3PM3A

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pm3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pm3A02
5GIBA 1C1SA 1BTHH 3SU4A 1HGTH 1FY1A 3A7ZA 1LVYA 5GCHG 2BD9A 4X1SU 3C1KA 4YT7H 4BAHB 3ATIA 1UCYH 3TJOA 1AVWA 4Z6AH 3Q76A 3HPTB 2PKAB 1O2XA 1F5RA 5HXFA 2AYWA 1A0HB 3PLBA 3HATH 4GCHF 4I8HA 1HAGE 3E91A 1QFKH 2J9NA 5F8XA 5A0BA 3P95A 1TONA 3RXRA 2CMYA 3T62A 2DE8A 5ESTE 3UWJH 3RU4T 3RXHA 3A8CA 3ZVFA 1P3CA 4MNYA 1G3DA 3SQHE 3FZZA 1T4VH 1HV7A 4H42U 1YP9A 1NESE 2Y7XA 1CU1A 1VCQA 4IW4E 2OC7A 1C1MA 1S0RA 1YCPK 1YBWA 1D3TB 5EQQA 1ZPBA 3RXVA 1SFIA 7ESTE 1J16A 3E8LA 2Y7ZA 1O2QA 5AFZH 4OGYA 1XM1A 1EOLA 4AGJA 4X1QU 2VWLA 4MLFB 4UD9H 2BQ6B 3A82A 3RXQA 1N1LA 1UK3A 1O2MA 3G01A 3FP6E 2ZTYA 1ACBE 1Z6JH 5E2OA 1GVKB 1MKXK 3BEFB 2BX4A 5HGGA 5EW2H 1RIWC 3H7OA 2UUYA 1CSOE 1YC0A 1YGCH 2OTVA 3O8CA 2VJ1A 1TPOA 1O2KA 2EEKA 3D23A 5I25A 1VJAU 3O8BA 4AX9H 3ZZDA 4TWWA 5EQSA 2VVUA 3LGTA 1P57B 2J4IA 1O3GA 1VITH 1V2KT 1EP5A 2BLWA 1QURH 1FONA 1OKXA 1BRAA 3DUXH 1UTLM 2VB0A 3LU9B 3MO9A 4NA9H 1EPTC 1C9PA 5FX6A 1BMLA 1TGSZ 2CGAA 4AORA 2H5CA 3MNCA 1IAUA 1U6QA 4JMYA 4YT6H 6ESTA 2VIVA 1MQ6A 2V35A 3SUFA 2EI7A 3U9AH 2W5EA 1SBWA 2TPIZ 4VGCB 3VB6A 3ZVEA 2BTCE 1PPCE 5FPSA 3TK9A 5DPAA 3MU1A 3E90B 1IQHA 2F9VA 1GJ4H 4NSYA 3T28A 1CGJE 1TPSA 2ZDKA 2Y5GA 4GUXA 2HWLB 3P6ZB 1PPBH 4TWYA 3PMAB 1WAYB 3PO1C 3M7UA 1AZZA 2QN5T 4IN2A 1RIWB 4CR9A 3BV9B 2NWNA 1GBDA 1FY4A 3MH7A 4B75A 1OWKA 1ZSKA 4Y76A 1O2SA 2D1JA 3RXCA 2B8OH 2Z3CA 1ZTJA 1N6XA 1ZPCA 1GMDF 5A0CA 4NZQA 2ZEBA 2AEIH 2ZF0H 1CT0E 2CF8H 2VIWA 1C1OA 3F1SB 4ZROA 5EG4A 2ZDVH 1HAXB 4UEHH 3DT0H 3H7TA 3MO3A 3SI4H 3A8AA 2Z9IA 3UNSA 1CVWH 1ELBA 4K60A 2BOKA 1O33A 1GBHA 1KLIH 1V2ST 1YLDA 1DSTA 3M3VA 1YKTA 5T6GA 3SV9A 3AAVA 2VWOA 1HB0B 1UK4A 4XSKU 3A7XA 2O8TA 3T29A 3PLKA 3PMHB 2QGRA 1JIMA 1XXFA 5DP5A 1AZ8A 2P93A 3M3TA 4H4FA 4Q7XA 1DPOA 3A81A 1PPHE 1A5IA 4AGKA 1XKBC 3GCTF 1DWBH 1SGIB 1C1UH 1TX8A 1TFXA 2P8OB 4AB8A 1NTPA 3E1XB 2Q6GA 1TYNA 2F9NA 1X7AC 1S84A 4E05H 2BDHA 1C5TA 1SHHB 2QA9E 1W0ZU 1ZR0A 1P10A 1KDQA 4MNWA 4X8VH 3NK8A 3M7TA 4ZMAH 4LXBH 1C5MD 5CMXH 3T2NA 1QQ4A 6GCHF 1MAYA 3SJKA 5BRRE 2C8ZB 1TGTA 2A1DB 1DUAA 1TOMH 2P16A 4BTUB 1F0SA 4XBDA 3RXGA 1DWCH 1HIAA 2J94A 3MNXA 3RC6A 5JB9S 1DS2E 4IMQA 4U2WA 5DP4A 5JB8S 1GHYH 4I8KA 1UTPA 1AO5A 1QBOA 3P17H 1C4Y2 3BTEE 1TIOA 1BTWA 3AAUA 2F9OA 2XNIA 1P2KA 1P06A 1RTFB 1HRTH 2IPHA 3ATMA 4CRGA 1O3LA 1ARBA 2SGQE 7GCHG 1TNKA 4JYVH 1BHXB 2W7UA 4X6NA 1K9OE 1EB1H 2Z3DA 1OWDA 3EGKH 1O30A 2ZU5A 2AIQA 5JBAS 3RXJA 1OX1A 1HFDA 4NZLA 1SVPA 3FVFB 2QF0A 3GY5A 2BDGA 4GAWA 1GHBG 3W94A 1G36A 3RMMH 4BAOB 1AWHB 1TB6H 3QZRA 2BX3A 1WQSA 1V2UT 3SNBA 2Z9KA 1BTXA 3A86A 4BANB 8GCHF 4D7FA 1YCPM 1ORFA 1PPEE 4XDEA 1MKWK 4ZUHA 4GLYA 2XRCA 2ZFPH 1O35A 3SN8A 1O5GH 3QTOH 2ZPSA 4FUDA 1N6YA 2WPHS 1IQFA 3TIUA 5IDKA 4WWYA 5AHGH 1PQ7A 3MYWA 1KXAA 2WPIS 3GCHB 3FP7E 2BXUH 4LOYH 2G55A 1ID5H 1MBMA 2GCTB 1JRTA 3K65B 1C5XB 1E36B 3PWCA 1GJBB 1Y5BT 1YPHC 4AZ2B 2BY9X 2ZU4A 2PUXB 4MVNA 4BAMB 1K1MA 1V2JT 1JOUB 5E0GA 3MTYA 4HGCA 4WXVA 1P04A 3LH1A 3L33A 1CGIE 3HK3B 1C5WB 2Y5FA 1O5BB 2FIRH 2OQUA 1ZMNA 3MI4A 3QN7A 3BTGE 3TJNA 1GG6B 1K1IA 2HNTF 4X0WU 3EYDA 1EJAA 3KF2A 4AB9A 1AKSB 1ZOMA 1XUJA 1HLTH 2R9PA 3QLPH 4X2XA 2WPLS 2NU4E 3URDA 5DGJA 4FUCA 1ANCA 1YF4A 1D3PB 2H2ZA 2FI3E 3LGYA 1HIAB 3RXMA 3TK5A 1OOKB 4B2AA 3URCA 2FOGA 4D76A 1TMUH 1O3KA 4WH6A 1ETTH 5AF9H 4ABAA 1UHBA 1ZHRA 3ZZBA 1LVBA 1BA8B 4BXSA 1PQ5A 4X6MA 3UY9A 1UTMA 4YOIA 1J15A 4MQAA 2AFQB 4U01A 5CE1A 1LDTT 2WV4A 1B0FA 1NO9H 3EE0B 3QO6A 4U30A 3SNAA 1CBWB 1ESBA 1DWDH 1SGQE 4MPUA 2GTBA 1KXEA 2BDIA 2VIPA 1SOZA 2FI5E 1LHCH 4B74A 1QIXB 1QTFA 1E37B 4UONA 2A0QB 4QT8C 1H1BA 1BRUP 2DUCA 1QJ1B 1O2OA 4F4OC 1G32B 3I77A 4Y11E 3RXFA 3V13A 2WPJS 1BDAA 2VIQA 5DJ7A 4MG3A 4B71A 3K6YA 4I31A 1GVLA 1GJ9B 4CR5A 1SR5C 6CHAB 2GDDA 1O31A 3M37A 2J34A 2OINA 4NWKA 1K1OA 2BDYA 1CQQA 3UTUH 4XFQA 3LGWA 1JRSA 1TQ0B 2FLBH 5DP9A 1NRNH 1SGEE 3M5LA 4JZIA 2VVCA 1BMNH 2QCYA 1DDJA 3BTHE 3KHVA 1RTLA 3QDZB 3S0NA 1H8DH 3STIA 5C5NA 1W8BH 3MWIU 3I29A 1O2LA 1UCYK 4E7RG 4GVUA 3MOCA 1FZZA 1TWXB 2ZU1A 5DP7A 3HK6B 5C1UA 1KTSB 3KCGH 3UFAA 1CHOF 3ZZAA 3MU0A 4O3UA 1OWEA 1BJUA 1EZQA 3SJOA 1XMNB 5C67A 1O34A 2HPQH 1BUIA 1WTGH 1THPB 1GBBA 4YLUA 2EI6A 2FEQH 2SGAA 2GV7A 4BNRA 1MKWH 1HUTH 1VZQH 2R2MB 2ZFFH 1C1PA 1O2JA 4NIVA 4JZDH 4X1RU 1T31A 4GCHG 1QQUA 3KN2A 1T8MA 2ZFTA 4K1TA 4ZKOU 2FTLE 1GI1A 2Y6TA 1THRH 3UQVA 2JH5D 1C5LH 1UTKA 3SV2H 1CA0B 4ABBA 3QTVH 2STAE 4DCDA 1T4UH 8GCHG 4O3TA 5DK1A 2Z6BD 1LCYA 2TRMA 1Q3XA 3GY6A 1K1PA 3CS7A 3P70B 4Z0KA 1NRSH 2ULLA 4WH8A 1O3DA 1BB0B 3E0NB 4JZ1A 3U1JB 1S82A 2JH6D 1UCYE 4DG4A 4JZEH 2UUKB 1XUKA 2C3SA 1O2UA 1SGNE 1QRZA 1C2KA 3TH3H 1QA0A 3RDZA 5IYTA 2ANKH 2F9PA 3ITIA 2ZTZA 1C2JA 1QCPA 3EDXB 7LPRA 1VGCB 1YPHE 6CHAC 1KXCA 4CREA 1CA0C 1DFPA 2FOBA 1FV9A 2C93B 3OU0A 4R0IA 1GHBF 1O3EA 1GBIA 1ZSLA 3D62A 2GX4A 2D8WA 2JH0D 2ANWA 1CO7E 4HZHA 1MTUA 1TE0A 2ODQA 3F68H 2UUJB 4AG2A 1A3BH 1GBTA 1N8OC 2ZPQA 2OQ5A 3MH5A 4I7YH 5C1XA 2PKSC 5I46H 3VB5A 3W95A 2SNWA 1H9HE 1ELGA 2PGQB 1MTSA 1AGJA 1GI7B 4IC5A 4BAQB 4IN1A 1QGFA 3JZ2B 1O3HA 2XC4A 3V3MA 1O2GH 2QXIA 4NWLA 4WXIA 3UWIA 4X8UH 5GCHF 4X8SH 1BRCE 1O5AB 3SJ9A 3I78A 3RLWH 2KAIB 1YPJH 2FTMA 4ISOA 4FUIA 5JYIA 1IQEA 1YPLH 2V3OH 1HYLA 4INLA 2NU1E 1LKAA 4XE4A 4PROA 1SGTA 2FPZA 1C1QA 1CA8B 2FOAA 5EPNA 1P03A 3SGQE 2H1UA 2BMGB 1FXYA 3PV4A 1GBLA 1O3MA 3RLYH 2FMJA 3LIWA 1GGDC 3VFEA 4K8BA 3BF6H 3MMGA 4WMEA 4ZHLU 3LGUA 2ZWLH 1UO6A 1C2LA 9LPRA 4M7GA 4SGAE 1ZTKA 1SGPE 1PPZA 1MD8A 3F9FA 1Q2WA 3LOXA 2HGTH 1Z1IA 1SHYA 2BZAA 1EZXC 1NFXA 3P92A 3M61U 1NFUA 3NCLA 1FAKH 1O3BA 4KTCA 2WUBA 1Y59T 1C2EA 5TJXA 3RXAA 1C5PA 3ATKA 1ELEE 2H9TH 3BN9A 5EXMA 1A0LA 4CBOA 1KDQB 1UJ1A 4K2YA 1GBMA 2QXGA 2C8WB 1L4DA 3RM2H 1P2MA 2AMQA 1VITG 2Q1JA 4BOHA 3T25A 1O5FH 4IBLH 1V2OT 3VGCC 1HAYB 1SGFG 1F92A 1GDNA 1OPHB 2EI8A 4CH2B 1C2IA 4AYYB 3SV8A 3SNCA 1DT2A 2ODYB 3GY7A 1CE5A 1C5RA 1KYNA 1C5YB 1H8IH 3QGNB 1KY9A 1AMHA 5FCKA 4WF8A 3FANA 3U8TH 4MPXA 1UHBB 3EA7A 1G3EA 1EZSC 2BY5X 4X2WA 5ABWA 3PTBA 2GZ7A 2I6QA 5FBEA 3RXDA 1BOQA 1RFNA 4BXWA 1EOJA 9ESTA 2PLXA 4J1YA 2ZHQH 1A3EH 2ZHWH 1ZJKA 3F6UH 3ZVCA 3HGNA 3VEQB 1P9UA 2Q6FA 1GBAA 2H5DA 3LKWA 5J4SA 3KQCA 2D26C 3SU0A 3JZ1B 1DICA 1HAOH 1EJNA 4HFPB 2O8WA 2BLVA 1K22H 3MU4A 5GPIB 4F49A 1RJXB 1A46H 1TNLA 3RMOH 2R2WU 4AFSA 3F9EA 1GHWH 1Y3XA 3RXUA 3SQEE 1V2TT 3GISB 2ZO3H 3GY8A 4IC6A 4UDWH 1GHAF 1C5NH 5F03A 4ZKSU 1K2I1 1GI6A 1C2FA 3GCNA 3O8RA 4ABDA 1J9CH 1GPZA 4X1PU 2XBWA 3RXIA 1E0FD 4OS5A 3ESTA 2BVXH 3TK6A 3VXFH 1EPTB 2AGEX 1V2VT 1OP0A 5LPRA 2GMTC 4DGJA 2SGFE 4I8LA 1DY8A 3RXTA 1MBQA 4FUJA 1AU8A 1Y3UA 2A5AA 1KSNA 1SC8U 1AWFH 1BTUA 2BD5A 1C2MA 2W26A 4TY7A 3FZDA 4AN7A 4CRDA 1IQMA 4Y71A 1NROH 1FIWA 1NS3A 2QXHA 1OP8A 1DWEH 3NWUA 1HDTH 1D3DB 3S69A 1WCZA 3RXKA 2FWWA 4ZKRU 5DG6A 1B5GH 3BTKE 2ILNA 3VXEH 4IMZA 2FYRA 3QGJA 1AHTH 4NSVA 3OY6U 1MU8B 2BD2A 1NRPH 1AFEH 3ODDA 4NCYA 3MNBA 1Z7KA 3OTJE 2HLCA 5H4IB 1DOJA 5EW1H 1IQNA 4ISLA 1P09A 1EXFA 2AMPA 1FI8A 2ZCKP 1VCPA 3KQBA 1G3CA 1W14U 1BTYA 3RC5A 2J2UA 3M5OA 3A8BA 4D7GA 1A2CH 2IOTA 4R8TB 1O39A 3UNQA 4LZ1H 3ELAH 1BJVA 2A45B 3SU3A 1HJ8A 1SI5H 3LPRA 3B9FH 2XBVA 4K69A 5FXLA 1CHOG 3BG8A 1QA7A 1J14A 2CHAC 2QF3A 2GCHG 2VH0A 3M5NA 1ABJH 1DLKB 1UK2A 2XCFA 1A61H 1ELFA 1JWTA 2AMDA 2HPPH 1C5VA 1RD3B 2H6MA 1JMOH 3U8RH 1ESAA 3AASA 1SLWB 4AYVB 1BZXE 1LVMA 2CXVA 1FUJA 1SLXB 2OBQA 3DA9B 2FXRA 2G5NA 1AIXH 1SQOA 4CHAC 1GHAG 4RN6A 3GDSA 1BTZA 1G30B 1Z8IB 5C2ZA 2QC2A 3STJA 4LK4A 1JBUH 1AB9B 4LZ4B 4GHTA 1VCWA 1EPTA 2G81E 3OYPA 2P3FH 5HMAA 3A85A 2J38A 3ATLA 2ZP0H 3KIDU 3T26A 2VU8E 1UTOA 1BIOA 4I8JA 5T6FA 2JKHA 1GCTC 1A7SA 1IQLA 4K1SA 3BSQA 5EPYA 4E7NA 1YPGH 3NPSA 1QNJA 1O5CB 2O8MA 1F2SE 1A1RA 1NM6A 3UOPA 1C2DA 1Y5UT 4RKOB 1AUTC 2PGBB 3BIUH 1AD8H 2A4RA 2UWOA 3L6PA 4ABIA 1S81A 5E0JA 3RP2A 1P3EA 1V2MT 3OSYA 1P8VC 5F8ZA 5GXPA 1DM4B 4B2BA 1EAIA 1UTJA 2BVRH 1MH0A 2OC0A 5LGOA 3GDVA 3U69H 3UPEA 2PTNA 3SHCH 3EAJA 1EAUA 1AE5A 1HPGA 2BXTH 3WY8A 1NY22 1C1VH 2BD4A 5GJ4B 5A09A 4Y7AA 4B2CA 2BY7X 2H9HA 3S7KB 1Y3VA 2Z9LA 2W3IA 1TGNA 4FVDA 3SV7A 1G3BA 2FESH 1TAWA 3ZZ5A 1TALA 4IS5A 2ZHFH 1F5LA 8KME2 2FX6A 1YLCA 1AFQB 3TNTA 4YO9A 3DFLA 2P3TB 1HAZB 4YESB 1GMCG 1O37A 1MZDA 3VB4A 1B0EA 2P95A 1ELVA 2VGCC 5E0HA 1EP6A 2FI4E 3NKKA 1MU6B 4NFFA 5TCAA 3IITA 1FPCH 2ZGBH 2QV1A 2F91A 3FAOA 1ZTLA 4CHAB 1ZMJA 1ANEA 1F0TA 3A7VA 5L2YH 5T6DA 2GCHF 2BM2A 1P11E 2BD8A 3GY3A 3LONA 1C1WH 5K7RA 1ZHPA 1GL0E 1RRKA 4NIWA 3FFGA 1O5EH 2C8XB 1XXDA 4CRBA 1ELCA 2WPKS 3NZIA 3NUMA 3RU4E 2B9LA 4ZXXH 4JK5A 3ZZ7A 1GHZA 1EASA 5A0AE 1D9IA 2JETB 5FPTA 1GI9B 2ZG0H 1AFQC 1FY5A 5C5OA 1GCTB 4DY7B 1W7GH 2UWPA 4UFFH 1DSUA 1WQVH 2IJOB 1MD7A 2BOHB 2FOMB 1M9UA 8LPRA 2IN2A 2CF9H 1HXFH 7GCHF 2THFB 3ZZ3A 4XBBA 2BY8X 3VB7A 2DE9A 4ABHA 1AY6H 3A83A 4ZXYH 1O3FA 2O8LA 3ODFA 2PSYA 4JCNA 1GMHG 3S7HB 1ZZZA 1TPPA 1LHGH 2ZGCA 3QWCH 1HAVA 1SGYE 3DD2H 3RC4A 2RG3A 1PFXC 2B0FA 2ZDNA 3TGKE 1O2YA 3CS0A 2CN0H 1AN1E 3B8JA 1LPZB 3QUMP 2R3YA 2VGCB 4MTBA 5G4BA 4WMFA 1TNIA 2AERH 5DKMA 3K9XB 1LMWB 1YYY1 3PB1E 4RKJB 1PPGE 5PTPA 1Z1JA 3E3TA 2OCVB 1C5OH 2P59A 1P12E 2ZU2A 2ZI2H 3SJ8A 1Z8GA 3SGBE 1BHXF 1RS0A 1TRYA 2LNCA 3TJVA 1XUGA 5EODA 1L0ZA 4FUBA 4OS2A 4ABEA 2YNBA 2AH4X 5ETXA 1OWIA 1Y3YA 5EU8A 4DOQA 2JETC 2SGDE 5EOKA 2XBYA 1QL9A 1ZPZA 2QY0B 3SJIA 4OS6A 1SGRE 3GCHC 1KXBA 3TU7H 2V0BA 3BTDE 2G00A 3R0FA 2FOHA 3RXBA 1BCUH 2BHGA 1HXEH 5GDSH 1YCPH 1KTTB 1TGCA 3EQ0H 1ZMLA 1Z8JB 1O3JA 4OS4A 2G5VA 2XWBI 1GMHF 4O97A 2ZFQH 1B7XB 3MU5A 1GJCB 1OP2A 3SGAE 1GMCF 1E38B 1FN8A 2ZHEH 5TCCA 2Z94A 3BTTE 1D6RA 1IQJA 1L2EA 5C20A 1G37A 1ZYOA 1HNEE 1Y5AT 3LJOA 1N8OB 1L4ZA 2ZQ2A 1QRXA 3C27B 1HJAB 1W7XH 5CHAC 4AFZA 4YM9A 5K0HA 1FJSA 1P2OA 1ZGIA 2NU3E 2WPMS 3ZZ9A 1T8OA 2ZNKH 4A5TS 2XCNA 2Y80A 1SG8B 1RGQA 1G2MA 1J17T 2RDLA 1PQAA 4SGBE 1ANDA 1P2NA 3HKJB 4FU7A 1S83A 2BD7A 4RSPA 3ATWA 3UIRA 2A5IA 1NC6A 3ZVDA 3SZNA 2ZGJA 1ZHMA 2ZECA 1EJMA 4Q7YA 1VR1H 1VITF 1O3PB 1XUIA 4GPGA 1FQ3A 3LT3A 1GBKA 2BVSH 3AVZA 1FIZA 4X8TH 1DLEA 1O3NA 1LHFH 1TBQH 3E0PB 3SU5A 1GBCA 2OLGA 5C3NA 1QJ7B 2CJIA 1K1JA 2XXLA 1NT1A 2GD4B 3QK1A 1GWAA 1MZAA 3SOSA 1O2ZA 1GI4A 2BD3A 4D8NA 3TGJE 3A87A 4A92A 3M3SA 3SU1A 1Y8TA 1AE8H 2OUAA 1KXFA 2ZFSA 2ZGHA 1W3CA 3ZZ4A 4MNVA 1NFYA 4FVBA 1O2TA 4TY6A 4X2YA 2PR3A 1HJ9A 1O2RA 2ANYA 2XYAA 4CRAA 1T7CA 1WYKA 3GCTG 5T3HA 2A4GA 1O3CA 1SL3A 1BRBE 4DIHH 2XTTB 1MUEB 2ZDAH 1HJAC 3OX7U 4MDSA 2VH6A 1UVUH 4Y8YA 3E6PH 4ISNA 4FUFA 5FPYA 5A2MH 2OD3B 4GSOA 4MPVA 2OC1A 1IQKA 1MTWA 3MNSA 1GGDB 4E06H 2ZGXH 1NU9A 3ZV9A 5ESBA 2P8OC 2TIOA 2P3UB 3LGIA 2W7SA 1F7ZA 4OS1A 1C4V2 2ZQ1A 4ZHMU 1YM0A 3GOVB 1CBWC 1FAXA 2UUFB 1XUFA 3UOUA 4YZUA 3UQOA 1XVMA 1EX3A 1BITA 2A7HA 5L6NH 3UNRA 2PKAA 3A80A 1D3QB 1IHSH 5DO4H 2ALVA 1O5DH 2UWLA 1V2QT 3KQEA 5EXNA 4CRCA 2C8YB 1SSXA 3U8OH 3OY5U 5A8ZA 2AGGX 2XC5A 2SGEE 3B23B 4FUGA 3ZYDA 5FCRA 4K1EA 4ABGA 1F0UA 1NRQH 1PYTC 3EA8A 1TNJA 1GCDA 4YOJA 3LJJA 5HYOA 3P8FA 2BDBA 3M36A 1S85A 1YPEH 1NZQH 2B5TB 1P9SA 4DW2U 2SFAA 1W13U 2BB4A 1SGDE 1HAVB 3BTWE 1P01A 4K5ZA 1MTVA 3TJUA 2FS9A 2TBSA 2WV5A 1D4PB 2FOEA 1AI8H 2SNVA 2BDCA 2EA3A 1W2KH 3SORA 3MU8A 1TRMA 2TGDA 4HTCH 1P02A 4BTIB 1HAIH 2QAAA 4ZAEA 2YOLA 1OYTH 4ESTE 1SB1H 3RXEA 3ZVGA 2ZPRA 3A89A 2WUCA 5JBCS 3NXPA 1TX6A 1A4WH 1BMMH 3KNXA 1MKXH 3ZZ6A 1ELAA 1J8AA 2PSXA 3E16B 1FY3A 4XOJA 3GYMA 2RCEA 1QBVH 1QBNA 1C2HA 1V2PT 5FHTA 2Y5HA 5JBTA 5B6OA 2ESTE 1TNHA 1FNIA 2Y82A 5DP8A 5LH8A 1QL8A 3F9HA 3R3GB 1XVOA 2GV6A 1TABE 2TGTA 4Y6DA 5BPEA 4J2YB 2PV9B 1C1RA 3PO1B 4CBNA 2AIPA 1KLJH 3QZQA 2ODPA 4UFDH 2PWXA 3LDXH 4YTAA 2F9UA 2FM2A 3S9AA 2GKVE 1ZJDA 1AB9C 4Y8ZA 5AFYH 2XC0A 1K28D 5DP6A 4WVPE 1F5KU 1PPFE 5C1YA 3VGCB 1ANBA 4B73A 1GI3A 4D9RA 1ARCA 3PMBB 2Z9JA 2VVVA 4IGDA 1DVAH 2R0LA 2C90B 1UVPA 1INCA 4H6TA 3SU6A 2GDEH 1LHEH 3RU4D 1TMBH 2RA0A 1F0RA 1Z71A 3ZVBA 1QL7A 1O3AA 2VWMA 2OXSA 1KLTA 1G2LA 1K1NA 4DT7B 1SQTA 3TH4H 2FODA 3ZVAA 1H9LB 2A2QH 2GGVB 2FOCA 3P8OA 2Q6DA 4DIIH 1WU1A 2ZKSA 2XW9A 5F8TA 4O9VA 1C1NA 5A8YA 2CV3A 3TVJB 3ZZ8A 1W12U 3BTFE 3PM3A 1WUNH 1L1NA 1K1LA 3TPIZ 2R0KA 2RA3A 1GBJA 3GYLB 4CH8B 2BDAA 1ESTA 2HNTE 1A5HA 1MTNC 6GCHG 1ELDE 1TMTH 1XKAC 3RMNH 5L2ZH 3A8DA 2Z9GA 2KAIA 1GJ6A 1O0DH 2W3KA 5LPEA 1DY9A 1GHVH 3GICB 2Z7FE 4OGXA 3RUOA 3TNSA 2OP9A 1V2WT 1ZLRA 1ZGVA 4KP0A 1A5GH 2WYGA 4Y0ZE 1LQEA 1AQ7A 2ZC9H 1MCTA 4KGAA 1UVTH 4O03A 2FO9A 4I32A 3SI3H 4CRFA 5EXLA 2ZTXA 1D6WA 3UREA 4I8GA 1HAHH 1S6FA 3Q3XA 1ABIH 1FN6A 1GMDG 1LKBA 3MH6A 4Y8XA 1MTNB 2BQ7B 3DFJA 5FBIA 3V0XA 2BLQA 1E34B 1TNGA 3H5CB 4H6SB 4MPWA 1PYTD 4ABFA 5GWZA 3M7QA 2GT8A 4X2VA 1P2JA 2F9BH 4Y10E 2HNTC 1NN6A 2PTCE 4NIYA 1O32A 4K8YA 1GJ8B 4FXGH 4WJG2 3LC5A 2A7JA 2ZCHP 2ALPA 2VINA 2BQWB 4ZHAA 3TH2H 2P94A 1E35B 1NFWA 2A32A 4FU8A 4DJZB 2VIDA 2A4OA 1PJPA 2BYAX 1DXWA 4ISIH 1GI8B 1HBTH 4ISHH 1ZSJA 5SGAE 3SUGA 2AGIX 2K1QA 4Q7ZA 1KIGH 3RXPA 1RXPA 4NG9H 4KKDA 4UFGH 3PWBA 4TYDA 1QJ6B 1Z8RA 1TPAE 1FDPA 1EQ9A 4FUEA 1ETSH 2BZ6H 3KGPA 2YNAA 4ABJA 1FLEE 1QB1A 4MNXA 2O8UA 4INKA 1DUEA 3K2UA 4K3JA 1P0SH 5E8EH 4WY3A 5J4QA 1OWJA 2ZZUH 3S9CA 1JXPA 1GI5A 1XX9A 3SHAH 1V6DA 3ZZCA 2F83A 2G4UA 5JBBS 1V2LT 5EGMA 1BMAA 1P2QA 1ELTA 1OS8A 3ENSB 3MHWU 1EB2A 3SU2A 3AW0A 1NRRH 2FZZA 1HCGA 2J95A 5E2PA 1TX7A 2OC8A 3BEUA 3HGPA 3KL6A 1G9IE 1YPKH 3A84A 3PMJA 3PYHA 3VB3A 2ZIQH 2ANMH 3LH3A 3RXSA 4Y7BA 1DX5M 2ASUB 4INHA 4Y79A 2VWNA 1EUFA 1GBEA 1TOCB 1T8NA 2D2DA 2TGPZ 3BG4B 1P05A 3S9BA 1HAPH 3GY2A 1MCVA 3D49H 1Q31A 4A1XA 3P8GA 1EATA 2GCTC 1IQGA 1C9TA 1JIRA 4UE7H 3Q3KA 2AS9A 3LC3A 3SNEA 1O2PA 2SGPE 2ZDLA 4ZH8A 3D65E 1BTPA 1YPMH 1NPMA 3DHKH 2HOBA 3TGIE 2WINI 3T27A 5EQRA 4X1NU 1BQYA 4AG1A 3RMLH 1SOTA 4KELA 1CT4E 1C4U2 2HVXA 1C5QA 5HM2A 2GMTB 1C1TA 2R3UA 1O2IA 1QB9A 1ZRBA 1TGBA 1O2HA 1O3IA 3PLPA 1BT7A 1TBZH 2FX4A 3TITA 1OSSA 3BTQE 4AOQA 4NIXA 4THNH 3L3TA 2V3HH 1IOEA 3SUDA 1W10U 4FU9A 1LO6A 5A8XA 1OXGA 3MH4A 1OWHA 1TRNA 1V2NT 4GHQA 1UMAH 1SFQB 1GI0A 3UR9A 3BEIB 3SW2B 1Z6EA 5AVDA 4ASHA 2OBOA 3Q77A 1SGFA 4I33A 3VPKA 5JPMH 2FYQA 4DURA 1GHXH 2ZU3A 2TGAA 1DXPA 2PW8H 2HRVA 1V3XA 4YOGA 1GBFA 2HALA 3A7WA 1MAXA 1EZUC 2LPRA 1C5ZB 1GJ5H 4X6PA 1SMFE 2F3CE 2A2XH 2O9QA 4A1TA 2PUQH 2GT7A 5FX5A 1EKBB 1H9IE 1FMGA 4JZFH 1GI2A 1S5SA 2A7CA 1TA6A 3RM0H 1CGHA 4B76A 1UVSH 3U98H 1T32A 1BBRK 1SPJA 3CENA 1IHTH 1DANH 1H4WA 4JK6A 3N7OA 1LQDB 4XBCA 2XWAA 1QB6A 1MMJN 4TPYA 3RXOA 2NU0E 2VNTA 1BBRH 1PQ8A 1LTOA 3M35A 3V12A 2ZFRH 1AUJA 1IQIA 2H9EH 1QY6A 2FOFA 3P8NA 1SQAA 3LGVA 1AVXA 1GVZA 4TPIZ 3T5FH 1C2GA 1AVGH 1S6HA 1KXDA 1VGCC 1WV7H 1FPHH 1W0YH 2GP9B 3IG6B 1A0JA 3PTNA 4KTUA 3ZV8A 2NU2E 3RXLA 3KQDA 3K6ZA 4NA8A 4NFEA 2ZCLP 4D9QA 5F6MA 2I6SA 6LPRA 2QYIA 3GCOA 1ZRKA 3BIVH 4ZKNU 1LPGB 1SLUB 4KTSA 4U32A 1C5SA 1GDUA 1O2VA 2C4FH 5FAHA 2CHAB 1TLDA 1S0QA 4A1VA 4JYUH 1O2NA 4BAKB 1O38A 2ZA5A 1WOFA 4AFUA 1ETRH 3GDUA 3Q00A 4X6OA 1P2IA 2GVFA 2ZHDA 4JYTA 4HI3A 3EA9A 3IWMA 1SGCA 4Y0YE 2G51A 1QR3E 5JDUB 1T8LA 1V2RT 1AKSA 2PHBA 1GJ7B 1O36A 1L1GA 3Q3YA 4WMDA 1RTKA 3F9GA 4B1TA 4NGAH 2A4QA 1XUHA 3FP8E 2BLOA 1C5UA 1GDQA 3SNDA 4VGCC 2WYJA 3O8DA 1EAWA 1BBRE 1TQ7B 2Y81A 2PKSB 3MFJA 3BTME 1WTHD 1THSH 1QRWA 4BTTB 1GJAB 2G4TA 1UTNA 1UTQA 1LPKB 1O2WA 1GL1A 4A6LA 1SLVB 3U1IB 2Z3EA 1GG6C 5L30H 5LPFA 1WSSH 3BG4C 2J92A 2QXJA 1DITH 3CP7A 2G8TA 1DE7H 2G52A 1QHRB 3KEEA 1UVOA 4OS7A 3M5MA 2GZ8A 1W11U 2FS8A 1OYQA 2FLRH 4FUHA 2EC9H 4UFEH 3HKIB 2XBXA 4Q80A 3SUEA 3UR6A 3ZYEA 1O3OA 2VIOA 1NU7B 3MO6A 1Y3WA 1EAXA 3A7TA 1FY8E 1CHGA 2M5TA 2BY6X 1VJ9U 1TA2A 5HM9A 1TBRH 3SBKA 4NA7A 3A88A 4DVAU 2V6NA 4YLQH 2STBE 3TLOA 2FDAA 1LVOA 1GJDB 3V7TA 2FP7B 5DP3A 3AW1A 1WBGB 2GZ9A 2PFEA 3QX5H 4Q2KA 2ZDMA 3GY4A 8ESTE 1MQ5A 1CT2E 1L1JA 2B7DH 3SO3A 3A7YA 3SV6A 2A5KA 4AFQA 5CHAB 2QIQA 4A7IB 1LHDH 1K21H 2A31A 3UUZA 3PROA 7KMEH
chains in the Genus database with same CATH superfamily
5GIBA 1C1SA 1BTHH 3SU4A 1HGTH 1FY1A 3A7ZA 1LVYA 5GCHG 3SYJA 2BD9A 4X1SU 3C1KA 4YT7H 4BAHB 3ATIA 1UCYH 3TJOA 1AVWA 4Z6AH 3Q76A 3HPTB 2PKAB 1O2XA 1F5RA 3OEED 5HXFA 2AYWA 1A0HB 3PLBA 3HATH 4GCHF 4I8HA 1HAGE 2KCPA 3E91A 1QFKH 2J9NA 5F8XA 5A0BA 3P95A 1TONA 3RXRA 2CMYA 3T62A 2DE8A 5ESTE 3UWJH 3RU4T 3RXHA 3A8CA 3ZVFA 1P3CA 4MNYA 1G3DA 3SQHE 3FZZA 1T4VH 3OAAD 1HV7A 4H42U 1YP9A 1NESE 2Y7XA 1CU1A 1VCQA 4IW4E 2YMSC 2OC7A 1C1MA 1S0RA 1YCPK 1YBWA 1D3TB 5EQQA 1ZPBA 3RXVA 1SFIA 7ESTE 1J16A 3E8LA 2Y7ZA 1O2QA 5AFZH 4OGYA 1XM1A 1EOLA 4AGJA 4X1QU 2VWLA 4MLFB 4UD9H 2BQ6B 3A82A 3RXQA 1N1LA 2L6OA 1UK3A 1O2MA 3G01A 3FP6E 2ZTYA 1ACBE 1Z6JH 5E2OA 1GVKB 2LELA 1MKXK 3BEFB 2BX4A 5HGGA 5EW2H 1RIWC 3H7OA 2UUYA 1CSOE 1YC0A 1YGCH 2OTVA 3O8CA 2VJ1A 1TPOA 1O2KA 2EEKA 3D23A 5I25A 1VJAU 3O8BA 4AX9H 3ZZDA 4TWWA 5EQSA 2VVUA 3LGTA 1P57B 2J4IA 1O3GA 1VITH 1H8ED 1V2KT 1EP5A 2BLWA 1QURH 1FONA 1OKXA 1BRAA 3DUXH 1UTLM 1NBMD 2VB0A 3LU9B 3MO9A 4NA9H 1EPTC 1C9PA 5FX6A 5HIZA 1BMLA 1TGSZ 2CGAA 4AORA 2H5CA 3MNCA 1IAUA 1U6QA 4JMYA 4YT6H 6ESTA 2VIVA 1MQ6A 2V35A 3SUFA 2EI7A 3U9AH 2W5EA 1SBWA 2TPIZ 4VGCB 3VB6A 3ZVEA 4Q63A 2BTCE 1PPCE 5FPSA 3TK9A 5DPAA 3MU1A 3E90B 1IQHA 2F9VA 1GJ4H 4NSYA 3T28A 1CGJE 1TPSA 2ZDKA 2Y5GA 4GUXA 2HWLB 3P6ZB 1PPBH 1WXRA 4TWYA 3PMAB 1WAYB 3PO1C 4M9FA 3M7UA 1AZZA 2QN5T 4IN2A 1RIWB 4CR9A 3BV9B 2NWNA 1GBDA 2J98B 1FY4A 3MH7A 4B75A 1OWKA 1ZSKA 4Y76A 1O2SA 2D1JA 3PV2A 3RXCA 2B8OH 2Z3CA 1ZTJA 1N6XA 1ZPCA 1GMDF 5A0CA 4NZQA 2ZEBA 3PRDA 2AEIH 2ZF0H 1CT0E 2CF8H 5HKKD 2VIWA 1C1OA 3F1SB 4ZROA 5EG4A 2ZDVH 4ZCNA 1HAXB 4UEHH 3DT0H 3H7TA 3MO3A 3SI4H 3A8AA 2Z9IA 3UNSA 1CVWH 1ELBA 4K60A 5DSFA 2BOKA 1O33A 1GBHA 1KLIH 1V2ST 1YLDA 1DSTA 3M3VA 1YKTA 5T6GA 3SV9A 3AAVA 2VWOA 1HB0B 1UK4A 4XSKU 3A7XA 2O8TA 3T29A 3PLKA 3PMHB 2QGRA 1JIMA 1XXFA 5DP5A 1AZ8A 2P93A 3M3TA 4H4FA 3N7EA 4Q7XA 1DPOA 3A81A 1PPHE 1A5IA 4AGKA 3OTPA 1XKBC 3GCTF 1DWBH 1SGIB 1C1UH 1TX8A 1TFXA 2P8OB 4AB8A 1NTPA 3E1XB 2Q6GA 1TYNA 2F9NA 1X7AC 1S84A 4E05H 2BDHA 1C5TA 1E79D 1SHHB 1ZR0A 2QA9E 1W0ZU 1P10A 1KDQA 4MNWA 4X8VH 3NK8A 3M7TA 4ZMAH 4LXBH 1C5MD 5CMXH 3T2NA 1QQ4A 6GCHF 1MAYA 2CK3D 3SJKA 5BRRE 2C8ZB 1TGTA 2A1DB 1DUAA 1TOMH 2P16A 4BTUB 1F0SA 4XBDA 3RXGA 5C17A 1DWCH 2KX4A 1HIAA 2J94A 3MNXA 3RC6A 5JB9S 1DS2E 4IMQA 4U2WA 5DP4A 2WSSD 5JB8S 1GHYH 4RT0A 4I8KA 1UTPA 1AO5A 1QBOA 3P17H 1C4Y2 3BTEE 1TIOA 1BTWA 3AAUA 2F9OA 2XNIA 1P2KA 1P06A 1RTFB 1HRTH 2IPHA 3ATMA 4TSFD 4CRGA 1O3LA 1ARBA 2J97A 4ACBA 3SZEA 2SGQE 7GCHG 1TNKA 4JYVH 1BHXB 2W7UA 4X6NA 1K9OE 1EB1H 2Z3DA 1OWDA 3EGKH 1O30A 2ZU5A 2AIQA 5JBAS 3RXJA 1OX1A 1HFDA 4NZLA 1SVPA 3FVFB 2QF0A 3GY5A 2BDGA 4GAWA 1GHBG 3W94A 1G36A 3RMMH 4BAOB 1AWHB 1TB6H 3QZRA 2BX3A 1WQSA 1V2UT 3SNBA 2Z9KA 1BTXA 3A86A 4BANB 8GCHF 4D7FA 1YCPM 1ORFA 1PPEE 4XDEA 1MKWK 4ZUHA 4GLYA 2XRCA 2ZFPH 1O35A 3SN8A 1O5GH 3QTOH 2ZPSA 4FUDA 1N6YA 2WPHS 1IQFA 3TIUA 5IDKA 4WWYA 5AHGH 1PQ7A 3MYWA 1KXAA 2WPIS 3GCHB 3FP7E 2KR7A 3KYGA 2BXUH 4LOYH 2G55A 1ID5H 1MBMA 2GCTB 1JRTA 3K65B 1C5XB 1E36B 3PWCA 1GJBB 1Y5BT 1YPHC 4AZ2B 2BY9X 2ZU4A 2PUXB 4MVNA 4P00A 4BAMB 1K1MA 1V2JT 1JOUB 5E0GA 3MTYA 4HGCA 4WXVA 1P04A 3LH1A 3L33A 1CGIE 3HK3B 1C5WB 2Y5FA 1O5BB 2FIRH 2OQUA 1ZMNA 3MI4A 3QN7A 3BTGE 3TJNA 1GG6B 1YLNA 1K1IA 2HNTF 4X0WU 3EYDA 1EJAA 3KF2A 4AB9A 4B6FA 1AKSB 1ZOMA 1XUJA 1HLTH 2RDEA 2R9PA 3QLPH 4X2XA 2WPLS 2NU4E 3URDA 5DGJA 4FUCA 1ANCA 1YF4A 1D3PB 2H2ZA 2FI3E 3PV5A 3LGYA 3W1EA 1HIAB 3RXMA 3TK5A 1OOKB 4B2AA 3URCA 2FOGA 4D76A 1TMUH 1O3KA 4WH6A 2KM0A 1ETTH 5AF9H 4ABAA 1UHBA 1ZHRA 3ZZBA 3DSGA 1LVBA 1BA8B 4BXSA 1PQ5A 4X6MA 3UY9A 1UTMA 4YOIA 1J15A 4MQAA 2AFQB 4U01A 5CE1A 1LDTT 2WV4A 1B0FA 1NO9H 3EE0B 3QO6A 4U30A 1QZ8A 3SNAA 1CBWB 1ESBA 1DWDH 1SGQE 4MPUA 2GTBA 1KXEA 2BDIA 2VIPA 1SOZA 2FI5E 1LHCH 4B74A 1QIXB 1QTFA 1E37B 4UONA 2A0QB 4QT8C 1H1BA 1BRUP 2DUCA 1QJ1B 1O2OA 4F4OC 1G32B 3I77A 4Y11E 3RXFA 3V13A 2WPJS 1BDAA 2VIQA 5DJ7A 4MG3A 4B71A 3K6YA 4I31A 1GVLA 1GJ9B 4CR5A 1SR5C 6CHAB 2GDDA 1O31A 3M37A 2J34A 2OINA 4NWKA 1K1OA 2BDYA 1CQQA 3UTUH 4XFQA 3LGWA 1JRSA 1TQ0B 1NBME 1W0JD 3F2FA 2FLBH 5DP9A 1NRNH 1SGEE 3M5LA 4JZIA 2VVCA 1BMNH 2QCYA 1DDJA 3BTHE 3KHVA 1RTLA 5KGOA 3QDZB 3S0NA 1H8DH 3STIA 5C5NA 1W8BH 3MWIU 3I29A 1O2LA 1UCYK 4E7RG 4GVUA 3MOCA 1FZZA 1TWXB 2ZU1A 5DP7A 3HK6B 5C1UA 1KTSB 3KCGH 3UFAA 1CHOF 3ZZAA 3MU0A 4O3UA 1OWEA 1BJUA 1EZQA 3SJOA 1XMNB 5C67A 1O34A 2HPQH 1BUIA 1WTGH 1THPB 1GBBA 4YLUA 2EI6A 2FEQH 2SGAA 2GV7A 3N7DA 1MKWH 4BNRA 1VZQH 2R2MB 1HUTH 2ZFFH 1C1PA 1O2JA 4NIVA 4JZDH 1COWD 4X1RU 1T31A 4GCHG 1QQUA 3KN2A 1T8MA 2ZFTA 4K1TA 4ZKOU 2FTLE 1GI1A 2Y6TA 1THRH 3UQVA 2JH5D 1C5LH 1UTKA 3SV2H 1CA0B 4ABBA 3QTVH 2STAE 4DCDA 1T4UH 2IPQX 8GCHG 4O3TA 5DK1A 1S6LA 2Z6BD 1LCYA 2TRMA 1Q3XA 3GY6A 1K1PA 3CS7A 3P70B 4Z0KA 3WW7A 1NRSH 2ULLA 4WH8A 1O3DA 1BB0B 3E0NB 4JZ1A 3U1JB 3WWFA 1S82A 2JH6D 1UCYE 4DG4A 4JZEH 2UUKB 1XUKA 5C0TA 2C3SA 1O2UA 1SGNE 1QRZA 1C2KA 3TH3H 1QA0A 3RDZA 5IYTA 2ANKH 2F9PA 3ITIA 2ZTZA 1C2JA 1QCPA 3EDXB 7LPRA 1VGCB 1YPHE 6CHAC 1KXCA 4CREA 1CA0C 1DFPA 1W0KD 2FOBA 2IJD1 1FV9A 2C93B 3OU0A 4R0IA 1GHBF 1O3EA 1GBIA 1ZSLA 3D62A 2GX4A 2D8WA 2JH0D 2LP6A 2ANWA 1CO7E 4HZHA 1MTUA 1TE0A 2ODQA 3F68H 2UUJB 4AG2A 1A3BH 1GBTA 1N8OC 2ZPQA 2OQ5A 3MH5A 4I7YH 5C1XA 2PKSC 5I46H 3VB5A 3N99A 3W95A 2SNWA 1H9HE 1ELGA 2PGQB 1MTSA 1AGJA 1GI7B 4IC5A 4BAQB 4IN1A 1QGFA 3JZ2B 1O3HA 2XC4A 3V3MA 3F2GA 1O2GH 2QXIA 4NWLA 4WXIA 3UWIA 4X8UH 5GCHF 4XRNA 4X8SH 1BRCE 1O5AB 3SJ9A 3I78A 3RLWH 2KAIB 1YPJH 2FTMA 4ISOA 4FUIA 5JYIA 1IQEA 1YPLH 2V3OH 1HYLA 4INLA 2K8IA 2NU1E 1LKAA 4XE4A 4PROA 1SGTA 2FPZA 3FO8D 1C1QA 1CA8B 2FOAA 5EPNA 1P03A 3SGQE 2H1UA 2BMGB 1FXYA 3PV4A 1GBLA 1O3MA 3RLYH 2FMJA 3LIWA 1GGDC 3VFEA 4K8BA 3BF6H 3MMGA 4WMEA 4ZHLU 3LGUA 3F0PA 2ZWLH 1UO6A 1C2LA 9LPRA 4M7GA 4SGAE 1ZTKA 1SGPE 1PPZA 1MD8A 3F9FA 1Q2WA 3LOXA 2HGTH 1Z1IA 1SHYA 2BZAA 1EZXC 1NFXA 2W6ID 3P92A 3M61U 1NFUA 3NCLA 1FAKH 1O3BA 4KTCA 2WUBA 1Y59T 1C2EA 5TJXA 3RXAA 1C5PA 3ATKA 1ELEE 3PRBA 2H9TH 3BN9A 5EXMA 5EJLA 1A0LA 4CBOA 1KDQB 2XOKD 1UJ1A 4K2YA 1GBMA 1EFRD 2QXGA 2C8WB 1L4DA 3RM2H 5KEDA 1P2MA 2AMQA 1VITG 2Q1JA 4BOHA 3T25A 1O5FH 4IBLH 1V2OT 3VGCC 1HAYB 1SGFG 1F92A 1GDNA 1OPHB 2EI8A 4CH2B 1WDIA 1C2IA 4AYYB 3SV8A 3SNCA 1DT2A 2ODYB 3GY7A 1CE5A 1C5RA 1KYNA 1C5YB 1H8IH 3QGNB 1KY9A 4OM9A 1AMHA 5FCKA 4WF8A 3FANA 3U8TH 4MPXA 1UHBB 3EA7A 1G3EA 1EZSC 2BY5X 4X2WA 5ABWA 3PTBA 2GZ7A 2I6QA 5FBEA 3RXDA 1BOQA 1RFNA 4BXWA 1EOJA 5C0UA 9ESTA 2PLXA 4J1YA 2ZHQH 1A3EH 2ZHWH 1ZJKA 3F6UH 3ZVCA 3HGNA 3VEQB 1P9UA 2Q6FA 1GBAA 2H5DA 3LKWA 5J4SA 3KQCA 2D26C 3SU0A 3JZ1B 1DICA 1HAOH 1EJNA 4HFPB 2O8WA 2BLVA 1K22H 3MU4A 5GPIB 4F49A 1RJXB 1A46H 3F2HA 1TNLA 3RMOH 2R2WU 4AFSA 3F9EA 1GHWH 1Y3XA 3RXUA 3SQEE 1V2TT 3GISB 2ZO3H 3GY8A 4IC6A 4UDWH 1GHAF 1C5NH 5F03A 4ZKSU 1K2I1 1GI6A 1C2FA 3GCNA 5DN6D 3O8RA 4ABDA 1J9CH 1GPZA 4X1PU 2XBWA 3RXIA 1E0FD 4OS5A 3ESTA 2BVXH 3TK6A 1H8HD 3VXFH 1EPTB 2AGEX 1V2VT 5C94A 1OP0A 5LPRA 2GMTC 4DGJA 2SGFE 4I8LA 2EQNA 1DY8A 3RXTA 1MBQA 4FUJA 1AU8A 1Y3UA 2A5AA 2WHXA 1KSNA 1SC8U 1AWFH 1BTUA 2BD5A 1C2MA 2W26A 4TY7A 3FZDA 2L74A 4AN7A 4CRDA 1IQMA 4Y71A 1NROH 1FIWA 1NS3A 2QXHA 1OP8A 1DWEH 3NWUA 1HDTH 1D3DB 3S69A 1WCZA 4FETA 3RXKA 2FWWA 4ZKRU 5DG6A 1B5GH 3CNRA 3BTKE 2ILNA 3UAIC 3VXEH 4IMZA 2FYRA 3QGJA 1AHTH 4NSVA 3OY6U 1MU8B 2BD2A 1NRPH 1AFEH 3ODDA 4NCYA 3MNBA 1Z7KA 3OTJE 2HLCA 5H4IB 1DOJA 5EW1H 1IQNA 4ISLA 1P09A 1EXFA 2AMPA 1FI8A 2ZCKP 1VCPA 3KQBA 2J5UA 1G3CA 1W14U 1BTYA 3RC5A 2J2UA 3M5OA 3A8BA 4D7GA 1A2CH 2IOTA 4R8TB 1O39A 3UNQA 4LZ1H 3ELAH 1BJVA 2A45B 3SU3A 1HJ8A 3OFND 1SI5H 3LPRA 3B9FH 2XBVA 2YMSB 3DSOA 4K69A 5FXLA 1CHOG 3BG8A 1QA7A 1J14A 2CHAC 2QF3A 2GCHG 2VH0A 3M5NA 1ABJH 1DLKB 1UK2A 1A61H 2XCFA 1ELFA 1JWTA 2AMDA 2HPPH 1C5VA 1RD3B 2H6MA 1JMOH 3U8RH 1ESAA 3AASA 1SLWB 4AYVB 1BZXE 1LVMA 2CXVA 1FUJA 1SLXB 2OBQA 3DA9B 2FXRA 2G5NA 1AIXH 1SQOA 4CHAC 1GHAG 4RN6A 3GDSA 1BTZA 1G30B 1Z8IB 5C2ZA 4F55A 2QC2A 5F53A 3STJA 4LK4A 1JBUH 1AB9B 4LZ4B 4GHTA 1VCWA 1EPTA 2G81E 3OYPA 2P3FH 5HMAA 3A85A 2J38A 3ATLA 2ZP0H 3KIDU 3T26A 2VU8E 1UTOA 1BIOA 4I8JA 5T6FA 2JKHA 1GCTC 1A7SA 1IQLA 4K1SA 3BSQA 4FOUC 5EPYA 4E7NA 1YPGH 3NPSA 1QNJA 1O5CB 2O8MA 1F2SE 1A1RA 1NM6A 3UOPA 1C2DA 1Y5UT 4RKOB 1OHHD 1AUTC 2PGBB 3BIUH 1AD8H 2A4RA 2UWOA 3H09A 3L6PA 4ABIA 1S81A 5E0JA 3RP2A 1P3EA 1V2MT 3OSYA 1P8VC 5F8ZA 5GXPA 1DM4B 4B2BA 1EAIA 1UTJA 2BVRH 2M2AA 1MH0A 2OC0A 5LGOA 3GDVA 3U69H 3UPEA 2PTNA 3SHCH 3EAJA 1EAUA 1AE5A 1HPGA 2BXTH 3WY8A 1NY22 5IK2D 1C1VH 2BD4A 5GJ4B 5A09A 4Y7AA 4B2CA 2BY7X 2H9HA 3S7KB 1Y3VA 2Z9LA 1BMFD 2W3IA 1TGNA 4FVDA 3SV7A 1G3BA 1FX0B 2FESH 1TAWA 4XD7D 3ZZ5A 1TALA 3DCLA 4IS5A 2ZHFH 1F5LA 8KME2 2FX6A 1YLCA 1AFQB 2F43B 3TNTA 4YO9A 3DFLA 2P3TB 1HAZB 4YESB 1GMCG 1O37A 1MZDA 3VB4A 1B0EA 2P95A 1ELVA 2VGCC 5E0HA 1EP6A 2FI4E 3NKKA 1MU6B 4NFFA 5TCAA 3IITA 1FPCH 2ZGBH 2QV1A 2F91A 3FAOA 1ZTLA 4CHAB 1ZMJA 1ANEA 1F0TA 3A7VA 2JIZD 5L2YH 5T6DA 2GCHF 2BM2A 1P11E 2BD8A 3GY3A 3LONA 1C1WH 5K7RA 1ZHPA 1GL0E 1RRKA 4NIWA 5EIYA 3FFGA 1O5EH 4F48B 2C8XB 1XXDA 2JJ1D 1ELCA 2WPKS 3NZIA 4CRBA 3NUMA 3RU4E 2B9LA 4ZXXH 4JK5A 3ZZ7A 1GHZA 1EASA 5A0AE 1D9IA 2JETB 5FPTA 1GI9B 2ZG0H 1AFQC 3AK5A 1FY5A 5C5OA 1GCTB 4DY7B 1W7GH 2UWPA 2YMSD 4UFFH 1DSUA 1WQVH 2IJOB 1MD7A 2BOHB 2FOMB 1M9UA 8LPRA 2IN2A 2CF9H 1HXFH 7GCHF 3NRLA 2THFB 3ZZ3A 4XBBA 2BY8X 3VB7A 2DE9A 4ABHA 1AY6H 3A83A 4ZXYH 1O3FA 2O8LA 3ODFA 2PSYA 4JCNA 1GMHG 3S7HB 1ZZZA 1TPPA 1LHGH 2ZGCA 3QWCH 1HAVA 1SGYE 3DD2H 3RC4A 2RG3A 1PFXC 2B0FA 2ZDNA 3TGKE 1O2YA 3CS0A 2CN0H 2J98A 1AN1E 3B8JA 3DSPA 1LPZB 3QUMP 2R3YA 2VGCB 4MTBA 5G4BA 4WMFA 1TNIA 2AERH 5DKMA 3K9XB 1LMWB 1YYY1 3PB1E 4RKJB 1PPGE 5PTPA 2HLDD 1Z1JA 3E3TA 2OCVB 1C5OH 2P59A 1P12E 2ZU2A 2ZI2H 3SJ8A 1Z8GA 3SGBE 1BHXF 1RS0A 1TRYA 2LNCA 3TJVA 1XUGA 5EODA 1L0ZA 4FUBA 4OS2A 4ABEA 2YNBA 2AH4X 5ETXA 1OWIA 1Y3YA 5EU8A 4DOQA 2JETC 2SGDE 5EOKA 2XBYA 1QL9A 1ZPZA 2QY0B 3SJIA 4OS6A 1SGRE 3GCHC 1KXBA 3TU7H 2V0BA 3BTDE 2G00A 3R0FA 2FOHA 3RXBA 1BCUH 2BHGA 1HXEH 5GDSH 1YCPH 1KMHB 1KTTB 1TGCA 3EQ0H 1ZMLA 1Z8JB 2RFKC 1O3JA 4OS4A 5FL7D 2V3MA 2G5VA 2XWBI 1GMHF 4O97A 2ZFQH 1B7XB 3MU5A 1GJCB 1OP2A 3SGAE 1GMCF 1E38B 1FN8A 2ZHEH 5TCCA 2Z94A 3BTTE 1D6RA 1IQJA 1L2EA 5C20A 1G37A 1ZYOA 1HNEE 1Y5AT 3LJOA 1N8OB 1L4ZA 2ZQ2A 1QRXA 3C27B 1HJAB 1W7XH 5CHAC 4AFZA 4YM9A 5K0HA 4ASUD 1FJSA 1P2OA 1ZGIA 2NU3E 2WPMS 3ZZ9A 1T8OA 2ZNKH 4A5TS 2XCNA 2Y80A 1SG8B 1RGQA 1G2MA 1J17T 2RDLA 1PQAA 4SGBE 1ANDA 1P2NA 3HKJB 4FU7A 1S83A 2BD7A 4RSPA 3ATWA 3UIRA 2A5IA 5EJ1A 1NC6A 3FKSD 3ZVDA 3SZNA 2ZGJA 1ZHMA 2ZECA 1EJMA 4Q7YA 1VR1H 1VITF 1O3PB 1XUIA 3FOAA 4GPGA 1FQ3A 3LT3A 1GBKA 2BVSH 3AVZA 1FIZA 4X8TH 1DLEA 1O3NA 1LHFH 1TBQH 3E0PB 3SU5A 1GBCA 2OLGA 5C3NA 1QJ7B 2CJIA 2F4LA 1K1JA 2XXLA 1NT1A 2GD4B 3QK1A 1GWAA 1MZAA 3SOSA 2KCYA 1O2ZA 1GI4A 2BD3A 4D8NA 3TGJE 3A87A 4A92A 3M3SA 3SU1A 1Y8TA 1AE8H 2OUAA 1KXFA 2ZFSA 2ZGHA 1W3CA 3ZZ4A 4MNVA 1NFYA 4FVBA 1O2TA 4TY6A 4X2YA 2PR3A 1HJ9A 1O2RA 2ANYA 2XYAA 4CRAA 1T7CA 1WYKA 3GCTG 5T3HA 2A4GA 1O3CA 1SL3A 1BRBE 4DIHH 2XTTB 1MUEB 4ACAA 2ZDAH 1HJAC 3OX7U 4MDSA 2VH6A 1UVUH 4Y8YA 3E6PH 4ISNA 4FUFA 5FPYA 5A2MH 2OD3B 4GSOA 4MPVA 2OC1A 1IQKA 1MTWA 3MNSA 1GGDB 4E06H 2ZGXH 1NU9A 3ZV9A 5ESBA 2P8OC 2TIOA 2P3UB 3LGIA 2W7SA 1F7ZA 4OS1A 1C4V2 2ZQ1A 4ZHMU 1YM0A 3GOVB 1CBWC 1FAXA 2UUFB 1XUFA 3UOUA 4YZUA 3UQOA 2EY4C 1XVMA 1EX3A 1BITA 2A7HA 5L6NH 3UNRA 2PKAA 3A80A 1D3QB 1IHSH 5DO4H 2ALVA 1O5DH 2UWLA 1V2QT 3KQEA 2XNDD 5EXNA 2JDID 4CRCA 2C8YB 1SSXA 3U8OH 3OY5U 5A8ZA 2AGGX 2XC5A 2SGEE 3B23B 4FUGA 3ZYDA 5FCRA 3ZIAD 4K1EA 4ABGA 1F0UA 1NRQH 1PYTC 3EA8A 1TNJA 1GCDA 4YOJA 3LJJA 5HIYA 5HYOA 3P8FA 2BDBA 3M36A 1S85A 1YPEH 1NZQH 2B5TB 1P9SA 4DW2U 2SFAA 1W13U 2BB4A 1SGDE 2QE7D 1HAVB 3BTWE 3KQ5A 1P01A 4K5ZA 1MTVA 3TJUA 2FS9A 2TBSA 2WV5A 1D4PB 2FOEA 1AI8H 2SNVA 2BDCA 2EA3A 1W2KH 3SORA 3MU8A 1TRMA 2TGDA 4HTCH 5CDFE 1P02A 4BTIB 1HAIH 2QAAA 4ZAEA 2YOLA 1OYTH 4ESTE 1SB1H 3RXEA 3ZVGA 2W6JD 2ZPRA 2WZQA 3A89A 2WUCA 5JBCS 3NXPA 1TX6A 1A4WH 1BMMH 3KNXA 1MKXH 3ZZ6A 1ELAA 1J8AA 4RT1A 2PSXA 3E16B 1FY3A 4XOJA 3GYMA 2RCEA 1QBVH 1QBNA 3UB0A 1C2HA 1V2PT 5FHTA 2Y5HA 5JBTA 5B6OA 2ESTE 1TNHA 1FNIA 1SQRA 2Y82A 5DP8A 5LH8A 1QL8A 3F9HA 3R3GB 1XVOA 3F3BA 2GV6A 1TABE 2VBCA 2TGTA 4Y6DA 5BPEA 2WV9A 4J2YB 2PV9B 1C1RA 3PO1B 4CBNA 1E1RD 2AIPA 1KLJH 3QZQA 2ODPA 4UFDH 2PWXA 3LDXH 4YTAA 3VG8A 2F9UA 1K0HA 2FM2A 3S9AA 2GKVE 1ZJDA 1AB9C 4Y8ZA 5AFYH 2XC0A 1K28D 5DP6A 4B6EA 4WVPE 1F5KU 1PPFE 5C1YA 3VGCB 1ANBA 4B73A 1GI3A 4D9RA 1ARCA 3PMBB 2Z9JA 2VVVA 4IGDA 1DVAH 2R0LA 2C90B 1UVPA 1INCA 4H6TA 3SU6A 2GDEH 1LHEH 3RU4D 1TMBH 2RA0A 1F0RA 1Z71A 3ZVBA 1QL7A 3U28C 1O3AA 2VWMA 2OXSA 1KLTA 2OK5A 1G2LA 1K1NA 4DT7B 1SQTA 3TH4H 2FODA 3ZVAA 1H9LB 2A2QH 2GGVB 2FOCA 3P8OA 2Q6DA 4HG6A 4DIIH 1WU1A 2ZKSA 2XW9A 5F8TA 4O9VA 1C1NA 5A8YA 2CV3A 3TVJB 3ZZ8A 1W12U 3BTFE 3PM3A 1WUNH 1L1NA 1K1LA 3TPIZ 2R0KA 2RA3A 1GBJA 3GYLB 4CH8B 2BDAA 1ESTA 2HNTE 1A5HA 1MTNC 6GCHG 1ELDE 1TMTH 1XKAC 3RMNH 5L2ZH 3A8DA 2Z9GA 2KAIA 1GJ6A 1O0DH 1UW7A 2W3KA 5LPEA 1DY9A 1GHVH 3GICB 2Z7FE 3OEHD 4OGXA 3RUOA 3WWBA 3TNSA 2OP9A 1V2WT 1ZLRA 1ZGVA 4KP0A 1A5GH 2WYGA 4Y0ZE 1LQEA 1AQ7A 2ZC9H 1MCTA 4TT3D 4KGAA 1UVTH 4O03A 2FO9A 4I32A 3SI3H 4CRFA 5EXLA 2ZTXA 1D6WA 5GNDA 3UREA 4I8GA 1HAHH 1S6FA 3Q3XA 1ABIH 1FN6A 1GMDG 1LKBA 3MH6A 4Y8XA 1MTNB 2BQ7B 3DFJA 3F0OA 5FBIA 3V0XA 2BLQA 1E34B 1TNGA 3H5CB 4H6SB 4MPWA 1PYTD 4ABFA 5GWZA 3M7QA 2GT8A 4X2VA 1P2JA 2F9BH 4Y10E 2HNTC 1NN6A 3MQKC 2PTCE 4NIYA 1O32A 4K8YA 1GJ8B 4FXGH 5T1VA 4WJG2 3LC5A 2A7JA 2ZCHP 2ALPA 2VINA 2BQWB 4ZHAA 3TH2H 2AHME 2P94A 1E35B 1NFWA 2A32A 4FU8A 4DJZB 2VIDA 2A4OA 1PJPA 2BYAX 1DXWA 4ISIH 1GI8B 1HBTH 4ISHH 1ZSJA 5SGAE 3SUGA 2AGIX 2K1QA 4Q7ZA 1KIGH 3RXPA 1RXPA 4NG9H 4KKDA 4UFGH 3PWBA 4TYDA 1QJ6B 1Z8RA 1VKYA 1TPAE 1FDPA 1EQ9A 2WPDD 4FUEA 1ETSH 2BZ6H 3KGPA 2YNAA 4ABJA 1FLEE 1QB1A 4MNXA 2O8UA 4INKA 1DUEA 3K2UA 4K3JA 1P0SH 5E8EH 4WY3A 5J4QA 1OWJA 2ZZUH 3S9CA 1JXPA 1GI5A 1XX9A 3SHAH 1V6DA 2QF5A 2F83A 2G4UA 5JBBS 3ZZCA 1V2LT 5EGMA 1BMAA 1P2QA 1ELTA 1OS8A 3ENSB 3MHWU 1EB2A 3SU2A 3AW0A 1NRRH 2FZZA 1HCGA 2KCAA 2J95A 5E2PA 1TX7A 2OC8A 3BEUA 3HGPA 3KL6A 1SKYE 4Q4LA 1G9IE 1YPKH 3A84A 3KYFA 3PMJA 3PYHA 3VB3A 2ZIQH 2ANMH 3LH3A 3RXSA 4Y7BA 1DX5M 2ASUB 4INHA 4Y79A 2VWNA 1EUFA 1GBEA 5EJZA 1TOCB 1T8NA 2D2DA 2TGPZ 3BG4B 1P05A 3S9BA 1HAPH 3OE7D 3GY2A 1MCVA 3D49H 1Q31A 4A1XA 3P8GA 1EATA 2GCTC 1IQGA 1C9TA 1JIRA 4UE7H 3Q3KA 2AS9A 3LC3A 3SNEA 1O2PA 2SGPE 2ZDLA 4ZH8A 3D65E 1BTPA 1YPMH 1NPMA 3DHKH 2HOBA 3TGIE 2WINI 3T27A 5EQRA 4X1NU 1BQYA 4AG1A 3RMLH 1SOTA 4KELA 1CT4E 1C4U2 2HVXA 1C5QA 5HM2A 2GMTB 1C1TA 2R3UA 1O2IA 1QB9A 1MABB 1ZRBA 1TGBA 1O2HA 2K0QA 1O3IA 3PLPA 1BT7A 1TBZH 2FX4A 3TITA 1OSSA 3BTQE 4AOQA 4NIXA 4THNH 3L3TA 2V3HH 1IOEA 3SUDA 1W10U 4FU9A 1LO6A 5A8XA 1OXGA 3MH4A 1OWHA 1TRNA 1V2NT 4GHQA 1UMAH 1SFQB 1GI0A 3UR9A 4DT4A 4P02A 3BEIB 3SW2B 1Z6EA 5AVDA 4ASHA 2OBOA 3Q77A 1SGFA 2HVYB 4I33A 3VPKA 5JPMH 2FYQA 4DURA 1GHXH 2ZU3A 2TGAA 1DXPA 2PW8H 2HRVA 1V3XA 4YOGA 1GBFA 2HALA 3A7WA 1MAXA 1EZUC 2LPRA 1C5ZB 1GJ5H 4X6PA 1SMFE 5B6LA 2F3CE 2A2XH 2O9QA 4A1TA 2PUQH 2GT7A 5FX5A 2GJGA 1EKBB 1H9IE 1FMGA 4JZFH 1GI2A 1S5SA 2A7CA 1TA6A 3RM0H 1CGHA 4B76A 1UVSH 3U98H 1T32A 1BBRK 1SPJA 3CENA 1IHTH 1DANH 1H4WA 4JK6A 3N7OA 1LQDB 4XBCA 2XWAA 1QB6A 1MMJN 4TPYA 3RXOA 2NU0E 2VNTA 1BBRH 1PQ8A 1LTOA 3M35A 3V12A 2ZFRH 1AUJA 1IQIA 2H9EH 1QY6A 2FOFA 3P8NA 1SQAA 3LGVA 1AVXA 1GVZA 4TPIZ 3T5FH 1C2GA 1AVGH 1S6HA 1KXDA 1VGCC 1WV7H 1E1QD 1FPHH 1W0YH 2GP9B 3IG6B 1A0JA 3PTNA 4KTUA 3ZV8A 2NU2E 3RXLA 3GS9A 3KQDA 3K6ZA 4NA8A 4NFEA 2ZCLP 4D9QA 5F6MA 2I6SA 6LPRA 2QYIA 4Z1MD 2JJ2D 3GCOA 1ZRKA 3BIVH 4ZKNU 1LPGB 1SLUB 3FN8A 4KTSA 4U32A 1C5SA 1GDUA 1O2VA 2C4FH 5FAHA 2CHAB 1TLDA 1S0QA 4A1VA 4JYUH 1O2NA 4BAKB 1O38A 2ZA5A 1WOFA 4AFUA 4YXWD 1ETRH 3GDUA 3Q00A 2KZ4A 4X6OA 1P2IA 2GVFA 2ZHDA 4JYTA 4HI3A 3EA9A 3IWMA 1SGCA 4Y0YE 2G51A 1QR3E 5JDUB 1T8LA 1V2RT 1AKSA 2PHBA 1GJ7B 1O36A 1L1GA 3Q3YA 4WMDA 1RTKA 3F9GA 4B1TA 4NGAH 2A4QA 1XUHA 3FP8E 1YWUA 1C5UA 2BLOA 1GDQA 3SNDA 2QF4A 3EE7A 4VGCC 2WYJA 4I86A 3O8DA 1EAWA 1BBRE 1TQ7B 1YY3A 2Y81A 2PKSB 4RI0A 3MFJA 3BTME 1WTHD 1THSH 1QRWA 2KFWA 4BTTB 1GJAB 2G4TA 1UTNA 1UTQA 2PP6A 1LPKB 1O2WA 1GL1A 4A6LA 1SLVB 3U1IB 2Z3EA 1GG6C 5L30H 5LPFA 1WSSH 3BG4C 2J92A 2QXJA 1DITH 3CP7A 2G8TA 1DE7H 2G52A 1QHRB 3KEEA 1UVOA 4OS7A 3M5MA 2GZ8A 1W11U 2FS8A 1OYQA 2FLRH 4AC9A 4FUHA 2EC9H 4UFEH 3HKIB 2XBXA 4Q80A 3SUEA 3UR6A 3ZYEA 1O3OA 2VIOA 1NU7B 3MO6A 1Y3WA 1EAXA 3A7TA 1FY8E 1CHGA 2M5TA 2BY6X 1VJ9U 1TA2A 5HM9A 1TBRH 3SBKA 4NA7A 3A88A 4DVAU 2V6NA 4YLQH 2STBE 3TLOA 2FDAA 1LVOA 1GJDB 2KCOA 3V7TA 2FP7B 5DP3A 5KECA 2V7QD 5CHBA 3AW1A 1WBGB 2GZ9A 2PFEA 3QX5H 4Q2KA 2ZDMA 3GY4A 8ESTE 1MQ5A 1CT2E 1L1JA 2B7DH 3SO3A 3A7YA 3SV6A 2A5KA 4AFQA 5CHAB 2QIQA 4A7IB 1LHDH 1K21H 2A31A 3UUZA 3PROA 7KMEH
chains in the Genus database with same CATH topology
5GIBA 1C1SA 1BTHH 3SU4A 1HGTH 1FY1A 3A7ZA 1LVYA 5GCHG 2BD9A 4X1SU 3C1KA 4YT7H 4BAHB 3ATIA 1UCYH 3TJOA 1AVWA 4Z6AH 3Q76A 3HPTB 2PKAB 1O2XA 1F5RA 5HXFA 2AYWA 1A0HB 3PLBA 3HATH 4GCHF 4I8HA 1HAGE 3E91A 1QFKH 2J9NA 5F8XA 5A0BA 3P95A 1TONA 3RXRA 2CMYA 3T62A 2DE8A 5ESTE 3UWJH 3RU4T 3RXHA 3A8CA 3ZVFA 1P3CA 4MNYA 1G3DA 3SQHE 3FZZA 1T4VH 1HV7A 4H42U 1YP9A 1NESE 2Y7XA 1CU1A 1VCQA 4IW4E 2OC7A 1C1MA 1S0RA 1YCPK 1YBWA 1D3TB 5EQQA 1ZPBA 3RXVA 1SFIA 7ESTE 1J16A 3E8LA 2Y7ZA 1O2QA 5AFZH 4OGYA 1XM1A 1EOLA 4AGJA 4X1QU 2VWLA 4MLFB 4UD9H 2BQ6B 3A82A 3RXQA 1N1LA 1UK3A 1O2MA 3G01A 3FP6E 2ZTYA 1ACBE 1Z6JH 5E2OA 1GVKB 1MKXK 3BEFB 2BX4A 5HGGA 5EW2H 1RIWC 3H7OA 2UUYA 1CSOE 1YC0A 1YGCH 2OTVA 3O8CA 2VJ1A 1TPOA 1O2KA 2EEKA 3D23A 5I25A 1VJAU 3O8BA 4AX9H 3ZZDA 4TWWA 5EQSA 2VVUA 3LGTA 1P57B 2J4IA 1O3GA 1VITH 1V2KT 1EP5A 2BLWA 1QURH 1FONA 1OKXA 1BRAA 3DUXH 1UTLM 2VB0A 3LU9B 3MO9A 4NA9H 1EPTC 1C9PA 5FX6A 1BMLA 1TGSZ 2CGAA 4AORA 2H5CA 3MNCA 1IAUA 1U6QA 4JMYA 4YT6H 6ESTA 2VIVA 1MQ6A 2V35A 3SUFA 2EI7A 3U9AH 2W5EA 1SBWA 2TPIZ 4VGCB 3VB6A 3ZVEA 2BTCE 1PPCE 5FPSA 3TK9A 5DPAA 3MU1A 3E90B 1IQHA 2F9VA 1GJ4H 4NSYA 3T28A 1CGJE 1TPSA 2ZDKA 2Y5GA 4GUXA 2HWLB 3P6ZB 1PPBH 4TWYA 3PMAB 1WAYB 3PO1C 3M7UA 1AZZA 2QN5T 4IN2A 1RIWB 4CR9A 3BV9B 2NWNA 1GBDA 1FY4A 3MH7A 4B75A 1OWKA 1ZSKA 4Y76A 1O2SA 2D1JA 3RXCA 2B8OH 2Z3CA 1ZTJA 1N6XA 1ZPCA 1GMDF 5A0CA 4NZQA 2ZEBA 2AEIH 2ZF0H 1CT0E 2CF8H 2VIWA 1C1OA 3F1SB 4ZROA 5EG4A 2ZDVH 1HAXB 4UEHH 3DT0H 3H7TA 3MO3A 3SI4H 3A8AA 2Z9IA 3UNSA 1CVWH 1ELBA 4K60A 2BOKA 1O33A 1GBHA 1KLIH 1V2ST 1YLDA 1DSTA 3M3VA 1YKTA 5T6GA 3SV9A 3AAVA 2VWOA 1HB0B 1UK4A 4XSKU 3A7XA 2O8TA 3T29A 3PLKA 3PMHB 2QGRA 1JIMA 1XXFA 5DP5A 1AZ8A 2P93A 3M3TA 4H4FA 4Q7XA 1DPOA 3A81A 1PPHE 1A5IA 4AGKA 1XKBC 3GCTF 1DWBH 1SGIB 1C1UH 1TX8A 1TFXA 2P8OB 4AB8A 1NTPA 3E1XB 2Q6GA 1TYNA 2F9NA 1X7AC 1S84A 4E05H 2BDHA 1C5TA 1SHHB 2QA9E 1W0ZU 1ZR0A 1P10A 1KDQA 4MNWA 4X8VH 3NK8A 3M7TA 4ZMAH 4LXBH 1C5MD 5CMXH 3T2NA 1QQ4A 6GCHF 1MAYA 3SJKA 5BRRE 2C8ZB 1TGTA 2A1DB 1DUAA 1TOMH 2P16A 4BTUB 1F0SA 4XBDA 3RXGA 1DWCH 1HIAA 2J94A 3MNXA 3RC6A 5JB9S 1DS2E 4IMQA 4U2WA 5DP4A 5JB8S 1GHYH 4I8KA 1UTPA 1AO5A 1QBOA 3P17H 1C4Y2 3BTEE 1TIOA 1BTWA 3AAUA 2F9OA 2XNIA 1P2KA 1P06A 1RTFB 1HRTH 2IPHA 3ATMA 4CRGA 1O3LA 1ARBA 2SGQE 7GCHG 1TNKA 4JYVH 1BHXB 2W7UA 4X6NA 1K9OE 1EB1H 2Z3DA 1OWDA 3EGKH 1O30A 2ZU5A 2AIQA 5JBAS 3RXJA 1OX1A 1HFDA 4NZLA 1SVPA 3FVFB 2QF0A 3GY5A 2BDGA 4GAWA 1GHBG 3W94A 1G36A 3RMMH 4BAOB 1AWHB 1TB6H 3QZRA 2BX3A 1WQSA 1V2UT 3SNBA 2Z9KA 1BTXA 3A86A 4BANB 8GCHF 4D7FA 1YCPM 1ORFA 1PPEE 4XDEA 1MKWK 4ZUHA 4GLYA 2XRCA 2ZFPH 1O35A 3SN8A 1O5GH 3QTOH 2ZPSA 4FUDA 1N6YA 2WPHS 1IQFA 3TIUA 5IDKA 4WWYA 5AHGH 1PQ7A 3MYWA 1KXAA 2WPIS 3GCHB 3FP7E 2BXUH 4LOYH 2G55A 1ID5H 1MBMA 2GCTB 1JRTA 3K65B 1C5XB 1E36B 3PWCA 1GJBB 1Y5BT 1YPHC 4AZ2B 2BY9X 2ZU4A 2PUXB 4MVNA 4BAMB 1K1MA 1V2JT 1JOUB 5E0GA 3MTYA 4HGCA 4WXVA 1P04A 3LH1A 3L33A 1CGIE 3HK3B 1C5WB 2Y5FA 1O5BB 2FIRH 2OQUA 1ZMNA 3MI4A 3QN7A 3BTGE 3TJNA 1GG6B 1K1IA 2HNTF 4X0WU 3EYDA 1EJAA 3KF2A 4AB9A 1AKSB 1ZOMA 1XUJA 1HLTH 2R9PA 3QLPH 4X2XA 2WPLS 2NU4E 3URDA 5DGJA 4FUCA 1ANCA 1YF4A 1D3PB 2H2ZA 2FI3E 3LGYA 1HIAB 3RXMA 3TK5A 1OOKB 4B2AA 3URCA 2FOGA 4D76A 1TMUH 1O3KA 4WH6A 1ETTH 5AF9H 4ABAA 1UHBA 1ZHRA 3ZZBA 1LVBA 1BA8B 4BXSA 1PQ5A 4X6MA 3UY9A 1UTMA 4YOIA 1J15A 4MQAA 2AFQB 4U01A 5CE1A 1LDTT 2WV4A 1B0FA 1NO9H 3EE0B 3QO6A 4U30A 3SNAA 1CBWB 1ESBA 1DWDH 1SGQE 4MPUA 2GTBA 1KXEA 2BDIA 2VIPA 1SOZA 2FI5E 1LHCH 4B74A 1QIXB 1QTFA 1E37B 4UONA 2A0QB 4QT8C 1H1BA 1BRUP 2DUCA 1QJ1B 1O2OA 4F4OC 1G32B 3I77A 4Y11E 3RXFA 3V13A 2WPJS 1BDAA 2VIQA 5DJ7A 4MG3A 4B71A 3K6YA 4I31A 1GVLA 1GJ9B 4CR5A 1SR5C 6CHAB 2GDDA 1O31A 3M37A 2J34A 2OINA 4NWKA 1K1OA 2BDYA 1CQQA 3UTUH 4XFQA 3LGWA 1JRSA 1TQ0B 2FLBH 5DP9A 1NRNH 1SGEE 3M5LA 4JZIA 2VVCA 1BMNH 2QCYA 1DDJA 3BTHE 3KHVA 1RTLA 3QDZB 3S0NA 1H8DH 3STIA 5C5NA 1W8BH 3MWIU 3I29A 1O2LA 1UCYK 4E7RG 4GVUA 3MOCA 1FZZA 1TWXB 2ZU1A 5DP7A 3HK6B 5C1UA 1KTSB 3KCGH 3UFAA 1CHOF 3ZZAA 3MU0A 4O3UA 1OWEA 1BJUA 1EZQA 3SJOA 1XMNB 5C67A 1O34A 2HPQH 1BUIA 1WTGH 1THPB 1GBBA 4YLUA 2EI6A 2FEQH 2SGAA 2GV7A 4BNRA 1MKWH 1HUTH 1VZQH 2R2MB 2ZFFH 1C1PA 1O2JA 4NIVA 4JZDH 4X1RU 1T31A 4GCHG 1QQUA 3KN2A 1T8MA 2ZFTA 4K1TA 4ZKOU 2FTLE 1GI1A 2Y6TA 1THRH 3UQVA 2JH5D 1C5LH 1UTKA 3SV2H 1CA0B 4ABBA 3QTVH 2STAE 4DCDA 1T4UH 8GCHG 4O3TA 5DK1A 2Z6BD 1LCYA 2TRMA 1Q3XA 3GY6A 1K1PA 3CS7A 3P70B 4Z0KA 1NRSH 2ULLA 4WH8A 1O3DA 1BB0B 3E0NB 4JZ1A 3U1JB 1S82A 2JH6D 1UCYE 4DG4A 4JZEH 2UUKB 1XUKA 2C3SA 1O2UA 1SGNE 1QRZA 1C2KA 3TH3H 1QA0A 3RDZA 5IYTA 2ANKH 2F9PA 3ITIA 2ZTZA 1C2JA 1QCPA 3EDXB 7LPRA 1VGCB 1YPHE 6CHAC 1KXCA 4CREA 1CA0C 1DFPA 2FOBA 1FV9A 2C93B 3OU0A 4R0IA 1GHBF 1O3EA 1GBIA 1ZSLA 3D62A 2GX4A 2D8WA 2JH0D 2ANWA 1CO7E 4HZHA 1MTUA 1TE0A 2ODQA 3F68H 2UUJB 4AG2A 1A3BH 1GBTA 1N8OC 2ZPQA 2OQ5A 3MH5A 4I7YH 5C1XA 2PKSC 5I46H 3VB5A 3W95A 2SNWA 1H9HE 1ELGA 2PGQB 1MTSA 1AGJA 1GI7B 4IC5A 4BAQB 4IN1A 1QGFA 3JZ2B 1O3HA 2XC4A 3V3MA 1O2GH 2QXIA 4NWLA 4WXIA 3UWIA 4X8UH 5GCHF 4X8SH 1BRCE 1O5AB 3SJ9A 3I78A 3RLWH 2KAIB 1YPJH 2FTMA 4ISOA 4FUIA 5JYIA 1IQEA 1YPLH 2V3OH 1HYLA 4INLA 2NU1E 1LKAA 4XE4A 4PROA 1SGTA 2FPZA 1C1QA 1CA8B 2FOAA 5EPNA 1P03A 3SGQE 2H1UA 2BMGB 1FXYA 3PV4A 1GBLA 1O3MA 3RLYH 2FMJA 3LIWA 1GGDC 3VFEA 4K8BA 3BF6H 3MMGA 4WMEA 4ZHLU 3LGUA 2ZWLH 1UO6A 1C2LA 9LPRA 4M7GA 4SGAE 1ZTKA 1SGPE 1PPZA 1MD8A 3F9FA 1Q2WA 3LOXA 2HGTH 1Z1IA 1SHYA 2BZAA 1EZXC 1NFXA 3P92A 3M61U 1NFUA 3NCLA 1FAKH 1O3BA 4KTCA 2WUBA 1Y59T 1C2EA 5TJXA 3RXAA 1C5PA 3ATKA 1ELEE 2H9TH 3BN9A 5EXMA 1A0LA 4CBOA 1KDQB 1UJ1A 4K2YA 1GBMA 2QXGA 2C8WB 1L4DA 3RM2H 1P2MA 2AMQA 1VITG 2Q1JA 4BOHA 3T25A 1O5FH 4IBLH 1V2OT 3VGCC 1HAYB 1SGFG 1F92A 1GDNA 1OPHB 2EI8A 4CH2B 1C2IA 4AYYB 3SV8A 3SNCA 1DT2A 2ODYB 3GY7A 1CE5A 1C5RA 1KYNA 1C5YB 1H8IH 3QGNB 1KY9A 1AMHA 5FCKA 4WF8A 3FANA 3U8TH 4MPXA 1UHBB 3EA7A 1G3EA 1EZSC 2BY5X 4X2WA 5ABWA 3PTBA 2GZ7A 2I6QA 5FBEA 3RXDA 1BOQA 1RFNA 4BXWA 1EOJA 9ESTA 2PLXA 4J1YA 2ZHQH 1A3EH 2ZHWH 1ZJKA 3F6UH 3ZVCA 3HGNA 3VEQB 1P9UA 2Q6FA 1GBAA 2H5DA 3LKWA 5J4SA 3KQCA 2D26C 3SU0A 3JZ1B 1DICA 1HAOH 1EJNA 4HFPB 2O8WA 2BLVA 1K22H 3MU4A 5GPIB 4F49A 1RJXB 1A46H 1TNLA 3RMOH 2R2WU 4AFSA 3F9EA 1GHWH 1Y3XA 3RXUA 3SQEE 1V2TT 3GISB 2ZO3H 3GY8A 4IC6A 4UDWH 1GHAF 1C5NH 5F03A 4ZKSU 1K2I1 1GI6A 1C2FA 3GCNA 3O8RA 4ABDA 1J9CH 1GPZA 4X1PU 2XBWA 3RXIA 1E0FD 4OS5A 3ESTA 2BVXH 3TK6A 3VXFH 1EPTB 2AGEX 1V2VT 1OP0A 5LPRA 2GMTC 4DGJA 2SGFE 4I8LA 1DY8A 3RXTA 1MBQA 4FUJA 1AU8A 1Y3UA 2A5AA 1KSNA 1SC8U 1AWFH 1BTUA 2BD5A 1C2MA 2W26A 4TY7A 3FZDA 4AN7A 4CRDA 1IQMA 4Y71A 1NROH 1FIWA 1NS3A 2QXHA 1OP8A 1DWEH 3NWUA 1HDTH 1D3DB 3S69A 1WCZA 3RXKA 2FWWA 4ZKRU 5DG6A 1B5GH 3BTKE 2ILNA 3VXEH 4IMZA 2FYRA 3QGJA 1AHTH 4NSVA 3OY6U 1MU8B 2BD2A 1NRPH 1AFEH 3ODDA 4NCYA 3MNBA 1Z7KA 3OTJE 2HLCA 5H4IB 1DOJA 5EW1H 1IQNA 4ISLA 1P09A 1EXFA 2AMPA 1FI8A 2ZCKP 1VCPA 3KQBA 1G3CA 1W14U 1BTYA 3RC5A 2J2UA 3M5OA 3A8BA 4D7GA 1A2CH 2IOTA 4R8TB 1O39A 3UNQA 4LZ1H 3ELAH 1BJVA 2A45B 3SU3A 1HJ8A 1SI5H 3LPRA 3B9FH 2XBVA 4K69A 5FXLA 1CHOG 3BG8A 1QA7A 1J14A 2CHAC 2QF3A 2GCHG 2VH0A 3M5NA 1ABJH 1DLKB 1UK2A 2XCFA 1A61H 1ELFA 1JWTA 2AMDA 2HPPH 1C5VA 1RD3B 2H6MA 1JMOH 3U8RH 1ESAA 3AASA 1SLWB 4AYVB 1BZXE 1LVMA 2CXVA 1FUJA 1SLXB 2OBQA 3DA9B 2FXRA 2G5NA 1AIXH 1SQOA 4CHAC 1GHAG 4RN6A 3GDSA 1BTZA 1G30B 1Z8IB 5C2ZA 2QC2A 3STJA 4LK4A 1JBUH 1AB9B 4LZ4B 4GHTA 1VCWA 1EPTA 2G81E 3OYPA 2P3FH 5HMAA 3A85A 2J38A 3ATLA 2ZP0H 3KIDU 3T26A 2VU8E 1UTOA 1BIOA 4I8JA 5T6FA 2JKHA 1GCTC 1A7SA 1IQLA 4K1SA 3BSQA 5EPYA 4E7NA 1YPGH 3NPSA 1QNJA 1O5CB 2O8MA 1F2SE 1A1RA 1NM6A 3UOPA 1C2DA 1Y5UT 4RKOB 1AUTC 2PGBB 3BIUH 1AD8H 2A4RA 2UWOA 3L6PA 4ABIA 1S81A 5E0JA 3RP2A 1P3EA 1V2MT 3OSYA 1P8VC 5F8ZA 5GXPA 1DM4B 4B2BA 1EAIA 1UTJA 2BVRH 1MH0A 2OC0A 5LGOA 3GDVA 3U69H 3UPEA 2PTNA 3SHCH 3EAJA 1EAUA 1AE5A 1HPGA 2BXTH 3WY8A 1NY22 1C1VH 2BD4A 5GJ4B 5A09A 4Y7AA 4B2CA 2BY7X 2H9HA 3S7KB 1Y3VA 2Z9LA 2W3IA 1TGNA 4FVD