1TLDA

Crystal structure of bovine beta-trypsin at 1.5 angstroms resolution in a crystal form with low molecular packing density. active site geometry, ion pairs and solvent structure
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Crystal structure of bovine beta-trypsin at 1.5 A resolution in a crystal form with low molecular packing density. Active site geometry, ion pairs and solvent structure.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1989-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tldA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tldA02
4FUGA 5BRRE 3GY2A 3L3TA 3QO6A 2BLOA 1GG6C 2H9EH 1GBEA 2EA3A 3HKJB 5EXNA 3RXRA 3A84A 5JB9S 2XBXA 1LVOA 2OC0A 2OTVA 4IW4E 2K1QA 3TJVA 2AEIH 3P17H 1ORFA 1V2OT 3GCHC 5DP6A 1CA8B 4AFQA 8GCHG 4DY7B 2LPRA 1ZTLA 1C1MA 1THPB 1YC0A 1ETTH 2Y81A 3GYMA 2VIDA 2FI4E 3OTJE 1P57B 2FXRA 3B8JA 4YOIA 2FIRH 1CT4E 2TGDA 1NO9H 2BQWB 2QF0A 1WQSA 4RKOB 1GMDF 5HYOA 1O34A 3KQEA 5E2PA 1DX5M 1UTKA 1DOJA 2G5VA 3SQEE 3TK6A 1MKXH 2NU0E 3JZ2B 3RXCA 3O8CA 3STIA 2BDCA 2ZGCA 5GIBA 3PLPA 2QXGA 3A80A 1TMBH 2IN2A 2OP9A 2AMQA 1XUGA 1O31A 3SV7A 5TCCA 2FS9A 4ABDA 1QA0A 1DE7H 8GCHF 3SGAE 4TWYA 1OWDA 3U98H 1TNLA 3RM0H 1O2MA 3VEQB 1LCYA 1BJVA 1GHWH 1WYKA 4AG1A 2A5KA 2R2WU 3BTDE 1B7XB 1T31A 3MOCA 5HMAA 1FPCH 3M7QA 2D8WA 3RXBA 1C1RA 1Y3YA 1C2KA 1P2NA 2QYIA 2DE8A 1P9SA 2ZCLP 1FY4A 1ELGA 1V2WT 3BTFE 1TNIA 4X2WA 4B1TA 1C5RA 2GT7A 1UCYK 5J4SA 3TH3H 1YCPK 1ELAA 2W7UA 1BUIA 1GI8B 3ZYDA 5E2OA 2ZU2A 1O3IA 4NA8A 1C1SA 1N1LA 1LHCH 1Z1IA 2W26A 3PYHA 4H4FA 5JYIA 3P95A 2Z6BD 3RLWH 2C4FH 4AOQA 1ZMJA 4A1VA 1GCTB 1MTUA 1YPGH 2BDHA 4AYVB 3QN7A 4MVNA 4B74A 2Z9GA 5HGGA 4FXGH 1W8BH 1LPGB 1W12U 2FDAA 3TITA 3H7OA 4GAWA 1LPKB 5HM2A 4YM9A 2FLRH 1THRH 4BAOB 5AFZH 3R3GB 5DP7A 1PQ5A 1O3OA 4D7FA 1ELTA 1GJBB 2BYAX 4IC5A 3VB7A 1VGCC 1OP0A 2BOKA 1O2PA 3NPSA 1JOUB 3UY9A 1TX8A 2BDIA 1VCWA 1HAXB 2ULLA 1CVWH 1WCZA 1JBUH 2P59A 3PB1E 1A5HA 1ZHMA 2TGPZ 1C5SA 1IQJA 1J8AA 1NPMA 4X2XA 2A4RA 5EPYA 1D4PB 2GP9B 3T29A 2J9NA 2UUFB 1OWEA 4ISOA 3T62A 1CHGA 1FI8A 4UFGH 2G52A 1CQQA 3OSYA 3GCTG 3SQHE 4CHAC 1Y5BT 1P09A 1WBGB 4Y0YE 5JBAS 5BPEA 2ZGXH 1TA2A 4Y79A 1O2QA 3NUMA 2W7SA 1O36A 1MTSA 3D23A 1D6RA 2FTMA 3TIUA 2OBOA 3SU0A 1VITG 3BEFB 4FU8A 1XVMA 1GG6B 2VVUA 1BT7A 3MWIU 1J16A 4CH8B 2V3OH 4KELA 3SORA 3RXKA 1FPHH 1ID5H 3K2UA 3M7UA 1SLXB 1AWFH 3AASA 4B2AA 1YPMH 3QK1A 3GCHB 2WPLS 3U8OH 1QJ1B 2G55A 1UK4A 2HNTC 4YOJA 2GCHG 1JRTA 4Z0KA 2BTCE 3UR6A 3DA9B 3GCTF 1SGEE 2KAIB 1HAGE 2C8WB 1NFYA 4ZHMU 3A82A 3QWCH 1BZXE 1SFQB 1UCYH 2P3FH 2JH5D 4ESTE 2C90B 4BAKB 3SNAA 5E0GA 1TFXA 1EAUA 4AN7A 2LNCA 1GPZA 4TPYA 4CRAA 5F6MA 3ODDA 1ELFA 4WMEA 1VITF 5E0HA 1RIWB 3H7TA 3K9XB 3TU7H 5FAHA 1UK3A 2A4OA 4NFFA 4IBLH 5DPAA 1UTLM 2GD4B 1EX3A 3RDZA 2ZQ1A 2PHBA 1C5WB 1TX6A 3SUGA 2ILNA 2Q1JA 1FAXA 1A46H 1P10A 6LPRA 1QBOA 3UPEA 5DP5A 1SGTA 2VNTA 4ISNA 3SBKA 3CS0A 1QB9A 2GCHF 3I77A 4TY7A 3PROA 5F8TA 2OD3B 4THNH 1F0UA 1OKXA 3QTVH 5EGMA 1DXWA 4OGYA 3E0PB 2ZFPH 2FOGA 4J1YA 1K21H 1G3CA 2BDAA 1LVMA 4IN2A 1P06A 4R8TB 2BLVA 1HAZB 4UD9H 2HNTF 1TPSA 4ZAEA 2FPZA 4TWWA 1UTJA 3A87A 6CHAC 2SGPE 1JIMA 4K3JA 1GHAF 2D1JA 3RXDA 1ANDA 3F68H 1GDNA 1SQAA 1FN6A 3T28A 1UTMA 1WSSH 3O8DA 5L6NH 4X6OA 3ATMA 4GLYA 3A7XA 1GBMA 3W94A 1AMHA 5EODA 1WTGH 1HXFH 1O2YA 1ZTJA 4Y8YA 3LC3A 1C9TA 5EXLA 3TJOA 1TBRH 2JKHA 2NU3E 1CGHA 1G36A 4I7YH 2ZFRH 4IMZA 3KIDU 3FP8E 3KGPA 3MNSA 2XXLA 3ATIA 4NIXA 4ABGA 1EZXC 5H4IB 4HFPB 4MNYA 4ZXYH 1AQ7A 3A86A 5L30H 1O33A 1QJ7B 2VGCC 5F03A 1YLDA 2CMYA 3OX7U 1O37A 5EQSA 1J14A 5EQRA 1VGCB 4K8YA 2FP7B 3RXVA 2PWXA 2A7CA 4OS6A 1QQ4A 1HAOH 2QC2A 2YNBA 1KTTB 1FNIA 3RXUA 1C1PA 1GMCG 2C8ZB 2BZAA 3SHAH 5A0CA 1BRUP 2QXIA 1WOFA 4O9VA 1ANCA 2ZDAH 2CJIA 1QL9A 2F9OA 2ZFFH 2HNTE 3LT3A 4I33A 1BTWA 1GHXH 1PYTD 3RXPA 3PLBA 2EI8A 3GY3A 1SGFG 2BHGA 3LGIA 4CR9A 4MPUA 2XC0A 2ZU5A 4CHAB 1T8LA 3SV8A 3VGCC 3RXFA 4K8BA 3UNSA 4X1QU 1NFXA 2XNIA 3LOXA 5GWZA 2W5EA 1RXPA 1Z8JB 3ESTA 2A5AA 2VIWA 1GMCF 1UVOA 3EA9A 2AGGX 4BTTB 2Y82A 4I8JA 1BDAA 4GCHG 4Q7ZA 1FY3A 2CV3A 5AVDA 1K1LA 1IQIA 3A7WA 1EOJA 1O2ZA 1SLUB 1XKAC 1TWXB 1O3JA 3DFLA 1ZJDA 2DUCA 2GGVB 4IMQA 3ZVBA 4ZROA 8KME2 4CRBA 2F9UA 9ESTA 1VR1H 3SU6A 1YCPM 2F83A 3PO1C 1NTPA 1HLTH 4KKDA 3GCNA 1DUAA 1O3KA 1T7CA 3IWMA 3OY5U 2BD3A 1Y3WA 1AE5A 2BLWA 2BB4A 4YT6H 1UVSH 1GWAA 1K1PA 4WMFA 4ABFA 1QL7A 1X7AC 3UR9A 2R0LA 2ZHEH 3HK3B 1KY9A 2C8XB 3EAJA 4GCHF 1EB1H 3BTEE 1QCPA 3T2NA 1RD3B 3VFEA 1CA0B 4ZH8A 1ELVA 1S85A 5DO4H 1GHBG 1G32B 1KXDA 1TMUH 4HI3A 4A7IB 3RXHA 4INHA 2G4TA 4MDSA 1DLKB 2VWLA 2PSXA 5EG4A 2GZ9A 2TPIZ 1AB9C 5EXMA 5A8YA 2XTTB 1LHGH 4UFDH 4BXWA 1KXAA 2ZFSA 2FM2A 1Y8TA 3NXPA 4FUCA 2PSYA 3CENA 3FP6E 4O3UA 2BQ7B 4JZ1A 1BMAA 1BTZA 1TGNA 3MO6A 3OY6U 2FMJA 1Y3XA 2GX4A 4Q7XA 8LPRA 2J92A 5AHGH 4K60A 1YF4A 3Q76A 4Y71A 1A4WH 1EJAA 1GBTA 2V35A 2ZG0H 4MTBA 1GHBF 2EEKA 4I8GA 5I46H 5LH8A 1FZZA 3S9AA 2BD2A 2BDYA 1YGCH 1AKSA 1XVOA 4U32A 1OPHB 1TONA 1KIGH 3RXEA 3URDA 1MTVA 2PLXA 3BSQA 2PKAB 3RU4D 3SJ9A 5A09A 2BOHB 2VJ1A 1G9IE 2FOCA 1SLVB 2ZU4A 1TMTH 1HJ9A 3LH3A 3PMHB 2VVVA 3MU1A 1SOTA 3UWIA 1BB0B 4HGCA 1EZSC 1AN1E 1SGYE 2FEQH 2IOTA 5DK1A 6GCHG 1DXPA 2ODQA 1AWHB 1S0RA 2PGQB 2H1UA 2PKAA 2VGCB 2GDDA 1O3PB 2ZFTA 3SW2B 1ZR0A 4ABJA 2WV5A 5TCAA 4FUFA 4HTCH 1TLDA 2J94A 4K1TA 4NFEA 1FLEE 1YKTA 3KHVA 4MQAA 4B2CA 4Q2KA 4DGJA 1EP5A 3DD2H 2Z94A 1MMJN 1O2HA 1O2WA 2A0QB 2YNAA 1UVTH 3F9GA 1NRPH 2Z3CA 1C2HA 3Q77A 2UUJB 1Q3XA 1ZRBA 4CRCA 3UQVA 1TOMH 2QV1A 1P2JA 1O30A 4UE7H 1O5GH 3TPIZ 3VGCB 4YESB 2F9NA 1FQ3A 3M3VA 1AIXH 1ANEA 1OYTH 2O8UA 1K9OE 1Z7KA 1FY1A 2B5TB 1OWIA 1YPLH 1CE5A 3STJA 1NRSH 2GV6A 1FN8A 5K0HA 2AGIX 3VB6A 5LPEA 1O2TA 1GJ4H 1OWHA 1SSXA 4JK6A 1C5OH 3GDSA 3OYPA 4YLQH 2GTBA 3ZZ9A 5ABWA 1PQ8A 3MH6A 1P2QA 1MU8B 1YM0A 1ABJH 4A1TA 1SFIA 1V2RT 4CRFA 2XYAA 4RSPA 3PTNA 3TK9A 1Z8IB 1OX1A 4X8VH 3DT0H 3BF6H 3S9BA 4D9QA 3L6PA 2FESH 3LKWA 1SMFE 3P8OA 1DY8A 3PWBA 1MH0A 2ZDMA 1V3XA 1GL1A 3G01A 3LGYA 4ZMAH 1TNGA 3PO1B 4E7RG 1ELEE 1C1OA 5EW2H 2ANMH 2ZC9H 5FX6A 1L1JA 2P94A 1BJUA 1NFUA 4GUXA 1U6QA 1C2GA 3F9FA 1DANH 5F8XA 1TABE 3QLPH 1KXFA 1ZMLA 4CH2B 1UJ1A 1K1NA 3BG4C 4F4OC 1RIWC 2FYQA 4WVPE 4MPVA 2XW9A 1HBTH 2BLQA 1DWCH 3M37A 3GY5A 1AE8H 1E34B 1BBRH 2VVCA 3MNXA 4MLFB 4XFQA 2PUXB 5C1YA 1C5ZB 1SGRE 3E8LA 2FX4A 3P8NA 3ZZ5A 2QIQA 4DG4A 1D9IA 1T32A 4UFEH 1NU7B 1AB9B 3KNXA 1V2PT 1GJCB 3R0FA 1EAIA 2QXJA 2Q6FA 4DVAU 2PTNA 2ZQ2A 3PM3A 1KDQB 1GBIA 3RXAA 4DIIH 2ZTXA 3ATKA 1INCA 1N8OC 3SNEA 2FOMB 1GBHA 1UTPA 1AUTC 1G3EA 4SGAE 4Y7AA 5FX5A 1HCGA 2HRVA 2RA3A 2XBVA 3U8TH 3MHWU 1QRXA 1H9LB 1KDQA 1Y5UT 3K6YA 2ZHQH 4ISHH 3F6UH 3F1SB 2IJOB 2RDLA 2WYGA 2ZA5A 3AVZA 1RRKA 3MNCA 2ZO3H 4J2YB 4AFUA 1P12E 2ZDVH 2TGAA 1O5FH 1E0FD 1FUJA 3H5CB 2M5TA 1GL0E 4MNVA 1WUNH 1KYNA 1GHZA 4DCDA 1P2KA 4NIWA 1GJ5H 1XXDA 1V2QT 3TGJE 2ALVA 3TGIE 1ZHPA 3GY6A 8ESTE 1OWJA 3HPTB 1C1QA 3A88A 2QAAA 1S5SA 1F0RA 1GI7B 4JCNA 1Q31A 5T6FA 2Y80A 1HYLA 1KLJH 1SB1H 5EW1H 2FO9A 4E06H 1O2IA 1RGQA 3SNDA 2VINA 1G3BA 2ZECA 1BTHH 3E1XB 5C1UA 1LO6A 1PPFE 2A2QH 2BD5A 4BAHB 2SGFE 2TIOA 4FUJA 2VIOA 3P6ZB 1C2DA 2F9PA 2Z9IA 1T8MA 5DJ7A 4JZIA 3S0NA 1MBMA 1O35A 2ZHWH 1S6FA 1YPJH 1EJNA 1MQ6A 4U30A 1V2LT 5JDUB 1F92A 4IGDA 1SGPE 3TK5A 5EQQA 3RXLA 1TRNA 1TPAE 3BTME 5C20A 3B9FH 2J38A 4MNWA 3ELAH 2TBSA 2BMGB 4O97A 4Y10E 3UNQA 1C2MA 3RXOA 7GCHG 2UWPA 2D26C 3GY7A 1L2EA 1UMAH 3ATLA 1OSSA 1OS8A 2TRMA 1EZUC 3MO3A 1TIOA 3VXEH 1BRAA 2FOBA 1TYNA 2FLBH 1C5VA 2HGTH 1GBAA 4K69A 1H4WA 1QRWA 4WY3A 1ZMNA 2D2DA 5A8XA 5ESTE 2FS8A 3GISB 1HV7A 1GVKB 1YPKH 4NWLA 3RLYH 1C9PA 1SGDE 3A8BA 1WAYB 5DKMA 3LIWA 3E90B 4X1PU 4AB9A 4ZKRU 4ZKSU 3LC5A 4X6PA 3EDXB 3RUOA 1T8NA 2BD8A 2UUYA 1QQUA 1ANBA 2HPPH 1BIOA 1GJAB 3KCGH 2BX4A 3BG4B 1O2LA 5C2ZA 4M7GA 2G00A 1P3CA 1T4VH 1UHBA 2SGDE 1Z8RA 1O5DH 3C27B 1W7XH 1QR3E 4FU7A 1W7GH 2P93A 4OS4A 4NGAH 5A2MH 1CA0C 4NIVA 1FY8E 1OOKB 3GCOA 3QGNB 2ZHFH 5ESBA 5T6DA 1O0DH 1O3FA 1F7ZA 1ZJKA 2WPMS 4OS2A 4AFZA 4JYVH 5HXFA 2H5DA 1AZZA 1KXBA 2BVSH 4MPXA 1C5MD 4I31A 3QZRA 3TJUA 1EKBB 1K1JA 4UEHH 2RCEA 2OXSA 5FPSA 1QL8A 1DY9A 1GGDB 1PJPA 1N8OB 5C3NA 4CBOA 4AGJA 5CHAC 3SV6A 2AYWA 3FAOA 1HPGA 2ZEBA 1ZRKA 2Y5GA 4X1SU 1GHYH 2O8TA 4AFSA 1P03A 1FJSA 1W0ZU 4D9RA 1HAVA 1FIWA 2JETC 2A7JA 1P3EA 1SGCA 1EP6A 3RXIA 4ZHLU 5FBIA 3LDXH 2BD9A 5JBTA 2CHAC 4RN6A 5PTPA 2GV7A 2BD7A 3VB5A 3I29A 1QB6A 1C2LA 2Y6TA 1MTNB 4D7GA 3A7ZA 1GDQA 2ZU1A 1S6HA 1O5CB 1SR5C 2J95A 3MTYA 3UREA 1F0TA 3M5MA 4Y6DA 2JH6D 1TX7A 2FZZA 2GDEH 1D3PB 1ELBA 5F8ZA 3SUDA 2WPKS 1O3MA 1A5IA 1EZQA 3JZ1B 4NA9H 2PTCE 3LGTA 2PFEA 4ISLA 5FCRA 2QN5T 2O8WA 2SFAA 1NROH 4DOQA 3BTHE 2G4UA 1EPTA 1GMHG 3AW1A 1OP8A 4INLA 1J17T 1SLWB 1XUIA 5JPMH 2JH0D 1AGJA 7KMEH 1O2RA 4FU9A 3RP2A 4ZUHA 4VGCC 2H5CA 2Z3EA 1BTYA 1HRTH 1V2VT 4YOGA 1HB0B 1RFNA 1ZSKA 1HAIH 4KTCA 1VCPA 1W3CA 1B0FA 5DP8A 1O5AB 1RJXB 1A0JA 3LONA 1KXCA 1DS2E 3AAUA 3T5FH 4UONA 1W14U 1O2OA 1SI5H 1A5GH 3MH5A 2FOHA 1SOZA 2ZDLA 3Q3KA 1GBLA 1SVPA 5ETXA 3SGBE 2BY9X 1P05A 1WV7H 1MCVA 3ZV8A 3PTBA 2UUKB 4XOJA 1CO7E 2Y7XA 4RKJB 4OS1A 3EYDA 2ZPSA 3SZNA 3A8CA 2XC4A 1L1GA 1MAYA 1EB2A 5C5NA 1MD7A 2ZCKP 3KL6A 3GDVA 4XBDA 1D6WA 1FIZA 1QRZA 2P95A 2RG3A 2OC1A 1Z71A 4FUIA 3UTUH 5T3HA 3Q00A 1P11E 4GSOA 1QBVH 1O2GH 3RXSA 1DSTA 2ZTZA 1MZAA 2V3HH 2QGRA 1FDPA 2ZWLH 1DICA 2ZGJA 2WUCA 2GZ8A 1TPOA 2ZGBH 3UFAA 1IAUA 1C1NA 4WXVA 1LHFH 1IQFA 1S81A 4WH6A 3MO9A 1SGQE 1QTFA 1LQEA 1TQ7B 1VJAU 1GBKA 3DFJA 3FFGA 4LOYH 2VH6A 5LPRA 2XBYA 1YLCA 2ANWA 1O3LA 3MI4A 1TA6A 4YT7H 1P04A 2B8OH 4MG3A 1V2NT 1NU9A 2ZCHP 2XC5A 1GJ9B 3P8GA 1W13U 4Y8XA 1LTOA 1P0SH 3V0XA 1SPJA 1GI9B 2G51A 3M7TA 2STAE 5FHTA 3EE0B 1O2UA 1D3TB 3RMLH 1E37B 1MAXA 1A3EH 4TY6A 2W3IA 1CT2E 4BOHA 2P3TB 4Y7BA 1MQ5A 1N6YA 1HAPH 1BCUH 2DE9A 1BRCE 4R0IA 2VIVA 4I8KA 1C1UH 1GJ6A 3ZVEA 4XSKU 1GJ8B 1IQEA 2A7HA 5CHAB 2ZKSA 1LVBA 4X8SH 3VXFH 4H6SB 3M3SA 4LXBH 1IQKA 1J9CH 4WJG2 4D8NA 2UWLA 1O3DA 5GJ4B 1AKSB 1KLIH 2FWWA 4AZ2B 2HVXA 3CS7A 2PV9B 2JETB 3TH4H 4CBNA 2BY8X 3RXMA 1UTOA 3SOSA 2H9HA 1GJDB 1O5EH 1D3QB 1G37A 1J15A 2CHAB 2FOAA 4I8HA 3SU4A 1QNJA 1L1NA 4BNRA 4FVBA 3GOVB 1GI3A 1TQ0B 1HDTH 3BG8A 2PUQH 5SGAE 1C2EA 3QGJA 3P8FA 3ZZDA 1EXFA 1MKWH 4AYYB 1DT2A 1O2NA 4TPIZ 1THSH 4GPGA 3PMAB 1BMLA 3SU5A 2O9QA 1O2JA 3RU4E 1BBRK 1XX9A 3ENSB 3I78A 1A3BH 1XUFA 1C5LH 4DW2U 4WXIA 1AD8H 4LK4A 1YPEH 3S69A 4JZFH 1OXGA 1GI0A 2B9LA 1JRSA 5EOKA 3E16B 1L0ZA 1G3DA 4MNXA 1ESBA 1P2IA 1S84A 1O3NA 2WYJA 4DURA 4E7NA 1RTLA 1LKBA 1XUKA 4VGCB 4JYTA 3TNTA 1IQHA 5GXPA 1F5LA 4UFFH 1O2XA 1DM4B 1NRRH 2OLGA 1TGSZ 1QURH 3QDZB 5HM9A 4NIYA 1GI6A 3MFJA 1Q2WA 2YOLA 3BEIB 3ZZ3A 3RC5A 1BA8B 1NN6A 1QB1A 1CSOE 2Z7FE 2THFB 6GCHF 4ABBA 2BY6X 1VITH 4ZHAA 3U1JB 2FODA 3LGVA 1OP2A 4Y0ZE 5IYTA 4K2YA 1XUHA 4CRGA 5IDKA 1JMOH 2GKVE 4IC6A 2A31A 3MU8A 1HJAC 1K1IA 3S7HB 3ZV9A 3SGQE 4A1XA 4AX9H 1EAXA 3U69H 4FUHA 1G30B 2EI6A 4Z6AH 2Q6GA 3S9CA 2ZIQH 3HATH 1QFKH 2V0BA 1BQYA 1JXPA 2SGAA 2A32A 2Z9JA 2A5IA 1KTSB 3KEEA 1UCYE 4WH8A 3RC4A 1DPOA 1CU1A 2Z3DA 4BTUB 1UO6A 4OGXA 3OU0A 1GMDG 4AGKA 2ZI2H 3A8AA 3ZVCA 1IHTH 2A4GA 1P01A 1Z8GA 4X1NU 1AFEH 2NU2E 1HIAA 1TPPA 1C4Y2 5TJXA 3NZIA 1V2KT 2QA9E 1AI8H 4X2VA 4F49A 1AO5A 4I8LA 3SJOA 4GHTA 1NC6A 2QXHA 2HWLB 5E0JA 2Z9LA 3Q3YA 3SJIA 2A2XH 4ZXXH 2G8TA 1NM6A 2FTLE 1AUJA 1HAYB 1P2OA 4DIHH 4B73A 3RXJA 1WQVH 1V6DA 3MU5A 5JBCS 1GCDA 2XWBI 3F9HA 1CHOG 1Y3VA 2O8MA 5G4BA 1MBQA 5A0AE 1S0QA 1MTWA 1C1WH 1ZPBA 1C1VH 3WY8A 1PPHE 1WTHD 3NK8A 1YP9A 2Y5HA 1SG8B 2VWOA 2FOFA 1CBWC 3KQDA 1YPHC 3HGPA 3SHCH 3LJOA 1ZGIA 9LPRA 3ZVFA 3FANA 2BDGA 3P70B 1HXEH 2V6NA 4O3TA 1GI1A 1NY22 4D76A 2XCFA 1S83A 3TJNA 1VCQA 3CP7A 4NWKA 2OBQA 1AY6H 1AU8A 1GGDC 3D62A 1ZGVA 4K1EA 1CT0E 2HALA 3SU3A 3SU2A 1CHOF 3M5LA 1AZ8A 3KQBA 1O38A 2VIQA 1F2SE 2AIQA 3M35A 3C1KA 1H1BA 3MYWA 2AIPA 2GCTC 3S7KB 1C2IA 1BHXB 3ATWA 4BAMB 5DGJA 4JYUH 3SNCA 2J4IA 2HLCA 3SI4H 1BMMH 3ITIA 1FMGA 3BTGE 1MTNC 1C1TA 2XRCA 1ZLRA 1H9HE 4WMDA 3RU4T 3BIUH 3MH4A 2P8OC 1IOEA 2IPHA 1L4ZA 4Y11E 5DG6A 1TB6H 3W95A 3LU9B 1C5PA 1CGJE 1DWDH 1SHYA 2XCNA 1EPTC 1DITH 2AFQB 2W3KA 3ZYEA 1NESE 1W2KH 1M9UA 1C2JA 1K1MA 3BTWE 4YTAA 3SUEA 3MU0A 2ZU3A 1DDJA 4H6TA 1A61H 2NWNA 4NSVA 5DP4A 1LQDB 2H6MA 3L33A 4SGBE 1ZZZA 4E05H 3HKIB 1F5KU 2C8YB 2ZPRA 1OYQA 3E91A 1RTFB 1GI5A 2BDBA 1O2SA 1BTXA 3PMBB 1QIXB 2OQ5A 2ODYB 3PLKA 1AHTH 1ACBE 1H8IH 2H2ZA 1SL3A 5FCKA 2ZTYA 1Z6JH 4NZLA 1O3BA 3U1IB 1HJ8A 2F91A 2CN0H 2C93B 3GDUA 3UQOA 5L2YH 2OUAA 4NCYA 1TBZH 3SNBA 1C2FA 1GJ7B 2STBE 3FZDA 1HJAB 4IS5A 1CGIE 1Y3UA 5C5OA 5C1XA 1NRQH 1K1OA 2BD4A 2FOEA 3SU1A 3P92A 1XUJA 1O5BB 5JB8S 4B71A 3UNRA 1B0EA 1LKAA 2TGTA 2ZNKH 1LMWB 2XWAA 1H8DH 1PPGE 4FVDA 1PPBH 3QX5H 3TVJB 1QHRB 2CGAA 3PWCA 1TRYA 2SGEE 3V13A 5L2ZH 3VB4A 3UOPA 2GT8A 1K2I1 1JIRA 2P16A 2OQUA 1YPHE 3FVFB 2BQ6B 1ETRH 1UK2A 1IQLA 3QZQA 4FUDA 1XM1A 2BVXH 4H42U 1A0HB 2ZP0H 3ZVAA 3ZZBA 1UHBB 2WINI 2BXTH 2AMDA 1SBWA 3N7OA 4KTUA 2NU1E 1A0LA 4KP0A 3AW0A 4I32A 2PKSC 1PYTC 7GCHF 1C5QA 3LH1A 1QBNA 1TGCA 2OC8A 4X0WU 3ZZ8A 1ZSLA 4A92A 2R9PA 1TAWA 1O32A 1GBJA 2HOBA 3UWJH 1Z6EA 3GYLB 1PPCE 1IHSH 3Q3XA 1T4UH 3LJJA 5DP3A 1ZHRA 3EA7A 4KGAA 3EA8A 1O2KA 1ELDE 3BTTE 4IN1A 1F0SA 4ZKOU 2AERH 2BVRH 4WWYA 2R3YA 1YCPH 2BX3A 3VB3A 3V12A 1JWTA 3UIRA 3A81A 2QCYA 1O3CA 1CBWB 5A8ZA 5AF9H 5T6GA 5LPFA 3KN2A 3SO3A 1LHEH 1UTQA 1PPEE 2ZHDA 3GY4A 5GPIB 3ZZCA 2J2UA 3E0NB 2KAIA 3F9EA 7ESTE 3EGKH 1GHAG 1HUTH 1P02A 1HAVB 1SQTA 2SGQE 1IQGA 1TBQH 4X8TH 5A0BA 2B7DH 1C5XB 2ZPQA 3NKKA 1D3DB 4O03A 1P2MA 4AG2A 5FBEA 1TOCB 1UTNA 2CXVA 3LPRA 1O3AA 2FYRA 4YLUA 3D65E 1C4U2 4Q80A 4WF8A 4X2YA 1BOQA 4K1SA 4QT8C 2GCTB 3A89A 1E38B 3A7YA 1ESAA 1Y59T 2GMTC 1N6XA 3SV9A 5FXLA 2AS9A 3HK6B 4PROA 1DFPA 2ZFQH 4GVUA 3EQ0H 1SGNE 4HZHA 2CF8H 4U2WA 2P8OB 4X8UH 2ALPA 2R2MB 3MH7A 2ESTE 3E6PH 2G5NA 1K28D 2BY7X 1EAWA 5EU8A 3TGKE 2VB0A 1DUEA 3O8RA 2ODPA 1EPTB 4MPWA 2SNWA 3IITA 1ZYOA 3HGNA 1QA7A 1HGTH 1W10U 1S82A 1TRMA 1FV9A 1YYY1 5EPNA 3AAVA 1KSNA 1C5TA 1W0YH 3SI3H 2ASUB 5CMXH 1DVAH 1TNJA 3SN8A 3B23B 3V7TA 7LPRA 2VH0A 2O8LA 4ZKNU 4BTIB 1QY6A 2HPQH 1EATA 1DWBH 1P8VC 3BTQE 3PMJA 4YO9A 4JK5A 1AVWA 1V2TT 3KQCA 3A8DA 4LZ4B 2VIPA 3SUFA 1HNEE 3D49H 1AFQC 2NU4E 2F3CE 1Z1JA 1TGBA 3NWUA 2A45B 1KXEA 1O3GA 3TLOA 5GCHG 2EC9H 1GBFA 4NZQA 2BY5X 4NSYA 4A6LA 3SV2H 1PFXC 3ODFA 3T25A 1V2UT 1EUFA 4TYDA 2I6SA 3DUXH 1SQOA 1DSUA 2BZ6H 3BV9B 1ABIH 1FXYA 1MKWK 4B76A 2AGEX 1GMHF 1ARBA 3E3TA 1BTPA 1GBCA 1AVXA 4ABIA 2A4QA 1L4DA 4XBBA 5I25A 4CR5A 2ZF0H 1TNKA 2PGBB 5AFYH 5CE1A 4B75A 3M36A 1XMNB 1V2ST 1G2LA 2OC7A 3TNSA 2Z9KA 3ZVGA 3U8RH 4NG9H 1GHVH 5C67A 4FUBA 1KLTA 5FPYA 5GCHF 1ARCA 2ZDNA 4INKA 2VWMA 4ISIH 1RTKA 1WU1A 2ZGHA 1ELCA 1C5YB 1XXFA 1UVUH 3SJKA 3GICB 1LPZB 3V3MA 3LGUA 1BBRE 2PKSB 3T27A 3M5NA 2AH4X 3ZZ4A 1EOLA 1IQMA 1QJ6B 2EI7A 4ABEA 4JZDH 4XE4A 1GBDA 1SC8U 2ANKH 2UWOA 4GHQA 2C3SA 1QGFA 3TH2H 2FX6A 1GDUA 2RA0A 5K7RA 1E35B 4DJZB 5LGOA 1LHDH 3FP7E 2OCVB 2WPIS 2B0FA 1YBWA 2ANYA 3O8BA 2ZZUH 2WV4A 1UVPA 1V2MT 4Y76A 3M5OA 2I6QA 2QY0B 1O39A 4AORA 3ZZAA 3RMNH 1OWKA 1Y5AT 4XBCA 2H9TH 1ZTKA 2FI5E 3T26A 4LZ1H 3QUMP 4ABAA 1O3HA 1RS0A 1EQ9A 3A83A 4OS7A 2PR3A 3BTKE 2GZ7A 2WPHS 3MU4A 3UUZA 1A2CH 1SHHB 3UOUA 1H9IE 1VZQH 3RMOH 3ZVDA 2BM2A 1T8OA 4X1RU 1K22H 1PQ7A 3IG6B 4K5ZA 1O2VA 4YZUA 1NRNH 3KF2A 1ZPCA 2GMTB 4DT7B 5DP9A 3LGWA 1HAHH 3A85A 4FUEA 2CF9H 1GVLA 2BXUH 5GDSH 1E36B 1C5UA 6CHAB 1MUEB 1P9UA 2WPJS 3URCA 4ABHA 1DLEA 1BTUA 1NS3A 3RXQA 1ESTA 1NT1A 3ZZ6A 1NZQH 2ZDKA 3RXGA 2SNVA 1ZPZA 4OS5A 2QF3A 2G81E 4BANB 2J34A 1FONA 1A1RA 1HFDA 3SJ8A 2F9BH 3K6ZA 4ASHA 3FZZA 1EASA 1NFWA 1MKXK 1PPZA 3RC6A 3MMGA 6ESTA 1O3EA 4CRDA 3QTOH 4BXSA 4JMYA 4X6NA 1F5RA 3BEUA 1GCTC 4AB8A 1DWEH 4Q7YA 1B5GH 3M3TA 1GVZA 3U9AH 5B6OA 3ZZ7A 2Y7ZA 2OINA 2VU8E 1ETSH 1VJ9U 2AMPA 4XDEA 1LDTT 3VPKA 4X6MA 3BIVH 1V2JT 3NCLA 3RXTA 3RM2H 1BHXF 1AFQB 3K65B 4Y8ZA 1GI4A 1A7SA 1LVYA 1TGTA 4U01A 3RMMH 1BITA 1EJMA 1TE0A 1TNHA 1PQAA 2A1DB 2P3UB 3DHKH 4NA7A 3A7VA 1IQNA 5E8EH 1SGIB 4JZEH 5JBBS 1C4V2 2F9VA 4A5TS 1MU6B 1MD8A 1BRBE 3BN9A 1HIAB 1MZDA 1XKBC 1AVGH 2R0KA 4UDWH 1ZOMA 2Q6DA 1SGFA 2Y5FA 1FAKH 1FY5A 1GI2A 5FPTA 1BMNH 1W11U 2FI3E 5J4QA 3MNBA 2GVFA 2R3UA 1MCTA 4BAQB 1C5NH 2WUBA 1G2MA 1ZSJA 1GBBA 3PV4A 3M61U 4B2BA 4CREA 3A7TA 2PW8H 1TALA 2XBWA 4KTSA 3GY8A 2VWNA
chains in the Genus database with same CATH superfamily
4FUGA 5BRRE 3GY2A 3L3TA 3QO6A 2BLOA 4RT0A 1GG6C 2H9EH 1GBEA 1WDIA 2EA3A 3HKJB 2V7QD 5EXNA 3RXRA 3A84A 5JB9S 2XBXA 1LVOA 2OC0A 2OTVA 3PRBA 4IW4E 2K1QA 2HVYB 3TJVA 2AEIH 3P17H 1ORFA 1V2OT 2VBCA 3GCHC 5DP6A 3VG8A 1CA8B 4AFQA 8GCHG 4DY7B 2LPRA 1ZTLA 1C1MA 1THPB 1YC0A 1ETTH 2Y81A 3GYMA 2VIDA 2FI4E 3OTJE 1P57B 2FXRA 3B8JA 4YOIA 2FIRH 1CT4E 2TGDA 1NO9H 2BQWB 2QF0A 1WQSA 4RKOB 1GMDF 5HYOA 1O34A 3KQEA 5E2PA 1DX5M 1UTKA 1DOJA 1SQRA 2G5VA 2J97A 3SQEE 3TK6A 1MKXH 2NU0E 3JZ2B 3RXCA 3O8CA 3STIA 2BDCA 2ZGCA 5GIBA 3PLPA 2QXGA 3A80A 1TMBH 2IN2A 2OP9A 2AMQA 1XUGA 1O31A 3SV7A 5TCCA 2FS9A 4ABDA 1QA0A 1DE7H 8GCHF 3SGAE 4TWYA 1OWDA 3U98H 1TNLA 3RM0H 1O2MA 3VEQB 1LCYA 1QZ8A 1BJVA 1GHWH 1WYKA 4AG1A 2A5KA 2R2WU 3FO8D 3BTDE 1B7XB 1T31A 3MOCA 5HMAA 1FPCH 3M7QA 2D8WA 3RXBA 1C1RA 1Y3YA 1C2KA 4RT1A 1P2NA 2QYIA 2DE8A 1P9SA 4ACAA 2ZCLP 1FY4A 1ELGA 1V2WT 3BTFE 1TNIA 4X2WA 2OK5A 4B1TA 1C5RA 2GT7A 1UCYK 5J4SA 5DN6D 3TH3H 1YCPK 1ELAA 2W7UA 1BUIA 1GI8B 3ZYDA 5E2OA 2ZU2A 1O3IA 4NA8A 1C1SA 1N1LA 1LHCH 1Z1IA 2W26A 3PYHA 4H4FA 5JYIA 3P95A 2Z6BD 3RLWH 2C4FH 4AOQA 1ZMJA 3DCLA 2CK3D 4A1VA 1GCTB 1MTUA 1YPGH 2BDHA 4AYVB 3QN7A 4MVNA 4B74A 2Z9GA 5HGGA 4FXGH 1W8BH 1LPGB 1W12U 2FDAA 3TITA 3H7OA 4GAWA 1LPKB 5HM2A 4YM9A 2FLRH 1THRH 4BAOB 5AFZH 3R3GB 4B6EA 2KCPA 5DP7A 1PQ5A 1O3OA 4D7FA 1ELTA 1GJBB 2BYAX 4IC5A 3VB7A 1VGCC 1OP0A 2BOKA 1O2PA 3NPSA 5EJ1A 1WXRA 1JOUB 3UY9A 1TX8A 2BDIA 1VCWA 1HAXB 2ULLA 1CVWH 1WCZA 1JBUH 2P59A 1E79D 3PB1E 1A5HA 1ZHMA 2TGPZ 1C5SA 2AHME 1IQJA 1J8AA 1NPMA 4X2XA 2A4RA 5EPYA 3FKSD 1D4PB 2GP9B 3T29A 2J9NA 2UUFB 1OWEA 4ISOA 3T62A 1CHGA 1FI8A 4UFGH 2G52A 1CQQA 3U28C 3OSYA 3GCTG 4RI0A 3SQHE 4CHAC 1Y5BT 1P09A 1WBGB 3KYFA 4Y0YE 5JBAS 5BPEA 2ZGXH 1TA2A 4Y79A 1O2QA 3NUMA 2W7SA 1O36A 1MTSA 3D23A 1D6RA 2FTMA 3TIUA 2OBOA 3SU0A 1VITG 3BEFB 4FU8A 1XVMA 1GG6B 2VVUA 1BT7A 3MWIU 1J16A 4CH8B 2V3OH 4KELA 4P02A 3SORA 3RXKA 1FPHH 1ID5H 3K2UA 3M7UA 1SLXB 1AWFH 3AASA 2J98B 1YPMH 4B2AA 3QK1A 3GCHB 2WPLS 3U8OH 1QJ1B 2G55A 1UK4A 2HNTC 4YOJA 2GCHG 1YLNA 1JRTA 4Z0KA 2BTCE 3UR6A 3DA9B 3GCTF 1SGEE 2KAIB 1HAGE 2C8WB 1NFYA 4ZHMU 3A82A 3QWCH 3CNRA 1BZXE 1SFQB 1UCYH 2P3FH 2JH5D 2J98A 2C90B 4BAKB 5DSFA 3SNAA 5E0GA 1TFXA 1EAUA 4AN7A 4ESTE 2LNCA 1GPZA 4TPYA 4CRAA 5F6MA 3ODDA 1ELFA 4WMEA 1VITF 5E0HA 1RIWB 3H7TA 3K9XB 3TU7H 5FAHA 1UK3A 2A4OA 4NFFA 4IBLH 5DPAA 1UTLM 2GD4B 1EX3A 3RDZA 2ZQ1A 2PHBA 1C5WB 1W0JD 1TX6A 3SUGA 2ILNA 2Q1JA 1FAXA 1A46H 1P10A 6LPRA 1QBOA 3UPEA 5DP5A 1SGTA 2VNTA 4ISNA 3SBKA 3CS0A 1QB9A 2GCHF 3I77A 3W1EA 4TY7A 3PROA 5F8TA 2OD3B 4THNH 1F0UA 1OKXA 3QTVH 5EGMA 3KYGA 1DXWA 4OGYA 3E0PB 2ZFPH 2FOGA 4J1YA 1K21H 1G3CA 2BDAA 1LVMA 3NRLA 4IN2A 1P06A 4R8TB 2BLVA 1HAZB 4UD9H 2HNTF 1TPSA 4ZAEA 2FPZA 4TWWA 1UTJA 3F2HA 3A87A 6CHAC 2SGPE 1JIMA 4K3JA 1GHAF 2D1JA 3RXDA 2XOKD 2F4LA 3N7EA 1ANDA 3F68H 1GDNA 1SQAA 1FN6A 3T28A 1UTMA 1WSSH 3O8DA 5L6NH 4X6OA 3ATMA 4GLYA 3A7XA 1GBMA 3W94A 1AMHA 5EODA 1WTGH 1HXFH 1O2YA 1ZTJA 4Y8YA 3LC3A 1C9TA 5EXLA 2JJ2D 3TJOA 1TBRH 2JKHA 2NU3E 2GJGA 1CGHA 2YMSD 1G36A 4I7YH 2ZFRH 4IMZA 3KIDU 3FP8E 3KGPA 3MNSA 2XXLA 3ATIA 4NIXA 4ABGA 1EZXC 5H4IB 4HFPB 4MNYA 4ZXYH 1AQ7A 3A86A 5L30H 1O33A 1QJ7B 2VGCC 5F03A 1YLDA 2CMYA 3OX7U 1O37A 5EQSA 2EQNA 1J14A 5EQRA 1VGCB 4K8YA 2FP7B 1EFRD 3RXVA 2PWXA 2A7CA 4OS6A 1QQ4A 1HAOH 2QC2A 2YNBA 1KTTB 1FNIA 3RXUA 1C1PA 1GMCG 2C8ZB 5F53A 2BZAA 3SHAH 5A0CA 1BRUP 2EY4C 3FOAA 4F55A 2QXIA 2KCAA 5KGOA 1WOFA 4O9VA 1ANCA 2ZDAH 2CJIA 1QL9A 2F9OA 2ZFFH 2HNTE 3LT3A 4I33A 1BTWA 1GHXH 1PYTD 3RXPA 3PLBA 2EI8A 3GY3A 1SGFG 2BHGA 3LGIA 4CR9A 4MPUA 2XC0A 2ZU5A 4CHAB 1T8LA 3SV8A 3VGCC 3RXFA 4K8BA 3UNSA 2WZQA 4X1QU 1NFXA 2XNIA 3LOXA 5GWZA 2W5EA 1RXPA 1Z8JB 3ESTA 2A5AA 2VIWA 1GMCF 1UVOA 3EA9A 2AGGX 4BTTB 1MABB 2Y82A 2F43B 4I8JA 1BDAA 4GCHG 4Q7ZA 1FY3A 5KECA 2CV3A 5AVDA 1K1LA 1IQIA 3A7WA 1EOJA 1O2ZA 1SLUB 1XKAC 1TWXB 1O3JA 3DFLA 1ZJDA 2DUCA 2GGVB 4IMQA 3ZVBA 4ZROA 8KME2 4CRBA 2F9UA 9ESTA 1VR1H 3F0PA 1H8ED 1YCPM 3SU6A 2F83A 3PO1C 1NTPA 1HLTH 4KKDA 4M9FA 3GCNA 1DUAA 1O3KA 1T7CA 3IWMA 3OY5U 2BD3A 1Y3WA 1AE5A 2BLWA 2BB4A 4YT6H 1UVSH 1GWAA 1K1PA 4WMFA 1KMHB 4ABFA 1QL7A 1X7AC 3UR9A 2R0LA 2ZHEH 3HK3B 1KY9A 2C8XB 3EAJA 4GCHF 1EB1H 3BTEE 1QCPA 3T2NA 1RD3B 3VFEA 3OEED 1CA0B 4ZH8A 1ELVA 1S85A 5DO4H 1GHBG 1G32B 1KXDA 1TMUH 4HI3A 4A7IB 3RXHA 4INHA 2G4TA 4MDSA 1DLKB 2W6JD 2VWLA 2PSXA 5EG4A 2GZ9A 2TPIZ 1AB9C 5EXMA 5A8YA 2XTTB 1LHGH 4UFDH 4BXWA 1KXAA 2ZFSA 1K0HA 2FM2A 1Y8TA 3NXPA 4FUCA 2PSYA 3CENA 3FP6E 4O3UA 2BQ7B 4JZ1A 1BMAA 1BTZA 1TGNA 3MO6A 3OY6U 2FMJA 1Y3XA 2GX4A 4Q7XA 8LPRA 2J92A 5AHGH 4K60A 1YF4A 3Q76A 4Y71A 1A4WH 1EJAA 1GBTA 2V35A 2ZG0H 4MTBA 1GHBF 2EEKA 4I8GA 5I46H 5LH8A 1FZZA 3S9AA 2BD2A 2QF4A 2BDYA 1YGCH 1AKSA 1XVOA 4U32A 1OPHB 1TONA 1KIGH 3RXEA 3URDA 1MTVA 2PLXA 3WW7A 3BSQA 2PKAB 3RU4D 3SJ9A 5A09A 2BOHB 2VJ1A 3N7DA 1G9IE 2FOCA 1SLVB 2ZU4A 1TMTH 1HJ9A 3LH3A 3PMHB 2VVVA 3MU1A 1SOTA 3UWIA 1BB0B 4HGCA 1EZSC 1AN1E 1SGYE 2FEQH 2IOTA 5DK1A 6GCHG 4XRNA 1DXPA 2ODQA 1AWHB 1S0RA 2PGQB 2H1UA 2PKAA 2VGCB 5GNDA 2GDDA 1O3PB 2ZFTA 4P00A 3SW2B 1ZR0A 4ABJA 2JIZD 2WV5A 5TCAA 4FUFA 4HTCH 1TLDA 2J94A 4K1TA 4NFEA 1FLEE 1VKYA 1YKTA 3KHVA 4TT3D 4MQAA 4B2CA 4Q2KA 4DGJA 1EP5A 3DD2H 3PV2A 2Z94A 1E1QD 1MMJN 1O2HA 1O2WA 2A0QB 2YNAA 1UVTH 3F9GA 1NRPH 2Z3CA 1C2HA 3Q77A 2UUJB 1Q3XA 1ZRBA 4CRCA 3UQVA 4TSFD 2QF5A 1TOMH 2QV1A 1P2JA 1O30A 4UE7H 1O5GH 3TPIZ 3VGCB 4YESB 2F9NA 1FQ3A 3M3VA 1AIXH 1ANEA 1OYTH 2O8UA 1K9OE 1Z7KA 1FY1A 2B5TB 1OWIA 1YPLH 1CE5A 3STJA 1NRSH 2GV6A 1FN8A 4FOUC 5K0HA 4I86A 2AGIX 3VB6A 3OEHD 5LPEA 1O2TA 1GJ4H 1OWHA 1SSXA 4JK6A 3FN8A 1C5OH 3GDSA 3OYPA 4YLQH 2GTBA 3ZZ9A 5ABWA 1PQ8A 3MH6A 1P2QA 1MU8B 1YM0A 1ABJH 4A1TA 1SFIA 1V2RT 4CRFA 2XYAA 4RSPA 3PTNA 3PV5A 3TK9A 1Z8IB 1OX1A 4X8VH 3DT0H 3BF6H 3S9BA 4D9QA 3L6PA 2FESH 3LKWA 1SMFE 3P8OA 1DY8A 3PWBA 1MH0A 2KR7A 1V3XA 1GL1A 2ZDMA 3G01A 3LGYA 4ZMAH 1TNGA 3PO1B 4E7RG 1ELEE 1C1OA 2WPDD 5HIZA 5EW2H 2ANMH 2ZC9H 5FX6A 1L1JA 2P94A 1BJUA 1NFUA 4GUXA 1U6QA 1C2GA 3F9FA 1DANH 5F8XA 1TABE 3QLPH 1KXFA 1ZMLA 3WWBA 4CH2B 1UJ1A 5EJLA 1K1NA 3BG4C 4F4OC 1RIWC 2FYQA 2RFKC 4WVPE 4MPVA 2XW9A 3N99A 1HBTH 2BLQA 1DWCH 3M37A 3GY5A 1AE8H 1E34B 1BBRH 2VVCA 3MNXA 4MLFB 4XFQA 2PUXB 5C0TA 5C1YA 1C5ZB 5C17A 1SGRE 3E8LA 2FX4A 3P8NA 3ZZ5A 2QIQA 4DG4A 1D9IA 1T32A 4UFEH 1NU7B 3F2FA 1AB9B 3KNXA 1V2PT 1GJCB 2K0QA 1EAIA 2QXJA 2Q6FA 3R0FA 4DVAU 2PTNA 2ZQ2A 3PM3A 1KDQB 1GBIA 3RXAA 4DIIH 2ZTXA 3ATKA 1INCA 1N8OC 3SNEA 2FOMB 1GBHA 1UTPA 1AUTC 1G3EA 4SGAE 4Y7AA 5FX5A 1HCGA 2HRVA 2RA3A 2XBVA 3U8TH 3MHWU 1QRXA 1H9LB 1KDQA 1Y5UT 3K6YA 2ZHQH 4ISHH 4OM9A 1BMFD 3F6UH 3F1SB 2IJOB 2RDLA 2WYGA 2ZA5A 3AVZA 1RRKA 3MNCA 2ZO3H 4J2YB 4AFUA 1P12E 2ZDVH 2TGAA 1O5FH 1E0FD 1FUJA 3H5CB 2M5TA 1GL0E 4MNVA 1WUNH 1KYNA 1GHZA 4DCDA 1P2KA 4NIWA 1GJ5H 1XXDA 1V2QT 3TGJE 4F48B 4DT4A 2ALVA 2KZ4A 3TGIE 1ZHPA 3GY6A 8ESTE 1OWJA 3HPTB 1C1QA 3A88A 2QAAA 1S5SA 1F0RA 1GI7B 4JCNA 1Q31A 5T6FA 2Y80A 1HYLA 1KLJH 1SB1H 5EW1H 2FO9A 4E06H 1O2IA 1RGQA 3SNDA 2VINA 1G3BA 2ZECA 1BTHH 3E1XB 5C1UA 1LO6A 3UAIC 1PPFE 2A2QH 2BD5A 4BAHB 2SGFE 2TIOA 4FUJA 2VIOA 3P6ZB 1C2DA 2F9PA 2Z9IA 1T8MA 5DJ7A 4JZIA 2XNDD 3S0NA 1MBMA 1O35A 2ZHWH 1S6FA 1YPJH 1EJNA 1MQ6A 4U30A 1V2LT 5JDUB 1F92A 4IGDA 1SGPE 3TK5A 5EQQA 3RXLA 1TRNA 1TPAE 3BTME 5C20A 4Q63A 3B9FH 2J38A 2KCOA 4MNWA 2KCYA 2WV9A 3ELAH 2TBSA 2BMGB 4O97A 4Y10E 3UNQA 1C2MA 3RXOA 7GCHG 2UWPA 2D26C 3WWFA 3GY7A 1L2EA 1UMAH 3ATLA 1OSSA 1OS8A 2TRMA 1EZUC 3MO3A 1TIOA 2L74A 3VXEH 1BRAA 2FOBA 1TYNA 2FLBH 1C5VA 2HGTH 1GBAA 4K69A 1H4WA 1QRWA 4WY3A 1ZMNA 2D2DA 5A8XA 5ESTE 2FS8A 3GISB 4XD7D 1HV7A 1GVKB 1YPKH 4NWLA 1NBMD 3RLYH 1C9PA 1SGDE 3A8BA 1WAYB 5DKMA 3LIWA 3E90B 4X1PU 4AB9A 4ZKRU 4ZKSU 3LC5A 4X6PA 3EDXB 3RUOA 1T8NA 2BD8A 2UUYA 1QQUA 1ANBA 2HPPH 1BIOA 1GJAB 3KCGH 5HKKD 2BX4A 3BG4B 1O2LA 5C2ZA 4M7GA 2G00A 1P3CA 1T4VH 1UHBA 2SGDE 1Z8RA 1O5DH 3DSPA 3C27B 1W7XH 5FL7D 1QR3E 4FU7A 1W7GH 2P93A 4OS4A 4NGAH 5A2MH 1CA0C 4NIVA 1FY8E 1OOKB 3GCOA 3QGNB 2ZHFH 5ESBA 5T6DA 1O0DH 1O3FA 1F7ZA 1ZJKA 2WPMS 4OS2A 4AFZA 4JYVH 5HXFA 2H5DA 1AZZA 1KXBA 2BVSH 4MPXA 1C5MD 4I31A 3QZRA 3TJUA 1EKBB 1K1JA 4UEHH 2RCEA 2OXSA 5FPSA 1QL8A 1DY9A 3OTPA 1GGDB 1PJPA 1N8OB 5C3NA 4CBOA 4AGJA 5CHAC 3SV6A 2AYWA 3FAOA 1HPGA 2ZEBA 2K8IA 1ZRKA 2Y5GA 4X1SU 1GHYH 2O8TA 4AFSA 1P03A 1FJSA 1W0ZU 4D9RA 1HAVA 1FIWA 2JETC 2A7JA 1P3EA 1SGCA 1EP6A 3RXIA 4ZHLU 2KM0A 5FBIA 3LDXH 2BD9A 5JBTA 2CHAC 4RN6A 5PTPA 2GV7A 2BD7A 3VB5A 3I29A 1QB6A 1C2LA 2Y6TA 1MTNB 4D7GA 3A7ZA 1GDQA 2ZU1A 1S6HA 5T1VA 1O5CB 1SR5C 2J95A 3MTYA 3UREA 1F0TA 3M5MA 4Y6DA 2JH6D 1TX7A 2FZZA 2GDEH 1D3PB 2LP6A 1ELBA 5F8ZA 3SUDA 2WPKS 2QE7D 4B6FA 1O3MA 1A5IA 2J5UA 1EZQA 3JZ1B 4NA9H 2PTCE 3LGTA 2PFEA 4ISLA 5FCRA 2QN5T 2O8WA 2SFAA 1NROH 4DOQA 3BTHE 1S6LA 2G4UA 1EPTA 1GMHG 3AW1A 1OP8A 4INLA 1J17T 1SLWB 1XUIA 5JPMH 2JH0D 1AGJA 7KMEH 1O2RA 4FU9A 3RP2A 4ZUHA 1H8HD 4VGCC 2H5CA 2Z3EA 1BTYA 1HRTH 1V2VT 4YOGA 1HB0B 1RFNA 1ZSKA 1HAIH 4KTCA 1VCPA 1W3CA 1B0FA 5DP8A 1O5AB 1RJXB 1A0JA 2L6OA 3LONA 1KXCA 1DS2E 3AAUA 3T5FH 4UONA 1W14U 1O2OA 1SI5H 1A5GH 3MH5A 2FOHA 1SOZA 2ZDLA 3Q3KA 1GBLA 1SVPA 2YMSB 5ETXA 3SGBE 2BY9X 1P05A 1WV7H 1MCVA 3ZV8A 3PTBA 2UUKB 4XOJA 1CO7E 2Y7XA 4RKJB 4OS1A 3EYDA 2ZPSA 3SZNA 3A8CA 2XC4A 1L1GA 1MAYA 1EB2A 5C5NA 1MD7A 2ZCKP 2WHXA 3KL6A 3GDVA 4XBDA 1D6WA 1FIZA 1QRZA 2P95A 2RG3A 2OC1A 1Z71A 4FUIA 3UTUH 5T3HA 3Q00A 1P11E 4GSOA 1QBVH 1O2GH 3RXSA 1DSTA 2ZTZA 1MZAA 2V3HH 2QGRA 1FDPA 2ZWLH 1DICA 3SYJA 2ZGJA 2WUCA 2GZ8A 1TPOA 2ZGBH 3DSGA 3UFAA 1IAUA 1C1NA 4WXVA 1LHFH 1IQFA 1S81A 4WH6A 3MO9A 1SGQE 1QTFA 1LQEA 1TQ7B 1VJAU 1GBKA 3DFJA 3FFGA 4LOYH 2VH6A 5LPRA 2XBYA 1YLCA 2ANWA 1O3LA 3MI4A 1TA6A 4YT7H 3AK5A 1P04A 2B8OH 4MG3A 1V2NT 1NU9A 2ZCHP 4ZCNA 2XC5A 1GJ9B 3P8GA 1W13U 4Y8XA 1LTOA 1P0SH 3V0XA 1SPJA 1GI9B 2G51A 3M7TA 2STAE 5FHTA 3EE0B 1O2UA 1D3TB 3RMLH 1E37B 1MAXA 1A3EH 4TY6A 2W3IA 1CT2E 4BOHA 2P3TB 4Y7BA 1MQ5A 1N6YA 1HAPH 1BCUH 2DE9A 1BRCE 4R0IA 2VIVA 4I8KA 1C1UH 1GJ6A 3ZVEA 4XSKU 1GJ8B 1IQEA 1FX0B 2A7HA 5CHAB 2ZKSA 1LVBA 4X8SH 3VXFH 4H6SB 3M3SA 4LXBH 1IQKA 1J9CH 4WJG2 4D8NA 2UWLA 5HIYA 1O3DA 5GJ4B 1AKSB 1KLIH 1E1RD 2FWWA 4AZ2B 2HVXA 3CS7A 4ASUD 2PV9B 2JETB 3TH4H 4CBNA 2BY8X 3RXMA 5EJZA 1UTOA 3SOSA 2H9HA 1GJDB 1O5EH 5C0UA 1D3QB 1G37A 1J15A 2CHAB 2FOAA 4I8HA 3SU4A 1QNJA 1L1NA 4BNRA 4FVBA 3GOVB 1GI3A 1TQ0B 1HDTH 3BG8A 2PUQH 5SGAE 1C2EA 3QGJA 3P8FA 3ZZDA 1EXFA 1MKWH 4AYYB 5IK2D 1DT2A 1O2NA 4TPIZ 1THSH 4GPGA 3PMAB 1BMLA 3SU5A 2O9QA 1O2JA 3RU4E 1BBRK 1XX9A 3ENSB 3I78A 1A3BH 1XUFA 1C5LH 4DW2U 4WXIA 1AD8H 4LK4A 1YPEH 3S69A 4JZFH 1OXGA 1GI0A 2B9LA 1JRSA 5EOKA 3E16B 1L0ZA 1G3DA 4MNXA 1ESBA 1P2IA 1S84A 1O3NA 2WYJA 4DURA 4E7NA 1RTLA 1LKBA 1XUKA 4VGCB 5CDFE 4JYTA 3TNTA 1IQHA 5GXPA 1F5LA 4UFFH 1O2XA 1DM4B 1NRRH 2OLGA 1TGSZ 1QURH 3QDZB 5HM9A 4NIYA 1GI6A 3MFJA 1Q2WA 2YOLA 3BEIB 3ZZ3A 3RC5A 1BA8B 1NN6A 1QB1A 1CSOE 2Z7FE 2THFB 6GCHF 4ABBA 2BY6X 1VITH 4ZHAA 3U1JB 2FODA 3LGVA 1OP2A 4Y0ZE 5IYTA 4K2YA 1XUHA 4CRGA 5IDKA 1JMOH 3KQ5A 2GKVE 4IC6A 2A31A 3MU8A 1HJAC 1K1IA 3S7HB 3ZV9A 3SGQE 4A1XA 3F3BA 4AX9H 1EAXA 3U69H 4FUHA 1G30B 2EI6A 4Z6AH 2Q6GA 3S9CA 2ZIQH 3HATH 1QFKH 2V0BA 1BQYA 1COWD 1JXPA 2SGAA 2A32A 2Z9JA 2A5IA 1KTSB 3KEEA 1UCYE 4WH8A 3RC4A 1DPOA 1CU1A 2Z3DA 4BTUB 1UO6A 4OGXA 3OU0A 1GMDG 4AGKA 2ZI2H 3A8AA 3ZVCA 1IHTH 2A4GA 1P01A 1Z8GA 4X1NU 1AFEH 2NU2E 1HIAA 1TPPA 1C4Y2 5TJXA 5B6LA 3NZIA 1V2KT 2QA9E 1AI8H 4X2VA 4F49A 1AO5A 4I8LA 1YWUA 2IJD1 3SJOA 3OE7D 4GHTA 1NC6A 2QXHA 2HWLB 5E0JA 2Z9LA 3Q3YA 3SJIA 2A2XH 4ZXXH 2G8TA 2V3MA 1NM6A 2FTLE 1AUJA 1HAYB 1P2OA 4DIHH 4B73A 3RXJA 1WQVH 1V6DA 3MU5A 5JBCS 1GCDA 2XWBI 3F9HA 1CHOG 4YXWD 1Y3VA 2O8MA 5G4BA 1MBQA 5A0AE 4FETA 1S0QA 1MTWA 1C1WH 1ZPBA 1C1VH 3WY8A 1PPHE 1WTHD 3NK8A 1YP9A 2Y5HA 1SG8B 2VWOA 2FOFA 1CBWC 3KQDA 1UW7A 1YPHC 3HGPA 3SHCH 3LJOA 1ZGIA 9LPRA 3ZVFA 3FANA 2BDGA 3P70B 1HXEH 2V6NA 4O3TA 1GI1A 1NY22 4D76A 2XCFA 1S83A 3TJNA 3MQKC 1VCQA 3CP7A 3DSOA 4NWKA 2OBQA 1AY6H 1AU8A 1GGDC 3D62A 1ZGVA 4K1EA 1CT0E 2HALA 3SU3A 3SU2A 1CHOF 3M5LA 1AZ8A 3KQBA 1O38A 2VIQA 1F2SE 2AIQA 3M35A 2KX4A 3C1KA 1H1BA 3MYWA 2AIPA 2GCTC 3S7KB 1C2IA 1BHXB 3ATWA 5CHBA 4BAMB 5DGJA 4JYUH 3SNCA 2J4IA 2HLCA 3SI4H 1BMMH 3ITIA 1FMGA 3BTGE 1MTNC 1C1TA 2XRCA 1ZLRA 1H9HE 4WMDA 3RU4T 3BIUH 3MH4A 2P8OC 4AC9A 1IOEA 2IPHA 1L4ZA 4Y11E 5DG6A 1TB6H 3W95A 1W0KD 3LU9B 1C5PA 1CGJE 1DWDH 1SHYA 2XCNA 1EPTC 1DITH 2AFQB 2W3KA 3ZYEA 1NESE 1W2KH 1M9UA 1C2JA 1K1MA 3BTWE 4YTAA 3SUEA 3MU0A 2ZU3A 1DDJA 4H6TA 1A61H 2NWNA 4NSVA 5DP4A 1LQDB 2H6MA 3L33A 4SGBE 1ZZZA 4E05H 3HKIB 1F5KU 2C8YB 2ZPRA 1OYQA 3E91A 1YY3A 1RTFB 1GI5A 2BDBA 1O2SA 1BTXA 3PMBB 1QIXB 2OQ5A 2ODYB 2JDID 3PLKA 1AHTH 1ACBE 1H8IH 2H2ZA 1SL3A 5FCKA 3OFND 2ZTYA 1Z6JH 4NZLA 2RDEA 1O3BA 3U1IB 1HJ8A 2F91A 2CN0H 2C93B 3GDUA 3UQOA 5L2YH 2OUAA 2YMSC 4NCYA 1TBZH 3SNBA 1C2FA 1GJ7B 2STBE 3FZDA 1HJAB 4IS5A 1CGIE 1Y3UA 5C5OA 5C1XA 1NRQH 1K1OA 2BD4A 2FOEA 3SU1A 2JJ1D 3P92A 1XUJA 1O5BB 2KFWA 4B71A 5JB8S 3UNRA 1B0EA 1LKAA 2TGTA 2ZNKH 1LMWB 2XWAA 1H8DH 1PPGE 4FVDA 1PPBH 3QX5H 3TVJB 1QHRB 2CGAA 3PWCA 1TRYA 2SGEE 3V13A 5L2ZH 3VB4A 3UOPA 2GT8A 1K2I1 1JIRA 2P16A 2OQUA 1YPHE 3FVFB 2BQ6B 1ETRH 1UK2A 1IQLA 3QZQA 4FUDA 1XM1A 2BVXH 3ZIAD 4H42U 1A0HB 2ZP0H 3ZVAA 3ZZBA 1UHBB 2WINI 2BXTH 2AMDA 1SBWA 3N7OA 4KTUA 2NU1E 1A0LA 4KP0A 1NBME 3AW0A 4I32A 2PKSC 1PYTC 7GCHF 1C5QA 3LH1A 1QBNA 1TGCA 2OC8A 4X0WU 3ZZ8A 1ZSLA 4A92A 2R9PA 1TAWA 1O32A 1GBJA 2HOBA 3UWJH 1Z6EA 3GYLB 1PPCE 1IHSH 3Q3XA 1T4UH 3LJJA 5DP3A 1ZHRA 3EA7A 4KGAA 3EA8A 1O2KA 1ELDE 3BTTE 4IN1A 1F0SA 4ZKOU 2AERH 2BVRH 4WWYA 2R3YA 1YCPH 2BX3A 3VB3A 3V12A 1JWTA 3UIRA 3A81A 2QCYA 1O3CA 1CBWB 5A8ZA 5AF9H 5T6GA 5LPFA 3KN2A 3SO3A 1LHEH 1UTQA 1PPEE 2ZHDA 3GY4A 3H09A 5GPIB 3ZZCA 2J2UA 3E0NB 2KAIA 3F9EA 7ESTE 3EGKH 1GHAG 1HUTH 1P02A 1HAVB 1SQTA 2SGQE 1IQGA 1TBQH 4X8TH 5A0BA 2B7DH 1C5XB 2ZPQA 3NKKA 1D3DB 4O03A 1OHHD 1P2MA 4AG2A 5FBEA 1TOCB 1UTNA 2CXVA 3LPRA 1O3AA 2FYRA 4YLUA 3D65E 1C4U2 4Q80A 4WF8A 4X2YA 1BOQA 4K1SA 4QT8C 2GCTB 2M2AA 3A89A 1E38B 3A7YA 5C94A 1ESAA 1Y59T 2GMTC 1N6XA 3SV9A 5FXLA 2AS9A 3HK6B 4PROA 1DFPA 2ZFQH 4GVUA 3EQ0H 1SGNE 4HZHA 3SZEA 2CF8H 4U2WA 2P8OB 4X8UH 2ALPA 2R2MB 3MH7A 2ESTE 3E6PH 4HG6A 2G5NA 1K28D 2BY7X 1EAWA 5EU8A 3TGKE 2VB0A 1DUEA 3O8RA 2ODPA 1EPTB 4MPWA 2SNWA 3IITA 1ZYOA 3HGNA 1QA7A 1HGTH 1W10U 1S82A 1TRMA 1FV9A 1YYY1 5EPNA 3AAVA 1KSNA 4Q4LA 1C5TA 5EIYA 1W0YH 3SI3H 2ASUB 5CMXH 1DVAH 1TNJA 3SN8A 3B23B 3V7TA 7LPRA 2VH0A 2O8LA 4ZKNU 4BTIB 1QY6A 2HPQH 1EATA 1DWBH 1P8VC 4Z1MD 3BTQE 3PMJA 4YO9A 2PP6A 5KEDA 4JK5A 1AVWA 1V2TT 3KQCA 3A8DA 4LZ4B 2VIPA 3SUFA 1HNEE 3D49H 3EE7A 1AFQC 2NU4E 2F3CE 1Z1JA 1TGBA 3NWUA 2A45B 1KXEA 1O3GA 3TLOA 5GCHG 2EC9H 1GBFA 4NZQA 2BY5X 4NSYA 4A6LA 3SV2H 1PFXC 3ODFA 2HLDD 3T25A 1V2UT 1EUFA 4TYDA 2I6SA 3DUXH 1SQOA 1DSUA 2BZ6H 3BV9B 1ABIH 1FXYA 1MKWK 4B76A 2AGEX 1GMHF 1ARBA 3E3TA 1BTPA 1GBCA 1AVXA 4ABIA 2A4QA 1L4DA 4XBBA 5I25A 4CR5A 2ZF0H 1TNKA 2PGBB 5AFYH 5CE1A 4B75A 3M36A 1XMNB 1V2ST 1G2LA 2OC7A 3TNSA 2Z9KA 3ZVGA 3U8RH 4NG9H 1GHVH 5C67A 4FUBA 1KLTA 5FPYA 5GCHF 1ARCA 2ZDNA 4INKA 2VWMA 4ISIH 1RTKA 1WU1A 2ZGHA 1ELCA 1C5YB 1XXFA 1UVUH 3SJKA 3GICB 1LPZB 3V3MA 3LGUA 1BBRE 2PKSB 3T27A 3M5NA 2AH4X 3ZZ4A 1EOLA 1IQMA 1QJ6B 2EI7A 4ABEA 4JZDH 4XE4A 1GBDA 1SC8U 2ANKH 2UWOA 4GHQA 2C3SA 1QGFA 3TH2H 2FX6A 1GDUA 2RA0A 5K7RA 1E35B 4DJZB 5LGOA 1LHDH 3FP7E 2OCVB 2WPIS 2B0FA 1YBWA 2ANYA 3O8BA 2ZZUH 2WV4A 1UVPA 1V2MT 4Y76A 3M5OA 2I6QA 2QY0B 1O39A 4AORA 3F0OA 3ZZAA 3RMNH 1OWKA 1Y5AT 4XBCA 2H9TH 1ZTKA 2FI5E 3T26A 4LZ1H 3QUMP 4ABAA 1O3HA 1RS0A 1EQ9A 2WSSD 3A83A 4OS7A 2PR3A 3BTKE 2GZ7A 2W6ID 2WPHS 3MU4A 3UUZA 1A2CH 1SHHB 3UOUA 1H9IE 1VZQH 3RMOH 3ZVDA 2BM2A 1T8OA 4X1RU 3PRDA 2LELA 1K22H 1PQ7A 3IG6B 4K5ZA 1O2VA 4YZUA 1NRNH 3KF2A 4ACBA 1ZPCA 2GMTB 4DT7B 5DP9A 3LGWA 1HAHH 3A85A 4FUEA 2CF9H 1GVLA 2BXUH 5GDSH 1E36B 1C5UA 6CHAB 1MUEB 1P9UA 2WPJS 3URCA 4ABHA 1DLEA 1BTUA 1NS3A 3RXQA 1ESTA 1NT1A 3OAAD 3ZZ6A 1NZQH 2ZDKA 3RXGA 2IPQX 2SNVA 1ZPZA 4OS5A 2QF3A 2G81E 4BANB 2J34A 1FONA 1A1RA 1HFDA 3SJ8A 2F9BH 3K6ZA 4ASHA 3FZZA 1EASA 1NFWA 1MKXK 1PPZA 3F2GA 3MMGA 3RC6A 6ESTA 1O3EA 4CRDA 3UB0A 3QTOH 4BXSA 4JMYA 4X6NA 1F5RA 3BEUA 1GCTC 4AB8A 1DWEH 4Q7YA 1B5GH 3GS9A 3M3TA 1GVZA 3U9AH 5B6OA 3ZZ7A 2Y7ZA 2OINA 2VU8E 1ETSH 1VJ9U 2AMPA 4XDEA 1LDTT 3VPKA 4X6MA 3BIVH 1V2JT 3NCLA 3RXTA 3RM2H 1BHXF 1AFQB 3K65B 4Y8ZA 1GI4A 1A7SA 1LVYA 1TGTA 4U01A 3RMMH 1BITA 1EJMA 1TE0A 1TNHA 1PQAA 2A1DB 2P3UB 3DHKH 4NA7A 3A7VA 1IQNA 5E8EH 1SGIB 4JZEH 5JBBS 1C4V2 2F9VA 4A5TS 1MU6B 1MD8A 1BRBE 3BN9A 1HIAB 1MZDA 1XKBC 1AVGH 2R0KA 4UDWH 1ZOMA 2Q6DA 1SGFA 2Y5FA 1FAKH 1FY5A 1GI2A 5FPTA 1BMNH 1W11U 2FI3E 1SKYE 5J4QA 3MNBA 2GVFA 2R3UA 1MCTA 4BAQB 1C5NH 2WUBA 1G2MA 1ZSJA 1GBBA 3PV4A 3M61U 4B2BA 4CREA 3A7TA 2PW8H 1TALA 2XBWA 4KTSA 3GY8A 2VWNA
chains in the Genus database with same CATH topology
4FUGA 5BRRE 3GY2A 3L3TA 3QO6A 2BLOA 1GG6C 2H9EH 1GBEA 2EA3A 3HKJB 5EXNA 3RXRA 3A84A 5JB9S 2XBXA 1LVOA 2OC0A 2OTVA 4IW4E 2K1QA 3TJVA 2AEIH 3P17H 1ORFA 1V2OT 3GCHC 5DP6A 1CA8B 4AFQA 8GCHG 4DY7B 2LPRA 1ZTLA 1C1MA 1THPB 1YC0A 1ETTH 2Y81A 3GYMA 2VIDA 2FI4E 3OTJE 1P57B 2FXRA 3B8JA 4YOIA 2FIRH 1CT4E 2TGDA 1NO9H 2BQWB 2QF0A 1WQSA 4RKOB 1GMDF 5HYOA 1O34A 3KQEA 5E2PA 1DX5M 1UTKA 1DOJA 2G5VA 3SQEE 3TK6A 1MKXH 2NU0E 3JZ2B 3RXCA 3O8CA 3STIA 2BDCA 2ZGCA 5GIBA 3PLPA 2QXGA 3A80A 1TMBH 2IN2A 2OP9A 2AMQA 1XUGA 1O31A 3SV7A 5TCCA 2FS9A 4ABDA 1QA0A 1DE7H 8GCHF 3SGAE 4TWYA 1OWDA 3U98H 1TNLA 3RM0H 1O2MA 3VEQB 1LCYA 1BJVA 1GHWH 1WYKA 4AG1A 2A5KA 2R2WU 3BTDE 1B7XB 1T31A 3MOCA 5HMAA 1FPCH 3M7QA 2D8WA 3RXBA 1C1RA 1Y3YA 1C2KA 1P2NA 2QYIA 2DE8A 1P9SA 2ZCLP 1FY4A 1ELGA 1V2WT 3BTFE 1TNIA 4X2WA 4B1TA 1C5RA 2GT7A 1UCYK 5J4SA 3TH3H 1YCPK 1ELAA 2W7UA 1BUIA 1GI8B 3ZYDA 5E2OA 2ZU2A 1O3IA 4NA8A 1C1SA 1N1LA 1LHCH 1Z1IA 2W26A 3PYHA 4H4FA 5JYIA 3P95A 2Z6BD 3RLWH 2C4FH 4AOQA 1ZMJA 4A1VA 1GCTB 1MTUA 1YPGH 2BDHA 4AYVB 3QN7A 4MVNA 4B74A 2Z9GA 5HGGA 4FXGH 1W8BH 1LPGB 1W12U 2FDAA 3TITA 3H7OA 4GAWA 1LPKB 5HM2A 4YM9A 2FLRH 1THRH 4BAOB 5AFZH 3R3GB 5DP7A 1PQ5A 1O3OA 4D7FA 1ELTA 1GJBB 2BYAX 4IC5A 3VB7A 1VGCC 1OP0A 2BOKA 1O2PA 3NPSA 1JOUB 3UY9A 1TX8A 2BDIA 1VCWA 1HAXB 2ULLA 1CVWH 1WCZA 1JBUH 2P59A 3PB1E 1A5HA 1ZHMA 2TGPZ 1C5SA 1IQJA 1J8AA 1NPMA 4X2XA 2A4RA 5EPYA 1D4PB 2GP9B 3T29A 2J9NA 2UUFB 1OWEA 4ISOA 3T62A 1CHGA 1FI8A 4UFGH 2G52A 1CQQA 3OSYA 3GCTG 3SQHE 4CHAC 1Y5BT 1P09A 1WBGB 4Y0YE 5JBAS 5BPEA 2ZGXH 1TA2A 4Y79A 1O2QA 3NUMA 2W7SA 1O36A 1MTSA 3D23A 1D6RA 2FTMA 3TIUA 2OBOA 3SU0A 1VITG 3BEFB 4FU8A 1XVMA 1GG6B 2VVUA 1BT7A 3MWIU 1J16A 4CH8B 2V3OH 4KELA 3SORA 3RXKA 1FPHH 1ID5H 3K2UA 3M7UA 1SLXB 1AWFH 3AASA 4B2AA 1YPMH 3QK1A 3GCHB 2WPLS 3U8OH 1QJ1B 2G55A 1UK4A 2HNTC 4YOJA 2GCHG 1JRTA 4Z0KA 2BTCE 3UR6A 3DA9B 3GCTF 1SGEE 2KAIB 1HAGE 2C8WB 1NFYA 4ZHMU 3A82A 3QWCH 1BZXE 1SFQB 1UCYH 2P3FH 2JH5D 4ESTE 2C90B 4BAKB 3SNAA 5E0GA 1TFXA 1EAUA 4AN7A 2LNCA 1GPZA 4TPYA 4CRAA 5F6MA 3ODDA 1ELFA 4WMEA 1VITF 5E0HA 1RIWB 3H7TA 3K9XB 3TU7H 5FAHA 1UK3A 2A4OA 4NFFA 4IBLH 5DPAA 1UTLM 2GD4B 1EX3A 3RDZA 2ZQ1A 2PHBA 1C5WB 1TX6A 3SUGA 2ILNA 2Q1JA 1FAXA 1A46H 1P10A 6LPRA 1QBOA 3UPEA 5DP5A 1SGTA 2VNTA 4ISNA 3SBKA 3CS0A 1QB9A 2GCHF 3I77A 4TY7A 3PROA 5F8TA 2OD3B 4THNH 1F0UA 1OKXA 3QTVH 5EGMA 1DXWA 4OGYA 3E0PB 2ZFPH 2FOGA 4J1YA 1K21H 1G3CA 2BDAA 1LVMA 4IN2A 1P06A 4R8TB 2BLVA 1HAZB 4UD9H 2HNTF 1TPSA 4ZAEA 2FPZA 4TWWA 1UTJA 3A87A 6CHAC 2SGPE 1JIMA 4K3JA 1GHAF 2D1JA 3RXDA 1ANDA 3F68H 1GDNA 1SQAA 1FN6A 3T28A 1UTMA 1WSSH 3O8DA 5L6NH 4X6OA 3ATMA 4GLYA 3A7XA 1GBMA 3W94A 1AMHA 5EODA 1WTGH 1HXFH 1O2YA 1ZTJA 4Y8YA 3LC3A 1C9TA 5EXLA 3TJOA 1TBRH 2JKHA 2NU3E 1CGHA 1G36A 4I7YH 2ZFRH 4IMZA 3KIDU 3FP8E 3KGPA 3MNSA 2XXLA 3ATIA 4NIXA 4ABGA 1EZXC 5H4IB 4HFPB 4MNYA 4ZXYH 1AQ7A 3A86A 5L30H 1O33A 1QJ7B 2VGCC 5F03A 1YLDA 2CMYA 3OX7U 1O37A 5EQSA 1J14A 5EQRA 1VGCB 4K8YA 2FP7B 3RXVA 2PWXA 2A7CA 4OS6A 1QQ4A 1HAOH 2QC2A 2YNBA 1KTTB 1FNIA 3RXUA 1C1PA 1GMCG 2C8ZB 2BZAA 3SHAH 5A0CA 1BRUP 2QXIA 1WOFA 4O9VA 1ANCA 2ZDAH 2CJIA 1QL9A 2F9OA 2ZFFH 2HNTE 3LT3A 4I33A 1BTWA 1GHXH 1PYTD 3RXPA 3PLBA 2EI8A 3GY3A 1SGFG 2BHGA 3LGIA 4CR9A 4MPUA 2XC0A 2ZU5A 4CHAB 1T8LA 3SV8A 3VGCC 3RXFA 4K8BA 3UNSA 4X1QU 1NFXA 2XNIA 3LOXA 5GWZA 2W5EA 1RXPA 1Z8JB 3ESTA 2A5AA 2VIWA 1GMCF 1UVOA 3EA9A 2AGGX 4BTTB 2Y82A 4I8JA 1BDAA 4GCHG 4Q7ZA 1FY3A 2CV3A 5AVDA 1K1LA 1IQIA 3A7WA 1EOJA 1O2ZA 1SLUB 1XKAC 1TWXB 1O3JA 3DFLA 1ZJDA 2DUCA 2GGVB 4IMQA 3ZVBA 4ZROA 8KME2 4CRBA 2F9UA 9ESTA 1VR1H 3SU6A 1YCPM 2F83A 3PO1C 1NTPA 1HLTH 4KKDA 3GCNA 1DUAA 1O3KA 1T7CA 3IWMA 3OY5U 2BD3A 1Y3WA 1AE5A 2BLWA 2BB4A 4YT6H 1UVSH 1GWAA 1K1PA 4WMFA 4ABFA 1QL7A 1X7AC 3UR9A 2R0LA 2ZHEH 3HK3B 1KY9A 2C8XB 3EAJA 4GCHF 1EB1H 3BTEE 1QCPA 3T2NA 1RD3B 3VFEA 1CA0B 4ZH8A 1ELVA 1S85A 5DO4H 1GHBG 1G32B 1KXDA 1TMUH 4HI3A 4A7IB 3RXHA 4INHA 2G4TA 4MDSA 1DLKB 2VWLA 2PSXA 5EG4A 2GZ9A 2TPIZ 1AB9C 5EXMA 5A8YA 2XTTB 1LHGH 4UFDH 4BXWA 1KXAA 2ZFSA 2FM2A 1Y8TA 3NXPA 4FUCA 2PSYA 3CENA 3FP6E 4O3UA 2BQ7B 4JZ1A 1BMAA 1BTZA 1TGNA 3MO6A 3OY6U 2FMJA 1Y3XA 2GX4A 4Q7XA 8LPRA 2J92A 5AHGH 4K60A 1YF4A 3Q76A 4Y71A 1A4WH 1EJAA 1GBTA 2V35A 2ZG0H 4MTBA 1GHBF 2EEKA 4I8GA 5I46H 5LH8A 1FZZA 3S9AA 2BD2A 2BDYA 1YGCH 1AKSA 1XVOA 4U32A 1OPHB 1TONA 1KIGH 3RXEA 3URDA 1MTVA 2PLXA 3BSQA 2PKAB 3RU4D 3SJ9A 5A09A 2BOHB 2VJ1A 1G9IE 2FOCA 1SLVB 2ZU4A 1TMTH 1HJ9A 3LH3A 3PMHB 2VVVA 3MU1A 1SOTA 3UWIA 1BB0B 4HGCA 1EZSC 1AN1E 1SGYE 2FEQH 2IOTA 5DK1A 6GCHG 1DXPA 2ODQA 1AWHB 1S0RA 2PGQB 2H1UA 2PKAA 2VGCB 2GDDA 1O3PB 2ZFTA 3SW2B 1ZR0A 4ABJA 2WV5A 5TCAA 4FUFA 4HTCH 1TLDA 2J94A 4K1TA 4NFEA 1FLEE 1YKTA 3KHVA 4MQAA 4B2CA 4Q2KA 4DGJA 1EP5A 3DD2H 2Z94A 1MMJN 1O2HA 1O2WA 2A0QB 2YNAA 1UVTH 3F9GA 1NRPH 2Z3CA 1C2HA 3Q77A 2UUJB 1Q3XA 1ZRBA 4CRCA 3UQVA 1TOMH 2QV1A 1P2JA 1O30A 4UE7H 1O5GH 3TPIZ 3VGCB 4YESB 2F9NA 1FQ3A 3M3VA 1AIXH 1ANEA 1OYTH 2O8UA 1K9OE 1Z7KA 1FY1A 2B5TB 1OWIA 1YPLH 1CE5A 3STJA 1NRSH 2GV6A 1FN8A 5K0HA 2AGIX 3VB6A 5LPEA 1O2TA 1GJ4H 1OWHA 1SSXA 4JK6A 1C5OH 3GDSA 3OYPA 4YLQH 2GTBA 3ZZ9A 5ABWA 1PQ8A 3MH6A 1P2QA 1MU8B 1YM0A 1ABJH 4A1TA 1SFIA 1V2RT 4CRFA 2XYAA 4RSPA 3PTNA 3TK9A 1Z8IB 1OX1A 4X8VH 3DT0H 3BF6H 3S9BA 4D9QA 3L6PA 2FESH 3LKWA 1SMFE 3P8OA 1DY8A 3PWBA 1MH0A 2ZDMA 1V3XA 1GL1A 3G01A 3LGYA 4ZMAH 1TNGA 3PO1B 4E7RG 1ELEE 1C1OA 5EW2H 2ANMH 2ZC9H 5FX6A 1L1JA 2P94A 1BJUA 1NFUA 4GUXA 1U6QA 1C2GA 3F9FA 1DANH 5F8XA 1TABE 3QLPH 1KXFA 1ZMLA 4CH2B 1UJ1A 1K1NA 3BG4C 4F4OC 1RIWC 2FYQA 4WVPE 4MPVA 2XW9A 1HBTH 2BLQA 1DWCH 3M37A 3GY5A 1AE8H 1E34B 1BBRH 2VVCA 3MNXA 4MLFB 4XFQA 2PUXB 5C1YA 1C5ZB 1SGRE 3E8LA 2FX4A 3P8NA 3ZZ5A 2QIQA 4DG4A 1D9IA 1T32A 4UFEH 1NU7B 1AB9B 3KNXA 1V2PT 1GJCB 3R0FA 1EAIA 2QXJA 2Q6FA 4DVAU 2PTNA 2ZQ2A 3PM3A 1KDQB 1GBIA 3RXAA 4DIIH 2ZTXA 3ATKA 1INCA 1N8OC 3SNEA 2FOMB 1GBHA 1UTPA 1AUTC 1G3EA 4SGAE 4Y7AA 5FX5A 1HCGA 2HRVA 2RA3A 2XBVA 3U8TH 3MHWU 1QRXA 1H9LB 1KDQA 1Y5UT 3K6YA 2ZHQH 4ISHH 3F6UH 3F1SB 2IJOB 2RDLA 2WYGA 2ZA5A 3AVZA 1RRKA 3MNCA 2ZO3H 4J2YB 4AFUA 1P12E 2ZDVH 2TGAA 1O5FH 1E0FD 1FUJA 3H5CB 2M5TA 1GL0E 4MNVA 1WUNH 1KYNA 1GHZA 4DCDA 1P2KA 4NIWA 1GJ5H 1XXDA 1V2QT 3TGJE 2ALVA 3TGIE 1ZHPA 3GY6A 8ESTE 1OWJA 3HPTB 1C1QA 3A88A 2QAAA 1S5SA 1F0RA 1GI7B 4JCNA 1Q31A 5T6FA 2Y80A 1HYLA 1KLJH 1SB1H 5EW1H 2FO9A 4E06H 1O2IA 1RGQA 3SNDA 2VINA 1G3BA 2ZECA 1BTHH 3E1XB 5C1UA 1LO6A 1PPFE 2A2QH 2BD5A 4BAHB 2SGFE 2TIOA 4FUJA 2VIOA 3P6ZB 1C2DA 2F9PA 2Z9IA 1T8MA 5DJ7A 4JZIA 3S0NA 1MBMA 1O35A 2ZHWH 1S6FA 1YPJH 1EJNA 1MQ6A 4U30A 1V2LT 5JDUB 1F92A 4IGDA 1SGPE 3TK5A 5EQQA 3RXLA 1TRNA 1TPAE 3BTME 5C20A 3B9FH 2J38A 4MNWA 3ELAH 2TBSA 2BMGB 4O97A 4Y10E 3UNQA 1C2MA 3RXOA 7GCHG 2UWPA 2D26C 3GY7A 1L2EA 1UMAH 3ATLA 1OSSA 1OS8A 2TRMA 1EZUC 3MO3A 1TIOA 3VXEH 1BRAA 2FOBA 1TYNA 2FLBH 1C5VA 2HGTH 1GBAA 4K69A 1H4WA 1QRWA 4WY3A 1ZMNA 2D2DA 5A8XA 5ESTE 2FS8A 3GISB 1HV7A 1GVKB 1YPKH 4NWLA 3RLYH 1C9PA 1SGDE 3A8BA 1WAYB 5DKMA 3LIWA 3E90B 4X1PU 4AB9A 4ZKRU 4ZKSU 3LC5A 4X6PA 3EDXB 3RUOA 1T8NA 2BD8A 2UUYA 1QQUA 1ANBA 2HPPH 1BIOA 1GJAB 3KCGH 2BX4A 3BG4B 1O2LA 5C2ZA 4M7GA 2G00A 1P3CA 1T4VH 1UHBA 2SGDE 1Z8RA 1O5DH 3C27B 1W7XH 1QR3E 4FU7A 1W7GH 2P93A 4OS4A 4NGAH 5A2MH 1CA0C 4NIVA 1FY8E 1OOKB 3GCOA 3QGNB 2ZHFH 5ESBA 5T6DA 1O0DH 1O3FA 1F7ZA 1ZJKA 2WPMS 4OS2A 4AFZA 4JYVH 5HXFA 2H5DA 1AZZA 1KXBA 2BVSH 4MPXA 1C5MD 4I31A 3QZRA 3TJUA 1EKBB 1K1JA 4UEHH 2RCEA 2OXSA 5FPSA 1QL8A 1DY9A 1GGDB 1PJPA 1N8OB 5C3NA 4CBOA 4AGJA 5CHAC 3SV6A 2AYWA 3FAOA 1HPGA 2ZEBA 1ZRKA 2Y5GA 4X1SU 1GHYH 2O8TA 4AFSA 1P03A 1FJSA 1W0ZU 4D9RA 1HAVA 1FIWA 2JETC 2A7JA 1P3EA 1SGCA 1EP6A 3RXIA 4ZHLU 5FBIA 3LDXH 2BD9A 5JBTA 2CHAC 4RN6A 5PTPA 2GV7A 2BD7A 3VB5A 3I29A 1QB6A 1C2LA 2Y6TA 1MTNB 4D7GA 3A7ZA 1GDQA 2ZU1A 1S6HA 1O5CB 1SR5C 2J95A 3MTYA 3UREA 1F0TA 3M5MA 4Y6DA 2JH6D 1TX7A 2FZZA 2GDEH 1D3PB 1ELBA 5F8ZA 3SUDA 2WPKS 1O3MA 1A5IA 1EZQA 3JZ1B 4NA9H 2PTCE 3LGTA 2PFEA 4ISLA 5FCRA 2QN5T 2O8WA