1SQTA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Interaction with the S1beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors.
pubmed rcsb
source organism Homo sapiens
total genus 58
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqtA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqtA01
1WQSA 2GV6A 5LPEA 1TA2A 3M35A 4JYVH 3ZZAA 1E35B 1GBDA 4Y8ZA 2BDBA 1C1QA 4E05H 2ZFTA 2ZU3A 1ESBA 1HJAC 1EPTB 3PO1C 4CH8B 1PPEE 2H9EH 4X1RU 3BTME 3BTTE 1KLIH 1EASA 4ISIH 3N7OA 1WBGB 4JZDH 1YPGH 2G00A 1NRRH 1Y5UT 1OWJA 3O8RA 2NU1E 1HJ8A 2FX6A 4B71A 1AN1E 5JBTA 3SUDA 1BRCE 4CBOA 2XBXA 2ZDAH 1A5GH 1MCTA 1GHYH 2OTVA 3TJOA 4NA9H 1JWTA 5C2ZA 2WPMS 4JK6A 4YOIA 1GBIA 1D6RA 3CS7A 4OS1A 1FQ3A 2ZG0H 3ZZBA 3A8DA 3RC4A 2ZFQH 4I33A 2A2QH 6CHAC 4AFUA 1IQIA 3ZV9A 1FIZA 1Q3XA 3S9AA 3SJIA 4Z6AH 2PKSC 3SU5A 5DO4H 4AYVB 1QTFA 3Q00A 2BVRH 4YTAA 3E16B 3GY3A 2PUXB 1Z71A 1ELVA 2SNWA 3A85A 3RU4T 1GHBG 1JBUH 2GT7A 1YLDA 4BXWA 3SV8A 2ANWA 4WH6A 2OINA 2J94A 5DP3A 4LZ1H 2FI3E 2PW8H 2ZCHP 2WINI 1C2JA 1FONA 2G5NA 2QF3A 2H9TH 4IN2A 4IS5A 4YESB 1PFXC 1QURH 1MAYA 1WYKA 1JIRA 5GWZA 1CA8B 1TE0A 5DP6A 1MKXH 4A6LA 5GCHF 1L2EA 2Z9LA 1GCDA 4MVNA 1QL8A 1C9PA 4WH8A 1J9CH 1IQEA 2WYJA 3VEQB 4UD9H 1KYNA 1ZSJA 3MH5A 2BOKA 1B7XB 1TPAE 3RXIA 2VB0A 3MU5A 4IC5A 1O2HA 4BTIB 1PJPA 1XXFA 1C5TA 1WTGH 4NSYA 2JKHA 2BZAA 2H5DA 4CR9A 3ATWA 2FTLE 2P95A 1T4UH 3KEEA 4MDSA 4F4OC 1HAYB 2C8XB 2OC0A 1ZPZA 2PKAB 3RXUA 1QL9A 2FO9A 1V2MT 2J92A 4U32A 1OWEA 1OWHA 1SFQB 1ZR0A 2BX4A 2ZFPH 4X6NA 3U1IB 2ILNA 1SQAA 1BTPA 1UVTH 2A5IA 3EE0B 3UOUA 3P92A 1QRWA 1BRBE 3P8FA 2VGCB 1AU8A 3UUZA 5G4BA 1OYTH 3ATLA 4ZAEA 2B5TB 4AN7A 2VNTA 4BXSA 3UREA 1TMBH 1AWHB 1PQ5A 3SV6A 5EU8A 4B76A 3SU0A 1BQYA 4K8BA 1V6DA 1VGCB 4AORA 1N6XA 2O8MA 1L1NA 1MU6B 2XC0A 1EQ9A 1K21H 2ZPQA 4FVDA 1RXPA 3MH7A 1WCZA 4X1SU 3Q77A 4UFFH 3GISB 1DFPA 1FLEE 1XUHA 3ZVAA 1T8OA 1K1LA 4WF8A 1C5MD 2ZTXA 1EAWA 3PO1B 4AOQA 1L1JA 1K1OA 3UNRA 1O31A 1O2TA 5FBIA 1O2UA 2C93B 1FXYA 3RXOA 1AD8H 4ABHA 1XVMA 1L4DA 1GJAB 3GCHC 3BN9A 1O3NA 1QFKH 2CV3A 2NU2E 1FAKH 4Z0KA 1C5VA 1ZZZA 3E91A 5DP5A 3PMAB 1KDQA 1BMNH 1OP2A 2J34A 2OC8A 1EX3A 1NO9H 4Q2KA 3FZDA 1TNJA 2UUFB 2D2DA 1ANCA 4MNWA 1LVYA 4B2BA 1SLVB 2C90B 3BIUH 1WAYB 1Z7KA 2AEIH 4ISOA 3RXRA 3A7TA 1O2KA 1HIAA 4AX9H 3F1SB 5CE1A 1TBRH 1K1IA 2B8OH 2A7HA 2Z94A 2HLCA 3LJOA 3M7TA 2BD5A 1O2PA 1GCTC 2PKSB 1JIMA 1K22H 1D6WA 3HATH 1HNEE 2WUCA 1Y3WA 3VB6A 1XKAC 1A0HB 1ABJH 2UUKB 2ANKH 4UEHH 3ZVBA 3TK9A 4DCDA 1ZMNA 1GBFA 2CF9H 3ZZ9A 2BX3A 4ISLA 2ZU1A 4NIYA 2AS9A 3A84A 2OC7A 1CT4E 2CHAB 1TNKA 2A45B 1O5EH 3LGWA 3MFJA 4WMDA 4TPYA 1AE5A 2A0QB 1B0EA 1OXGA 1Y3YA 4R8TB 2QXGA 5F8ZA 1NRNH 1LKBA 2XCFA 1EKBB 4X6PA 4ABBA 1TA6A 1SLUB 4FUBA 3A7XA 4WXVA 1F0SA 2ZC9H 4GHQA 1ZRKA 4K1SA 2P8OB 2BLVA 1O32A 3BTGE 3MOCA 4QT8C 3RXLA 6LPRA 1UJ1A 4CR5A 1TYNA 1E37B 2UWOA 5AF9H 1G36A 5EQRA 4YZUA 7GCHG 4E7NA 1GBCA 4Q7ZA 3Q76A 2PFEA 2VINA 1GMHG 5BPEA 4I8HA 1CHGA 2FOAA 1ZPCA 4RSPA 4IW4E 1NN6A 4FXGH 2R3YA 3FVFB 1Q2WA 1O5DH 5GJ4B 3GY2A 1GDUA 2Z3EA 3RC6A 1O37A 3LH3A 1EPTA 3C27B 5JBBS 5C5OA 1HBTH 1O3OA 3NXPA 1RD3B 4A1TA 1D3DB 2OC1A 4CRAA 4I32A 4Y71A 1V2OT 1QBVH 5L2ZH 2PHBA 3RXVA 1NFUA 1O2IA 4GHTA 5L6NH 2FEQH 3T28A 1G9IE 2TGDA 2XC4A 4YOJA 3UQOA 3LC5A 2BY9X 1TNLA 1QQUA 4Q80A 7KMEH 1AZ8A 2D1JA 3P8OA 1BTYA 1LVMA 1NY22 4THNH 2H1UA 2KAIA 3CP7A 1ZTJA 5T3HA 1O2LA 3RC5A 1GBKA 1T31A 1TLDA 3NWUA 5GXPA 1LKAA 3EA8A 3L3TA 4XBDA 3SGQE 2ZHQH 2FTMA 2W3KA 2C3SA 5T6FA 3VGCB 5ABWA 1MZAA 2B7DH 3RXHA 1SOZA 2V35A 5CMXH 1L4ZA 1S0RA 3TU7H 3NKKA 3SGBE 1MTVA 3A7VA 5EPNA 1YF4A 3ZVGA 1P2JA 1UVOA 2BD3A 1TAWA 1IQKA 1MTWA 3PTNA 2GTBA 2C8WB 1UCYH 3T27A 1SGTA 4NCYA 3F9FA 2XTTB 5IYTA 1DWDH 4UFDH 1C2HA 4NA8A 1ELFA 3GDVA 5JB9S 1UCYE 4K8YA 2ODYB 3KQCA 1GBAA 1QA0A 1LPGB 5A0AE 2XBVA 2BHGA 2VIDA 3B9FH 1FDPA 1GCTB 1P04A 2IPHA 2VH0A 1O39A 1HAIH 4ABGA 1BUIA 3UQVA 1TPOA 4WJG2 2GDDA 1EJMA 1GBEA 1GHAG 1TGNA 1P02A 1N8OC 4KELA 1O38A 1AFEH 3OSYA 1O2OA 1G3BA 1MTSA 1U6QA 1YC0A 4Y10E 1OWKA 1C4U2 1ELBA 1P9UA 3MNBA 2XWAA 1ZHPA 1QJ7B 2I6QA 1OS8A 2BZ6H 3JZ2B 1A3EH 2TPIZ 2P93A 2ZHWH 4B2AA 1ELEE 5EQSA 1AFQC 3ZZ5A 5DP7A 4FUDA 2ZCKP 3LDXH 1QGFA 2J2UA 1P2QA 1BMLA 2BXTH 1INCA 2QCYA 1EZQA 5FPTA 1A7SA 5DP4A 1D3QB 2GCHG 2F9VA 6GCHF 7LPRA 4KTUA 2QYIA 1C5YB 3CS0A 2Y82A 3DHKH 2QV1A 1BOQA 3RMLH 1DLKB 1TQ7B 4DJZB 4FUGA 3M61U 3URDA 1LHEH 1C1OA 1GGDC 3VXEH 5EW2H 1UK4A 3LGIA 3EYDA 4ASHA 3RXEA 2BMGB 3EA9A 3MU1A 3O8BA 4LK4A 5LPFA 1TPSA 1SB1H 1TRMA 5HXFA 3K6YA 3VPKA 4X6OA 3SHCH 3URCA 3I78A 1C1SA 1O2JA 1YLCA 3OY6U 1C1PA 4FU9A 4IMQA 3ESTA 3RXFA 3BTFE 3NUMA 4ZKOU 1AWFH 2FOFA 3RDZA 8GCHF 3U8OH 3MO3A 2ZTYA 2ZDNA 3RM2H 3RXDA 1HAZB 1DT2A 4AZ2B 4DG4A 1MTUA 2VWLA 2BDGA 2B0FA 4XOJA 4DIIH 2O8TA 3A80A 5E0HA 3PMJA 4NIXA 3M5NA 1V2JT 1ZGVA 1TX8A 1T8MA 4TWWA 1VITG 1Z8RA 2W26A 1TQ0B 3MYWA 1YKTA 7GCHF 1TBQH 5C1UA 4MG3A 1HAVA 2ALVA 1CGHA 1V2PT 1GMHF 4H4FA 4X6MA 4B75A 2GZ8A 4E7RG 2BQ7B 3STJA 3MNSA 2FI5E 2VIWA 1GBMA 2TIOA 1S5SA 1SGFA 1ANBA 1O2MA 1GMCF 4GCHG 1G3DA 1GI0A 1ZGIA 2SGAA 4OS5A 5JBCS 1YPMH 2ZCLP 3HGNA 1QCPA 1UCYK 2ZTZA 8KME2 3UOPA 2HPPH 2SNVA 4SGBE 1O3KA 1NTPA 5JPMH 3GCTF 2HPQH 2GD4B 3AVZA 1GBTA 3UIRA 1SGIB 1CHOG 4BANB 4Q7YA 1ZTLA 3U69H 1AY6H 1CU1A 2JH0D 2VIQA 1AKSA 1KTSB 3LGYA 4BAMB 1UMAH 1RS0A 5F8TA 1HJ9A 3QK1A 3R0FA 2BD8A 1H8IH 3GCOA 4J1YA 1PQAA 1FY5A 5F03A 3SN8A 1C5RA 1WQVH 2PWXA 3BTEE 2B9LA 3Q3XA 4X1QU 4UFGH 1JXPA 2IN2A 3AAVA 3F9GA 3S69A 1F92A 3F9EA 3MH6A 1IOEA 3PTBA 1O3PB 1WU1A 4OS6A 4BTTB 1EZUC 1Y5BT 1YP9A 1O2SA 2BY7X 3BG4B 5FPSA 3O8CA 1C4V2 4NZLA 2STBE 3U8RH 4FUEA 1F0RA 4AFQA 4I8LA 1AUTC 3GY4A 2BOHB 3EDXB 3I77A 2QXJA 1LDTT 5TCCA 5I46H 1GGDB 5DP9A 2YOLA 1C4Y2 1MUEB 2FYRA 4INHA 2BDCA 1TB6H 4JZEH 1EXFA 3IITA 1GG6C 4ZHAA 3GY8A 3T2NA 3EAJA 2DE9A 1K9OE 1SGNE 2Z9JA 3SU2A 2ZZUH 4Y79A 1O36A 3RLWH 1YCPH 2Z9IA 3P8NA 1GHAF 2FIRH 1TGTA 3AW0A 3LH1A 2QIQA 3LC3A 2Z3CA 1ARBA 1GDNA 2OCVB 2QXHA 1G3EA 3M3SA 1ARCA 3RM0H 1BJVA 4MNYA 2C4FH 1Z8GA 2VWNA 2EEKA 2GDEH 3ITIA 2PUQH 5TCAA 1FZZA 2BDHA 1RFNA 1J14A 2IJOB 2GGVB 3TGJE 1GVLA 2BD2A 2VWMA 5C20A 4FUIA 3D23A 4YLUA 1T32A 3FP6E 1GMDG 3PWBA 5J4QA 1A46H 3HK6B 1O3JA 1EOJA 2O8WA 1BTXA 2VIPA 3UPEA 3EA7A 4Y8XA 3ODDA 1YBWA 2ODPA 1XUGA 3QGJA 4NIVA 5E2PA 3T25A 3LIWA 5AHGH 1ANEA 2WPJS 3CENA 4O3TA 4DVAU 1TNGA 2OBOA 2R0KA 1HUTH 1S83A 2A7CA 3QUMP 1P57B 1SQOA 1WOFA 4MTBA 4U2WA 2Z7FE 3STIA 3ZYDA 1SC8U 1NM6A 2G81E 1AVGH 3IWMA 1FNIA 5E8EH 5GDSH 4LZ4B 1C2LA 1TGCA 3HKIB 8LPRA 1LVBA 1GHZA 2HNTF 3ATKA 3D62A 1ETTH 1G2LA 4E06H 1GI4A 1EOLA 3QX5H 4MLFB 4CBNA 1RTKA 4HTCH 3ZZ7A 1OPHB 1ZHRA 1VCPA 1E38B 2TRMA 2UWLA 4KKDA 3LJJA 5FPYA 2I6SA 1C1MA 3TGIE 1S81A 3GY5A 4K60A 4U30A 2HOBA 1W8BH 3LONA 4DY7B 4BNRA 5GIBA 1O5AB 3GDSA 1XVOA 1MQ6A 2GV7A 1UHBB 1W0ZU 5A8YA 2IOTA 1QQ4A 3V0XA 3AW1A 3NK8A 4HGCA 1ELGA 2F91A 3SQHE 3L33A 1ZPBA 2HNTE 1AO5A 2BD4A 1ZYOA 4B1TA 5C67A 1FV9A 4HZHA 3KF2A 1F5LA 1O3HA 2Y6TA 2H2ZA 3BTKE 3ZZCA 4INLA 1HJAB 3P17H 4TY7A 1KLTA 1DWBH 1GJDB 7ESTE 1C5SA 2GMTC 2P3TB 5LGOA 4J2YB 2ANMH 2OUAA 2UWPA 1VITH 1DM4B 1P3EA 4GCHF 2TBSA 2XWBI 5JDUB 4ZH8A 4AFZA 1BDAA 3SI4H 3RXKA 1DPOA 1P2IA 1OYQA 2UUJB 5DP8A 1P11E 4GLYA 1O2XA 5C1XA 4OGXA 2XW9A 3Q3YA 1BTHH 6CHAB 5I25A 1S85A 1AVXA 2H5CA 1C2MA 2YNAA 1Z8IB 3QN7A 2ZU2A 4WWYA 4Y11E 1T8NA 1GG6B 3A8BA 3UTUH 1UTJA 1DWCH 1C2DA 5EG4A 4GVUA 1YCPK 2ZU5A 3PROA 4LOYH 4X0WU 5EW1H 2GCTC 1AQ7A 2OXSA 1GWAA 4FU8A 4H42U 2BYAX 2K1QA 1QNJA 1C2IA 3Q3KA 1DSTA 3OYPA 1DS2E 4IBLH 1XUIA 1C1VH 5C5NA 4NGAH 1E34B 1AZZA 1P2MA 1MD8A 1C1RA 5B6OA 1YM0A 1DY9A 2FM2A 3RMOH 2VVCA 1IHTH 1A2CH 2DUCA 1BIOA 4XE4A 1XUFA 1EZXC 2XYAA 3H7OA 1DXWA 1FN6A 1FPCH 1MTNC 2QY0B 2RA3A 3SNBA 2RDLA 1GHXH 1RJXB 5HMAA 3MI4A 2Y7XA 3UR6A 4B2CA 2ZF0H 5DJ7A 2FZZA 3GY7A 4KGAA 3TNSA 1TMUH 3ZVCA 1ABIH 3IG6B 2EA3A 3BTWE 3GDUA 1ETSH 2Z3DA 1HB0B 3UFAA 1AB9C 2PGQB 2RCEA 3TJNA 1K2I1 1OWDA 4ABEA 3ELAH 2Z9GA 1IQNA 2A2XH 2ZI2H 3S9CA 1YGCH 3D49H 3JZ1B 1JRSA 3B23B 1FI8A 3OY5U 1QB9A 1GJCB 5HM2A 4UONA 1GHBF 1FIWA 1S82A 4O97A 3SV7A 1DVAH 4MQAA 3RXBA 4CRDA 1S6HA 1NC6A 4JYUH 3DT0H 1C5UA 1UK2A 2R9PA 4RKJB 3SNEA 4YM9A 2VIVA 2ZGJA 2OQUA 1P05A 1Z8JB 1TRYA 2ZU4A 1D3PB 1DDJA 1RIWC 2ZDLA 2W5EA 2PTCE 4Y76A 3LKWA 2BXUH 4JCNA 3KIDU 1YPHC 3ZVDA 4X2XA 1AGJA 3SJ9A 1BZXE 4OGYA 1O3DA 3HKJB 1TGBA 4NWKA 4X1PU 2V3OH 2F9BH 2AH4X 3TVJB 4KTSA 1LHGH 1K1JA 1HRTH 2XRCA 1JOUB 3FP8E 4VGCC 2GZ9A 3FANA 3RXSA 1HXFH 1MKWK 3P8GA 2G5VA 2VH6A 1HDTH 3PLPA 1H8DH 4UFEH 1F5KU 1ZOMA 3F6UH 1IQMA 1M9UA 1F2SE 3SV2H 1QIXB 5CHAC 5AFZH 2A5KA 1H9IE 1ELAA 2BLOA 1NFXA 2AGGX 2Q1JA 4IGDA 3GCHB 1Z1JA 3U8TH 5L2YH 4D8NA 3ZZ3A 1KTTB 4I8JA 2G52A 2TGTA 3M7QA 5IDKA 1O5CB 2HWLB 1IAUA 1J16A 3GOVB 2BQ6B 1G30B 2FODA 4ZHMU 4U01A 2QA9E 4GPGA 1BTWA 1CVWH 2G4UA 1GJ4H 1HV7A 1GJ8B 2QAAA 3A83A 2A31A 1W13U 2BVXH 4UDWH 4D9RA 3TGKE 1EAUA 1SVPA 1GI3A 1NFYA 3A8CA 4CHAC 3M3TA 1WV7H 2FLBH 3HPTB 1NFWA 2FI4E 4CRFA 2CJIA 1ZRBA 2FS9A 3RXJA 1MD7A 1V2NT 4Y0ZE 2O8LA 2ZFRH 1AVWA 1O3AA 1P12E 5FHTA 4ABFA 1BHXB 1LPZB 1P3CA 3BTHE 3PM3A 5ESTE 1FY4A 4Y7AA 3FAOA 2PKAA 3L6PA 5F6MA 2EI6A 4WY3A 3PLKA 4OS7A 4A1XA 1GPZA 1BHXF 4Y6DA 1PPZA 1N6YA 1SPJA 1L1GA 4NZQA 2FOGA 2BDAA 1TONA 3PYHA 1C2KA 3TPIZ 1MMJN 3GY6A 4CRCA 1ZTKA 4ISHH 1SGEE 5FCKA 1EPTC 3RXQA 2Z6BD 1ZJKA 1CA0C 3UR9A 1QRXA 2H9HA 2FOCA 2ZPSA 2LNCA 1DLEA 4LXBH 1AB9B 1TX6A 4I7YH 4ZUHA 1ZLRA 4D7FA 3TK6A 1Y59T 5A2MH 4MPUA 5A0BA 2R2WU 3RU4E 4NFEA 2GKVE 1C1NA 3MMGA 4JK5A 5BRRE 2XBWA 1S0QA 2C8YB 2G4TA 1GHWH 1DE7H 2Q6DA 1P8VC 3VB5A 1QY6A 3O8DA 2QF0A 1P01A 4A1VA 1FY1A 1UTPA 3U1JB 2ODQA 2Y5FA 1GVZA 3PV4A 1MQ5A 3QWCH 3RMMH 4O9VA 2BVSH 4B74A 5C3NA 1UO6A 2PSYA 5L30H 1L0ZA 3BF6H 1GVKB 1IQLA 2BM2A 3T26A 3QZQA 4ABJA 1HAOH 4R0IA 4YO9A 1H4WA 2FWWA 4X8VH 2BLQA 1AHTH 1GL0E 4CRBA 1KDQB 1DWEH 4YLQH 2F9PA 5EOKA 3RLYH 2H6MA 4MPVA 4AGKA 2J95A 3U98H 3MNCA 2FDAA 1RGQA 2V6NA 3QDZB 3E8LA 1UVUH 1O34A 1KXDA 1HIAB 2Y80A 4BOHA 3SUEA 3VB4A 3RXGA 1BBRE 3KQEA 4TYDA 1LCYA 1TMTH 3BEUA 2LPRA 1C5ZB 4D9QA 4WVPE 1C2EA 1NPMA 2SGDE 1V2ST 1YCPM 1V2LT 3MH4A 3HK3B 2D8WA 1UTKA 1AUJA 1GI7B 2FYQA 4AFSA 2QXIA 2FXRA 2STAE 3G01A 2W3IA 1BTUA 5FXLA 2XC5A 2BLWA 3MU4A 2P59A 1C2GA 5T6GA 1W3CA 1A0LA 4KTCA 1O5BB 3QTOH 3PMHB 1MBQA 3UWIA 2THFB 3M3VA 1VJ9U 1BJUA 1EP6A 2P3UB 1A61H 2PTNA 2SFAA 2F9UA 4NA7A 1NRQH 2ZDVH 2Y5GA 4ZROA 1BITA 2VGCC 4I31A 1N8OB 1K1NA 1FN8A 4BAHB 1TALA 3UNSA 3T5FH 3WY8A 4DIHH 1MCVA 1QB1A 3RP2A 2TGPZ 3ENSB 1OP0A 3SU3A 4IMZA 1EB1H 2SGPE 5A8ZA 3RXTA 2P3FH 1UTNA 1P06A 1SOTA 2WV4A 1TGSZ 1AIXH 3RUOA 3PMBB 1VGCC 1GBBA 3M5OA 1AFQB 3M7UA 1H1BA 5LPRA 2JETC 4D76A 4ABIA 4WXIA 1XM1A 2A4RA 1E36B 1P2KA 1WUNH 1KXEA 3ZV8A 3SUFA 2ZQ2A 5JB8S 1O3FA 3FP7E 1O3BA 1O2WA 1ZMJA 3B8JA 3SW2B 1F0UA 1DUAA 1MU8B 3A7WA 2J4IA 1SHYA 5EQQA 1CA0B 1SGFG 5HGGA 4YT6H 5A0CA 4GUXA 1VCWA 5K0HA 3UY9A 2A4GA 1DSUA 2HRVA 2F3CE 4ABDA 8ESTE 1C5NH 1O35A 4HFPB 4XBBA 1A3BH 2ZFSA 2ANYA 4ZHLU 2XCNA 1YPKH 1EJNA 5ETXA 4FUCA 1P0SH 1GL1A 3M5MA 3TK5A 1PPBH 1D3TB 2ALPA 2TGAA 1HAPH 2DE8A 2KAIB 4NIWA 3M37A 2ZEBA 2GP9B 2YNBA 1SQTA 1W7XH 4K69A 1MBMA 1JMOH 4B73A 2FMJA 3A7YA 1CSOE 2ASUB 5JYIA 2ZHFH 5DPAA 1DY8A 1FJSA 1BRAA 3P70B 3K9XB 1O3IA 1QBNA 4MNVA 4DOQA 1HFDA 1V2KT 1V2RT 4AG2A 2GCHF 2AYWA 2ZP0H 1G37A 2AMQA 2ZHEH 1O3EA 2CHAC 4WMEA 2PR3A 2AIPA 1BMAA 2EC9H 1BBRK 1CO7E 3RU4D 2P94A 1O2GH 3E0NB 2GVFA 2SGFE 1GJ7B 4X8SH 1ESAA 4AG1A 4SGAE 1G32B 2ZHDA 2ZNKH 3PB1E 1TFXA 4MPXA 3UWJH 1NESE 1KXAA 3SU1A 1J15A 1ORFA 3M36A 3SO3A 3DFJA 2PGBB 3LPRA 1F7ZA 1HXEH 2CGAA 3SNDA 2QGRA 2P8OC 1C5QA 3TH2H 3DD2H 3A88A 1HCGA 3P6ZB 2BD9A 1C1WH 2F9OA 1GI8B 1K28D 1PPCE 3QTVH 1SGYE 1O0DH 2O8UA 3S0NA 3KNXA 4K1TA 2FPZA 4CREA 3RMNH 3ATIA 4X8TH 1LVOA 3AAUA 2ZWLH 5GPIB 4JZIA 4JZ1A 4HI3A 1DITH 1A5IA 3NCLA 2V0BA 2PSXA 1OKXA 3SBKA 2ZKSA 1NRSH 2Z9KA 2JH6D 1OP8A 9ESTA 2F83A 1BB0B 1KXBA 4BTUB 1YYY1 6ESTA 4X8UH 1J17T 1LHCH 2VVUA 1BRUP 5DGJA 1XUJA 4NSVA 1AMHA 1MKWH 1S84A 2C8ZB 1CQQA 4I8KA 3MU0A 1VITF 1O5GH 3V13A 3K65B 3SOSA 2AIQA 4A5TS 1XKBC 1NU9A 1SLXB 3W94A 5J4SA 4XBCA 4D7GA 1LPKB 5F8XA 4A92A 4RKOB 1V2TT 4OS4A 1OX1A 2ZGXH 3SZNA 3E90B 1O2ZA 1LQEA 1W12U 2JETB 3D65E 4NFFA 2VVVA 2FLRH 4PROA 3SU6A 2R0LA 2V3HH 2FS8A 4NG9H 4X2YA 1EATA 1QBOA 1WSSH 3ZVEA 3RXAA 1V2QT 2VJ1A 4DT7B 3E3TA 1TRNA 4X1NU 1GBJA 1UTLM 3VGCC 1DANH 1O2NA 3RXCA 3P95A 1CHOF 3V3MA 2CF8H 4WMFA 3VB7A 1LQDB 3LOXA 3TNTA 5H4IB 3OTJE 4GAWA 1FPHH 3V12A 4ZMAH 3LGTA 4KP0A 1N1LA 6GCHG 2PLXA 3E6PH 2ZPRA 1Z1IA 1P9SA 5EXMA 1LHFH 1O30A 1P09A 2GZ7A 4YT7H 2HGTH 3UNQA 1H9HE 1PPFE 3DA9B 1P10A 1KLJH 2BDIA 2ULLA 5FBEA 1GJ5H 1O2YA 3KQBA 2VIOA 1NT1A 1SSXA 3A8AA 3GICB 3SV9A 3BV9B 3LU9B 2ZIQH 3RXPA 1DICA 3VXFH 4Q7XA 1HAVB 2ZA5A 2AMPA 3SJKA 1GI2A 1ZHMA 1H9LB 3ZZ4A 2CXVA 2Y5HA 4BAQB 5DK1A 2XNIA 2W7SA 2SGEE 1O2RA 1O2QA 2JH5D 2RA0A 1FAXA 3C1KA 5DKMA 2NU0E 3AASA 1V2VT 2GX4A 1ZSKA 4K3JA 1C5LH 2W7UA 1BT7A 2OP9A 1QL7A 3K6ZA 8GCHG 2WPLS 1SGPE 2OQ5A 3TITA 1TPPA 1V2WT 1PYTD 3H5CB 1SMFE 1W10U 5FX5A 1EJAA 3SU4A 5HYOA 4JMYA 4CRGA 3R3GB 5K7RA 2BDYA 4H6TA 4I8GA 3ATMA 1QR3E 1T4VH 2G51A 1AKSB 2A32A 1Y3XA 1MKXK 1SGDE 4O3UA 1CE5A 4XFQA 1O3GA 1FY3A 1UK3A 2WPKS 3MU8A 1Y3UA 1QRZA 1ZJDA 2BTCE 4X2WA 1V3XA 1CBWC 4ZXYH 4DW2U 2R3UA 5E2OA 4FU7A 2EI7A 1IQJA 1GBHA 4AB8A 4O03A 3A87A 3VB3A 3KHVA 3PLBA 5FCRA 4ESTE 5E0JA 1HLTH 2A4OA 1X7AC 2FOMB 3F9HA 4TY6A 5EODA 3ZZ8A 1FUJA 1PPGE 1GMCG 3MHWU 1GMDF 1GHVH 4TWYA 3T62A 3GCTG 1PQ7A 4Y7BA 1ZMLA 2BD7A 2AERH 4JZFH 1HPGA 3ZZ6A 1C5XB 1KIGH 2FESH 3SI3H 2G55A 1JRTA 1ETRH 5DG6A 3QZRA 2RG3A 1XMNB 2OBQA 4XDEA 4IN1A 1RRKA 4ZKSU 3S7KB 4FUFA 1DX5M 1GBLA 1KXCA 3TJVA 3W95A 1XX9A 2WUBA 3RXMA 4DURA 1VCQA 2HALA 1T7CA 1HGTH 4JYTA 2J38A 3PWCA 5AVDA 3TLOA 1HAXB 1EAIA 1J8AA 1A1RA 2GMTB 1O3LA 1IQHA 1V2UT 3BSQA 3DUXH 3A82A 1TX7A 2ZFFH 4UE7H 1GI5A 2M5TA 1P03A 1K1MA 2CN0H 1YPJH 3TJUA 2XBYA 4Y8YA 1VJAU 5FX6A 4K1EA 5EXLA 1SR5C 5JBAS 1F5RA 2A1DB 2O9QA 1D4PB 4XSKU 2OLGA 3KN2A 1QJ6B 3KQDA 1O33A 3VFEA 1TIOA 1Y5AT 2EI8A 1BA8B 3U9AH 2AFQB 2Y7ZA 5A09A 5E0GA 2FOBA 4NWLA 1VZQH 2AMDA 2ZECA 2ZGBH 1HYLA 3MTYA 1W0YH 1O2VA 1UVPA 1YPEH 1Z6EA 3S9BA 1MH0A 1SGQE 3BG8A 1BCUH 1ESTA 1ACBE 1NZQH 1A5HA 2D26C 2OD3B 2J9NA 3SHAH 1DXPA 3ZVFA 2XXLA 1NU7B 2GCTB 4ZXXH 3BTDE 3H7TA 3FFGA 1GI6A 1Q31A 1WTHD 1Z6JH 1D9IA 2BQWB 4M7GA 1SI5H 2F9NA 1UVSH 1E0FD 3QO6A 3LT3A 4ISNA 1GDQA 1O3MA 2A5AA 3SORA 1CT0E 1SGRE 1ZSLA 1CGIE 3M5LA 4BAOB 3KL6A 1PYTC 1SFIA 4MNXA 1RTLA 1KSNA 2GT8A 2BY5X 1BMMH 1G3CA 3KGPA 1KXFA 1MTNB 2BY8X 3A89A 4OS2A 3HGPA 2CMYA 4DGJA 1P2OA 3K2UA 1SL3A 2A7JA 3E1XB 1UTOA 3QLPH 1OWIA 5A8XA 1LO6A 1GI9B 4X2VA 1F0TA 1C5WB 4FVBA 5EGMA 3MO9A 2ZQ1A 1CT2E 2Y81A 2WYGA 2NU4E 1UHBA 4K2YA 1EP5A 2QN5T 3TH3H 1O5FH 2G8TA 2ZGCA 5ESBA 1C1UH 4A7IB 5FAHA 1W14U 3DFLA 1SGCA 2AGEX 3BG4C 1QJ1B 1DOJA 1XXDA 3EGKH 2ZDMA 1Y8TA 1K1PA 1EZSC 1MZDA 4ZKNU 1W7GH 3LGUA 5PTPA 2P16A 3KCGH 5GCHG 2UUYA 3LGVA 3NPSA 3SJOA 1TBZH 4IC6A 4Y0YE 4AYYB 4INKA 2Q6FA 1CBWB 1FMGA 4CH2B 1AE8H 1LTOA 1S6FA 1ELCA 1HAHH 1PQ8A 5AFYH 3GCNA 4ABAA 4YOGA 3SJ8A 1C9TA 1GJBB 1EB2A 1O3CA 1RIWB 1G2MA 1TNIA 2FP7B 1TNHA 2WPIS 2ZDKA 3BEIB 1IHSH 3A86A 1Y3VA 3MNXA 3TIUA 1IQFA 3OU0A 4GSOA 3MO6A 3MWIU 3V7TA 1LMWB 2SGQE 2NU3E 1BTZA 1UTQA 2VWOA 2QC2A 1RTFB 5EXNA 4VGCB 1ANDA 3SGAE 1THSH 4TPIZ 1C5OH 1KY9A 5SGAE 1W2KH 1SG8B 3TH4H 4H6SB 1BBRH 1NS3A 2A4QA 1SHHB 2ZGHA 1GJ6A 4F49A 1YPLH 2WPHS 1C1TA 1A4WH 1OSSA 1T8LA 1MAXA 3ZZDA 1HAGE 1DUEA 2R2MB 2PV9B 1B0FA 5CHAB 3SNCA 2FOHA 1THPB 2ZO3H 1GJ9B 4BAKB 1LHDH 3QGNB 5T6DA 3NZIA 3GYMA 1YPHE 1GI1A 9LPRA 2BY6X 2WV5A 1TOCB 3SNAA 4ZKRU 1SBWA 1QB6A 2HNTC 1C5PA 3EQ0H 3SUGA 4RN6A 1A0JA 1ELTA 4FUJA 1XUKA 1B5GH 4AGJA 2FX4A 1PPHE 1AI8H 1FY8E 2AGIX 2HVXA 1TOMH 2ESTE 1IQGA 1W11U 5C1YA 3SQEE 3I29A 5EPYA 3T29A 1ELDE 1EAXA 4CHAB 1SLWB 3BEFB 1NROH 1OOKB 1NRPH 3A81A 4FUHA 5HM9A 1P2NA 1ID5H 1QHRB 2NWNA 1THRH 1TWXB 3A7ZA 4AB9A 3F68H 1C2FA 5LH8A 4MPWA 2VU8E 3GYLB 3BTQE 1QA7A 1VR1H 5TJXA 3BIVH 2BB4A 4K5ZA 3FZZA 3ZYEA 2FOEA 3OX7U 2Q6GA 3ODFA 3S7HB 3E0PB 1UTMA 1CGJE 1EUFA 1TABE
chains in the Genus database with same CATH superfamily
1WQSA 2GV6A 5LPEA 1TA2A 3M35A 4JYVH 3ZZAA 1E35B 1GBDA 4Y8ZA 2BDBA 1C1QA 4E05H 2ZFTA 2ZU3A 1ESBA 1HJAC 1EPTB 3PO1C 4CH8B 3MQKC 1PPEE 2H9EH 4X1RU 3BTME 3BTTE 1KLIH 1EASA 4ISIH 3N7OA 1WBGB 4JZDH 1YPGH 2LELA 2G00A 1NRRH 1Y5UT 1OWJA 3O8RA 2NU1E 1HJ8A 2FX6A 3FKSD 4B71A 1AN1E 5JBTA 3SUDA 1BRCE 4CBOA 2XBXA 2ZDAH 1A5GH 1MCTA 1GHYH 2OTVA 3TJOA 4NA9H 1JWTA 5C2ZA 2WPMS 4JK6A 4YOIA 1D6RA 1GBIA 3CS7A 4OS1A 1FQ3A 2ZG0H 3ZZBA 3A8DA 3RC4A 2ZFQH 4I33A 5DN6D 2A2QH 6CHAC 4AFUA 1IQIA 3ZV9A 1FIZA 1Q3XA 3S9AA 3SJIA 4Z6AH 2PKSC 3SU5A 5DO4H 4AYVB 1QTFA 3Q00A 2BVRH 2L6OA 4YTAA 3E16B 3GY3A 2PUXB 1Z71A 1ELVA 2SNWA 3A85A 3RU4T 1GHBG 1JBUH 2GT7A 1YLDA 4BXWA 3SV8A 2ANWA 4WH6A 2OINA 2J94A 5DP3A 4LZ1H 2FI3E 2PW8H 2ZCHP 2WINI 1C2JA 1FONA 2G5NA 2QF3A 2H9TH 4IN2A 4IS5A 4YESB 1PFXC 1QURH 1MAYA 1WYKA 1JIRA 5GWZA 1CA8B 1TE0A 5DP6A 1MKXH 4A6LA 5GCHF 1L2EA 2Z9LA 2KM0A 1GCDA 3OTPA 4MVNA 1QL8A 1C9PA 4WH8A 1J9CH 3F0OA 1IQEA 2WYJA 3VEQB 4UD9H 1KYNA 1ZSJA 3MH5A 2BOKA 1B7XB 1TPAE 3RXIA 2VB0A 3MU5A 4IC5A 1O2HA 4BTIB 1PJPA 1XXFA 1C5TA 1WTGH 4NSYA 2JKHA 2BZAA 2H5DA 4CR9A 3ATWA 2FTLE 2P95A 1T4UH 3KEEA 4MDSA 4F4OC 1HAYB 2C8XB 2OC0A 2OK5A 1ZPZA 2PKAB 3RXUA 5C0TA 1QL9A 2FO9A 1V2MT 2J92A 4U32A 1OWEA 1OWHA 1SFQB 1ZR0A 2BX4A 2ZFPH 4X6NA 3U1IB 2ILNA 1SQAA 1BTPA 1UVTH 1MABB 4M9FA 2A5IA 3EE0B 3UOUA 3P92A 1QRWA 1S6LA 1BRBE 3P8FA 2VGCB 1AU8A 5GNDA 3UUZA 5G4BA 1OYTH 3ATLA 3PV5A 2B5TB 4ZAEA 5T1VA 2VNTA 4AN7A 4BXSA 3UREA 4B6FA 1TMBH 1AWHB 1PQ5A 3OEED 3SV6A 5EU8A 4B76A 1H8HD 3SU0A 1BQYA 4K8BA 1V6DA 1VGCB 4AORA 1N6XA 2O8MA 1L1NA 1MU6B 2XC0A 1EQ9A 1K21H 2ZPQA 4FVDA 1RXPA 3MH7A 1WCZA 4X1SU 3Q77A 4UFFH 3GISB 1DFPA 1FLEE 1XUHA 3ZVAA 1T8OA 1K1LA 4WF8A 1C5MD 2ZTXA 1EAWA 3PO1B 4AOQA 1L1JA 1K1OA 3UNRA 1O31A 1O2TA 5FBIA 1O2UA 2C93B 1FXYA 3RXOA 1AD8H 4ABHA 1XVMA 1L4DA 1COWD 1GJAB 3BN9A 3GCHC 1O3NA 1QFKH 2CV3A 2NU2E 1FAKH 4Z0KA 1C5VA 1ZZZA 2JIZD 3E91A 5DP5A 3PMAB 1KDQA 1BMNH 1OP2A 2J34A 2OC8A 1EX3A 1YY3A 2KCYA 1NO9H 4Q2KA 3FZDA 1TNJA 2UUFB 2D2DA 1ANCA 4MNWA 1LVYA 4B2BA 1SLVB 2C90B 3BIUH 1WAYB 1Z7KA 2AEIH 4ISOA 3RXRA 3A7TA 1O2KA 1HIAA 4AX9H 2J97A 3F1SB 5CE1A 1TBRH 1K1IA 2B8OH 2A7HA 2Z94A 2HLCA 3LJOA 3M7TA 2BD5A 1O2PA 5EIYA 1GCTC 2PKSB 1JIMA 1K22H 1D6WA 3HATH 1HNEE 2WUCA 1Y3WA 3VB6A 1XKAC 1A0HB 1ABJH 2UUKB 2ANKH 4UEHH 3ZVBA 3TK9A 4DCDA 1ZMNA 4P00A 1GBFA 2CF9H 3ZZ9A 2BX3A 4ISLA 2ZU1A 3WWFA 4NIYA 2AS9A 3A84A 2OC7A 1CT4E 2CHAB 1TNKA 2A45B 1O5EH 3LGWA 3MFJA 4WMDA 4TPYA 1AE5A 2A0QB 1B0EA 1OXGA 1Y3YA 4R8TB 2QXGA 5F8ZA 1NRNH 1LKBA 2XCFA 1EKBB 4X6PA 4ABBA 1TA6A 1SLUB 4FUBA 3A7XA 4WXVA 1F0SA 2ZC9H 4GHQA 1ZRKA 4K1SA 2P8OB 2BLVA 1O32A 3BTGE 3MOCA 4QT8C 3RXLA 6LPRA 1UJ1A 4CR5A 1TYNA 1E37B 2UWOA 2J5UA 4ASUD 5AF9H 1G36A 5EQRA 4YZUA 7GCHG 4E7NA 1GBCA 4Q7ZA 3Q76A 2VBCA 2PFEA 2VINA 1GMHG 5BPEA 2F4LA 4I8HA 1CHGA 2FOAA 1ZPCA 4RSPA 4IW4E 1NN6A 4FXGH 2R3YA 3FVFB 1Q2WA 1O5DH 5GJ4B 3GY2A 1GDUA 2Z3EA 3RC6A 1O37A 2W6ID 3LH3A 4FOUC 1EPTA 3C27B 5JBBS 5C5OA 1HBTH 1O3OA 3NXPA 1RD3B 4A1TA 1D3DB 2OC1A 4CRAA 3FOAA 4I32A 4Y71A 1V2OT 1QBVH 5L2ZH 2WZQA 2PHBA 3RXVA 1NFUA 1O2IA 4GHTA 5L6NH 2FEQH 3T28A 1G9IE 2TGDA 2XC4A 4YOJA 3UQOA 3LC5A 2BY9X 1TNLA 1QQUA 2YMSC 4Q80A 7KMEH 3FN8A 1AZ8A 2D1JA 3P8OA 1BTYA 1LVMA 1NY22 4THNH 2H1UA 2K8IA 2KAIA 3CP7A 1ZTJA 5T3HA 1O2LA 3RC5A 1GBKA 1T31A 1TLDA 3NWUA 5GXPA 5DSFA 1LKAA 3EA8A 3L3TA 4XBDA 3SGQE 2ZHQH 2FTMA 2W3KA 2C3SA 3CNRA 5T6FA 3VGCB 5ABWA 1MZAA 2B7DH 3RXHA 1SOZA 2V35A 5CMXH 3DSGA 1L4ZA 1S0RA 3TU7H 3NKKA 3SGBE 3KYGA 1MTVA 3A7VA 5EPNA 1YF4A 5CDFE 3ZVGA 1P2JA 1UVOA 2BD3A 1TAWA 1IQKA 1MTWA 3PTNA 2GTBA 2C8WB 1UCYH 3T27A 1SGTA 4NCYA 4OM9A 3F9FA 2XTTB 5IYTA 1DWDH 4UFDH 1C2HA 4NA8A 2K0QA 1ELFA 3GDVA 5JB9S 1UCYE 4K8YA 2ODYB 3KQCA 1GBAA 1QA0A 5HIZA 1LPGB 5A0AE 2XBVA 2BHGA 2VIDA 3B9FH 1FDPA 1GCTB 1P04A 2IPHA 2VH0A 1O39A 1HAIH 4ABGA 1BUIA 3UQVA 1TPOA 4WJG2 2GDDA 3OE7D 5B6LA 1EJMA 1GBEA 1GHAG 1TGNA 1P02A 1N8OC 4KELA 1O38A 1AFEH 3OSYA 1O2OA 1G3BA 1MTSA 1U6QA 1YC0A 4Y10E 1OWKA 1C4U2 1ELBA 1P9UA 3MNBA 2XWAA 1ZHPA 1QJ7B 2I6QA 4YXWD 1OS8A 2BZ6H 3JZ2B 1A3EH 2TPIZ 2P93A 2ZHWH 4B2AA 1ELEE 5EQSA 1AFQC 3ZZ5A 3H09A 5DP7A 4FUDA 2ZCKP 3LDXH 1QGFA 2J2UA 1P2QA 1BMLA 2BXTH 1INCA 2QCYA 1EZQA 5FPTA 1A7SA 5DP4A 4RI0A 1D3QB 2GCHG 2F9VA 6GCHF 7LPRA 4KTUA 2QYIA 1C5YB 3CS0A 2Y82A 3DHKH 2QV1A 1BOQA 3RMLH 1DLKB 1TQ7B 1UW7A 4FUGA 4DJZB 3M61U 3URDA 1LHEH 1C1OA 1GGDC 3VXEH 5EW2H 1UK4A 3LGIA 3EYDA 4ASHA 3RXEA 2BMGB 3EA9A 3MU1A 3O8BA 4LK4A 5FL7D 5LPFA 1TPSA 1SB1H 1TRMA 5HXFA 4Z1MD 3K6YA 4P02A 3VPKA 4X6OA 3SHCH 3URCA 3I78A 1C1SA 4ZCNA 1O2JA 1YLCA 2L74A 1C1PA 3OY6U 4FU9A 3ESTA 4IMQA 4RT1A 4XRNA 3RXFA 3BTFE 3NUMA 4ZKOU 1AWFH 2FOFA 3RDZA 8GCHF 3U8OH 3MO3A 2ZTYA 2ZDNA 3RM2H 3RXDA 1YWUA 1HAZB 1DT2A 4AZ2B 4DG4A 1MTUA 2VWLA 2BDGA 2B0FA 4XOJA 4DIIH 2O8TA 3A80A 5E0HA 3PMJA 4NIXA 3M5NA 1V2JT 1ZGVA 1TX8A 1T8MA 4TWWA 1VITG 1Z8RA 2W26A 2RDEA 1TQ0B 3MYWA 1YKTA 7GCHF 1TBQH 5C1UA 4MG3A 1HAVA 2ALVA 1CGHA 1V2PT 1GMHF 4H4FA 4X6MA 4B75A 2GZ8A 4E7RG 2BQ7B 3STJA 2IJD1 3MNSA 2FI5E 2VIWA 1GBMA 2TIOA 1S5SA 1SGFA 1ANBA 1O2MA 1GMCF 4I86A 4GCHG 1G3DA 1GI0A 1ZGIA 2SGAA 4OS5A 5JBCS 1YPMH 2ZCLP 3HGNA 1QCPA 1UCYK 2ZTZA 8KME2 3UOPA 2HPPH 2SNVA 4SGBE 1O3KA 1NTPA 5JPMH 3GCTF 2HPQH 2GD4B 3AVZA 3OFND 1GBTA 3UIRA 1SGIB 1CHOG 4BANB 4Q7YA 1ZTLA 3U69H 4F48B 1AY6H 1CU1A 2J98A 2JH0D 2VIQA 3WWBA 1AKSA 1KTSB 3LGYA 4BAMB 1UMAH 1RS0A 5F8TA 1HJ9A 3QK1A 3R0FA 2BD8A 1H8IH 3GCOA 2V3MA 4J1YA 1PQAA 1FY5A 5F03A 3SN8A 1C5RA 4RT0A 1WQVH 2PWXA 3BTEE 2B9LA 3Q3XA 4X1QU 4UFGH 1JXPA 2IN2A 3AAVA 3F9GA 5C0UA 1NBMD 3S69A 1F92A 3F9EA 3MH6A 1IOEA 3PTBA 1O3PB 1WU1A 4OS6A 4BTTB 1EZUC 4F55A 1Y5BT 1YP9A 4TSFD 1O2SA 2BY7X 3BG4B 5FPSA 3O8CA 1C4V2 4NZLA 2STBE 3U8RH 4FUEA 1F0RA 4AFQA 4I8LA 1AUTC 3GY4A 2BOHB 3EDXB 3I77A 3AK5A 2QXJA 1LDTT 5TCCA 5I46H 1GGDB 5DP9A 2YOLA 1C4Y2 1MUEB 2FYRA 4INHA 2BDCA 1TB6H 4JZEH 1EXFA 3IITA 1GG6C 4ZHAA 3GY8A 3T2NA 3EAJA 2DE9A 1K9OE 1SGNE 2Z9JA 3SU2A 2ZZUH 4Y79A 1O36A 3RLWH 1YCPH 2Z9IA 3P8NA 1GHAF 2FIRH 1TGTA 3AW0A 3LH1A 2EQNA 2GJGA 2QIQA 3LC3A 2Z3CA 1ARBA 1GDNA 2OCVB 2QXHA 1G3EA 3M3SA 1ARCA 3RM0H 1BJVA 4MNYA 2C4FH 1Z8GA 2VWNA 2EEKA 2GDEH 3ITIA 2PUQH 5TCAA 1FZZA 2BDHA 1RFNA 1J14A 2IJOB 2GGVB 3TGJE 1GVLA 2BD2A 2VWMA 5C20A 4FUIA 3D23A 4YLUA 1T32A 3FP6E 1GMDG 3PWBA 5J4QA 1A46H 4HG6A 3HK6B 1O3JA 1EOJA 2O8WA 1BTXA 2VIPA 3UPEA 3EA7A 4Y8XA 3ODDA 1YBWA 2ODPA 1XUGA 3QGJA 4NIVA 5E2PA 3T25A 3LIWA 5AHGH 1ANEA 2WPJS 3CENA 4O3TA 4DVAU 1TNGA 2OBOA 4FETA 2KFWA 2R0KA 1HUTH 1S83A 2A7CA 3QUMP 1P57B 1SQOA 1WOFA 4MTBA 4U2WA 2Z7FE 3STIA 3ZYDA 1SC8U 1NM6A 2KCPA 2G81E 1AVGH 3IWMA 1FNIA 5E8EH 5GDSH 4LZ4B 1C2LA 1TGCA 3HKIB 8LPRA 1LVBA 1GHZA 2HNTF 3ATKA 3D62A 1ETTH 5HIYA 1G2LA 4E06H 1GI4A 1EOLA 3QX5H 4MLFB 4CBNA 1RTKA 4HTCH 3ZZ7A 1OPHB 1ZHRA 1VCPA 1E38B 2TRMA 2UWLA 4KKDA 3LJJA 5FPYA 2I6SA 1C1MA 3TGIE 4Q63A 1S81A 3GY5A 4K60A 4U30A 2HOBA 1W8BH 3LONA 4DY7B 4BNRA 5GIBA 1O5AB 3GDSA 1XVOA 1MQ6A 3NRLA 2GV7A 2QE7D 1UHBB 1W0ZU 5A8YA 2IOTA 2KCOA 1QQ4A 3V0XA 3AW1A 3NK8A 4HGCA 1ELGA 2F91A 3SQHE 3L33A 1ZPBA 2HNTE 1AO5A 2BD4A 3DSPA 1ZYOA 4B1TA 5C67A 1FV9A 4HZHA 3KF2A 1F5LA 1O3HA 2Y6TA 2H2ZA 3BTKE 4ACBA 3ZZCA 3DSOA 4INLA 2LP6A 1HJAB 3P17H 4TY7A 1KLTA 3EE7A 1DWBH 1GJDB 7ESTE 1C5SA 2YMSD 2GMTC 2P3TB 5LGOA 4J2YB 2ANMH 2OUAA 2UWPA 1VITH 1DM4B 1P3EA 4GCHF 3UB0A 2TBSA 2XWBI 5JDUB 4ZH8A 4AFZA 1BDAA 3SI4H 3RXKA 1DPOA 1P2IA 1OYQA 2UUJB 5DP8A 1P11E 4GLYA 1O2XA 5C1XA 4OGXA 2XW9A 2XOKD 3Q3YA 1BTHH 6CHAB 5I25A 1S85A 1AVXA 2H5CA 1C2MA 2YNAA 1Z8IB 3QN7A 2ZU2A 4WWYA 4Y11E 1T8NA 1GG6B 3A8BA 3UTUH 1UTJA 1DWCH 1C2DA 5EG4A 4GVUA 1YCPK 2ZU5A 3PROA 4LOYH 4X0WU 5EW1H 2GCTC 1AQ7A 2OXSA 1GWAA 4FU8A 4H42U 2BYAX 2K1QA 1QNJA 1C2IA 3Q3KA 1DSTA 3OYPA 1DS2E 4IBLH 1XUIA 1C1VH 5C5NA 4NGAH 1E34B 1AZZA 1P2MA 1MD8A 1C1RA 5B6OA 5HKKD 1YM0A 1DY9A 2FM2A 3SZEA 3RMOH 2VVCA 1IHTH 1A2CH 2DUCA 1BIOA 4XE4A 1XUFA 1EZXC 2XYAA 2KZ4A 3H7OA 1DXWA 1FN6A 1FPCH 1MTNC 2QY0B 2RA3A 3SNBA 2RDLA 1GHXH 1RJXB 5HMAA 3MI4A 2Y7XA 3UR6A 4B2CA 2ZF0H 5DJ7A 2FZZA 3GY7A 4KGAA 3TNSA 1TMUH 3ZVCA 1ABIH 3IG6B 2EA3A 3BTWE 3GDUA 1ETSH 2Z3DA 4Q4LA 1HB0B 3UFAA 1AB9C 2PGQB 2RCEA 3TJNA 1K2I1 1OWDA 4ABEA 3ELAH 2Z9GA 1IQNA 2A2XH 2ZI2H 3S9CA 1YGCH 3D49H 3JZ1B 1JRSA 3B23B 1FI8A 3OY5U 1QB9A 1GJCB 5HM2A 4UONA 1GHBF 1FIWA 1S82A 4O97A 3SV7A 1DVAH 4MQAA 3RXBA 4CRDA 1S6HA 1NC6A 4JYUH 3DT0H 1C5UA 1UK2A 2R9PA 4RKJB 3SNEA 5CHBA 4YM9A 2VIVA 2ZGJA 2OQUA 1P05A 1Z8JB 1TRYA 2ZU4A 1D3PB 1DDJA 1RIWC 2ZDLA 2W5EA 2PTCE 4Y76A 3LKWA 2BXUH 4JCNA 3KIDU 1YPHC 3ZVDA 4X2XA 1AGJA 3SJ9A 1BZXE 4OGYA 1O3DA 3HKJB 1TGBA 4NWKA 4X1PU 2V3OH 2F9BH 2AH4X 3TVJB 4KTSA 1LHGH 1K1JA 1HRTH 2XRCA 1JOUB 3FP8E 4VGCC 2GZ9A 3FANA 3RXSA 1HXFH 1MKWK 3P8GA 2G5VA 3F2GA 2VH6A 1HDTH 3PLPA 3ZIAD 1H8DH 4UFEH 1F5KU 1ZOMA 3F6UH 1IQMA 1M9UA 1F2SE 3SV2H 1QIXB 5CHAC 5AFZH 2A5KA 1H9IE 1ELAA 2BLOA 3F2HA 1NFXA 2AGGX 2Q1JA 4IGDA 3GCHB 1Z1JA 3U8TH 5L2YH 4D8NA 3ZZ3A 1KTTB 4I8JA 2G52A 2TGTA 3M7QA 5IDKA 1O5CB 2HWLB 1IAUA 1J16A 3GOVB 2BQ6B 1G30B 1NBME 2FODA 4ZHMU 4U01A 2QA9E 4GPGA 1BTWA 1CVWH 2G4UA 1GJ4H 1HV7A 1GJ8B 2QAAA 3A83A 2A31A 1W13U 2BVXH 4UDWH 4D9RA 3KYFA 3TGKE 1EAUA 1SVPA 1GI3A 1NFYA 3A8CA 4CHAC 3OAAD 3M3TA 1WV7H 2FLBH 3HPTB 1NFWA 2FI4E 5EJLA 4CRFA 2CJIA 1ZRBA 2FS9A 3RXJA 1MD7A 3N7DA 1V2NT 4Y0ZE 2O8LA 2ZFRH 1AVWA 1O3AA 1P12E 5FHTA 4ABFA 1BHXB 1LPZB 1P3CA 3BTHE 3PM3A 5ESTE 1FY4A 4Y7AA 3FAOA 2PKAA 3L6PA 5F6MA 2EI6A 4WY3A 3PLKA 4OS7A 4A1XA 1GPZA 1BHXF 4Y6DA 1PPZA 1N6YA 1SPJA 1L1GA 4NZQA 2FOGA 2BDAA 1TONA 3PYHA 1C2KA 3TPIZ 1MMJN 3GY6A 4CRCA 1ZTKA 4ISHH 1SGEE 5FCKA 1EPTC 4TT3D 5C17A 3RXQA 2Z6BD 1ZJKA 1CA0C 3UR9A 1QRXA 2H9HA 2FOCA 2ZPSA 2LNCA 1DLEA 4LXBH 1AB9B 1TX6A 4I7YH 4ZUHA 1ZLRA 4D7FA 3TK6A 2EY4C 1FX0B 1Y59T 5A2MH 4MPUA 5A0BA 2R2WU 3RU4E 4NFEA 2GKVE 2M2AA 1C1NA 2AHME 3MMGA 4JK5A 5BRRE 2XBWA 1S0QA 2C8YB 2G4TA 1GHWH 1DE7H 2Q6DA 1P8VC 3VB5A 1QY6A 1K0HA 3O8DA 2QF0A 1P01A 4A1VA 1FY1A 1UTPA 3U1JB 2ODQA 2Y5FA 1GVZA 3GS9A 3PV4A 1MQ5A 3QWCH 3RMMH 4O9VA 2BVSH 4B74A 5C3NA 1UO6A 2PSYA 5L30H 1L0ZA 3BF6H 1GVKB 1IQLA 2BM2A 3T26A 3QZQA 4ABJA 1HAOH 2YMSB 4R0IA 4YO9A 2WHXA 1H4WA 2FWWA 4X8VH 2BLQA 1AHTH 1GL0E 4CRBA 1KDQB 1DWEH 4YLQH 3OEHD 2F9PA 5EOKA 3RLYH 2H6MA 4MPVA 4AGKA 2J95A 4AC9A 3U98H 3MNCA 2FDAA 1RGQA 2V6NA 3QDZB 1SKYE 3E8LA 1UVUH 1O34A 1KXDA 1HIAB 2Y80A 4BOHA 3SUEA 3VB4A 3RXGA 1BBRE 3KQEA 1OHHD 4TYDA 1LCYA 1TMTH 3BEUA 2LPRA 2XNDD 1C5ZB 4D9QA 4WVPE 5EJ1A 1C2EA 1NPMA 2SGDE 1V2ST 1YCPM 1V2LT 3MH4A 3HK3B 2D8WA 1UTKA 1AUJA 1GI7B 2FYQA 4AFSA 2QXIA 2FXRA 2STAE 3G01A 3UAIC 2W3IA 1BTUA 5FXLA 2XC5A 2BLWA 3MU4A 2P59A 1C2GA 5T6GA 1W3CA 1A0LA 4KTCA 1O5BB 1KMHB 3QTOH 3PMHB 1MBQA 3U28C 3UWIA 2THFB 3M3VA 1VJ9U 1H8ED 1BJUA 1EP6A 2P3UB 1A61H 2PTNA 2SFAA 3PRDA 2F9UA 1BMFD 4NA7A 4XD7D 1NRQH 2ZDVH 2Y5GA 4ZROA 1BITA 2VGCC 4I31A 1N8OB 1K1NA 1FN8A 4BAHB 1TALA 3UNSA 3T5FH 3WY8A 4DIHH 1MCVA 2PP6A 1QB1A 3RP2A 2TGPZ 3ENSB 1OP0A 3SU3A 4IMZA 1EB1H 2SGPE 5A8ZA 3RXTA 2P3FH 1UTNA 1P06A 1SOTA 2WV4A 1TGSZ 1AIXH 3RUOA 3PMBB 1VGCC 1GBBA 2JJ1D 3M5OA 1AFQB 3M7UA 1H1BA 3N7EA 5LPRA 2JETC 4D76A 4ABIA 4WXIA 1XM1A 2A4RA 1E36B 1P2KA 1WUNH 1KXEA 3ZV8A 3F3BA 3SUFA 2ZQ2A 5JB8S 1O3FA 3FP7E 1O3BA 1O2WA 1ZMJA 3B8JA 3SW2B 1F0UA 1DUAA 1MU8B 3A7WA 2J4IA 1SHYA 5EQQA 1CA0B 1SGFG 5HGGA 4YT6H 2WV9A 5A0CA 4GUXA 1VCWA 5K0HA 3UY9A 2A4GA 1DSUA 2HRVA 2F3CE 4ABDA 8ESTE 1C5NH 1O35A 4HFPB 4XBBA 1A3BH 2ZFSA 2ANYA 4ZHLU 2XCNA 1YPKH 1EJNA 5ETXA 4FUCA 1P0SH 1GL1A 3M5MA 3TK5A 1PPBH 1D3TB 2ALPA 2TGAA 1HAPH 2DE8A 2KAIB 4NIWA 3M37A 2ZEBA 2GP9B 2YNBA 1SQTA 1WDIA 1W7XH 4K69A 1MBMA 1JMOH 4B73A 2FMJA 3A7YA 1CSOE 2ASUB 5JYIA 2ZHFH 5DPAA 1DY8A 1FJSA 1BRAA 3P70B 3K9XB 1O3IA 1QBNA 4MNVA 4DOQA 1HFDA 3PRBA 1V2KT 1V2RT 4AG2A 2GCHF 2AYWA 2ZP0H 1G37A 2AMQA 2ZHEH 1O3EA 2CHAC 4WMEA 2PR3A 2AIPA 1BMAA 2EC9H 1BBRK 1CO7E 3RU4D 2P94A 1O2GH 3E0NB 2GVFA 2SGFE 1GJ7B 4X8SH 1ESAA 4AG1A 4SGAE 1G32B 2ZHDA 2ZNKH 3PB1E 1TFXA 4MPXA 3UWJH 1NESE 1KXAA 3SU1A 1J15A 1ORFA 3M36A 3SO3A 3DFJA 2PGBB 3LPRA 1F7ZA 1HXEH 2CGAA 3SNDA 2QGRA 2P8OC 1C5QA 3TH2H 3DD2H 3A88A 1HCGA 3P6ZB 2BD9A 1C1WH 2F9OA 1GI8B 1W0JD 1K28D 1PPCE 3QTVH 1SGYE 1O0DH 2O8UA 3S0NA 3KNXA 4K1TA 2FPZA 4CREA 3RMNH 3ATIA 4X8TH 1LVOA 3AAUA 2ZWLH 5GPIB 4JZIA 3WW7A 4JZ1A 4HI3A 1DITH 1A5IA 3NCLA 2V0BA 2PSXA 1OKXA 3SBKA 2ZKSA 1NRSH 2Z9KA 2JH6D 1OP8A 9ESTA 2F83A 1BB0B 1KXBA 4BTUB 1YYY1 6ESTA 4X8UH 1J17T 1LHCH 2VVUA 1BRUP 5DGJA 1XUJA 4NSVA 1AMHA 1MKWH 1S84A 2C8ZB 1CQQA 4I8KA 3MU0A 1VITF 1O5GH 3V13A 3K65B 3SOSA 2AIQA 4A5TS 1XKBC 1NU9A 5C94A 1SLXB 3W94A 5J4SA 4XBCA 4D7GA 3PV2A 1LPKB 5F8XA 4A92A 4RKOB 1V2TT 4OS4A 2RFKC 1OX1A 2ZGXH 3SZNA 3E90B 1O2ZA 1LQEA 3SYJA 1W12U 2JETB 3D65E 4NFFA 2VVVA 2FLRH 4PROA 3SU6A 2R0LA 2V3HH 2FS8A 4NG9H 4X2YA 1EATA 1QBOA 1WSSH 3ZVEA 3RXAA 1V2QT 2VJ1A 4DT7B 3E3TA 1TRNA 4X1NU 1GBJA 1UTLM 3VGCC 1DANH 1O2NA 3RXCA 3P95A 1CHOF 3V3MA 2CF8H 4WMFA 3VB7A 1LQDB 3LOXA 3TNTA 5H4IB 3OTJE 4GAWA 1FPHH 3V12A 4ZMAH 3LGTA 4KP0A 1N1LA 6GCHG 2PLXA 3E6PH 2ZPRA 1Z1IA 1P9SA 5EXMA 1LHFH 1O30A 1P09A 3F2FA 2GZ7A 4YT7H 2HGTH 3UNQA 1H9HE 1PPFE 3DA9B 1P10A 1KLJH 2BDIA 2ULLA 5FBEA 1GJ5H 1O2YA 3KQBA 2VIOA 1NT1A 1SSXA 3A8AA 3GICB 3SV9A 3BV9B 1EFRD 3LU9B 2ZIQH 3RXPA 5KEDA 1DICA 3VXFH 4Q7XA 1HAVB 2ZA5A 2AMPA 3SJKA 1GI2A 1ZHMA 1H9LB 3ZZ4A 2CXVA 2Y5HA 4BAQB 5DK1A 2XNIA 2W7SA 2SGEE 1O2RA 1O2QA 2JH5D 2RA0A 1FAXA 1QZ8A 3C1KA 2HVYB 5DKMA 2NU0E 3AASA 1V2VT 2GX4A 1ZSKA 4K3JA 1C5LH 2W7UA 1BT7A 2OP9A 1QL7A 3K6ZA 8GCHG 2WPLS 1SGPE 2OQ5A 3TITA 1TPPA 1V2WT 1PYTD 3H5CB 1SMFE 1W10U 5FX5A 1EJAA 3SU4A 5HYOA 4JMYA 4CRGA 3R3GB 5K7RA 2BDYA 4H6TA 4I8GA 3ATMA 1QR3E 2J98B 1T4VH 2G51A 1AKSB 2A32A 1Y3XA 2W6JD 1MKXK 2WSSD 1SGDE 4O3UA 1CE5A 4XFQA 1O3GA 1FY3A 1UK3A 2WPKS 3MU8A 1Y3UA 1QRZA 1ZJDA 2BTCE 4X2WA 1V3XA 1CBWC 4ZXYH 4DW2U 2R3UA 5E2OA 4FU7A 3DCLA 2EI7A 1IQJA 1GBHA 4AB8A 5IK2D 4O03A 3A87A 3VB3A 3KHVA 3PLBA 5FCRA 4ESTE 5E0JA 1HLTH 2A4OA 1X7AC 2FOMB 3F9HA 4TY6A 5EODA 3ZZ8A 1FUJA 1PPGE 1GMCG 3MHWU 1SQRA 1GMDF 1GHVH 1WXRA 4TWYA 3T62A 3N99A 3GCTG 1PQ7A 4Y7BA 1ZMLA 2BD7A 2QF5A 2AERH 4JZFH 1HPGA 3ZZ6A 1C5XB 1KIGH 2FESH 3SI3H 2G55A 1JRTA 1ETRH 5DG6A 3QZRA 2RG3A 1XMNB 2OBQA 4XDEA 4IN1A 1RRKA 4ZKSU 3S7KB 4FUFA 1DX5M 1GBLA 1KXCA 3TJVA 3W95A 1XX9A 2WUBA 3RXMA 4DURA 1VCQA 2HALA 1T7CA 1HGTH 4JYTA 2J38A 3PWCA 5AVDA 3TLOA 1HAXB 1EAIA 1J8AA 1A1RA 2GMTB 1O3LA 1IQHA 1V2UT 3BSQA 3DUXH 3A82A 1TX7A 2ZFFH 4UE7H 1GI5A 2M5TA 1P03A 5EJZA 1K1MA 2CN0H 1YPJH 3TJUA 2XBYA 4Y8YA 1VJAU 5FX6A 4K1EA 2F43B 5EXLA 1SR5C 5JBAS 1F5RA 2A1DB 2O9QA 1D4PB 4XSKU 2OLGA 3KN2A 1QJ6B 1E79D 3KQDA 1O33A 3VFEA 1TIOA 1Y5AT 2EI8A 1BA8B 3U9AH 2AFQB 2Y7ZA 5A09A 5E0GA 2KX4A 2FOBA 4NWLA 1VZQH 2AMDA 2ZECA 2ZGBH 1HYLA 3MTYA 1W0YH 1O2VA 2IPQX 1UVPA 1YPEH 1Z6EA 3S9BA 1MH0A 1SGQE 3BG8A 1BCUH 1ESTA 1ACBE 1NZQH 1A5HA 2D26C 2J9NA 2OD3B 3SHAH 1DXPA 3ZVFA 2XXLA 1NU7B 2GCTB 4ZXXH 3BTDE 3H7TA 3FFGA 1GI6A 1Q31A 1WTHD 1Z6JH 1D9IA 2BQWB 2WPDD 4M7GA 1SI5H 2F9NA 1UVSH 2HLDD 1E0FD 3QO6A 3LT3A 4ISNA 1GDQA 1O3MA 2A5AA 3SORA 1CT0E 1SGRE 1ZSLA 1CGIE 3M5LA 4BAOB 3KL6A 1PYTC 1SFIA 4MNXA 1RTLA 4ACAA 1KSNA 2GT8A 2BY5X 1BMMH 1G3CA 3F0PA 3KGPA 1KXFA 1MTNB 2BY8X 3A89A 4OS2A 3HGPA 2CMYA 4DGJA 1P2OA 3K2UA 5F53A 1SL3A 2A7JA 3E1XB 1UTOA 3QLPH 1OWIA 5A8XA 1LO6A 2JJ2D 1GI9B 4X2VA 1F0TA 1C5WB 4FVBA 5EGMA 3MO9A 4DT4A 2ZQ1A 1CT2E 2Y81A 5KECA 2WYGA 2NU4E 1UHBA 4K2YA 1EP5A 2QF4A 2QN5T 3TH3H 1O5FH 2G8TA 2ZGCA 5ESBA 1C1UH 4A7IB 5FAHA 1W14U 3DFLA 1SGCA 2AGEX 3BG4C 1QJ1B 1DOJA 1XXDA 3EGKH 2ZDMA 1Y8TA 3VG8A 1K1PA 1EZSC 1MZDA 4ZKNU 1W7GH 3LGUA 5PTPA 2P16A 1VKYA 3KCGH 5GCHG 2UUYA 3LGVA 3NPSA 3SJOA 1TBZH 4IC6A 4Y0YE 4AYYB 4INKA 1W0KD 2Q6FA 2JDID 1CBWB 1FMGA 1E1RD 1YLNA 4CH2B 1AE8H 1LTOA 1S6FA 1ELCA 1HAHH 1PQ8A 5AFYH 3GCNA 4ABAA 4YOGA 3KQ5A 3W1EA 3SJ8A 1C9TA 1GJBB 1EB2A 1O3CA 1RIWB 1G2MA 1TNIA 2FP7B 1TNHA 2WPIS 2ZDKA 3BEIB 1IHSH 3A86A 1Y3VA 3MNXA 3TIUA 1IQFA 3OU0A 4GSOA 3MO6A 3MWIU 3V7TA 1LMWB 2SGQE 2NU3E 1BTZA 1UTQA 2VWOA 2QC2A 1RTFB 5EXNA 4VGCB 1ANDA 3SGAE 1THSH 4TPIZ 1C5OH 1KY9A 5SGAE 1W2KH 1SG8B 3TH4H 4H6SB 1BBRH 1NS3A 2A4QA 1SHHB 2ZGHA 1GJ6A 4F49A 1YPLH 2WPHS 1C1TA 1A4WH 1OSSA 1T8LA 1MAXA 3ZZDA 1HAGE 5KGOA 1DUEA 2R2MB 2PV9B 1B0FA 5CHAB 3SNCA 2FOHA 1THPB 2ZO3H 1GJ9B 4BAKB 1LHDH 3QGNB 5T6DA 3NZIA 3GYMA 1YPHE 1GI1A 9LPRA 2BY6X 2WV5A 1TOCB 3SNAA 2CK3D 4ZKRU 1SBWA 1QB6A 2HNTC 3FO8D 1C5PA 3EQ0H 3SUGA 4RN6A 1A0JA 1ELTA 4FUJA 1XUKA 1B5GH 4AGJA 2FX4A 1PPHE 1AI8H 1FY8E 2AGIX 2KR7A 2HVXA 1TOMH 2ESTE 1IQGA 1W11U 5C1YA 3SQEE 3I29A 5EPYA 3T29A 1ELDE 1EAXA 4CHAB 1SLWB 3BEFB 1NROH 1E1QD 1OOKB 1NRPH 3A81A 4FUHA 4B6EA 5HM9A 1P2NA 1ID5H 1QHRB 2NWNA 1THRH 1TWXB 3A7ZA 4AB9A 3F68H 1C2FA 5LH8A 4MPWA 2VU8E 3GYLB 3BTQE 1QA7A 1VR1H 5TJXA 3BIVH 2BB4A 4K5ZA 3FZZA 3ZYEA 2FOEA 3OX7U 2Q6GA 3ODFA 3S7HB 3E0PB 2KCAA 1UTMA 1CGJE 1EUFA 1TABE 2V7QD
chains in the Genus database with same CATH topology
1WQSA 2GV6A 5LPEA 1TA2A 3M35A 4JYVH 3ZZAA 1E35B 1GBDA 4Y8ZA 2BDBA 1C1QA 4E05H 2ZFTA 2ZU3A 1ESBA 1HJAC 1EPTB 3PO1C 4CH8B 1PPEE 2H9EH 4X1RU 3BTME 3BTTE 1KLIH 1EASA 4ISIH 3N7OA 1WBGB 4JZDH 1YPGH 2G00A 1NRRH 1Y5UT 1OWJA 3O8RA 2NU1E 1HJ8A 2FX6A 4B71A 1AN1E 5JBTA 3SUDA 1BRCE 4CBOA 2XBXA 2ZDAH 1A5GH 1MCTA 1GHYH 2OTVA 3TJOA 4NA9H 1JWTA 5C2ZA 2WPMS 4JK6A 4YOIA 1GBIA 1D6RA 3CS7A 4OS1A 1FQ3A 2ZG0H 3ZZBA 3A8DA 3RC4A 2ZFQH 4I33A 2A2QH 6CHAC 4AFUA 1IQIA 3ZV9A 1FIZA 1Q3XA 3S9AA 3SJIA 4Z6AH 2PKSC 3SU5A 5DO4H 4AYVB 1QTFA 3Q00A 2BVRH 4YTAA 3E16B 3GY3A 2PUXB 1Z71A 1ELVA 2SNWA 3A85A 3RU4T 1GHBG 1JBUH 2GT7A 1YLDA 4BXWA 3SV8A 2ANWA 4WH6A 2OINA 2J94A 5DP3A 4LZ1H 2FI3E 2PW8H 2ZCHP 2WINI 1C2JA 1FONA 2G5NA 2QF3A 2H9TH 4IN2A 4IS5A 4YESB 1PFXC 1QURH 1MAYA 1WYKA 1JIRA 5GWZA 1CA8B 1TE0A 5DP6A 1MKXH 4A6LA 5GCHF 1L2EA 2Z9LA 1GCDA 4MVNA 1QL8A 1C9PA 4WH8A 1J9CH 1IQEA 2WYJA 3VEQB 4UD9H 1KYNA 1ZSJA 3MH5A 2BOKA 1B7XB 1TPAE 3RXIA 2VB0A 3MU5A 4IC5A 1O2HA 4BTIB 1PJPA 1XXFA 1C5TA 1WTGH 4NSYA 2JKHA 2BZAA 2H5DA 4CR9A 3ATWA 2FTLE 2P95A 1T4UH 3KEEA 4MDSA 4F4OC 1HAYB 2C8XB 2OC0A 1ZPZA 2PKAB 3RXUA 1QL9A 2FO9A 1V2MT 2J92A 4U32A 1OWEA 1OWHA 1SFQB 1ZR0A 2BX4A 2ZFPH 4X6NA 3U1IB 2ILNA 1SQAA 1BTPA 1UVTH 2A5IA 3EE0B 3UOUA 3P92A 1QRWA 1BRBE 3P8FA 2VGCB 1AU8A 3UUZA 5G4BA 1OYTH 3ATLA 4ZAEA 2B5TB 4AN7A 2VNTA 4BXSA 3UREA 1TMBH 1AWHB 1PQ5A 3SV6A 5EU8A 4B76A 3SU0A 1BQYA 4K8BA 1V6DA 1VGCB 4AORA 1N6XA 2O8MA 1L1NA 1MU6B 2XC0A 1EQ9A 1K21H 2ZPQA 4FVDA 1RXPA 3MH7A 1WCZA 4X1SU 3Q77A 4UFFH 3GISB 1DFPA 1FLEE 1XUHA 3ZVAA 1T8OA 1K1LA 4WF8A 1C5MD 2ZTXA 1EAWA 3PO1B 4AOQA 1L1JA 1K1OA 3UNRA 1O31A 1O2TA 5FBIA 1O2UA 2C93B 1FXYA 3RXOA 1AD8H 4ABHA 1XVMA 1L4DA 1GJAB 3GCHC 3BN9A 1O3NA 1QFKH 2CV3A 2NU2E 1FAKH 4Z0KA 1C5VA 1ZZZA 3E91A 5DP5A 3PMAB 1KDQA 1BMNH 1OP2A 2J34A 2OC8A 1EX3A 1NO9H 4Q2KA 3FZDA 1TNJA 2UUFB 2D2DA 1ANCA 4MNWA 1LVYA 4B2BA 1SLVB 2C90B 3BIUH 1WAYB 1Z7KA 2AEIH 4ISOA 3RXRA 3A7TA 1O2KA 1HIAA 4AX9H 3F1SB 5CE1A 1TBRH 1K1IA 2B8OH 2A7HA 2Z94A 2HLCA 3LJOA 3M7TA 2BD5A 1O2PA 1GCTC 2PKSB 1JIMA 1K22H 1D6WA 3HATH 1HNEE 2WUCA 1Y3WA 3VB6A 1XKAC 1A0HB 1ABJH 2UUKB 2ANKH 4UEHH 3ZVBA 3TK9A 4DCDA 1ZMNA 1GBFA 2CF9H 3ZZ9A 2BX3A 4ISLA 2ZU1A 4NIYA 2AS9A 3A84A 2OC7A 1CT4E 2CHAB 1TNKA 2A45B 1O5EH 3LGWA 3MFJA 4WMDA 4TPYA 1AE5A 2A0QB 1B0EA 1OXGA 1Y3YA 4R8TB 2QXGA 5F8ZA 1NRNH 1LKBA 2XCFA 1EKBB 4X6PA 4ABBA 1TA6A 1SLUB 4FUBA 3A7XA 4WXVA 1F0SA 2ZC9H 4GHQA 1ZRKA 4K1SA 2P8OB 2BLVA 1O32A 3BTGE 3MOCA 4QT8C 3RXLA 6LPRA 1UJ1A 4CR5A 1TYNA 1E37B 2UWOA 5AF9H 1G36A 5EQRA 4YZUA 7GCHG 4E7NA 1GBCA 4Q7ZA 3Q76A 2PFEA 2VINA 1GMHG 5BPEA 4I8HA 1CHGA 2FOAA 1ZPCA 4RSPA 4IW4E 1NN6A 4FXGH 2R3YA 3FVFB 1Q2WA 1O5DH 5GJ4B 3GY2A 1GDUA 2Z3EA 3RC6A 1O37A 3LH3A 1EPTA 3C27B 5JBBS 5C5OA 1HBTH 1O3OA 3NXPA 1RD3B 4A1TA 1D3DB 2OC1A 4CRAA 4I32A 4Y71A 1V2OT 1QBVH 5L2ZH 2PHBA 3RXVA 1NFUA 1O2IA 4GHTA 5L6NH 2FEQH 3T28A 1G9IE 2TGDA 2XC4A 4YOJA 3UQOA 3LC5A 2BY9X 1TNLA 1QQUA 4Q80A 7KMEH 1AZ8A 2D1JA 3P8OA 1BTYA 1LVMA 1NY22 4THNH 2H1UA 2KAIA 3CP7A 1ZTJA 5T3HA 1O2LA 3RC5A 1GBKA 1T31A 1TLDA 3NWUA 5GXPA 1LKAA 3EA8A 3L3TA 4XBDA 3SGQE 2ZHQH 2FTMA 2W3KA 2C3SA 5T6FA 3VGCB 5ABWA 1MZAA 2B7DH 3RXHA 1SOZA 2V35A 5CMXH 1L4ZA 1S0RA 3TU7H 3NKKA 3SGBE 1MTVA 3A7VA 5EPNA 1YF4A 3ZVGA 1P2JA 1UVOA 2BD3A 1TAWA 1IQKA 1MTWA 3PTNA 2GTBA 2C8WB 1UCYH 3T27A 1SGTA 4NCYA 3F9FA 2XTTB 5IYTA 1DWDH 4UFDH 1C2HA 4NA8A 1ELFA 3GDVA 5JB9S 1UCYE 4K8YA 2ODYB 3KQCA 1GBAA 1QA0A 1LPGB 5A0AE 2XBVA 2BHGA 2VIDA 3B9FH 1FDPA 1GCTB 1P04A 2IPHA 2VH0A 1O39A 1HAIH 4ABGA 1BUIA 3UQVA 1TPOA 4WJG2 2GDDA 1EJMA 1GBEA 1GHAG 1TGNA 1P02A 1N8OC 4KELA 1O38A 1AFEH 3OSYA 1O2OA 1G3BA 1MTSA 1U6QA 1YC0A 4Y10E 1OWKA 1C4U2 1ELBA 1P9UA 3MNBA 2XWAA 1ZHPA 1QJ7B 2I6QA 1OS8A 2BZ6H 3JZ2B 1A3EH 2TPIZ 2P93A 2ZHWH 4B2AA 1ELEE 5EQSA 1AFQC 3ZZ5A 5DP7A 4FUDA 2ZCKP 3LDXH 1QGFA 2J2UA 1P2QA 1BMLA 2BXTH 1INCA 2QCYA 1EZQA 5FPTA 1A7SA 5DP4A 1D3QB 2GCHG 2F9VA 6GCHF 7LPRA 4KTUA 2QYIA 1C5YB 3CS0A 2Y82A 3DHKH 2QV1A 1BOQA 3RMLH 1DLKB 1TQ7B 4DJZB 4FUGA 3M61U 3URDA 1LHEH 1C1OA 1GGDC 3VXEH 5EW2H 1UK4A 3LGIA 3EYDA 4ASHA 3RXEA 2BMGB 3EA9A 3MU1A 3O8BA 4LK4A 5LPFA 1TPSA 1SB1H 1TRMA 5HXFA 3K6YA 3VPKA 4X6OA 3SHCH 3URCA 3I78A 1C1SA 1O2JA 1YLCA 3OY6U 1C1PA 4FU9A 4IMQA 3ESTA 3RXFA 3BTFE 3NUMA 4ZKOU 1AWFH 2FOFA 3RDZA 8GCHF 3U8OH 3MO3A 2ZTYA 2ZDNA 3RM2H 3RXDA 1HAZB 1DT2A 4AZ2B 4DG4A 1MTUA 2VWLA 2BDGA 2B0FA 4XOJA 4DIIH 2O8TA 3A80A 5E0HA 3PMJA 4NIXA 3M5NA 1V2JT 1ZGVA 1TX8A 1T8MA 4TWWA 1VITG 1Z8RA 2W26A 1TQ0B 3MYWA 1YKTA 7GCHF 1TBQH 5C1UA 4MG3A 1HAVA 2ALVA 1CGHA 1V2PT 1GMHF 4H4FA 4X6MA 4B75A 2GZ8A 4E7RG 2BQ7B 3STJA 3MNSA 2FI5E 2VIWA 1GBMA 2TIOA 1S5SA 1SGFA 1ANBA 1O2MA 1GMCF 4GCHG 1G3DA 1GI0A 1ZGIA 2SGAA 4OS5A 5JBCS 1YPMH 2ZCLP 3HGNA 1QCPA 1UCYK 2ZTZA 8KME2 3UOPA 2HPPH 2SNVA 4SGBE 1O3KA 1NTPA 5JPMH 3GCTF 2HPQH 2GD4B 3AVZA 1GBTA 3UIRA 1SGIB 1CHOG 4BANB 4Q7YA 1ZTLA 3U69H 1AY6H 1CU1A 2JH0D 2VIQA 1AKSA 1KTSB 3LGYA 4BAMB 1UMAH 1RS0A 5F8TA 1HJ9A 3QK1A 3R0FA 2BD8A 1H8IH 3GCOA 4J1YA 1PQAA 1FY5A 5F03A 3SN8A 1C5RA 1WQVH 2PWXA 3BTEE 2B9LA 3Q3XA 4X1QU 4UFGH 1JXPA 2IN2A 3AAVA 3F9GA 3S69A 1F92A 3F9EA 3MH6A 1IOEA 3PTBA 1O3PB 1WU1A 4OS6A 4BTTB 1EZUC 1Y5BT 1YP9A 1O2SA 2BY7X 3BG4B 5FPSA 3O8CA 1C4V2 4NZLA 2STBE 3U8RH 4FUEA 1F0RA 4AFQA 4I8LA 1AUTC 3GY4A 2BOHB 3EDXB 3I77A 2QXJA 1LDTT 5TCCA 5I46H 1GGDB 5DP9A 2YOLA 1C4Y2 1MUEB 2FYRA 4INHA 2BDCA 1TB6H 4JZEH 1EXFA 3IITA 1GG6C 4ZHAA 3GY8A 3T2NA 3EAJA 2DE9A 1K9OE 1SGNE 2Z9JA 3SU2A 2ZZUH 4Y79A 1O36A 3RLWH 1YCPH 2Z9IA 3P8NA 1GHAF 2FIRH 1TGTA 3AW0A 3LH1A 2QIQA 3LC3A 2Z3CA 1ARBA 1GDNA 2OCVB 2QXHA 1G3EA 3M3SA 1ARCA 3RM0H 1BJVA 4MNYA 2C4FH 1Z8GA 2VWNA 2EEKA 2GDEH 3ITIA 2PUQH 5TCAA 1FZZA 2BDHA 1RFNA 1J14A 2IJOB 2GGVB 3TGJE 1GVLA 2BD2A 2VWMA 5C20A 4FUIA 3D23A 4YLUA 1T32A 3FP6E 1GMDG 3PWBA 5J4QA 1A46H 3HK6B 1O3JA 1EOJA 2O8WA 1BTXA 2VIPA 3UPEA 3EA7A 4Y8XA 3ODDA 1YBWA 2ODPA 1XUGA 3QGJA 4NIVA 5E2PA 3T25A 3LIWA 5AHGH 1ANEA 2WPJS 3CENA 4O3TA 4DVAU 1TNGA 2OBOA 2R0KA 1HUTH 1S83A 2A7CA 3QUMP 1P57B 1SQOA 1WOFA 4MTBA 4U2WA 2Z7FE 3STIA 3ZYDA 1SC8U 1NM6A 2G81E 1AVGH 3IWMA 1FNIA 5E8EH 5GDSH 4LZ4B 1C2LA 1TGCA 3HKIB 8LPRA 1LVBA 1GHZA 2HNTF 3ATKA 3D62A 1ETTH 1G2LA 4E06H 1GI4A 1EOLA 3QX5H 4MLFB 4CBNA 1RTKA 4HTCH 3ZZ7A 1OPHB 1ZHRA 1VCPA 1E38B 2TRMA 2UWLA 4KKDA 3LJJA 5FPYA 2I6SA 1C1MA 3TGIE 1S81A 3GY5A 4K60A 4U30A 2HOBA 1W8BH 3LONA 4DY7B 4BNRA 5GIBA 1O5AB 3GDSA 1XVOA 1MQ6A 2GV7A 1UHBB 1W0ZU 5A8YA 2IOTA 1QQ4A 3V0XA 3AW1A 3NK8A 4HGCA 1ELGA 2F91A 3SQHE 3L33A 1ZPBA 2HNTE 1AO5A 2BD4A 1ZYOA 4B1TA 5C67A 1FV9A 4HZHA 3KF2A 1F5LA 1O3HA 2Y6TA 2H2ZA 3BTKE 3ZZCA 4INLA 1HJAB 3P17H 4TY7A 1KLTA 1DWBH 1GJDB 7ESTE 1C5SA 2GMTC 2P3TB 5LGOA 4J2YB 2ANMH 2OUAA 2UWPA 1VITH 1DM4B 1P3EA 4GCHF 2TBSA 2XWBI 5JDUB 4ZH8A 4AFZA 1BDAA 3SI4H 3RXKA 1DPOA 1P2IA 1OYQA 2UUJB 5DP8A 1P11E 4GLYA 1O2XA 5C1XA 4OGXA 2XW9A 3Q3YA 1BTHH 6CHAB 5I25A 1S85A 1AVXA 2H5CA 1C2MA 2YNAA 1Z8IB 3QN7A 2ZU2A 4WWYA 4Y11E 1T8NA 1GG6B 3A8BA 3UTUH 1UTJA 1DWCH 1C2DA 5EG4A 4GVUA 1YCPK 2ZU5A 3PROA 4LOYH 4X0WU 5EW1H 2GCTC 1AQ7A 2OXSA 1GWAA 4FU8A 4H42U 2BYAX 2K1QA 1QNJA 1C2IA 3Q3KA 1DSTA 3OYPA 1DS2E 4IBLH 1XUIA 1C1VH 5C5NA 4NGAH 1E34B 1AZZA 1P2MA 1MD8A 1C1RA 5B6OA 1YM0A 1DY9A 2FM2A 3RMOH 2VVCA 1IHTH 1A2CH 2DUCA 1BIOA 4XE4A 1XUFA 1EZXC 2XYAA 3H7OA 1DXWA 1FN6A 1FPCH 1MTNC 2QY0B 2RA3A 3SNBA 2RDLA 1GHXH 1RJXB 5HMAA 3MI4A 2Y7XA 3UR6A 4B2CA 2ZF0H 5DJ7A 2FZZA 3GY7A 4KGAA 3TNSA 1TMUH 3ZVCA 1ABIH 3IG6B 2EA3A 3BTWE 3GDUA 1ETSH 2Z3DA 1HB0B 3UFAA 1AB9C 2PGQB 2RCEA 3TJNA 1K2I1 1OWDA 4ABEA 3ELAH 2Z9GA 1IQNA 2A2XH 2ZI2H 3S9CA 1YGCH 3D49H 3JZ1B 1JRSA 3B23B 1FI8A 3OY5U 1QB9A 1GJCB 5HM2A 4UONA 1GHBF 1FIWA 1S82A 4O97A 3SV7A 1DVAH 4MQAA 3RXBA 4CRDA 1S6HA 1NC6A 4JYUH 3DT0H 1C5UA 1UK2A 2R9PA 4RKJB 3SNEA 4YM9A 2VIVA 2ZGJA 2OQUA 1P05A 1Z8JB 1TRYA 2ZU4A 1D3PB 1DDJA 1RIWC 2ZDLA 2W5EA 2PTCE 4Y76A 3LKWA 2BXUH 4JCNA 3KIDU 1YPHC 3ZVDA 4X2XA 1AGJA 3SJ9A 1BZXE 4OGYA 1O3DA 3HKJB 1TGBA 4NWKA 4X1PU 2V3OH 2F9BH