1TLDA

Crystal structure of bovine beta-trypsin at 1.5 angstroms resolution in a crystal form with low molecular packing density. active site geometry, ion pairs and solvent structure
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Crystal structure of bovine beta-trypsin at 1.5 A resolution in a crystal form with low molecular packing density. Active site geometry, ion pairs and solvent structure.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1989-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tldA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tldA02
1OPHB 4ABJA 4HGCA 1Y5BT 1OX1A 3STJA 1Y3VA 1A0HB 1GCTC 2ZECA 4TY6A 4A1TA 1DX5M 1HXEH 2F9VA 3PMAB 1PQ8A 3ZZ5A 2GDEH 2ZU2A 2VVVA 3TK5A 3F9HA 3SJ8A 4Z0KA 5TJXA 1A5GH 1ORFA 1C2FA 3D65E 1AD8H 2WV4A 1H9IE 4O3TA 3M61U 2RA0A 1GBDA 3M35A 1PPEE 1C1VH 1UTLM 1MKWK 1YPKH 2FDAA 3L33A 3NK8A 4KTCA 1O30A 1TRNA 2XC5A 2ANYA 4WY3A 2SGAA 1Z1IA 2GTBA 3MH5A 2OLGA 3GCOA 1NRQH 1QR3E 2EI7A 1MU8B 1BJUA 2BD5A 1ELTA 3T25A 1X7AC 5CMXH 3IITA 2FMJA 1ZRBA 3KF2A 2RCEA 1N6XA 2ALPA 1O2XA 1TPOA 2AIPA 1ABIH 4CH2B 2FTMA 4FUCA 4NFFA 1V3XA 1CHGA 2HNTE 1ARCA 2FI3E 1UVUH 4K69A 1XUIA 4Q7XA 2ZG0H 1J9CH 2FWWA 2Q6DA 3SJKA 2P94A 4O03A 1GPZA 4BAQB 2A0QB 3RXVA 1BUIA 1EX3A 2Z3CA 2CGAA 5FX6A 1W8BH 4U01A 2PKSC 1W2KH 2Q6FA 3BTFE 3URDA 3F6UH 1C5ZB 2SGEE 4JYVH 1UHBB 3TGJE 1AMHA 1TQ7B 1NU9A 1OP2A 3ZZ4A 2ZC9H 1DM4B 5E2PA 1QHRB 1DLKB 1C1UH 3KL6A 3ZVAA 1NC6A 3LPRA 5A09A 3A82A 4NIWA 1MD8A 2WUBA 1CT2E 3PTBA 4KELA 4X2XA 2VIPA 3TPIZ 1QL9A 1ZRKA 1TOMH 2HALA 1Z71A 1C5VA 1DWCH 3BG4B 1P04A 1HAYB 2W5EA 4K1EA 2A4GA 4DURA 1FXYA 5FHTA 1GJ5H 3ZVGA 1IQIA 3HK3B 5A0AE 5JDUB 4ZH8A 3FP8E 1ZSKA 1WQSA 2OP9A 1SHYA 2NU1E 1GJ7B 2FS9A 2D26C 1P09A 1KXCA 5K0HA 1N6YA 1ZSJA 4E7RG 5DP4A 2P3UB 2QAAA 5HMAA 1CGIE 1SSXA 2BXUH 2GVFA 3LC5A 3TLOA 1SC8U 2GCHG 1DY9A 4XBCA 1QIXB 4YOIA 3IWMA 4INHA 4A1VA 1RFNA 3A7TA 4KTUA 3TU7H 1G37A 4GCHF 3DD2H 5FCKA 2XCFA 3LGTA 1S0RA 1BCUH 4YO9A 2WPKS 3ZYEA 2BY6X 1EB2A 6GCHF 5EPYA 3SHAH 4SGAE 4MNWA 2QF0A 1HAOH 1UCYK 5C2ZA 2R0KA 4LOYH 1SGTA 1SGPE 2UUYA 1FDPA 1HYLA 5EQQA 3SNCA 3VB5A 1KLTA 1ELAA 1LTOA 4B2CA 2A32A 4Y7BA 5F8TA 2VGCB 4YM9A 2EA3A 1TNJA 3VFEA 1GI5A 2OQUA 5JYIA 3AW1A 7GCHF 1DE7H 1W11U 5A8ZA 3EYDA 2DE8A 1OWDA 3GDVA 3LGUA 4KP0A 3JZ2B 1LHGH 3EGKH 1JIMA 4I8HA 3GY2A 4X6NA 1LPGB 1KXAA 1O3AA 1CQQA 1CHOF 1O5GH 3BTTE 1D6WA 1V2VT 3RXBA 1E0FD 4IC6A 3P8NA 4ZXXH 2KAIB 3BTME 4GUXA 2G81E 1DICA 1MTSA 3P70B 2VIVA 4BAHB 1K1MA 1P2JA 4FVBA 2PSXA 3HGPA 3BG4C 1TNKA 2ZU1A 4Y79A 1C5QA 1F0RA 5GWZA 1OXGA 1PPGE 4ESTE 3GYMA 1NT1A 2FX6A 2AH4X 3KCGH 2W3KA 1GI3A 2ZI2H 2W7SA 3E16B 1SGRE 4A1XA 4JZ1A 2ZNKH 4FUBA 3RXJA 4XSKU 1EB1H 4AN7A 2QV1A 1BTWA 3A7YA 2CV3A 5I46H 3LGYA 4Y11E 4JK5A 1W0ZU 1BJVA 2BDHA 3Q3YA 3E90B 4JYTA 3MO3A 4MPWA 3QX5H 1EZSC 2Q6GA 1W7GH 1O34A 1SR5C 1XXFA 4YT7H 3ZZ7A 1DUAA 1QFKH 2XC4A 1K9OE 1WV7H 2GCTB 4Y8ZA 1P57B 1O3NA 1D3TB 2PKAB 2XWBI 4AZ2B 3SUFA 4I8JA 1UTKA 2QXJA 3NXPA 4TY7A 1C5TA 2BOKA 4K2YA 1GI6A 3LGIA 4TWYA 1ANBA 3SGQE 3BIUH 1ZOMA 1AI8H 5CE1A 1TPAE 2VGCC 3GY4A 3SU1A 1C9TA 1ELDE 1Y3UA 3BEFB 2R2WU 3ZZ3A 2CHAB 2BLQA 1DXPA 5A8XA 5J4QA 9LPRA 4BANB 2EI8A 4K1TA 4LK4A 2ZU3A 3BTHE 1EATA 1E35B 2G00A 2VU8E 5AF9H 2IJOB 4Y10E 2J95A 1XVOA 1YPJH 1S6HA 4TYDA 2ESTE 2WV5A 1Q2WA 4E7NA 2G4UA 3F1SB 1F0UA 1SGDE 5EOKA 3UOPA 3A85A 2W3IA 4TPIZ 1SGIB 1A7SA 2STAE 1CVWH 1AQ7A 3SW2B 4ISLA 1DITH 1HGTH 4A6LA 4MG3A 2JETB 1JWTA 2AIQA 1A3BH 1MZDA 3P8GA 1AUTC 1VITH 3LIWA 1IOEA 3GCNA 1ZTKA 2YNBA 4X1SU 2Z9GA 4AORA 3V12A 1TAWA 1FONA 2XWAA 4KTSA 1YPGH 3SJ9A 1TGBA 3SU6A 1K28D 1ELGA 1YLDA 3M3TA 3K2UA 1UVOA 2CXVA 3M3SA 1TLDA 3CS0A 4AB8A 2PTCE 1NRNH 1AKSA 3C27B 4MTBA 1PPCE 1XUJA 1C2HA 3GOVB 1L2EA 2QXIA 1FAKH 1L1NA 4B1TA 2GCTC 5L30H 1YYY1 4AGJA 4QT8C 1ZGIA 1UVSH 1S81A 2GMTB 1QL7A 4CBOA 4RKJB 3GYLB 3RM2H 1DWEH 1Y5AT 3LDXH 1TBRH 1NY22 2D1JA 5BPEA 1RJXB 1MQ5A 3ZZ6A 1D3DB 3ENSB 2OC1A 1P3CA 3RXEA 4CHAB 2J2UA 2CHAC 1AVGH 1GJ6A 1E37B 2Y5HA 3ZZDA 3TH4H 3ATKA 5DG6A 1IQJA 3TITA 1SLUB 3LONA 2GDDA 4UE7H 3TJVA 4NZLA 2K1QA 3LJOA 1W13U 1WTGH 1FUJA 1K1PA 4IS5A 3SU5A 5E2OA 1BOQA 1BRUP 2HLCA 1WOFA 1D3QB 1JMOH 1SHHB 1WSSH 1YPLH 4OS6A 4NWLA 4UONA 2HVXA 2JETC 1Z6EA 4WH6A 1O2WA 4X1RU 3VEQB 1AE8H 2HNTF 1HAXB 3RC5A 1BMMH 5E8EH 1LVBA 2C8XB 4FXGH 1O3LA 1OSSA 1F5RA 1O3EA 3V3MA 3Q76A 4KKDA 1AZ8A 2ZFRH 5EQRA 1V2QT 1LPKB 1RS0A 3BTEE 2BVSH 3A8BA 3RMLH 3VGCB 1QY6A 2HGTH 2IN2A 2P59A 2FI5E 5C5OA 3JZ1B 1V2KT 2A31A 4GCHG 1MBQA 5HM9A 1OYQA 1LQEA 2AS9A 4X2VA 4GLYA 1LHEH 2ZTXA 3ESTA 1THRH 1TRMA 1C5XB 3OY6U 1TB6H 3EA7A 4X2YA 1JOUB 3GDUA 1HV7A 1PQ5A 2FOCA 4AFZA 1JRSA 2VB0A 4YT6H 5JBTA 2VJ1A 2SGQE 3D49H 2B7DH 4H6SB 8GCHG 3U1JB 3B23B 2D8WA 3TNSA 2ZCHP 1MCTA 2GZ9A 1QA0A 3BG8A 4ABIA 2A4RA 1UTPA 3F9FA 1NROH 1UHBA 2Y5GA 2GMTC 3MNXA 7GCHG 5FPTA 2Y7XA 3T27A 4CR9A 3PO1B 2BD7A 1ETTH 4FUHA 2C90B 1QJ7B 1OWEA 1J17T 5HYOA 1K1OA 1O2TA 3LGWA 2BQ6B 3TGKE 1GVLA 4CHAC 2VH6A 2Y80A 2BLWA 3O8RA 3RU4D 2FXRA 1FN6A 1CHOG 1PJPA 2Z9LA 4OS1A 2ZWLH 3T62A 4OS2A 4IMZA 2ZFTA 1KYNA 2Z3DA 1YPHC 1SL3A 4XDEA 5ABWA 4F49A 3H5CB 4AFSA 1G3EA 1Z6JH 1O2VA 2BHGA 8LPRA 1WBGB 1GBJA 3HKJB 2SGPE 1EZUC 2H1UA 2UWPA 1BRAA 2W7UA 1ZMNA 2A5IA 2VINA 3RXTA 2ZU5A 1LQDB 1CGHA 2R9PA 1XKAC 2R3YA 1O2PA 2A2XH 2BTCE 2EEKA 3NPSA 3OU0A 3A7WA 3UNSA 2FLBH 1J14A 2ALVA 3P6ZB 3GY6A 1BTUA 1TMBH 1K1JA 1GJ9B 1T8NA 5EPNA 1O3OA 3A80A 3F68H 4ABGA 1RTFB 1C5LH 3RXPA 1S84A 4JK6A 3UNQA 3VGCC 2ZDMA 3MU8A 1NU7B 3RXSA 3NKKA 1B0EA 3MNBA 1A0LA 2ZHEH 4AG1A 1C1RA 1L4ZA 1BIOA 2VVCA 3H7OA 1H8IH 1MKXH 1NZQH 2PW8H 1PPFE 4KGAA 1A4WH 2M5TA 1BTYA 4IN2A 2AFQB 2XBXA 5EXLA 5LPRA 3SNBA 1Y8TA 1LMWB 2QC2A 1QQ4A 1V2PT 4DGJA 4A7IB 1TYNA 3AW0A 1CT4E 3E0NB 4ZHLU 2RDLA 1T32A 3SQEE 3T26A 3I78A 1YCPK 1KIGH 1NM6A 1SLVB 4WMDA 1DDJA 1QRXA 1TALA 1TIOA 3PO1C 2PFEA 2SGDE 4I8LA 4UFGH 4VGCB 2BY9X 1EUFA 1L4DA 3KGPA 3M5OA 3LH1A 2JH5D 3MO6A 4Q7YA 1B0FA 2KAIA 3GY3A 4NSVA 2G5VA 3UFAA 4LZ1H 1JXPA 2B8OH 4JYUH 1KXFA 1PYTD 1C2MA 3FFGA 2PSYA 3K9XB 4SGBE 1AIXH 4H4FA 4D7GA 3RXFA 3PWCA 4UDWH 1O2JA 4J1YA 1UO6A 1NRPH 3BEIB 2Z7FE 3P17H 1INCA 2F9NA 1HNEE 3TK6A 3SO3A 6LPRA 1UK4A 3ODFA 1SI5H 4YLUA 3C1KA 1THSH 3TIUA 3QDZB 5FPYA 1FY3A 1XM1A 2ZHDA 2F9OA 1ZPCA 1JBUH 3RXDA 3BTGE 4TPYA 2GGVB 2SFAA 2ZGCA 1GCDA 4Y0ZE 3ZZCA 2A4OA 1TGNA 4IGDA 4PROA 1AB9B 4ZMAH 4IMQA 3SU0A 3RXUA 1DY8A 2PKAA 1AY6H 2A7JA 5AFZH 2P95A 3VB4A 1BRCE 5L2ZH 5DKMA 1QBNA 4K60A 1GI4A 5FBEA 4WXIA 2J9NA 1UTQA 3RXAA 3A84A 3HKIB 3RMNH 4ZXYH 1MKWH 1MAXA 1C1SA 4MPXA 1O2ZA 4JZIA 1V2ST 2LPRA 2BVRH 2XTTB 2H5CA 2NU4E 2PHBA 1C9PA 1FIZA 2O9QA 3DFJA 3TJUA 3A88A 2WPLS 1K22H 1VR1H 1YCPM 5FBIA 4ISHH 3VXFH 4ISIH 1P2KA 3ATWA 2CJIA 1DSUA 1P3EA 3EA8A 1V2JT 1EASA 4D9RA 1GHXH 4VGCC 1ZSLA 5F8XA 1SGFG 2QF3A 3KQCA 3RLYH 1K1LA 4GAWA 5DP6A 1G2MA 2WPHS 2ZZUH 4D9QA 1DOJA 1FY1A 2V35A 4UEHH 1HJAB 1ZPBA 3U8OH 2ZHFH 2ZEBA 2TIOA 3UNRA 3U69H 2ZPQA 3RXGA 1YPMH 1N8OB 3ATIA 2FOFA 1FPCH 2ILNA 2ZO3H 1PPZA 1GL0E 2FS8A 3GDSA 1MTUA 1O2KA 2FODA 2NU0E 1C2GA 1O2GH 1XXDA 1C1MA 4GHQA 3B8JA 1S5SA 1HAPH 1FLEE 1CT0E 2EI6A 1A5HA 4FUFA 1VGCB 1C5YB 1DS2E 1UMAH 2PTNA 1K21H 5LPEA 2PUQH 2R0LA 3A81A 1MD7A 1UJ1A 3S9BA 1F92A 2HPPH 4AFUA 1AB9C 1HDTH 1AN1E 1ELBA 4DT7B 1HRTH 5C67A 1NFWA 2JH0D 2AEIH 4YESB 2ZFSA 1O37A 1Z8RA 2RG3A 1SOTA 3BTDE 1LO6A 2BD3A 3SHCH 1S85A 1BA8B 1NRRH 3SQHE 3U8RH 3H7TA 2ANMH 5C20A 1V2TT 4RN6A 1G3BA 8GCHF 4X8UH 1O5FH 1SBWA 3MHWU 4B73A 3SI3H 4FU8A 1TGTA 4JZDH 3QTVH 1NESE 2GV6A 3QTOH 2UUJB 2ZA5A 1YC0A 3SJOA 4YTAA 3UY9A 5DO4H 2ODPA 1P03A 1S0QA 1P02A 2OTVA 5DPAA 3RU4E 3DUXH 1LDTT 1QURH 1QTFA 1V2NT 2BD8A 5CHAB 2OBOA 1MZAA 4Y6DA 1GHVH 2VIOA 3AASA 4Y7AA 2FEQH 2P3TB 3SJIA 1FMGA 1DWBH 1UCYH 5GDSH 1HJAC 1NN6A 5EODA 2J92A 1O0DH 2AMDA 1P8VC 1UK3A 4IBLH 5GPIB 1HLTH 4FUJA 1KXDA 1WU1A 1UTNA 2ZFPH 1N8OC 4X6PA 3PLPA 2QCYA 3E91A 1MAYA 3MMGA 1LHDH 1GMHF 2G55A 3D62A 4NA9H 4GVUA 1IQEA 1HAZB 1JRTA 1EJAA 3RP2A 1GMCF 2TGTA 2GV7A 2I6QA 1BBRK 1GBFA 4Y76A 1XUGA 1XUFA 3FANA 1KTSB 4ZHMU 1O3MA 1VGCC 3OTJE 1GI2A 5FXLA 1QJ1B 3ZVBA 2ZP0H 3EE0B 1SGEE 1VCQA 1XUKA 3OX7U 1EPTB 3BEUA 2HNTC 4BXSA 2O8WA 1AO5A 3RUOA 1V6DA 1TA6A 2ULLA 4WMFA 1QB9A 1SGQE 4U32A 3WY8A 2FYQA 3BTWE 1O3CA 2Y7ZA 2ZDKA 2PGQB 2DE9A 4I8KA 4CH8B 3ZVFA 4YOGA 2G52A 1MQ6A 3N7OA 1A5IA 4BAMB 5E0GA 6CHAB 2BB4A 2R3UA 4X0WU 1CGJE 5DJ7A 3TK9A 1TRYA 1GVZA 2BZAA 4B71A 3V7TA 1DXWA 5CHAC 4A92A 1CSOE 4OS5A 1AWHB 3A8CA 2ZHWH 1TX6A 4DY7B 1EOLA 2A1DB 1Y5UT 1XX9A 3P8OA 4NA8A 2FZZA 3E1XB 2FP7B 2THFB 5I25A 2P16A 1QBOA 3M7QA 1Z8IB 1TNHA 1TMUH 4NSYA 1C5NH 1EZXC 2VVUA 2Z9IA 4CRFA 1NPMA 1D4PB 1QRZA 2I6SA 5AFYH 2G4TA 2BY8X 2ZF0H 2OC0A 1OWKA 2VNTA 3SNDA 2TBSA 3FP6E 1JIRA 2H5DA 1IQNA 1GG6C 3UIRA 4K3JA 1RXPA 1GJ8B 1T8MA 5ETXA 1FZZA 1HAHH 4WVPE 1GJDB 2FOGA 1UVTH 4GSOA 3M5NA 2QYIA 2F83A 1FV9A 3EA9A 1D9IA 2AGEX 1WAYB 2GKVE 2FESH 1KY9A 1TOCB 3PM3A 4RKOB 1FQ3A 1VITF 5C1XA 2CN0H 2VWNA 5JBBS 2GZ8A 2WUCA 5DGJA 3MI4A 1OWIA 2C8WB 3SN8A 1EPTC 2O8TA 3AVZA 3RC4A 1L1JA 7LPRA 2QIQA 3RXOA 3ZZAA 2PLXA 5EW2H 1EKBB 2CF8H 1GI1A 4LZ4B 3M7UA 1MTWA 2XXLA 4J2YB 4MNXA 2OC8A 3P8FA 1H4WA 2ZCLP 3GCTG 3GISB 3UREA 4DIIH 2BY7X 1ZZZA 1DUEA 1A1RA 1MUEB 4FU9A 5B6OA 3A8AA 4U2WA 2BQ7B 1A2CH 4YOJA 3BV9B 2BD4A 4FVDA 6CHAC 3S7KB 1W14U 1G30B 1SQAA 2TRMA 1NFXA 4CREA 1AE5A 4I31A 1TPPA 1TNIA 5EG4A 2FOHA 2BLVA 1F5KU 1O3GA 2ODQA 2AGGX 4K8BA 1C2IA 3CS7A 3A83A 4ISOA 1T31A 2QXHA 3K65B 1QBVH 1P01A 2OINA 1OOKB 3RXIA 1F2SE 2ZDVH 1EOJA 8KME2 5K7RA 2EC9H 2QN5T 2FOEA 3QLPH 3SV9A 4XE4A 4Y71A 2BQWB 5DK1A 1V2RT 2FLRH 2AMPA 2Q1JA 1SOZA 3LOXA 3MU5A 3M5LA 3VXEH 2ZGBH 3Q3XA 2DUCA 2VWOA 1GBHA 1PQAA 2ZFQH 1KDQB 3RC6A 1BMLA 5F6MA 1DWDH 3PWBA 5IYTA 3SV7A 1IQLA 3RXLA 4K8YA 3RXCA 1GBAA 2JKHA 1ZHRA 2GT8A 1BB0B 4WH8A 3SI4H 2UWLA 2H9EH 3P92A 1AFEH 1UCYE 4ABDA 2AYWA 3A89A 2Y81A 3PV4A 2V6NA 1C2KA 3DHKH 1SGYE 3ZVCA 1MMJN 4D7FA 1OP8A 4UFDH 3KQBA 1GHWH 3SGBE 1SLXB 2O8LA 1Z7KA 1CO7E 5FPSA 4TWWA 3PB1E 1C5WB 1KSNA 2P3FH 1O2UA 1QJ6B 1TGSZ 1A46H 2BY5X 4UD9H 2TGAA 8ESTE 3E0PB 4CRDA 1W10U 3SU2A 1EAXA 1A61H 1GHAG 1K1IA 4B76A 1C4V2 1D3PB 3DT0H 2BM2A 4MNVA 2OC7A 3SUGA 5TCAA 1TPSA 2G5NA 3GICB 1FIWA 3ZV9A 1ZPZA 1O5CB 1SGFA 2CMYA 1LVOA 2ZQ2A 2VH0A 1VCPA 2VWLA 1Y3YA 2ZGJA 4YLQH 3Q3KA 5EGMA 2WPJS 4NWKA 1AHTH 3SGAE 3Q00A 1C2LA 1ELEE 1ESBA 3SV8A 1HAVB 1C1TA 1GDNA 5JB8S 4K5ZA 1GMHG 2XBYA 1C2DA 2ZQ1A 1F0TA 1GDQA 4Q80A 1SGCA 3AAVA 3UPEA 1GMCG 4DG4A 3DFLA 2VIWA 4M7GA 1O32A 2FO9A 4X1QU 1RD3B 1XVMA 1O36A 3NCLA 1HJ8A 4I33A 3SNEA 4D8NA 5H4IB 3SNAA 1MKXK 3KIDU 1GJAB 4IC5A 4FU7A 4OGYA 1IQGA 1LPZB 1O33A 1FY4A 1AU8A 3UR6A 1CU1A 1BMNH 1GJBB 1G3CA 1HXFH 1PFXC 2YOLA 2ZDAH 4RSPA 3MNSA 1SQOA 5BRRE 5IDKA 2J34A 1C4Y2 1FY5A 1ESAA 5E0JA 1AVWA 2Z9KA 3E6PH 4FUDA 1O2HA 1VJAU 1ZTJA 1ZJKA 1GHZA 5HXFA 3UWIA 3FZZA 1WUNH 1C1NA 3ZZ9A 2BMGB 3Q77A 2ZPRA 4B75A 5JBAS 3ZVDA 2B5TB 2GX4A 1P9SA 2C8ZB 3S69A 3SV2H 4FUEA 3KQEA 1V2OT 1P2NA 5DP8A 1FAXA 1ZYOA 3HGNA 1WQVH 2WINI 2BLOA 2ZDLA 3P95A 3OYPA 3G01A 1UTMA 1HB0B 1H9LB 1YCPH 1MH0A 4AYVB 4B2AA 4MVNA 1IQHA 5T6GA 3VB3A 2HWLB 2R2MB 4E06H 1Y3XA 1O2NA 3ZVEA 3ZYDA 4B74A 1OWJA 4X8SH 5ESTE 3PMBB 1DPOA 1ARBA 3DA9B 1D6RA 5AVDA 4CRCA 1EPTA 1WCZA 1VITG 2F9BH 3GY8A 2FI4E 3D23A 4GHTA 1UVPA 1A3EH 1GDUA 2BDYA 5TCCA 3SUEA 2GZ7A 2ZGXH 3VPKA 3L6PA 1ELFA 5FX5A 1HJ9A 2C3SA 4ABHA 1O5DH 2TPIZ 2FOMB 3FVFB 1EJNA 4INKA 1ZGVA 4CRAA 2HOBA 3LH3A 1Q3XA 3M7TA 1HAIH 1YKTA 1V2WT 1TA2A 3ZV8A 1GHBF 1K2I1 3KNXA 2WYJA 1V2MT 3S7HB 2G51A 3GCTF 3T5FH 1C5MD 1IHSH 3KN2A 3F9EA 2FX4A 3RXKA 1BT7A 1DT2A 2WPMS 1FI8A 1P2IA 1B5GH 3RM0H 3UR9A 3VB7A 1P12E 5GCHF 1EAUA 2IOTA 5EXMA 2ZGHA 1VJ9U 4B2BA 1W3CA 1HPGA 2PV9B 3O8BA 1GGDB 3MWIU 1C1PA 4GPGA 2PUXB 1TWXB 2BXTH 3QGJA 1RTKA 3SORA 1BTHH 3BTKE 4A5TS 3STIA 1BRBE 1CBWB 1NRSH 1O2RA 1IAUA 3NZIA 2QA9E 1QB6A 3R3GB 3SZNA 3GY5A 1DVAH 3FZDA 1MTVA 1BHXB 4AB9A 5A0CA 1SFQB 1P2QA 2Z94A 1O5AB 3SBKA 4IN1A 1AFQB 2A45B 4BXWA 2OXSA 2BDAA 1CA8B 4AGKA 5F03A 2ANKH 2VWMA 1SMFE 1KTTB 3RXRA 3MH4A 5HM2A 2B0FA 4O9VA 3W94A 2V3HH 2PR3A 3FP7E 5EW1H 2A5AA 1A0JA 2FOBA 1O38A 2V3OH 2FIRH 2Z6BD 3UQVA 2ZTZA 7KMEH 2ANWA 3TJOA 1GMDG 1O35A 3HATH 4MLFB 5E0HA 1PQ7A 5L6NH 2BDGA 3KHVA 1TMTH 1DSTA 3MNCA 3TH2H 2F91A 1EXFA 4ZKSU 1GBEA 4NG9H 4AX9H 1RTLA 2J38A 3RXHA 2BX4A 2BDCA 4ASHA 5C1UA 1ZMLA 4XFQA 2H2ZA 1SPJA 1H8DH 1HAGE 1O5EH 4R0IA 1UTJA 3M37A 3O8DA 5G4BA 1GBCA 1GBKA 1S6FA 3TJNA 4Z6AH 1GI0A 3QO6A 2XBVA 1NS3A 3T28A 1WYKA 2H9TH 1QB1A 2HRVA 4JZFH 1C4U2 2P8OB 4AFQA 1ACBE 4ZKRU 3MH6A 1F0SA 1LHCH 4ZUHA 2BVXH 1AVXA 1FN8A 1O3FA 5DP5A 1H1BA 1GGDC 3QUMP 1GHAF 3MU0A 2O8MA 3MTYA 2A7CA 2HPQH 1ZMJA 4X2WA 1BZXE 1ANEA 1CBWC 3M36A 1MBMA 4NIXA 1YLCA 2SGFE 5LPFA 1HIAB 1EQ9A 2XW9A 1Z1JA 2VIDA 4ZHAA 5C1YA 1YPEH 1TABE 4INLA 4NGAH 1AFQC 1GG6B 4FUIA 4ZKOU 4JMYA 1N1LA 1XKBC 1EAWA 4AG2A 1O2MA 1KDQA 1QNJA 4DIHH 5SGAE 3PLBA 1SGNE 1MTNB 4XBBA 3LJJA 1GBLA 1HCGA 2XYAA 4DVAU 2B9LA 4WF8A 1GWAA 2D2DA 4WXVA 3S9CA 2BOHB 2C8YB 1Y3WA 4FUGA 2UWOA 4Y8YA 3RMOH 1F5LA 1GVKB 1YBWA 4DOQA 1MCVA 2FTLE 1THPB 2BDIA 4JCNA 1S83A 1W12U 1O2OA 2SNVA 2LNCA 1GBMA 4I32A 4NIYA 4DW2U 1OS8A 2ZTYA 3UOUA 3M5MA 5FAHA 2NWNA 3L3TA 3SUDA 4ZAEA 3SOSA 1TQ0B 3LT3A 3U1IB 4E05H 1P2OA 1H9HE 3A7VA 3ODDA 3PLKA 4D76A 2ZKSA 2ZPSA 5PTPA 1C5RA 4F4OC 1ESTA 5JB9S 1ANDA 1CA0B 1BBRH 4ISNA 1W0YH 1YP9A 2QGRA 1FPHH 5GIBA 1QGFA 4HTCH 1OP0A 1O3HA 4O3UA 1G36A 1W7XH 3TGIE 1O2SA 3E8LA 3HPTB 4CRBA 4BTTB 3RDZA 1BTZA 1B7XB 2A2QH 3PTNA 2P8OC 2XBWA 4CBNA 1EJMA 2G8TA 4DCDA 2STBE 3T29A 3TNTA 3LKWA 1CE5A 1RRKA 2ASUB 1GBTA 3CP7A 1VCWA 3NUMA 5EXNA 1HAVA 1ELVA 1P10A 2ZDNA 4YZUA 1IQKA 1IQMA 4ABAA 3HK6B 3BF6H 3E3TA 1QRWA 3QZQA 1S82A 4MQAA 3SU3A 4X1PU 3QN7A 2AERH 5DP9A 1O5BB 2XC0A 4R8TB 2BZ6H 5T3HA 1PPHE 1QCPA 3BTQE 4BOHA 1BMAA 1EP5A 1F7ZA 1O3DA 1PPBH 1P05A 1K1NA 1O2IA 1KXBA 2ZCKP 3O8CA 2ZIQH 3UWJH 3K6ZA 3RXQA 1YPHE 3M3VA 1BTXA 6ESTA 1MTNC 5ESBA 5EU8A 1QA7A 1MU6B 3A87A 4X8VH 1Q31A 1ZHPA 4HZHA 2A7HA 1DANH 1GI7B 1J15A 1O31A 2AMQA 1YGCH 1O3JA 1EP6A 1GJCB 1ABJH 3ELAH 3F9GA 1C5PA 4HFPB 5JPMH 4I8GA 1TGCA 2P93A 2FOAA 2GP9B 3A7XA 1YF4A 4H42U 2ZHQH 2A4QA 1LHFH 3BN9A 4X8TH 5JBCS 5C5NA 1DFPA 2A5KA 1AWFH 2BD9A 3EQ0H 1DLEA 1TBZH 3MH7A 9ESTA 3MO9A 3RXMA 1UTOA 4NA7A 1EAIA 1GHBG 4UFFH 3URCA 1L1GA 1C5UA 3GY7A 1L0ZA 4NZQA 2VIQA 1CA0C 5HGGA 4I7YH 1KLIH 4XOJA 1EZQA 3I29A 3KQDA 1LVYA 5GCHG 4NFEA 4THNH 5A8YA 1YM0A 2NU3E 4OGXA 1BDAA 1GJ4H 1O3BA 1WTHD 3NWUA 1BHXF 3PYHA 3OY5U 1QL8A 1C1QA 4O97A 1G9IE 2TGPZ 4ABEA 1T7CA 1E34B 1BTPA 3MU1A 2TGDA 2C93B 3SV6A 4X6MA 3MFJA 4AYYB 1TX7A 2W26A 1AGJA 5GJ4B 3A86A 2BD2A 1Z8JB 5F8ZA 2J94A 3BSQA 3R0FA 1TBQH 3IG6B 1P2MA 5A2MH 2YNAA 1OKXA 2BX3A 3LC3A 2V0BA 1T8LA 1J8AA 2CF9H 5FCRA 4JZEH 3GCHB 4WWYA 3RMMH 1O3KA 1SVPA 3SU4A 1ZLRA 3ZZBA 3RLWH 3AAUA 4WJG2 1P06A 2GT7A 1AUJA 1NO9H 4K1SA 1AZZA 1UK2A 1G3DA 2QXGA 3A8DA 4MPVA 4NIVA 4U30A 1SB1H 3S0NA 1GMDF 1IHTH 1GHYH 1T4VH 1HBTH 4WMEA 5J4SA 1QQUA 1GL1A 2F9PA 4MNYA 1HFDA 4Q7ZA 5DP7A 4X6OA 2XRCA 2Y82A 1Z8GA 2XNIA 4ZKNU 1GBBA 1O2QA 1G2LA 4AOQA 1C1WH 3UUZA 1ZHMA 1TE0A 2F9UA 1HUTH 2GCHF 1TX8A 4OS4A 1GI9B 1U6QA 1TFXA 1TNGA 4OS7A 3ZZ8A 2BDBA 3CENA 3MU4A 3W95A 1FNIA 3ITIA 4UFEH 1PYTC 1G32B 5A0BA 6GCHG 2UUKB 4ABFA 3UQOA 2Z3EA 1SQTA 1C1OA 1RIWB 1SFIA 3TH3H 1E38B 4CRGA 1ID5H 1T8OA 2O8UA 5DP3A 3EDXB 3U8TH 1FY8E 2PGBB 1O2YA 1BITA 1NFUA 1XUHA 3QK1A 3KEEA 1O2LA 1C2JA 2SNWA 2PWXA 1XMNB 3ATLA 1RGQA 2OQ5A 3TVJB 2IPHA 1ZR0A 1NTPA 1OWHA 1TONA 1V2LT 1NFYA 1SG8B 4BTIB 2FPZA 1GCTB 1C5SA 4BAOB 2Y5FA 2WYGA 5T6DA 4ZROA 1FJSA 1BBRE 2Y6TA 1OYTH 1VZQH 3QZRA 3GCHC 2NU2E 1P0SH 3PROA 1ZJDA 5C3NA 4ABBA 1IQFA 4BNRA 4CR5A 4X1NU 7ESTE 1J16A 1O3IA 1SLWB 3PMJA 2FYRA 4HI3A 2J4IA 1LCYA 3B9FH 3FAOA 2ODYB 1BQYA 2H6MA 2F3CE 2GD4B 4H6TA 1GI8B 5T6FA 1ETRH 5L2YH 3T2NA 3U98H 3OSYA 4Q2KA 3U9AH 3RU4T 3K6YA 1V2UT 3MOCA 2UUFB 3PMHB 2BYAX 3BIVH 2C4FH 1ZTLA 1KXEA 3LU9B 5LGOA 1O3PB 2JH6D 1O39A 3QWCH 2H9HA 1KLJH 1ELCA 4MDSA 3ATMA 4XBDA 4LXBH 1GBIA 2WPIS 3I77A 1P11E 1C5OH 2Z9JA 3VB6A 2XCNA 4MPUA 2ZFFH 3MYWA 1C2EA 3V0XA 2AGIX 1AKSB 2OBQA 5LH8A 2OCVB 2RA3A 1ETSH 3EAJA 1LVMA 3S9AA 2ZU4A 3LGVA 4DJZB 5EQSA 1RIWC 1ANCA 2PKSB 3V13A 1Y59T 4Y8XA 1E36B 2FM2A 4IW4E 1HIAA 2OD3B 4NCYA 4Y0YE 5AHGH 1LKAA 1LKBA 1P9UA 2OUAA 1M9UA 5GXPA 4BTUB 3UTUH 1TNLA 3A7ZA 3QGNB 1T4UH 4BAKB 2QY0B
chains in the Genus database with same CATH superfamily
1EFRD 1OPHB 4ABJA 4HGCA 1Y5BT 1OX1A 4Z1MD 3STJA 1Y3VA 1A0HB 1GCTC 2ZECA 4TY6A 4A1TA 1DX5M 1HXEH 2F9VA 3PMAB 1PQ8A 3ZZ5A 3PRBA 2GDEH 2ZU2A 2VVVA 3TK5A 3F9HA 4RT0A 3SJ8A 4Z0KA 5TJXA 1A5GH 1ORFA 1C2FA 3D65E 1AD8H 2WV4A 1H9IE 4O3TA 3M61U 2RA0A 1GBDA 3DCLA 3M35A 3FO8D 1PPEE 1C1VH 2FDAA 1UTLM 1MKWK 1YPKH 3L33A 3NK8A 4KTCA 1O30A 1TRNA 2XC5A 2ANYA 4WY3A 2SGAA 1Z1IA 2GTBA 3MH5A 2OLGA 3GCOA 1NRQH 1QR3E 2EI7A 1MU8B 1BJUA 2BD5A 1ELTA 3T25A 1X7AC 5CMXH 3IITA 2FMJA 1ZRBA 3KF2A 2RCEA 1N6XA 2ALPA 1O2XA 1TPOA 2AIPA 3WWBA 1ABIH 4CH2B 2FTMA 4FUCA 4NFFA 1V3XA 1CHGA 2HNTE 1ARCA 2FI3E 1UVUH 4K69A 1XUIA 4Q7XA 2ZG0H 1J9CH 2FWWA 2Q6DA 3SJKA 2P94A 4O03A 1GPZA 4BAQB 2A0QB 3RXVA 1BUIA 5HIYA 1EX3A 2Z3CA 2CGAA 5FX6A 2LELA 1W8BH 4U01A 2PKSC 3FN8A 1W2KH 2Q6FA 3BTFE 2EQNA 3URDA 3F6UH 1C5ZB 2SGEE 4JYVH 1UHBB 3TGJE 1AMHA 1TQ7B 1NU9A 1OP2A 3ZZ4A 2ZC9H 2JIZD 1DM4B 5E2PA 1QHRB 1DLKB 1C1UH 3KL6A 3ZVAA 1NC6A 3LPRA 5A09A 3A82A 4NIWA 1MD8A 3AK5A 2WUBA 1CT2E 3PTBA 4KELA 4X2XA 2VIPA 3TPIZ 1QL9A 3OTPA 1ZRKA 1TOMH 2HALA 1Z71A 1C5VA 1DWCH 3BG4B 1P04A 1HAYB 2W5EA 4K1EA 2A4GA 4DURA 4ZCNA 1FXYA 5FHTA 1GJ5H 3ZVGA 1IQIA 3HK3B 5A0AE 5JDUB 4ZH8A 3FP8E 4F48B 1ZSKA 1WQSA 2OP9A 1SHYA 2NU1E 1GJ7B 2FS9A 2D26C 1P09A 1KXCA 5K0HA 1N6YA 1ZSJA 4E7RG 5DP4A 2P3UB 2W6ID 2QAAA 5HMAA 1CGIE 1SSXA 2BXUH 2GVFA 3LC5A 3TLOA 1SC8U 2GCHG 1DY9A 4XBCA 1QIXB 4YOIA 3IWMA 4INHA 4A1VA 1RFNA 3A7TA 4KTUA 3TU7H 1G37A 2KM0A 4GCHF 3DD2H 5FCKA 2OK5A 2XCFA 3LGTA 1S0RA 1BCUH 4YO9A 2WPKS 3ZYEA 1S6LA 2BY6X 1EB2A 6GCHF 5EPYA 3SHAH 4SGAE 4MNWA 2QF0A 1HAOH 1UCYK 5C2ZA 2R0KA 4LOYH 1SGTA 1SGPE 2UUYA 1FDPA 1HYLA 5EQQA 3SNCA 3VB5A 1KLTA 1ELAA 1LTOA 4B2CA 2A32A 3DSPA 4Y7BA 5F8TA 2VGCB 4YM9A 2EA3A 1TNJA 3VFEA 1GI5A 2OQUA 5JYIA 3AW1A 7GCHF 1DE7H 1W11U 5A8ZA 3EYDA 2DE8A 1OWDA 3GDVA 3LGUA 4KP0A 3JZ2B 1LHGH 3EGKH 1JIMA 4I8HA 3GY2A 4X6NA 5CDFE 1LPGB 1KXAA 1O3AA 1CQQA 1CHOF 1O5GH 3BTTE 1D6WA 1V2VT 3RXBA 2QE7D 1E0FD 4IC6A 3P8NA 4ZXXH 2KAIB 3DSGA 3BTME 4GUXA 2G81E 1DICA 1MTSA 3P70B 2VIVA 4BAHB 1K1MA 1P2JA 4FVBA 2PSXA 3HGPA 3BG4C 1TNKA 2ZU1A 4Y79A 1C5QA 1F0RA 5GWZA 1OXGA 1PPGE 4ESTE 3F2GA 3GYMA 1NT1A 2FX6A 2AH4X 3KCGH 2W3KA 1GI3A 2ZI2H 2W7SA 3E16B 1SGRE 4A1XA 4JZ1A 2ZNKH 4FUBA 3RXJA 4XSKU 1EB1H 4AN7A 2QV1A 1BTWA 3A7YA 2CV3A 5I46H 3LGYA 2JJ2D 4Y11E 4JK5A 1W0ZU 1BJVA 2BDHA 3Q3YA 3E90B 4JYTA 3MO3A 4MPWA 3QX5H 1EZSC 2Q6GA 1W7GH 1O34A 1SR5C 1XXFA 4YT7H 3ZZ7A 1DUAA 1QFKH 2XC4A 1K9OE 1WV7H 2GCTB 4Y8ZA 1P57B 1O3NA 1D3TB 2PKAB 2XWBI 4AZ2B 3SUFA 4I8JA 1UTKA 2QXJA 3NXPA 4TY7A 1C5TA 2BOKA 4K2YA 1H8ED 1GI6A 3LGIA 4TWYA 1ANBA 3SGQE 3PV5A 3BIUH 1ZOMA 1AI8H 5CE1A 1TPAE 2VGCC 3GY4A 3SU1A 1C9TA 1ELDE 1Y3UA 3BEFB 2R2WU 3ZZ3A 2CHAB 2BLQA 1DXPA 5A8XA 5J4QA 9LPRA 4BANB 2EI8A 4K1TA 4LK4A 2ZU3A 3BTHE 4RT1A 1EATA 1E35B 2G00A 2VU8E 5AF9H 2J98B 2IJOB 4Y10E 4XRNA 2J95A 1XVOA 1YPJH 1S6HA 4TYDA 2ESTE 2WV5A 3F2FA 1Q2WA 4E7NA 2G4UA 3F1SB 1F0UA 1SGDE 5EOKA 3UOPA 3A85A 2W3IA 4TPIZ 1SGIB 1A7SA 2STAE 1CVWH 1AQ7A 3SW2B 4ISLA 1DITH 1HGTH 4A6LA 4MG3A 2JETB 1JWTA 2AIQA 1A3BH 1MZDA 3P8GA 1AUTC 1VITH 3LIWA 1IOEA 3GCNA 1ZTKA 2YNBA 4X1SU 2Z9GA 4AORA 3V12A 1TAWA 1FONA 2XWAA 4KTSA 1YPGH 1FX0B 3SJ9A 1TGBA 3SU6A 1K28D 1ELGA 1YLDA 3M3TA 3K2UA 1UVOA 2CXVA 3M3SA 1TLDA 3CS0A 4AB8A 2PTCE 1NRNH 1AKSA 3C27B 4MTBA 1PPCE 2IPQX 1XUJA 1C2HA 3GOVB 1L2EA 2QXIA 1FAKH 1L1NA 4B1TA 2GCTC 5L30H 1YYY1 4AGJA 4QT8C 1ZGIA 1UVSH 1S81A 2GMTB 1QL7A 4CBOA 4RKJB 3GYLB 3RM2H 1DWEH 1Y5AT 2JDID 4P00A 3LDXH 1TBRH 1NY22 2D1JA 5BPEA 1RJXB 1MQ5A 3ZZ6A 1D3DB 3ENSB 2OC1A 1P3CA 3RXEA 4CHAB 2J2UA 2CHAC 1AVGH 1GJ6A 1E37B 2Y5HA 3ZZDA 3TH4H 2WZQA 3ATKA 5DG6A 1IQJA 3TITA 1SLUB 3LONA 2GDDA 4UE7H 3TJVA 4NZLA 3DSOA 2K1QA 3LJOA 1W13U 1WTGH 1FUJA 1K1PA 4IS5A 3SU5A 5E2OA 1BOQA 5KEDA 1BRUP 2HLCA 1WOFA 1D3QB 1JMOH 1SHHB 1WSSH 1YPLH 4OS6A 4NWLA 4UONA 2HVXA 2JETC 1Z6EA 4WH6A 1O2WA 4X1RU 3VEQB 2J97A 1AE8H 2HNTF 1HAXB 3RC5A 1BMMH 5E8EH 5DSFA 1LVBA 2C8XB 4FXGH 1O3LA 1OSSA 1F5RA 1O3EA 3V3MA 3Q76A 4KKDA 1AZ8A 2ZFRH 5EQRA 1V2QT 1LPKB 1RS0A 3BTEE 2BVSH 3A8BA 3RMLH 3VGCB 1QY6A 2HGTH 2IN2A 2FI5E 2P59A 5C5OA 3JZ1B 1V2KT 2A31A 4GCHG 1MBQA 5HM9A 1OYQA 1LQEA 2AS9A 4X2VA 4GLYA 1LHEH 2ZTXA 3ESTA 1THRH 1TRMA 1C5XB 3OY6U 1TB6H 3EA7A 4X2YA 1JOUB 3GDUA 1HV7A 1PQ5A 2FOCA 4AFZA 1JRSA 2EY4C 2VB0A 4YT6H 5JBTA 2VJ1A 2SGQE 3D49H 2B7DH 4H6SB 8GCHG 3U1JB 3B23B 2D8WA 3TNSA 2ZCHP 1MCTA 2GZ9A 2J5UA 1QA0A 3BG8A 4ABIA 2A4RA 1UTPA 3F9FA 1NROH 1UHBA 2Y5GA 2GMTC 3MNXA 7GCHG 2PP6A 5FPTA 5EIYA 2Y7XA 3T27A 4CR9A 3PO1B 2BD7A 1ETTH 4FUHA 5C0UA 2C90B 1YLNA 1QJ7B 1OWEA 1J17T 5HYOA 1K1OA 1O2TA 3LGWA 2BQ6B 3TGKE 1GVLA 4CHAC 2VH6A 2Y80A 2BLWA 3O8RA 3RU4D 2FXRA 1FN6A 1CHOG 1PJPA 2Z9LA 4OS1A 2ZWLH 3T62A 4OS2A 4IMZA 2ZFTA 1KYNA 2Z3DA 1YPHC 2KX4A 1SL3A 4XDEA 5ABWA 4F49A 3H5CB 4AFSA 1G3EA 1Z6JH 1O2VA 2BHGA 8LPRA 2QF4A 1WBGB 1GBJA 3HKJB 2SGPE 1EZUC 2H1UA 2UWPA 1BRAA 2W7UA 1ZMNA 2A5IA 2VINA 3RXTA 2ZU5A 1LQDB 1CGHA 2R9PA 1XKAC 2R3YA 1O2PA 2A2XH 2BTCE 2EEKA 3NPSA 3OU0A 3A7WA 3UNSA 2FLBH 3OAAD 1J14A 2ALVA 3P6ZB 3GY6A 1BTUA 1TMBH 1K1JA 1GJ9B 1T8NA 5EPNA 1O3OA 3A80A 3F68H 4ABGA 1RTFB 1C5LH 3RXPA 1S84A 2KZ4A 4JK6A 3UNQA 2ZDMA 3VGCC 3MU8A 1NU7B 4RI0A 3RXSA 3NKKA 1B0EA 3MNBA 1A0LA 2ZHEH 4AG1A 1C1RA 1L4ZA 3WW7A 1BIOA 3KYGA 2VVCA 3H7OA 1H8IH 1MKXH 1NZQH 2PW8H 1PPFE 4KGAA 3OFND 1A4WH 2M5TA 1BTYA 4IN2A 2AFQB 2XBXA 5EXLA 5LPRA 3SNBA 1Y8TA 1LMWB 2QC2A 1QQ4A 1V2PT 4DGJA 4A7IB 1TYNA 3AW0A 1CT4E 3E0NB 4ZHLU 2RDLA 1T32A 3SQEE 3T26A 3I78A 1YCPK 1KIGH 1NM6A 1SLVB 4WMDA 1DDJA 1QRXA 5EJLA 1TALA 1TIOA 4AC9A 3PO1C 2PFEA 5KGOA 2SGDE 4I8LA 4UFGH 4VGCB 2BY9X 1EUFA 1L4DA 3KGPA 3M5OA 3LH1A 2JH5D 3MO6A 4Q7YA 1B0FA 2RFKC 2KAIA 3GY3A 4NSVA 2G5VA 3UFAA 4LZ1H 1JXPA 2B8OH 4JYUH 1KXFA 1PYTD 1C2MA 3NRLA 3FFGA 2PSYA 3K9XB 4SGBE 1AIXH 4H4FA 4D7GA 3RXFA 3PWCA 4UDWH 1O2JA 4J1YA 1UO6A 1NRPH 3BEIB 2Z7FE 3P17H 1INCA 2F9NA 1HNEE 3TK6A 3SO3A 6LPRA 1UK4A 3UAIC 3ODFA 1SI5H 4YLUA 3C1KA 1THSH 3TIUA 3QDZB 5FPYA 1FY3A 1XM1A 2ZHDA 2F9OA 1ZPCA 1JBUH 3RXDA 3BTGE 4TPYA 2GGVB 2SFAA 5KECA 2ZGCA 1GCDA 4Y0ZE 3ZZCA 2A4OA 1TGNA 4IGDA 4PROA 1AB9B 4ZMAH 4IMQA 3SU0A 3RXUA 1DY8A 2PKAA 1AY6H 2A7JA 5AFZH 2P95A 3VB4A 1BRCE 5L2ZH 5DKMA 1QBNA 4K60A 1GI4A 5FBEA 4WXIA 2J9NA 1UTQA 3RXAA 3A84A 3HKIB 3RMNH 4ZXYH 1MKWH 1MAXA 1C1SA 4MPXA 1O2ZA 4JZIA 2KR7A 1V2ST 2LPRA 2BVRH 2XTTB 2H5CA 2NU4E 2PHBA 1C9PA 1FIZA 2O9QA 3DFJA 3TJUA 3A88A 2WPLS 1K22H 1VR1H 1YCPM 5FBIA 4ISHH 3VXFH 4ISIH 1P2KA 3ATWA 2CJIA 1DSUA 1P3EA 2J98A 3EA8A 1V2JT 1EASA 4D9RA 1GHXH 4VGCC 1ZSLA 5F8XA 3SYJA 1SGFG 2QF3A 3KQCA 3RLYH 1K1LA 4GAWA 5DP6A 1G2MA 2WPHS 2ZZUH 4D9QA 1DOJA 1FY1A 2V35A 3KYFA 4UEHH 1HJAB 1ZPBA 2L6OA 3U8OH 2ZHFH 2ZEBA 2TIOA 3UNRA 3U28C 3U69H 2ZPQA 3RXGA 1YPMH 1N8OB 3ATIA 2FOFA 1FPCH 2ILNA 2ZO3H 1PPZA 1YY3A 1GL0E 2FS8A 3GDSA 1MTUA 1O2KA 3WWFA 2FODA 2NU0E 1C2GA 5C0TA 1O2GH 1XXDA 1C1MA 4GHQA 3B8JA 1S5SA 1HAPH 1FLEE 1CT0E 2EI6A 1BMFD 1A5HA 4FUFA 1VGCB 1C5YB 1DS2E 1UMAH 2PTNA 1K21H 5LPEA 2PUQH 3VG8A 2R0LA 3A81A 1MD7A 3H09A 1UJ1A 3S9BA 1F92A 2HPPH 4AFUA 1AB9C 1HDTH 1AN1E 1ELBA 4DT7B 1HRTH 5C67A 1NFWA 2JH0D 2AEIH 4YESB 2ZFSA 1O37A 1Z8RA 2RG3A 1SOTA 3BTDE 1LO6A 2BD3A 3SHCH 1S85A 1BA8B 1NRRH 3SQHE 3U8RH 3H7TA 2ANMH 5C20A 1V2TT 4RN6A 1G3BA 2LP6A 8GCHF 4X8UH 1O5FH 1SBWA 3MHWU 4B73A 3SI3H 4FU8A 1TGTA 4JZDH 3QTVH 1NESE 2GV6A 3QTOH 2UUJB 2ZA5A 1YC0A 3SJOA 4YTAA 3UY9A 5DO4H 2AHME 1P03A 2ODPA 1S0QA 1P02A 2OTVA 5DPAA 3RU4E 3DUXH 3UB0A 1LDTT 1QURH 1QTFA 1V2NT 4YXWD 2BD8A 5CHAB 2OBOA 1MZAA 4Y6DA 1GHVH 1W0KD 2VIOA 3AASA 4Y7AA 2FEQH 2P3TB 3SJIA 1FMGA 1DWBH 1UCYH 5GDSH 1HJAC 1NN6A 5EODA 2J92A 1O0DH 2AMDA 1P8VC 1UK3A 4IBLH 5GPIB 1HLTH 4FUJA 1KXDA 1WU1A 1UTNA 2ZFPH 1N8OC 4X6PA 3PLPA 2QCYA 3E91A 1MAYA 3F0PA 3MMGA 1LHDH 1GMHF 2G55A 3D62A 4NA9H 4GVUA 1IQEA 1HAZB 1JRTA 2M2AA 1EJAA 3RP2A 1GMCF 2TGTA 2GV7A 2I6QA 1BBRK 1GBFA 4Y76A 1XUGA 1XUFA 3FANA 1KTSB 4ZHMU 1O3MA 1VGCC 3OTJE 1GI2A 5FXLA 1QJ1B 3ZVBA 2ZP0H 3EE0B 3N7DA 1SGEE 1VCQA 1XUKA 2CK3D 3OX7U 1EPTB 3BEUA 2HNTC 4BXSA 2O8WA 1AO5A 2K0QA 3RUOA 1V6DA 1TA6A 2ULLA 4WMFA 1QB9A 1SGQE 4U32A 3WY8A 2FYQA 3BTWE 2GJGA 1O3CA 2Y7ZA 2ZDKA 2PGQB 2DE9A 4I8KA 4CH8B 3ZVFA 4YOGA 2G52A 1MQ6A 3N7OA 1A5IA 4BAMB 5E0GA 6CHAB 2BB4A 2R3UA 4X0WU 1CGJE 5DJ7A 3TK9A 1TRYA 1GVZA 2BZAA 4B71A 3V7TA 1DXWA 5CHAC 4A92A 1CSOE 4OS5A 1AWHB 2VBCA 2ZHWH 1TX6A 3A8CA 4DY7B 1EOLA 2A1DB 1Y5UT 1XX9A 3P8OA 4NA8A 2FZZA 3E1XB 5HIZA 2FP7B 2THFB 5I25A 2P16A 1QBOA 3M7QA 1Z8IB 1TNHA 1TMUH 4NSYA 1C5NH 1EZXC 2VVUA 2Z9IA 4CRFA 1NPMA 1D4PB 4ACAA 1QRZA 2I6SA 5AFYH 2G4TA 2BY8X 4Q4LA 2ZF0H 2OC0A 1OWKA 2VNTA 2WSSD 3SNDA 2TBSA 3FP6E 1JIRA 2H5DA 1IQNA 1GG6C 3UIRA 4K3JA 1RXPA 1GJ8B 1T8MA 5ETXA 1FZZA 1HAHH 4WVPE 1GJDB 2FOGA 1UVTH 4GSOA 3M5NA 2QYIA 1E1RD 2F83A 1FV9A 3EA9A 1D9IA 2AGEX 1WAYB 2GKVE 2FESH 1KY9A 1TOCB 3PM3A 4RKOB 1FQ3A 1VITF 5C1XA 2CN0H 2VWNA 5JBBS 2GZ8A 2WUCA 5DGJA 3MI4A 1OWIA 2C8WB 3SN8A 1EPTC 2O8TA 3AVZA 3RC4A 1L1JA 7LPRA 2QIQA 3RXOA 3ZZAA 2PLXA 5EW2H 1EKBB 2CF8H 1GI1A 4LZ4B 3M7UA 1MTWA 2XXLA 4J2YB 4MNXA 2OC8A 5IK2D 3P8FA 1H4WA 2ZCLP 3GCTG 3GISB 3UREA 4DIIH 4TT3D 2BY7X 1ZZZA 1DUEA 1A1RA 2V7QD 1MUEB 4FU9A 5B6OA 3A8AA 4U2WA 2BQ7B 1A2CH 4YOJA 3BV9B 2BD4A 4FVDA 6CHAC 3S7KB 1W14U 1G30B 1SQAA 2TRMA 1NFXA 3OEHD 4CREA 1AE5A 4I31A 1TPPA 1TNIA 5EG4A 2FOHA 2BLVA 1F5KU 1O3GA 2ODQA 2AGGX 4K8BA 3PRDA 1C2IA 3CS7A 3A83A 4ISOA 1T31A 2QXHA 3K65B 1QBVH 1P01A 2OINA 1OOKB 3RXIA 1F2SE 2ZDVH 1EOJA 8KME2 5K7RA 2EC9H 2QN5T 2FOEA 3QLPH 4Q63A 3SV9A 4XE4A 4Y71A 2BQWB 5DK1A 1V2RT 2FLRH 2AMPA 2Q1JA 1SOZA 4FOUC 3LOXA 3MU5A 3M5LA 3VXEH 2ZGBH 1NBMD 3Q3XA 5FL7D 2DUCA 2VWOA 1GBHA 1PQAA 2ZFQH 1KDQB 3RC6A 1BMLA 5F6MA 1DWDH 3PWBA 5IYTA 3SV7A 1IQLA 3RXLA 4K8YA 3RXCA 1GBAA 2JKHA 1ZHRA 2GT8A 5EJ1A 1BB0B 4WH8A 3SI4H 2UWLA 2H9EH 3P92A 1AFEH 1UCYE 4ABDA 2AYWA 3A89A 2Y81A 3PV4A 2V6NA 1C2KA 3DHKH 1SGYE 3SZEA 3ZVCA 1MMJN 4D7FA 1OP8A 4UFDH 3KQBA 1GHWH 2QF5A 3SGBE 1SLXB 2O8LA 1Z7KA 1CO7E 5FPSA 4TWWA 3PB1E 1C5WB 1KSNA 2P3FH 1O2UA 3F0OA 1QJ6B 1TGSZ 1A46H 2BY5X 4UD9H 2TGAA 8ESTE 2KCPA 3E0PB 4CRDA 1W10U 3SU2A 1EAXA 1A61H 1GHAG 1K1IA 4B76A 1C4V2 1D3PB 3DT0H 2BM2A 4MNVA 2OC7A 3SUGA 5TCAA 1TPSA 2G5NA 3GICB 1FIWA 3ZV9A 1ZPZA 1O5CB 1SGFA 2CMYA 1LVOA 2ZQ2A 2VH0A 1VCPA 2VWLA 1Y3YA 2XNDD 2ZGJA 4YLQH 4B6EA 3Q3KA 5EGMA 2WPJS 4NWKA 1AHTH 3SGAE 3Q00A 1C2LA 1ELEE 1WDIA 1ESBA 3SV8A 1HAVB 1C1TA 1GDNA 5JB8S 4K5ZA 1GMHG 2XBYA 1C2DA 2ZQ1A 1F0TA 1GDQA 4Q80A 1SGCA 3AAVA 3UPEA 1GMCG 4DG4A 3DFLA 4M9FA 2VIWA 4M7GA 1O32A 2FO9A 4X1QU 1RD3B 1XVMA 2XOKD 1O36A 3NCLA 1HJ8A 4I33A 3SNEA 4D8NA 5H4IB 3SNAA 1KMHB 1MKXK 3KIDU 1GJAB 4IC5A 4FU7A 4OGYA 1IQGA 1LPZB 1O33A 1FY4A 1AU8A 3UR6A 1CU1A 1BMNH 1GJBB 1G3CA 1HXFH 1PFXC 2KCOA 2YOLA 2ZDAH 4RSPA 3MNSA 1SQOA 5BRRE 5IDKA 2J34A 1C4Y2 1FY5A 1ESAA 5E0JA 1AVWA 2Z9KA 3E6PH 4FUDA 1O2HA 1VJAU 1ZTJA 1ZJKA 1GHZA 5F53A 3UWIA 5HXFA 3FZZA 1WUNH 1C1NA 3ZZ9A 2BMGB 3Q77A 1E79D 2ZPRA 4B75A 5JBAS 3ZVDA 2B5TB 4I86A 2GX4A 5B6LA 4TSFD 1P9SA 2C8ZB 3S69A 3SV2H 4FUEA 3KQEA 1V2OT 1P2NA 5DP8A 1FAXA 1ZYOA 3HGNA 3N7EA 4FETA 1WQVH 2WINI 2BLOA 2ZDLA 3P95A 3OYPA 3G01A 1UTMA 1HB0B 1H9LB 1YCPH 1MH0A 4AYVB 4B2AA 4MVNA 1IQHA 5T6GA 3VB3A 2HWLB 2R2MB 4E06H 1Y3XA 1O2NA 3ZVEA 3ZYDA 4B74A 1OWJA 4X8SH 5ESTE 3PMBB 1DPOA 1COWD 1ARBA 3DA9B 1D6RA 5AVDA 4CRCA 1EPTA 1WCZA 1VITG 2F9BH 3GY8A 2FI4E 3D23A 4GHTA 1UVPA 1A3EH 1GDUA 2BDYA 5TCCA 3SUEA 2GZ7A 2ZGXH 3VPKA 3L6PA 1ELFA 5FX5A 1HJ9A 2C3SA 4ABHA 1O5DH 2TPIZ 2FOMB 3FVFB 2L74A 1EJNA 4INKA 1ZGVA 4CRAA 2HOBA 3LH3A 1Q3XA 3M7TA 1HAIH 1YKTA 1V2WT 1OHHD 1TA2A 3ZV8A 1GHBF 1K2I1 3KNXA 2WYJA 1V2MT 3S7HB 2G51A 3GCTF 3T5FH 1C5MD 1IHSH 3KN2A 3F9EA 2FX4A 3RXKA 1BT7A 1DT2A 2WPMS 1FI8A 1P2IA 1B5GH 3RM0H 3N99A 3UR9A 3VB7A 3FKSD 1P12E 5GCHF 1EAUA 4P02A 2IOTA 5EXMA 2ZGHA 1VJ9U 4B2BA 1W3CA 1HPGA 2PV9B 5GNDA 3O8BA 1GGDB 3MWIU 1C1PA 2IJD1 4GPGA 2PUXB 1TWXB 2BXTH 3QGJA 1RTKA 3SORA 1BTHH 3BTKE 4A5TS 1E1QD 3STIA 1BRBE 1CBWB 1NRSH 1O2RA 1IAUA 3NZIA 2QA9E 1QB6A 3R3GB 3SZNA 3GY5A 1DVAH 3FZDA 1MTVA 1BHXB 4AB9A 5A0CA 1SFQB 4DT4A 1P2QA 2Z94A 1UW7A 1O5AB 3SBKA 4IN1A 1AFQB 2A45B 4BXWA 2OXSA 2BDAA 1CA8B 4AGKA 1NBME 2WPDD 5F03A 2ANKH 2VWMA 1SMFE 1KTTB 3RXRA 3MH4A 5HM2A 2B0FA 4O9VA 3W94A 2V3HH 2PR3A 3FP7E 5EW1H 2A5AA 1A0JA 2FOBA 1K0HA 1O38A 2V3OH 2FIRH 2Z6BD 3UQVA 2ZTZA 7KMEH 2ANWA 3TJOA 1GMDG 1O35A 3HATH 4MLFB 5E0HA 1PQ7A 5L6NH 2BDGA 3KHVA 1TMTH 1DSTA 3MNCA 3TH2H 3GS9A 2F91A 2KCYA 1EXFA 4ZKSU 1GBEA 4NG9H 4AX9H 1RTLA 2J38A 2WV9A 2BX4A 2BDCA 3RXHA 4ASHA 5C1UA 1ZMLA 4XFQA 2H2ZA 1SPJA 1H8DH 1HAGE 1O5EH 4R0IA 1UTJA 3M37A 3W1EA 3O8DA 5G4BA 1GBCA 1GBKA 1S6FA 3TJNA 4Z6AH 1GI0A 3QO6A 2XBVA 1NS3A 3T28A 1WYKA 2H9TH 1QB1A 2HRVA 4JZFH 1WXRA 1C4U2 2P8OB 4AFQA 1ACBE 4ZKRU 3MH6A 1F0SA 1LHCH 4ZUHA 2BVXH 2V3MA 1AVXA 1FN8A 1O3FA 5DP5A 1H1BA 1GGDC 3QUMP 1GHAF 1YWUA 3F2HA 3MU0A 2O8MA 3MTYA 2A7CA 2KFWA 2HPQH 1ZMJA 4X2WA 1BZXE 1ANEA 1CBWC 3M36A 1MBMA 4NIXA 4XD7D 1YLCA 2SGFE 5LPFA 1HIAB 1EQ9A 2XW9A 2JJ1D 1Z1JA 2VIDA 4ZHAA 5C1YA 1YPEH 1TABE 4INLA 4NGAH 1AFQC 1GG6B 4FUIA 4ZKOU 3OE7D 4JMYA 1N1LA 4HG6A 1XKBC 1EAWA 4AG2A 1O2MA 1KDQA 1QNJA 4DIHH 5SGAE 3PLBA 1QZ8A 1SGNE 1MTNB 4XBBA 3LJJA 1GBLA 1HCGA 2XYAA 4DVAU 2B9LA 4WF8A 3MQKC 1GWAA 2D2DA 4WXVA 3S9CA 2BOHB 2C8YB 1Y3WA 4FUGA 2UWOA 4Y8YA 3RMOH 1F5LA 1GVKB 1YBWA 4DOQA 1MCVA 2FTLE 1THPB 2BDIA 4JCNA 1S83A 1W12U 1O2OA 2SNVA 2LNCA 2W6JD 1GBMA 4I32A 4NIYA 4DW2U 1OS8A 2ZTYA 3UOUA 3M5MA 5FAHA 2NWNA 3L3TA 5T1VA 3SUDA 4ZAEA 3SOSA 1TQ0B 3LT3A 3U1IB 2WHXA 1P2OA 4E05H 1H9HE 3A7VA 3ODDA 3PLKA 4D76A 2ZKSA 2ZPSA 5PTPA 1C5RA 4F4OC 1ESTA 5JB9S 1ANDA 1CA0B 1BBRH 4ISNA 1W0YH 1YP9A 2QGRA 1FPHH 5GIBA 1QGFA 4HTCH 3PV2A 1OP0A 1O3HA 4O3UA 1G36A 1W7XH 3TGIE 1O2SA 3E8LA 3HPTB 4CRBA 4BTTB 3RDZA 1BTZA 1B7XB 2A2QH 3PTNA 2P8OC 3KQ5A 2XBWA 4CBNA 1EJMA 2G8TA 4DCDA 2YMSB 2STBE 3T29A 3TNTA 3LKWA 3F3BA 1CE5A 1RRKA 2ASUB 1GBTA 3CP7A 1VCWA 3NUMA 5EXNA 1HAVA 1ELVA 4OM9A 1P10A 2ZDNA 4YZUA 1IQKA 1IQMA 4ABAA 3HK6B 3BF6H 3E3TA 1QRWA 3QZQA 1S82A 4MQAA 3SU3A 4X1PU 3QN7A 2AERH 5DP9A 1O5BB 2XC0A 4R8TB 2BZ6H 5T3HA 1PPHE 1W0JD 1QCPA 3OEED 3BTQE 4BOHA 1BMAA 1EP5A 1F7ZA 1O3DA 1PPBH 1P05A 1K1NA 1O2IA 1KXBA 2ZCKP 3O8CA 2ZIQH 3UWJH 3K6ZA 3RXQA 1YPHE 3M3VA 1BTXA 6ESTA 1MTNC 1H8HD 5ESBA 5EU8A 1QA7A 1MU6B 3A87A 4X8VH 1Q31A 1ZHPA 4HZHA 2A7HA 1DANH 1GI7B 1J15A 1O31A 2AMQA 1YGCH 5C17A 1O3JA 1EP6A 1GJCB 1ABJH 3ELAH 3F9GA 1C5PA 4HFPB 5JPMH 4I8GA 1TGCA 2P93A 2FOAA 2GP9B 3A7XA 1YF4A 4H42U 2ZHQH 2A4QA 1LHFH 3BN9A 4X8TH 5JBCS 5C5NA 1DFPA 2A5KA 1AWFH 2BD9A 3EQ0H 1DLEA 1TBZH 3MH7A 9ESTA 3MO9A 3RXMA 1UTOA 4NA7A 1EAIA 1GHBG 4UFFH 3URCA 1L1GA 1C5UA 3GY7A 1L0ZA 4NZQA 2VIQA 1CA0C 5HGGA 4I7YH 1KLIH 4XOJA 1EZQA 3I29A 3KQDA 1LVYA 5GCHG 4NFEA 4THNH 5A8YA 1YM0A 2NU3E 4OGXA 1BDAA 1GJ4H 1O3BA 1WTHD 3NWUA 1BHXF 3PYHA 3OY5U 1QL8A 1C1QA 4O97A 1G9IE 2TGPZ 4ABEA 1T7CA 1E34B 1BTPA 3MU1A 2YMSC 2TGDA 1SQRA 2KCAA 2C93B 3SV6A 4X6MA 3MFJA 1MABB 1TX7A 2W26A 4AYYB 1AGJA 5GJ4B 3A86A 2BD2A 1Z8JB 5F8ZA 5DN6D 2J94A 3BSQA 3R0FA 1TBQH 4F55A 3IG6B 5C94A 1P2MA 2HVYB 5A2MH 2YNAA 1OKXA 2BX3A 3LC3A 2V0BA 2F4LA 1T8LA 1J8AA 2CF9H 5FCRA 4JZEH 3GCHB 4WWYA 3RMMH 1O3KA 1SVPA 3SU4A 1ZLRA 3ZZBA 3RLWH 3ZIAD 3AAUA 4WJG2 1P06A 2GT7A 1AUJA 1NO9H 4K1SA 2HLDD 1AZZA 1UK2A 5CHBA 1G3DA 2QXGA 3A8DA 4MPVA 4NIVA 4U30A 1SB1H 3S0NA 1GMDF 1IHTH 1GHYH 1T4VH 1HBTH 4WMEA 5J4SA 1QQUA 2F43B 1GL1A 2F9PA 4MNYA 1HFDA 4Q7ZA 5DP7A 4X6OA 2XRCA 1SKYE 2Y82A 1Z8GA 2XNIA 4ZKNU 1GBBA 1O2QA 1G2LA 4AOQA 1C1WH 3UUZA 1ZHMA 1TE0A 2F9UA 1HUTH 2GCHF 1TX8A 4OS4A 1GI9B 1U6QA 1TFXA 1TNGA 4OS7A 3ZZ8A 2BDBA 3CENA 3MU4A 3W95A 1FNIA 3ITIA 4UFEH 1PYTC 1G32B 5A0BA 6GCHG 2UUKB 4ABFA 3UQOA 2Z3EA 1SQTA 1C1OA 1RIWB 1SFIA 3TH3H 1E38B 4CRGA 1ID5H 1T8OA 2O8UA 5DP3A 3EDXB 3U8TH 1FY8E 2PGBB 1O2YA 1BITA 1NFUA 1XUHA 3QK1A 3KEEA 1O2LA 1C2JA 2SNWA 2PWXA 1VKYA 1XMNB 3ATLA 1RGQA 5EJZA 2OQ5A 3TVJB 2IPHA 1ZR0A 1NTPA 1OWHA 1TONA 4ACBA 1V2LT 1NFYA 3EE7A 4ASUD 1SG8B 4BTIB 2FPZA 1GCTB 1C5SA 4BAOB 2Y5FA 5HKKD 2WYGA 3CNRA 4ZROA 5T6DA 1FJSA 1BBRE 2Y6TA 1OYTH 1VZQH 3QZRA 3GCHC 2NU2E 1P0SH 3PROA 1ZJDA 5C3NA 4ABBA 1IQFA 2YMSD 4BNRA 2K8IA 4CR5A 4X1NU 7ESTE 1J16A 1O3IA 1SLWB 3PMJA 2FYRA 4HI3A 2J4IA 1LCYA 3B9FH 3FAOA 2ODYB 1BQYA 2H6MA 2F3CE 2GD4B 4H6TA 1GI8B 5T6FA 1ETRH 5L2YH 3T2NA 3U98H 3OSYA 4Q2KA 3U9AH 3RU4T 3K6YA 1V2UT 3MOCA 2UUFB 3PMHB 2BYAX 3BIVH 2C4FH 1ZTLA 1KXEA 3LU9B 5LGOA 1O3PB 2JH6D 1O39A 3QWCH 2H9HA 1KLJH 2RDEA 1ELCA 4MDSA 3ATMA 4XBDA 4LXBH 1GBIA 2WPIS 3I77A 1P11E 1C5OH 2Z9JA 3VB6A 2XCNA 4MPUA 2ZFFH 3MYWA 1C2EA 3V0XA 2AGIX 1AKSB 2OBQA 5LH8A 2OCVB 2RA3A 1ETSH 3EAJA 1LVMA 3S9AA 2ZU4A 3LGVA 4DJZB 5EQSA 1RIWC 1ANCA 2PKSB 3V13A 1Y59T 4Y8XA 1E36B 2FM2A 4IW4E 1HIAA 2OD3B 4NCYA 4Y0YE 5AHGH 1LKAA 1LKBA 1P9UA 2OUAA 3FOAA 1M9UA 5GXPA 4B6FA 4BTUB 3UTUH 1TNLA 3A7ZA 3QGNB 1T4UH 4BAKB 2QY0B
chains in the Genus database with same CATH topology
1OPHB 4ABJA 4HGCA 1Y5BT 1OX1A 3STJA 1Y3VA 1A0HB 1GCTC 2ZECA 4TY6A 4A1TA 1DX5M 1HXEH 2F9VA 3PMAB 1PQ8A 3ZZ5A 2GDEH 2ZU2A 2VVVA 3TK5A 3F9HA 3SJ8A 4Z0KA 5TJXA 1A5GH 1ORFA 1C2FA 3D65E 1AD8H 2WV4A 1H9IE 4O3TA 3M61U 2RA0A 1GBDA 3M35A 1PPEE 1C1VH 1UTLM 1MKWK 1YPKH 2FDAA 3L33A 3NK8A 4KTCA 1O30A 1TRNA 2XC5A 2ANYA 4WY3A 2SGAA 1Z1IA 2GTBA 3MH5A 2OLGA 3GCOA 1NRQH 1QR3E 2EI7A 1MU8B 1BJUA 2BD5A 1ELTA 3T25A 1X7AC 5CMXH 3IITA 2FMJA 1ZRBA 3KF2A 2RCEA 1N6XA 2ALPA 1O2XA 1TPOA 2AIPA 1ABIH 4CH2B 2FTMA 4FUCA 4NFFA 1V3XA 1CHGA 2HNTE 1ARCA 2FI3E 1UVUH 4K69A 1XUIA 4Q7XA 2ZG0H 1J9CH 2FWWA 2Q6DA 3SJKA 2P94A 4O03A 1GPZA 4BAQB 2A0QB 3RXVA 1BUIA 1EX3A 2Z3CA 2CGAA 5FX6A 1W8BH 4U01A 2PKSC 1W2KH 2Q6FA 3BTFE 3URDA 3F6UH 1C5ZB 2SGEE 4JYVH 1UHBB 3TGJE 1AMHA 1TQ7B 1NU9A 1OP2A 3ZZ4A 2ZC9H 1DM4B 5E2PA 1QHRB 1DLKB 1C1UH 3KL6A 3ZVAA 1NC6A 3LPRA 5A09A 3A82A 4NIWA 1MD8A 2WUBA 1CT2E 3PTBA 4KELA 4X2XA 2VIPA 3TPIZ 1QL9A 1ZRKA 1TOMH 2HALA 1Z71A 1C5VA 1DWCH 3BG4B 1P04A 1HAYB 2W5EA 4K1EA 2A4GA 4DURA 1FXYA 5FHTA 1GJ5H 3ZVGA 1IQIA 3HK3B 5A0AE 5JDUB 4ZH8A 3FP8E 1ZSKA 1WQSA 2OP9A 1SHYA 2NU1E 1GJ7B 2FS9A 2D26C 1P09A 1KXCA 5K0HA 1N6YA 1ZSJA 4E7RG 5DP4A 2P3UB 2QAAA 5HMAA 1CGIE 1SSXA 2BXUH 2GVFA 3LC5A 3TLOA 1SC8U 2GCHG 1DY9A 4XBCA 1QIXB 4YOIA 3IWMA 4INHA 4A1VA 1RFNA 3A7TA 4KTUA 3TU7H 1G37A 4GCHF 3DD2H 5FCKA 2XCFA 3LGTA 1S0RA 1BCUH 4YO9A 2WPKS 3ZYEA 2BY6X 1EB2A 6GCHF 5EPYA 3SHAH 4SGAE 4MNWA 2QF0A 1HAOH 1UCYK 5C2ZA 2R0KA 4LOYH 1SGTA 1SGPE 2UUYA 1FDPA 1HYLA 5EQQA 3SNCA 3VB5A 1KLTA 1ELAA 1LTOA 4B2CA 2A32A 4Y7BA 5F8TA 2VGCB 4YM9A 2EA3A 1TNJA 3VFEA 1GI5A 2OQUA 5JYIA 3AW1A 7GCHF 1DE7H 1W11U 5A8ZA 3EYDA 2DE8A 1OWDA 3GDVA 3LGUA 4KP0A 3JZ2B 1LHGH 3EGKH 1JIMA 4I8HA 3GY2A 4X6NA 1LPGB 1KXAA 1O3AA 1CQQA 1CHOF 1O5GH 3BTTE 1D6WA 1V2VT 3RXBA 1E0FD 4IC6A 3P8NA 4ZXXH 2KAIB 3BTME 4GUXA 2G81E 1DICA 1MTSA 3P70B 2VIVA 4BAHB 1K1MA 1P2JA 4FVBA 2PSXA 3HGPA 3BG4C 1TNKA 2ZU1A 4Y79A 1C5QA 1F0RA 5GWZA 1OXGA 1PPGE 4ESTE 3GYMA 1NT1A 2FX6A 2AH4X 3KCGH 2W3KA 1GI3A 2ZI2H 2W7SA 3E16B 1SGRE 4A1XA 4JZ1A 2ZNKH 4FUBA 3RXJA 4XSKU 1EB1H 4AN7A 2QV1A 1BTWA 3A7YA 2CV3A 5I46H 3LGYA 4Y11E 4JK5A 1W0ZU 1BJVA 2BDHA 3Q3YA 3E90B 4JYTA 3MO3A 4MPWA 3QX5H 1EZSC 2Q6GA 1W7GH 1O34A 1SR5C 1XXFA 4YT7H 3ZZ7A 1DUAA 1QFKH 2XC4A 1K9OE 1WV7H 2GCTB 4Y8ZA 1P57B 1O3NA 1D3TB 2PKAB 2XWBI 4AZ2B 3SUFA 4I8JA 1UTKA 2QXJA 3NXPA 4TY7A 1C5TA 2BOKA 4K2YA 1GI6A 3LGIA 4TWYA 1ANBA 3SGQE 3BIUH 1ZOMA 1AI8H 5CE1A 1TPAE 2VGCC 3GY4A 3SU1A 1C9TA 1ELDE 1Y3UA 3BEFB 2R2WU 3ZZ3A 2CHAB 2BLQA 1DXPA 5A8XA 5J4QA 9LPRA 4BANB 2EI8A 4K1TA 4LK4A 2ZU3A 3BTHE 1EATA 1E35B 2G00A 2VU8E 5AF9H 2IJOB 4Y10E 2J95A 1XVOA 1YPJH 1S6HA 4TYDA 2ESTE 2WV5A 1Q2WA 4E7NA 2G4UA 3F1SB 1F0UA 1SGDE 5EOKA 3UOPA 3A85A 2W3IA 4TPIZ 1SGIB 1A7SA 2STAE 1CVWH 1AQ7A 3SW2B 4ISLA 1DITH 1HGTH 4A6LA 4MG3A 2JETB 1JWTA 2AIQA 1A3BH 1MZDA 3P8GA 1AUTC 1VITH 3LIWA 1IOEA 3GCNA 1ZTKA 2YNBA 4X1SU 2Z9GA 4AORA 3V12A 1TAWA 1FONA 2XWAA 4KTSA 1YPGH 3SJ9A 1TGBA 3SU6A 1K28D 1ELGA 1YLDA 3M3TA 3K2UA 1UVOA 2CXVA 3M3SA 1TLDA 3CS0A 4AB8A 2PTCE 1NRNH 1AKSA 3C27B 4MTBA 1PPCE 1XUJA 1C2HA 3GOVB 1L2EA 2QXIA 1FAKH 1L1NA 4B1TA 2GCTC 5L30H 1YYY1 4AGJA 4QT8C 1ZGIA 1UVSH 1S81A 2GMTB 1QL7A 4CBOA 4RKJB 3GYLB 3RM2H 1DWEH 1Y5AT 3LDXH 1TBRH 1NY22 2D1JA 5BPEA 1RJXB 1MQ5A 3ZZ6A 1D3DB 3ENSB 2OC1A 1P3CA 3RXEA 4CHAB 2J2UA 2CHAC 1AVGH 1GJ6A 1E37B 2Y5HA 3ZZDA 3TH4H 3ATKA 5DG6A 1IQJA 3TITA 1SLUB 3LONA 2GDDA 4UE7H 3TJVA 4NZLA 2K1QA 3LJOA 1W13U 1WTGH 1FUJA 1K1PA 4IS5A 3SU5A 5E2OA 1BOQA 1BRUP 2HLCA 1WOFA 1D3QB 1JMOH 1SHHB 1WSSH 1YPLH 4OS6A 4NWLA 4UONA 2HVXA 2JETC 1Z6EA 4WH6A 1O2WA 4X1RU 3VEQB 1AE8H 2HNTF 1HAXB 3RC5A 1BMMH 5E8EH 1LVBA 2C8XB 4FXGH 1O3LA 1OSSA 1F5RA 1O3EA 3V3MA 3Q76A 4KKDA 1AZ8A 2ZFRH 5EQRA 1V2QT 1LPKB 1RS0A 3BTEE 2BVSH 3A8BA 3RMLH 3VGCB 1QY6A 2HGTH 2IN2A 2P59A 2FI5E 5C5OA 3JZ1B 1V2KT 2A31A 4GCHG 1MBQA 5HM9A 1OYQA 1LQEA 2AS9A 4X2VA 4GLYA 1LHEH 2ZTXA 3ESTA 1THRH 1TRMA 1C5XB 3OY6U 1TB6H 3EA7A 4X2YA 1JOUB 3GDUA 1HV7A 1PQ5A 2FOCA 4AFZA 1JRSA 2VB0A 4YT6H 5JBTA 2VJ1A 2SGQE 3D49H 2B7DH 4H6SB 8GCHG 3U1JB 3B23B 2D8WA 3TNSA 2ZCHP 1MCTA 2GZ9A 1QA0A 3BG8A 4ABIA 2A4RA 1UTPA 3F9FA 1NROH 1UHBA 2Y5GA 2GMTC 3MNXA 7GCHG 5FPTA 2Y7XA 3T27A 4CR9A 3PO1B 2BD7A 1ETTH 4FUHA 2C90B 1QJ7B 1OWEA 1J17T 5HYOA 1K1OA 1O2TA 3LGWA 2BQ6B 3TGKE 1GVLA 4CHAC 2VH6A 2Y80A 2BLWA 3O8RA 3RU4D 2FXRA 1FN6A 1CHOG 1PJPA 2Z9LA 4OS1A 2ZWLH 3T62A 4OS2A 4IMZA 2ZFTA 1KYNA 2Z3DA 1YPHC 1SL3A 4XDEA 5ABWA 4F49A 3H5CB 4AFSA 1G3EA 1Z6JH 1O2VA 2BHGA 8LPRA 1WBGB 1GBJA 3HKJB 2SGPE 1EZUC 2H1UA 2UWPA 1BRAA 2W7UA 1ZMNA 2A5IA 2VINA 3RXTA 2ZU5A 1LQDB 1CGHA 2R9PA 1XKAC 2R3YA 1O2PA 2A2XH 2BTCE 2EEKA 3NPSA 3OU0A 3A7WA 3UNSA 2FLBH 1J14A 2ALVA 3P6ZB 3GY6A 1BTUA 1TMBH 1K1JA 1GJ9B 1T8NA 5EPNA 1O3OA 3A80A 3F68H 4ABGA 1RTFB 1C5LH 3RXPA 1S84A 4JK6A 3UNQA 3VGCC 2ZDMA 3MU8A 1NU7B 3RXSA 3NKKA 1B0EA 3MNBA 1A0LA 2ZHEH 4AG1A 1C1RA 1L4ZA 1BIOA 2VVCA 3H7OA 1H8IH 1MKXH 1NZQH 2PW8H 1PPFE 4KGAA 1A4WH 2M5TA 1BTYA 4IN2A 2AFQB 2XBXA 5EXLA 5LPRA 3SNBA 1Y8TA 1LMWB 2QC2A 1QQ4A 1V2PT 4DGJA 4A7IB 1TYNA 3AW0A 1CT4E 3E0NB 4ZHLU 2RDLA 1T32A 3SQEE 3T26A 3I78A 1YCPK 1KIGH 1NM6A 1SLVB 4WMDA 1DDJA 1QRXA 1TALA 1TIOA 3PO1C 2PFEA 2SGDE 4I8LA 4UFGH 4VGCB 2BY9X 1EUFA 1L4DA 3KGPA 3M5OA 3LH1A 2JH5D 3MO6A 4Q7YA 1B0FA 2KAIA 3GY3A 4NSVA 2G5VA 3UFAA 4LZ1H 1JXPA 2B8OH 4JYUH 1KXFA 1PYTD 1C2MA 3FFGA 2PSYA 3K9XB 4SGBE 1AIXH 4H4FA 4D7GA 3RXFA 3PWCA 4UDWH 1O2JA 4J1YA 1UO6A 1NRPH 3BEIB 2Z7FE 3P17H 1INCA 2F9NA 1HNEE 3TK6A 3SO3A 6LPRA 1UK4A 3ODFA 1SI5H 4YLUA 3C1KA 1THSH 3TIUA 3QDZB 5FPYA 1FY3A 1XM1A 2ZHDA 2F9OA 1ZPCA 1JBUH 3RXDA 3BTGE 4TPYA 2GGVB 2SFAA 2ZGCA 1GCDA 4Y0ZE 3ZZCA 2A4OA 1TGNA 4IGDA 4PROA 1AB9B 4ZMAH 4IMQA 3SU0A 3RXUA 1DY8A 2PKAA 1AY6H 2A7JA 5AFZH 2P95A 3VB4A 1BRCE 5L2ZH 5DKMA 1QBNA 4K60A 1GI4A 5FBEA 4WXIA 2J9NA 1UTQA 3RXAA 3A84A 3HKIB 3RMNH 4ZXYH 1MKWH 1MAXA 1C1SA 4MPXA 1O2ZA 4JZIA 1V2ST 2LPRA 2BVRH 2XTTB 2H5CA 2NU4E 2PHBA 1C9PA 1FIZA 2O9QA 3DFJA 3TJUA 3A88A 2WPLS 1K22H 1VR1H 1YCPM 5FBIA 4ISHH 3VXFH 4ISIH 1P2KA 3ATWA 2CJIA 1DSUA 1P3EA 3EA8A 1V2JT 1EASA 4D9RA 1GHXH 4VGCC 1ZSLA 5F8XA 1SGFG 2QF3A 3KQCA 3RLYH 1K1LA 4GAWA 5DP6A 1G2MA 2WPHS 2ZZUH 4D9QA 1DOJA 1FY1A 2V35A 4UEHH 1HJAB 1ZPBA 3U8OH 2ZHFH 2ZEBA 2TIOA 3UNRA 3U69H 2ZPQA 3RXGA 1YPMH 1N8OB 3ATIA 2FOFA 1FPCH 2ILNA 2ZO3H 1PPZA 1GL0E 2FS8A 3GDSA 1MTUA 1O2KA 2FODA 2NU0E 1C2GA 1O2GH 1XXDA 1C1MA 4GHQA 3B8JA 1S5SA 1HAPH 1FLEE 1CT0E 2EI6A 1A5HA 4FUFA 1VGCB 1C5YB 1DS2E 1UMAH 2PTNA 1K21H 5LPEA 2PUQH 2R0LA 3A81A 1MD7A 1UJ1A 3S9BA 1F92A 2HPPH 4AFUA 1AB9C 1HDTH 1AN1E 1ELBA 4DT7B 1HRTH 5C67A 1NFWA 2JH0D 2AEIH 4YESB 2ZFSA 1O37A 1Z8RA 2RG3A 1SOTA 3BTDE 1LO6A 2BD3A 3SHCH 1S85A 1BA8B 1NRRH 3SQHE 3U8RH 3H7TA 2ANMH 5C20A 1V2TT 4RN6A 1G3BA 8GCHF 4X8UH 1O5FH 1SBWA 3MHWU 4B73A 3SI3H 4FU8A 1TGTA 4JZDH 3QTVH 1NESE 2GV6A 3QTOH 2UUJB 2ZA5A 1YC0A 3SJOA 4YTAA 3UY9A 5DO4H 2ODPA 1P03A 1S0QA 1P02A 2OTVA 5DPAA 3RU4E 3DUXH 1LDTT 1QURH 1QTFA 1V2NT 2BD8A 5CHAB 2OBOA 1MZAA 4Y6DA 1GHVH 2VIOA 3AASA 4Y7AA 2FEQH 2P3TB 3SJIA 1FMGA 1DWBH 1UCYH 5GDSH 1HJAC 1NN6A 5EODA 2J92A 1O0DH 2AMDA 1P8VC 1UK3A 4IBLH 5GPIB 1HLTH 4FUJA 1KXDA 1WU1A 1UTNA 2ZFPH 1N8OC 4X6PA 3PLPA 2QCYA 3E91A 1MAYA 3MMGA 1LHDH 1GMHF 2G55A 3D62A 4NA9H 4GVUA 1IQEA 1HAZB 1JRTA 1EJAA 3RP2A 1GMCF 2TGTA 2GV7A 2I6QA 1BBRK 1GBFA 4Y76A 1XUGA 1XUFA 3FANA 1KTSB 4ZHMU 1O3MA 1VGCC 3OTJE 1GI2A 5FXLA 1QJ1B 3ZVBA 2ZP0H 3EE0B 1SGEE 1VCQA 1XUKA 3OX7U 1EPTB 3BEUA 2HNTC 4BXSA 2O8WA 1AO5A 3RUOA 1V6DA 1TA6A 2ULLA 4WMFA 1QB9A 1SGQE 4U32A 3WY8A 2FYQA 3BTWE 1O3CA 2Y7ZA 2ZDKA 2PGQB 2DE9A 4I8KA 4CH8B 3ZVFA 4YOGA 2G52A 1MQ6A 3N7OA 1A5IA 4BAMB 5E0GA 6CHAB 2BB4A 2R3UA 4X0WU 1CGJE 5DJ7A 3TK9A 1TRYA 1GVZA 2BZAA 4B71A 3V7TA 1DXWA 5CHAC 4A92A 1CSOE 4OS5A 1AWHB 3A8CA 2ZHWH 1TX6A 4DY7B 1EOLA 2A1DB 1Y5UT 1XX9A 3P8OA 4NA8A 2FZZA 3E1XB 2FP7B 2THFB 5I25A 2P16A 1QBOA 3M7QA 1Z8IB 1TNHA 1TMUH 4NSYA 1C5NH 1EZXC 2VVUA 2Z9IA 4CRFA 1NPMA 1D4PB 1QRZA 2I6SA 5AFYH