2OTVA

Crystal structure of the complex formed between bovine trypsin and nicotinamide at 1.56 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Crystal structure of the complex formed between bovine trypsin and nicotinamide at 1.56 A resolution
rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2otvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2otvA02
4E06H 5EG4A 4MPUA 1NRRH 4FUIA 4UDWH 1BCUH 2HNTF 2Q6FA 3S9BA 1BRCE 1HIAA 1J15A 2A0QB 3DA9B 1F0RA 3EA8A 1AVXA 5HXFA 3EA9A 1LPZB 1HAPH 1O34A 1GCTB 1P01A 1TRYA 4K60A 1C1OA 5GDSH 3SZNA 1GHAF 2G81E 2HRVA 4DG4A 2C8XB 3ZVEA 2K1QA 2HPQH 4CHAC 1MH0A 2F9UA 1EX3A 2V35A 3OSYA 1YP9A 3BTHE 1C5SA 3PM3A 2AMPA 7ESTE 1FPHH 1AVWA 4DIHH 4FXGH 3SUFA 1SFIA 5JBAS 2VVUA 1O3MA 3E1XB 4FUCA 1OWDA 4CRDA 3P8FA 3A86A 2ZCLP 1BA8B 3LU9B 1TBZH 2C93B 2A32A 2J94A 2ZFQH 4NA8A 4BTUB 3H5CB 3V13A 4CRBA 1GHVH 2Z9KA 1W7GH 1HXEH 1TGNA 1SL3A 2P3UB 1GPZA 2HGTH 1GI1A 1XKAC 3RXJA 2GT7A 2Y82A 1T7CA 1W0ZU 2HOBA 5TJXA 1OKXA 1H8IH 2QN5T 1NO9H 1HAHH 1UTKA 1YBWA 4XDEA 3SU6A 2FTLE 5DG6A 3FVFB 2SGPE 3BTWE 1S84A 3S7KB 4UD9H 3GICB 3F9EA 2P8OB 2GCTB 3TK9A 5C3NA 2F9OA 5G4BA 5FX5A 1O5CB 4FU8A 3JZ1B 4INHA 2A45B 1C5QA 3PV4A 4KTCA 1GVZA 3RXMA 1HAGE 3SNEA 1TMTH 2GV6A 1EZUC 2ZFFH 3ATLA 3A83A 3M7UA 8LPRA 2DUCA 2J34A 1V2MT 5BRRE 1P03A 2FOBA 1T8LA 1O3FA 2A2XH 1GJCB 2ZNKH 2OXSA 3E16B 1AKSA 2ANMH 1AB9B 1UVUH 1AI8H 1O2SA 5JB8S 1ZRBA 3M7QA 1QR3E 5DGJA 1GJ6A 5LPEA 2I6SA 6CHAB 4ZKRU 2ZU4A 4YT7H 2Z7FE 3DUXH 5A09A 1C5MD 5GCHG 4WF8A 1UTMA 2PW8H 3H7TA 1SOZA 3SW2B 3CS7A 1O5BB 2VH6A 5C5OA 3P8GA 5FXLA 3RC6A 2CHAC 1V2PT 2XWAA 1YPGH 4CRGA 1UK4A 2PKAB 4FUFA 1BUIA 1F5RA 2HNTE 2BM2A 4WXIA 2XNIA 2VINA 3MNSA 1O2PA 1TBQH 4I32A 1P3EA 2BD7A 2J2UA 3LC3A 1EATA 2Z3EA 1GMDF 1NS3A 1O3HA 3A85A 3KNXA 3LT3A 3RXOA 2VIOA 5L2ZH 1ZGIA 4Y8XA 1TNJA 1ELVA 1LHFH 3A8AA 1ZMJA 1KDQA 1E38B 3ZZDA 4UFGH 1P9UA 4WXVA 3KF2A 4YOGA 4TWWA 4B2AA 3P8OA 2QYIA 2GCTC 4MPWA 2W7SA 1KLTA 1WSSH 2Q1JA 2V6NA 1G3DA 5DJ7A 1YGCH 3SJOA 3F9FA 1ANBA 1BBRE 3BTKE 3F1SB 1WU1A 2J4IA 3OTJE 1O2HA 1EPTA 1CHOF 2VWLA 3SU2A 1DITH 4AFZA 1BHXB 1QBVH 1MZAA 1P11E 1PJPA 2FI3E 1O36A 3LJOA 1EJAA 1GI5A 4KP0A 5A0BA 2GV7A 1LVOA 4ASHA 1VGCC 1DWDH 1B0FA 4MNWA 4X8UH 1W11U 1GBEA 1GBKA 2NWNA 3ZZ6A 1BTPA 1SLXB 2J38A 1SSXA 2ZCHP 4MNYA 2AMQA 1C5NH 4A92A 1O5EH 5FBIA 1GJ4H 2P16A 3B9FH 3DT0H 1W10U 2EA3A 1K2I1 1ZRKA 3MU0A 4FUHA 4BXSA 1P9SA 1BTXA 4MVNA 2Z3DA 3VXFH 3NCLA 1SGYE 2BDCA 1O3CA 3EDXB 1S5SA 1FV9A 1TNHA 1PQAA 1QTFA 3SU1A 4AOQA 4O3TA 1O2OA 2AGEX 4BAHB 3HGPA 1G3CA 5FPYA 1O3EA 2QY0B 3DD2H 1Z8IB 3KQDA 3SI4H 2ZFRH 4K1TA 5A0CA 2GMTC 1GVKB 1FONA 3SHAH 3ZVFA 1F5LA 1O5AB 3L3TA 1LCYA 3FANA 4E7NA 4ZMAH 1UVTH 2YNBA 4THNH 3TITA 3S9CA 4Y8YA 2WYJA 4KKDA 2ZQ1A 5I25A 1AUTC 2BY8X 1P57B 3T26A 3SU0A 1L4ZA 3T62A 4K8BA 1NM6A 2BDYA 4I8HA 3A8CA 2STBE 2O8UA 5PTPA 1GMCG 3MH6A 1RJXB 1RS0A 2SNWA 2P95A 1CT4E 4H6SB 1QNJA 2ZFSA 5C2ZA 3SU3A 3GY7A 3RXLA 1KXFA 4X2WA 5JBCS 1A2CH 1W8BH 3ZZAA 1AMHA 1VZQH 3VB7A 2CMYA 1UVOA 3QTOH 4K1SA 1DT2A 2QGRA 1IQGA 1QFKH 1UO6A 1O38A 2OINA 3BEFB 1G3EA 4CREA 2R0KA 1C1TA 3P6ZB 3KL6A 1GWAA 3A7YA 3A8BA 1OYTH 3PYHA 2WV5A 3QZRA 1IHTH 3VB6A 1G3BA 1GGDB 1TMUH 2UWPA 4JK6A 4IS5A 1JOUB 2BHGA 4E7RG 4K1EA 3SJKA 3U8OH 4A1XA 3SU4A 1GG6B 3SN8A 4B2BA 3AASA 1C5WB 1OP8A 3TGIE 1DX5M 2G8TA 1O2VA 1MQ5A 1TFXA 3MFJA 1O3IA 2HPPH 3RM0H 5EPNA 1HAYB 2FESH 1J17T 3WY8A 2ZDLA 1FAXA 4IBLH 1A0HB 1T32A 2FLBH 3UIRA 2XBWA 2TRMA 5TCCA 2SGEE 3GCHC 5K0HA 3GY3A 3MU5A 3IWMA 3Q00A 4DCDA 1NN6A 1J16A 3SUEA 2R2WU 2WV4A 4A1VA 3L33A 2LNCA 1OWJA 1U6QA 4LZ1H 3SORA 5L30H 1ELFA 1MTSA 1EAUA 1O39A 3AW0A 3QK1A 2PLXA 2YNAA 2AGGX 1ELBA 3PWCA 2G52A 1B0EA 1E0FD 4NA9H 1YPHC 2ANYA 3TPIZ 1P05A 1CHGA 4AGKA 2ASUB 1IQJA 1L1NA 2G4TA 1SGTA 4XBBA 3TIUA 5E0HA 4AZ2B 1V3XA 3DFJA 1MKWK 1Y8TA 3UWIA 4ABDA 1FIWA 3MNBA 1O2JA 3U1IB 2A7HA 2XCFA 2W7UA 2XYAA 4GCHF 1SG8B 2D26C 2VWNA 1C2EA 3Q76A 2FMJA 2BXUH 4YLQH 5C20A 1W12U 2TBSA 1ARBA 2Z6BD 4AG2A 1C1VH 1O35A 4GLYA 5T6FA 1UVSH 1BMAA 4GAWA 4I7YH 1QURH 3KQEA 2OUAA 1S0RA 1K1LA 1SGNE 1BMMH 1TOCB 3TJVA 1XVMA 5CMXH 3NUMA 1A5GH 1Y5UT 4ZHLU 3BEIB 2XBYA 1GVLA 1IQHA 3UUZA 3UFAA 5DPAA 3M7TA 2BTCE 1QIXB 1Z6JH 5EQQA 1QBNA 3K2UA 4AGJA 1CA0C 1MCVA 1CVWH 3T28A 1PYTD 1BQYA 4ISLA 2BVSH 3A84A 1AQ7A 1NROH 1TA6A 5A8YA 1BB0B 1Z1JA 1LVYA 2OC0A 3RLWH 3B8JA 1TOMH 1X7AC 3GCNA 1C1QA 3RP2A 2AGIX 1C2JA 4J1YA 2AIPA 1YPJH 3T27A 2Y80A 2AERH 3ODFA 5SGAE 3CS0A 1V2JT 1ETTH 2BDAA 3H7OA 2GCHF 1JRTA 2G00A 1PPBH 2GT8A 2O9QA 2AIQA 3BTDE 1PQ5A 3LGTA 1HXFH 3MU1A 4AFUA 7GCHG 1LTOA 5GXPA 1SQOA 1XUGA 1EPTC 1S0QA 4ABGA 4BAMB 2B9LA 3AVZA 1TMBH 3D49H 3NPSA 1QBOA 1GDNA 3RLYH 1ELCA 5FBEA 1V2ST 4JYUH 3PMJA 2PUXB 3E6PH 4Y71A 2OD3B 4D9RA 3VPKA 2R3UA 1TPAE 3E3TA 2Y7XA 1IQFA 3LH3A 4Q2KA 2R0LA 5EXMA 4DGJA 1TGCA 2JH6D 3TH4H 1YPHE 2GVFA 2AYWA 3L6PA 3E0PB 4X1QU 5AF9H 2BD5A 2ZU5A 5A2MH 4O3UA 3OY5U 4CBNA 5E8EH 1XVOA 3RXBA 1AD8H 1NFUA 5IYTA 1NPMA 1CGHA 1V2QT 1C5UA 3BG8A 1SPJA 4YO9A 1C2MA 3E91A 4ZAEA 2ZDMA 1O2ZA 1TPSA 3KHVA 3OU0A 2JETB 2GZ9A 3TLOA 3M5OA 1IOEA 1V2LT 1PYTC 3UR9A 1ZPBA 1BDAA 1GMDG 2XXLA 1Y3YA 2BQ7B 6GCHF 3A87A 2ZDKA 3BSQA 4AN7A 3GOVB 1H9HE 3M3VA 1GBCA 1LHDH 3GY2A 2ODQA 2PGQB 3I77A 4A6LA 4MQAA 1O5FH 1OWHA 3F9HA 5GJ4B 1SGFA 2OTVA 4JCNA 1QQ4A 2C4FH 5DKMA 1LO6A 1H9IE 4ZXXH 1ANDA 3QTVH 2ULLA 2ZTZA 3MU8A 1LPKB 4GVUA 1UCYH 2FYQA 1P02A 4NIXA 2F9VA 3PLBA 2QXIA 2DE8A 1SC8U 1ABIH 3KQBA 1DXPA 2OBQA 3BIVH 3GYLB 3P92A 1DFPA 1C5OH 1MKWH 1DSUA 3HPTB 2SGAA 2FIRH 1HAIH 1Z7KA 4JZFH 2VNTA 3GY8A 5FCKA 1TRNA 1T4UH 5F8ZA 2P59A 4IMQA 5HYOA 4RN6A 5DP4A 1ELGA 1AN1E 3O8DA 4UFEH 3ZVDA 2ZHFH 1V2TT 1PPEE 1EOJA 1O30A 4O9VA 4OGXA 4AG1A 1FY4A 4K69A 2HNTC 1ESBA 3SOSA 2BMGB 1BZXE 1D3TB 4X6OA 1C1UH 2IPHA 3QZQA 5I46H 4NIYA 2VB0A 2JETC 2ZWLH 3RXDA 1XUFA 1DY9A 2RA0A 6LPRA 1GDQA 1SI5H 1SGFG 2WUBA 1LVBA 3ZZ7A 1BMLA 1O2UA 1GBAA 3FZDA 1ZTKA 3SGAE 2TGTA 4JYTA 2PSXA 4Y7BA 3C1KA 2FI4E 4ZKOU 2WPIS 1OWIA 1F2SE 3C27B 3URDA 2FOEA 2H1UA 4BTIB 3KGPA 3TK6A 1IAUA 3HATH 1GJAB 4Y11E 4NGAH 1JMOH 1MTUA 4GSOA 1EJMA 1LKAA 2LPRA 2QC2A 1GHXH 1DWCH 1PFXC 1QA7A 2CXVA 1ANEA 3GCTF 1WV7H 2G5VA 2CHAB 4M7GA 3VXEH 1B5GH 2H9EH 4WY3A 2P94A 1LHGH 1TQ7B 1Q3XA 2FEQH 2BOKA 4R0IA 3MNXA 5F03A 1CT0E 1A7SA 1L2EA 3MU4A 2ILNA 4WH6A 4LOYH 1RRKA 2B8OH 1SGEE 1F0UA 4Y8ZA 1W2KH 2UUKB 2BQ6B 1V2NT 1TPPA 1O3DA 1XUKA 2JKHA 1O5DH 1O3KA 1Z6EA 2A4QA 2XWBI 4NG9H 2BDGA 3RXAA 2ZZUH 1KTSB 2CJIA 3RXVA 1JXPA 3MH7A 1IHSH 1GI2A 3TVJB 4I8GA 2XBVA 3FFGA 4DIIH 3SQHE 3HKJB 1GJ9B 1FLEE 1OS8A 3ATMA 3SNAA 2BLQA 1ZZZA 4GUXA 1IQIA 3ZVGA 2RG3A 4Q7YA 4Y0ZE 1W7XH 4KGAA 4PROA 2OQUA 3HKIB 4JZIA 3UQOA 1S83A 3ELAH 2RA3A 1UTNA 5JB9S 3FP8E 3BTGE 2JH5D 1EP6A 2UWLA 1W14U 4BTTB 1ELDE 1VGCB 1EUFA 2NU2E 2KAIB 5AFYH 4ABHA 2JH0D 4ABFA 1TPOA 3IG6B 2QV1A 2FDAA 3OYPA 2O8WA 1ZMNA 4H4FA 5A0AE 1HAVA 1CQQA 1O3JA 3F9GA 3ZYDA 3RDZA 4DVAU 4K3JA 5FAHA 3UNQA 2XBXA 4NFEA 1GJ8B 4SGAE 1P09A 5FCRA 1OP2A 2EI7A 1T31A 4KELA 1EAWA 1GL1A 1AWHB 1C1MA 4MPXA 4TY7A 1INCA 1ESAA 2RCEA 2BOHB 2CN0H 4ZH8A 2WPJS 1P2MA 5E2OA 1G2LA 2GMTB 2I6QA 2WPMS 3ATKA 1DANH 2VIPA 3URCA 1FJSA 3ZV9A 1WQVH 4IW4E 3UR6A 1OP0A 4UEHH 1ETRH 4X2VA 4FVDA 4YT6H 4BAKB 1JIMA 1GBDA 2BB4A 2BVXH 3SJIA 2BQWB 1GHBF 3KIDU 5H4IB 4JZ1A 1HAXB 3UREA 3I78A 2A4OA 2ZPRA 4JZDH 2GP9B 1N8OC 1Y3WA 4NWLA 1MTNB 1K1NA 3QDZB 3ZVAA 4OS2A 4Y10E 2XC0A 2PKSC 2RDLA 3ZZ5A 2GGVB 4ZKNU 1NRSH 1N6XA 2Y6TA 1F0SA 5ESTE 3KCGH 2GKVE 1QRXA 1M9UA 4JYVH 3BTEE 3TU7H 1BTWA 3P95A 1EAIA 1GBFA 2B7DH 1RD3B 2ZFTA 1J14A 2VH0A 1NFXA 1GI3A 1TRMA 4FUJA 1Y5AT 3BV9B 1GMHG 1IQMA 1RIWC 1Y3VA 1YCPM 1HIAB 3MH5A 4X6NA 4ABIA 3UPEA 4INLA 1O5GH 2ZHWH 1GI8B 1RGQA 3A88A 2PTNA 3GISB 3MO3A 4Q7ZA 1DOJA 1O2MA 1QL8A 1GL0E 2OLGA 3SHCH 1C5XB 1DLKB 2UUJB 4TYDA 1WCZA 4MNVA 1QL7A 1UTJA 2GZ7A 5LH8A 3NKKA 3JZ2B 1NT1A 1V2WT 1AO5A 2GTBA 2VU8E 5HM9A 1HJAC 3EA7A 2W5EA 3U98H 2ZDAH 1O2GH 3LDXH 3A89A 4I8KA 4FUBA 4A1TA 2QF0A 1C2FA 5F8XA 1ZHPA 3GY6A 1AY6H 1KXCA 4ZUHA 1OX1A 1SQAA 3SNCA 5HGGA 4X0WU 1J8AA 5EW1H 4FUDA 2TIOA 3A7WA 1EZSC 2VVCA 2AMDA 3SJ8A 3EQ0H 3S9AA 3LH1A 3QWCH 1SGCA 3TJOA 3SBKA 1BRUP 2GZ8A 3MYWA 1MUEB 2PFEA 4JMYA 3GCHB 2BD4A 3UOPA 1QL9A 1RTLA 5B6OA 1P2KA 2ZFPH 4OS1A 1FY1A 4ABAA 1O2LA 4A7IB 2XRCA 3PLKA 1MTNC 5T6DA 1NY22 3A7VA 3TGJE 2F91A 3PB1E 1Y59T 2AS9A 2D1JA 1LHCH 3B23B 1HFDA 3RM2H 1FDPA 1P12E 4HZHA 2HLCA 2A2QH 1K1OA 1SGDE 1BOQA 2H9HA 1TE0A 2ZTXA 1SGRE 2WPKS 3BEUA 1C5LH 1E36B 4LK4A 3ZZBA 3KEEA 1VR1H 4I31A 1D4PB 1PPZA 1LDTT 3KQCA 5F6MA 3F6UH 3W94A 1TNGA 1UHBA 2FOFA 1TNKA 2CV3A 2QIQA 1BHXF 2G51A 4LXBH 2AFQB 1VCQA 1NRNH 1YF4A 3BIUH 1JBUH 3SUDA 1FMGA 2W26A 4F4OC 4X1PU 1D6WA 4CBOA 2VIVA 4XSKU 3PMHB 1AKSB 1SFQB 3F68H 4J2YB 2PSYA 3ZVBA 2C90B 1O2YA 2ZO3H 1O2XA 4NA7A 1SR5C 3AAVA 3SV6A 1PQ7A 2BD2A 4OGYA 3RXUA 4D7FA 3ZYEA 1WOFA 1UK2A 1D3QB 2V3HH 3VEQB 4TPYA 1P0SH 2Z3CA 2ZPSA 4MLFB 3UTUH 4BNRA 4WMFA 2ESTE 1T4VH 3TK5A 2ZGBH 4U01A 1Y3UA 1CA0B 1DSTA 1NU7B 5E2PA 4E05H 3LGWA 4AFQA 2ZECA 4ISNA 1MTWA 3BG4C 1CBWC 1FY8E 1ZLRA 8GCHF 1ZPCA 1SVPA 1O31A 2PUQH 1V2VT 1KDQB 4ZKSU 4IC6A 1SHHB 1O2NA 1G30B 2GDEH 1C5TA 1UCYK 2YOLA 1KXAA 5A8XA 1P06A 3LPRA 1C2IA 1SLVB 3BTTE 1F92A 1YM0A 1BTHH 3E90B 3OX7U 1BRBE 5CHAB 3TNSA 1AVGH 1Q2WA 1EPTB 1XXDA 1QJ1B 4H6TA 4MG3A 2BLVA 1NU9A 3K6YA 3ENSB 2A1DB 4OS6A 2Z9IA 1T8OA 4X2XA 3A80A 1GHAG 1PPFE 1SMFE 2ALVA 3QN7A 2FOMB 2BD3A 1UJ1A 3SNDA 2ZIQH 1BBRH 3M36A 1H8DH 4D76A 1K1PA 1A3BH 3LGVA 4RSPA 4XOJA 1C2GA 1WAYB 1O2QA 1G2MA 1MU6B 1P3CA 3LIWA 3E8LA 1AWFH 4MTBA 4SGBE 4AFSA 1XUJA 2STAE 1H9LB 2GDDA 1GDUA 4GHTA 3M5LA 3IITA 1C5ZB 2NU0E 2CF9H 3GCTG 4O03A 2ZEBA 5EODA 1C9TA 3PWBA 1O3NA 3O8BA 1UK3A 2FOAA 4CRCA 2R3YA 3QGJA 4D8NA 1FZZA 1HJ8A 4X6MA 1BJUA 1PQ8A 3NK8A 1D3DB 1AGJA 4UFFH 2UWOA 1F7ZA 3ZV8A 4Z6AH 5T6GA 3RU4T 1QA0A 3RC5A 1EB2A 2XCNA 2B5TB 4Q80A 3RU4E 3TGKE 3MHWU 2BX3A 1XXFA 1L1GA 2CGAA 8ESTE 3LONA 4FU7A 4B76A 5L6NH 1WYKA 3MNCA 2VWMA 4TPIZ 2W3IA 3M35A 2ZA5A 1CU1A 3MTYA 4NZQA 2OC7A 4K2YA 1B7XB 1RFNA 5CHAC 2FOCA 2BDHA 3S0NA 1AFQC 3NXPA 4FUEA 1OOKB 4CH2B 3KN2A 2FLRH 1Q31A 3RMMH 3K6ZA 3V12A 1O33A 2ZF0H 2TPIZ 3GYMA 3LOXA 5CE1A 2VIQA 2W3KA 5F8TA 1MKXK 1ZHMA 2FODA 3RXHA 1TB6H 1UHBB 1HAOH 1MBQA 3SQEE 5JBBS 2J95A 2XW9A 5E0GA 1W13U 3A7ZA 5LPRA 2OQ5A 3A81A 3QLPH 3RXEA 3BF6H 5EGMA 1YCPK 1GMCF 2F9PA 1E34B 1GBTA 1K1IA 5J4SA 1A61H 1A3EH 1GJDB 1V6DA 1CGJE 1Y5BT 1NFWA 1ZHRA 1TX7A 2C8WB 4ISHH 3LGIA 1HRTH 4WH8A 1O2RA 2FS8A 1BJVA 1FNIA 2NU1E 1L0ZA 3RXGA 2BDBA 1FY5A 4RKJB 2ODPA 4ESTE 1TX8A 2FM2A 1VITH 2A5KA 1KYNA 4Y76A 3U8RH 2ZC9H 4MNXA 2H6MA 2Z9GA 2BZAA 4NIWA 3T25A 1ZOMA 3PTNA 4BANB 4AYYB 1GBMA 1C2KA 2A7JA 1MU8B 5EW2H 4OS5A 3HK3B 1V2OT 1S85A 1JWTA 2ANKH 4B75A 1AZ8A 1QRZA 2PKAA 3UWJH 4YTAA 1BITA 1S81A 2OC8A 2A4RA 1C5RA 3SV7A 2HVXA 4YLUA 3SNBA 2H5DA 1CHOG 3E0NB 2BY5X 2EI8A 9LPRA 1GI0A 4UE7H 5AHGH 5EQSA 1XX9A 1LQDB 2SGDE 2OBOA 5DP8A 2WPHS 2ANWA 1AE8H 1DVAH 3UNSA 3W95A 1A46H 3A7TA 2QCYA 3NWUA 1RXPA 1V2KT 1ZSLA 2A5AA 2QXJA 2ZTYA 5GWZA 1C1NA 2FOHA 1L4DA 1P2IA 1YPMH 5GIBA 3M37A 5EXLA 5C1YA 3U9AH 1MMJN 1A5IA 4D9QA 3Q3XA 1HYLA 4R8TB 1O2WA 4ISIH 2EC9H 4YESB 5EPYA 3BN9A 1T8NA 3CENA 1DUAA 2ZDVH 1FUJA 5JYIA 1G37A 2F9NA 2ZGJA 1GBLA 1Z8GA 1C4U2 1DPOA 3M5NA 3ZVCA 5C67A 1LKBA 3UQVA 1GI6A 4Y0YE 1GHZA 7LPRA 3RMLH 4X8VH 1P2JA 3HGNA 1KIGH 1KXBA 2FYRA 1NRQH 3ZZCA 2SFAA 5EXNA 1K1MA 4VGCC 5E0JA 1AFEH 1VJAU 1JIRA 1MQ6A 1C5YB 1YPLH 1DXWA 2DE9A 1EXFA 2C8ZB 3PO1C 1SBWA 3SV9A 4B71A 2SGQE 4NSYA 1QRWA 1Z1IA 1TX6A 1XUHA 1C2DA 1IQEA 3QUMP 3GDVA 1FQ3A 2THFB 3R3GB 1QB1A 3SO3A 2ZGHA 2O8MA 2VGCB 4JK5A 1THRH 3N7OA 4ZROA 1QB6A 2H9TH 4FU9A 1OSSA 3ODDA 4Z0KA 1CGIE 1DWBH 1MKXH 3RMNH 3OY6U 1FY3A 2ZPQA 1P04A 3A82A 2AEIH 1HJ9A 1OYQA 3V7TA 1N8OB 5EQRA 1ZJKA 1AHTH 1Y3XA 3RXPA 1GBIA 1D6RA 2PKSB 2B0FA 2FXRA 1MCTA 1XUIA 1YCPH 4IN2A 4NWKA 4X2YA 4Y7AA 1EB1H 1L1JA 1IQKA 1TIOA 2P3FH 4IMZA 1GI4A 1NESE 5LPFA 3M5MA 1DDJA 1GBBA 2A5IA 1Z8JB 1HBTH 4YM9A 3AAUA 1WTGH 3LGUA 1QJ6B 1EZQA 1RIWB 7GCHF 2FS9A 5C1XA 4BAOB 3QO6A 3PLPA 2BDIA 1GBHA 5FHTA 1GCTC 3RXKA 1CO7E 2UUFB 1KLIH 1C2HA 2ZU2A 4QT8C 3PROA 1FAKH 3PMAB 1CA8B 2Y7ZA 4DY7B 1ZR0A 3S69A 1SB1H 3O8CA 1HJAB 1TONA 3ESTA 1TNIA 1Z8RA 3MI4A 3QX5H 4YOJA 8GCHG 1UTQA 8KME2 3MMGA 3RMOH 2V3OH 1EJNA 1F0TA 1ZMLA 2SGFE 3VB5A 1HDTH 2ZGXH 1ZYOA 1DWEH 3STIA 4XE4A 4CH8B 3UNRA 2BYAX 2VGCC 2XC4A 3FP6E 3K9XB 4U32A 3V0XA 1MD8A 1P2QA 1EQ9A 1DICA 5BPEA 3LC5A 5L2YH 1RTKA 5GPIB 2F9BH 3TH3H 4ISOA 3LJJA 1VCWA 3LKWA 1N1LA 5C5NA 2Z9JA 3EAJA 1SHYA 4GCHG 2P93A 3RXIA 5LGOA 2AH4X 4DT7B 3STJA 1ETSH 2Y5GA 2XTTB 2HALA 1HLTH 1NTPA 1SLWB 2G55A 2ALPA 3U69H 1ZTJA 3U1JB 2D2DA 2FI5E 1VITF 2P8OC 4H42U 1TA2A 2XC5A 3HK6B 3GDUA 2G5NA 3M3TA 5DP5A 1KLJH 4AX9H 2BD8A 2QXHA 1NC6A 2BY6X 2O8TA 1IQNA 2G4UA 3GDSA 1MBMA 1SGQE 4NFFA 4WMDA 1P8VC 1ANCA 2TGDA 5DP7A 4B74A 1MAXA 2BY7X 1K22H 1C4Y2 1BBRK 1XMNB 2GD4B 3ATIA 4K5ZA 1WBGB 2PGBB 2NU4E 3DHKH 1AB9C 3VB3A 3G01A 1P10A 1OPHB 3BTFE 1H1BA 2SNVA 4O97A 3RU4D 3RXSA 5DP6A 1XKBC 6CHAC 1GI9B 5DK1A 4ABBA 1PPHE 2ZDNA 1EASA 5C1UA 2ZHEH 4DJZB 3NZIA 1O3AA 4OS4A 4XFQA 1ZTLA 1WTHD 2QXGA 4TWYA 1G9IE 4X1SU 2ZQ2A 2O8LA 3SV2H 5JPMH 1J9CH 1DLEA 1W3CA 1ELEE 2GCHG 1F5KU 1DUEA 1GHYH 3D62A 3SU5A 1LMWB 1EKBB 1D3PB 1QHRB 1IQLA 2IJOB 5JBTA 1ZSJA 1G36A 2PV9B 3T2NA 1YPKH 1K28D 3P17H 3BG4B 2BVRH 4IC5A 1CBWB 5ABWA 1HNEE 1VJ9U 1TAWA 1ZPZA 1LPGB 1SLUB 3GY5A 5IDKA 4U30A 5AFZH 3Q3YA 3GCOA 3MOCA 2FPZA 1ELAA 2Y81A 1E35B 1A1RA 2TGAA 2FX6A 1TABE 2BZ6H 4OS7A 5FPTA 1LVMA 3RXCA 1C1PA 1THPB 2M5TA 1A5HA 3P8NA 4AORA 2PWXA 1FI8A 1O3PB 1O2TA 2Z94A 2F3CE 4B73A 1MAYA 3ATWA 4AB9A 2BX4A 1FIZA 1O2KA 1TALA 2BLWA 3ZZ4A 2ZGCA 1AU8A 2GX4A 2VIWA 4ABJA 1AE5A 1THSH 4XBDA 1JRSA 3U8TH 3BTME 4IGDA 3MH4A 2NU3E 6GCHG 3RC4A 5FPSA 3QGNB 4CR5A 2ODYB 3M61U 4I8JA 1TYNA 3MO9A 1HUTH 4DURA 1EP5A 1C5VA 1HAVB 2CF8H 2Q6DA 4X1NU 1TNLA 4NZLA 4JZEH 2VWOA 3T29A 3Q3KA 5TCAA 2C3SA 1AIXH 1AUJA 3UY9A 1K21H 1OWEA 1SQTA 2QAAA 3SV8A 1A0LA 2ZI2H 1C2LA 1BTZA 3CP7A 1ZGVA 2FTMA 4ABEA 1TGBA 2H5CA 4IN1A 2OCVB 1BIOA 2UUYA 2ZKSA 1S6HA 3SGBE 3PMBB 4HTCH 4X8TH 2ZCKP 1KY9A 4MDSA 2OC1A 1P2NA 2PTCE 1QQUA 1LHEH 1SGIB 5GCHF 1UCYE 4BAQB 4Y6DA 1GHWH 4NCYA 1MD7A 3SJ9A 3EE0B 1C1SA 3TJNA 1BMNH 1YLDA 1PPGE 1O32A 4INKA 2J92A 3AW1A 3MWIU 4BOHA 2HWLB 3P70B 4A5TS 4NIVA 1AFQB 4WMEA 2WPLS 1UMAH 1NFYA 2ZU1A 2FP7B 2ZHQH 4YOIA 4GPGA 1GJBB 1WUNH 1FN8A 1S6FA 4WJG2 2PR3A 2A7CA 4HFPB 2VVVA 4WVPE 1K9OE 4CR9A 4XBCA 3EGKH 2F83A 4FUGA 5HM2A 3TJUA 4K8YA 3GY4A 1TWXB 5T3HA 1HPGA 2Y5FA 4UONA 3SGQE 1HB0B 3A7XA 2BXTH 4X6PA 5EU8A 4HGCA 1QB9A 1GGDC 3VFEA 1HGTH 4ZHMU 1DS2E 4AB8A 4I8LA 1FXYA 3ZZ3A 2ZU3A 3PTBA 5ETXA 1E37B 1GG6C 4GHQA 4ZXYH 3RXQA 6ESTA 4ZHAA 2A31A 1GMHF 1EAXA 1C5PA 2C8YB 1G32B 5FX6A 1O0DH 1CT2E 1NRPH 1C1WH 3VGCB 1SOTA 1T8MA 1YKTA 3D23A 3K65B 2TGPZ 2WYGA 1OWKA 5HMAA 5AVDA 1EOLA 4NSVA 5A8ZA 1TGSZ 1DM4B 1QGFA 3TH2H 1CSOE 2R9PA 2ZG0H 1BTUA 2QA9E 1HCGA 3O8RA 3I29A 4DW2U 1UVPA 2WINI 2J9NA 3SI3H 3FP7E 1D9IA 2VIDA 1VCPA 1GJ5H 1QJ7B 3VB4A 4YZUA 1ZJDA 3R0FA 1ORFA 1ESTA 1KSNA 1MZDA 1YLCA 4WWYA 2EEKA 1KXDA 2OP9A 1YPEH 3MO6A 1N6YA 3D65E 1FN6A 3RUOA 3ITIA 5DP3A 1O2IA 1O37A 1DE7H 2R2MB 4KTUA 1K1JA 1YC0A 2FZZA 4CRFA 2H2ZA 3FAOA 1OXGA 1GJ7B 3RXTA 4Y79A 1NZQH 1TGTA 1GBJA 1C1RA 4X8SH 2FO9A 3FZZA 2BLOA 4BXWA 3RXRA 1KXEA 5ESBA 4U2WA 1C4V2 4MPVA 4TY6A 3LGYA 1WQSA 1XM1A 2IOTA 1GI7B 4X1RU 1O3OA 2FOGA 1HAZB 1C9PA 1TLDA 1TQ0B 1S82A 2KAIA 1A0JA 2V0BA 4D7GA 3SUGA 2P3TB 2Z9LA 1AZZA 4CRAA 1QY6A 2VJ1A 2IN2A 5JDUB 2BY9X 3VGCC 2ZP0H 4HI3A 1ZSKA 4LZ4B 3T5FH 4DOQA 2FWWA 7KMEH 2FX4A 1ACBE 1RTFB 1BT7A 1UTLM 4VGCB 3M3SA 5K7RA 1EZXC 1P2OA 3DFLA 4B1TA 5EOKA 2WUCA 1GHBG 4CHAB 1V2RT 1H4WA 1ID5H 3PO1B 1BTYA 3TNTA 3S7HB 1KTTB 5DP9A 5DO4H 4F49A 1ABJH 2Y5HA 1HV7A 1ELTA 1SGPE 9ESTA 4FVBA 4AYVB 1UTPA 1VITG 1MTVA 1W0YH 1CE5A 1TBRH 3UOUA 2ZHDA 1UTOA 4I33A 4Q7XA 3EYDA 4B2CA 2PHBA 3ZZ9A 1FPCH 3BTQE 3Q77A 5J4QA 1O3GA 4RKOB 1V2UT 1LQEA 2BD9A 4KTSA 3ZZ8A 1GCDA 2Q6GA 2A4GA 1YYY1 3A8DA 3V3MA 1O3BA 1Z71A 2QF3A 1O3LA 1ARCA 3RXFA 1BRAA 2EI6A 1QCPA 4UFDH 1DY8A 1A4WH 1PPCE 2D8WA
chains in the Genus database with same CATH superfamily
4E06H 5EG4A 4MPUA 1NRRH 4FUIA 4UDWH 1BCUH 2HNTF 2Q6FA 5HIYA 3S9BA 2QF4A 1BRCE 1HIAA 1J15A 2A0QB 3DA9B 3OAAD 1F0RA 2RDEA 1AVXA 3EA8A 5HXFA 3EA9A 1LPZB 1HAPH 1O34A 4YXWD 1GCTB 1P01A 1TRYA 4K60A 1C1OA 5GDSH 3SZNA 1GHAF 2G81E 2HRVA 4DG4A 2C8XB 3ZVEA 2K1QA 2HPQH 4CHAC 1MH0A 2F9UA 1EX3A 2V35A 4Q4LA 3OSYA 1YP9A 5EIYA 3BTHE 1C5SA 5IK2D 3PM3A 2AMPA 7ESTE 1FPHH 1AVWA 4DIHH 4FXGH 3SUFA 1SFIA 5JBAS 2VVUA 1O3MA 3E1XB 4FUCA 1OWDA 4CRDA 3P8FA 3A86A 2ZCLP 1BA8B 3LU9B 1TBZH 2C93B 2A32A 2J94A 2ZFQH 4NA8A 4BTUB 3H5CB 2WSSD 3V13A 4CRBA 1GHVH 2Z9KA 1W7GH 1HXEH 1TGNA 1SL3A 2P3UB 1GPZA 2HGTH 1GI1A 1XKAC 3RXJA 2GT7A 1OHHD 2Y82A 1T7CA 1W0ZU 2HOBA 5TJXA 1OKXA 1H8IH 2QN5T 1NO9H 1HAHH 1UTKA 1YBWA 4XDEA 3SU6A 2FTLE 5DG6A 1YLNA 3FVFB 2SGPE 3BTWE 1S84A 3S7KB 4UD9H 3GICB 3F9EA 2P8OB 3WWFA 2GCTB 3TK9A 5C3NA 2F9OA 5G4BA 5FX5A 1O5CB 4FU8A 3JZ1B 4INHA 2A45B 1C5QA 3PV4A 4KTCA 1GVZA 3RXMA 1HAGE 3SNEA 1TMTH 2GV6A 1EZUC 2ZFFH 3ATLA 3A83A 3M7UA 8LPRA 2DUCA 2J34A 1V2MT 3F2HA 5BRRE 1P03A 2FOBA 1T8LA 1O3FA 2A2XH 1GJCB 2ZNKH 2OXSA 3E16B 1AKSA 2ANMH 1AB9B 1UVUH 1AI8H 1O2SA 5JB8S 1ZRBA 3M7QA 1QR3E 2KM0A 1GJ6A 5DGJA 5LPEA 2I6SA 5EJ1A 6CHAB 4ZKRU 2ZU4A 4YT7H 2Z7FE 3DUXH 5A09A 1C5MD 5GCHG 4WF8A 1UTMA 2PW8H 3H7TA 1SOZA 3SW2B 3CS7A 1O5BB 2VH6A 5C5OA 3P8GA 5FXLA 3RC6A 4FOUC 2CHAC 1V2PT 2XWAA 1YPGH 4CRGA 1UK4A 2PKAB 4FUFA 1BUIA 1F5RA 2HNTE 2BM2A 4WXIA 2XNIA 2VINA 3MNSA 1O2PA 1TBQH 4I32A 1P3EA 2BD7A 2J2UA 3LC3A 3CNRA 1EATA 2Z3EA 1GMDF 1NS3A 1O3HA 3A85A 3KNXA 3LT3A 3RXOA 2VIOA 5L2ZH 1ZGIA 4Y8XA 1TNJA 1ELVA 1LHFH 3A8AA 1ZMJA 1KDQA 2JJ1D 1E38B 2L6OA 3EE7A 4UFGH 3ZZDA 1P9UA 4WXVA 3KF2A 4YOGA 4TWWA 4B2AA 3P8OA 2QYIA 2GCTC 4MPWA 2W7SA 1KLTA 1WSSH 2Q1JA 2V6NA 1G3DA 5DJ7A 1YGCH 3SJOA 3F9FA 1ANBA 1BBRE 3BTKE 3F1SB 1WU1A 2J4IA 3OTJE 1O2HA 1EPTA 1CHOF 2VWLA 3SU2A 1DITH 4AFZA 1BHXB 1QBVH 1MZAA 1P11E 1PJPA 2FI3E 1O36A 3LJOA 1EJAA 1GI5A 4KP0A 5A0BA 2GV7A 1LVOA 4ASHA 1VGCC 1DWDH 1B0FA 4MNWA 4X8UH 1W11U 1GBEA 1GBKA 2NWNA 3ZZ6A 1BTPA 1SLXB 2J38A 1SSXA 2ZCHP 4MNYA 2AMQA 1C5NH 4A92A 1O5EH 5FBIA 1GJ4H 2P16A 3B9FH 3DT0H 1W10U 2EA3A 1K2I1 1ZRKA 3MU0A 4FUHA 4BXSA 1P9SA 1BTXA 4MVNA 2Z3DA 3VXFH 3NCLA 1SGYE 2BDCA 1O3CA 3EDXB 1S5SA 1FV9A 1TNHA 1PQAA 1QTFA 3SU1A 4AOQA 4O3TA 1O2OA 2AGEX 4BAHB 3HGPA 1G3CA 5FPYA 1O3EA 2QY0B 3DD2H 1Z8IB 3KQDA 3SI4H 2ZFRH 4K1TA 5A0CA 2GMTC 1GVKB 1FONA 3SHAH 3ZVFA 1F5LA 1O5AB 3L3TA 1LCYA 3FANA 4E7NA 4ZMAH 1UVTH 2YNBA 4THNH 3TITA 3VG8A 3S9CA 4Y8YA 2WYJA 2QF5A 4KKDA 2ZQ1A 5I25A 1AUTC 2BY8X 1P57B 3T26A 3FKSD 3SU0A 1L4ZA 3T62A 4K8BA 1NM6A 2BDYA 4I8HA 1WDIA 3A8CA 3OTPA 2STBE 2O8UA 5PTPA 1GMCG 3MH6A 1RJXB 2PP6A 1RS0A 2SNWA 2P95A 1CT4E 4H6SB 3GS9A 1QNJA 2ZFSA 5C2ZA 3SU3A 3GY7A 3RXLA 1KXFA 1YWUA 4X2WA 5JBCS 3FO8D 4ACBA 1A2CH 1W8BH 3ZZAA 1AMHA 1VZQH 3VB7A 2CMYA 1UVOA 3QTOH 4K1SA 1DT2A 2QGRA 1IQGA 1QFKH 1UO6A 1O38A 2OINA 3BEFB 1G3EA 4CREA 2R0KA 1C1TA 3P6ZB 3KL6A 1GWAA 3A7YA 3A8BA 1OYTH 3PYHA 2WV5A 3QZRA 1IHTH 3VB6A 1G3BA 1GGDB 1TMUH 2UWPA 4JK6A 4IS5A 1JOUB 2BHGA 4E7RG 4K1EA 3F0PA 3SJKA 3U8OH 4P02A 4A1XA 3SU4A 1GG6B 3SN8A 4B2BA 3AASA 1C5WB 1OP8A 3TGIE 1DX5M 2G8TA 1O2VA 1MQ5A 1TFXA 3MFJA 1O3IA 2HPPH 3RM0H 5EPNA 1HAYB 2FESH 1J17T 3WY8A 2ZDLA 1FAXA 4IBLH 1A0HB 1T32A 2FLBH 3UIRA 2XBWA 5GNDA 2TRMA 5TCCA 2SGEE 3GCHC 5K0HA 3GY3A 3MU5A 3IWMA 3Q00A 4DCDA 1NN6A 1J16A 3SUEA 2R2WU 2WV4A 4A1VA 3L33A 2J98A 3SZEA 2LNCA 1OWJA 1U6QA 4LZ1H 3SORA 5L30H 1ELFA 1MTSA 1EAUA 1O39A 3AW0A 3QK1A 2PLXA 2YNAA 2AGGX 1ELBA 3PWCA 2G52A 1B0EA 1E0FD 2KCPA 4NA9H 1YPHC 2ANYA 3TPIZ 1P05A 1CHGA 4AGKA 2ASUB 1IQJA 1L1NA 2G4TA 1SGTA 4XBBA 3TIUA 5E0HA 4Z1MD 4AZ2B 2RFKC 1V3XA 3DFJA 1MKWK 1Y8TA 3UWIA 4ABDA 1FIWA 3MNBA 1O2JA 3U1IB 2A7HA 2XCFA 2W7UA 2XYAA 4GCHF 2D26C 1SG8B 2VWNA 1C2EA 3Q76A 2FMJA 2BXUH 4YLQH 5C20A 1W12U 2TBSA 1ARBA 5KECA 2Z6BD 4AG2A 1C1VH 1O35A 1UW7A 4GLYA 5T6FA 1UVSH 1BMAA 4GAWA 4ASUD 1QURH 4I7YH 3KQEA 2OUAA 2EY4C 1K1LA 1S0RA 1SGNE 1BMMH 1TOCB 3TJVA 1XVMA 5CMXH 3NUMA 1A5GH 1Y5UT 4ZHLU 3KYGA 3BEIB 2XBYA 1GVLA 1IQHA 3UUZA 3UFAA 2WV9A 5DPAA 3M7TA 2BTCE 1QIXB 1Z6JH 5EQQA 1QBNA 3K2UA 4AGJA 1CA0C 1MCVA 1CVWH 3T28A 1PYTD 1BQYA 4ISLA 2BVSH 3A84A 1AQ7A 1NROH 1TA6A 5A8YA 1BB0B 1Z1JA 1LVYA 2OC0A 3RLWH 3B8JA 1TOMH 1SQRA 1X7AC 3GCNA 1C1QA 3RP2A 2AGIX 1C2JA 4J1YA 2AIPA 1YPJH 3T27A 2Y80A 2AERH 3ODFA 5SGAE 3CS0A 1V2JT 1ETTH 2BDAA 3H7OA 2GCHF 1JRTA 2G00A 2L74A 1PPBH 2GT8A 2O9QA 4P00A 2AIQA 3BTDE 1PQ5A 3LGTA 1HXFH 3MU1A 4AFUA 7GCHG 1LTOA 5GXPA 1SQOA 1XUGA 1EPTC 1S0QA 4ABGA 4BAMB 2B9LA 3AVZA 1TMBH 3D49H 3NPSA 1QBOA 1GDNA 3RLYH 1ELCA 5FBEA 1V2ST 4JYUH 3PMJA 2PUXB 3E6PH 4Y71A 2OD3B 4D9RA 3VPKA 2R3UA 1TPAE 3E3TA 2Y7XA 1IQFA 3LH3A 4Q2KA 2R0LA 5EXMA 4DGJA 1TGCA 2JH6D 3TH4H 1YPHE 2GVFA 2AYWA 3L6PA 3E0PB 4X1QU 5AF9H 2BD5A 2ZU5A 5A2MH 4O3UA 3OY5U 4CBNA 5E8EH 1XVOA 3RXBA 1AD8H 1NFUA 5IYTA 1NPMA 1CGHA 1MABB 1V2QT 1C5UA 3BG8A 1SPJA 4YO9A 1C2MA 3E91A 4ZAEA 2ZDMA 1O2ZA 1TPSA 3KHVA 1WXRA 3OU0A 2JETB 2GZ9A 3TLOA 3M5OA 1IOEA 1V2LT 1PYTC 3UR9A 1ZPBA 1BDAA 3OEHD 1GMDG 2XXLA 1H8HD 1Y3YA 2BQ7B 6GCHF 3A87A 2ZDKA 3BSQA 4AN7A 3GOVB 1H9HE 3M3VA 1GBCA 1LHDH 3GY2A 2ODQA 3DSOA 2PGQB 3I77A 4A6LA 4MQAA 1O5FH 1OWHA 3F9HA 5GJ4B 1SGFA 5C17A 2OTVA 4JCNA 1QQ4A 2C4FH 5DKMA 1LO6A 1H9IE 4ZXXH 1ANDA 3QTVH 2ULLA 2ZTZA 3MU8A 1LPKB 4GVUA 1UCYH 2FYQA 1P02A 4NIXA 2F9VA 3PLBA 2QXIA 2DE8A 1SC8U 1ABIH 3KQBA 1DXPA 2OBQA 3BIVH 3GYLB 3P92A 1DFPA 1C5OH 5FL7D 1MKWH 1DSUA 3HPTB 2SGAA 2FIRH 1HAIH 1Z7KA 4JZFH 2VNTA 3GY8A 5FCKA 1TRNA 1T4UH 5F8ZA 2J97A 2P59A 4IMQA 5HYOA 4RN6A 5DP4A 1ELGA 1AN1E 3O8DA 4UFEH 3ZVDA 2WPDD 2ZHFH 1V2TT 1PPEE 1EOJA 2IPQX 1O30A 4O9VA 4OGXA 4AG1A 1FY4A 4K69A 2HNTC 1ESBA 3SOSA 2BMGB 1BZXE 1D3TB 4X6OA 1C1UH 2IPHA 3QZQA 5I46H 4NIYA 2VB0A 2JETC 3ZIAD 2ZWLH 3RXDA 1XUFA 1DY9A 2RA0A 6LPRA 3PRDA 1GDQA 1SI5H 1SGFG 2KCOA 2WUBA 1LVBA 3ZZ7A 1BMLA 1O2UA 2LELA 1GBAA 3FZDA 1ZTKA 3SGAE 2TGTA 4JYTA 2PSXA 4Y7BA 3C1KA 2FI4E 4ZKOU 2WPIS 1OWIA 1F2SE 3C27B 3URDA 2FOEA 2H1UA 4BTIB 3KGPA 3TK6A 1IAUA 3F0OA 3OE7D 3HATH 1GJAB 4Y11E 4NGAH 1JMOH 1MTUA 4GSOA 1EJMA 1LKAA 2LPRA 2QC2A 1GHXH 1DWCH 2WZQA 1PFXC 1QA7A 2CXVA 1ANEA 3GCTF 1WV7H 2G5VA 2CHAB 4M7GA 4XRNA 3VXEH 1B5GH 2H9EH 4WY3A 2P94A 1LHGH 1TQ7B 1Q3XA 2FEQH 2BOKA 4R0IA 3MNXA 5F03A 1CT0E 1A7SA 1L2EA 3MU4A 2ILNA 4RT1A 4WH6A 5F53A 4LOYH 1RRKA 2B8OH 1SGEE 2KCAA 1F0UA 4Y8ZA 3AK5A 1W2KH 2UUKB 2BQ6B 2GJGA 1V2NT 1TPPA 1O3DA 1XUKA 2JKHA 1O5DH 1O3KA 1Z6EA 2A4QA 2XWBI 3KYFA 4NG9H 2BDGA 1QZ8A 3RXAA 2ZZUH 1KTSB 2K0QA 2CJIA 3RXVA 1JXPA 3MH7A 1IHSH 1GI2A 3TVJB 4I8GA 2XBVA 3FFGA 4DIIH 3N7DA 3SQHE 3HKJB 1GJ9B 1FLEE 1OS8A 3ATMA 3SNAA 2BLQA 1ZZZA 4GUXA 1IQIA 3ZVGA 2RG3A 4Q7YA 4Y0ZE 1W7XH 4KGAA 4PROA 2OQUA 3HKIB 4JZIA 3UQOA 1S83A 3ELAH 2RA3A 1UTNA 5JB9S 2LP6A 3FP8E 3BTGE 2JH5D 1EP6A 2UWLA 1W14U 4BTTB 1ELDE 1VGCB 1EUFA 2QE7D 2NU2E 2KAIB 5AFYH 4ABHA 2JH0D 4ABFA 1TPOA 3H09A 2QV1A 3IG6B 2FDAA 3OYPA 2O8WA 1ZMNA 1EFRD 4H4FA 5A0AE 1HAVA 1CQQA 1O3JA 3F9GA 3ZYDA 3RDZA 4DVAU 2VBCA 4K3JA 5FAHA 3UNQA 2XBXA 4NFEA 1GJ8B 4SGAE 1P09A 5FCRA 1OP2A 2EI7A 1T31A 4KELA 1EAWA 1GL1A 1AWHB 1C1MA 4MPXA 5CHBA 2KCYA 4TY7A 1INCA 1ESAA 2RCEA 2BOHB 2CN0H 4ZH8A 2WPJS 1P2MA 5E2OA 1G2LA 2GMTB 2I6QA 2WPMS 3ATKA 1DANH 2VIPA 3URCA 1FJSA 3ZV9A 2V3MA 1WQVH 3WW7A 4IW4E 3UR6A 1OP0A 4UEHH 1ETRH 4X2VA 3N7EA 4FVDA 4YT6H 3U28C 4BAKB 1JIMA 1GBDA 2BB4A 2BVXH 3SJIA 3OFND 2BQWB 1GHBF 3KIDU 5H4IB 4JZ1A 4XD7D 1HAXB 3UREA 3I78A 2A4OA 2ZPRA 4JZDH 2GP9B 1N8OC 1Y3WA 4NWLA 1MTNB 1K1NA 3QDZB 3ZVAA 4OS2A 4Y10E 2XC0A 2PKSC 2RDLA 3ZZ5A 2GGVB 4ZKNU 1NRSH 1N6XA 2Y6TA 1F0SA 5ESTE 3KCGH 2GKVE 1QRXA 1M9UA 4JYVH 3BTEE 3TU7H 1BTWA 3P95A 1EAIA 1GBFA 2B7DH 1RD3B 2ZFTA 1J14A 2VH0A 1NFXA 1GI3A 1TRMA 4FUJA 1Y5AT 3BV9B 1GMHG 1IQMA 1RIWC 1Y3VA 1YCPM 1HIAB 3MH5A 4X6NA 4ABIA 3UPEA 4INLA 1O5GH 2ZHWH 1GI8B 1RGQA 3A88A 2PTNA 3GISB 3MO3A 4Q7ZA 1DOJA 1O2MA 1QL8A 1GL0E 2OLGA 3SHCH 1C5XB 1DLKB 2UUJB 4TYDA 1WCZA 2EQNA 4MNVA 1QL7A 1UTJA 2GZ7A 5LH8A 3NKKA 3JZ2B 1NT1A 1V2WT 1AO5A 2GTBA 2VU8E 5HM9A 1HJAC 3EA7A 2W5EA 3U98H 2ZDAH 1O2GH 3LDXH 3A89A 4I8KA 4FUBA 4A1TA 2QF0A 4ZCNA 1C2FA 5F8XA 1ZHPA 3GY6A 1AY6H 1KXCA 4ZUHA 1OX1A 1SQAA 3SNCA 5HGGA 4X0WU 1J8AA 2YMSD 5EW1H 4FUDA 2TIOA 3A7WA 1EZSC 2VVCA 2AMDA 3SJ8A 3EQ0H 3S9AA 3LH1A 3QWCH 1SGCA 3TJOA 3SBKA 1BRUP 2GZ8A 3MYWA 1MUEB 2PFEA 4JMYA 3GCHB 2BD4A 3UOPA 1QL9A 1RTLA 5B6OA 1P2KA 2ZFPH 3PV2A 4OS1A 1FY1A 4TSFD 4ABAA 1O2LA 4A7IB 2XRCA 3PLKA 1MTNC 5T6DA 1NY22 3A7VA 3TGJE 2F91A 3PB1E 1Y59T 2AS9A 2D1JA 1LHCH 3B23B 1HFDA 3RM2H 1FDPA 1P12E 4HZHA 2HLCA 2A2QH 1K1OA 1SGDE 1BOQA 2H9HA 1TE0A 2ZTXA 3NRLA 1SGRE 2WPKS 3BEUA 1C5LH 1E36B 4LK4A 5EJLA 3ZZBA 3KEEA 1VR1H 4I31A 1D4PB 1PPZA 1LDTT 3KQCA 5F6MA 3F6UH 3W94A 1TNGA 1UHBA 2FOFA 1TNKA 2CV3A 2QIQA 1BHXF 2G51A 4LXBH 2AFQB 1VCQA 1NRNH 1YF4A 3BIUH 1JBUH 3SUDA 1FMGA 2W26A 4F4OC 3N99A 4X1PU 1D6WA 4CBOA 2VIVA 4XSKU 3PMHB 1AKSB 1SFQB 3F68H 4J2YB 2PSYA 3UB0A 3ZVBA 1NBME 2C90B 1O2YA 2ZO3H 1O2XA 4NA7A 1SR5C 2W6JD 3AAVA 2J5UA 1PQ7A 2BD2A 4OGYA 3RXUA 3SV6A 4D7FA 3ZYEA 1W0KD 1WOFA 1UK2A 1D3QB 2V3HH 3VEQB 4TPYA 1P0SH 2YMSC 2Z3CA 2ZPSA 4MLFB 3UTUH 4BNRA 4WMFA 4FETA 2ESTE 1T4VH 5C0TA 3TK5A 1FX0B 3F2GA 2ZGBH 4U01A 1Y3UA 1CA0B 1DSTA 1NU7B 5E2PA 4E05H 3LGWA 5EJZA 4AFQA 2ZECA 4ISNA 1MTWA 3BG4C 1CBWC 1FY8E 1ZLRA 8GCHF 1ZPCA 3F2FA 1SVPA 1O31A 2PUQH 1V2VT 1KDQB 4ZKSU 4IC6A 1SHHB 1O2NA 1G30B 2OK5A 2GDEH 1C5TA 1UCYK 2YOLA 1KXAA 5A8XA 4RT0A 1P06A 3UAIC 3LPRA 1C2IA 1SLVB 3BTTE 1F92A 1YM0A 1BTHH 3E90B 3OX7U 1BRBE 5CHAB 3TNSA 1AVGH 1Q2WA 1EPTB 1XXDA 1QJ1B 4H6TA 4MG3A 2BLVA 1NU9A 3K6YA 3ENSB 2A1DB 4OS6A 2Z9IA 1T8OA 4X2XA 3A80A 1GHAG 1PPFE 1SMFE 2ALVA 3QN7A 1VKYA 2FOMB 2BD3A 1UJ1A 2IJD1 3SNDA 2ZIQH 1BBRH 3M36A 1H8DH 4D76A 1K1PA 1A3BH 3LGVA 4RSPA 4XOJA 1C2GA 1WAYB 1O2QA 1G2MA 1MU6B 1P3CA 3LIWA 3E8LA 1AWFH 4MTBA 4SGBE 4AFSA 2HVYB 1XUJA 2STAE 1H9LB 2GDDA 3DSPA 1GDUA 4GHTA 2XNDD 3IITA 3M5LA 1C5ZB 2NU0E 5HIZA 2CF9H 3GCTG 4O03A 2ZEBA 5EODA 1C9TA 3PWBA 1O3NA 3O8BA 1UK3A 2FOAA 4CRCA 2R3YA 3QGJA 2KZ4A 4D8NA 1FZZA 1HJ8A 4X6MA 1BJUA 1PQ8A 3NK8A 1D3DB 1AGJA 4UFFH 2UWOA 1F7ZA 3ZV8A 4Z6AH 5T6GA 3RU4T 1QA0A 3RC5A 1EB2A 2XCNA 2B5TB 4Q80A 1COWD 3RU4E 3TGKE 3MHWU 2BX3A 1XXFA 1L1GA 2CGAA 8ESTE 3LONA 4FU7A 4B76A 5L6NH 1WYKA 3MNCA 4M9FA 2VWMA 4TPIZ 2W3IA 3M35A 2ZA5A 1CU1A 3PRBA 3MTYA 1K0HA 4NZQA 2OC7A 4K2YA 1B7XB 1RFNA 5CHAC 2FOCA 2BDHA 3S0NA 1AFQC 3NXPA 4FUEA 1OOKB 4CH2B 3KN2A 2FLRH 1Q31A 3RMMH 3K6ZA 3V12A 1O33A 2ZF0H 2TPIZ 3GYMA 3LOXA 5CE1A 2VIQA 2W3KA 5F8TA 1MKXK 1ZHMA 2FODA 3RXHA 1TB6H 1UHBB 1HAOH 1MBQA 3SQEE 5JBBS 2J95A 2XW9A 5E0GA 1W13U 3A7ZA 5LPRA 2OQ5A 3WWBA 3A81A 3QLPH 2K8IA 3RXEA 3BF6H 5EGMA 1YCPK 1GMCF 2F9PA 1E34B 1GBTA 1K1IA 5J4SA 1A61H 1A3EH 1GJDB 1V6DA 1CGJE 1Y5BT 1NFWA 1ZHRA 1TX7A 2C8WB 4ISHH 3LGIA 1HRTH 4WH8A 1O2RA 2FS8A 1BJVA 1E1QD 1FNIA 2NU1E 1L0ZA 3RXGA 2BDBA 1FY5A 4RKJB 2ODPA 4ESTE 1TX8A 2FM2A 1VITH 2A5KA 1KYNA 4Y76A 3U8RH 2ZC9H 4MNXA 2H6MA 2Z9GA 2BZAA 4NIWA 3T25A 1ZOMA 3PTNA 4BANB 4AYYB 1GBMA 1C2KA 2A7JA 1MU8B 5EW2H 4OS5A 3HK3B 1V2OT 1S85A 1JWTA 2ANKH 4B75A 1AZ8A 1QRZA 2PKAA 2J98B 3UWJH 4YTAA 1BITA 1S81A 2OC8A 2A4RA 1C5RA 3SV7A 2HVXA 4YLUA 3SNBA 2H5DA 1CHOG 5B6LA 3E0NB 2BY5X 2EI8A 9LPRA 1GI0A 4UE7H 5AHGH 5EQSA 1XX9A 1LQDB 2SGDE 2OBOA 5DP8A 2WPHS 2ANWA 1AE8H 1DVAH 3UNSA 3W95A 1A46H 3A7TA 2QCYA 3NWUA 1RXPA 1V2KT 1ZSLA 2A5AA 2QXJA 2ZTYA 5GWZA 5C94A 1C1NA 2FOHA 1L4DA 1P2IA 1YPMH 5GIBA 3M37A 5EXLA 5C1YA 3U9AH 1MMJN 1A5IA 4D9QA 3Q3XA 1HYLA 4R8TB 1O2WA 4ISIH 2EC9H 4YESB 5EPYA 3BN9A 1T8NA 3CENA 1DUAA 2ZDVH 1FUJA 5JYIA 1G37A 2F9NA 2ZGJA 1GBLA 1Z8GA 1C4U2 1DPOA 3M5NA 3ZVCA 5C67A 2AHME 1LKBA 3UQVA 1GI6A 4Y0YE 1GHZA 7LPRA 3RMLH 4X8VH 1P2JA 1W0JD 3HGNA 1KIGH 1KXBA 2FYRA 1NRQH 3ZZCA 2SFAA 5EXNA 1K1MA 4VGCC 2WHXA 5E0JA 3FOAA 1AFEH 1VJAU 1JIRA 1MQ6A 1C5YB 1YPLH 1DXWA 2DE9A 1EXFA 2C8ZB 4B6EA 3PO1C 1SBWA 3SV9A 4B71A 2SGQE 4NSYA 1QRWA 1Z1IA 1TX6A 1XUHA 1C2DA 1IQEA 3QUMP 3GDVA 1FQ3A 2THFB 3R3GB 1QB1A 3SO3A 2ZGHA 2O8MA 2VGCB 4JK5A 1THRH 5T1VA 3N7OA 4ZROA 1QB6A 2H9TH 4FU9A 1H8ED 1OSSA 3ODDA 5CDFE 4Z0KA 5KEDA 1CGIE 1DWBH 1MKXH 3RMNH 3OY6U 1FY3A 1SKYE 4F48B 2ZPQA 1P04A 3A82A 2AEIH 1HJ9A 1OYQA 3V7TA 1N8OB 5EQRA 1NBMD 1ZJKA 4DT4A 1AHTH 1Y3XA 2F4LA 3RXPA 1GBIA 1D6RA 2PKSB 3W1EA 2B0FA 2FXRA 1MCTA 1XUIA 1YCPH 4IN2A 4NWKA 4X2YA 4Y7AA 1EB1H 1L1JA 1IQKA 1TIOA 2P3FH 4IMZA 1GI4A 1E1RD 1NESE 3M5MA 1DDJA 1GBBA 2A5IA 5LPFA 1Z8JB 1HBTH 4YM9A 3AAUA 1WTGH 3LGUA 1QJ6B 1EZQA 1RIWB 7GCHF 2FS9A 5C1XA 4BAOB 3QO6A 3PLPA 2BDIA 1GBHA 5FHTA 1GCTC 3RXKA 1CO7E 2UUFB 1KLIH 1C2HA 2ZU2A 4QT8C 3PROA 1FAKH 3PMAB 1CA8B 2Y7ZA 4DY7B 1ZR0A 4F55A 3S69A 1SB1H 3O8CA 3PV5A 1HJAB 1TONA 3ESTA 1TNIA 1Z8RA 3MI4A 5KGOA 3QX5H 4YOJA 8GCHG 4HG6A 4I86A 1UTQA 8KME2 3MMGA 3RMOH 2F43B 2V3OH 1EJNA 1F0TA 1ZMLA 2SGFE 3VB5A 1HDTH 2ZGXH 1ZYOA 1DWEH 3STIA 4XE4A 4CH8B 3UNRA 2BYAX 2VGCC 2XC4A 3FP6E 3K9XB 4U32A 3V0XA 1MD8A 1P2QA 1EQ9A 1DICA 5BPEA 3LC5A 5L2YH 1RTKA 5GPIB 2F9BH 3TH3H 4ISOA 3LJJA 1VCWA 3LKWA 1N1LA 5C5NA 2Z9JA 3EAJA 1SHYA 4GCHG 2P93A 2W6ID 3RXIA 1BMFD 5LGOA 2AH4X 4DT7B 3STJA 1ETSH 2Y5GA 2XTTB 2HALA 1HLTH 1NTPA 1SLWB 2G55A 2ALPA 3U69H 1ZTJA 3U1JB 2D2DA 2FI5E 1VITF 2P8OC 4H42U 1TA2A 2XC5A 3HK6B 3GDUA 2G5NA 3M3TA 5DP5A 1KLJH 4AX9H 2BD8A 2QXHA 1NC6A 2BY6X 2O8TA 1IQNA 2G4UA 3GDSA 1MBMA 1SGQE 4NFFA 4WMDA 1P8VC 1ANCA 2TGDA 5DP7A 4B74A 1MAXA 2BY7X 1K22H 1C4Y2 1BBRK 1XMNB 2GD4B 3ATIA 4K5ZA 1WBGB 2PGBB 2NU4E 2CK3D 3DHKH 1AB9C 3VB3A 3G01A 4Q63A 1P10A 1OPHB 3BTFE 1H1BA 2SNVA 4O97A 3RU4D 3RXSA 5DP6A 1XKBC 6CHAC 1GI9B 5DK1A 4ABBA 1PPHE 2ZDNA 1EASA 5C1UA 2ZHEH 4DJZB 3NZIA 1O3AA 4OS4A 4XFQA 1ZTLA 4TT3D 1WTHD 2QXGA 4TWYA 1G9IE 4X1SU 2ZQ2A 3MQKC 2O8LA 3SV2H 5JPMH 1J9CH 1DLEA 1W3CA 2YMSB 1ELEE 2GCHG 1F5KU 1DUEA 1GHYH 3D62A 3SU5A 1LMWB 1EKBB 1D3PB 1QHRB 1IQLA 2IJOB 5JBTA 1ZSJA 1G36A 1YY3A 2PV9B 3T2NA 1YPKH 1K28D 1KMHB 3P17H 3BG4B 2BVRH 4IC5A 1CBWB 5ABWA 1HNEE 2V7QD 1VJ9U 1TAWA 1ZPZA 1LPGB 1SLUB 3GY5A 5IDKA 4U30A 5AFZH 3Q3YA 3GCOA 3MOCA 2FPZA 1ELAA 2Y81A 1E35B 1A1RA 2TGAA 2FX6A 1TABE 2BZ6H 4OS7A 5FPTA 1LVMA 3RXCA 1C1PA 1THPB 4RI0A 2M5TA 1A5HA 1E79D 3P8NA 4AORA 2PWXA 1FI8A 1O3PB 1O2TA 2Z94A 2F3CE 4B73A 1MAYA 3ATWA 4AB9A 4B6FA 2BX4A 1FIZA 3FN8A 4ACAA 1O2KA 1TALA 2BLWA 3ZZ4A 2ZGCA 1AU8A 2GX4A 2VIWA 4ABJA 1AE5A 1THSH 4XBDA 3OEED 1JRSA 3U8TH 3BTME 4IGDA 3MH4A 2NU3E 6GCHG 3RC4A 5FPSA 3QGNB 4CR5A 2ODYB 3M61U 4I8JA 1TYNA 3MO9A 1HUTH 4DURA 1EP5A 1C5VA 1HAVB 2CF8H 2Q6DA 4X1NU 1TNLA 4NZLA 4JZEH 2VWOA 3T29A 3Q3KA 5TCAA 2C3SA 1AIXH 1AUJA 3UY9A 1K21H 1OWEA 1SQTA 2QAAA 3SV8A 1A0LA 2ZI2H 1C2LA 1BTZA 3CP7A 1ZGVA 2FTMA 4ABEA 1TGBA 2H5CA 4IN1A 2OCVB 1BIOA 2JJ2D 2UUYA 2ZKSA 1S6HA 3SGBE 3PMBB 4HTCH 4X8TH 2ZCKP 1KY9A 4MDSA 2OC1A 1P2NA 2PTCE 1QQUA 1LHEH 1SGIB 5GCHF 1UCYE 4BAQB 4Y6DA 1GHWH 4NCYA 1MD7A 3SJ9A 3EE0B 1C1SA 3TJNA 1BMNH 1YLDA 1PPGE 1O32A 4INKA 2J92A 3AW1A 3MWIU 4BOHA 2HWLB 3P70B 4A5TS 4NIVA 1AFQB 4WMEA 2WPLS 3SYJA 1UMAH 1NFYA 2ZU1A 2FP7B 2ZHQH 3DCLA 4YOIA 4GPGA 1GJBB 1WUNH 1FN8A 1S6FA 4WJG2 2PR3A 2A7CA 3KQ5A 4AC9A 4HFPB 2VVVA 4WVPE 1K9OE 4CR9A 4XBCA 5DSFA 3EGKH 2F83A 4FUGA 5HM2A 3TJUA 4K8YA 3GY4A 1TWXB 5T3HA 1HPGA 2Y5FA 4UONA 3SGQE 1HB0B 3F3BA 3A7XA 2BXTH 4X6PA 5EU8A 4HGCA 1QB9A 1GGDC 3VFEA 1HGTH 4ZHMU 1DS2E 4AB8A 2M2AA 1FXYA 4I8LA 4OM9A 3ZZ3A 2JIZD 2ZU3A 3PTBA 5ETXA 1E37B 1GG6C 2KFWA 4GHQA 4ZXYH 3RXQA 6ESTA 4ZHAA 2A31A 1GMHF 1EAXA 1C5PA 2C8YB 1G32B 5FX6A 5DN6D 1O0DH 1CT2E 1NRPH 1C1WH 3VGCB 1SOTA 1T8MA 1YKTA 3D23A 3K65B 2TGPZ 2WYGA 1OWKA 5HMAA 5AVDA 1EOLA 4NSVA 5A8ZA 1TGSZ 1DM4B 1QGFA 3TH2H 1CSOE 2R9PA 2ZG0H 1BTUA 3DSGA 2QA9E 1HCGA 5C0UA 3O8RA 3I29A 4DW2U 1UVPA 2WINI 2HLDD 2J9NA 3SI3H 3FP7E 1D9IA 2VIDA 1VCPA 1GJ5H 1QJ7B 3VB4A 4YZUA 1ZJDA 3R0FA 1ORFA 1ESTA 1KSNA 1MZDA 1YLCA 4WWYA 2EEKA 1KXDA 2OP9A 1YPEH 3MO6A 1N6YA 3D65E 1FN6A 3RUOA 3ITIA 5DP3A 1O2IA 1O37A 1DE7H 2R2MB 4KTUA 5HKKD 1K1JA 1YC0A 2FZZA 4CRFA 2H2ZA 3FAOA 1OXGA 1GJ7B 3RXTA 4Y79A 1NZQH 1TGTA 1GBJA 1C1RA 4X8SH 2FO9A 3FZZA 2BLOA 4BXWA 3RXRA 1KXEA 5ESBA 4U2WA 1C4V2 4MPVA 4TY6A 3LGYA 2KR7A 1WQSA 1XM1A 2IOTA 1GI7B 4X1RU 1O3OA 2FOGA 1HAZB 1C9PA 1TLDA 1TQ0B 1S82A 2KAIA 1A0JA 2V0BA 4D7GA 3SUGA 2P3TB 2Z9LA 1AZZA 4CRAA 1QY6A 2VJ1A 2IN2A 5JDUB 2BY9X 3VGCC 2ZP0H 4HI3A 1ZSKA 4LZ4B 3T5FH 4DOQA 2FWWA 7KMEH 2FX4A 1ACBE 1RTFB 1BT7A 1UTLM 4VGCB 3M3SA 5K7RA 1EZXC 1P2OA 3DFLA 4B1TA 5EOKA 2WUCA 1GHBG 2XOKD 4CHAB 1V2RT 1H4WA 1ID5H 3PO1B 1BTYA 3TNTA 3S7HB 1KTTB 1S6LA 5DP9A 5DO4H 4F49A 1ABJH 2Y5HA 2KX4A 1HV7A 1ELTA 1SGPE 9ESTA 4FVBA 4AYVB 1UTPA 1VITG 1MTVA 1W0YH 1CE5A 1TBRH 3UOUA 2ZHDA 1UTOA 4I33A 4Q7XA 3EYDA 4B2CA 2PHBA 3ZZ9A 1FPCH 3BTQE 3Q77A 5J4QA 1O3GA 4RKOB 1V2UT 1LQEA 2BD9A 4KTSA 3ZZ8A 1GCDA 2Q6GA 2A4GA 1YYY1 3A8DA 3V3MA 1O3BA 1Z71A 2QF3A 1O3LA 1ARCA 3RXFA 1BRAA 2EI6A 1QCPA 2JDID 4UFDH 1DY8A 1A4WH 1PPCE 2D8WA
chains in the Genus database with same CATH topology
4E06H 5EG4A 4MPUA 1NRRH 4FUIA 4UDWH 1BCUH 2HNTF 2Q6FA 3S9BA 1BRCE 1HIAA 1J15A 2A0QB 3DA9B 1F0RA 3EA8A 1AVXA 5HXFA 3EA9A 1LPZB 1HAPH 1O34A 1GCTB 1P01A 1TRYA 4K60A 1C1OA 5GDSH 3SZNA 1GHAF 2G81E 2HRVA 4DG4A 2C8XB 3ZVEA 2K1QA 2HPQH 4CHAC 1MH0A 2F9UA 1EX3A 2V35A 3OSYA 1YP9A 3BTHE 1C5SA 3PM3A 2AMPA 7ESTE 1FPHH 1AVWA 4DIHH 4FXGH 3SUFA 1SFIA 5JBAS 2VVUA 1O3MA 3E1XB 4FUCA 1OWDA 4CRDA 3P8FA 3A86A 2ZCLP 1BA8B 3LU9B 1TBZH 2C93B 2A32A 2J94A 2ZFQH 4NA8A 4BTUB 3H5CB 3V13A 4CRBA 1GHVH 2Z9KA 1W7GH 1HXEH 1TGNA 1SL3A 2P3UB 1GPZA 2HGTH 1GI1A 1XKAC 3RXJA 2GT7A 2Y82A 1T7CA 1W0ZU 2HOBA 5TJXA 1OKXA 1H8IH 2QN5T 1NO9H 1HAHH 1UTKA 1YBWA 4XDEA 3SU6A 2FTLE 5DG6A 3FVFB 2SGPE 3BTWE 1S84A 3S7KB 4UD9H 3GICB 3F9EA 2P8OB 2GCTB 3TK9A 5C3NA 2F9OA 5G4BA 5FX5A 1O5CB 4FU8A 3JZ1B 4INHA 2A45B 1C5QA 3PV4A 4KTCA 1GVZA 3RXMA 1HAGE 3SNEA 1TMTH 2GV6A 1EZUC 2ZFFH 3ATLA 3A83A 3M7UA 8LPRA 2DUCA 2J34A 1V2MT 5BRRE 1P03A 2FOBA 1T8LA 1O3FA 2A2XH 1GJCB 2ZNKH 2OXSA 3E16B 1AKSA 2ANMH 1AB9B 1UVUH 1AI8H 1O2SA 5JB8S 1ZRBA 3M7QA 1QR3E 5DGJA 1GJ6A 5LPEA 2I6SA 6CHAB 4ZKRU 2ZU4A 4YT7H 2Z7FE 3DUXH 5A09A 1C5MD 5GCHG 4WF8A 1UTMA 2PW8H 3H7TA 1SOZA 3SW2B 3CS7A 1O5BB 2VH6A 5C5OA 3P8GA 5FXLA 3RC6A 2CHAC 1V2PT 2XWAA 1YPGH 4CRGA 1UK4A 2PKAB 4FUFA 1BUIA 1F5RA 2HNTE 2BM2A 4WXIA 2XNIA 2VINA 3MNSA 1O2PA 1TBQH 4I32A 1P3EA 2BD7A 2J2UA 3LC3A 1EATA 2Z3EA 1GMDF 1NS3A 1O3HA 3A85A 3KNXA 3LT3A 3RXOA 2VIOA 5L2ZH 1ZGIA 4Y8XA 1TNJA 1ELVA 1LHFH 3A8AA 1ZMJA 1KDQA 1E38B 3ZZDA 4UFGH 1P9UA 4WXVA 3KF2A 4YOGA 4TWWA 4B2AA 3P8OA 2QYIA 2GCTC 4MPWA 2W7SA 1KLTA 1WSSH 2Q1JA 2V6NA 1G3DA 5DJ7A 1YGCH 3SJOA 3F9FA 1ANBA 1BBRE 3BTKE 3F1SB 1WU1A 2J4IA 3OTJE 1O2HA 1EPTA 1CHOF 2VWLA 3SU2A 1DITH 4AFZA 1BHXB 1QBVH 1MZAA 1P11E 1PJPA 2FI3E 1O36A 3LJOA 1EJAA 1GI5A 4KP0A 5A0BA 2GV7A 1LVOA 4ASHA 1VGCC 1DWDH 1B0FA 4MNWA 4X8UH 1W11U 1GBEA 1GBKA 2NWNA 3ZZ6A 1BTPA 1SLXB 2J38A 1SSXA 2ZCHP 4MNYA 2AMQA 1C5NH 4A92A 1O5EH 5FBIA 1GJ4H 2P16A 3B9FH 3DT0H 1W10U 2EA3A 1K2I1 1ZRKA 3MU0A 4FUHA 4BXSA 1P9SA 1BTXA 4MVNA 2Z3DA 3VXFH 3NCLA 1SGYE 2BDCA 1O3CA 3EDXB 1S5SA 1FV9A 1TNHA 1PQAA 1QTFA 3SU1A 4AOQA 4O3TA 1O2OA 2AGEX 4BAHB 3HGPA 1G3CA 5FPYA 1O3EA 2QY0B 3DD2H 1Z8IB 3KQDA 3SI4H 2ZFRH 4K1TA 5A0CA 2GMTC 1GVKB 1FONA 3SHAH 3ZVFA 1F5LA 1O5AB 3L3TA 1LCYA 3FANA 4E7NA 4ZMAH 1UVTH 2YNBA 4THNH 3TITA 3S9CA 4Y8YA 2WYJA 4KKDA 2ZQ1A 5I25A 1AUTC 2BY8X 1P57B 3T26A 3SU0A 1L4ZA 3T62A 4K8BA 1NM6A 2BDYA 4I8HA 3A8CA 2STBE 2O8UA 5PTPA 1GMCG 3MH6A 1RJXB 1RS0A 2SNWA 2P95A 1CT4E 4H6SB 1QNJA 2ZFSA 5C2ZA 3SU3A 3GY7A 3RXLA 1KXFA 4X2WA 5JBCS 1A2CH 1W8BH 3ZZAA 1AMHA 1VZQH 3VB7A 2CMYA 1UVOA 3QTOH 4K1SA 1DT2A 2QGRA 1IQGA 1QFKH 1UO6A 1O38A 2OINA 3BEFB 1G3EA 4CREA 2R0KA 1C1TA 3P6ZB 3KL6A 1GWAA 3A7YA 3A8BA 1OYTH 3PYHA 2WV5A 3QZRA 1IHTH 3VB6A 1G3BA 1GGDB 1TMUH 2UWPA 4JK6A 4IS5A 1JOUB 2BHGA 4E7RG 4K1EA 3SJKA 3U8OH 4A1XA 3SU4A 1GG6B 3SN8A 4B2BA 3AASA 1C5WB 1OP8A 3TGIE 1DX5M 2G8TA 1O2VA 1MQ5A 1TFXA 3MFJA 1O3IA 2HPPH 3RM0H 5EPNA 1HAYB 2FESH 1J17T 3WY8A 2ZDLA 1FAXA 4IBLH 1A0HB 1T32A 2FLBH 3UIRA 2XBWA 2TRMA 5TCCA 2SGEE 3GCHC 5K0HA 3GY3A 3MU5A 3IWMA 3Q00A 4DCDA 1NN6A 1J16A 3SUEA 2R2WU 2WV4A 4A1VA 3L33A 2LNCA 1OWJA 1U6QA 4LZ1H 3SORA 5L30H 1ELFA 1MTSA 1EAUA 1O39A 3AW0A 3QK1A 2PLXA 2YNAA 2AGGX 1ELBA 3PWCA 2G52A 1B0EA 1E0FD 4NA9H 1YPHC 2ANYA 3TPIZ 1P05A 1CHGA 4AGKA 2ASUB 1IQJA 1L1NA 2G4TA 1SGTA 4XBBA 3TIUA 5E0HA 4AZ2B 1V3XA 3DFJA 1MKWK 1Y8TA 3UWIA 4ABDA 1FIWA 3MNBA 1O2JA 3U1IB 2A7HA 2XCFA 2W7UA 2XYAA 4GCHF 1SG8B 2D26C 2VWNA 1C2EA 3Q76A 2FMJA 2BXUH 4YLQH 5C20A 1W12U 2TBSA 1ARBA 2Z6BD 4AG2A 1C1VH 1O35A 4GLYA 5T6FA 1UVSH 1BMAA 4GAWA 4I7YH 1QURH 3KQEA 2OUAA 1S0RA 1K1LA 1SGNE 1BMMH 1TOCB 3TJVA 1XVMA 5CMXH 3NUMA 1A5GH 1Y5UT 4ZHLU 3BEIB 2XBYA 1GVLA 1IQHA 3UUZA 3UFAA 5DPAA 3M7TA 2BTCE 1QIXB 1Z6JH 5EQQA 1QBNA 3K2UA 4AGJA 1CA0C 1MCVA 1CVWH 3T28A 1PYTD 1BQYA 4ISLA 2BVSH 3A84A 1AQ7A 1NROH 1TA6A 5A8YA 1BB0B 1Z1JA 1LVYA 2OC0A 3RLWH 3B8JA 1TOMH 1X7AC 3GCNA 1C1QA 3RP2A 2AGIX 1C2JA 4J1YA 2AIPA 1YPJH 3T27A 2Y80A 2AERH 3ODFA 5SGAE 3CS0A 1V2JT 1ETTH 2BDAA 3H7OA 2GCHF 1JRTA 2G00A 1PPBH 2GT8A 2O9QA 2AIQA 3BTDE 1PQ5A 3LGTA 1HXFH 3MU1A 4AFUA 7GCHG 1LTOA 5GXPA 1SQOA 1XUGA 1EPTC 1S0QA 4ABGA 4BAMB 2B9LA 3AVZA 1TMBH 3D49H 3NPSA 1QBOA 1GDNA 3RLYH 1ELCA 5FBEA 1V2ST 4JYUH 3PMJA 2PUXB 3E6PH 4Y71A 2OD3B 4D9RA 3VPKA 2R3UA 1TPAE 3E3TA 2Y7XA 1IQFA 3LH3A 4Q2KA 2R0LA 5EXMA 4DGJA 1TGCA 2JH6D 3TH4H 1YPHE 2GVFA 2AYWA 3L6PA 3E0PB 4X1QU 5AF9H 2BD5A 2ZU5A 5A2MH 4O3UA 3OY5U 4CBNA 5E8EH 1XVOA 3RXBA 1AD8H 1NFUA 5IYTA 1NPMA 1CGHA 1V2QT 1C5UA 3BG8A 1SPJA 4YO9A 1C2MA 3E91A 4ZAEA 2ZDMA 1O2ZA 1TPSA 3KHVA 3OU0A 2JETB 2GZ9A 3TLOA 3M5OA 1IOEA 1V2LT 1PYTC 3UR9A 1ZPBA 1BDAA 1GMDG 2XXLA 1Y3YA 2BQ7B 6GCHF 3A87A 2ZDKA 3BSQA 4AN7A 3GOVB 1H9HE 3M3VA 1GBCA 1LHDH 3GY2A 2ODQA 2PGQB 3I77A 4A6LA 4MQAA 1O5FH 1OWHA 3F9HA 5GJ4B 1SGFA 2OTVA 4JCNA 1QQ4A 2C4FH 5DKMA 1LO6A 1H9IE 4ZXXH 1ANDA 3QTVH 2ULLA 2ZTZA 3MU8A 1LPKB 4GVUA 1UCYH 2FYQA 1P02A 4NIXA 2F9VA 3PLBA 2QXIA 2DE8A 1SC8U 1ABIH 3KQBA 1DXPA 2OBQA 3BIVH 3GYLB 3P92A 1DFPA 1C5OH 1MKWH 1DSUA 3HPTB 2SGAA 2FIRH 1HAIH 1Z7KA 4JZFH 2VNTA 3GY8A 5FCKA 1TRNA 1T4UH 5F8ZA 2P59A 4IMQA 5HYOA 4RN6A 5DP4A 1ELGA 1AN1E 3O8DA 4UFEH 3ZVDA 2ZHFH 1V2TT 1PPEE 1EOJA 1O30A 4O9VA 4OGXA 4AG1A 1FY4A 4K69A 2HNTC 1ESBA 3SOSA 2BMGB 1BZXE 1D3TB 4X6OA 1C1UH 2IPHA 3QZQA 5I46H 4NIYA 2VB0A 2JETC 2ZWLH 3RXDA 1XUFA 1DY9A 2RA0A 6LPRA 1GDQA 1SI5H 1SGFG 2WUBA 1LVBA 3ZZ7A 1BMLA 1O2UA 1GBAA 3FZDA 1ZTKA 3SGAE 2TGTA 4JYTA 2PSXA 4Y7BA 3C1KA 2FI4E 4ZKOU 2WPIS 1OWIA 1F2SE 3C27B 3URDA 2FOEA 2H1UA 4BTIB 3KGPA 3TK6A 1IAUA 3HATH 1GJAB 4Y11E 4NGAH 1JMOH 1MTUA 4GSOA 1EJMA 1LKAA 2LPRA 2QC2A 1GHXH 1DWCH 1PFXC 1QA7A 2CXVA 1ANEA 3GCTF 1WV7H 2G5VA 2CHAB 4M7GA 3VXEH 1B5GH 2H9EH 4WY3A 2P94A 1LHGH 1TQ7B 1Q3XA 2FEQH 2BOKA 4R0IA 3MNXA 5F03A 1CT0E 1A7SA 1L2EA 3MU4A 2ILNA 4WH6A 4LOYH 1RRKA 2B8OH 1SGEE 1F0UA 4Y8ZA 1W2KH 2UUKB 2BQ6B 1V2NT 1TPPA 1O3DA 1XUKA 2JKHA 1O5DH 1O3KA 1Z6EA 2A4QA 2XWBI 4NG9H 2BDGA 3RXAA 2ZZUH 1KTSB 2CJIA 3RXVA 1JXPA 3MH7A 1IHSH 1GI2A 3TVJB 4I8GA 2XBVA 3FFGA 4DIIH 3SQHE 3HKJB 1GJ9B 1FLEE 1OS8A 3ATMA 3SNAA 2BLQA 1ZZZA 4GUXA 1IQIA 3ZVGA 2RG3A 4Q7YA 4Y0ZE 1W7XH 4KGAA 4PROA 2OQUA 3HKIB 4JZIA 3UQOA 1S83A 3ELAH 2RA3A 1UTNA 5JB9S 3FP8E 3BTGE 2JH5D 1EP6A 2UWLA 1W14U 4BTTB 1ELDE 1VGCB 1EUFA 2NU2E 2KAIB 5AFYH 4ABHA 2JH0D 4ABFA 1TPOA 3IG6B 2QV1A 2FDAA 3OYPA 2O8WA 1ZMNA 4H4FA 5A0AE 1HAVA 1CQQA 1O3JA 3F9GA 3ZYDA 3RDZA 4DVAU 4K3JA 5FAHA 3UNQA 2XBXA 4NFEA 1GJ8B 4SGAE 1P09A 5FCRA 1OP2A 2EI7A 1T31A 4KELA 1EAWA 1GL1A 1AWHB 1C1MA 4MPXA 4TY7A 1INCA 1ESAA 2RCEA 2BOHB 2CN0H 4ZH8A 2WPJS 1P2MA 5E2OA 1G2LA 2GMTB 2I6QA 2WPMS 3ATKA 1DANH 2VIPA 3URCA 1FJSA 3ZV9A 1WQVH 4IW4E 3UR6A 1OP0A 4UEHH 1ETRH 4X2VA 4FVDA 4YT6H 4BAKB 1JIMA 1GBDA 2BB4A 2BVXH 3SJIA 2BQWB 1GHBF 3KIDU 5H4IB 4JZ1A 1HAXB 3UREA 3I78A 2A4OA 2ZPRA 4JZDH 2GP9B 1N8OC 1Y3WA 4NWLA 1MTNB 1K1NA 3QDZB 3ZVAA 4OS2A 4Y10E 2XC0A 2PKSC 2RDLA 3ZZ5A 2GGVB 4ZKNU 1NRSH 1N6XA 2Y6TA 1F0SA 5ESTE 3KCGH 2GKVE 1QRXA 1M9UA 4JYVH 3BTEE 3TU7H 1BTWA 3P95A 1EAIA 1GBFA 2B7DH 1RD3B 2ZFTA 1J14A 2VH0A 1NFXA 1GI3A 1TRMA 4FUJA 1Y5AT 3BV9B 1GMHG 1IQMA 1RIWC 1Y3VA 1YCPM 1HIAB 3MH5A 4X6NA 4ABIA 3UPEA 4INLA 1O5GH 2ZHWH 1GI8B 1RGQA 3A88A 2PTNA 3GISB 3MO3A 4Q7ZA 1DOJA 1O2MA 1QL8A 1GL0E 2OLGA 3SHCH 1C5XB 1DLKB 2UUJB 4TYDA 1WCZA 4MNVA 1QL7A 1UTJA 2GZ7A 5LH8A 3NKKA 3JZ2B 1NT1A 1V2WT 1AO5A 2GTBA 2VU8E 5HM9A 1HJAC 3EA7A 2W5EA 3U98H 2ZDAH 1O2GH 3LDXH 3A89A 4I8KA 4FUBA 4A1TA 2QF0A 1C2FA 5F8XA 1ZHPA 3GY6A 1AY6H 1KXCA 4ZUHA 1OX1A 1SQAA 3SNCA 5HGGA 4X0WU 1J8AA 5EW1H 4FUDA 2TIOA 3A7WA 1EZSC 2VVCA 2AMDA 3SJ8A 3EQ0H 3S9AA 3LH1A 3QWCH 1SGCA 3TJOA 3SBKA 1BRUP 2GZ8A 3MYWA 1MUEB 2PFEA 4JMYA 3GCHB 2BD4A 3UOPA 1QL9A 1RTLA 5B6OA 1P2KA 2ZFPH 4OS1A 1FY1A 4ABAA 1O2LA 4A7IB 2XRCA 3PLKA 1MTNC 5T6DA 1NY22 3A7VA 3TGJE 2F91A 3PB1E 1Y59T 2AS9A 2D1JA 1LHCH 3B23B 1HFDA 3RM2H 1FDPA 1P12E 4HZHA 2HLCA 2A2QH 1K1OA 1SGDE 1BOQA 2H9HA 1TE0A 2ZTXA 1SGRE 2WPKS