1TLDA

Crystal structure of bovine beta-trypsin at 1.5 angstroms resolution in a crystal form with low molecular packing density. active site geometry, ion pairs and solvent structure
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine beta-trypsin at 1.5 A resolution in a crystal form with low molecular packing density. Active site geometry, ion pairs and solvent structure.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1989-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tldA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tldA02
1OWKA 4YOGA 1A4WH 1O2WA 1D3DB 1TA2A 2AH4X 1CU1A 4D9RA 1MBQA 1YPJH 1KXDA 2SFAA 1VITF 1YPKH 1HJAC 3FFGA 1GG6C 4BTUB 1FY4A 1DUEA 5JBAS 1PFXC 4X8UH 2GV7A 2CMYA 4O9VA 1FDPA 4MPXA 1DFPA 3IITA 3U8RH 4A1VA 1ZTLA 4KTCA 1BCUH 1O5DH 1GJ4H 2ZKSA 4I8GA 2FTMA 4M7GA 2QAAA 3OSYA 5GJ4B 3SU3A 1RXPA 1YC0A 2VJ1A 3A81A 2P3UB 2BLOA 1BTUA 1QL7A 3M5OA 1AUJA 1C5WB 1IQGA 1O3LA 1OP2A 3QUMP 4Y7BA 1ZHPA 1HFDA 3O8BA 1CA0C 3EDXB 1GHZA 2CHAB 3TJUA 4YLQH 3BTEE 1LTOA 4INHA 1XKBC 3A83A 3V12A 1P2MA 4NCYA 3TH3H 4ABJA 2SNVA 3VXEH 1FLEE 1N1LA 2ZGHA 1UVTH 1V2WT 1H8DH 4OGXA 1MTSA 4O3TA 1BIOA 2Y82A 4LZ1H 3Q76A 3A7XA 2O8LA 1DY9A 4AGJA 5FAHA 3PM3A 2BTCE 1TBQH 1DSTA 2OQUA 3A7ZA 4YTAA 4ISLA 1AMHA 1GMHF 4WJG2 1TX7A 1S82A 1C9PA 1ELDE 1C9TA 3PV4A 2VINA 3D62A 1QIXB 3A84A 1GBCA 3E0NB 5AVDA 3NWUA 3F9FA 2A31A 2ZP0H 2SGDE 3A87A 1BHXF 1TGBA 1O5GH 2H6MA 1CA8B 1XUHA 2ZCKP 1BQYA 1ELFA 1GBEA 3RXHA 1LHFH 3TNSA 5FXLA 4DIIH 2VGCC 1P02A 3OYPA 1TBZH 1UCYH 1GHAG 4I33A 3TGIE 1YPGH 3M7UA 4KP0A 1ZLRA 2C8ZB 2TGAA 1HJ8A 1CA0B 4K2YA 2PUXB 2GGVB 2UWPA 4XBBA 1LDTT 1GPZA 4BAOB 4MNVA 4XE4A 3SU0A 2XC5A 4Y76A 4ZHMU 3QZQA 1LKBA 3KGPA 1SGPE 1GBKA 1O2TA 3T25A 3CS7A 7KMEH 1XVOA 1ZOMA 1A0LA 4WMDA 1T7CA 3RXIA 2RCEA 3RC5A 1BTYA 1J8AA 1QJ6B 1G32B 1TRMA 4OS5A 1KXBA 1QNJA 5HXFA 1TA6A 2ZGXH 3RXSA 1FAXA 1EB1H 1F0UA 3F68H 3L3TA 4D76A 2CHAC 1SGEE 2PR3A 3ZZ3A 2D1JA 1Z8IB 5EOKA 1DWDH 4U32A 1HAYB 3A7VA 4CH8B 2J2UA 1INCA 1C5SA 1DSUA 1C4V2 3TH2H 1DXPA 5HM9A 3VXFH 1ZTKA 2ZDVH 2F9UA 1O5EH 3PLKA 2UUYA 1IHTH 1EOLA 1O2UA 1P06A 2ZU1A 2I6SA 3T62A 1LKAA 1HIAA 3BTME 4FUEA 1THSH 1IQKA 1AI8H 4F49A 4VGCC 8GCHF 1QTFA 1C1UH 4X8VH 3UQOA 3HPTB 2HNTF 2O8WA 3ZVEA 1HXEH 3UWIA 1QRWA 1UTMA 1W10U 2ZHDA 1T8MA 4B1TA 6GCHF 2QY0B 2ZGBH 2OTVA 1AWHB 1F92A 3B9FH 1C5UA 3ZZAA 3VB4A 4Z6AH 1HAHH 2VVVA 1MTVA 1O3AA 4F4OC 3A88A 2UUJB 2C93B 1W7GH 1BDAA 2ZDNA 1MTNB 1RD3B 3RXUA 4XDEA 2FOAA 1QA0A 2FEQH 3Q77A 1GHYH 5T6DA 1G3DA 3ESTA 2Z3EA 2AIQA 1O2JA 3PLPA 1SGFG 1ANCA 3RC4A 2ALVA 1C2KA 4MPWA 8LPRA 2HWLB 1O3GA 2ZFQH 2A7JA 5F8TA 1GJAB 2TIOA 2VWOA 2A7HA 4ZH8A 3BF6H 5GXPA 1ZJDA 1C4U2 4H4FA 2GVFA 1MTUA 2GTBA 3MU5A 3A82A 2VIPA 4A6LA 1DITH 4MNYA 1GI5A 5DPAA 4D7GA 1H9HE 1NFXA 1EJMA 1HAGE 2BX3A 2G52A 3SZNA 1MCTA 1C2DA 2H1UA 4K60A 1ZPBA 2KAIA 1BTXA 1VJ9U 2AERH 5ABWA 1XUKA 4TPYA 1GI3A 4WH6A 4NIWA 2P94A 4OS6A 3RP2A 4SGBE 1XM1A 4Y11E 4WF8A 1ORFA 5CE1A 3NK8A 1ETSH 3I78A 2QXGA 3EGKH 1UK4A 3MTYA 5BRRE 1GJBB 5IDKA 4JZFH 1MAYA 3MH4A 2F9VA 1FZZA 3KCGH 4ISHH 1OS8A 1PQ8A 2OC1A 2FM2A 2GZ9A 3VB6A 5A8ZA 1AVXA 3E6PH 3L33A 1L1JA 3RXLA 3SUEA 3KQBA 3E1XB 1VZQH 1V2ST 3S69A 5TJXA 4J2YB 1PPZA 1QURH 2RG3A 5JBTA 1QQUA 5HGGA 3UR9A 4AZ2B 1C5PA 5C5OA 2VWLA 3GY7A 4FUHA 4FUDA 1D4PB 2I6QA 3SU2A 3SU4A 1UO6A 3P8NA 1O30A 4HI3A 5DP7A 2H5CA 1AU8A 5A0BA 4X2YA 1SVPA 3V13A 3TU7H 5PTPA 1O5FH 2A2XH 1EPTA 4GCHG 2Y6TA 3MNBA 1RIWB 3MU0A 1PQ5A 2ZFPH 1GVLA 3SUFA 3A8BA 2QXJA 1GHBG 1GI2A 1PYTD 1YF4A 4FUFA 3A85A 3MH6A 4AFSA 4WWYA 2J34A 2ZU4A 3RXGA 4I31A 2ZECA 1O3FA 1QJ1B 2ZGCA 1NC6A 3RC6A 2PUQH 2Y5GA 1AVGH 3EA7A 1DE7H 4IMZA 3RM2H 5I25A 4FXGH 4OS1A 3MU4A 1Z71A 1O3BA 1IQNA 1H1BA 2QN5T 2J4IA 4YM9A 1NRPH 1O39A 4IC6A 2ZFFH 1E0FD 3URCA 1AN1E 3P95A 4A1TA 1GVZA 1FNIA 2Q6GA 2ULLA 1DM4B 1EQ9A 1TX6A 1Y3XA 1B0FA 3M3VA 1EZUC 4GCHF 5A09A 1BITA 2BDYA 1P2QA 1TNJA 2OUAA 3ZVCA 4AFZA 3FZZA 3OY6U 3HATH 4FU8A 4NSYA 3IG6B 1BTZA 1EP6A 3P8GA 5JYIA 4E7NA 1P2NA 3PLBA 4ZKSU 3GCNA 2ZQ1A 1YCPM 3ZYDA 2ZHFH 1UTJA 4ABHA 2A5KA 2ZTXA 2C4FH 2D8WA 1QJ7B 5AF9H 2DE8A 1GMCG 1MTWA 5E2PA 2O8TA 2ZCLP 3F9GA 1ABJH 3MHWU 1JIMA 1DWEH 3BIVH 3SHAH 1FAKH 1GWAA 1OSSA 1FPHH 2QGRA 1FN6A 4O03A 4ZROA 3ATLA 2SGEE 1O0DH 3LU9B 1JOUB 4K8BA 1JBUH 1A2CH 4NA9H 2PTNA 4THNH 3GCTG 1UMAH 2GT8A 2PKAA 2SGAA 1WV7H 5DK1A 1K1OA 2J95A 4X0WU 1JMOH 2WPMS 4MVNA 1RFNA 3RDZA 2WPIS 3H7TA 4FUBA 2HALA 1T4VH 1PPEE 1AIXH 2C8XB 1HAVA 2QXIA 3T28A 1O36A 1D6RA 4Q80A 1H4WA 1LVOA 1O3OA 5GDSH 1PPHE 4DIHH 3GDSA 3SBKA 1F5KU 1HLTH 3RXEA 1NZQH 1NRNH 2BVSH 3SUGA 5EXMA 3H5CB 3NKKA 2BMGB 3GDUA 3ZVDA 3UFAA 2C90B 3ITIA 1DLKB 2V35A 1SQTA 2R0LA 4IN1A 4I8HA 3UNSA 2HRVA 1OWHA 1NFUA 3A8AA 1FMGA 3BG4C 2G5NA 4INLA 1C1NA 1AVWA 4WXVA 4X6OA 3AW0A 1YM0A 2PKSC 1C2HA 5G4BA 1GMHG 5LPEA 2ESTE 1DS2E 1VCQA 3RMLH 4IW4E 1E38B 1PPGE 3TITA 1CGJE 1O3IA 2PFEA 4DURA 4KKDA 2EI6A 3OY5U 1NM6A 1GDUA 3STJA 3MO6A 3A89A 4U2WA 1ANBA 3GY8A 1UJ1A 1GBMA 1SLVB 2K1QA 2BQWB 5FCKA 3EAJA 2UUKB 2A4QA 2CV3A 2HPPH 2VIVA 2OBOA 4A1XA 1GL1A 1AHTH 1OWDA 2GZ8A 3K65B 2ZHWH 3NUMA 2BOHB 2TBSA 1FXYA 1EAWA 5GIBA 1CHOG 1ZRBA 4FUIA 2H2ZA 4NG9H 4XBDA 1XXDA 3A7YA 2NU0E 4NFEA 3ODFA 1O3EA 4RKOB 2BDAA 2ZPRA 1AWFH 3MMGA 1O35A 3PROA 2BY6X 3TJOA 3M5NA 1K9OE 1GBJA 1SL3A 2Q1JA 3I29A 2H9HA 1WCZA 2SNWA 1SLWB 1RTLA 2J94A 2BD2A 2QIQA 1K1LA 3QX5H 2XWAA 1N8OC 1O2ZA 1JIRA 3EA9A 2ZFTA 1BJVA 2B0FA 1C5RA 3E3TA 4B2AA 3LGWA 2ZC9H 2HVXA 1C1OA 4JZEH 3RXMA 4DVAU 2TRMA 2A2QH 2ZHQH 4ABGA 1MKWH 7ESTE 1TE0A 2THFB 1NS3A 5EODA 5EW1H 1BUIA 2G81E 1WSSH 3LC5A 5DP9A 3HK3B 2P3FH 1O2IA 1GGDC 3BTWE 1ARCA 4IC5A 2WPLS 4HZHA 1MU8B 2OC8A 3JZ2B 1B7XB 1C2JA 1O2NA 4BOHA 1H9LB 2P8OC 4YOJA 4DOQA 1Z6JH 4SGAE 4I32A 2Y7ZA 1NFYA 1SLUB 4X8SH 5E0JA 1TRNA 3T2NA 5DKMA 2QC2A 2BYAX 4E05H 2FI3E 3A80A 3PO1B 1B0EA 1TQ7B 1EOJA 2A1DB 1O3PB 3QDZB 2GV6A 1ID5H 4BNRA 3QLPH 1HAPH 1Z1IA 4X1RU 4BAMB 3SI3H 3SGBE 1GJ7B 2HNTE 2XBVA 3SV7A 1GJDB 2BVXH 1F7ZA 1OP0A 1V2KT 2HOBA 2UUFB 4NZLA 4AYYB 1MKWK 1A5HA 1GCTC 1TNHA 3DHKH 3U98H 2TGTA 1P04A 3KQEA 2IOTA 4Y6DA 3C27B 2BX4A 1P8VC 6CHAC 5FPTA 1Y5UT 1K1IA 3Q3YA 3RXFA 2WINI 1VITG 1LPGB 1MBMA 1C5XB 1G3CA 3RM0H 4AB9A 4JYVH 3FP6E 1ZZZA 4IBLH 4BXWA 2BM2A 2CGAA 2EEKA 2PGBB 1ZGVA 6CHAB 1SGFA 1LQDB 3AVZA 1JXPA 3MI4A 1UTKA 2VH0A 3AW1A 3DA9B 1DDJA 4DG4A 4ZKNU 3PB1E 4CR9A 2BXTH 1NTPA 2A4GA 4BAKB 1YCPK 2V3HH 1MH0A 2OC7A 1QA7A 2WV4A 3A86A 3PWBA 3SUDA 2FPZA 4FUJA 2A5IA 1HDTH 1LCYA 3M3SA 5CHAC 2FWWA 3OX7U 1TYNA 4ZKRU 2W3KA 4DGJA 1A7SA 3LGTA 2R3UA 1Q31A 2R2WU 1U6QA 2M5TA 2NWNA 3S7KB 1Z8JB 3P8OA 2NU1E 3ELAH 1QRXA 1GJ9B 4ZXYH 2BD9A 2XWBI 1GJ5H 1OP8A 5AHGH 1AB9B 1C5VA 1SQOA 1DUAA 4O97A 3SU1A 3LGVA 1XUFA 2PHBA 3BEUA 3ZZ7A 1AFQC 1CT0E 4WMFA 5ESTE 1JRTA 1V2OT 2W3IA 3QO6A 2JETC 5LH8A 3UREA 2ZU3A 3RU4T 3M5MA 2BDGA 2ANMH 1IQIA 3OTJE 1LVBA 2FDAA 1HJ9A 5H4IB 2PLXA 3BG8A 1BRUP 4INKA 2BQ7B 3GCHC 1O3DA 1TONA 4TYDA 2Z9IA 5A0CA 2WV5A 4UONA 2WUBA 2GZ7A 2NU4E 3PYHA 1AE5A 2C8WB 1G3EA 2ZDMA 2RA3A 1NO9H 4U30A 1V2MT 1KXAA 4R0IA 1C1TA 1MD7A 3UQVA 1C4Y2 3FAOA 1CO7E 3GCOA 1C5QA 3F9HA 3U9AH 4X2VA 1TGSZ 2ZHEH 1OWEA 1NROH 3SO3A 1WAYB 1ZPCA 1MQ5A 2G4TA 3RXVA 4CRFA 4Y79A 2F9PA 2FXRA 1SGIB 3SJKA 3PMHB 1EKBB 4K3JA 1XMNB 1L2EA 2BDIA 4B73A 1C2LA 1XVMA 2BD8A 4ABAA 4BTTB 1V2LT 1PPBH 2GD4B 1CGIE 3RXPA 1C2IA 4I7YH 3TK9A 2Z9KA 2B5TB 2Z6BD 1TFXA 3K6YA 1ELEE 4IS5A 5ESBA 2A32A 4I8LA 3SN8A 4X6PA 4JYTA 1NPMA 1MD8A 3RXBA 1VGCC 1S5SA 2VIOA 1HPGA 1N6YA 3KQCA 1S0QA 2AGGX 2GCHG 4DY7B 2BDHA 4UFDH 3ZVFA 1TGTA 3KHVA 3EYDA 1T8OA 1DWBH 1EJAA 1RIWC 3UIRA 1J15A 1OWJA 4Q7XA 2HNTC 3BTFE 3A8CA 4Y0ZE 1RGQA 2VIQA 2O9QA 2J9NA 2FIRH 3MYWA 4B74A 3M35A 4B2CA 1BBRE 1LQEA 1RTFB 4ZHLU 3MU8A 2BDBA 1GHBF 3QN7A 1IQFA 2BY5X 1RS0A 1BZXE 1L1NA 3D65E 3TPIZ 2ZEBA 1EATA 1FV9A 1TPSA 4FVDA 1FPCH 4OGYA 1BTHH 1UVPA 3ZZ5A 5J4QA 1K1PA 5FHTA 2FO9A 1EAXA 3SV2H 4CRCA 3UY9A 2H9TH 5E0GA 1GI6A 1TMUH 4Q7YA 1K1MA 4FVBA 4TWYA 4B75A 4RSPA 2XCFA 2ZU2A 1TMBH 3KL6A 3LIWA 1V2QT 1AE8H 1QR3E 3BIUH 2OCVB 2PSXA 3ODDA 1UK3A 5JPMH 1ELAA 1V2VT 4LZ4B 2WPJS 3BTKE 1BA8B 3RMNH 1O2RA 2ZNKH 1XX9A 4MNXA 3SV8A 1AKSB 4AOQA 3RXCA 4BANB 2ODYB 1P03A 1ZSKA 1QCPA 5TCAA 2A5AA 1GJ6A 3UTUH 4NIYA 1K22H 3AASA 1LHCH 1SOZA 3RMMH 1NU7B 3RMOH 1MKXH 3QGNB 4ABIA 4X1QU 3UWJH 3RU4E 1J16A 1VR1H 1L4DA 2CJIA 2GP9B 4KTSA 3RU4D 5E2OA 2B9LA 4UDWH 1NFWA 3FVFB 1LPZB 1P05A 2P8OB 1O5CB 3FANA 3HKIB 4X1SU 3SV6A 1V2TT 1P11E 1AFEH 5LGOA 1DWCH 1UCYK 1TQ0B 5EQRA 3FZDA 1TOMH 1HAVB 1UHBA 4JZDH 1O2VA 1HAZB 3K2UA 1RTKA 2W26A 1P2IA 3KNXA 4NA8A 4Y10E 4UD9H 3STIA 5LPFA 2Z9JA 1ETRH 2G4UA 2FLBH 5F8XA 1SGQE 1GHXH 2ILNA 3QTVH 3QZRA 4GVUA 1NRRH 1ESTA 2TGPZ 3SNDA 2H5DA 2ALPA 1TPOA 1FY5A 2BD5A 1ZHMA 2SGFE 1V2PT 3LC3A 2EI8A 3UNRA 1PQ7A 1HAIH 1T4UH 4CRGA 1K28D 4IN2A 1C5LH 3TVJB 5EG4A 1MZAA 1BBRH 3R3GB 2P16A 1HCGA 2OLGA 1HYLA 4RN6A 3ATIA 1HV7A 3T27A 4BAHB 3KIDU 1DVAH 1C5NH 1ZHRA 1O2LA 5JBCS 5EPNA 3W95A 1Z7KA 3PWCA 1XUIA 2P3TB 3LKWA 1UTOA 2FLRH 1GJ8B 3F9EA 1S83A 4Y71A 5GCHG 3O8CA 1HNEE 3NPSA 1C5TA 2AMQA 1LHDH 1FJSA 1ESBA 2C8YB 2JH0D 3KF2A 4AYVB 5GWZA 1BB0B 1CVWH 4AN7A 5IYTA 3SU5A 4NA7A 1QY6A 4WXIA 3F6UH 2P93A 1VITH 4JZIA 1C1QA 2VGCB 1DPOA 5C1XA 1PPCE 4FUCA 3ZVBA 4X1NU 3GOVB 1WTHD 2GDDA 2XTTB 4AFQA 1IQMA 4MG3A 2F3CE 2YNBA 4YT7H 3I77A 1TGNA 2XBXA 4O3UA 1T8LA 3PMJA 4AG1A 3MFJA 1KDQB 2BD4A 3ATMA 3HGNA 3ZZDA 4GAWA 4X1PU 2IPHA 4UFEH 1ZSLA 5DP6A 3MH5A 4D8NA 1TMTH 5L6NH 1ZSJA 1F0RA 2BLQA 1CHOF 3S7HB 5C1UA 1ZPZA 3U69H 6ESTA 1GBHA 4FUGA 3LGUA 4MLFB 1FY3A 3U1IB 2IJOB 3ZVGA 1EASA 2Q6FA 1Y59T 4X2WA 2RDLA 1NN6A 5EQSA 2PV9B 3SJOA 3ZZCA 5F8ZA 2VB0A 2F9OA 4IGDA 1C5YB 1EPTC 3SQHE 1AUTC 2WPKS 4I8KA 5B6OA 2XXLA 1KTTB 1S6HA 4A5TS 1GI7B 1HUTH 1MUEB 1TALA 2AGEX 2OINA 3GCTF 1JWTA 9ESTA 1WTGH 3EA8A 4ZHAA 2FOCA 1GGDB 1FUJA 4FU7A 1ELGA 4ABEA 5K7RA 2BY9X 1BTWA 4A92A 3AAVA 6LPRA 1EUFA 1FQ3A 4DJZB 1ANEA 2D26C 2VH6A 2R3YA 1A61H 5FBIA 8GCHG 4Y7AA 1G36A 1MQ6A 3UUZA 5F03A 3SOSA 5EW2H 4FU9A 4UFGH 1NT1A 2V3OH 3ATKA 2WUCA 1BRBE 1PYTC 1SHYA 1WYKA 1UVUH 2FS8A 2A4OA 1QB1A 2FX4A 3ENSB 3ZZ6A 3HGPA 1D6WA 2OBQA 1C2EA 1XUJA 1W3CA 1ELCA 5L2YH 1T8NA 3TIUA 3BEFB 2ZQ2A 4JYUH 4UE7H 3MU1A 3R0FA 2AS9A 3MH7A 2HLCA 1NESE 3QTOH 2P95A 1L1GA 3B8JA 1HBTH 4XFQA 3SORA 4AORA 4E06H 3O8RA 1O37A 1H9IE 1QQ4A 3RLWH 2F9BH 1TNLA 2ZIQH 1HAXB 2ZG0H 3D49H 1O2QA 1MAXA 1WQSA 4U01A 1K1JA 3PMBB 2GCHF 4J1YA 3URDA 3S9CA 1TABE 1ARBA 3CP7A 3TJNA 4ZMAH 2FOGA 3U8OH 5DGJA 1TX8A 3PMAB 2ZPSA 1LMWB 4K5ZA 1E34B 1OXGA 5EPYA 3EE0B 2FOBA 4NZQA 1L0ZA 1KLIH 1LO6A 2UWOA 2FODA 4GUXA 4UEHH 1O5AB 2QA9E 2FI4E 3AAUA 1TNIA 2XBYA 1YPMH 1EZSC 3VFEA 1Y3VA 1KY9A 4H42U 1SQAA 1SFIA 1ZMNA 2AMDA 4ZAEA 1P09A 1GI9B 3VB7A 3GY6A 5HMAA 1HB0B 1SMFE 1QHRB 3SI4H 1O2MA 1DXWA 4GSOA 2O8UA 1YKTA 1BJUA 3TLOA 1C5MD 2Z9LA 7LPRA 1ZTJA 1Y3UA 3LDXH 1SGTA 4H6TA 1XUGA 1W11U 3MO3A 4KELA 3MOCA 2ZGJA 3BSQA 3UR6A 1GBIA 3GY4A 1EZXC 1BRAA 1QBOA 2PTCE 2BLWA 2Z3DA 1UTPA 2OQ5A 5SGAE 1G30B 1BRCE 1T32A 1KLJH 4NIXA 1TPAE 2TGDA 4UFFH 1OWIA 4DW2U 2PSYA 5EXNA 1VGCB 3TGJE 1QB6A 2V0BA 4GHTA 1G2MA 5DP4A 1TGCA 2G5VA 3UOUA 4ASHA 3DD2H 1UCYE 3TK6A 1IAUA 4MPVA 1EP5A 2EC9H 1DANH 2FESH 1G37A 2YOLA 3SV9A 4DCDA 1NU9A 2PWXA 3VEQB 3DT0H 5AFYH 1K21H 1BHXB 3ZVAA 1GBFA 1ELVA 2WYJA 1CBWB 1VCPA 2GCTB 3ZZBA 3LONA 1P57B 4YZUA 4CR5A 1TNGA 3S9AA 4TY6A 4OS2A 2FYQA 1SLXB 4JK6A 4X6MA 2FI5E 5EU8A 1UVOA 3RXJA 4ABFA 1UVSH 3QK1A 4KTUA 1GVKB 4JZ1A 3D23A 4TY7A 1Y3WA 1DY8A 5DO4H 1ZR0A 2GMTB 4CBOA 1V2RT 4WVPE 3E8LA 1F0TA 4JMYA 9LPRA 2QF3A 1THPB 5A8YA 2JH6D 5FPSA 4AFUA 3MNCA 1P01A 4YLUA 1V6DA 2HGTH 2A0QB 1GHAF 1F5LA 1KXFA 1QL8A 2BOKA 3P70B 1KLTA 1SG8B 2BHGA 3RXDA 3SNCA 1GBDA 1LHEH 1J9CH 1KIGH 1O34A 2JKHA 2ZCHP 2BD3A 1O2SA 3KEEA 4MPUA 4LK4A 1C2FA 1FY1A 1FIZA 1O2OA 3GYMA 3PTBA 3SGAE 5FCRA 4VGCB 2ZO3H 3OU0A 2ZPQA 3RXTA 2FZZA 1O2KA 1FY8E 2A45B 1OX1A 3W94A 1AKSA 3LH1A 1L4ZA 1TRYA 3E0PB 2ZFRH 1IQEA 2WPHS 3VB3A 3RXKA 1O32A 1SGDE 1BMMH 4ZXXH 1OPHB 3GCHB 4Q2KA 5FX5A 2AFQB 5T6GA 2B8OH 1C2GA 1UTNA 2FOFA 3MNSA 2ZDLA 3TNTA 1G3BA 1P0SH 1ELTA 2GMTC 2R9PA 3BTHE 2DUCA 2ZDKA 4OS4A 2BXUH 1W2KH 1EPTB 1SGCA 2BVRH 2F83A 4QT8C 1QBVH 1QL9A 1Z1JA 4HGCA 3VPKA 1TWXB 2FTLE 2W7SA 1C1VH 2AGIX 4Z0KA 1O3JA 3P92A 4X6NA 2GCTC 1AQ7A 1WBGB 5JBBS 2CN0H 1GBBA 2CF8H 1W0YH 3VB5A 1D9IA 2ZTZA 5DP5A 3ZV8A 5JB8S 2OXSA 4LOYH 1YPHC 5L2ZH 1C1RA 3CENA 1F2SE 1LVMA 1E35B 4AB8A 3LPRA 2BZAA 1B5GH 4Q7ZA 1A0JA 2VWMA 3SNEA 4HFPB 5JDUB 2CF9H 4NSVA 3ZYEA 1EZQA 3Q3XA 4K1EA 3ZV9A 5A0AE 1GMDF 1YPHE 2OC0A 3F1SB 2C3SA 4K1SA 1GDQA 1PPFE 1GMDG 1P9UA 1G9IE 2H9EH 4ISIH 5J4SA 1P2JA 3GYLB 4IMQA 1H8IH 1ZMJA 3T26A 1KYNA 2AYWA 1OOKB 3RXAA 1DX5M 3M7TA 4AX9H 1EXFA 1SPJA 2GT7A 2QYIA 4NWKA 3BTQE 4B71A 1C5ZB 2Y80A 3BTGE 3KN2A 4XOJA 1D3TB 3WY8A 1O2GH 1BT7A 1AY6H 2P59A 1D3PB 2ANKH 1O2PA 3S9BA 4ZKOU 1IQLA 1SSXA 1ZJKA 4JK5A 1MU6B 5EXLA 3O8DA 2JETB 3T29A 3T5FH 1CQQA 1GBLA 1V3XA 1TOCB 4CBNA 3C1KA 5C67A 7GCHG 2STBE 4ABDA 1Y5BT 4YESB 4YOIA 1MCVA 1SI5H 3LGYA 2Z7FE 1FIWA 1GHVH 2ZWLH 2Q6DA 1ZYOA 2A4RA 2QV1A 1KXCA 1FONA 1ETTH 2XYAA 4WMEA 1BMNH 2G55A 1TNKA 3NCLA 1QGFA 4DT7B 2B7DH 1GCDA 1C1MA 1ACBE 5A8XA 1A1RA 1ZMLA 1IOEA 1CE5A 1AFQB 3M5LA 1YPEH 1A3EH 4K8YA 2LNCA 1WOFA 1S81A 5LPRA 1TBRH 4PROA 4K1TA 1C5OH 1AB9C 1MKXK 2WYGA 3TH4H 1UTQA 3TK5A 3M36A 1PJPA 1CHGA 4XSKU 1SR5C 3U1JB 1A0HB 1C1PA 1CSOE 4MQAA 3SW2B 3V7TA 1GG6B 2BDCA 2QF0A 5I46H 1CT2E 2GDEH 2Z94A 2CXVA 1WUNH 2ASUB 2HPQH 3M3TA 2ZFSA 1TIOA 2XNIA 3ZZ4A 3EQ0H 1BMAA 1SGNE 4BTIB 4CRBA 3RXQA 2DE9A 1SFQB 3K9XB 3M7QA 2ZU5A 2FOMB 3HKJB 1BMLA 1ZGIA 2PKSB 3GY3A 1SBWA 4ISNA 1OKXA 3SU6A 3SNAA 5C20A 5HM2A 4ISOA 5A2MH 2NU2E 2EI7A 3NXPA 2ANWA 4R8TB 3RLYH 1YYY1 1XKAC 2ZA5A 2R0KA 1X7AC 1GI4A 1P12E 1QRZA 2QCYA 3ZZ8A 3P17H 2VVCA 1HJAB 1O2XA 2BB4A 4MNWA 1GI8B 1MZDA 1GMCF 1O5BB 4B2BA 8KME2 1JRSA 2F91A 2XBWA 3CS0A 3DFJA 1HIAB 2OP9A 2W5EA 5AFZH 1SHHB 2Z3CA 3U8TH 1V2JT 3FP8E 3FP7E 1SGRE 2OD3B 5TCCA 1KSNA 5FX6A 1C1SA 2QXHA 3LH3A 1P3EA 1Z8RA 1SGYE 1WU1A 3H7OA 1HGTH 2AIPA 4ESTE 1VCWA 1FI8A 1P2KA 1AD8H 5E0HA 2BY8X 2SGQE 1Z6EA 1V2NT 3MNXA 5C5NA 3TJVA 4GPGA 1Y8TA 1YLDA 1UHBB 2VVUA 3M61U 5F6MA 3PO1C 1YLCA 5K0HA 1E37B 4BAQB 2IN2A 1AZZA 1CGHA 7GCHF 1YPLH 1A46H 2FYRA 2XW9A 1O3CA 3V3MA 5L30H 2Y5FA 3UOPA 1P10A 3A7WA 3LOXA 1Y5AT 1N8OB 5CHAB 3LJOA 1C2MA 4CHAB 1LPKB 6GCHG 4Y8ZA 1PQAA 3G01A 1GCTB 4KGAA 3SQEE 2FS9A 1TPPA 2ODQA 5GPIB 3Q3KA 4RKJB 2RA0A 1HXFH 1YCPH 2J92A 1KDQA 1EAUA 5ETXA 4MTBA 1O31A 1AGJA 2ZTYA 3DFLA 1YBWA 1DICA 2XC0A 2BD7A 2Z9GA 4NWLA 2PW8H 4Y8YA 5C2ZA 5T3HA 2VNTA 1W14U 5E8EH 1W8BH 1ESAA 1MMJN 5FBEA 3SGQE 1S85A 1THRH 4WH8A 2G51A 1BOQA 3A8DA 1NRSH 2TPIZ 5EQQA 2AEIH 4CRDA 1EB2A 2NU3E 4GHQA 3JZ1B 1C1WH 4X2XA 2VIDA 4A7IB 2GKVE 2VWNA 3BEIB 3UPEA 5DP3A 2KAIB 1ANDA 3GY2A 3Q00A 3GDVA 4WY3A 1D3QB 1FN8A 3GY5A 4NIVA 3SNBA 4D7FA 5DG6A 1W12U 2G00A 2R2MB 1HAOH 3MWIU 4GLYA 2G8TA 3MO9A 1Q3XA 2FX6A 4NGAH 1UTLM 3TGKE 5HYOA 1QB9A 1IQJA 1TB6H 1GL0E 1YGCH 3K6ZA 1W0ZU 1GDNA 2W7UA 3BG4B 4CRAA 2BLVA 1GI0A 4YO9A 1Y3YA 3QWCH 8ESTE 2JH5D 4LXBH 4Y0YE 1DT2A 1LHGH 1NY22 2PGQB 4B76A 1SOTA 1HRTH 2Y81A 4I8JA 2VU8E 1RJXB 1O3NA 4K69A 1J14A 3SHCH 1P2OA 3PTNA 1SC8U 3P6ZB 3ATWA 4HTCH 1O38A 4Y8XA 1P9SA 1KXEA 1J17T 2UWLA 1AO5A 3E91A 5DJ7A 3UNQA 1CBWC 1V2UT 2XCNA 1DOJA 4OS7A 2STAE 2XC4A 3N7OA 3LJJA 4CHAC 1EX3A 3LGIA 3HK6B 5C3NA 2ZZUH 2FMJA 1YP9A 3SJIA 3DUXH 1O3MA 5CMXH 3A7TA 1IHSH 5C1YA 1XXFA 4ABBA 3BTDE 3VGCC 2BZ6H 1BBRK 4YT6H 3S0NA 4JCNA 3RUOA 1EAIA 3NZIA 1O2HA 1Z8GA 2ZDAH 1A5IA 2ODPA 3RXRA 1GI1A 3GICB 1O33A 1DLEA 4BXSA 3RXOA 1SB1H 1TAWA 2BQ6B 2J38A 1OYTH 2O8MA 3BTTE 3B23B 4NFFA 1UK2A 4ZUHA 1O3HA 1W7XH 2EA3A 2V6NA 1W13U 1S6FA 1WQVH 1IQHA 1F5RA 1EJNA 5BPEA 3SJ8A 1ELBA 1Q2WA 4MDSA 4TWWA 1G2LA 2LPRA 1BTPA 4AGKA 1A5GH 1GHWH 2ANYA 4TPIZ 1ABIH 3VGCB 5FPYA 3P8FA 2FOEA 3GISB 4H6SB 1O2YA 5EGMA 1GJCB 1OYQA 1T31A 1MTNC 1RRKA 3M37A 4XBCA 1NRQH 4E7RG 2FP7B 3E90B 2AMPA 3KQDA 2FOHA 1A3BH 2ZF0H 5JB9S 1KTSB 5T6FA 3V0XA 2BY7X 2VIWA 2GX4A 1TLDA 4D9QA 1S84A 1P3CA 2Y5HA 2SGPE 3LT3A 3QGJA 4X8TH 2XRCA 2ZI2H 1N6XA 1M9UA 1ZRKA 1GBAA 3BV9B 4AG2A 1VJAU 2PKAB 2Y7XA 1F0SA 1K1NA 1S0RA 5DP8A 5GCHF 1K2I1 1QFKH 1LVYA 3L6PA 2A7CA 1QBNA 3IWMA 1E36B 3ZZ9A 4CREA 2YNAA 3SJ9A 1CT4E 3BN9A 4CH2B 1AZ8A 2F9NA 1GBTA 2D2DA 3E16B 1O3KA
chains in the Genus database with same CATH superfamily
1OWKA 3DCLA 4YOGA 1A4WH 1O2WA 1D3DB 1TA2A 2AH4X 1CU1A 4D9RA 1MBQA 1YPJH 1KXDA 2SFAA 4Z1MD 1VITF 1YPKH 1HJAC 3FFGA 1GG6C 4BTUB 1FY4A 1DUEA 5JBAS 1PFXC 4X8UH 2GV7A 2CMYA 4O9VA 1FDPA 4MPXA 1DFPA 3IITA 3U8RH 4A1VA 1ZTLA 4KTCA 1BCUH 1O5DH 1GJ4H 2ZKSA 4I8GA 2FTMA 4M7GA 2QAAA 3OSYA 2OK5A 5GJ4B 3SU3A 1RXPA 1YC0A 2VJ1A 3A81A 2P3UB 2BLOA 1BTUA 1QL7A 3M5OA 1AUJA 1C5WB 1IQGA 1O3LA 1OP2A 3QUMP 4Y7BA 1ZHPA 1HFDA 3O8BA 1CA0C 3EDXB 1GHZA 2CHAB 3TJUA 4YLQH 3BTEE 1LTOA 4INHA 1XKBC 3A83A 3V12A 1P2MA 4NCYA 3TH3H 4ABJA 2SNVA 3VXEH 1FLEE 1N1LA 2ZGHA 1UVTH 1V2WT 1H8DH 4OGXA 1MTSA 4O3TA 1BIOA 2Y82A 4LZ1H 3Q76A 3A7XA 2WHXA 2O8LA 1DY9A 4AGJA 5FAHA 3PM3A 2BTCE 1TBQH 1DSTA 2OQUA 3A7ZA 4YTAA 4ISLA 1AMHA 1GMHF 4WJG2 1TX7A 1S82A 1C9PA 1ELDE 1C9TA 3PV4A 2VINA 3D62A 1QIXB 3A84A 1GBCA 3E0NB 5AVDA 5C17A 3NWUA 3F9FA 2A31A 2ZP0H 4ZCNA 1COWD 2SGDE 3A87A 1BHXF 1TGBA 1O5GH 2H6MA 1CA8B 3OEHD 1XUHA 2ZCKP 1BQYA 1ELFA 1GBEA 3RXHA 3DSPA 1LHFH 3H09A 3TNSA 5FXLA 4DIIH 2VGCC 1P02A 3OYPA 1TBZH 1UCYH 1GHAG 4I33A 3TGIE 1YPGH 3M7UA 4KP0A 1ZLRA 2C8ZB 2TGAA 1HJ8A 1CA0B 4K2YA 2PUXB 2GGVB 2UWPA 4P02A 4XBBA 1E1RD 1LDTT 1GPZA 4BAOB 4MNVA 4XE4A 3SU0A 2XC5A 4Y76A 4ZHMU 3QZQA 1LKBA 3KGPA 1SGPE 1GBKA 1O2TA 3T25A 3CS7A 7KMEH 1XVOA 1ZOMA 1A0LA 4WMDA 1T7CA 3RXIA 2RCEA 3RC5A 1BTYA 1J8AA 1QJ6B 1G32B 1TRMA 4OS5A 1KXBA 1QNJA 5HXFA 1TA6A 2ZGXH 3RXSA 1FAXA 5FL7D 1EB1H 1F0UA 3F68H 3L3TA 4D76A 2CHAC 1SGEE 2PR3A 3ZZ3A 3PV5A 2D1JA 1Z8IB 5EOKA 1DWDH 4U32A 3UAIC 1HAYB 3A7VA 4CH8B 2J2UA 1INCA 3PRBA 1C5SA 1DSUA 1C4V2 3TH2H 1MABB 1DXPA 5HM9A 3VXFH 1ZTKA 2ZDVH 2F9UA 1O5EH 3PLKA 2UUYA 1IHTH 1EOLA 1O2UA 1P06A 2ZU1A 2I6SA 3T62A 1LKAA 1HIAA 3BTME 4FUEA 1THSH 1IQKA 2RFKC 1AI8H 4F49A 4VGCC 4F55A 8GCHF 1QTFA 1C1UH 4X8VH 3UQOA 3HPTB 2HNTF 2O8WA 3ZVEA 1HXEH 3UWIA 1QRWA 1UTMA 1W10U 2ZHDA 1T8MA 4B1TA 6GCHF 2QY0B 2ZGBH 2OTVA 1AWHB 1F92A 3B9FH 1C5UA 2PP6A 3ZZAA 3VB4A 4Z6AH 1HAHH 2VVVA 1MTVA 1O3AA 4F4OC 2V7QD 2UUJB 3A88A 2C93B 1W7GH 1BDAA 2ZDNA 1MTNB 1RD3B 1W0JD 3RXUA 4XDEA 2FOAA 1QA0A 2FEQH 3Q77A 1GHYH 5T6DA 1G3DA 3ESTA 2Z3EA 2AIQA 1O2JA 3PLPA 1SGFG 1ANCA 3RC4A 2ALVA 1C2KA 4MPWA 8LPRA 2HWLB 1O3GA 2J98A 2ZFQH 2A7JA 5F8TA 3DSGA 1GJAB 2TIOA 2VWOA 2A7HA 4ZH8A 3BF6H 5GXPA 1ZJDA 1C4U2 4H4FA 2GVFA 1MTUA 2GTBA 3MU5A 3F3BA 3A82A 2VIPA 4A6LA 1DITH 4MNYA 1GI5A 5DPAA 5GNDA 4D7GA 1H9HE 1NFXA 1EJMA 1HAGE 2BX3A 2G52A 3SZNA 1MCTA 1C2DA 2H1UA 4K60A 1ZPBA 2KAIA 1BTXA 1VJ9U 2AERH 4F48B 5ABWA 1XUKA 4TPYA 2EQNA 1GI3A 4WH6A 3F2GA 4NIWA 2P94A 4OS6A 3RP2A 4SGBE 1XM1A 4Y11E 4WF8A 1ORFA 1WDIA 5CE1A 3NK8A 1ETSH 3I78A 2QXGA 3EGKH 1UK4A 3MTYA 5BRRE 1GJBB 5IDKA 4JZFH 1MAYA 3MH4A 2F9VA 1FZZA 3KCGH 4DT4A 4ISHH 1OS8A 1PQ8A 2OC1A 2FM2A 2GZ9A 3VB6A 5A8ZA 1AVXA 3E6PH 3L33A 1L1JA 3RXLA 3SUEA 3KQBA 3E1XB 1VZQH 1V2ST 3S69A 5TJXA 4J2YB 1PPZA 1QURH 2RG3A 5JBTA 1QQUA 5HGGA 3UR9A 4AZ2B 1C5PA 5C5OA 2VWLA 3GY7A 4FUHA 4FUDA 1D4PB 2I6QA 3SU2A 3SU4A 1UO6A 3P8NA 1O30A 4HI3A 5DP7A 2L74A 2H5CA 1AU8A 5A0BA 4X2YA 1SVPA 3V13A 3TU7H 5PTPA 1O5FH 2A2XH 1EPTA 4GCHG 2Y6TA 3MNBA 4OM9A 1RIWB 3MU0A 1PQ5A 2ZFPH 1GVLA 3SUFA 3OFND 3A8BA 2QXJA 1GHBG 1GI2A 1PYTD 1YF4A 4FUFA 3A85A 3MH6A 4AFSA 4WWYA 2J34A 2ZU4A 3RXGA 4I31A 2ZECA 1O3FA 1QJ1B 2ZGCA 1NC6A 3RC6A 2PUQH 2Y5GA 1AVGH 3EA7A 1DE7H 4IMZA 3RM2H 5I25A 2CK3D 4FXGH 4OS1A 3MU4A 1Z71A 1O3BA 1IQNA 1H1BA 2QN5T 2J4IA 4RT0A 4YM9A 1NRPH 1O39A 4IC6A 2ZFFH 1E0FD 3URCA 1AN1E 3P95A 4A1TA 1GVZA 3ZIAD 1FNIA 2Q6GA 2ULLA 1DM4B 1EQ9A 1TX6A 1Y3XA 1B0FA 3M3VA 1EZUC 4GCHF 5A09A 1BITA 2BDYA 1P2QA 1TNJA 2OUAA 3ZVCA 4AFZA 3FZZA 2K8IA 3OY6U 3HATH 4FU8A 3N7EA 4NSYA 3IG6B 1BTZA 1EP6A 3P8GA 5JYIA 4E7NA 1P2NA 3PLBA 2HVYB 4ZKSU 3GCNA 2ZQ1A 1YCPM 3ZYDA 2ZHFH 1UTJA 4ABHA 2A5KA 2ZTXA 2C4FH 5CHBA 2D8WA 1QJ7B 5AF9H 2DE8A 1GMCG 1MTWA 5E2PA 5IK2D 2O8TA 2ZCLP 3F9GA 1ABJH 3MHWU 1JIMA 1DWEH 3BIVH 3SHAH 1FAKH 1GWAA 1OSSA 1FPHH 2QGRA 1FN6A 4O03A 4ZROA 3ATLA 2SGEE 1O0DH 3LU9B 1JOUB 4K8BA 1JBUH 1A2CH 4NA9H 2PTNA 4THNH 3GCTG 1UMAH 2GT8A 2PKAA 1YY3A 2SGAA 1WV7H 5DK1A 1K1OA 2J95A 4X0WU 1JMOH 2WPMS 4MVNA 1RFNA 3RDZA 2WPIS 3H7TA 4FUBA 3W1EA 2HALA 1T4VH 1PPEE 2J5UA 1AIXH 2C8XB 1HAVA 2QXIA 3T28A 1O36A 1D6RA 3KQ5A 4Q80A 1H4WA 1LVOA 1O3OA 5GDSH 1PPHE 4DIHH 3GDSA 3SBKA 1F5KU 1HLTH 1QZ8A 3RXEA 3FKSD 1NZQH 1NRNH 2BVSH 3SUGA 5EXMA 1WXRA 3H5CB 3NKKA 1H8ED 2BMGB 3GDUA 3ZVDA 3UFAA 2YMSC 2C90B 3ITIA 1DLKB 2V35A 1SQTA 2R0LA 4IN1A 4I8HA 3UNSA 2HRVA 1OWHA 1NFUA 3A8AA 1FMGA 3BG4C 2G5NA 4YXWD 4INLA 4RI0A 1C1NA 1AVWA 2XNDD 4WXVA 4X6OA 3AW0A 2JDID 1YM0A 2PKSC 1C2HA 5G4BA 3N7DA 1GMHG 5LPEA 2ESTE 1DS2E 1VCQA 3RMLH 4IW4E 1E38B 1PPGE 3TITA 1CGJE 1O3IA 2PFEA 4DURA 2QF5A 4KKDA 2EI6A 3OY5U 1NM6A 1GDUA 3STJA 3MO6A 3A89A 4U2WA 1ANBA 3GY8A 1UJ1A 1GBMA 1SLVB 2K1QA 2BQWB 5FCKA 3EAJA 2UUKB 2A4QA 2CV3A 2HPPH 2VIVA 2OBOA 4A1XA 1GL1A 1AHTH 1OWDA 2GZ8A 3K65B 2ZHWH 3NUMA 2BOHB 2TBSA 1FXYA 1EAWA 5GIBA 1CHOG 1ZRBA 4FUIA 2H2ZA 4NG9H 4XBDA 1XXDA 3A7YA 2NU0E 4NFEA 3ODFA 1O3EA 4RKOB 2BDAA 2ZPRA 1AWFH 3MMGA 1O35A 3PROA 2BY6X 3TJOA 3M5NA 1K9OE 1GBJA 1SL3A 2J98B 2Q1JA 2H9HA 3I29A 1WCZA 1H8HD 2SNWA 2KFWA 1SLWB 1RTLA 2J94A 2BD2A 2QIQA 1K1LA 3QX5H 2XWAA 1N8OC 1O2ZA 1JIRA 3EA9A 2ZFTA 1BJVA 2B0FA 1C5RA 3E3TA 4B2AA 3LGWA 2ZC9H 2HVXA 1C1OA 4JZEH 3RXMA 4DVAU 2TRMA 2A2QH 2ZHQH 4ABGA 1MKWH 7ESTE 1TE0A 2THFB 1NS3A 5EODA 5EW1H 1BUIA 2G81E 1WSSH 3LC5A 5DP9A 3HK3B 2P3FH 1O2IA 1GGDC 3BTWE 1ARCA 4IC5A 2WPLS 4HZHA 1MU8B 2OC8A 3JZ2B 1B7XB 2IPQX 1C2JA 1O2NA 4BOHA 1H9LB 2P8OC 4YOJA 4DOQA 1Z6JH 4SGAE 1K0HA 4I32A 2Y7ZA 1NFYA 1SLUB 1W0KD 4X8SH 5E0JA 1TRNA 3T2NA 5DKMA 2QC2A 2BYAX 4E05H 2FI3E 3A80A 3PO1B 1B0EA 1TQ7B 2KCOA 1EOJA 2A1DB 1O3PB 3QDZB 2GV6A 1ID5H 4BNRA 3QLPH 1HAPH 1Z1IA 4X1RU 4BAMB 3SI3H 3SGBE 1GJ7B 5DSFA 2HNTE 2XBVA 3SV7A 1GJDB 2BVXH 4Q63A 1F7ZA 1OP0A 1V2KT 2HOBA 2UUFB 4NZLA 4AYYB 1MKWK 1A5HA 1GCTC 1TNHA 3DHKH 3U98H 2TGTA 1P04A 3KQEA 2IOTA 4Y6DA 3C27B 2BX4A 1P8VC 6CHAC 5FPTA 1Y5UT 1YLNA 1K1IA 3Q3YA 3RXFA 2WINI 1VITG 1LPGB 1MBMA 1C5XB 1G3CA 3OE7D 3RM0H 4AB9A 4JYVH 3FP6E 1ZZZA 4IBLH 4BXWA 2BM2A 2CGAA 2EEKA 2PGBB 1YWUA 1ZGVA 6CHAB 1SGFA 1LQDB 3AVZA 1JXPA 3MI4A 1UTKA 2WSSD 2VH0A 3AW1A 3DA9B 1DDJA 4DG4A 4ZKNU 3PB1E 4CR9A 2BXTH 1NTPA 2A4GA 4BAKB 1YCPK 2V3HH 1MH0A 2OC7A 3EE7A 1QA7A 2WV4A 3A86A 3PWBA 3SUDA 2FPZA 4FUJA 2A5IA 1HDTH 1LCYA 3M3SA 5CHAC 2FWWA 3OX7U 1TYNA 4ZKRU 2JIZD 2W3KA 4DGJA 1A7SA 3LGTA 2R3UA 4FOUC 1Q31A 2R2WU 1U6QA 2M5TA 2NWNA 3S7KB 3DSOA 1Z8JB 3P8OA 2NU1E 3ELAH 1QRXA 1GJ9B 4ZXYH 2BD9A 2XWBI 1GJ5H 1OP8A 5AHGH 1AB9B 1C5VA 1SQOA 1DUAA 4O97A 3PV2A 3SU1A 3LGVA 1XUFA 2PHBA 3BEUA 3ZZ7A 1AFQC 3U28C 1CT0E 4WMFA 5ESTE 1JRTA 1V2OT 2W3IA 3QO6A 2JETC 5LH8A 3UREA 4XRNA 3CNRA 2ZU3A 3RU4T 3M5MA 2XOKD 2BDGA 2ANMH 1IQIA 3OTJE 1LVBA 2KZ4A 2FDAA 1HJ9A 5H4IB 2PLXA 3BG8A 1BRUP 4INKA 2BQ7B 3GCHC 1O3DA 1TONA 4TYDA 2Z9IA 5A0CA 2WV5A 4UONA 2WUBA 2GZ7A 2NU4E 3PYHA 1AE5A 2C8WB 1G3EA 2ZDMA 2RA3A 1NO9H 4U30A 1V2MT 1KXAA 4R0IA 1C1TA 1MD7A 3UQVA 1C4Y2 5C94A 3FAOA 1CO7E 3GCOA 1C5QA 3F9HA 3U9AH 4X2VA 1TGSZ 2ZHEH 1OWEA 1NROH 3SO3A 1WAYB 1ZPCA 1MQ5A 2G4TA 3RXVA 4CRFA 4Y79A 2F9PA 2FXRA 3SYJA 1SGIB 3SJKA 3PMHB 1EKBB 4K3JA 1XMNB 1L2EA 2BDIA 4B73A 1C2LA 1XVMA 2BD8A 4ABAA 4BTTB 1V2LT 1PPBH 2GD4B 1CGIE 3RXPA 1C2IA 4I7YH 3TK9A 2Z9KA 2B5TB 2Z6BD 1TFXA 3K6YA 1ELEE 4IS5A 5ESBA 5KECA 2A32A 4I8LA 3SN8A 4X6PA 4JYTA 1NPMA 1MD8A 3RXBA 1VGCC 1S5SA 2VIOA 1HPGA 1N6YA 3KQCA 1UW7A 1S0QA 2AGGX 2GCHG 4DY7B 2BDHA 4UFDH 3ZVFA 1TGTA 3KHVA 3EYDA 1T8OA 1DWBH 1EJAA 1RIWC 3UIRA 5HIZA 1J15A 1OWJA 4Q7XA 2HNTC 3BTFE 3A8CA 4Y0ZE 1RGQA 2VIQA 2O9QA 2J9NA 2FIRH 3MYWA 4B74A 3M35A 1OHHD 4B2CA 1BBRE 1LQEA 1RTFB 4ZHLU 3MU8A 2BDBA 1GHBF 3QN7A 1IQFA 2BY5X 1RS0A 1BZXE 1L1NA 2WV9A 3D65E 3TPIZ 2ZEBA 1EATA 1FV9A 1TPSA 4FVDA 1FPCH 4OGYA 1BTHH 1UVPA 3ZZ5A 5J4QA 1K1PA 5FHTA 2AHME 2FO9A 1EAXA 3SV2H 4CRCA 3UY9A 2H9TH 5E0GA 1GI6A 1TMUH 4Q7YA 1K1MA 4FVBA 4TWYA 4B75A 4RSPA 2XCFA 2ZU2A 1TMBH 3KL6A 2KCPA 3LIWA 1V2QT 1AE8H 1QR3E 3BIUH 2OCVB 2PSXA 3ODDA 1UK3A 5JPMH 1ELAA 1V2VT 4LZ4B 2WPJS 3BTKE 1NBME 1BA8B 3RMNH 1O2RA 2ZNKH 1XX9A 4MNXA 3SV8A 1AKSB 4AOQA 2L6OA 3RXCA 4BANB 2ODYB 1P03A 1ZSKA 1QCPA 5TCAA 2A5AA 1GJ6A 3UTUH 4NIYA 1K22H 3AASA 1LHCH 1SOZA 3RMMH 1NU7B 3RMOH 1MKXH 3QGNB 4ABIA 4X1QU 3UWJH 3RU4E 1J16A 1VR1H 1L4DA 2CJIA 2GP9B 4KTSA 3RU4D 5E2OA 2B9LA 4UDWH 1NFWA 3FVFB 3N99A 1LPZB 1P05A 2P8OB 2RDEA 1O5CB 3FANA 3HKIB 4X1SU 3SV6A 1V2TT 1P11E 1AFEH 5LGOA 3SZEA 1DWCH 5C0UA 1UCYK 1TQ0B 5EQRA 3FZDA 1TOMH 1HAVB 1UHBA 4JZDH 1O2VA 1HAZB 3K2UA 1RTKA 2W26A 1P2IA 3KNXA 4NA8A 4Y10E 4UD9H 3STIA 5LPFA 2Z9JA 1ETRH 2G4UA 2KR7A 2FLBH 5F8XA 1SGQE 1GHXH 2ILNA 3QTVH 3QZRA 4GVUA 5T1VA 1NRRH 1ESTA 2TGPZ 3SNDA 2H5DA 2ALPA 1TPOA 1FY5A 2BD5A 1ZHMA 2SGFE 1V2PT 3LC3A 2EI8A 3UNRA 1PQ7A 1HAIH 1T4UH 4CRGA 1K28D 4IN2A 1C5LH 3TVJB 4FETA 5CDFE 5EG4A 1MZAA 1BBRH 3R3GB 2P16A 1HCGA 2OLGA 1HYLA 4RN6A 3ATIA 1HV7A 3T27A 4BAHB 3KIDU 1DVAH 1C5NH 1ZHRA 1O2LA 5JBCS 5EPNA 3W95A 1Z7KA 3PWCA 1XUIA 2KX4A 2P3TB 3LKWA 1UTOA 2YMSD 2FLRH 4TSFD 1GJ8B 3F9EA 1S83A 3FO8D 3GS9A 4Y71A 5GCHG 3O8CA 1HNEE 3NPSA 1C5TA 2AMQA 1LHDH 4B6FA 1FJSA 1ESBA 2C8YB 2JH0D 3KF2A 4AYVB 5GWZA 1FX0B 1BB0B 1CVWH 4AN7A 5IYTA 3SU5A 4NA7A 1QY6A 4WXIA 3F6UH 2P93A 1VITH 2YMSB 4JZIA 1C1QA 2VGCB 1DPOA 5C1XA 1PPCE 4FUCA 3ZVBA 4X1NU 3GOVB 1WTHD 2GDDA 2XTTB 4AFQA 1IQMA 4MG3A 2F3CE 2YNBA 4YT7H 3I77A 1TGNA 2XBXA 4O3UA 1T8LA 3PMJA 4AG1A 3MFJA 1KDQB 2BD4A 3ATMA 3HGNA 3ZZDA 4GAWA 4X1PU 2IPHA 4UFEH 1ZSLA 5DP6A 3MH5A 4D8NA 1TMTH 5L6NH 1ZSJA 1F0RA 2BLQA 1CHOF 3S7HB 5C1UA 1ZPZA 3U69H 6ESTA 1GBHA 4FUGA 3LGUA 4MLFB 1FY3A 3U1IB 2IJOB 3ZVGA 1EASA 2Q6FA 1Y59T 4X2WA 2RDLA 1NN6A 5EQSA 2PV9B 3SJOA 3ZZCA 5F8ZA 2VB0A 2F9OA 1NBMD 4IGDA 1C5YB 1EPTC 2LP6A 3SQHE 1AUTC 2WPKS 4I8KA 5B6OA 2XXLA 1KTTB 1S6HA 4A5TS 4ACAA 1GI7B 1HUTH 1MUEB 1TALA 2AGEX 2OINA 3GCTF 1JWTA 9ESTA 1WTGH 3EA8A 4ZHAA 2FOCA 1GGDB 1FUJA 4FU7A 1ELGA 4ABEA 5K7RA 2BY9X 1BTWA 3F0OA 4A92A 5EIYA 3AAVA 6LPRA 1EUFA 3F0PA 5C0TA 1FQ3A 4DJZB 1ANEA 2D26C 2VH6A 2R3YA 1A61H 5FBIA 8GCHG 4Y7AA 1G36A 1MQ6A 3UUZA 5F03A 3SOSA 1E79D 5EW2H 4FU9A 4UFGH 1NT1A 2V3OH 3ATKA 2WUCA 1BRBE 1PYTC 1SHYA 1WYKA 1UVUH 2FS8A 2A4OA 1QB1A 2FX4A 3ENSB 3ZZ6A 3HGPA 2JJ2D 1D6WA 2OBQA 1C2EA 1XUJA 1W3CA 1ELCA 5L2YH 1T8NA 3TIUA 3BEFB 2ZQ2A 4JYUH 3OTPA 4UE7H 3MU1A 3R0FA 2AS9A 3MH7A 2HLCA 1NESE 3QTOH 2P95A 1L1GA 3B8JA 1HBTH 4XFQA 3SORA 4AORA 4E06H 3O8RA 1O37A 1H9IE 2W6ID 2KM0A 1QQ4A 3RLWH 2F9BH 1TNLA 2ZIQH 1HAXB 2ZG0H 3D49H 1O2QA 1MAXA 1WQSA 4U01A 1K1JA 3PMBB 2GCHF 4J1YA 5HKKD 3URDA 3S9CA 1TABE 1ARBA 3CP7A 3TJNA 3WW7A 4ZMAH 4ASUD 2FOGA 3U8OH 5DGJA 1TX8A 3PMAB 2ZPSA 1LMWB 4K5ZA 1E34B 1OXGA 5EPYA 3EE0B 2FOBA 3KYGA 4NZQA 1L0ZA 1KLIH 1LO6A 2UWOA 2FODA 4GUXA 4UEHH 1O5AB 2QA9E 2FI4E 3AAUA 1TNIA 2XBYA 1YPMH 1EZSC 5KGOA 3VFEA 1Y3VA 5B6LA 1KY9A 4H42U 1SQAA 1SFIA 1ZMNA 2AMDA 4ZAEA 1P09A 1GI9B 3VB7A 3GY6A 5HMAA 1HB0B 1SMFE 1QHRB 3SI4H 1O2MA 1DXWA 4GSOA 2O8UA 1YKTA 1BJUA 3TLOA 1C5MD 2Z9LA 7LPRA 1ZTJA 1Y3UA 3LDXH 1SGTA 4H6TA 1XUGA 1W11U 3MO3A 4KELA 3MOCA 2ZGJA 3BSQA 3UR6A 1GBIA 3GY4A 1EZXC 1BRAA 1QBOA 2PTCE 2BLWA 4RT1A 2Z3DA 1UTPA 2OQ5A 5SGAE 1G30B 1BRCE 1T32A 1KLJH 4I86A 4NIXA 1TPAE 2TGDA 4UFFH 1OWIA 4DW2U 2PSYA 5EXNA 1VGCB 3TGJE 1QB6A 2V0BA 4GHTA 1G2MA 3MQKC 5DP4A 1TGCA 2G5VA 3UOUA 4ASHA 3DD2H 3F2HA 1UCYE 3TK6A 1IAUA 4MPVA 1EP5A 2EC9H 1DANH 2FESH 1G37A 2YOLA 3WWFA 3SV9A 4DCDA 1NU9A 2PWXA 3VEQB 3DT0H 5AFYH 1K21H 1BHXB 3ZVAA 1GBFA 1ELVA 2WYJA 1CBWB 1VCPA 2GCTB 3ZZBA 3LONA 1P57B 4YZUA 4CR5A 1TNGA 3S9AA 4TY6A 4OS2A 2FYQA 1SLXB 4JK6A 4X6MA 2FI5E 5EU8A 1UVOA 3RXJA 4ABFA 1UVSH 3QK1A 4KTUA 1GVKB 4JZ1A 3D23A 4TY7A 1Y3WA 1DY8A 5DO4H 1ZR0A 2GMTB 4CBOA 1V2RT 4WVPE 3E8LA 1F0TA 4JMYA 9LPRA 2QF3A 1THPB 5A8YA 2LELA 2JH6D 5FPSA 4AFUA 3MNCA 1P01A 4YLUA 1V6DA 2HGTH 2A0QB 1GHAF 1F5LA 1KXFA 1QL8A 3UB0A 2BOKA 3P70B 1KLTA 1SG8B 2BHGA 3RXDA 3SNCA 1GBDA 1LHEH 1J9CH 1KIGH 1O34A 2JKHA 2ZCHP 2BD3A 1O2SA 3KEEA 4MPUA 4LK4A 1C2FA 1FY1A 1FIZA 1O2OA 3GYMA 3PTBA 3SGAE 5FCRA 4VGCB 3PRDA 2ZO3H 3OU0A 2ZPQA 3RXTA 2FZZA 1O2KA 1FY8E 2A45B 1OX1A 3W94A 1AKSA 3LH1A 1L4ZA 3VG8A 1TRYA 3E0PB 2ZFRH 1IQEA 2WPHS 3VB3A 3RXKA 1O32A 1SGDE 1BMMH 4ZXXH 2QE7D 1OPHB 3GCHB 4Q2KA 5FX5A 2AFQB 5T6GA 2B8OH 1C2GA 1UTNA 2FOFA 4TT3D 3MNSA 2ZDLA 3TNTA 1G3BA 1P0SH 2K0QA 1ELTA 2GMTC 2R9PA 3BTHE 2DUCA 2ZDKA 4OS4A 2BXUH 1W2KH 1EPTB 1SGCA 2BVRH 2F83A 4QT8C 1QBVH 1QL9A 1Z1JA 4HGCA 3VPKA 1TWXB 2FTLE 2W7SA 1C1VH 2AGIX 4Z0KA 1O3JA 3P92A 4X6NA 3KYFA 2WZQA 2GCTC 1AQ7A 1WBGB 5JBBS 2CN0H 1GBBA 2CF8H 1W0YH 3VB5A 1D9IA 2ZTZA 5DP5A 3ZV8A 5JB8S 2OXSA 4LOYH 1YPHC 5L2ZH 4B6EA 1C1RA 3CENA 1F2SE 1LVMA 1E35B 4AB8A 3LPRA 2BZAA 1B5GH 4Q7ZA 1A0JA 2VWMA 3SNEA 4HFPB 5JDUB 2CF9H 4NSVA 3ZYEA 1EZQA 3Q3XA 4K1EA 2IJD1 3ZV9A 5A0AE 1GMDF 1YPHE 2OC0A 3F1SB 2C3SA 4K1SA 1GDQA 1PPFE 1GMDG 1P9UA 1G9IE 2H9EH 4ISIH 5J4SA 1P2JA 3GYLB 4IMQA 1H8IH 1ZMJA 3T26A 2F4LA 1KYNA 2AYWA 1OOKB 3RXAA 1DX5M 3M7TA 4AX9H 1EXFA 1SPJA 1SQRA 2GT7A 2QYIA 4NWKA 3BTQE 4B71A 1C5ZB 2Y80A 3BTGE 3FN8A 3WWBA 3KN2A 4XOJA 1D3TB 3WY8A 1O2GH 1BT7A 1E1QD 1AY6H 2P59A 1D3PB 2ANKH 4ACBA 1O2PA 3S9BA 4ZKOU 1IQLA 1SSXA 1ZJKA 4JK5A 1MU6B 5EXLA 3O8DA 2JETB 3T29A 3T5FH 1CQQA 1GBLA 1V3XA 1TOCB 4CBNA 3C1KA 5C67A 7GCHG 2STBE 4ABDA 1Y5BT 4YESB 4YOIA 1MCVA 1SI5H 3LGYA 2Z7FE 1FIWA 1VKYA 1GHVH 2ZWLH 2Q6DA 4XD7D 1ZYOA 2A4RA 2QF4A 1KXCA 2QV1A 1FONA 1ETTH 2XYAA 4WMEA 1BMNH 2G55A 1TNKA 3NCLA 1QGFA 4DT7B 2M2AA 2B7DH 1GCDA 1C1MA 1ACBE 5A8XA 1A1RA 1ZMLA 1IOEA 1CE5A 1AFQB 3M5LA 1YPEH 1A3EH 4K8YA 4Q4LA 2LNCA 1WOFA 1S81A 5LPRA 1TBRH 4PROA 4K1TA 1C5OH 1AB9C 1MKXK 2WYGA 3TH4H 1UTQA 3TK5A 3M36A 1PJPA 1CHGA 4P00A 4XSKU 1SR5C 3U1JB 2JJ1D 1A0HB 1C1PA 1CSOE 4MQAA 3SW2B 3V7TA 1GG6B 2BDCA 2QF0A 5I46H 1CT2E 2GDEH 2Z94A 2CXVA 1WUNH 2ASUB 2HPQH 3M3TA 2ZFSA 1TIOA 2XNIA 3ZZ4A 3EQ0H 1BMAA 1SGNE 4BTIB 4CRBA 2V3MA 3RXQA 2DE9A 1SFQB 3K9XB 4M9FA 1KMHB 3M7QA 2ZU5A 2FOMB 3HKJB 1BMLA 1ZGIA 2PKSB 2KCAA 3GY3A 1SBWA 4ISNA 1OKXA 3SU6A 3SNAA 5C20A 4HG6A 4ISOA 5HM2A 5A2MH 2NU2E 2EI7A 3NXPA 2ANWA 4R8TB 3RLYH 1YYY1 1XKAC 2ZA5A 2R0KA 1X7AC 1GI4A 1P12E 1QRZA 2QCYA 3ZZ8A 3P17H 5EJ1A 2VVCA 1HJAB 1O2XA 2BB4A 3OEED 5DN6D 4MNWA 1GI8B 1MZDA 1GMCF 1O5BB 4B2BA 8KME2 1JRSA 2F91A 2XBWA 3CS0A 3DFJA 1HIAB 2OP9A 2W5EA 5AFZH 1SHHB 2Z3CA 3U8TH 1V2JT 3FP8E 3FP7E 1SGRE 2OD3B 5TCCA 1KSNA 5FX6A 1C1SA 2QXHA 1S6LA 3LH3A 1P3EA 1Z8RA 1SGYE 1WU1A 3H7OA 1HGTH 2AIPA 4ESTE 1VCWA 1FI8A 1P2KA 1AD8H 5E0HA 5KEDA 2BY8X 2SGQE 1Z6EA 1V2NT 3MNXA 5C5NA 1SKYE 3TJVA 4GPGA 1Y8TA 1YLDA 1UHBB 2VVUA 3M61U 5F6MA 3PO1C 1YLCA 5K0HA 1E37B 4BAQB 2IN2A 1AZZA 1CGHA 7GCHF 1YPLH 1A46H 2FYRA 2XW9A 1O3CA 3V3MA 5L30H 2Y5FA 3UOPA 3OAAD 1P10A 3A7WA 3LOXA 1Y5AT 1N8OB 5CHAB 3LJOA 1C2MA 3NRLA 1LPKB 4CHAB 6GCHG 4Y8ZA 1PQAA 3G01A 1GCTB 4KGAA 5EJLA 3SQEE 2FS9A 1TPPA 2ODQA 5GPIB 3Q3KA 4RKJB 2RA0A 1HXFH 1YCPH 2J92A 1KDQA 1EAUA 5ETXA 4MTBA 1O31A 1AGJA 2ZTYA 3DFLA 1YBWA 1DICA 2XC0A 2BD7A 2Z9GA 4NWLA 2PW8H 4Y8YA 5C2ZA 5T3HA 2VNTA 3AK5A 1W14U 5E8EH 1W8BH 1ESAA 2WPDD 1MMJN 5FBEA 3SGQE 1S85A 1THRH 4WH8A 2G51A 1BOQA 3A8DA 1NRSH 2TPIZ 5EQQA 2AEIH 4CRDA 1EB2A 2NU3E 4GHQA 3JZ1B 1C1WH 4X2XA 2VIDA 4A7IB 2GKVE 2VWNA 3BEIB 3UPEA 5DP3A 2KAIB 1ANDA 3GY2A 3Q00A 3GDVA 4WY3A 1D3QB 1FN8A 3GY5A 4NIVA 3SNBA 4D7FA 5DG6A 1W12U 2G00A 2R2MB 2KCYA 1HAOH 5EJZA 2W6JD 3MWIU 3FOAA 4GLYA 2G8TA 3MO9A 1Q3XA 2FX6A 4NGAH 1UTLM 3TGKE 5HYOA 1QB9A 1IQJA 1TB6H 1GL0E 5HIYA 1YGCH 3K6ZA 1W0ZU 1GDNA 2W7UA 3BG4B 4CRAA 2BLVA 1GI0A 4YO9A 1Y3YA 2F43B 3QWCH 8ESTE 2JH5D 4LXBH 3F2FA 4Y0YE 1DT2A 1LHGH 1NY22 2PGQB 4B76A 1EFRD 1HRTH 1SOTA 2Y81A 4I8JA 4AC9A 2VU8E 1RJXB 1O3NA 4K69A 1J14A 3SHCH 1P2OA 3PTNA 1SC8U 3P6ZB 3ATWA 4HTCH 1O38A 4Y8XA 1P9SA 1KXEA 1J17T 2UWLA 1AO5A 3E91A 5DJ7A 3UNQA 2VBCA 1CBWC 1V2UT 2XCNA 1DOJA 4OS7A 2STAE 2XC4A 3N7OA 3LJJA 4CHAC 1EX3A 3LGIA 3HK6B 5C3NA 2ZZUH 2FMJA 1YP9A 3SJIA 3DUXH 1O3MA 5CMXH 5F53A 3A7TA 1IHSH 5C1YA 1XXFA 4ABBA 3BTDE 3VGCC 2BZ6H 1BBRK 4YT6H 3S0NA 4JCNA 3RUOA 1EAIA 3NZIA 1O2HA 1Z8GA 2ZDAH 1A5IA 2ODPA 3RXRA 1GI1A 3GICB 1O33A 1DLEA 4BXSA 3RXOA 1SB1H 1TAWA 2BQ6B 2J38A 1OYTH 2O8MA 3BTTE 3B23B 4NFFA 1UK2A 4ZUHA 1O3HA 1W7XH 2EA3A 2V6NA 1BMFD 1W13U 1S6FA 1WQVH 1IQHA 1F5RA 2HLDD 1EJNA 5BPEA 3SJ8A 1ELBA 1Q2WA 4MDSA 4TWWA 1G2LA 2LPRA 1BTPA 4AGKA 1A5GH 1GHWH 2ANYA 4TPIZ 1ABIH 3VGCB 5FPYA 3P8FA 2FOEA 3GISB 4H6SB 1O2YA 5EGMA 1GJCB 1OYQA 1T31A 1MTNC 1RRKA 3M37A 4XBCA 1NRQH 4E7RG 2FP7B 3E90B 2AMPA 3KQDA 2FOHA 1A3BH 2ZF0H 5JB9S 1KTSB 5T6FA 3V0XA 2BY7X 2VIWA 2GX4A 1TLDA 4D9QA 1S84A 1P3CA 2Y5HA 2SGPE 3LT3A 3QGJA 4X8TH 2XRCA 2ZI2H 1N6XA 1M9UA 1ZRKA 1GBAA 3BV9B 2EY4C 4AG2A 1VJAU 2J97A 2PKAB 2Y7XA 1F0SA 1K1NA 1S0RA 5DP8A 5GCHF 1K2I1 1QFKH 1LVYA 3L6PA 2A7CA 1QBNA 3IWMA 1E36B 3ZZ9A 4CREA 2YNAA 3SJ9A 1CT4E 3BN9A 4CH2B 1AZ8A 2F9NA 1GBTA 2D2DA 3E16B 2GJGA 1O3KA
chains in the Genus database with same CATH topology
1OWKA 4YOGA 1A4WH 1O2WA 1D3DB 1TA2A 2AH4X 1CU1A 4D9RA 1MBQA 1YPJH 1KXDA 2SFAA 1VITF 1YPKH 1HJAC 3FFGA 1GG6C 4BTUB 1FY4A 1DUEA 5JBAS 1PFXC 4X8UH 2GV7A 2CMYA 4O9VA 1FDPA 4MPXA 1DFPA 3IITA 3U8RH 4A1VA 1ZTLA 4KTCA 1BCUH 1O5DH 1GJ4H 2ZKSA 4I8GA 2FTMA 4M7GA 2QAAA 3OSYA 5GJ4B 3SU3A 1RXPA 1YC0A 2VJ1A 3A81A 2P3UB 2BLOA 1BTUA 1QL7A 3M5OA 1AUJA 1C5WB 1IQGA 1O3LA 1OP2A 3QUMP 4Y7BA 1ZHPA 1HFDA 3O8BA 1CA0C 3EDXB 1GHZA 2CHAB 3TJUA 4YLQH 3BTEE 1LTOA 4INHA 1XKBC 3A83A 3V12A 1P2MA 4NCYA 3TH3H 4ABJA 2SNVA 3VXEH 1FLEE 1N1LA 2ZGHA 1UVTH 1V2WT 1H8DH 4OGXA 1MTSA 4O3TA 1BIOA 2Y82A 4LZ1H 3Q76A 3A7XA 2O8LA 1DY9A 4AGJA 5FAHA 3PM3A 2BTCE 1TBQH 1DSTA 2OQUA 3A7ZA 4YTAA 4ISLA 1AMHA 1GMHF 4WJG2 1TX7A 1S82A 1C9PA 1ELDE 1C9TA 3PV4A 2VINA 3D62A 1QIXB 3A84A 1GBCA 3E0NB 5AVDA 3NWUA 3F9FA 2A31A 2ZP0H 2SGDE 3A87A 1BHXF 1TGBA 1O5GH 2H6MA 1CA8B 1XUHA 2ZCKP 1BQYA 1ELFA 1GBEA 3RXHA 1LHFH 3TNSA 5FXLA 4DIIH 2VGCC 1P02A 3OYPA 1TBZH 1UCYH 1GHAG 4I33A 3TGIE 1YPGH 3M7UA 4KP0A 1ZLRA 2C8ZB 2TGAA 1HJ8A 1CA0B 4K2YA 2PUXB 2GGVB 2UWPA 4XBBA 1LDTT 1GPZA 4BAOB 4MNVA 4XE4A 3SU0A 2XC5A 4Y76A 4ZHMU 3QZQA 1LKBA 3KGPA 1SGPE 1GBKA 1O2TA 3T25A 3CS7A 7KMEH 1XVOA 1ZOMA 1A0LA 4WMDA 1T7CA 3RXIA 2RCEA 3RC5A 1BTYA 1J8AA 1QJ6B 1G32B 1TRMA 4OS5A 1KXBA 1QNJA 5HXFA 1TA6A 2ZGXH 3RXSA 1FAXA 1EB1H 1F0UA 3F68H 3L3TA 4D76A 2CHAC 1SGEE 2PR3A 3ZZ3A 2D1JA 1Z8IB 5EOKA 1DWDH 4U32A 1HAYB 3A7VA 4CH8B 2J2UA 1INCA 1C5SA 1DSUA 1C4V2 3TH2H 1DXPA 5HM9A 3VXFH 1ZTKA 2ZDVH 2F9UA 1O5EH 3PLKA 2UUYA 1IHTH 1EOLA 1O2UA 1P06A 2ZU1A 2I6SA 3T62A 1LKAA 1HIAA 3BTME 4FUEA 1THSH 1IQKA 1AI8H 4F49A 4VGCC 8GCHF 1QTFA 1C1UH 4X8VH 3UQOA 3HPTB 2HNTF 2O8WA 3ZVEA 1HXEH 3UWIA 1QRWA 1UTMA 1W10U 2ZHDA 1T8MA 4B1TA 6GCHF 2QY0B 2ZGBH 2OTVA 1AWHB 1F92A 3B9FH 1C5UA 3ZZAA 3VB4A 4Z6AH 1HAHH 2VVVA 1MTVA 1O3AA 4F4OC 3A88A 2UUJB 2C93B 1W7GH 1BDAA 2ZDNA 1MTNB 1RD3B 3RXUA 4XDEA 2FOAA 1QA0A 2FEQH 3Q77A 1GHYH 5T6DA 1G3DA 3ESTA 2Z3EA 2AIQA 1O2JA 3PLPA 1SGFG 1ANCA 3RC4A 2ALVA 1C2KA 4MPWA 8LPRA 2HWLB 1O3GA 2ZFQH 2A7JA 5F8TA 1GJAB 2TIOA 2VWOA 2A7HA 4ZH8A 3BF6H 5GXPA 1ZJDA 1C4U2 4H4FA 2GVFA 1MTUA 2GTBA 3MU5A 3A82A 2VIPA 4A6LA 1DITH 4MNYA 1GI5A 5DPAA 4D7GA 1H9HE 1NFXA 1EJMA 1HAGE 2BX3A 2G52A 3SZNA 1MCTA 1C2DA 2H1UA 4K60A 1ZPBA 2KAIA 1BTXA 1VJ9U 2AERH 5ABWA 1XUKA 4TPYA 1GI3A 4WH6A 4NIWA 2P94A 4OS6A 3RP2A 4SGBE 1XM1A 4Y11E 4WF8A 1ORFA 5CE1A 3NK8A 1ETSH 3I78A 2QXGA 3EGKH 1UK4A 3MTYA 5BRRE 1GJBB 5IDKA 4JZFH 1MAYA 3MH4A 2F9VA 1FZZA 3KCGH 4ISHH 1OS8A 1PQ8A 2OC1A 2FM2A 2GZ9A 3VB6A 5A8ZA 1AVXA 3E6PH 3L33A 1L1JA 3RXLA 3SUEA 3KQBA 3E1XB 1VZQH 1V2ST 3S69A 5TJXA 4J2YB 1PPZA 1QURH 2RG3A 5JBTA 1QQUA 5HGGA 3UR9A 4AZ2B 1C5PA 5C5OA 2VWLA 3GY7A 4FUHA 4FUDA 1D4PB 2I6QA 3SU2A 3SU4A 1UO6A 3P8NA 1O30A 4HI3A 5DP7A 2H5CA 1AU8A 5A0BA 4X2YA 1SVPA 3V13A 3TU7H 5PTPA 1O5FH 2A2XH 1EPTA 4GCHG 2Y6TA 3MNBA 1RIWB 3MU0A 1PQ5A 2ZFPH 1GVLA 3SUFA 3A8BA 2QXJA 1GHBG 1GI2A 1PYTD 1YF4A 4FUFA 3A85A 3MH6A 4AFSA 4WWYA 2J34A 2ZU4A 3RXGA 4I31A 2ZECA 1O3FA 1QJ1B 2ZGCA 1NC6A 3RC6A 2PUQH 2Y5GA 1AVGH 3EA7A 1DE7H 4IMZA 3RM2H 5I25A 4FXGH 4OS1A 3MU4A 1Z71A 1O3BA 1IQNA 1H1BA 2QN5T 2J4IA 4YM9A 1NRPH 1O39A 4IC6A 2ZFFH 1E0FD 3URCA 1AN1E 3P95A 4A1TA 1GVZA 1FNIA 2Q6GA 2ULLA 1DM4B 1EQ9A 1TX6A 1Y3XA 1B0FA 3M3VA 1EZUC 4GCHF 5A09A 1BITA 2BDYA 1P2QA 1TNJA 2OUAA 3ZVCA 4AFZA 3FZZA 3OY6U 3HATH 4FU8A 4NSYA 3IG6B 1BTZA 1EP6A 3P8GA 5JYIA 4E7NA 1P2NA 3PLBA 4ZKSU 3GCNA 2ZQ1A 1YCPM 3ZYDA 2ZHFH 1UTJA 4ABHA 2A5KA 2ZTXA 2C4FH 2D8WA 1QJ7B 5AF9H 2DE8A 1GMCG 1MTWA 5E2PA 2O8TA 2ZCLP 3F9GA 1ABJH 3MHWU 1JIMA 1DWEH 3BIVH 3SHAH 1FAKH 1GWAA 1OSSA 1FPHH 2QGRA 1FN6A 4O03A 4ZROA 3ATLA 2SGEE 1O0DH 3LU9B 1JOUB 4K8BA 1JBUH 1A2CH 4NA9H 2PTNA 4THNH 3GCTG 1UMAH 2GT8A 2PKAA 2SGAA 1WV7H 5DK1A 1K1OA 2J95A 4X0WU 1JMOH 2WPMS 4MVNA 1RFNA 3RDZA 2WPIS 3H7TA 4FUBA 2HALA 1T4VH 1PPEE 1AIXH 2C8XB 1HAVA 2QXIA 3T28A 1O36A 1D6RA 4Q80A 1H4WA 1LVOA 1O3OA 5GDSH 1PPHE 4DIHH 3GDSA 3SBKA 1F5KU 1HLTH 3RXEA 1NZQH 1NRNH 2BVSH 3SUGA 5EXMA 3H5CB 3NKKA 2BMGB 3GDUA 3ZVDA 3UFAA 2C90B 3ITIA 1DLKB 2V35A 1SQTA 2R0LA 4IN1A 4I8HA 3UNSA 2HRVA 1OWHA 1NFUA 3A8AA 1FMGA 3BG4C 2G5NA 4INLA 1C1NA 1AVWA 4WXVA 4X6OA 3AW0A 1YM0A 2PKSC 1C2HA 5G4BA 1GMHG 5LPEA 2ESTE 1DS2E 1VCQA 3RMLH 4IW4E 1E38B 1PPGE 3TITA 1CGJE 1O3IA 2PFEA 4DURA 4KKDA 2EI6A 3OY5U 1NM6A 1GDUA 3STJA 3MO6A 3A89A 4U2WA 1ANBA 3GY8A 1UJ1A 1GBMA 1SLVB 2K1QA 2BQWB 5FCKA 3EAJA 2UUKB 2A4QA 2CV3A 2HPPH 2VIVA 2OBOA 4A1XA 1GL1A 1AHTH 1OWDA 2GZ8A 3K65B 2ZHWH 3NUMA 2BOHB 2TBSA 1FXYA 1EAWA 5GIBA 1CHOG 1ZRBA 4FUIA 2H2ZA 4NG9H 4XBDA 1XXDA 3A7YA 2NU0E 4NFEA 3ODFA 1O3EA 4RKOB 2BDAA 2ZPRA 1AWFH 3MMGA 1O35A 3PROA 2BY6X 3TJOA 3M5NA 1K9OE 1GBJA 1SL3A 2Q1JA 3I29A 2H9HA 1WCZA 2SNWA 1SLWB 1RTLA 2J94A 2BD2A 2QIQA 1K1LA 3QX5H 2XWAA 1N8OC 1O2ZA 1JIRA 3EA9A 2ZFTA 1BJVA 2B0FA 1C5RA 3E3TA 4B2AA 3LGWA 2ZC9H 2HVXA 1C1OA 4JZEH 3RXMA 4DVAU 2TRMA 2A2QH 2ZHQH 4ABGA 1MKWH 7ESTE 1TE0A 2THFB 1NS3A 5EODA 5EW1H 1BUIA 2G81E 1WSSH 3LC5A 5DP9A 3HK3B 2P3FH 1O2IA 1GGDC 3BTWE 1ARCA 4IC5A 2WPLS 4HZHA 1MU8B 2OC8A 3JZ2B 1B7XB 1C2JA 1O2NA 4BOHA 1H9LB 2P8OC 4YOJA 4DOQA 1Z6JH 4SGAE 4I32A 2Y7ZA 1NFYA 1SLUB 4X8SH 5E0JA 1TRNA 3T2NA 5DKMA 2QC2A 2BYAX 4E05H 2FI3E 3A80A 3PO1B 1B0EA 1TQ7B 1EOJA 2A1DB 1O3PB 3QDZB 2GV6A 1ID5H 4BNRA 3QLPH 1HAPH 1Z1IA 4X1RU 4BAMB 3SI3H 3SGBE 1GJ7B 2HNTE 2XBVA 3SV7A 1GJDB 2BVXH 1F7ZA 1OP0A 1V2KT 2HOBA 2UUFB 4NZLA 4AYYB 1MKWK 1A5HA 1GCTC 1TNHA 3DHKH 3U98H 2TGTA 1P04A 3KQEA 2IOTA 4Y6DA 3C27B 2BX4A 1P8VC 6CHAC 5FPTA 1Y5UT 1K1IA 3Q3YA 3RXFA 2WINI 1VITG 1LPGB 1MBMA 1C5XB 1G3CA 3RM0H 4AB9A 4JYVH 3FP6E 1ZZZA 4IBLH 4BXWA 2BM2A 2CGAA 2EEKA 2PGBB 1ZGVA 6CHAB 1SGFA 1LQDB 3AVZA 1JXPA 3MI4A 1UTKA 2VH0A 3AW1A 3DA9B 1DDJA 4DG4A 4ZKNU 3PB1E 4CR9A 2BXTH 1NTPA 2A4GA 4BAKB 1YCPK 2V3HH 1MH0A 2OC7A 1QA7A 2WV4A 3A86A 3PWBA 3SUDA 2FPZA 4FUJA 2A5IA 1HDTH 1LCYA 3M3SA 5CHAC 2FWWA 3OX7U 1TYNA 4ZKRU 2W3KA 4DGJA 1A7SA 3LGTA 2R3UA 1Q31A 2R2WU 1U6QA 2M5TA 2NWNA 3S7KB 1Z8JB 3P8OA 2NU1E 3ELAH 1QRXA 1GJ9B 4ZXYH 2BD9A 2XWBI 1GJ5H 1OP8A 5AHGH 1AB9B 1C5VA 1SQOA 1DUAA 4O97A 3SU1A 3LGVA 1XUFA 2PHBA 3BEUA 3ZZ7A 1AFQC 1CT0E 4WMFA 5ESTE 1JRTA 1V2OT 2W3IA 3QO6A 2JETC 5LH8A 3UREA 2ZU3A 3RU4T 3M5MA 2BDGA 2ANMH 1IQIA 3OTJE 1LVBA 2FDAA 1HJ9A 5H4IB 2PLXA 3BG8A 1BRUP 4INKA 2BQ7B 3GCHC 1O3DA 1TONA 4TYDA 2Z9IA 5A0CA 2WV5A 4UONA 2WUBA 2GZ7A 2NU4E 3PYHA 1AE5A 2C8WB 1G3EA 2ZDMA 2RA3A 1NO9H 4U30A 1V2MT 1KXAA 4R0IA 1C1TA 1MD7A 3UQVA 1C4Y2 3FAOA 1CO7E 3GCOA 1C5QA 3F9HA 3U9AH 4X2VA 1TGSZ 2ZHEH 1OWEA 1NROH 3SO3A 1WAYB 1ZPCA 1MQ5A 2G4TA 3RXVA 4CRFA 4Y79A 2F9PA 2FXRA 1SGIB 3SJKA 3PMHB 1EKBB 4K3JA 1XMNB 1L2EA 2BDIA 4B73A 1C2LA 1XVMA 2BD8A 4ABAA 4BTTB 1V2LT 1PPBH 2GD4B 1CGIE 3RXPA 1C2IA 4I7YH 3TK9A 2Z9KA 2B5TB 2Z6BD 1TFXA 3K6YA 1ELEE 4IS5A 5ESBA 2A32A 4I8LA 3SN8A 4X6PA 4JYTA 1NPMA 1MD8A 3RXBA 1VGCC 1S5SA 2VIOA 1HPGA 1N6YA 3KQCA 1S0QA 2AGGX 2GCHG 4DY7B 2BDHA 4UFDH 3ZVFA 1TGTA 3KHVA 3EYDA 1T8OA 1DWBH 1EJAA 1RIWC 3UIRA 1J15A 1OWJA 4Q7XA 2HNTC 3BTFE 3A8CA 4Y0ZE 1RGQA 2VIQA 2O9QA 2J9NA 2FIRH 3MYWA 4B74A 3M35A 4B2CA 1BBRE 1LQEA 1RTFB 4ZHLU 3MU8A 2BDBA 1GHBF 3QN7A 1IQFA 2BY5X 1RS0A 1BZXE 1L1NA 3D65E 3TPIZ 2ZEBA 1EATA 1FV9A 1TPSA 4FVDA 1FPCH 4OGYA 1BTHH 1UVPA 3ZZ5A 5J4QA 1K1PA 5FHTA 2FO9A 1EAXA 3SV2H 4CRCA 3UY9A 2H9TH 5E0GA 1GI6A 1TMUH 4Q7YA 1K1MA 4FVBA 4TWYA 4B75A 4RSPA 2XCFA 2ZU2A 1TMBH 3KL6A 3LIWA 1V2QT 1AE8H 1QR3E 3BIUH 2OCVB 2PSXA 3ODDA 1UK3A 5JPMH 1ELAA 1V2VT 4LZ4B 2WPJS 3BTKE 1BA8B 3RMNH 1O2RA 2ZNKH 1XX9A 4MNXA 3SV8A 1AKSB 4AOQA 3RXCA 4BANB 2ODYB 1P03A 1ZSKA 1QCPA 5TCAA 2A5AA 1GJ6A 3UTUH 4NIYA 1K22H 3AASA 1LHCH 1SOZA 3RMMH 1NU7B 3RMOH 1MKXH 3QGNB 4ABIA 4X1QU 3UWJH 3RU4E 1J16A 1VR1H 1L4DA 2CJIA 2GP9B 4KTSA 3RU4D 5E2OA 2B9LA 4UDWH 1NFWA 3FVFB 1LPZB 1P05A 2P8OB 1O5CB 3FANA 3HKIB 4X1SU 3SV6A 1V2TT 1P11E 1AFEH 5LGOA 1DWCH 1UCYK 1TQ0B 5EQRA 3FZDA 1TOMH 1HAVB 1UHBA 4JZDH 1O2VA 1HAZB 3K2UA 1RTKA 2W26A 1P2IA 3KNXA 4NA8A 4Y10E 4UD9H 3STIA 5LPFA 2Z9JA 1ETRH 2G4UA 2FLBH