 1ETTH 1P2JA 2QXHA 2LPRA 4CH2B 1TX7A 2IJOB 1ZMLA 2ANKH 2R2WU 2C3SA 3KIDU 1W12U 1NZQH 2IOTA 2HNTC 2ODPA 4BAOB 2ZWLH 1DFPA 1O36A 1RGQA 2PUQH 3PWBA 2FM2A 4JZ1A 4INHA 1ELTA 4Y7BA 3LGTA 1VGCB 4D8NA 1BBRK 1TWXB 2DE8A 1ESAA 4PROA 5SGAE 1GJ8B 1ZSJA 1O3CA 2PFEA 1HB0B 2HOBA 1Y59T 5IDKA 1O5BB 5T3HA 1TRMA 3LOXA 4JYUH 3SN8A 3NPSA 1O3DA 1ANEA 1K1LA 5JPMH 1KTSB 1BUIA 1HAGE 2PUXB 2FOMB 2ZFSA 2ZHWH 2A2XH 4NA8A 1LKAA 2HWLB 2PKSC 3EAJA 4WWYA 1BHXF 1D3TB 4FUCA 1S5SA 3BEFB 4FUEA 1EAUA 3QUMP 3TGKE 1DPOA 2PLXA 3MH4A 1LO6A 2Y5GA 2BM2A 3A88A 4CRFA 3MU4A 1BMAA 5FCRA 3U1IB 9ESTA 1O3BA 5HM2A 1G3BA 1B7XB 4ZH8A 2NWNA 4B75A 3GCTG 1CGIE 1LVYA 2AYWA 2UUYA 3IITA 4B74A 4JK5A 4ABHA 1L0ZA 2OP9A 1RFNA 1VJAU 2QYIA 4E06H 2FOCA 3L3TA 1K2I1 4NWLA 1VITH 4AFZA 1OYQA 1EJAA 3M3TA 3RXMA 3T27A 5JB8S 1Q3XA 1H9IE 1AQ7A 1THPB 1XUIA 5CHAB 4YM9A 1YPKH 1CHOG 3RXHA 4CRBA 5EQQA 2FOFA 1YLDA 2BYAX 5HM9A 1VCWA 4B2AA 3VB5A 1TE0A 2WYJA 1ELDE 5C2ZA 1HJAC 1FY8E 2PGBB 2VH6A 3KQEA 2VWNA 1C5QA 1TPSA 5C1UA 2OD3B 1C4U2 1CGJE 3PO1C 1W10U 3QZRA 2AMPA 3MU5A 2A7HA 3C1KA 1GBBA 4E05H 1O2WA 4MDSA 4YOIA 3BG4B 1KTTB 1Z71A 4XFQA 1DT2A 1PPHE 3FZDA 3UQVA 1LHFH 2P3UB 2ZHDA 3ATLA 1Q2WA 2A5IA 5ESTE 4JZIA 5EXMA 1CA0C 1EPTA 3FANA 3SJIA 4YO9A 3JZ1B 2XBWA 5FPYA 3M3VA 2TRMA 5E0GA 1MTSA 7LPRA 1C4V2 1ZR0A 2I6SA 5JDUB 5B6OA 1TLDA 2XCFA 1SQTA 2GX4A 2PWXA 3T62A 3PMAB 2OQ5A 1O2NA 3MO6A 2PTNA 2HNTF 4B71A 1BT7A 1P10A 2BDGA 4Y76A 1CT4E 2ZDLA 3SV2H 1IOEA 1LHDH 1GHAG 1VITF 1W0YH 2FWWA 4JZEH 4ABIA 1MKWH 4Y79A 5HYOA 2FEQH 2BQ6B 1ANBA 3A82A 1D6RA 3T26A 1Y5UT 1VCQA 3D65E 1MKWK 2G81E 1BRUP 5A2MH 3TLOA 3UWJH 3GY5A 3Q77A 4IN2A 3U1JB 1V2NT 5FCKA 2QV1A 1GG6B 1PYTD 2BOKA 4K8BA 4OS7A 1C2LA 6LPRA 2BY7X 3OU0A 3M7QA 3E3TA 1V2VT 2FOGA 1A7SA 6CHAC 3M61U 3LJOA 4WMFA 1F0TA 9LPRA 1SR5C 2W7SA 4B2BA 4BXWA 1GMHG 1HCGA 1S85A 1JIMA 3I77A 5C1YA 2A5AA 4CBNA 1LMWB 1O38A 1OSSA 4X6PA 5E2OA 2P3TB 2VVCA 4ISLA 1IHTH 2VIOA 2F9NA 4NA9H 2ZQ1A 2AERH 4CR9A 1IAUA 4AG1A 4R8TB 1BJVA 2VVVA 1CVWH 2HRVA 3UREA 3EGKH 1YGCH 1CE5A 1GI8B 1YPGH 2Q6GA 1ANDA 1QTFA 2BXUH 1EQ9A 2ZI2H 4KELA 5ABWA 1GHZA 1QBOA 3TIUA 4GPGA 4KTUA 3VEQB 2F83A 1UK4A 2Z3CA 3RMOH 1TNGA 1ANCA 4JZDH 1DM4B 5EW1H 4ABJA 3ZZ3A 2NU2E 2TIOA 1MTNC 2QA9E 5EODA 4GHTA 1C5XB 2GZ8A 1ARBA 2R0LA 4ESTE 1IQIA 1C2MA 5JB9S 4DIIH 3TH4H 2TGAA 1HBTH 4O03A 2R2MB 3FZZA 1FN8A 4GUXA 1SGPE 4Q7ZA 1J8AA 1C5UA 3KEEA 4U30A 1GBMA 1A1RA 3ODDA 2VU8E 1UJ1A 2GCTB 1IQJA 5T6GA 1O32A 2BD8A 3W94A 1LKBA 1TFXA 1UTKA 3U8RH 1E37B 1GHBF 5CE1A 5E8EH 1H8IH 1O30A 2P93A 2Y5HA 2QXIA 2Z9KA 3DFLA 3ZZAA 1AO5A 3S7KB 5EXNA 1XX9A 4AGJA 2I6QA 3I29A 2YNBA 3VB7A 3V12A 2GD4B 4FVBA 2J94A 4GHQA 1GJDB 1ETRH 2A5KA 3GISB 3RUOA 3RXUA 1PPBH 3PV4A 1QA0A 1J16A 3A86A 3UNRA 1FAXA 2PTCE 1GDQA 5H4IB 2Z94A 4FVDA 1WV7H 4D76A 4ZXXH 3MH5A 2A0QB 1DX5M 1XUHA 3U98H 3GY6A 2QXJA 3URCA 2QF0A 3M7UA 5FX6A 1SGDE 3MYWA 1FJSA 1UTOA 2O9QA 4MPWA 2XBYA 2WV5A 4FXGH 1C5OH 1IQFA 8GCHG 1C1SA 3SHAH 1SHYA 5AHGH 5T6DA 3S69A 1W13U 1P2KA 1SBWA 1NM6A 4XBDA 1C1VH 4ZKSU 1UVTH 4K1EA 4WXVA 1SLXB 2R3YA 1YYY1 1YPHE 1MH0A 2C90B 1ABJH 2ZU3A 4X1NU 2AGEX 2J4IA 1DXPA 1AY6H 2XCNA 2BVXH 1TOMH 2FOBA 1ZMJA 2BX4A 3LGIA 4X1PU 4RN6A 1KY9A 1LTOA 1V2JT 2H6MA 3KHVA 1YBWA 3ODFA 1LHGH 5C3NA 4K1SA 2VVUA 1OX1A 3SQHE 2C8YB 1FPCH 2A1DB 2R3UA 1OOKB 5LH8A 2Y82A 3MMGA 3VXEH 4H42U 1BDAA 3H5CB 1GBJA 2XXLA 2ZPSA 1AIXH 2AGIX 1BTPA 2FO9A 3STJA 3GY3A 4KKDA 4ISNA 2WPJS 5A0BA 2RG3A 2BDIA 4WY3A 2FOEA 1SL3A 2FLRH 1QRXA 2VGCC 3GCHC 4MNWA 4WH6A 2BY6X 1G3EA 2Z9GA 1T4UH 2TBSA 4ABGA 3URDA 1MCVA 2EI8A 1C5SA 2RA3A 2BDHA 2V0BA 2A4OA 3U8OH 1UTLM 1EPTB 1JRSA 1FUJA 1TNIA 4I8KA 1KXBA 5EGMA 2JH6D 1WSSH 3K6YA 4K2YA 4O97A 1SLVB 3FP6E 1Z6JH 5AVDA 1CO7E 3ZVCA 1UTNA 1Z8IB 1CT2E 2ZIQH 3H7TA 4KTSA 5E0HA 1V2WT 2EC9H 1IQHA 4ZKOU 1N8OC 1TGCA 3PLKA 1AMHA 1ZSKA 2CJIA 3GYMA 1OKXA 2IPHA 4MPVA 2F9BH 4CHAB 5F8ZA 3ESTA 1ZJKA 4Y0ZE 3O8DA 1SGNE 2F9VA 1AB9C 5EOKA 3O8RA 1VJ9U 1UTQA 4K3JA 1RXPA 2O8WA 3A8BA 2ZFPH 2G5NA 4LK4A 1MZDA 3BSQA 2OCVB 1AE5A 2BTCE 2FDAA 1Y3XA 1P9SA 3HATH 2XWAA 3K6ZA 1V2ST 2F3CE 3BTQE 5F6MA 4FU7A 1P57B 2Y7XA 2GT8A 5TJXA 1SFQB 3M7TA 1D3DB 1X7AC 1SGCA 2ZTZA 4NFFA 3BTME 4ZHMU 2ZF0H 4X6NA 3T5FH 5PTPA 2ZC9H 1G32B 1LVOA 1RD3B 1C5PA 1O5EH 1GHYH 1V2OT 2ODQA 1YKTA 4JYTA 4FUGA 1SQAA 1GI9B 3MFJA 2VWMA 3LC3A 3SO3A 1UK3A