1SQTA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction with the S1beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 58
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqtA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqtA01
1C4Y2 1V2TT 1K1MA 2B5TB 4B71A 1ELVA 3RXEA 5JBBS 4GHTA 1UTNA 1CVWH 2FXRA 2P8OB 5EW2H 2XTTB 1HAOH 1AQ7A 5EU8A 1GJ5H 3GYMA 4K1TA 2QXJA 1DLEA 1ZRKA 1KTSB 1KXFA 1UTKA 2G5VA 4Y0ZE 1LVBA 4ABHA 1O5FH 2BQ6B 4Y8XA 5DG6A 3LDXH 5AVDA 1GI0A 1BIOA 1HPGA 1ZSJA 1DWEH 1HCGA 4MNXA 3GY6A 1DICA 3D62A 7KMEH 1FY5A 3URDA 2JH5D 3EA8A 1MQ5A 3RMLH 5T6FA 1ELAA 1S85A 1TX8A 5HM2A 4CH2B 2FOAA 3H7OA 1KY9A 4Y71A 2A7CA 1O33A 2GX4A 4KTSA 4GVUA 4GPGA 1HAHH 1O5AB 2Q6FA 4E05H 1PQ5A 1HYLA 1FI8A 2ZO3H 2ZPRA 3ZZ9A 4WXIA 1GI3A 3R0FA 1YP9A 1LTOA 1TE0A 4FUIA 4FU9A 1C2LA 3M5OA 4ZMAH 1A5GH 1BMMH 4CRBA 3SV7A 2VNTA 5E8EH 1E37B 4CHAB 1AN1E 3P8NA 5EPYA 3QLPH 2VWMA 3UIRA 3FVFB 2Z9IA 1YPHE 2GP9B 1CA0C 1AY6H 2Y7XA 3NUMA 2XCFA 2Z94A 2SGDE 4FXGH 4YLQH 4R0IA 1V2ST 2W7UA 4CH8B 3QWCH 1H9HE 1W11U 3RU4D 2GGVB 2OC8A 2ZPSA 2FLBH 3TLOA 2C8YB 4H4FA 1MD7A 4K1SA 2IN2A 2XCNA 4GCHF 2NU2E 1ELCA 1SGFG 1GI9B 2J38A 1TGSZ 4X6NA 2OINA 2QN5T 3GDVA 2FZZA 4ZUHA 4A1XA 1MH0A 3ITIA 4K2YA 2ZQ2A 1K9OE 4UE7H 1MKWH 2OBOA 3ODDA 1SGYE 1XVMA 2WPIS 3MU1A 3PLKA 1N6XA 1QHRB 4NG9H 1GBTA 1MTSA 2TPIZ 1O2KA 3MO6A 1C1OA 5FPSA 3LKWA 1MMJN 1ZGVA 2BXTH 4DIHH 1ZYOA 1HRTH 2Z9GA 3GCOA 2BTCE 1C1MA 1KXBA 3OU0A 1TLDA 5CHAB 3TGJE 2WPJS 1S83A 4AFSA 1C1UH 1DITH 3W95A 3A8BA 1MBQA 2OLGA 4JZDH 4X8VH 3UPEA 3SOSA 1EZUC 4XBCA 3MU0A 3QTVH 1C4V2 1Y3XA 4MNVA 2ZF0H 3PTBA 1BBRH 4CRDA 1LHGH 1NESE 1C5VA 1HAPH 2ZKSA 3GY2A 5TJXA 1VCQA 1FXYA 1C2FA 4H6SB 4IGDA 1F7ZA 3V12A 1MAXA 1OP2A 1OSSA 1CBWC 5DPAA 3E8LA 4TPIZ 1Y5BT 1ZHMA 3HGPA 3TJNA 2GV7A 1V2WT 1CSOE 1NC6A 1QL8A 2TGPZ 3L6PA 2BVRH 1GWAA 2ZCHP 4IMQA 1G3BA 1EPTA 5AFYH 5LPFA 4FU8A 2GZ7A 3P8OA 2HWLB 3P6ZB 3TJUA 1TA2A 1O3PB 1Y5AT 1GMDF 3CS0A 4CREA 3PMJA 2P3FH 1TPOA 3TK5A 4BTUB 2VIQA 1ZRBA 4INLA 1C1VH 1D3DB 2BVSH 4U30A 4XBBA 3SGQE 1QA0A 4AN7A 4WMDA 1HJ9A 4NSVA 3RXHA 4CBOA 3BTME 3A7WA 1ARCA 2NU4E 2XC0A 1F0TA 1C2EA 1AKSB 1TA6A 1O36A 4KTCA 1DLKB 1D4PB 3EDXB 4CHAC 3SJ8A 5JPMH 1O2UA 2ZQ1A 1P05A 2XC5A 1HXFH 3P92A 4WVPE 3SV9A 1GMDG 4JK5A 3RLWH 2A31A 1LHFH 3UFAA 2FOEA 1RFNA 4NZLA 1G3CA 2J4IA 1YGCH 1A61H 3RXVA 4ABFA 4WF8A 3SGBE 1DSUA 1UCYE 2OQUA 4XE4A 3UQOA 1DX5M 4BOHA 2Q6DA 4UONA 4DURA 1O2QA 3GISB 3SGAE 2BD2A 2A2XH 3VB3A 4ABIA 5IDKA 3BTEE 5TCCA 1C5WB 2SFAA 2PW8H 3BEFB 1PPCE 2THFB 1QL7A 1EJAA 2ZGHA 2RA3A 1BTZA 5AHGH 1MZDA 1IQKA 2CN0H 3KCGH 1O2SA 4Y76A 1YPJH 3IWMA 3RC6A 1GBFA 1A1RA 7ESTE 4NA8A 3S7KB 1NU7B 5EW1H 1C1TA 4I8GA 5FX6A 2P8OC 1QQ4A 4Z6AH 1A0HB 1HIAA 3ATLA 2ZTZA 1AWFH 4UFGH 5IYTA 1HJAB 4A92A 5ETXA 4ZAEA 1C5ZB 1W12U 3I29A 3SJKA 3DHKH 4LOYH 3TGIE 2Z6BD 1GL0E 1QRXA 1TBQH 1YPEH 3NK8A 1VCPA 2SGAA 1GMHF 4ISHH 1NRPH 1GVLA 1NS3A 4WMFA 5DP5A 1G30B 3S9AA 3RXKA 3O8RA 2BX4A 1KYNA 3PO1B 1EZXC 1GHAG 1V2OT 2H2ZA 3Q3KA 3KHVA 1D6WA 1QB9A 4X8SH 3B8JA 1C1WH 1U6QA 9LPRA 4Y11E 3EA9A 4F4OC 2FYQA 2R2MB 1FMGA 1DPOA 1GVZA 1QQUA 1O3MA 3U8RH 4INKA 3MU4A 1BHXB 4GUXA 1HLTH 2PSYA 1ZTJA 1RTKA 2F3CE 2TIOA 3RC4A 5JBTA 1BZXE 2IPHA 3LU9B 3TNSA 2ZC9H 2F9VA 1QURH 3UOUA 1C2HA 3SO3A 1CHGA 1JRTA 2SNWA 2VIVA 2ANKH 2ZPQA 1QB1A 2KAIA 1HAXB 1VITH 1T8MA 3QK1A 1GHAF 1L1NA 1OYTH 2FEQH 2QAAA 2ZDMA 2D26C 1SG8B 4ISNA 4KP0A 1JOUB 2DE8A 1IHSH 3F6UH 2FDAA 5SGAE 1W0YH 1SGEE 2AYWA 1C1RA 1QBNA 3LPRA 1DSTA 3ZZCA 1H8DH 1O39A 5CHAC 2Y80A 4YTAA 2H1UA 1P9SA 4JZ1A 1C4U2 2KAIB 3BEIB 3F9HA 3SU3A 3LONA 3RMOH 1QB6A 1ZTLA 4ZKNU 2QXHA 4HI3A 1ESAA 1IQFA 3BIVH 3STJA 2PTCE 2ZDKA 1UCYK 3TIUA 3ZZ7A 2ALPA 1P9UA 3U8OH 1GG6B 1WBGB 1T4VH 2AIQA 2FOCA 4X8TH 1GG6C 1MTUA 4THNH 2TGDA 4BAQB 3RC5A 1EJMA 1MU8B 1OXGA 3MNSA 2RCEA 4ZKRU 1AGJA 3TK6A 1NFXA 1XUJA 1UMAH 1THSH 1C5YB 2I6SA 3A82A 1O2PA 2QC2A 2AGEX 1UO6A 1MU6B 2ZIQH 1QTFA 3SHAH 1JXPA 3SORA 8ESTE 1W7XH 5K7RA 2NWNA 2NU0E 5GCHF 1QRZA 1EKBB 1O37A 1SOZA 1W7GH 1TOMH 2GMTB 3JZ1B 4E7RG 1H9LB 1C2MA 4E7NA 4BTTB 1ETSH 4MDSA 3AW0A 2GMTC 1BCUH 1BRAA 4OS2A 1C9TA 1ZMNA 1AHTH 2O8TA 5A2MH 1MD8A 3BTDE 2XWBI 2AMQA 2F91A 2AIPA 1ZPCA 5JYIA 4ABAA 3VGCB 1LQEA 1QGFA 2ASUB 2ZFSA 1P2NA 1YYY1 1GBMA 1Z8JB 2FOFA 1O3BA 3BF6H 2R0KA 4KKDA 1FIZA 1DXWA 2B8OH 1TWXB 2C8ZB 2OC7A 6CHAC 1THRH 2R9PA 1T8OA 1QFKH 1AFQC 1O38A 2Z3DA 1OWHA 3W94A 4Y7BA 1LDTT 3MH4A 2A32A 5FPTA 1C5LH 1V6DA 2FI3E 4FVDA 1HIAB 1DE7H 2J92A 3S9CA 3KIDU 4Q7ZA 2BQ7B 1SGTA 2ZHFH 1NROH 1TMBH 3RU4T 5F6MA 1RGQA 1IOEA 3RXTA 1GI7B 2SGQE 2BLWA 3DFJA 1Y59T 5ESBA 2PUXB 1UTMA 2ZGXH 4OS6A 2O8LA 3A7XA 2BOKA 2CMYA 1QY6A 3FAOA 4RKJB 1O2YA 4TYDA 3EQ0H 1XUFA 4B2BA 3K65B 4GHQA 1P57B 1GL1A 1MBMA 2C8XB 3NKKA 3UR9A 4IN1A 1K1NA 2XNIA 1J14A 3A86A 3A85A 4XBDA 4AB8A 1G32B 3LGIA 1JMOH 2V35A 1L4DA 2YNBA 1MKXH 2XRCA 1P2IA 2FI5E 6CHAB 3MTYA 4LK4A 2UWOA 4B73A 4I8LA 1ELGA 1O5EH 2BQWB 1PJPA 3BTFE 3K2UA 1HJAC 3PO1C 1KXEA 1F5KU 4FUJA 1Y3VA 3RUOA 1BTPA 2D8WA 1O31A 2OP9A 3SU5A 5DJ7A 4ZHMU 3VEQB 3LJOA 2FTMA 1S82A 2HPPH 5G4BA 4NZQA 5FPYA 1F2SE 1UTQA 1O30A 4AX9H 4YT6H 5DGJA 3O8DA 4ZHLU 1PQ8A 1ZHPA 2BYAX 4BAHB 1XUGA 3NXPA 3SJOA 5C1YA 3I77A 4YM9A 1FQ3A 2P93A 3P8FA 3GICB 1TQ0B 3MO3A 4ISIH 2FPZA 1GHBF 5CMXH 4ASHA 1E0FD 8GCHG 1FY1A 3NWUA 3ZZDA 3CP7A 3GY5A 1WQVH 4GCHG 3GDSA 1C5SA 3S69A 4DGJA 1O3KA 2XBYA 3UWJH 3QDZB 3P70B 3S7HB 1LKBA 4RSPA 1O3HA 1C2IA 1Z1JA 4OS4A 2B9LA 3U1JB 1OS8A 1A7SA 3RDZA 1PPGE 4FUCA 2WPKS 2CHAC 4MPUA 1P11E 1UVOA 1QNJA 4SGAE 1GDUA 1V2NT 1AD8H 1QL9A 2ILNA 2WPMS 4O9VA 3M3VA 1TNIA 2QF0A 3QX5H 5PTPA 4X1SU 1GBKA 3BTWE 2F9BH 1W3CA 1YM0A 2ZHEH 2A5AA 1GBIA 2W3IA 4ABEA 1ZMJA 1XX9A 1HXEH 1KLTA 5A0BA 2QF3A 3DD2H 2ZG0H 1EQ9A 4KELA 5T6GA 1AB9C 1WAYB 4ZKOU 2VH0A 3A88A 3MFJA 1O3AA 3PB1E 3S9BA 1NO9H 4NGAH 4O3UA 4X1RU 1O2WA 5ESTE 4K5ZA 3PROA 1ELBA 1BB0B 1QBOA 2GVFA 4IC6A 4YO9A 1LQDB 3VB4A 2AMDA 1ANEA 4UFDH 3HK3B 2FX6A 1K1OA 2ZCLP 4NWKA 1C2GA 1GBLA 2OUAA 1XMNB 1SOTA 3PLPA 4WH8A 1S5SA 1NRRH 3UUZA 3OX7U 5DP7A 4ABBA 1NFYA 1ZTKA 2AEIH 5C3NA 2BDYA 1QBVH 5C2ZA 3BTKE 2YOLA 5DP3A 2ULLA 1C5TA 1V2JT 3PMAB 2VJ1A 1CE5A 2GCTB 2VIWA 2ZEBA 3S0NA 3RXIA 3V7TA 2V3HH 1YPKH 3EGKH 4R8TB 2ALVA 3Q00A 4WY3A 3UNQA 4DW2U 1FY4A 4D7FA 1BJVA 1KLIH 1FY3A 1BHXF 2ZCKP 2FLRH 6LPRA 1PQ7A 2Q6GA 3E0NB 4QT8C 5A0CA 5L2YH 3M7QA 3Q3YA 1Z7KA 1DOJA 1TBZH 3UREA 4IMZA 1KDQA 1WUNH 6GCHG 1B7XB 3ZVBA 2A4OA 1O3OA 2VH6A 2H9EH 2VB0A 1ELFA 2XWAA 1OWDA 2PWXA 3V13A 5EPNA 1TRMA 3TH2H 3AAVA 4MQAA 4F49A 4YESB 1EPTB 1JIMA 2ANMH 1OOKB 4YOGA 1ELDE 1QA7A 1SFIA 3D23A 2XBVA 3GY3A 1VZQH 4MPXA 1MAYA 3LGWA 1CHOF 2PSXA 7GCHG 4DCDA 2QIQA 1TNKA 1ID5H 3OYPA 1O2VA 2ANYA 3SU6A 2P95A 2G52A 1VR1H 1LVMA 2XXLA 1MZAA 2BX3A 2GCTC 1RIWB 1UVSH 3D65E 1UHBA 4D9QA 3PYHA 2ZHDA 1GHZA 1QJ7B 1SHYA 1O3FA 4U32A 1GJAB 1C1NA 1DVAH 3MU8A 4NSYA 4WJG2 1V2LT 3OTJE 3MMGA 1F0SA 4CBNA 2YNAA 1Z6JH 1B0EA 1SLWB 2CV3A 2GDEH 4WXVA 2JKHA 1SC8U 4B74A 2BD3A 2BY9X 2GT8A 3TITA 1GMCF 4AGKA 4B1TA 5EQRA 4JZFH 2RA0A 2IJOB 3GOVB 2G81E 4I8JA 2PFEA 2Y5HA 2C90B 4AG2A 3MU5A 3UNRA 1GHVH 4BAMB 2Y82A 5LPEA 4K8YA 1YC0A 4JYUH 3UWIA 2FI4E 1UTPA 1MQ6A 1DWCH 1A0JA 1AZZA 1Z1IA 4Q80A 2F9UA 4NA7A 3B9FH 2OXSA 3KEEA 1H4WA 2Z9KA 2R3YA 3RXCA 1HB0B 5DP8A 4CRFA 1GHBG 3BG4B 5DP9A 1PPBH 2B7DH 3BTQE 1Y3YA 4K1EA 1CGJE 1X7AC 1AWHB 3MWIU 1V2RT 1BMLA 2DE9A 1RRKA 1V3XA 5L6NH 2Z7FE 1O35A 5F8XA 1L0ZA 3D49H 3U69H 3K6ZA 1EAUA 5A0AE 3SUDA 1VJAU 1FIWA 1AKSA 2R3UA 3LGYA 3DFLA 1ZGIA 1O3EA 1O3JA 1T7CA 4ZROA 4VGCC 1ANDA 4I32A 3HK6B 2BD4A 1BTHH 4X1QU 1TNLA 2VIDA 4MG3A 3HPTB 1O2LA 1WQSA 2P16A 1A46H 4TY7A 4D76A 1AO5A 1CU1A 2V6NA 2GKVE 3SV8A 4UD9H 3B23B 3BTTE 3DA9B 2P59A 1UK2A 4OS5A 3RXJA 5LH8A 1IQGA 3GDUA 1BTXA 1FJSA 2XBXA 1QJ1B 1NFUA 3SUEA 2G5NA 2R2WU 1DFPA 2ODPA 4JK6A 4HZHA 2G55A 1LCYA 1LO6A 3LT3A 1PYTD 1LMWB 3ATKA 3FZZA 1P06A 1THPB 1UCYH 1FN8A 3SQHE 3VFEA 3P8GA 5FXLA 1FDPA 1OWEA 1DY8A 3E90B 1AFQB 1GI4A 1LPGB 4FU7A 2Z9LA 1RTFB 1O2NA 2BXUH 4KTUA 3RMNH 3MNBA 3A80A 1W2KH 3ZVEA 1CBWB 1BTYA 2HPQH 1CT2E 2Y7ZA 3TVJB 1TPSA 1MKWK 3Q77A 3EYDA 1T4UH 4X8UH 1A2CH 1IQLA 2ZDNA 4BNRA 1AI8H 1SB1H 1IQMA 5FCRA 1DS2E 4DOQA 2A4GA 1T32A 1AZ8A 2ZNKH 1L1JA 1NPMA 3GYLB 2WYGA 1P09A 2BD5A 3T27A 1BITA 1J15A 3ZV9A 1P02A 1V2VT 1HV7A 1PFXC 3RXRA 1SFQB 3T2NA 2D2DA 4KGAA 1GJCB 3FFGA 1GHXH 4ABJA 2STBE 1ETRH 1CA8B 1IHTH 3HATH 3QZQA 1C9PA 3SZNA 1F5LA 1TNJA 1L2EA 5A8XA 2FTLE 4ZXYH 3ZZ6A 4CRCA 1TB6H 1LPKB 1FONA 7GCHF 2ZU4A 4DVAU 1Y3UA 2ZU5A 3TH4H 1AU8A 1XUIA 1C5RA 1EZQA 5DP4A 5JDUB 2A7HA 2Y5GA 1J8AA 4I7YH 2GV6A 1RIWC 4LXBH 2W26A 3RXMA 3M3TA 3A7ZA 5AF9H 2SNVA 1Z8IB 2WYJA 5GXPA 1WYKA 3T28A 4ZXXH 3ZVAA 4HGCA 3DT0H 4XDEA 1MTNC 3GCHB 3T25A 8KME2 2ZFPH 1TGBA 3NZIA 2W5EA 4UEHH 1M9UA 4YZUA 1P10A 4H42U 1BRBE 2ZU2A 4CRAA 1G9IE 1CGHA 2TBSA 1G2MA 5DKMA 2G00A 1S0QA 2OC0A 3BV9B 3OY5U 1RD3B 1G3DA 2ZHWH 3RXLA 3UNSA 1B5GH 2BY5X 1UK3A 1NTPA 2WINI 4A1TA 1O32A 2J95A 3N7OA 1CO7E 1YPHC 3BSQA 5C5OA 1V2KT 1MUEB 3SUFA 3LGUA 1KLJH 2PUQH 1XVOA 3BTHE 3RXUA 2GT7A 3SN8A 4JYTA 7LPRA 1C1QA 3ENSB 1GJ8B 3MNCA 3RXBA 2HALA 1A5HA 1P3CA 3A7YA 4NIWA 4YT7H 2PLXA 5E0HA 3PWBA 1Z71A 3A81A 1CQQA 1JRSA 2WV5A 1KSNA 1UTJA 3PMHB 2HVXA 3QTOH 3E0PB 4FUBA 2I6QA 3A89A 1A0LA 1FAXA 1SGCA 4BAOB 2CJIA 2A4QA 3LH3A 2F9NA 1O2TA 2XBWA 4Y79A 1Q2WA 1F0UA 1A5IA 2V3OH 2R0LA 2WUCA 2QA9E 1OYQA 1AE5A 3T5FH 5C1UA 3LGVA 2WV4A 1GHYH 1EASA 2BHGA 3E6PH 3LGTA 3U8TH 5JB9S 4FUFA 1CHOG 1P2OA 3M3SA 2J94A 3SJIA 1FY8E 3VB5A 2Z3CA 2G4TA 1H9IE 1RXPA 1Z8RA 2A5IA 3SV2H 2C8WB 4TPYA 1H8IH 1K2I1 2UUJB 1YCPM 3A7TA 4MNYA 1S84A 1WU1A 4Z0KA 5EQQA 1ZHRA 4O03A 2FIRH 6ESTA 5C20A 1P3EA 1K1IA 1Q31A 2FOMB 4X2WA 1O2MA 3L3TA 4VGCB 4MNWA 1EOJA 4DIIH 3ZZ4A 2BB4A 2HNTF 4RN6A 3OSYA 1O3CA 4HTCH 2SGPE 1D6RA 1XXDA 2FODA 1XUHA 3KL6A 1ESBA 2P94A 2VVVA 1C5MD 1BT7A 1O3DA 4AFUA 1UTOA 1P12E 1J17T 4OGYA 1AE8H 1T31A 3I78A 3Q3XA 3QO6A 1AUTC 5F8ZA 5TCAA 1CA0B 1P04A 1LHCH 1TNHA 1CT0E 1A3BH 1GJDB 4AB9A 1SBWA 4M7GA 1TNGA 2BOHB 4BANB 3M35A 1MTNB 4IC5A 1GI1A 2PKSC 2STAE 4Y8ZA 1T8NA 4I8HA 1O2GH 1BUIA 3TU7H 1Z6EA 1DWDH 2AS9A 2F83A 4X1NU 3IITA 2ODQA 1VCWA 1GBJA 2VWOA 4A6LA 1N8OC 2M5TA 1TX7A 3FP8E 3TJVA 5L30H 3RXOA 4AYVB 1D9IA 1WSSH 2FO9A 1BA8B 1HDTH 5HXFA 1ORFA 3K9XB 1N8OB 5A8YA 2RG3A 1SMFE 1ZJDA 1O5CB 1TYNA 3MI4A 1P01A 2Z9JA 1XXFA 1EP5A 1FLEE 3GY4A 2F9PA 1HBTH 2UWPA 1ZSLA 3DUXH 4TWWA 1LHEH 1TPAE 4A5TS 1NRNH 2BD9A 5C5NA 4Q2KA 3VPKA 3A83A 2VIOA 1P2KA 2TRMA 1L1GA 4IW4E 2AERH 1EAIA 1S6HA 1EOLA 4I31A 4JCNA 1SGRE 1SGDE 3FP6E 1O3GA 5HGGA 1BBRK 2CGAA 1O2JA 2QGRA 4X2XA 3RXDA 1EB1H 1V2PT 4BAKB 3SU2A 1Y8TA 1P2JA 1PPZA 5JBAS 1O3LA 1GI8B 3EAJA 3U98H 1SGIB 2QY0B 3ODFA 3EE0B 5BRRE 1JBUH 1L4ZA 2QXIA 1FAKH 3JZ2B 1EATA 3QGJA 3SNBA 5AFZH 3AASA 4K3JA 1FNIA 3A87A 3F9GA 1PYTC 3IG6B 3UQVA 4A7IB 1FN6A 5JBCS 3URCA 3P95A 1VITG 5J4SA 1G2LA 3CENA 1FPCH 1GJBB 1O3NA 3MYWA 2XYAA 2UUYA 4NIVA 4Y6DA 1LKAA 1SGFA 3GCNA 2FP7B 3ZZ5A 1AIXH 2OD3B 1LVOA 1TABE 2B0FA 3KNXA 2LNCA 5FBEA 1UTLM 1NN6A 3RM0H 1ZR0A 1C5UA 1HAIH 2HGTH 4WWYA 2BLOA 3SNAA 5LGOA 1BQYA 1BJUA 1HJ8A 1OWKA 2BDGA 1HAVB 1OWJA 2BDIA 1GHWH 2C3SA 5GCHG 2FOHA 1P2QA 2IOTA 1O2OA 3T29A 2C4FH 1WV7H 1QR3E 4MLFB 4X6OA 2ZU3A 1GMCG 1SHHB 3U1IB 2JH6D 2RDLA 2BDBA 3ZVCA 5E2PA 3GCTG 5E2OA 4MVNA 2PKAB 1IQNA 3V3MA 1UHBB 3TNTA 1EB2A 4X0WU 1SL3A 1HUTH 1GVKB 1Q3XA 1TOCB 4GAWA 1TGNA 4Y7AA 1V2UT 1BMNH 1SPJA 2PR3A 3ZYEA 1S81A 1EAWA 2PV9B 3H7TA 4CR9A 1W8BH 3PTNA 2FOGA 1G3EA 3LIWA 3RM2H 1AVXA 1W13U 1EJNA 2AMPA 4D9RA 5E0JA 3WY8A 3TJOA 2AFQB 1TQ7B 2BMGB 3BEUA 1MKXK 4NWLA 5LPRA 4FUDA 4INHA 1RTLA 3OY6U 2EC9H 3C1KA 5A09A 1UVTH 3VB6A 2TGAA 1MTVA 1BOQA 1IAUA 1GJ7B 1GBHA 2CHAB 3MH7A 3ELAH 3HGNA 3L33A 2G4UA 1ZPZA 1MCTA 2P3TB 2ESTE 3M37A 2F9OA 3RXSA 5CE1A 1B0FA 1E36B 3VB7A 3SW2B 2WPHS 3M36A 1ESTA 4XFQA 1BBRE 1IQIA 5GJ4B 1HNEE 3SU1A 4IBLH 4ABGA 2O8UA 4K8BA 3KN2A 5EG4A 1NRSH 5HM9A 1TALA 5GDSH 4HFPB 2ZI2H 1WCZA 2FWWA 1C5PA 2PGBB 5EXLA 4DG4A 1Z8GA 3QGNB 2NU1E 1O0DH 3RXFA 2HNTC 1AB9B 1MCVA 2EI6A 4ISLA 2VWLA 2H9TH 1GBBA 4ISOA 2ZGJA 1DUAA 3QN7A 2EA3A 2Y81A 1E35B 1GJ4H 3SI3H 1UJ1A 1NY22 4Q7XA 2WUBA 1ZPBA 4X2YA 3F9FA 4JYVH 1F92A 1P03A 4NIXA 1SVPA 5A8ZA 3GY7A 4GLYA 1F0RA 1AUJA 3SJ9A 3GY8A 3U9AH 2G8TA 2AGIX 2JETC 2A2QH 5HMAA 1BRCE 4K60A 3NPSA 1NRQH 1G37A 5DP6A 5C1XA 2O8MA 4DY7B 1ZSKA 1SGNE 1DUEA 2BM2A 2FS9A 4TWYA 1GI6A 3LH1A 2CF9H 3KQCA 1KDQB 1SGQE 1P0SH 1K1LA 3SUGA 1YF4A 1GCDA 3SU4A 4JMYA 5T6DA 1PPFE 4O97A 1C5XB 3FZDA 3ZYDA 2Y5FA 4ZH8A 1TAWA 1GBEA 2VIPA 3AAUA 3F9EA 3M7TA 1ZJKA 1H1BA 3FP7E 4AFZA 5K0HA 1GBCA 1DT2A 1N1LA 1SGPE 1AVGH 8GCHF 3T26A 1YBWA 2ZA5A 2AGGX 1A3EH 1QRWA 1UK4A 2ZZUH 2VGCB 1FPHH 1C5NH 1D3QB 3NCLA 3TPIZ 2W3KA 4I8KA 1YPMH 1JIRA 3QZRA 4XSKU 4D7GA 4FUGA 3BN9A 1GDQA 1EXFA 1S0RA 1AFEH 5EQSA 1W14U 1DANH 1YPLH 3MHWU 4Y0YE 4MPVA 4IS5A 2LPRA 1TFXA 5DK1A 1O5DH 1SLXB 1N6YA 2ZTYA 1OP0A 5EXMA 1BRUP 4ZHAA 1T8LA 4XOJA 1SQAA 2ZWLH 3M5LA 3ZZBA 1ABJH 2J34A 3ZZ8A 2VVUA 1A4WH 1TGCA 1TPPA 1XUKA 4SGBE 1GMHG 2SGEE 5EGMA 2VVCA 3G01A 1GBDA 1INCA 1ZZZA 2ZDAH 2HRVA 3LJJA 3UTUH 3H5CB 4X1PU 1J16A 1TRNA 2BDCA 4AYYB 2ZGCA 1O3IA 3GCTF 3A8CA 5B6OA 4DT7B 1K1JA 1TMTH 4YOJA 1SQOA 5EOKA 1C2DA 4NFEA 1SQTA 1GJ9B 1VGCB 2OTVA 2CXVA 4FVBA 2PGQB 2FOBA 3M5MA 3M5NA 3RXAA 4AZ2B 2BZAA 3STIA 1GBAA 2H9HA 4Q7YA 3BG8A 2ZGBH 2JH0D 2H5CA 1GI2A 2UWLA 2QCYA 1FV9A 2FMJA 3TH3H 2GDDA 3RLYH 2UUFB 4Y10E 4TY6A 4AGJA 3BIUH 1P8VC 2ZFRH 4E06H 3E1XB 1DY9A 1C2KA 4ABDA 2Q1JA 1LPZB 1NT1A 2D1JA 2A7JA 4BTIB 1YLDA 2ODYB 5FAHA 3CS7A 3BG4C 4K69A 3UR6A 3SNDA 2OCVB 2BD7A 1P2MA 3SBKA 3MO9A 2EI7A 4LZ4B 1MTWA 4AG1A 2PKSB 2O9QA 1JWTA 3UOPA 3A8DA 1HAGE 3RXPA 3PLBA 3PWCA 4FUEA 1GI5A 5FCKA 1GCTC 5L2ZH 1DM4B 2A45B 2ZDLA 3MH6A 2FX4A 1TRYA 1GJ6A 1C1PA 4B2AA 1Y3WA 3P17H 1HAZB 3HKIB 1KXCA 4I33A 3RMMH 1ZMLA 3VXEH 1ETTH 2BY7X 3M61U 3T62A 2ANWA 1W0ZU 1FZZA 1RS0A 3MNXA 1O5BB 2BVXH 5T3HA 3ATMA 4O3TA 2J9NA 2FM2A 4OGXA 4B2CA 3ZVGA 1YCPK 1YLCA 4AFQA 1YKTA 1KXDA 1ANBA 4RKOB 1TIOA 2AH4X 4OS1A 3ZV8A 1O5GH 5J4QA 1NFWA 1QJ6B 1IQJA 1OP8A 4CR5A 4YLUA 2EI8A 4CRGA 4JZIA 5DO4H 2ZTXA 3PM3A 4B75A 1KTTB 2DUCA 4X6MA 3R3GB 3HKJB 1K21H 1RJXB 1ELTA 1EPTC 4UDWH 2CF8H 2XW9A 1XM1A 1W10U 3LOXA 1TGTA 4B76A 5FHTA 3TK9A 1LVYA 3K6YA 1ARBA 2G51A 2FYRA 4FUHA 3PV4A 3SU0A 1YCPH 1J9CH 1KIGH 3UY9A 4H6TA 1OX1A 2ZECA 4U2WA 2V0BA 1TBRH 1PQAA 1CGIE 1DXPA 3E3TA 4NFFA 4Y8YA 2GCHF 2NU3E 2VINA 3TGKE 3RXGA 2JETB 2J2UA 2ZU1A 2ZHQH 3MOCA 3RU4E 2ZDVH 2BLQA 2HOBA 1HFDA 3A84A 2ZFTA 5GPIB 2Y6TA 1GDNA 1SLVB 3ZZAA 5JB8S 1C5QA 3SNCA 1O2IA 4PROA 3LC5A 2VWNA 1QCPA 3BTGE 4NA9H 4UFFH 1CT4E 1OKXA 5I25A 1SLUB 4ZKSU 1SSXA 1NM6A 3VGCC 1DWBH 5F8TA 1QIXB 2OC1A 2PTNA 2C93B 4WH6A 2H6MA 3E91A 2GCHG 2W7SA 3AVZA 2A5KA 1E38B 3SNEA 2ZP0H 5EXNA 1K1PA 1C2JA 3ESTA 4GSOA 1EZSC 1IQHA 2OQ5A 3ATIA 3O8BA 4UFEH 6GCHF 3SI4H 2UUKB 2QYIA 1PPHE 3V0XA 4WMEA 1K22H 1E34B 2PKAA 4X6PA 3AW1A 1EP6A 1EX3A 1GGDB 1OPHB 3SHCH 1SR5C 3ZVDA 3QUMP 2QXGA 1V2QT 2SGFE 2P3UB 1VJ9U 3KQEA 2GD4B 5I46H 4LZ1H 4U01A 1NZQH 3GCHC 2HLCA 1S6FA 4D8NA 2O8WA 9ESTA 1BDAA 1C5OH 2ZFQH 1VITF 3VXFH 4BXSA 1KXAA 1OWIA 2XC4A 1VGCC 1FUJA 1YPGH 1EUFA 1IQEA 1ANCA 1HGTH 1WTHD 4IN2A 2BZ6H 1GPZA 1O2ZA 3EA7A 3SV6A 5C67A 3F1SB 3KF2A 4AOQA 4YOIA 1ABIH 2FS8A 3MH5A 4X2VA 3M7UA 5EODA 1O2RA 2FESH 2ZFFH 5FBIA 1AVWA 5HYOA 1PPEE 5H4IB 4ESTE 1BTWA 1TX6A 1GGDC 1TONA 2GTBA 1D3PB 4J2YB 1UVPA 2BY8X 4BXWA 2BD8A 2Z3EA 4NIYA 1ZOMA 2GZ9A 1D3TB 3FANA 3RXQA 2OBQA 2GZ8A 5GWZA 1AMHA 3PMBB 2A4RA 1ACBE 1O34A 3C27B 1BMAA 2TGTA 1WOFA 3LC3A 4MPWA 1NU9A 1XKBC 1UVUH 4JZEH 3KQDA 2PHBA 3KGPA 3ZVFA 2A0QB 1DDJA 2BDAA 3Q76A 4A1VA 5E0GA 3E16B 5F03A 1G36A 1HAYB 2VU8E 1F5RA 1EAXA 1Y5UT 4DJZB 2VGCC 3SQEE 2A1DB 4AORA 3KQBA 2K1QA 1HAVA 1K28D 1WTGH 1O2XA 3ATWA 3F68H 1TMUH 3A7VA 5BPEA 1LHDH 1O2HA 1SI5H 5GIBA 2H5DA 4MTBA 1XKAC 3ZZ3A 3A8AA 8LPRA 4NCYA 1V2MT 1BTUA 1ZLRA 4OS7A 2BLVA 5ABWA 1ELEE 2BDHA 3RP2A 2QV1A 1GCTB 2WPLS 3O8CA 2BY6X 2EEKA 2HNTE 5FX5A 4J1YA 1C1SA
chains in the Genus database with same CATH superfamily
1C4Y2 1V2TT 1K1MA 2B5TB 4B71A 1ELVA 3RXEA 5JBBS 4GHTA 1UTNA 1CVWH 2FXRA 2P8OB 5EW2H 2XTTB 1HAOH 1AQ7A 5EU8A 1GJ5H 3GYMA 4K1TA 2QXJA 1DLEA 5EJ1A 1ZRKA 1KTSB 1KXFA 1UTKA 2G5VA 4Y0ZE 1LVBA 4ABHA 1O5FH 2BQ6B 4Y8XA 2J97A 5DG6A 3LDXH 5AVDA 1GI0A 1BIOA 1HPGA 1ZSJA 1DWEH 1HCGA 4MNXA 3GY6A 1DICA 5KEDA 3D62A 7KMEH 1FY5A 3URDA 2JH5D 3EA8A 1MQ5A 3RMLH 5T6FA 1ELAA 1S85A 1TX8A 5HM2A 5DSFA 4CH2B 2FOAA 3H7OA 1KY9A 4Y71A 2A7CA 1O33A 2GX4A 4KTSA 4GVUA 4GPGA 1HAHH 1O5AB 2Q6FA 4E05H 1PQ5A 1HYLA 1FI8A 2ZO3H 2ZPRA 3ZZ9A 4Z1MD 4WXIA 1GI3A 3R0FA 1YP9A 1LTOA 1TE0A 4FUIA 4FU9A 3DCLA 1C2LA 3M5OA 4ZMAH 1A5GH 1BMMH 4CRBA 3SV7A 2VNTA 5E8EH 1E37B 1YY3A 4CHAB 1AN1E 3P8NA 5EPYA 3QLPH 2VWMA 3UIRA 3FVFB 2Z9IA 1YPHE 2GP9B 1CA0C 1AY6H 2Y7XA 3NUMA 2XCFA 2Z94A 2SGDE 4FXGH 4YLQH 4R0IA 1V2ST 2W7UA 4CH8B 3QWCH 1H9HE 1W11U 3RU4D 2GGVB 2OC8A 2ZPSA 2FLBH 3TLOA 2C8YB 4H4FA 1MD7A 4K1SA 2IN2A 2XCNA 4GCHF 2NU2E 1ELCA 1SGFG 1GI9B 2J38A 1TGSZ 4X6NA 2OINA 2QN5T 3GDVA 2FZZA 4ZUHA 4A1XA 1MH0A 3ITIA 4K2YA 2ZQ2A 1K9OE 4UE7H 1MKWH 4TT3D 2OBOA 3ODDA 1SGYE 1XVMA 2WPIS 3MU1A 3PLKA 1N6XA 1QHRB 4NG9H 1GBTA 1MTSA 2TPIZ 1O2KA 3MO6A 1C1OA 5FPSA 3LKWA 1MMJN 1ZGVA 2BXTH 4DIHH 1ZYOA 1HRTH 2Z9GA 3GCOA 4P00A 2BTCE 1C1MA 1KXBA 3OU0A 2W6JD 1TLDA 5CHAB 3TGJE 2WPJS 1S83A 4AFSA 1C1UH 1DITH 1S6LA 3W95A 3A8BA 1MBQA 2OLGA 4JZDH 4X8VH 3UPEA 3SOSA 1EZUC 4XBCA 2RFKC 3MU0A 3QTVH 1C4V2 1Y3XA 4MNVA 2ZF0H 3PTBA 1BBRH 4CRDA 1LHGH 1NESE 1C5VA 1HAPH 2ZKSA 3GY2A 5TJXA 1VCQA 1FXYA 1C2FA 4H6SB 4IGDA 1F7ZA 3V12A 1YWUA 1MAXA 1OP2A 1OSSA 1CBWC 5DPAA 3E8LA 4TPIZ 1Y5BT 1ZHMA 3HGPA 3TJNA 3MQKC 2GV7A 1V2WT 1CSOE 1NC6A 1QL8A 2TGPZ 3L6PA 2BVRH 1GWAA 2ZCHP 4IMQA 1G3BA 1EPTA 5AFYH 5LPFA 4FU8A 2GZ7A 3P8OA 2HWLB 3P6ZB 3TJUA 1TA2A 1O3PB 1Y5AT 1GMDF 3CS0A 4CREA 4F48B 3PMJA 2P3FH 1TPOA 3TK5A 4BTUB 2VIQA 1ZRBA 3KYFA 4INLA 1C1VH 1D3DB 2BVSH 4U30A 4XBBA 3SGQE 1QA0A 4AN7A 4WMDA 1HJ9A 4NSVA 3RXHA 4CBOA 3BTME 3A7WA 1ARCA 2NU4E 2XC0A 1F0TA 1C2EA 1AKSB 1TA6A 1O36A 4KTCA 4XD7D 1DLKB 1D4PB 3EDXB 4CHAC 3SJ8A 5JPMH 1O2UA 2ZQ1A 1P05A 2XC5A 1HXFH 3P92A 4WVPE 3SV9A 1GMDG 4JK5A 3RLWH 2A31A 1LHFH 3UFAA 2FOEA 1RFNA 4NZLA 1G3CA 2J4IA 1YGCH 1A61H 3RXVA 3WW7A 4ABFA 4WF8A 3SGBE 1DSUA 1UCYE 2OQUA 4XE4A 3UQOA 1DX5M 4BOHA 2Q6DA 4UONA 4DURA 1O2QA 3GISB 3SGAE 2BD2A 2A2XH 3VB3A 4ABIA 5IDKA 3BTEE 5TCCA 1C5WB 2SFAA 2PW8H 2LELA 3BEFB 1PPCE 2THFB 1QL7A 1EJAA 2ZGHA 2RA3A 1BTZA 5AHGH 1MZDA 1IQKA 2CN0H 3KCGH 1O2SA 4Y76A 5DN6D 1YPJH 3IWMA 3RC6A 1GBFA 1A1RA 7ESTE 4NA8A 3S7KB 2K8IA 2XOKD 1NU7B 5EW1H 4RI0A 1C1TA 4I8GA 5FX6A 2P8OC 1QQ4A 4Z6AH 1A0HB 1HIAA 2OK5A 3ATLA 2ZTZA 5KGOA 1AWFH 4UFGH 5IYTA 1HJAB 4A92A 5ETXA 4ZAEA 1C5ZB 1W12U 3I29A 3SJKA 3DHKH 4LOYH 3TGIE 2Z6BD 1GL0E 1QRXA 1TBQH 1YPEH 3NK8A 1VCPA 2SGAA 1GMHF 2AHME 1NRPH 4ISHH 1GVLA 1NS3A 4WMFA 5DP5A 1G30B 3S9AA 3RXKA 3O8RA 2BX4A 1KYNA 3PO1B 1EZXC 1GHAG 1V2OT 2H2ZA 3Q3KA 3KHVA 1D6WA 1QB9A 4X8SH 3B8JA 1C1WH 1U6QA 9LPRA 4Y11E 3EA9A 4F4OC 2FYQA 2R2MB 1FMGA 1DPOA 1GVZA 1QQUA 1O3MA 3U8RH 4INKA 3MU4A 1BHXB 4GUXA 1HLTH 2PSYA 1ZTJA 1RTKA 2F3CE 2TIOA 3RC4A 5JBTA 1BZXE 2IPHA 3LU9B 3TNSA 2ZC9H 2F9VA 1QURH 3UOUA 1C2HA 3SO3A 1CHGA 1JRTA 2SNWA 2VIVA 2ANKH 2ZPQA 1QB1A 2KAIA 1HAXB 1VITH 1T8MA 3QK1A 1GHAF 1L1NA 1OYTH 3FN8A 2FEQH 2QAAA 2ZDMA 2D26C 1SG8B 4ISNA 4KP0A 1JOUB 2DE8A 1IHSH 3F6UH 2FDAA 5SGAE 1W0YH 1SGEE 2AYWA 1C1RA 1QBNA 3LPRA 1DSTA 3ZZCA 1H8DH 1O39A 5CHAC 2Y80A 4YTAA 2H1UA 1P9SA 4JZ1A 1C4U2 2KAIB 3BEIB 3F9HA 3SU3A 3LONA 3RMOH 1QB6A 1ZTLA 4ZKNU 2QXHA 4HI3A 1ESAA 1IQFA 3BIVH 3STJA 2PTCE 2ZDKA 1UCYK 3TIUA 3ZZ7A 2ALPA 1P9UA 3U8OH 2QF5A 1GG6B 1WBGB 2J5UA 1T4VH 2AIQA 2FOCA 4OM9A 4X8TH 1GG6C 1MTUA 4THNH 2TGDA 4BAQB 3RC5A 1EJMA 1MU8B 1OXGA 3MNSA 2RCEA 4ZKRU 1AGJA 3TK6A 1NFXA 1XUJA 1UMAH 1THSH 1C5YB 2I6SA 3A82A 1O2PA 2QC2A 2AGEX 1UO6A 1MU6B 2ZIQH 1QTFA 3SHAH 1JXPA 3SORA 8ESTE 1W7XH 5K7RA 2NWNA 2NU0E 5GCHF 1QRZA 1EKBB 1O37A 1SOZA 1W7GH 1TOMH 2J98B 1KMHB 2GMTB 3JZ1B 4E7RG 1H9LB 1C2MA 4E7NA 4BTTB 1ETSH 4MDSA 3AW0A 2GMTC 1BCUH 1BRAA 4OS2A 1C9TA 1ZMNA 1AHTH 2O8TA 5A2MH 1MD8A 3BTDE 2XWBI 2AMQA 2F91A 2AIPA 1ZPCA 3F0OA 5JYIA 4ACBA 4ABAA 3VGCB 1LQEA 1QGFA 2ASUB 2ZFSA 1P2NA 1YYY1 1GBMA 1Z8JB 2FOFA 1O3BA 3BF6H 2R0KA 4KKDA 1FIZA 1DXWA 2B8OH 3OEHD 1TWXB 2C8ZB 2OC7A 6CHAC 1THRH 2R9PA 1T8OA 1QFKH 1AFQC 1O38A 2Z3DA 1OWHA 3W94A 4Y7BA 1LDTT 3MH4A 2A32A 5FPTA 1C5LH 1V6DA 2FI3E 1H8HD 4FVDA 1HIAB 1DE7H 2J92A 3S9CA 3KIDU 4Q7ZA 2BQ7B 1SGTA 2ZHFH 1NROH 1TMBH 3RU4T 5F6MA 1RGQA 1IOEA 3RXTA 1GI7B 2KM0A 2SGQE 2BLWA 3DFJA 1Y59T 5ESBA 1QZ8A 5IK2D 5F53A 2PUXB 1UTMA 2ZGXH 4OS6A 2O8LA 3A7XA 2BOKA 2CMYA 1QY6A 3FAOA 4RKJB 1O2YA 4TYDA 3EQ0H 1XUFA 4B2BA 3K65B 4GHQA 1P57B 1GL1A 1MBMA 2C8XB 3NKKA 3PRBA 3UR9A 4IN1A 1K1NA 3F2GA 1J14A 2XNIA 3A86A 3A85A 4XBDA 4AB8A 1G32B 3LGIA 1JMOH 2V35A 1L4DA 2YNBA 1MKXH 2XRCA 1P2IA 2FI5E 6CHAB 3MTYA 4LK4A 2UWOA 4B73A 4I8LA 1ELGA 1O5EH 2BQWB 1PJPA 1WXRA 3BTFE 3K2UA 1HJAC 3PO1C 3AK5A 1KXEA 1F5KU 4ZCNA 4FUJA 1Y3VA 3RUOA 4Q63A 1BTPA 2D8WA 1O31A 3SYJA 2OP9A 5EJZA 3SU5A 5DJ7A 4ZHMU 3VEQB 3LJOA 2FTMA 1S82A 2HPPH 5G4BA 4NZQA 5FPYA 1F2SE 1UTQA 3UAIC 1O30A 4AX9H 4YT6H 2KFWA 5DGJA 3O8DA 4ZHLU 1PQ8A 1ZHPA 2KCYA 2BYAX 4BAHB 1XUGA 3NXPA 3SJOA 1SKYE 5C1YA 3I77A 4YM9A 1FQ3A 2P93A 3P8FA 3GICB 1TQ0B 3MO3A 4ISIH 2FPZA 1GHBF 5CMXH 4ASHA 1E0FD 8GCHG 1FY1A 3NWUA 3ZZDA 3CP7A 3GY5A 1WQVH 4GCHG 3GDSA 1C5SA 3S69A 1YLNA 4DGJA 1O3KA 2XBYA 3UWJH 2YMSD 3QDZB 3P70B 3S7HB 1LKBA 4RSPA 1O3HA 1C2IA 1Z1JA 4OS4A 2B9LA 3U1JB 1OS8A 1A7SA 3RDZA 1PPGE 4FUCA 2WPKS 2CHAC 4MPUA 1P11E 3PRDA 2YMSC 1UVOA 1QNJA 3F2FA 4SGAE 2HLDD 1GDUA 1V2NT 1AD8H 1QL9A 2ILNA 2WPMS 4O9VA 3M3VA 1TNIA 2QF0A 3QX5H 5PTPA 4X1SU 1GBKA 3BTWE 3N7DA 2F9BH 1W3CA 1YM0A 2ZHEH 2A5AA 1GBIA 2W3IA 4ABEA 1ZMJA 1XX9A 1HXEH 1UW7A 1KLTA 5A0BA 2QF3A 3DD2H 2ZG0H 1EQ9A 4KELA 5T6GA 1AB9C 1WAYB 4ZKOU 2VH0A 3A88A 3MFJA 1O3AA 3PB1E 3S9BA 1NO9H 4NGAH 4O3UA 4X1RU 1O2WA 5ESTE 4K5ZA 3PROA 1ELBA 1BB0B 1QBOA 2GVFA 4IC6A 4YO9A 1LQDB 3VB4A 2AMDA 1ANEA 3DSOA 4UFDH 3HK3B 2FX6A 1K1OA 2ZCLP 4NWKA 1C2GA 1GBLA 2OUAA 1XMNB 1SOTA 3PLPA 4WH8A 1S5SA 3ZIAD 1NRRH 3UUZA 3OX7U 5DP7A 4ABBA 2KCPA 1NFYA 1ZTKA 2AEIH 5FL7D 5C3NA 2BDYA 1QBVH 5C2ZA 3BTKE 2YOLA 5DP3A 2ULLA 1C5TA 5HKKD 1V2JT 3PMAB 2VJ1A 1CE5A 2GCTB 2VIWA 2ZEBA 3S0NA 3RXIA 3V7TA 2V3HH 1YPKH 3EGKH 4R8TB 2ALVA 3Q00A 1COWD 4WY3A 3UNQA 4DW2U 1FY4A 4D7FA 1BJVA 1KLIH 1FY3A 1BHXF 2ZCKP 2FLRH 6LPRA 1PQ7A 2Q6GA 3E0NB 4QT8C 5A0CA 5L2YH 3M7QA 3Q3YA 2IPQX 1Z7KA 1DOJA 1TBZH 3UREA 4IMZA 1KDQA 1WUNH 6GCHG 1B7XB 3ZVBA 2A4OA 1O3OA 2VH6A 2H9EH 2VB0A 1ELFA 2XWAA 3UB0A 1OWDA 2PWXA 3V13A 5EPNA 1TRMA 3TH2H 3AAVA 4MQAA 4F49A 4YESB 1EPTB 2L74A 1JIMA 2ANMH 1OOKB 3CNRA 4YOGA 1ELDE 1QA7A 1SFIA 3D23A 2F4LA 2XBVA 3GY3A 1VZQH 4MPXA 1MAYA 3LGWA 1CHOF 2PSXA 7GCHG 4DCDA 2QIQA 1TNKA 1ID5H 3OYPA 1O2VA 2ANYA 3SU6A 2G52A 2P95A 1VR1H 1LVMA 2F43B 2XXLA 1MZAA 2BX3A 2GCTC 1RIWB 1UVSH 3D65E 5B6LA 1UHBA 4D9QA 3PYHA 2ZHDA 1GHZA 1QJ7B 1SHYA 1O3FA 4U32A 1GJAB 1C1NA 1DVAH 3MU8A 4NSYA 4WJG2 1V2LT 2WV9A 3OTJE 3MMGA 1F0SA 4CBNA 2YNAA 1Z6JH 1B0EA 1SLWB 2CV3A 2GDEH 4WXVA 2JKHA 1SC8U 1BMFD 4B74A 2BD3A 2BY9X 2GT8A 3TITA 1GMCF 4AGKA 4B1TA 5EQRA 4JZFH 2RA0A 2IJOB 3GOVB 2G81E 4I8JA 2PFEA 2Y5HA 2C90B 4AG2A 3MU5A 3UNRA 1GHVH 4BAMB 2Y82A 5LPEA 4K8YA 1YC0A 4JYUH 3UWIA 2FI4E 1UTPA 1MQ6A 1DWCH 1A0JA 1AZZA 1Z1IA 4Q80A 2F9UA 4NA7A 3B9FH 2OXSA 3KEEA 1H4WA 2Z9KA 2R3YA 3RXCA 1HB0B 5DP8A 4CRFA 1GHBG 3BG4B 5DP9A 1PPBH 2B7DH 3BTQE 1Y3YA 4K1EA 1CGJE 1X7AC 1AWHB 3MWIU 3OFND 1V2RT 1BMLA 2DE9A 1RRKA 1V3XA 5EIYA 5L6NH 2Z7FE 3PV5A 1O35A 5F8XA 1L0ZA 3D49H 3U69H 3K6ZA 1EAUA 5A0AE 3SUDA 1VJAU 1FIWA 1AKSA 2R3UA 3LGYA 3DFLA 1ZGIA 1O3EA 1O3JA 1H8ED 1T7CA 4ZROA 4VGCC 1ANDA 4I32A 3HK6B 2BD4A 1BTHH 1WDIA 4X1QU 1TNLA 2VIDA 4MG3A 3DSPA 3HPTB 1O2LA 1WQSA 2P16A 1A46H 4TY7A 4D76A 1AO5A 1CU1A 2V6NA 2GKVE 3SV8A 4UD9H 3B23B 3BTTE 3DA9B 2P59A 1UK2A 4OS5A 3RXJA 5LH8A 1IQGA 3GDUA 1BTXA 1FJSA 1QJ1B 2XBXA 1NFUA 3SUEA 2G5NA 2R2WU 1DFPA 2ODPA 4JK6A 4HZHA 2G55A 1LCYA 1LO6A 3LT3A 1PYTD 1LMWB 3ATKA 3FZZA 1P06A 1THPB 1UCYH 1FN8A 3SQHE 3VFEA 3P8GA 5FXLA 1FDPA 1OWEA 1DY8A 3E90B 1AFQB 1GI4A 1LPGB 4FU7A 2Z9LA 1RTFB 1O2NA 2BXUH 4KTUA 3RMNH 3MNBA 3A80A 1W2KH 3ZVEA 1CBWB 1BTYA 2HPQH 1CT2E 2Y7ZA 3TVJB 1TPSA 1MKWK 3Q77A 3EYDA 1T4UH 2JIZD 4X8UH 1A2CH 1IQLA 2ZDNA 4BNRA 1AI8H 1SB1H 2JJ1D 1IQMA 5FCRA 1DS2E 4DOQA 2IJD1 2A4GA 1T32A 1AZ8A 4DT4A 2ZNKH 1L1JA 1NPMA 3GYLB 2WYGA 1P09A 2BD5A 3T27A 1BITA 3W1EA 1J15A 3ZV9A 1P02A 1V2VT 1HV7A 1PFXC 3RXRA 1NBMD 1SFQB 3T2NA 2D2DA 4KGAA 1GJCB 3FFGA 1GHXH 4ABJA 2STBE 1ETRH 3OE7D 1CA8B 1IHTH 3HATH 3QZQA 1C9PA 3SZNA 1F5LA 1TNJA 1L2EA 5A8XA 2FTLE 4ZXYH 3ZZ6A 4CRCA 1TB6H 1LPKB 1FONA 7GCHF 2ZU4A 4DVAU 1Y3UA 2ZU5A 3TH4H 1AU8A 1XUIA 1C5RA 1EZQA 5DP4A 5JDUB 2A7HA 2Y5GA 1J8AA 4I7YH 2GV6A 1RIWC 4LXBH 2W26A 3RXMA 3M3TA 3A7ZA 5AF9H 4ASUD 2SNVA 1Z8IB 2WYJA 1NBME 5GXPA 1WYKA 3T28A 4ZXXH 3ZVAA 4HGCA 3DT0H 4XDEA 1MTNC 3GCHB 3T25A 8KME2 2ZFPH 1TGBA 3NZIA 2W5EA 4UEHH 1M9UA 4YZUA 1P10A 4H42U 1BRBE 2ZU2A 4CRAA 1G9IE 1CGHA 2TBSA 1G2MA 5DKMA 2G00A 1S0QA 5CHBA 2OC0A 3BV9B 2JDID 3OY5U 1RD3B 1G3DA 2ZHWH 3RXLA 3UNSA 1B5GH 2BY5X 1UK3A 1NTPA 2WINI 4A1TA 1O32A 2J95A 3N7OA 1CO7E 1YPHC 3BSQA 5C5OA 1V2KT 1MUEB 3SUFA 2W6ID 3LGUA 1KLJH 5HIZA 2PUQH 1XVOA 3BTHE 3RXUA 2GT7A 3SN8A 4JYTA 7LPRA 1C1QA 3ENSB 2PP6A 1GJ8B 3MNCA 3RXBA 2HALA 1A5HA 1P3CA 3A7YA 4NIWA 4YT7H 2PLXA 5E0HA 3PWBA 1Z71A 3A81A 1CQQA 1JRSA 2WV5A 1KSNA 1UTJA 3PMHB 2HVXA 3QTOH 3E0PB 4FUBA 2I6QA 3A89A 1A0LA 1FAXA 1SGCA 1E1RD 4BAOB 2CJIA 2A4QA 3LH3A 2F9NA 1O2TA 2XBWA 4Y79A 1Q2WA 1F0UA 1A5IA 2V3OH 2R0LA 2WUCA 2QA9E 1OYQA 1AE5A 3T5FH 5C1UA 2KCOA 3LGVA 2WV4A 1GHYH 1EASA 2BHGA 3E6PH 3LGTA 3U8TH 5JB9S 4FUFA 1CHOG 1P2OA 3M3SA 2J94A 3SJIA 1FY8E 3VB5A 2Z3CA 2G4TA 1H9IE 1RXPA 1Z8RA 2A5IA 3SV2H 2C8WB 4TPYA 1H8IH 1K2I1 2UUJB 1YCPM 3A7TA 4MNYA 1S84A 1WU1A 4Z0KA 5EQQA 1ZHRA 4O03A 2FIRH 6ESTA 5C20A 1P3EA 1K1IA 1Q31A 2WHXA 2FOMB 4X2WA 1O2MA 3KYGA 3L3TA 4MNWA 1EOJA 4VGCB 4DIIH 3ZZ4A 2BB4A 2HNTF 4RN6A 3OSYA 1O3CA 4HTCH 2SGPE 4P02A 1D6RA 1XXDA 2FODA 1XUHA 3KL6A 1ESBA 2VBCA 2P94A 2VVVA 1C5MD 1SQRA 1BT7A 1O3DA 2L6OA 4AFUA 1UTOA 1P12E 1J17T 4OGYA 5CDFE 1AE8H 1T31A 3I78A 3Q3XA 3QO6A 3FO8D 1AUTC 5F8ZA 5TCAA 1CA0B 1P04A 1LHCH 1TNHA 1CT0E 1A3BH 3DSGA 1GJDB 4AB9A 1SBWA 4M7GA 1TNGA 2BOHB 4BANB 3F0PA 3M35A 1MTNB 4IC5A 5T1VA 1GI1A 2PKSC 2STAE 4Y8ZA 1T8NA 4I8HA 1O2GH 2K0QA 1BUIA 3TU7H 1Z6EA 1DWDH 2AS9A 2F83A 4X1NU 3IITA 2ODQA 1VCWA 1GBJA 2VWOA 4A6LA 1N8OC 2M5TA 1TX7A 3FP8E 3TJVA 5L30H 3RXOA 4AYVB 1D9IA 1WSSH 2FO9A 1BA8B 1HDTH 5HXFA 1ORFA 3K9XB 1N8OB 5A8YA 2RG3A 1SMFE 1ZJDA 1O5CB 1TYNA 3MI4A 1P01A 2Z9JA 1XXFA 1EP5A 1FLEE 3GY4A 2F9PA 1HBTH 2UWPA 1ZSLA 3DUXH 4TWWA 1LHEH 1TPAE 4A5TS 1NRNH 2BD9A 5C5NA 4Q2KA 3VPKA 3A83A 2VIOA 1P2KA 2TRMA 1L1GA 4IW4E 2AERH 1EAIA 1S6HA 1EOLA 4I31A 4JCNA 1SGRE 1SGDE 3FP6E 1O3GA 5HGGA 1BBRK 2CGAA 1O2JA 2QGRA 4X2XA 3RXDA 1EB1H 1V2PT 4BAKB 3SU2A 1Y8TA 1P2JA 1PPZA 5JBAS 1O3LA 1GI8B 3EAJA 3U98H 1SGIB 2QY0B 3ODFA 3EE0B 5BRRE 1JBUH 1L4ZA 2QXIA 1FAKH 3JZ2B 1EATA 3QGJA 3SNBA 5AFZH 3AASA 4K3JA 1FNIA 3A87A 3F9GA 1PYTC 3IG6B 3UQVA 4A7IB 1FN6A 5JBCS 3URCA 3P95A 1VITG 5J4SA 1G2LA 3CENA 1FPCH 1GJBB 1O3NA 3MYWA 2XYAA 2GJGA 2UUYA 3GS9A 3WWFA 4NIVA 4Y6DA 1LKAA 1SGFA 3GCNA 2FP7B 1FX0B 3ZZ5A 1AIXH 2OD3B 1LVOA 1TABE 2B0FA 3KNXA 2LNCA 5FBEA 1UTLM 2M2AA 1NN6A 3RM0H 1ZR0A 1C5UA 1HAIH 2HGTH 4WWYA 2BLOA 3SNAA 5LGOA 1BQYA 1BJUA 1HJ8A 1OWKA 2BDGA 1HAVB 5C17A 1OWJA 2BDIA 1GHWH 2C3SA 5GCHG 2FOHA 1P2QA 2IOTA 1O2OA 3T29A 2C4FH 1WV7H 1QR3E 4MLFB 4X6OA 2ZU3A 5EJLA 1GMCG 1SHHB 3U1IB 2JH6D 2RDLA 2BDBA 3ZVCA 5E2PA 3GCTG 5E2OA 4MVNA 2PKAB 1IQNA 3V3MA 1UHBB 3TNTA 1EB2A 4X0WU 1SL3A 1HUTH 3KQ5A 1GVKB 1Q3XA 1TOCB 4GAWA 1TGNA 4Y7AA 1V2UT 1BMNH 1SPJA 2QF4A 2PR3A 1EFRD 3ZYEA 1S81A 1EAWA 2PV9B 3H7TA 4CR9A 1W8BH 3PTNA 2FOGA 1G3EA 3LIWA 3RM2H 1AVXA 1W13U 1EJNA 2AMPA 4D9RA 5E0JA 3WY8A 3TJOA 2AFQB 1TQ7B 2BMGB 3BEUA 1MKXK 2V3MA 4NWLA 5LPRA 4FUDA 4INHA 1RTLA 3OY6U 2EC9H 3C1KA 4RT1A 1UVTH 5A09A 3VB6A 2TGAA 1MTVA 1BOQA 1IAUA 1GJ7B 1GBHA 2CHAB 3MH7A 3ELAH 3HGNA 4YXWD 3L33A 2G4UA 1ZPZA 1MCTA 2P3TB 2ESTE 3OTPA 3M37A 2F9OA 3RXSA 4AC9A 5CE1A 1B0FA 1E36B 3VB7A 3SW2B 1VKYA 2WPHS 3M36A 1ESTA 4XFQA 4I86A 1BBRE 1IQIA 5GJ4B 1HNEE 3SU1A 4IBLH 4ABGA 2O8UA 4K8BA 3KN2A 5EG4A 1NRSH 5HM9A 1TALA 5GDSH 4HFPB 2ZI2H 1WCZA 2FWWA 1C5PA 2PGBB 5EXLA 4DG4A 1Z8GA 3QGNB 2NU1E 1O0DH 3RXFA 2HNTC 1AB9B 1MCVA 2EI6A 4ISLA 2VWLA 2H9TH 1GBBA 4ISOA 2ZGJA 1DUAA 3QN7A 2EA3A 2Y81A 1E35B 1GJ4H 4FETA 4F55A 3SI3H 2KZ4A 1UJ1A 1NY22 4Q7XA 2WUBA 2QE7D 1ZPBA 4X2YA 3F9FA 4JYVH 1F92A 1P03A 2RDEA 4NIXA 1SVPA 5A8ZA 3GY7A 4GLYA 1F0RA 1AUJA 3SJ9A 3GY8A 3WWBA 3U9AH 2G8TA 2AGIX 2JETC 2A2QH 5HMAA 1BRCE 4K60A 3NPSA 1NRQH 1G37A 5DP6A 5C1XA 2O8MA 4DY7B 1ZSKA 1SGNE 1DUEA 2BM2A 2FS9A 4TWYA 1GI6A 3LH1A 2CF9H 3KQCA 1KDQB 1SGQE 1P0SH 1K1LA 3SUGA 1YF4A 1GCDA 2EQNA 3SU4A 4JMYA 5T6DA 1PPFE 4O97A 1C5XB 3FZDA 3ZYDA 3PV2A 2Y5FA 4ZH8A 1TAWA 1GBEA 2VIPA 3AAUA 3F9EA 3M7TA 1ZJKA 1H1BA 3FP7E 4AFZA 5K0HA 1GBCA 1DT2A 1N1LA 1SGPE 1AVGH 8GCHF 3T26A 1YBWA 2ZA5A 2AGGX 1A3EH 1QRWA 1UK4A 2ZZUH 2VGCB 1FPHH 4RT0A 1C5NH 1D3QB 3NCLA 3TPIZ 2W3KA 4I8KA 1YPMH 5HIYA 1JIRA 3QZRA 4XSKU 4D7GA 4FUGA 3BN9A 1GDQA 1EXFA 5C0TA 1S0RA 1AFEH 5EQSA 5C94A 1W14U 1DANH 1YPLH 3MHWU 4Y0YE 4MPVA 4IS5A 2LPRA 1TFXA 5DK1A 1O5DH 1SLXB 1N6YA 2ZTYA 1OP0A 5EXMA 1BRUP 4ZHAA 1T8LA 4XOJA 1SQAA 2ZWLH 3M5LA 3ZZBA 4XRNA 1ABJH 2J34A 3ZZ8A 1A4WH 2CK3D 2VVUA 1TGCA 1TPPA 1XUKA 4SGBE 1GMHG 2SGEE 5EGMA 2VVCA 3G01A 1GBDA 1INCA 1ZZZA 2ZDAH 2HRVA 3LJJA 3UTUH 3H5CB 4X1PU 1J16A 1TRNA 2BDCA 4AYYB 2ZGCA 1O3IA 3GCTF 3A8CA 5B6OA 4DT7B 1K1JA 1TMTH 4YOJA 1SQOA 5EOKA 3VG8A 1C2DA 4NFEA 1SQTA 1GJ9B 1VGCB 1W0KD 2CXVA 2OTVA 1W0JD 4FVBA 2PGQB 2FOBA 3M5MA 3M5NA 3RXAA 4AZ2B 2BZAA 3STIA 1GBAA 2H9HA 4Q7YA 3BG8A 2ZGBH 2JH0D 2H5CA 1GI2A 2UWLA 2QCYA 1FV9A 2FMJA 3TH3H 2GDDA 3RLYH 2UUFB 4Y10E 4TY6A 4AGJA 3BIUH 1P8VC 2ZFRH 4E06H 3E1XB 1DY9A 1C2KA 4ABDA 2Q1JA 1LPZB 1NT1A 2D1JA 2A7JA 4BTIB 1YLDA 2ODYB 5FAHA 3CS7A 3BG4C 4K69A 3UR6A 3SNDA 2OCVB 2BD7A 1P2MA 3SBKA 3MO9A 2EI7A 4LZ4B 1MTWA 4AG1A 2PKSB 2O9QA 5GNDA 1JWTA 3UOPA 3A8DA 1HAGE 3RXPA 3PLBA 3PWCA 4FUEA 1GI5A 5FCKA 1GCTC 5L2ZH 1DM4B 2A45B 2ZDLA 3MH6A 2FX4A 1TRYA 1GJ6A 1C1PA 4B2AA 1Y3WA 3P17H 4B6EA 1HAZB 3HKIB 1KXCA 2WPDD 4I33A 3RMMH 1ZMLA 3VXEH 1ETTH 2BY7X 3M61U 3T62A 2ANWA 3SZEA 1W0ZU 1FZZA 1RS0A 3MNXA 5KECA 1O5BB 2BVXH 5T3HA 3ATMA 4O3TA 2J9NA 2FM2A 3F3BA 4OGXA 4B2CA 3ZVGA 1YCPK 1YLCA 4AFQA 1YKTA 4M9FA 1KXDA 1ANBA 4RKOB 1TIOA 2AH4X 4OS1A 3ZV8A 2JJ2D 1O5GH 5J4QA 1NFWA 1QJ6B 1IQJA 1OP8A 4CR5A 4YLUA 3EE7A 2EI8A 4CRGA 4JZIA 3OEED 5DO4H 2ZTXA 3PM3A 4B75A 1KTTB 2DUCA 4X6MA 3R3GB 3HKJB 1K21H 1RJXB 1ELTA 1EPTC 4UDWH 2CF8H 2XW9A 1XM1A 2V7QD 4TSFD 1W10U 3LOXA 1TGTA 4B76A 5FHTA 3TK9A 1OHHD 1LVYA 2WSSD 3H09A 3K6YA 1ARBA 2G51A 2FYRA 4FUHA 3PV4A 3SU0A 1YCPH 1J9CH 1KIGH 3UY9A 2KR7A 4H6TA 1OX1A 3OAAD 2ZECA 4U2WA 2V0BA 1TBRH 1PQAA 1CGIE 1DXPA 3E3TA 4NFFA 4Y8YA 2GCHF 2NU3E 2VINA 3TGKE 3RXGA 2JETB 2J2UA 2ZU1A 3FOAA 2ZHQH 3MOCA 3RU4E 2ZDVH 2BLQA 2HOBA 1HFDA 3A84A 2ZFTA 5GPIB 2Y6TA 1GDNA 1SLVB 3ZZAA 5JB8S 1C5QA 3SNCA 1O2IA 4PROA 3LC5A 2HVYB 2VWNA 1QCPA 2KCAA 3BTGE 4NA9H 4UFFH 1CT4E 1OKXA 5I25A 1SLUB 1MABB 1SSXA 4ZKSU 1NM6A 3VGCC 1DWBH 5F8TA 1QIXB 2OC1A 2PTNA 2C93B 4WH6A 2H6MA 3E91A 2GCHG 2W7SA 3AVZA 2A5KA 1E38B 2XNDD 4ACAA 3NRLA 3SNEA 2ZP0H 5EXNA 1K1PA 1C2JA 3ESTA 4GSOA 1EZSC 1IQHA 3FKSD 2OQ5A 3ATIA 3O8BA 4UFEH 6GCHF 3SI4H 2UUKB 2QYIA 1PPHE 3V0XA 4WMEA 5C0UA 1K22H 1E34B 2PKAA 4X6PA 3AW1A 1EP6A 1EX3A 1GGDB 1OPHB 3SHCH 1SR5C 3ZVDA 3QUMP 2QXGA 1V2QT 2SGFE 2P3UB 1VJ9U 3KQEA 2GD4B 5I46H 4LZ1H 4U01A 1NZQH 3GCHC 2HLCA 1S6FA 4D8NA 2O8WA 9ESTA 2J98A 1BDAA 1C5OH 3F2HA 2ZFQH 1VITF 3VXFH 2YMSB 4BXSA 1KXAA 1OWIA 1E79D 2XC4A 2KX4A 1VGCC 1FUJA 1YPGH 1EUFA 1IQEA 1ANCA 1HGTH 1WTHD 4IN2A 2BZ6H 1GPZA 1O2ZA 3EA7A 3SV6A 5C67A 3F1SB 3KF2A 4AOQA 4YOIA 1ABIH 2FS8A 3MH5A 4X2VA 3M7UA 5EODA 1O2RA 2FESH 2ZFFH 5FBIA 1AVWA 5HYOA 1PPEE 5H4IB 4ESTE 1BTWA 1TX6A 1GGDC 4Q4LA 1TONA 2GTBA 1D3PB 4J2YB 1UVPA 2BY8X 4BXWA 2BD8A 2Z3EA 4FOUC 4NIYA 1ZOMA 2GZ9A 4B6FA 1D3TB 3FANA 3RXQA 2OBQA 2GZ8A 5GWZA 1AMHA 3PMBB 2A4RA 1ACBE 1O34A 2LP6A 3N7EA 3C27B 1BMAA 2TGTA 1WOFA 3LC3A 4MPWA 1NU9A 1XKBC 1UVUH 4JZEH 3KQDA 2PHBA 3KGPA 3ZVFA 2A0QB 1DDJA 2BDAA 3Q76A 4A1VA 2WZQA 5E0GA 3E16B 5F03A 1G36A 1HAYB 1F5RA 1EAXA 1Y5UT 2VU8E 4DJZB 2VGCC 3SQEE 2A1DB 4AORA 3KQBA 2K1QA 1HAVA 1K28D 1WTGH 1O2XA 3ATWA 3F68H 1TMUH 3A7VA 5BPEA 1LHDH 3U28C 1O2HA 1SI5H 4HG6A 5GIBA 2H5DA 4MTBA 1XKAC 3ZZ3A 3A8AA 8LPRA 4NCYA 1V2MT 1BTUA 1ZLRA 4OS7A 1E1QD 2BLVA 5ABWA 1K0HA 1ELEE 2BDHA 3N99A 3RP2A 2QV1A 2EY4C 1GCTB 2WPLS 3O8CA 2BY6X 2EEKA 2HNTE 5FX5A 4J1YA 1C1SA
chains in the Genus database with same CATH topology
1C4Y2 1V2TT 1K1MA 2B5TB 4B71A 1ELVA 3RXEA 5JBBS 4GHTA 1UTNA 1CVWH 2FXRA 2P8OB 5EW2H 2XTTB 1HAOH 1AQ7A 5EU8A 1GJ5H 3GYMA 4K1TA 2QXJA 1DLEA 1ZRKA 1KTSB 1KXFA 1UTKA 2G5VA 4Y0ZE 1LVBA 4ABHA 1O5FH 2BQ6B 4Y8XA 5DG6A 3LDXH 5AVDA 1GI0A 1BIOA 1HPGA 1ZSJA 1DWEH 1HCGA 4MNXA 3GY6A 1DICA 3D62A 7KMEH 1FY5A 3URDA 2JH5D 3EA8A 1MQ5A 3RMLH 5T6FA 1ELAA 1S85A 1TX8A 5HM2A 4CH2B 2FOAA 3H7OA 1KY9A 4Y71A 2A7CA 1O33A 2GX4A 4KTSA 4GVUA 4GPGA 1HAHH 1O5AB 2Q6FA 4E05H 1PQ5A 1HYLA 1FI8A 2ZO3H 2ZPRA 3ZZ9A 4WXIA 1GI3A 3R0FA 1YP9A 1LTOA 1TE0A 4FUIA 4FU9A 1C2LA 3M5OA 4ZMAH 1A5GH 1BMMH 4CRBA 3SV7A 2VNTA 5E8EH 1E37B 4CHAB 1AN1E 3P8NA 5EPYA 3QLPH 2VWMA 3UIRA 3FVFB 2Z9IA 1YPHE 2GP9B 1CA0C 1AY6H 2Y7XA 3NUMA 2XCFA 2Z94A 2SGDE 4FXGH 4YLQH 4R0IA 1V2ST 2W7UA 4CH8B 3QWCH 1H9HE 1W11U 3RU4D 2GGVB 2OC8A 2ZPSA 2FLBH 3TLOA 2C8YB 4H4FA 1MD7A 4K1SA 2IN2A 2XCNA 4GCHF 2NU2E 1ELCA 1SGFG 1GI9B 2J38A 1TGSZ 4X6NA 2OINA 2QN5T 3GDVA 2FZZA 4ZUHA 4A1XA 1MH0A 3ITIA 4K2YA 2ZQ2A 1K9OE 4UE7H 1MKWH 2OBOA 3ODDA 1SGYE 1XVMA 2WPIS 3MU1A 3PLKA 1N6XA 1QHRB 4NG9H 1GBTA 1MTSA 2TPIZ 1O2KA 3MO6A 1C1OA 5FPSA 3LKWA 1MMJN 1ZGVA 2BXTH 4DIHH 1ZYOA 1HRTH 2Z9GA 3GCOA 2BTCE 1C1MA 1KXBA 3OU0A 1TLDA 5CHAB 3TGJE 2WPJS 1S83A 4AFSA 1C1UH 1DITH 3W95A 3A8BA 1MBQA 2OLGA 4JZDH 4X8VH 3UPEA 3SOSA 1EZUC 4XBCA 3MU0A 3QTVH 1C4V2 1Y3XA 4MNVA 2ZF0H 3PTBA 1BBRH 4CRDA 1LHGH 1NESE 1C5VA 1HAPH 2ZKSA 3GY2A 5TJXA 1VCQA 1FXYA 1C2FA 4H6SB 4IGDA 1F7ZA 3V12A 1MAXA 1OP2A 1OSSA 1CBWC 5DPAA 3E8LA 4TPIZ 1Y5BT 1ZHMA 3HGPA 3TJNA 2GV7A 1V2WT 1CSOE 1NC6A 1QL8A 2TGPZ 3L6PA 2BVRH 1GWAA 2ZCHP 4IMQA 1G3BA 1EPTA 5AFYH 5LPFA 4FU8A 2GZ7A 3P8OA 2HWLB 3P6ZB 3TJUA 1TA2A 1O3PB 1Y5AT 1GMDF 3CS0A 4CREA 3PMJA 2P3FH 1TPOA 3TK5A 4BTUB 2VIQA 1ZRBA 4INLA 1C1VH 1D3DB 2BVSH 4U30A 4XBBA 3SGQE 1QA0A 4AN7A 4WMDA 1HJ9A 4NSVA 3RXHA 4CBOA 3BTME 3A7WA 1ARCA 2NU4E 2XC0A 1F0TA 1C2EA 1AKSB 1TA6A 1O36A 4KTCA 1DLKB 1D4PB 3EDXB 4CHAC 3SJ8A 5JPMH 1O2UA 2ZQ1A 1P05A 2XC5A 1HXFH 3P92A 4WVPE 3SV9A 1GMDG 4JK5A 3RLWH 2A31A 1LHFH 3UFAA 2FOEA 1RFNA 4NZLA 1G3CA 2J4IA 1YGCH 1A61H 3RXVA 4ABFA 4WF8A 3SGBE 1DSUA 1UCYE 2OQUA 4XE4A 3UQOA 1DX5M 4BOHA 2Q6DA 4UONA 4DURA 1O2QA 3GISB 3SGAE 2BD2A 2A2XH 3VB3A 4ABIA 5IDKA 3BTEE 5TCCA 1C5WB 2SFAA 2PW8H 3BEFB 1PPCE 2THFB 1QL7A 1EJAA 2ZGHA 2RA3A 1BTZA 5AHGH 1MZDA 1IQKA 2CN0H 3KCGH 1O2SA 4Y76A 1YPJH 3IWMA 3RC6A 1GBFA 1A1RA 7ESTE 4NA8A 3S7KB 1NU7B 5EW1H 1C1TA 4I8GA 5FX6A 2P8OC 1QQ4A 4Z6AH 1A0HB 1HIAA 3ATLA 2ZTZA 1AWFH 4UFGH 5IYTA 1HJAB 4A92A 5ETXA 4ZAEA 1C5ZB 1W12U 3I29A 3SJKA 3DHKH 4LOYH 3TGIE 2Z6BD 1GL0E 1QRXA 1TBQH 1YPEH 3NK8A 1VCPA 2SGAA 1GMHF 4ISHH 1NRPH 1GVLA 1NS3A 4WMFA 5DP5A 1G30B 3S9AA 3RXKA 3O8RA 2BX4A 1KYNA 3PO1B 1EZXC 1GHAG 1V2OT 2H2ZA 3Q3KA 3KHVA 1D6WA 1QB9A 4X8SH 3B8JA 1C1WH 1U6QA 9LPRA 4Y11E 3EA9A 4F4OC 2FYQA 2R2MB 1FMGA 1DPOA 1GVZA 1QQUA 1O3MA 3U8RH 4INKA 3MU4A 1BHXB 4GUXA 1HLTH 2PSYA 1ZTJA 1RTKA 2F3CE 2TIOA 3RC4A 5JBTA 1BZXE 2IPHA 3LU9B 3TNSA 2ZC9H 2F9VA 1QURH 3UOUA 1C2HA 3SO3A 1CHGA 1JRTA 2SNWA 2VIVA 2ANKH 2ZPQA 1QB1A 2KAIA 1HAXB 1VITH 1T8MA 3QK1A 1GHAF 1L1NA 1OYTH 2FEQH 2QAAA 2ZDMA 2D26C 1SG8B 4ISNA 4KP0A 1JOUB 2DE8A 1IHSH 3F6UH 2FDAA 5SGAE 1W0YH 1SGEE 2AYWA 1C1RA 1QBNA 3LPRA 1DSTA 3ZZCA 1H8DH 1O39A 5CHAC 2Y80A 4YTAA 2H1UA 1P9SA 4JZ1A 1C4U2 2KAIB 3BEIB 3F9HA 3SU3A 3LONA 3RMOH 1QB6A 1ZTLA 4ZKNU 2QXHA 4HI3A 1ESAA 1IQFA 3BIVH 3STJA 2PTCE 2ZDKA 1UCYK 3TIUA 3ZZ7A 2ALPA 1P9UA 3U8OH 1GG6B 1WBGB 1T4VH 2AIQA 2FOCA 4X8TH 1GG6C 1MTUA 4THNH 2TGDA 4BAQB 3RC5A 1EJMA 1MU8B 1OXGA 3MNSA 2RCEA 4ZKRU 1AGJA 3TK6A 1NFXA 1XUJA 1UMAH 1THSH 1C5YB 2I6SA 3A82A 1O2PA 2QC2A 2AGEX 1UO6A 1MU6B 2ZIQH 1QTFA 3SHAH 1JXPA 3SORA 8ESTE 1W7XH 5K7RA 2NWNA 2NU0E 5GCHF 1QRZA 1EKBB 1O37A 1SOZA 1W7GH 1TOMH 2GMTB 3JZ1B 4E7RG 1H9LB 1C2MA 4E7NA 4BTTB 1ETSH 4MDSA 3AW0A 2GMTC 1BCUH 1BRAA 4OS2A 1C9TA 1ZMNA 1AHTH 2O8TA 5A2MH 1MD8A 3BTDE 2XWBI 2AMQA 2F91A 2AIPA 1ZPCA 5JYIA 4ABAA 3VGCB 1LQEA 1QGFA 2ASUB 2ZFSA 1P2NA 1YYY1 1GBMA 1Z8JB 2FOFA 1O3BA 3BF6H 2R0KA 4KKDA 1FIZA 1DXWA 2B8OH 1TWXB 2C8ZB 2OC7A 6CHAC 1THRH 2R9PA 1T8OA 1QFKH 1AFQC 1O38A 2Z3DA 1OWHA 3W94A 4Y7BA 1LDTT 3MH4A 2A32A 5FPTA 1C5LH 1V6DA 2FI3E 4FVDA 1HIAB 1DE7H 2J92A 3S9CA 3KIDU 4Q7ZA 2BQ7B 1SGTA 2ZHFH 1NROH 1TMBH 3RU4T 5F6MA 1RGQA 1IOEA 3RXTA 1GI7B 2SGQE 2BLWA 3DFJA 1Y59T 5ESBA 2PUXB 1UTMA 2ZGXH 4OS6A 2O8LA 3A7XA 2BOKA 2CMYA 1QY6A 3FAOA 4RKJB 1O2YA 4TYDA 3EQ0H 1XUFA 4B2BA 3K65B 4GHQA 1P57B 1GL1A 1MBMA 2C8XB 3NKKA 3UR9A 4IN1A 1K1NA 2XNIA 1J14A 3A86A 3A85A 4XBDA 4AB8A 1G32B 3LGIA 1JMOH 2V35A 1L4DA 2YNBA 1MKXH 2XRCA 1P2IA 2FI5E 6CHAB 3MTYA 4LK4A 2UWOA 4B73A 4I8LA 1ELGA 1O5EH 2BQWB 1PJPA 3BTFE 3K2UA 1HJAC 3PO1C 1KXEA 1F5KU 4FUJA 1Y3VA 3RUOA 1BTPA 2D8WA 1O31A 2OP9A 3SU5A 5DJ7A 4ZHMU 3VEQB 3LJOA 2FTMA 1S82A 2HPPH 5G4BA 4NZQA 5FPYA 1F2SE 1UTQA 1O30A 4AX9H 4YT6H 5DGJA 3O8DA 4ZHLU 1PQ8A 1ZHPA 2BYAX 4BAHB 1XUGA 3NXPA 3SJOA 5C1YA 3I77A 4YM9A 1FQ3A 2P93A 3P8FA 3GICB 1TQ0B 3MO3A 4ISIH 2FPZA 1GHBF 5CMXH 4ASHA 1E0FD 8GCHG 1FY1A 3NWUA 3ZZDA 3CP7A 3GY5A 1WQVH 4GCHG 3GDSA 1C5SA 3S69A 4DGJA 1O3KA 2XBYA 3UWJH 3QDZB 3P70B 3S7HB 1LKBA 4RSPA 1O3HA 1C2IA 1Z1JA 4OS4A 2B9LA 3U1JB 1OS8A 1A7SA 3RDZA 1PPGE 4FUCA 2WPKS 2CHAC 4MPUA 1P11E 1UVOA 1QNJA 4SGAE 1GDUA 1V2NT 1AD8H 1QL9A 2ILNA 2WPMS 4O9VA 3M3VA 1TNIA 2QF0A 3QX5H 5PTPA 4X1SU 1GBKA 3BTWE 2F9BH 1W3CA 1YM0A 2ZHEH 2A5AA 1GBIA 2W3IA 4ABEA 1ZMJA 1XX9A 1HXEH 1KLTA 5A0BA 2QF3A 3DD2H 2ZG0H 1EQ9A 4KELA 5T6GA 1AB9C 1WAYB 4ZKOU 2VH0A 3A88A 3MFJA 1O3AA 3PB1E 3S9BA 1NO9H 4NGAH 4O3UA 4X1RU 1O2WA 5ESTE 4K5ZA 3PROA 1ELBA 1BB0B 1QBOA 2GVFA 4IC6A 4YO9A 1LQDB 3VB4A 2AMDA 1ANEA 4UFDH 3HK3B 2FX6A 1K1OA 2ZCLP 4NWKA 1C2GA 1GBLA 2OUAA 1XMNB 1SOTA 3PLPA 4WH8A 1S5SA 1NRRH 3UUZA 3OX7U 5DP7A 4ABBA 1NFYA 1ZTKA 2AEIH 5C3NA 2BDYA 1QBVH 5C2ZA 3BTKE 2YOLA 5DP3A 2ULLA 1C5TA 1V2JT 3PMAB 2VJ1A 1CE5A 2GCTB 2VIWA 2ZEBA 3S0NA 3RXIA 3V7TA 2V3HH 1YPKH 3EGKH 4R8TB 2ALVA 3Q00A 4WY3A 3UNQA 4DW2U 1FY4A 4D7FA 1BJVA 1KLIH 1FY3A 1BHXF 2ZCKP 2FLRH 6LPRA 1PQ7A 2Q6GA 3E0NB 4QT8C 5A0CA 5L2YH 3M7QA 3Q3YA 1Z7KA 1DOJA 1TBZH 3UREA 4IMZA 1KDQA 1WUNH 6GCHG 1B7XB 3ZVBA 2A4OA 1O3OA 2VH6A 2H9EH 2VB0A 1ELFA 2XWAA 1OWDA 2PWXA 3V13A 5EPNA 1TRMA 3TH2H 3AAVA 4MQAA 4F49A 4YESB 1EPTB 1JIMA 2ANMH 1OOKB 4YOGA 1ELDE 1QA7A 1SFIA 3D23A 2XBVA 3GY3A 1VZQH 4MPXA 1MAYA 3LGWA 1CHOF 2PSXA 7GCHG 4DCDA 2QIQA 1TNKA 1ID5H 3OYPA 1O2VA 2ANYA 3SU6A 2P95A 2G52A 1VR1H 1LVMA 2XXLA 1MZAA 2BX3A 2GCTC 1RIWB 1UVSH 3D65E 1UHBA 4D9QA 3PYHA 2ZHDA 1GHZA 1QJ7B 1SHYA 1O3FA 4U32A 1GJAB 1C1NA 1DVAH 3MU8A 4NSYA 4WJG2 1V2LT 3OTJE 3MMGA 1F0SA 4CBNA 2YNAA 1Z6JH 1B0EA 1SLWB 2CV3A 2GDEH 4WXVA 2JKHA 1SC8U 4B74A 2BD3A 2BY9X 2GT8A 3TITA 1GMCF 4AGKA 4B1TA 5EQRA 4JZFH 2RA0A 2IJOB 3GOVB 2G81E 4I8JA 2PFEA 2Y5HA 2C90B 4AG2A 3MU5A 3UNRA 1GHVH 4BAMB 2Y82A 5LPEA 4K8YA 1YC0A 4JYUH 3UWIA 2FI4E 1UTPA 1MQ6A 1DWCH 1A0JA 1AZZA 1Z1IA 4Q80A 2F9UA 4NA7A 3B9FH 2OXSA 3KEEA 1H4WA 2Z9KA 2R3YA 3RXCA 1HB0B 5DP8A 4CRFA 1GHBG 3BG4B 5DP9A 1PPBH 2B7DH 3BTQE 1Y3YA 4K1EA 1CGJE 1X7AC 1AWHB 3MWIU 1V2RT 1BMLA 2DE9A 1RRKA 1V3XA 5L6NH 2Z7FE 1O35A 5F8XA 1L0ZA 3D49H 3U69H 3K6ZA 1EAUA 5A0AE 3SUDA 1VJAU 1FIWA 1AKSA 2R3UA 3LGYA 3DFLA 1ZGIA 1O3EA 1O3JA 1T7CA 4ZROA 4VGCC 1ANDA 4I32A 3HK6B 2BD4A 1BTHH 4X1QU 1TNLA 2VIDA 4MG3A 3HPTB 1O2LA 1WQSA 2P16A 1A46H 4TY7A 4D76A 1AO5A 1CU1A 2V6NA 2GKVE 3SV8A 4UD9H 3B23B 3BTTE 3DA9B 2P59A 1UK2A 4OS5A 3RXJA 5LH8A 1IQGA 3GDUA 1BTXA 1FJSA 2XBXA 1QJ1B 1NFUA 3SUEA 2G5NA 2R2WU 1DFPA 2ODPA 4JK6A 4HZHA 2G55A 1LCYA 1LO6A 3LT3A 1PYTD 1LMWB 3ATKA 3FZZA 1P06A 1THPB 1UCYH 1FN8A 3SQHE 3VFEA 3P8GA 5FXLA 1FDPA 1OWEA 1DY8A 3E90B 1AFQB 1GI4A 1LPGB 4FU7A 2Z9LA 1RTFB 1O2NA 2BXUH 4KTUA 3RMNH 3MNBA 3A80A 1W2KH 3ZVEA 1CBWB 1BTYA 2HPQH 1CT2E 2Y7ZA 3TVJB 1TPSA 1MKWK 3Q77A 3EYDA 1T4UH 4X8UH 1A2CH 1IQLA 2ZDNA 4BNRA 1AI8H 1SB1H 1IQMA 5FCRA 1DS2E 4DOQA 2A4GA 1T32A 1AZ8A 2ZNKH 1L1JA 1NPMA 3GYLB 2WYGA 1P09A 2BD5A 3T27A 1BITA 1J15A 3ZV9A 1P02A 1V2VT 1HV7A 1PFXC 3RXRA 1SFQB