2OTVA

Crystal structure of the complex formed between bovine trypsin and nicotinamide at 1.56 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Crystal structure of the complex formed between bovine trypsin and nicotinamide at 1.56 A resolution
rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2otvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2otvA02
2Z3CA 3SUDA 1C9TA 2TIOA 4Z6AH 1NT1A 1MTVA 5DKMA 3CS0A 3SHAH 1TABE 1ZHRA 4X2XA 2HNTE 1MTNC 1NS3A 2BY6X 1BMAA 3P17H 5FPSA 2BTCE 1GHZA 3RMNH 1AUJA 1GDNA 1MTUA 1V2JT 1NU9A 1MH0A 1P3CA 1GI9B 1O3FA 2VWNA 3P8OA 4FVBA 2AERH 1OWDA 1B5GH 4LK4A 3GY2A 4DVAU 3ZV9A 2CGAA 3TK6A 1C2GA 2GV6A 2F3CE 3V13A 2FOEA 1THSH 3UNSA 2ZFQH 4YESB 2ZFPH 1HAYB 3ZVGA 1ELGA 2RA0A 4J1YA 4JK6A 1C5OH 4UD9H 1TPSA 3FP8E 1GI4A 3DA9B 4O3TA 4ZROA 1GJCB 1G2LA 1S84A 3RXCA 3SU2A 1PYTD 3ZVDA 1EPTA 2J4IA 1F5KU 3U69H 1A7SA 3PROA 1TAWA 1XX9A 1F2SE 9LPRA 4U2WA 3EA7A 5L2ZH 2ZDMA 1HXFH 1HJAB 5T6DA 1O2GH 2BXUH 3PMAB 1GI2A 4M7GA 1XKBC 1DY8A 5FPYA 3W94A 5C20A 2I6QA 5IYTA 2NU2E 2VIDA 1BMMH 4BAMB 3NCLA 2Q6GA 4E06H 1TB6H 1KDQB 3KN2A 1E34B 1CGHA 1MAYA 3STIA 4I8KA 3RXJA 3E3TA 3KIDU 4GHTA 4Q7YA 3SQHE 5A8ZA 2XC0A 1MBMA 1Q2WA 1GGDB 1KLIH 3M37A 1LQEA 2FOCA 1TNGA 1KXEA 1P9UA 1RFNA 1YLDA 2QY0B 4ISNA 4OS5A 3SO3A 2Y80A 2HOBA 2IN2A 1DOJA 3BTHE 5EQRA 1ZYOA 2K1QA 1O2NA 1GBIA 3PYHA 1SGRE 3QN7A 2AH4X 1FPCH 2ZDVH 2ZC9H 4MNVA 1GJAB 3P92A 5SGAE 3EA9A 1QURH 3H7OA 5FHTA 1GHXH 1MAXA 1J16A 1O3JA 3A82A 2BHGA 3PMJA 1E35B 1O2XA 4MPWA 3D65E 1Y59T 3E16B 1FIZA 1KXAA 2HALA 1C9PA 1AD8H 4I8JA 4IC5A 1AB9B 1ESBA 1PQAA 3ZZCA 1V2ST 1O2IA 1OOKB 4JZFH 5GDSH 1W14U 2CMYA 3TH3H 4JZ1A 1NRQH 2J38A 2TGTA 3MH7A 1P01A 3UR9A 4WMEA 1ZPCA 1GI6A 2CF9H 3BG8A 1NFXA 1QCPA 2V3HH 3MWIU 2ANWA 3JZ1B 3PMHB 1VR1H 3A7WA 1P03A 1DWEH 2A32A 4ZKSU 2ZHEH 3MI4A 4THNH 1LHEH 1G3BA 1YPGH 3NWUA 2R2MB 2ZDKA 1O3AA 4OS1A 1NZQH 1FAXA 1TNKA 4MDSA 1NC6A 1BTXA 1S83A 2PR3A 3SBKA 4BTIB 4CH8B 1GBHA 1QY6A 3PO1C 3ZV8A 3BEUA 3HPTB 2PSYA 4X1SU 1YCPH 4K1TA 5E8EH 1UVOA 3MU4A 2ZG0H 4DW2U 2PGBB 2ALVA 2GGVB 1TGNA 5ABWA 1UVUH 2PKSB 3GDVA 3OU0A 1QR3E 2PKAA 5GCHF 1P12E 4D7FA 1G37A 3B8JA 1LPGB 1GI0A 4JMYA 1DE7H 2Z6BD 5FBIA 1P2OA 1SSXA 7KMEH 2XNIA 1EZSC 1UCYE 3I77A 1O2JA 1K21H 1FN8A 4ZHMU 1BUIA 1V2KT 3TPIZ 4X2WA 1BJUA 3BF6H 2QGRA 2ZEBA 1GBCA 2BOHB 4ABDA 1OWHA 1EB1H 1TGTA 2ANYA 5F8ZA 2ZIQH 2ZTYA 5FPTA 1QBNA 1TPPA 4OS7A 3A89A 2C90B 1RS0A 1TPOA 1RXPA 1ZRBA 5JYIA 1DPOA 1UK4A 3SUGA 3RU4T 1FONA 2GVFA 2PW8H 3T2NA 1AFQB 1OYTH 3HGNA 2FEQH 1NFUA 2B0FA 1P2NA 4TYDA 2ODYB 3EGKH 1T31A 2A5KA 2FZZA 4Y8YA 2R0LA 4X6NA 4BTUB 1ZJDA 3ZZ3A 1Z8GA 1O2WA 1Z6EA 3SI3H 1SGFA 2OP9A 1A0JA 3LC5A 2GX4A 4NFFA 3M35A 1V3XA 1Z1JA 3KCGH 3PLPA 5I46H 2BVRH 3M61U 1FY1A 2O9QA 4Y11E 3K6ZA 2RG3A 1LHFH 3SU3A 1QRZA 3K65B 3LGYA 2WV4A 3GCHB 1BRCE 1ESTA 2A1DB 2BDYA 4Y0ZE 1GBDA 1ELAA 5EW2H 3A7ZA 2UUKB 1UK3A 3VPKA 4HFPB 1UTPA 4YT7H 1ELVA 2R2WU 1C4U2 1DXPA 5JB8S 1HJAC 5DJ7A 1YC0A 3SHCH 2ILNA 1ESAA 2O8TA 5GPIB 1O3LA 3BTQE 1TRYA 1LO6A 2D8WA 1GI7B 3F9HA 3U1IB 1PPZA 1Q31A 1V6DA 4GSOA 1ID5H 1BTZA 2ZQ2A 4H4FA 3DFLA 2GT8A 2HPQH 1CBWB 1ZR0A 2XBXA 3Q00A 3RXAA 1WQVH 4GVUA 3BSQA 4O3UA 1FUJA 4FUIA 4FXGH 1WV7H 3BEIB 4U30A 2ULLA 3RDZA 1Y5UT 1H8IH 1A3EH 1O3NA 2R0KA 1SG8B 1C1TA 1GI8B 1GGDC 1LPZB 4DCDA 4JYTA 4CRCA 3KNXA 3SQEE 2C8ZB 4Q80A 3NZIA 4ZMAH 2A7JA 1BB0B 3ZZ6A 3SUFA 1TOCB 1CT0E 1ZTLA 1BBRE 2ZU3A 3ZVCA 1DLEA 2ZDLA 3E6PH 2VVUA 1PPHE 2ZFSA 3R0FA 5AFYH 1ZLRA 2VIOA 3PLBA 1YPLH 3F9FA 3LGTA 1O2HA 2KAIA 3A86A 3QTOH 3MO3A 1AB9C 3SNDA 3U1JB 2VGCB 1QL7A 5AVDA 4ISIH 3SJKA 4R8TB 2BLWA 1GVKB 2PFEA 1ZSLA 1TQ0B 1GDUA 1P3EA 2GKVE 3IG6B 4LZ4B 1DLKB 2R3YA 3QTVH 1EAWA 3LIWA 5CHAC 3S7HB 1C1VH 4X1RU 1BJVA 5A8XA 2ZGCA 2C93B 2F83A 3A81A 2A0QB 3M5MA 1YPMH 5EXMA 1BRAA 2J94A 2ZDAH 2FTLE 1OSSA 5IDKA 1MQ6A 3ATMA 6CHAB 5G4BA 4MQAA 2B9LA 1TQ7B 3A87A 2QV1A 1WTGH 2GD4B 3LJOA 2FOFA 1P2MA 4HI3A 2P95A 2P59A 5GCHG 1C2KA 4FVDA 4GHQA 3P8NA 4DOQA 1O5EH 5DK1A 4WWYA 4IN2A 2ZTZA 3RLYH 1QQ4A 2PKSC 3QZQA 3ZVFA 3LONA 1ACBE 1GCDA 2XW9A 3SI4H 4XBCA 1XUJA 3MFJA 1QA0A 1TBRH 1PPEE 2FS9A 2A7HA 4YOJA 1EOJA 1V2QT 5FX5A 1WUNH 2ZHFH 1ARCA 4NIXA 5F8XA 2VU8E 2ZGJA 2DE9A 2ZNKH 4X1QU 3ZZ9A 4YT6H 4VGCB 5JDUB 1RTLA 1INCA 4JYVH 3KQCA 2ZGXH 1O3HA 3M5OA 4DG4A 3BTGE 4ZHAA 2BD5A 2DUCA 1THRH 1GHBG 1T8LA 1NESE 5J4QA 3GY4A 4KTSA 1QGFA 4TPYA 3PWBA 2ZTXA 1ZRKA 5FXLA 1VCPA 2A5IA 1AHTH 1PPCE 1Z8IB 3P6ZB 3FZDA 4HGCA 3RXDA 2A4RA 1AFQC 3Q3YA 3SU1A 8ESTE 3M3SA 1ZTJA 6ESTA 2RCEA 4CBNA 2CHAB 1O3MA 4WMFA 1GBJA 2OQUA 5DP5A 1GL0E 4MPXA 3TH2H 1LHDH 1EZXC 4ABBA 1DWBH 2BQWB 1V2VT 2BX3A 1A5HA 3RXEA 2VVCA 1MU8B 1NFYA 1D3TB 1BDAA 4CR5A 1O3KA 3U98H 1BRBE 1GMHF 3GCHC 2PTNA 2BXTH 1AE8H 1OP8A 4NIVA 1S0QA 1SI5H 2AS9A 4LZ1H 4IW4E 1E36B 1UO6A 5BPEA 3SOSA 1V2OT 1MQ5A 3Q3KA 2QXHA 3SORA 2B5TB 3SNAA 4AFUA 3UR6A 1IHTH 1MD8A 1VZQH 4CRGA 3KHVA 4WH6A 3MNBA 4TPIZ 3Q77A 4I33A 4O97A 1XUGA 3I29A 1ELBA 1O2UA 3PV4A 1H9LB 1C5RA 4X8TH 3T26A 3MNCA 3L33A 5J4SA 2ZCLP 1TX6A 1CBWC 1BBRH 1XXDA 4JCNA 5C1XA 4IGDA 5LPEA 1PQ8A 3D23A 1B7XB 2VH0A 4XFQA 2A5AA 1VITH 1C5TA 1TA2A 1C2MA 1NFWA 3AASA 3K9XB 4DIHH 1F5RA 3EQ0H 3A84A 3MNSA 1AVXA 3EA8A 1GBKA 1SFQB 2QF3A 1SOZA 3M5NA 4GCHG 3LOXA 3N7OA 4X6MA 4TWWA 4FUFA 2PKAB 1HYLA 5JBTA 2VIQA 1OYQA 2Z9LA 2GT7A 1NRPH 3S9AA 2C8WB 1EB2A 1A61H 1H9HE 2Z9JA 2SGFE 2ZGHA 4H6SB 2WYJA 2R3UA 3BIUH 1ZPZA 3UTUH 2Q6FA 3CP7A 2PWXA 1A1RA 2SGPE 2C8YB 2VNTA 4JZIA 4BAQB 2OC1A 2CJIA 5HM2A 5CMXH 2VINA 2VGCC 2A4OA 5EU8A 2HVXA 1G2MA 3MYWA 1BTHH 4MPVA 1O3CA 2XWBI 3GICB 1TX7A 3Q3XA 5TCCA 3SNBA 1FZZA 3RXPA 1QBVH 1ZMNA 1AI8H 2FWWA 4D9RA 2FX4A 1IQJA 3DFJA 2ZPSA 1TRNA 1GBLA 1GI3A 4XE4A 3ENSB 3UUZA 2Z9IA 3TGKE 1V2MT 5FBEA 2UWPA 4CBOA 2FDAA 3SNEA 2IJOB 1O31A 4UFEH 4X1PU 6CHAC 1H9IE 3UOPA 4WMDA 1P2JA 1SQTA 1G3CA 3I78A 2CXVA 3F9GA 1SB1H 1SGDE 1YGCH 2FODA 6GCHF 2AEIH 1JOUB 1G36A 2G4TA 3KQDA 5E0GA 5C67A 2Y5HA 3SZNA 5DG6A 4DJZB 1EPTC 1EASA 4TWYA 4ABGA 1XXFA 1O34A 4CRBA 2AGEX 5LH8A 1SR5C 2G8TA 1EQ9A 4AG2A 1HDTH 3UQVA 1C5SA 1LKBA 1VCQA 1GI1A 1O2OA 3E91A 1IOEA 2V35A 2H5DA 3LGVA 2TGDA 1DWDH 4VGCC 1FY5A 1BMNH 1DWCH 1T8MA 4A92A 1V2WT 2F9BH 1YCPK 1GDQA 1FXYA 3RXHA 5JBCS 4Q7XA 1SGEE 2JH5D 3V3MA 3PB1E 4GPGA 1QFKH 1Y3UA 5HMAA 1UHBB 4X8VH 3RLWH 1JRTA 2TBSA 1GPZA 1SGQE 3EYDA 3ZZ4A 3OTJE 1DSTA 3HKIB 3ZYEA 1BMLA 3C27B 3M3TA 1C1PA 2JH6D 5DO4H 1ELFA 3A85A 3T5FH 1GMDG 2Z94A 1TOMH 2OBOA 4K60A 5FCRA 3FZZA 1EP6A 2QXIA 3RXVA 2CHAC 2ZPRA 2ANKH 1VCWA 2F9VA 2PSXA 4RN6A 2Y81A 5E0JA 1C5XB 1ABJH 1O3EA 1O2TA 3ITIA 3SJ9A 4BXWA 1UTNA 1GMHG 3ATLA 3ZZDA 2C3SA 4UE7H 1EJNA 1QL8A 1C2LA 1KXBA 3SJ8A 1KLJH 1GVZA 1LCYA 1G30B 3RM2H 4GUXA 3T25A 3S9BA 1F0UA 1BRUP 4E7NA 2KAIB 1LDTT 1BTUA 4I31A 1GBTA 4OS4A 3SV7A 2NU3E 1QJ7B 1ZTKA 4Y10E 1DITH 2AMDA 3U9AH 3UY9A 5CHAB 2GCTB 2GDDA 3M7TA 4XDEA 1GVLA 1HXEH 3ZZBA 2TGPZ 3DHKH 3TIUA 1QHRB 1FY8E 1GHVH 2BM2A 3A8CA 1TBQH 2ZHQH 1TLDA 4Y8XA 1L4ZA 2P16A 4A1TA 1O2RA 4WVPE 2OTVA 1FI8A 1QBOA 1NM6A 3O8DA 2XWAA 3R3GB 3GY6A 4YTAA 1MUEB 2OLGA 2D26C 1GJ8B 1HUTH 1N1LA 3BTKE 1H4WA 4AYYB 4AGKA 3SU5A 3RXUA 2P3UB 3SV2H 1C4Y2 1GMCF 4UDWH 3VEQB 3RC4A 1H8DH 4I7YH 1TPAE 2BY9X 3QZRA 1VGCB 1AN1E 1T8OA 1MTWA 2FYQA 3RC5A 1O3DA 3F68H 4B73A 2ZPQA 1L1GA 1BITA 1AGJA 4HZHA 1XUKA 5DP4A 1AE5A 5GXPA 4NFEA 1G32B 2EA3A 3MU0A 4QT8C 2F9OA 3T29A 1N6YA 1HIAA 1LPKB 1YKTA 2FO9A 4KKDA 3RC6A 1TNJA 1TGBA 4FUJA 2EI7A 1ZPBA 1D6RA 2QXJA 2W26A 1FDPA 1EAUA 3RXBA 4CRFA 2FXRA 1S85A 2FLBH 2QXGA 2VVVA 1WYKA 2AIPA 1W8BH 3LJJA 1KIGH 1Y3VA 1GJ4H 3LH1A 5C3NA 5FCKA 4A1XA 3RXMA 3TGIE 1DICA 2AGIX 2C8XB 5EXNA 1DUAA 4WXIA 4B2AA 3E1XB 3UNRA 1UJ1A 1LHCH 4AFQA 3IWMA 1HNEE 1ZZZA 4F4OC 3WY8A 1QJ1B 2J92A 3GCTF 4B75A 4FU9A 3DD2H 1KLTA 4Y76A 2XBVA 3RXOA 6GCHG 2ZCKP 4AYVB 4RKOB 1AKSB 1O32A 1ARBA 1CQQA 1CT2E 1K9OE 2GDEH 3K2UA 2Y7XA 2F9PA 3UREA 2ZFTA 3ZVAA 1ELCA 1C2EA 2O8UA 2OBQA 5H4IB 1M9UA 3BN9A 2SNVA 1Y8TA 4IN1A 3SW2B 4D8NA 3SGQE 1C1OA 3P70B 5A0CA 1XUHA 3RMLH 4LOYH 1BHXF 3L3TA 8KME2 1ZMLA 1H1BA 2BDGA 2G51A 3C1KA 3D49H 3ZVBA 3EAJA 1O35A 1QA7A 3A7XA 1EAXA 2AYWA 4MTBA 3RM0H 4JZDH 5FX6A 4K69A 1OWJA 3GY3A 1SLVB 2JETC 5L6NH 1AVGH 5DP3A 2SFAA 3U8OH 3HGPA 1OX1A 2UWOA 3MO6A 2AIQA 3UIRA 2H6MA 1XUFA 3M36A 2WV5A 1A0LA 1K2I1 2PHBA 3ESTA 1ZHMA 3RMMH 4FU7A 5DPAA 1QB1A 3QUMP 4F49A 1T4VH 2GV7A 3LT3A 1UMAH 5HM9A 3GY7A 3QGNB 5A8YA 3GCOA 1G3EA 3A80A 3O8CA 1SBWA 4H42U 4NCYA 1FY3A 3BTWE 3PM3A 4WXVA 2G52A 1AU8A 4NZLA 2ZHWH 1O2PA 5A09A 1LHGH 3TJVA 3SJOA 5E2PA 2ZU1A 4KGAA 3QK1A 1TFXA 2VWOA 4FUHA 2ZI2H 1ZOMA 1HAVA 1DDJA 4Y8ZA 1T7CA 1V2RT 2G81E 3PTBA 4X6OA 1MBQA 3KQEA 2SGEE 3GYLB 3GCNA 3UPEA 1Y5BT 2YNAA 2XRCA 4NA8A 3GOVB 2QF0A 2H1UA 1F0TA 2XTTB 1G9IE 2BB4A 1SL3A 2C4FH 2ZU2A 3TGJE 1CHGA 1QRXA 3FFGA 3FAOA 1AMHA 2FX6A 5EW1H 1CT4E 1QB6A 3VB7A 1YPEH 4GAWA 1JBUH 1HRTH 2GCTC 3S69A 1MZAA 1O36A 1GHAF 1MTSA 3VB4A 4UONA 2W7SA 1NY22 1WOFA 1QQUA 3MH6A 3NK8A 3GISB 1YF4A 2F91A 1MKXH 1LVBA 2FI3E 3UNQA 1NPMA 3U8RH 1TE0A 1YPHC 4ZKRU 1BOQA 1KXCA 2VB0A 1J15A 1UCYH 2VJ1A 5LGOA 1RD3B 2Q1JA 3OYPA 5DP7A 4ISHH 2PGQB 1MD7A 4BAOB 1TYNA 1D9IA 2LPRA 3SU6A 4D76A 2AMPA 1GL1A 3VGCB 1SMFE 2BDCA 4A1VA 3TITA 1NRNH 2ZU4A 2ANMH 4CH2B 1CA8B 5F8TA 1DUEA 1OP0A 1P2KA 1EPTB 1YPJH 1F7ZA 2A2QH 5HYOA 4DURA 1VGCC 1SOTA 1RGQA 1TONA 1UTLM 1KTTB 1OP2A 7LPRA 4HTCH 4WH8A 3TJUA 4YOGA 2O8MA 2ZHDA 1ANCA 1Z8JB 1S5SA 3IITA 1TX8A 1CGIE 3M7QA 3QLPH 4SGBE 1A5GH 4PROA 2AFQB 1ZGVA 3RMOH 1PFXC 1P05A 4Y0YE 4ABAA 1BBRK 4AN7A 2Y6TA 4FUDA 1C5NH 1W7GH 1Z1IA 1K1NA 2FOAA 1AZZA 1IQNA 1EATA 4AOQA 3SGAE 3MO9A 2BY7X 3MNXA 2VIPA 1HFDA 3MMGA 3RXIA 5C1YA 5HGGA 5JBBS 5GJ4B 2UUYA 4AB8A 1FNIA 4WY3A 2SGDE 1RIWB 1VITF 3GCTG 1O3PB 1D3DB 1KTSB 2V3OH 1RTFB 3T28A 1YM0A 3NXPA 3K6YA 4BTTB 1A5IA 3S9CA 1PQ7A 1V2PT 2WPMS 2Y5FA 1GBFA 1P10A 1W3CA 2ESTE 1HAXB 1SQAA 3URDA 1SPJA 2BD3A 5EQSA 2IPHA 1MCTA 3U8TH 1MKWH 1FMGA 1AWFH 1C1SA 4CHAB 8GCHF 1QTFA 2WPIS 1SGFG 4AZ2B 4XBDA 1KSNA 3TH4H 1D3PB 1V2LT 1EZUC 1W0YH 2UWLA 3Q76A 2F9NA 3BIVH 3SV8A 3ZZ5A 2ZF0H 2OXSA 1FPHH 1AY6H 3S7KB 1JIMA 1SLUB 2HWLB 2HLCA 3PTNA 1MZDA 2BOKA 2FTMA 3SN8A 1FJSA 5C2ZA 4YLQH 1OWKA 2XXLA 3TU7H 4NZQA 1P57B 1O2VA 4X6PA 1S81A 1G3DA 1PPBH 1DT2A 1TMUH 1TRMA 1L2EA 2YOLA 2H5CA 4Y7BA 1T32A 3ZYDA 1HB0B 1O2MA 3T27A 1Y3WA 2EEKA 3LH3A 1GI5A 3ZZ8A 1V2NT 3B9FH 3SNCA 1GBAA 3OSYA 2OUAA 1Z7KA 1HAIH 3HK6B 1SLWB 4K5ZA 2JKHA 5EQQA 4D9QA 2NU4E 3BG4B 5AFZH 3BTEE 3OX7U 3TJNA 1WTHD 4XBBA 5LPFA 3H7TA 5JB9S 1SGNE 1AFEH 1GHWH 1ABIH 1Y3XA 1AQ7A 5C5OA 4IMQA 2ODPA 1K1PA 1UTQA 1O2ZA 4I8HA 2XC4A 2GMTB 4CRAA 1YLCA 2EI8A 4Y7AA 2G5NA 4NWKA 1WCZA 1SHYA 2LNCA 2NU0E 1EJAA 2HGTH 1L1JA 2FM2A 3HK3B 3MHWU 3MH4A 5A2MH 3OY5U 1E0FD 1UVPA 5E0HA 1NN6A 2I6SA 1HIAB 1DXWA 1K1OA 1IQKA 1IQGA 4X8UH 1GHAG 1GJDB 4X1NU 5ETXA 1E37B 1D4PB 1P04A 1LKAA 1K22H 3RXSA 1CE5A 4ABHA 4AFZA 1W0ZU 2OC0A 4YO9A 2BZAA 3VXEH 4NWLA 1AWHB 4I8GA 4INKA 3UQOA 1P2QA 2FOMB 5FAHA 1XVMA 2V0BA 2XCNA 3RP2A 1U6QA 1C5YB 2W7UA 1BHXB 1ETRH 1CHOF 1O30A 1O37A 1UK2A 1KXFA 2ZZUH 3AVZA 1C1QA 2UUJB 1IQMA 3TLOA 1OKXA 3VGCC 4LXBH 1WQSA 1C2DA 5HXFA 1V2TT 1TGCA 4ZXXH 2BDAA 3SGBE 1TGSZ 1J17T 1PPFE 5ESBA 2WPHS 2BD7A 2QA9E 1XUIA 1RRKA 1ANBA 2Z3EA 3M7UA 2F9UA 1GWAA 1O3OA 2M5TA 2BY5X 1MMJN 4H6TA 3LDXH 3ELAH 1WSSH 2ZGBH 2Y82A 3JZ2B 1THPB 2BMGB 1GCTB 2BZ6H 2XCFA 5PTPA 1SQOA 2JETB 1Y3YA 1PYTC 1GJ7B 3H5CB 2FIRH 5I25A 2FESH 1C5LH 3RXQA 4FU8A 4MVNA 5L2YH 4RKJB 1CSOE 5BRRE 3LGIA 1F5LA 2ZP0H 4JYUH 7ESTE 3L6PA 2BD2A 3QX5H 1Y5AT 2HNTC 4AFSA 2Z7FE 2QN5T 4OS2A 3BTFE 1HJ9A 1O33A 6LPRA 2OINA 5T3HA 3RXTA 2FI5E 1GG6C 2FOBA 1VITG 4IBLH 3UWIA 4B2CA 3F6UH 3KL6A 1QNJA 1DANH 3ATWA 5K0HA 1P8VC 2HNTF 1O5DH 1JRSA 1RIWC 1IHSH 3NKKA 1Z71A 3SV9A 3OY6U 1DX5M 2QC2A 4ESTE 2BDBA 4BOHA 1KY9A 1S0RA 1HAPH 1FQ3A 1RJXB 1TA6A 1N6XA 8GCHG 4BAHB 3V12A 4AB9A 4WJG2 4J2YB 4U01A 3AAUA 5F6MA 1K1JA 2GZ9A 1LVMA 2GCHF 1BTWA 4AG1A 1ANEA 1W13U 2BQ6B 1HAVB 3MU5A 4CHAC 2BDHA 1FIWA 2D1JA 1HJ8A 3SUEA 1MCVA 2ZU5A 4DT7B 3RUOA 2ZFRH 3LPRA 4BNRA 1QRWA 1TNHA 1BT7A 2ALPA 1IQHA 1PQ5A 4RSPA 1O5CB 1SGCA 3QWCH 1A4WH 1C5UA 4ABFA 1AZ8A 1J14A 1SHHB 1LVOA 1O3IA 2G55A 4BAKB 4NGAH 2XBYA 3RXRA 4NG9H 1WAYB 2PUQH 2GZ7A 1EUFA 4TY7A 4ZUHA 5A0AE 1HAOH 4UFFH 5L30H 3F9EA 1C1MA 2GTBA 1HAHH 1A2CH 1TWXB 5TJXA 1W11U 3DUXH 1ETSH 1DFPA 1X7AC 3A8AA 3FANA 1FY4A 2FI4E 3A7YA 3O8BA 2WPKS 1HAZB 1LMWB 1UTMA 1XVOA 2XBWA 1OXGA 2CN0H 3VXFH 3B23B 4NSVA 4Z0KA 3BG4C 2J34A 4BXSA 1BTPA 1L4DA 1EKBB 3A8DA 4IMZA 4IS5A 5E2OA 1SVPA 2ODQA 1YYY1 1J8AA 3HATH 3MU8A 3RXFA 4ISLA 1FLEE 1ZSJA 1GJ5H 1OWEA 4NIWA 1ELDE 4ABJA 4FUBA 2FOGA 3CS7A 1QL9A 4O03A 4AX9H 1YP9A 2GMTC 4ZKNU 4U32A 3AW1A 2WUCA 1W12U 4I8LA 1FN6A 1O3BA 1TIOA 1BA8B 2A4GA 2WYGA 3HKJB 1TBZH 1XM1A 1AIXH 1O39A 2AMQA 4MNXA 1ZMJA 2G00A 1T8NA 1UVSH 1SFIA 3LGWA 2FLRH 1N8OB 1S6HA 2A4QA 1TMTH 1SLXB 1UTOA 2ZA5A 1CA0B 1C5WB 1GHYH 2JH0D 3GY5A 2P8OB 3E0PB 4IC6A 3FP7E 4ZAEA 3UOUA 1QB9A 1Z8RA 1HPGA 1GHBF 1TALA 1ELTA 1B0EA 2ZKSA 1P2IA 1CHOG 2G4UA 5LPRA 3F1SB 2FS8A 1C2HA 1HBTH 2OC7A 3KQBA 2J95A 4A7IB 3PLKA 1AO5A 4ISOA 1E38B 1V2UT 2STBE 1D3QB 5DP9A 1TMBH 4A5TS 1LQDB 3BTDE 1IAUA 3AAVA 2B8OH 1NU7B 2V6NA 1C1NA 1P0SH 4Y6DA 4CR9A 2UUFB 2BVXH 3BTTE 1DSUA 2O8LA 2BYAX 1EXFA 4ZHLU 1DS2E 4YLUA 1QIXB 1O5AB 4XOJA 2QYIA 3UWJH 4ASHA 2BLVA 5EXLA 3M3VA 4OGXA 1SGTA 4NSYA 2WPLS 2H9EH 4INHA 1PPGE 1LVYA 2VWMA 3TNTA 2BD8A 3MH5A 3PWCA 4ZKOU 4DY7B 3EDXB 3MU1A 1C5PA 2SNWA 1MKXK 4KTCA 1B0FA 2WPJS 5JBAS 2R9PA 1GCTC 1W2KH 2DE8A 4X0WU 1KDQA 2A7CA 1ANDA 1C5QA 1K1LA 1DM4B 1C1WH 2FMJA 4ABEA 3E90B 1UCYK 1VJ9U 1TNIA 4K8YA 3PMBB 3RXKA 1IQLA 1EX3A 3SU4A 1YPHE 2OD3B 2PV9B 3TVJB 5EPYA 3STJA 1FAKH 1JWTA 2FYRA 1C5MD 4X8SH 4ABIA 8LPRA 1IQFA 1ZGIA 1UHBA 2EC9H 2SGQE 3QO6A 1F0RA 1PJPA 7GCHF 3URCA 1CGJE 4FUEA 2HRVA 3ZVEA 4YZUA 1BCUH 1GJ9B 2VWLA 3A7TA 1T4UH 2THFB 2AGGX 1F92A 2WUBA 3G01A 2XC5A 3ZZAA 2HPPH 2BQ7B 4CREA 4KELA 2QAAA 4UEHH 5F03A 3GDUA 1CVWH 1K1MA 1F0SA 3ODDA 4AGJA 2VIVA 3VB3A 2GCHG 1C1RA 1P11E 1NRSH 1S82A 3A88A 2J2UA 2FP7B 2ZCHP 3A7VA 4A6LA 5C1UA 4MPUA 4WF8A 2ZO3H 4GCHF 4D7GA 3GDSA 3RU4E 2PTCE 3QDZB 5A0BA 1XMNB 2W5EA 4TY6A 2G5VA 1HCGA 1MTNB 3LU9B 4E05H 1EP5A 3A83A 1DVAH 2BD4A 1A3BH 4MNYA 3FP6E 5AHGH 2STAE 4UFGH 1OWIA 3KEEA 5TCAA 3V7TA 1NO9H 2QCYA 4UFDH 5ESTE 2XYAA 1WU1A 1K1IA 3CENA 1O5GH 2RA3A 1OS8A 3VB5A 3E8LA 1GMCG 4R0IA 2BX4A 1GBMA 1O0DH 3GYMA 3S0NA 1D6WA 1RTKA 3GY8A 1MKWK 1QJ6B 3LKWA 1WBGB 4O9VA 2NU1E 2P94A 4X2YA 1BQYA 3EE0B 1HLTH 3MTYA 1HAGE 3NPSA 1TNLA 5EG4A 3RU4D 3FVFB 1C2JA 3ODFA 2PLXA 3TK5A 3SU0A 1O2QA 2BDIA 1P02A 2CF8H 4E7RG 1J9CH 1YPKH 3M5LA 1SGPE 3P8GA 1FV9A 4K2YA 1A46H 1MU6B 3TJOA 1P9SA 2Z3DA 3A8BA 4ZXYH 1AUTC 1HV7A 5EOKA 1YCPM 2SGAA 3KF2A 1SGYE 1JMOH 2PUXB 1VJAU 5GIBA 1JIRA 1KXDA 3KGPA 1OPHB 2BD9A 5AF9H 1P06A 1IQEA 1S6FA 1YBWA 5EGMA 1P09A 1C5ZB 3T62A 4B74A 4CRDA 1C5VA 4Q2KA 2O8WA 1O2YA 2QIQA 4JK5A 1GG6B 3D62A 3RXGA 1C1UH 1XKAC 5T6GA 4OGYA 1O2KA 4FUCA 1L1NA 1EAIA 1O5BB 1NTPA 1BZXE 2H9TH 4K3JA 2CV3A 2FOHA 4B1TA 1N8OC 5DP8A 1AVWA 2ZECA 3LGUA 1BTYA 1BIOA 4ZH8A 2P3FH 1SC8U 3TK9A 4SGAE 3V0XA 2BVSH 1GBBA 1CA0C 2P8OC 2TRMA 3W95A 2GP9B 1DY9A 5C5NA 1CU1A 2H9HA 3BEFB 5K7RA 2A31A 4MNWA 1W7XH 3QGJA 4JZEH 1C4V2 1O2LA 1Q3XA 1GJ6A 1SGIB 4MG3A 4OS6A 1KYNA 1AKSA 2VH6A 1GMDF 3MOCA 2FPZA 4YOIA 1O2SA 3E0NB 3AW0A 1Z6JH 1K28D 1CO7E 5CE1A 1UTKA 1A0HB 3RXLA 2ZDNA 2BY8X 3ATIA 5T6FA 1O3GA 3ATKA 2H2ZA 2ASUB 2W3IA 2B7DH 4I32A 4NA9H 1W10U 4Y71A 2YNBA 3VFEA 1IQIA 2D2DA 4FUGA 2TPIZ 4NIYA 2Y5GA 4B76A 1GJBB 3P95A 3BV9B 4INLA 3DT0H 4KTUA 1EZQA 2Z9GA 2NWNA 2P93A 5GWZA 2WINI 1HGTH 1ZSKA 2RDLA 4BANB 1UVTH 1ZJKA 1EOLA 4B71A 3P8FA 2OQ5A 4XSKU 4NA7A 4Q7ZA 9ESTA 2OC8A 2Y7ZA 7GCHG 2ZFFH 2J9NA 4Y79A 1ELEE 2BLQA 3VB6A 3PO1B 2BLOA 2ZQ1A 4K8BA 4K1SA 5EODA 1O38A 3O8RA 4DIIH 2IOTA 3SJIA 4X2VA 4KP0A 4YM9A 1C2FA 2TGAA 2VIWA 3UFAA 1JXPA 2ZWLH 1ETTH 3TNSA 3SV6A 3NUMA 5DGJA 3ZZ7A 4GLYA 2A45B 1L0ZA 5EPNA 2Q6DA 2GZ8A 1ORFA 1UTJA 1C2IA 1O5FH 5B6OA 3BTME 1LTOA 1NRRH 2EI6A 5JPMH 4MLFB 1EJMA 4K1EA 5DP6A 1ZHPA 2P3TB 4AORA 4DGJA 2W3KA 1GBEA 2A2XH 4B2BA 2Z9KA 2OCVB 3LC3A 1NROH
chains in the Genus database with same CATH superfamily
2Z3CA 3SUDA 1C9TA 2TIOA 4Z6AH 1NT1A 1MTVA 5DKMA 3CS0A 3SHAH 1TABE 1ZHRA 2VBCA 4X2XA 2HNTE 1MTNC 1NS3A 2BY6X 1BMAA 3P17H 5FPSA 2BTCE 1GHZA 3RMNH 1AUJA 1GDNA 1MTUA 1V2JT 1NU9A 1MH0A 1P3CA 1GI9B 1O3FA 2VWNA 3P8OA 4FVBA 2AERH 1OWDA 1B5GH 4LK4A 3GY2A 4DVAU 3ZV9A 2CGAA 3TK6A 1C2GA 2GV6A 2F3CE 3V13A 2FOEA 1THSH 3UNSA 2ZFQH 4YESB 2ZFPH 1HAYB 3ZVGA 1ELGA 2RA0A 4J1YA 4JK6A 1C5OH 4UD9H 1TPSA 3FP8E 1GI4A 3DA9B 4O3TA 4ZROA 1GJCB 1G2LA 1S84A 3RXCA 3SU2A 1PYTD 3ZVDA 1EPTA 2J4IA 1F5KU 3U69H 1A7SA 3PROA 1TAWA 1XX9A 1F2SE 9LPRA 4U2WA 3EA7A 5L2ZH 2ZDMA 1HXFH 1HJAB 5T6DA 1O2GH 2BXUH 3PMAB 1GI2A 4M7GA 1XKBC 1DY8A 5DSFA 5FPYA 3W94A 5C20A 2I6QA 5IYTA 2NU2E 3OFND 2VIDA 1BMMH 4BAMB 3NCLA 2Q6GA 4E06H 1TB6H 1KDQB 3KN2A 1E34B 1CGHA 1MAYA 3STIA 4I8KA 3RXJA 3E3TA 3KIDU 4GHTA 4Q7YA 3SQHE 5A8ZA 2XC0A 1MBMA 1Q2WA 1GGDB 1KLIH 3M37A 1LQEA 2FOCA 1TNGA 1KXEA 1P9UA 1RFNA 1YLDA 2QY0B 4ISNA 4OS5A 3SO3A 2Y80A 2HOBA 2IN2A 1DOJA 3BTHE 5EQRA 1ZYOA 2K1QA 1O2NA 1GBIA 3PYHA 1SGRE 3QN7A 2AH4X 1FPCH 2ZDVH 1SQRA 1SKYE 2ZC9H 4MNVA 1GJAB 3P92A 5SGAE 3EA9A 1QURH 3H7OA 5FHTA 1GHXH 1MAXA 1J16A 1O3JA 3A82A 2BHGA 3PMJA 1E35B 3H09A 1O2XA 4MPWA 3D65E 1Y59T 3E16B 1FIZA 1KXAA 2HALA 1C9PA 1AD8H 4I8JA 4IC5A 1AB9B 1ESBA 1PQAA 3ZZCA 1V2ST 1O2IA 1OOKB 4JZFH 5GDSH 1W14U 2CMYA 3TH3H 4JZ1A 1NRQH 2J38A 2TGTA 3MH7A 1P01A 3UR9A 4WMEA 1ZPCA 1GI6A 2CF9H 3BG8A 1NFXA 1QCPA 5HKKD 2V3HH 3MWIU 2ANWA 3JZ1B 3PMHB 4FOUC 1VR1H 3A7WA 4FETA 1P03A 1DWEH 2A32A 4ZKSU 2ZHEH 3MI4A 4THNH 1LHEH 1G3BA 1YPGH 3NWUA 2R2MB 2ZDKA 1O3AA 4OS1A 3KQ5A 1NZQH 1FAXA 1TNKA 4MDSA 1NC6A 1BTXA 1S83A 2PR3A 3SBKA 4BTIB 4CH8B 1GBHA 1QY6A 3PO1C 3ZV8A 3BEUA 3HPTB 2PSYA 4X1SU 1YCPH 4K1TA 5E8EH 1UVOA 3MU4A 2ZG0H 3N7EA 4DW2U 2PGBB 2ALVA 2GGVB 1TGNA 5ABWA 1UVUH 2PKSB 3GDVA 3OU0A 1QR3E 2PKAA 5GCHF 1P12E 4D7FA 1G37A 3B8JA 1LPGB 3FOAA 1GI0A 4JMYA 1DE7H 2Z6BD 5FBIA 1P2OA 1SSXA 7KMEH 2XNIA 1EZSC 1UCYE 3I77A 1O2JA 1K21H 1FN8A 4ZHMU 1BUIA 1V2KT 3TPIZ 4X2WA 1BJUA 3BF6H 2QGRA 2ZEBA 1GBCA 2BOHB 4ABDA 1OWHA 1EB1H 1TGTA 2ANYA 5F8ZA 2ZIQH 2ZTYA 5FPTA 1QBNA 1TPPA 4OS7A 3A89A 2C90B 1RS0A 1TPOA 1RXPA 1ZRBA 5JYIA 1DPOA 1UK4A 3SUGA 3RU4T 1FONA 2GVFA 2PW8H 3T2NA 1AFQB 1OYTH 3HGNA 2FEQH 1NFUA 2B0FA 1P2NA 4TYDA 2ODYB 3EGKH 1T31A 2A5KA 2FZZA 2KZ4A 4Y8YA 2R0LA 4X6NA 4BTUB 1ZJDA 3ZZ3A 1Z8GA 1O2WA 1Z6EA 3SI3H 1SGFA 2OP9A 1A0JA 3LC5A 2GX4A 4NFFA 3M35A 1V3XA 1Z1JA 3KCGH 3PLPA 5I46H 2BVRH 3M61U 1FY1A 2O9QA 4Y11E 3K6ZA 2RG3A 1LHFH 3SU3A 1QRZA 3K65B 3LGYA 2WV4A 3GCHB 1BRCE 1ESTA 2A1DB 2BDYA 4Y0ZE 1GBDA 1ELAA 5EW2H 3A7ZA 2UUKB 1UK3A 3VPKA 4HFPB 1UTPA 4YT7H 1ELVA 2JJ2D 2R2WU 1C4U2 1DXPA 5JB8S 1HJAC 5DJ7A 1YC0A 3SHCH 2ILNA 1ESAA 2O8TA 5GPIB 4F55A 1O3LA 3BTQE 1TRYA 1LO6A 2D8WA 1GI7B 3F9HA 3U1IB 1PPZA 1Q31A 1V6DA 4GSOA 3PRDA 1ID5H 1BTZA 2ZQ2A 4H4FA 3DFLA 2GT8A 2HPQH 1CBWB 1ZR0A 2XBXA 3Q00A 3RXAA 1WQVH 4GVUA 2J98A 5KEDA 3FO8D 3BSQA 3KYGA 4O3UA 1FUJA 4FUIA 4FXGH 1WV7H 3BEIB 4U30A 2ULLA 3RDZA 1Y5UT 1H8IH 1A3EH 1O3NA 2R0KA 1SG8B 1C1TA 1GI8B 1GGDC 1LPZB 4DCDA 4JYTA 4CRCA 3KNXA 3SQEE 2C8ZB 4Q80A 3NZIA 4ZMAH 2A7JA 1S6LA 1BB0B 3ZZ6A 3SUFA 1TOCB 1CT0E 1ZTLA 1YWUA 3OEHD 1BBRE 2ZU3A 3ZVCA 1DLEA 2ZDLA 3E6PH 2VVUA 1PPHE 2ZFSA 3R0FA 5AFYH 1ZLRA 2VIOA 3PLBA 5FL7D 1YPLH 3F9FA 3LGTA 1O2HA 2KAIA 3A86A 3QTOH 3F0OA 3MO3A 1AB9C 3SNDA 3U1JB 2VGCB 1QL7A 1YLNA 5AVDA 4ISIH 3SJKA 4R8TB 2BLWA 1GVKB 1ZSLA 1TQ0B 1GDUA 1P3EA 2PFEA 2GKVE 4TT3D 3IG6B 4LZ4B 1DLKB 2R3YA 3QTVH 1EAWA 3LIWA 5CHAC 3S7HB 1C1VH 4X1RU 1BJVA 1NBME 5A8XA 2ZGCA 2C93B 2F83A 3A81A 2A0QB 3M5MA 1YPMH 5EXMA 1BRAA 4B6EA 2J94A 2ZDAH 2FTLE 1OSSA 5IDKA 1MQ6A 3ATMA 6CHAB 5G4BA 1WDIA 3DSPA 4MQAA 2B9LA 1TQ7B 3A87A 2QV1A 1WTGH 2GD4B 2L6OA 3LJOA 2FOFA 1P2MA 4HI3A 2P95A 5C17A 2P59A 5GCHG 4I86A 1C2KA 4FVDA 4GHQA 5CDFE 3P8NA 4DOQA 1O5EH 5DK1A 1COWD 4WWYA 2F4LA 4IN2A 2ZTZA 3RLYH 1QQ4A 2PKSC 3QZQA 3ZVFA 3LONA 1ACBE 1GCDA 2XW9A 3SI4H 4XBCA 1XUJA 3MFJA 1QA0A 1TBRH 4M9FA 1PPEE 2J97A 2FS9A 2A7HA 4YOJA 1EOJA 1V2QT 5FX5A 1WUNH 2ZHFH 1ARCA 1K0HA 4NIXA 5F8XA 2VU8E 2ZGJA 2DE9A 2ZNKH 4X1QU 3ZZ9A 4YT6H 4VGCB 1NBMD 5JDUB 1RTLA 1INCA 4JYVH 3KQCA 2ZGXH 1O3HA 3M5OA 4DG4A 3BTGE 4ZHAA 2BD5A 2DUCA 1THRH 1GHBG 1T8LA 1NESE 5J4QA 3GY4A 4ACAA 4KTSA 1QGFA 4TPYA 3PWBA 5EJZA 2ZTXA 1ZRKA 5FXLA 1VCPA 2A5IA 1AHTH 1PPCE 1Z8IB 3P6ZB 3FZDA 4HGCA 3RXDA 2A4RA 1AFQC 3Q3YA 5IK2D 3SU1A 8ESTE 3M3SA 1ZTJA 6ESTA 2RCEA 4CBNA 2CHAB 1O3MA 4WMFA 1GBJA 2OQUA 5DP5A 1GL0E 4MPXA 3TH2H 1LHDH 1EZXC 4ABBA 1DWBH 2BQWB 1V2VT 2BX3A 1A5HA 3RXEA 2VVCA 1MU8B 1NFYA 1D3TB 1BDAA 4CR5A 1O3KA 3U98H 1BRBE 1GMHF 3GCHC 1KMHB 2PTNA 2BXTH 2KFWA 1AE8H 1OP8A 4NIVA 1S0QA 1SI5H 2AS9A 4LZ1H 4IW4E 1E36B 1UO6A 5BPEA 3SOSA 1V2OT 1MQ5A 3Q3KA 2QXHA 3SORA 2B5TB 3SNAA 4AFUA 3UR6A 1IHTH 1MD8A 1VZQH 4CRGA 3KHVA 4WH6A 3MNBA 4TPIZ 5EJLA 3Q77A 4I33A 4O97A 1XUGA 3I29A 1ELBA 1O2UA 3PV4A 1H9LB 1C5RA 4X8TH 3T26A 3MNCA 3L33A 2WZQA 5J4SA 2ZCLP 1TX6A 1CBWC 1BBRH 1XXDA 4JCNA 5C1XA 4IGDA 5LPEA 1PQ8A 3D23A 1B7XB 4ASUD 2VH0A 4XFQA 2A5AA 1VITH 1C5TA 1TA2A 1C2MA 1NFWA 3AASA 3K9XB 4DIHH 1F5RA 3EQ0H 3A84A 3MNSA 1AVXA 3EA8A 1MABB 1GBKA 1SFQB 2QF3A 1SOZA 3M5NA 4GCHG 3LOXA 1BMFD 3N7OA 4X6MA 4TWWA 4FUFA 2PKAB 1HYLA 5JBTA 2VIQA 1OYQA 2Z9LA 2GT7A 1NRPH 3S9AA 3OE7D 2C8WB 1EB2A 1A61H 1H9HE 2Z9JA 2SGFE 2ZGHA 4H6SB 2WYJA 2R3UA 1E79D 1ZPZA 3BIUH 3UTUH 2Q6FA 5DN6D 3CP7A 2PWXA 1A1RA 2SGPE 2C8YB 2VNTA 4JZIA 4BAQB 2OC1A 2CJIA 5HM2A 5CMXH 2VINA 2EQNA 2VGCC 2A4OA 5EU8A 2HVXA 1G2MA 2AHME 3MYWA 1BTHH 4MPVA 1O3CA 2XWBI 3GICB 1TX7A 3Q3XA 5TCCA 3SNBA 1FZZA 3RXPA 1QBVH 1ZMNA 1AI8H 2FWWA 4D9RA 4OM9A 2FX4A 1IQJA 3DFJA 2ZPSA 1TRNA 1GBLA 1GI3A 4XE4A 3ENSB 3UUZA 2Z9IA 3TGKE 1V2MT 5FBEA 2UWPA 4CBOA 2FDAA 3SNEA 2IJOB 1O31A 5KGOA 4UFEH 4X1PU 6CHAC 1H9IE 3UOPA 4WMDA 1P2JA 1SQTA 1EFRD 1G3CA 3I78A 2CXVA 3F9GA 1SB1H 1SGDE 1YGCH 2FODA 6GCHF 2AEIH 1JOUB 1G36A 2G4TA 3KQDA 5E0GA 5C67A 2Y5HA 3SZNA 4P02A 5DG6A 2KCPA 5B6LA 4DJZB 1EPTC 1EASA 4TWYA 4ABGA 1XXFA 1O34A 4CRBA 2AGEX 5LH8A 1SR5C 2G8TA 1EQ9A 4AG2A 1HDTH 3UQVA 1C5SA 1LKBA 1VCQA 1GI1A 1O2OA 3E91A 1IOEA 3UB0A 2V35A 2H5DA 3LGVA 2TGDA 2JDID 1DWDH 4VGCC 1FY5A 1BMNH 1DWCH 1T8MA 1VKYA 4A92A 1V2WT 2F9BH 1YCPK 1GDQA 1FXYA 3RXHA 5JBCS 4Q7XA 1SGEE 2JH5D 3V3MA 3PB1E 4GPGA 1QFKH 1Y3UA 5HMAA 1UHBB 2WV9A 4X8VH 3RLWH 3AK5A 2J98B 1JRTA 2TBSA 1GPZA 1SGQE 3EYDA 3ZZ4A 3OTJE 1DSTA 3HKIB 3ZYEA 1BMLA 3C27B 3M3TA 1C1PA 2JH6D 5DO4H 1ELFA 3A85A 3T5FH 1GMDG 2Z94A 3DCLA 1TOMH 2OBOA 4K60A 5FCRA 3FZZA 1EP6A 2QXIA 3RXVA 2CHAC 2ZPRA 2ANKH 1VCWA 2F9VA 2PSXA 4RN6A 2Y81A 5E0JA 1C5XB 1ABJH 2M2AA 1O3EA 1O2TA 3ITIA 3SJ9A 4BXWA 1UTNA 1GMHG 3ATLA 3ZZDA 2C3SA 4TSFD 4UE7H 1EJNA 1QL8A 1C2LA 1KXBA 3SJ8A 1KLJH 1GVZA 1LCYA 1G30B 3OEED 3RM2H 4GUXA 3T25A 3S9BA 1F0UA 1BRUP 4E7NA 2KAIB 1LDTT 1BTUA 4I31A 4YXWD 1GBTA 4OS4A 3SV7A 1ZTKA 1QJ7B 2NU3E 4Y10E 1DITH 2AMDA 3U9AH 3UY9A 4B6FA 5CHAB 2GCTB 2GDDA 3M7TA 4XDEA 1GVLA 1HXEH 3ZZBA 2W6JD 2RFKC 2TGPZ 3DHKH 3TIUA 1QHRB 1FY8E 1GHVH 3W1EA 2BM2A 3A8CA 1TBQH 2ZHQH 1TLDA 4Y8XA 1L4ZA 2P16A 4A1TA 1O2RA 2K8IA 1YY3A 4WVPE 2OTVA 1FI8A 1QBOA 1NM6A 3O8DA 2XWAA 3R3GB 3GY6A 4YTAA 1MUEB 2OLGA 2D26C 1GJ8B 1HUTH 1N1LA 3BTKE 1H4WA 4AYYB 4AGKA 3SU5A 3RXUA 2P3UB 3SV2H 1C4Y2 1GMCF 4UDWH 3VEQB 3RC4A 1H8DH 2V7QD 4I7YH 1TPAE 2BY9X 3QZRA 1VGCB 1AN1E 1T8OA 1MTWA 2FYQA 3OAAD 3RC5A 1O3DA 3F68H 4B73A 3NRLA 2ZPQA 1L1GA 1BITA 1AGJA 4HZHA 1XUKA 5DP4A 2IJD1 1AE5A 5GXPA 4NFEA 2KCOA 1G32B 2EA3A 3MU0A 4QT8C 2F9OA 3T29A 1N6YA 1HIAA 1LPKB 1YKTA 2FO9A 4KKDA 3RC6A 1TNJA 1TGBA 4FUJA 2EI7A 3OTPA 1ZPBA 5C0TA 1D6RA 2QXJA 2W26A 1FDPA 4Q63A 1EAUA 3RXBA 4CRFA 2FXRA 1S85A 2FLBH 2QXGA 2VVVA 1WYKA 2AIPA 1W8BH 3LJJA 1KIGH 1Y3VA 1GJ4H 3LH1A 5C3NA 5FCKA 4A1XA 3RXMA 3TGIE 1DICA 2AGIX 2C8XB 5EXNA 4ACBA 1DUAA 4WXIA 1QZ8A 4B2AA 3E1XB 3UNRA 1UJ1A 1LHCH 4Z1MD 4AFQA 3IWMA 1HNEE 1ZZZA 4F4OC 3WY8A 1QJ1B 2J92A 3GCTF 4B75A 4FU9A 3DD2H 1KLTA 4Y76A 2XBVA 3RXOA 6GCHG 2ZCKP 4AYVB 4RKOB 1AKSB 1O32A 1ARBA 1CQQA 1CT2E 1K9OE 2GDEH 3K2UA 2Y7XA 2F9PA 3UREA 2ZFTA 3ZVAA 1ELCA 1C2EA 2O8UA 2OBQA 5H4IB 1M9UA 2LELA 3BN9A 2SNVA 1Y8TA 4IN1A 3SW2B 4D8NA 3SGQE 1C1OA 3P70B 5A0CA 1XUHA 3RMLH 4LOYH 1BHXF 3L3TA 8KME2 1ZMLA 1H1BA 2BDGA 2G51A 4DT4A 3C1KA 3D49H 3ZVBA 3EAJA 1O35A 1QA7A 4RT1A 3A7XA 1EAXA 2AYWA 4MTBA 3MQKC 3RM0H 4JZDH 5FX6A 4K69A 1OWJA 3GY3A 1SLVB 2JETC 5L6NH 1AVGH 5DP3A 2SFAA 2KM0A 3GS9A 3HGPA 3U8OH 1OX1A 2UWOA 3MO6A 2AIQA 3UIRA 2H6MA 1XUFA 3M36A 2WV5A 1A0LA 1K2I1 2PHBA 3ESTA 1ZHMA 3RMMH 4FU7A 5DPAA 1QB1A 3QUMP 4F49A 1T4VH 2GV7A 3LT3A 1UMAH 5HM9A 3GY7A 3QGNB 5A8YA 3GCOA 1G3EA 3A80A 3O8CA 1SBWA 2KCYA 4H42U 2XNDD 4NCYA 1FY3A 3BTWE 2V3MA 3PM3A 2YMSC 4WXVA 2G52A 1AU8A 4NZLA 2ZHWH 1O2PA 5A09A 1LHGH 3TJVA 3SJOA 5E2PA 2ZU1A 4KGAA 3QK1A 1TFXA 2VWOA 4FUHA 2ZI2H 1ZOMA 1HAVA 1DDJA 4Y8ZA 1T7CA 1V2RT 2G81E 3PTBA 4X6OA 1MBQA 3KQEA 2SGEE 3GYLB 3GCNA 3UPEA 1Y5BT 2YNAA 2XRCA 4NA8A 3GOVB 2QF0A 2H1UA 1F0TA 2XTTB 5HIYA 1G9IE 2BB4A 1SL3A 2C4FH 2ZU2A 3TGJE 1CHGA 1QRXA 3FFGA 3FAOA 1AMHA 2FX6A 5EW1H 1CT4E 1QB6A 3VB7A 1YPEH 4GAWA 1JBUH 1HRTH 2GCTC 3S69A 1MZAA 1O36A 1GHAF 1MTSA 3VB4A 4UONA 2W7SA 1NY22 1WOFA 1QQUA 3MH6A 2OK5A 3NK8A 3GISB 1YF4A 2F91A 1MKXH 1LVBA 2FI3E 3UNQA 1NPMA 3U8RH 1TE0A 1YPHC 4Q4LA 4ZKRU 2W6ID 1BOQA 1KXCA 2VB0A 3PRBA 1J15A 1UCYH 2VJ1A 5LGOA 1RD3B 2Q1JA 3OYPA 5DP7A 4ISHH 2PGQB 1MD7A 4BAOB 1TYNA 1D9IA 2LPRA 3SU6A 4D76A 2AMPA 1GL1A 3VGCB 1SMFE 2BDCA 4A1VA 3TITA 1NRNH 2ZU4A 2ANMH 4CH2B 1CA8B 5F8TA 1DUEA 1OP0A 1P2KA 1EPTB 1YPJH 1F7ZA 2A2QH 5HYOA 4DURA 1VGCC 1SOTA 1RGQA 1TONA 2XOKD 1UTLM 1KTTB 3F2HA 1OP2A 7LPRA 4HTCH 4WH8A 3TJUA 3PV5A 4YOGA 2O8MA 2ZHDA 1ANCA 1Z8JB 1S5SA 3IITA 1TX8A 1CGIE 4HG6A 3M7QA 3WWBA 3QLPH 4SGBE 1A5GH 4PROA 2AFQB 1ZGVA 3RMOH 1PFXC 1P05A 4Y0YE 4ABAA 1BBRK 4AN7A 2Y6TA 4FUDA 1C5NH 1W7GH 1Z1IA 1K1NA 2FOAA 1AZZA 1IQNA 1EATA 1H8ED 4AOQA 2KR7A 3SGAE 3MO9A 2BY7X 3MNXA 2VIPA 1HFDA 3MMGA 3RXIA 5C1YA 5HGGA 5JBBS 5GJ4B 2UUYA 4AB8A 1FNIA 4WY3A 2SGDE 1RIWB 1VITF 3GCTG 1O3PB 1D3DB 1KTSB 2V3OH 1RTFB 4ZCNA 3FKSD 3T28A 1YM0A 3NXPA 3K6YA 4BTTB 1A5IA 3S9CA 1PQ7A 1V2PT 2WPMS 2Y5FA 1GBFA 1P10A 1W3CA 2ESTE 1HAXB 1SQAA 3URDA 1SPJA 2BD3A 5EQSA 2IPHA 1MCTA 3U8TH 2LP6A 1MKWH 1FMGA 1AWFH 1C1SA 4CHAB 8GCHF 1QTFA 2WPIS 1SGFG 4AZ2B 4XBDA 1KSNA 3TH4H 1D3PB 1V2LT 1EZUC 1W0YH 2UWLA 3Q76A 3F3BA 2F9NA 3BIVH 3SV8A 3ZZ5A 2ZF0H 1FPHH 2OXSA 1AY6H 3S7KB 1JIMA 1SLUB 2HWLB 2HLCA 3PTNA 1MZDA 2BOKA 2FTMA 3SN8A 1FJSA 5C2ZA 4YLQH 1OWKA 2XXLA 3TU7H 4NZQA 1P57B 1O2VA 4X6PA 3SYJA 1S81A 1G3DA 1PPBH 1DT2A 1TMUH 1TRMA 1L2EA 2YOLA 2H5CA 4Y7BA 1T32A 3ZYDA 1HB0B 1O2MA 3T27A 1Y3WA 2EEKA 3LH3A 1GI5A 3ZZ8A 1V2NT 3B9FH 3SNCA 2GJGA 1GBAA 3OSYA 2OUAA 1Z7KA 1HAIH 3HK6B 1SLWB 4K5ZA 2JKHA 5EQQA 4D9QA 5HIZA 2NU4E 3BG4B 5AFZH 3BTEE 3OX7U 3TJNA 1WTHD 4XBBA 5LPFA 3H7TA 5JB9S 1SGNE 3F0PA 1AFEH 1GHWH 1ABIH 1Y3XA 1AQ7A 5C5OA 4IMQA 2ODPA 1K1PA 1UTQA 1O2ZA 4I8HA 2XC4A 2GMTB 4CRAA 1YLCA 2EI8A 4Y7AA 2G5NA 1H8HD 4NWKA 1WCZA 1SHYA 2LNCA 2NU0E 1EJAA 2HGTH 1L1JA 2FM2A 3HK3B 3MHWU 3MH4A 5A2MH 3OY5U 1E0FD 1UVPA 5E0HA 1FX0B 1NN6A 2I6SA 1HIAB 3FN8A 1DXWA 1K1OA 1IQKA 1IQGA 4X8UH 1GHAG 1GJDB 4X1NU 5ETXA 1E37B 1D4PB 1P04A 1LKAA 1K22H 3RXSA 1CE5A 4ABHA 4AFZA 1W0ZU 2OC0A 4YO9A 2BZAA 3VXEH 4NWLA 1AWHB 4I8GA 4INKA 3UQOA 1P2QA 2FOMB 5FAHA 1XVMA 2V0BA 2XCNA 3RP2A 1U6QA 1C5YB 2W7UA 1BHXB 1ETRH 1CHOF 1O30A 1O37A 1UK2A 1KXFA 2ZZUH 3AVZA 1C1QA 2UUJB 1IQMA 3TLOA 1OKXA 3ZIAD 3VGCC 4LXBH 1WQSA 1C2DA 5HXFA 1V2TT 1TGCA 4ZXXH 2BDAA 3SGBE 1TGSZ 1J17T 1PPFE 5ESBA 2WPHS 2BD7A 2QA9E 1XUIA 1RRKA 2QF5A 1ANBA 2Z3EA 2WSSD 2F9UA 3M7UA 1GWAA 1O3OA 2M5TA 2BY5X 1MMJN 4H6TA 3LDXH 3ELAH 1WSSH 2ZGBH 2RDEA 2Y82A 3JZ2B 1THPB 2BMGB 1GCTB 2BZ6H 2XCFA 5PTPA 1SQOA 2JETB 1Y3YA 1PYTC 1GJ7B 2JJ1D 3H5CB 2FIRH 5I25A 2FESH 1C5LH 3RXQA 4FU8A 4MVNA 5L2YH 4RKJB 1CSOE 5BRRE 3LGIA 1F5LA 2ZP0H 4JYUH 7ESTE 3L6PA 2BD2A 3QX5H 1Y5AT 2HNTC 4AFSA 2Z7FE 2QN5T 4OS2A 3BTFE 1HJ9A 1O33A 6LPRA 2OINA 5T3HA 3RXTA 2FI5E 1GG6C 2FOBA 1VITG 4IBLH 3PV2A 3UWIA 4B2CA 2YMSB 3F6UH 1QNJA 1DANH 3ATWA 3KL6A 5K0HA 1P8VC 2HNTF 1O5DH 1JRSA 1RIWC 2K0QA 1IHSH 3NKKA 1Z71A 3SV9A 3N7DA 3OY6U 1DX5M 2QC2A 4ESTE 4AC9A 2BDBA 4BOHA 1KY9A 1S0RA 1HAPH 1FQ3A 1RJXB 1TA6A 1N6XA 8GCHG 4BAHB 3V12A 4AB9A 4WJG2 2QE7D 4J2YB 3AAUA 4U01A 5F6MA 1K1JA 2GZ9A 1LVMA 2GCHF 1BTWA 4AG1A 1ANEA 1W13U 2BQ6B 1HAVB 3MU5A 4CHAC 2J5UA 2BDHA 1FIWA 2D1JA 3UAIC 1HJ8A 3SUEA 1MCVA 2ZU5A 4DT7B 3RUOA 2ZFRH 3LPRA 4BNRA 1QRWA 1TNHA 1BT7A 2ALPA 1IQHA 1PQ5A 3WWFA 4RSPA 1O5CB 1SGCA 3QWCH 1A4WH 1C5UA 4ABFA 1AZ8A 1J14A 1SHHB 1LVOA 1O3IA 2G55A 4BAKB 2KCAA 4NGAH 2XBYA 3RXRA 4NG9H 1WAYB 2PUQH 2GZ7A 1EUFA 4TY7A 4ZUHA 5A0AE 1HAOH 4UFFH 5L30H 3F9EA 1C1MA 2GTBA 1HAHH 4XRNA 1A2CH 1TWXB 5TJXA 1W11U 3DUXH 1ETSH 1DFPA 1X7AC 3A8AA 3FANA 1FY4A 2FI4E 3A7YA 3O8BA 2WPKS 1HAZB 1LMWB 1UTMA 1XVOA 2XBWA 1OXGA 2CN0H 3VXFH 3B23B 4NSVA 4Z0KA 3F2GA 5T1VA 3BG4C 2J34A 4BXSA 1BTPA 1L4DA 1EKBB 3A8DA 4IMZA 4IS5A 5E2OA 1SVPA 2ODQA 1YYY1 1J8AA 3HATH 3MU8A 3RXFA 4ISLA 1FLEE 1ZSJA 1GJ5H 1OWEA 4NIWA 1ELDE 4ABJA 4FUBA 2FOGA 3CS7A 1QL9A 4O03A 4AX9H 1YP9A 2GMTC 4ZKNU 4U32A 3AW1A 2WUCA 3U28C 1W12U 4I8LA 1FN6A 1O3BA 1TIOA 1BA8B 2A4GA 2WYGA 3HKJB 1TBZH 2JIZD 1XM1A 1AIXH 1O39A 2AMQA 4MNXA 1ZMJA 2G00A 1T8NA 1UVSH 1SFIA 3LGWA 2FLRH 1N8OB 1S6HA 2A4QA 1TMTH 1SLXB 1UTOA 2ZA5A 2HVYB 1CA0B 1C5WB 1GHYH 2JH0D 3GY5A 2P8OB 3E0PB 4IC6A 3FP7E 4ZAEA 3UOUA 2CK3D 1QB9A 1Z8RA 1HPGA 1GHBF 1TALA 1ELTA 1B0EA 2ZKSA 1P2IA 1W0KD 2QF4A 1CHOG 2G4UA 5LPRA 3F1SB 2FS8A 1C2HA 1HBTH 2OC7A 3KQBA 2J95A 4A7IB 3PLKA 1AO5A 4ISOA 1E38B 1V2UT 2STBE 1D3QB 5DP9A 1TMBH 2EY4C 5F53A 4A5TS 1LQDB 3BTDE 1IAUA 3AAVA 2B8OH 1NU7B 2V6NA 1C1NA 1P0SH 4Y6DA 1E1RD 4CR9A 2UUFB 2BVXH 1UW7A 3BTTE 1DSUA 2O8LA 2BYAX 1EXFA 4ZHLU 1DS2E 4YLUA 1QIXB 1O5AB 4XOJA 2QYIA 3UWJH 4ASHA 2BLVA 5EXLA 3M3VA 4OGXA 1SGTA 4NSYA 2L74A 2WPLS 2H9EH 4INHA 1PPGE 1LVYA 2VWMA 3TNTA 2BD8A 3MH5A 3PWCA 4ZKOU 4DY7B 3EDXB 3MU1A 1C5PA 3F2FA 2SNWA 1MKXK 4KTCA 1B0FA 2WPJS 5JBAS 2R9PA 1GCTC 1W2KH 2DE8A 4X0WU 4XD7D 1KDQA 2A7CA 1ANDA 1C5QA 1K1LA 1DM4B 1C1WH 2FMJA 4ABEA 3E90B 1UCYK 1VJ9U 1TNIA 4K8YA 3PMBB 3RXKA 1IQLA 1EX3A 2YMSD 3SU4A 1YPHE 2OD3B 2PV9B 3TVJB 5EPYA 3STJA 3VG8A 1FAKH 1JWTA 2FYRA 1C5MD 4X8SH 4ABIA 8LPRA 1IQFA 1ZGIA 1UHBA 2EC9H 2SGQE 3QO6A 1F0RA 2IPQX 1PJPA 7GCHF 3URCA 1CGJE 4FUEA 2HRVA 3ZVEA 4RT0A 4YZUA 1BCUH 1GJ9B 2VWLA 4F48B 3A7TA 1T4UH 2THFB 2AGGX 1F92A 2WUBA 3G01A 2XC5A 3ZZAA 2HPPH 2BQ7B 4CREA 4KELA 2QAAA 4UEHH 5F03A 3GDUA 1CVWH 1K1MA 1F0SA 3ODDA 4AGJA 2VIVA 3VB3A 2GCHG 1C1RA 1P11E 1NRSH 1S82A 3A88A 2J2UA 2FP7B 2ZCHP 3A7VA 4A6LA 5C1UA 2WPDD 4MPUA 4WF8A 2ZO3H 4GCHF 4D7GA 3GDSA 3RU4E 2PTCE 3QDZB 5A0BA 1XMNB 2W5EA 4TY6A 2G5VA 1HCGA 1MTNB 3LU9B 4E05H 1EP5A 3A83A 1E1QD 1DVAH 2BD4A 3N99A 1A3BH 4MNYA 3FP6E 5AHGH 2STAE 4UFGH 1OWIA 3KEEA 5TCAA 3V7TA 1NO9H 2QCYA 4UFDH 5ESTE 2XYAA 1WU1A 1K1IA 3CENA 1O5GH 2RA3A 1OS8A 3VB5A 3E8LA 1GMCG 4R0IA 3EE7A 5GNDA 2BX4A 1GBMA 1O0DH 3GYMA 3S0NA 1D6WA 1RTKA 3GY8A 1MKWK 1QJ6B 3LKWA 1WBGB 4O9VA 2NU1E 2P94A 4X2YA 1BQYA 3EE0B 1HLTH 3MTYA 1HAGE 3NPSA 1TNLA 5EG4A 3RU4D 3FVFB 1C2JA 3ODFA 2PLXA 3TK5A 3SU0A 1O2QA 2BDIA 1P02A 2CF8H 4E7RG 1J9CH 1YPKH 3M5LA 1SGPE 3P8GA 1FV9A 4K2YA 1A46H 1MU6B 3TJOA 1P9SA 1W0JD 2Z3DA 3A8BA 1AUTC 4ZXYH 1HV7A 5EOKA 1YCPM 2SGAA 3KF2A 1SGYE 1JMOH 2PUXB 1VJAU 5GIBA 1JIRA 1KXDA 3KGPA 1OPHB 2BD9A 2PP6A 5AF9H 1P06A 1IQEA 1S6FA 1YBWA 5EGMA 1P09A 1C5ZB 3T62A 4B74A 4CRDA 1C5VA 4Q2KA 2O8WA 1O2YA 2QIQA 3KYFA 4JK5A 1GG6B 3D62A 3RXGA 1C1UH 1XKAC 5T6GA 4OGYA 1O2KA 4FUCA 1L1NA 1EAIA 1O5BB 1NTPA 1BZXE 2H9TH 4K3JA 2CV3A 2FOHA 4B1TA 1N8OC 5DP8A 1AVWA 2ZECA 3LGUA 1BTYA 1BIOA 4ZH8A 2P3FH 1SC8U 3TK9A 4SGAE 3V0XA 2BVSH 2KX4A 1GBBA 1CA0C 3WW7A 2P8OC 2TRMA 3W95A 2GP9B 1DY9A 5C5NA 5EIYA 1CU1A 3CNRA 2H9HA 3SZEA 3BEFB 5K7RA 2A31A 4MNWA 1W7XH 3QGJA 4JZEH 1C4V2 1O2LA 1Q3XA 2HLDD 1GJ6A 2WHXA 1SGIB 4MG3A 4OS6A 1KYNA 1AKSA 2VH6A 1GMDF 3MOCA 2FPZA 4RI0A 4YOIA 1O2SA 3E0NB 5C94A 3AW0A 1Z6JH 1K28D 1CO7E 5CE1A 1UTKA 1A0HB 3RXLA 2ZDNA 2BY8X 3ATIA 5T6FA 1O3GA 3ATKA 2H2ZA 2ASUB 2W3IA 2B7DH 4I32A 4NA9H 5KECA 1W10U 4Y71A 2YNBA 3VFEA 1IQIA 2D2DA 4FUGA 2TPIZ 4NIYA 2Y5GA 4B76A 1GJBB 3P95A 3BV9B 4INLA 3DT0H 4KTUA 1EZQA 2Z9GA 2NWNA 2P93A 5GWZA 2WINI 1HGTH 1ZSKA 2RDLA 4P00A 4BANB 1UVTH 1ZJKA 1EOLA 4B71A 3P8FA 2OQ5A 4XSKU 4NA7A 4Q7ZA 9ESTA 2OC8A 2Y7ZA 7GCHG 2ZFFH 2J9NA 4Y79A 1ELEE 2BLQA 3VB6A 3PO1B 2BLOA 2ZQ1A 4K8BA 5EJ1A 4K1SA 5EODA 1O38A 3O8RA 4DIIH 2IOTA 3SJIA 4X2VA 4KP0A 4YM9A 2F43B 1C2FA 2TGAA 2VIWA 3UFAA 1JXPA 2ZWLH 5CHBA 1ETTH 3TNSA 3SV6A 3NUMA 5DGJA 3ZZ7A 4GLYA 2A45B 1L0ZA 5EPNA 2Q6DA 2GZ8A 1ORFA 1UTJA 1OHHD 1C2IA 1O5FH 5B6OA 3BTME 1LTOA 1NRRH 2EI6A 5JPMH 4MLFB 3DSOA 1EJMA 4K1EA 5DP6A 1ZHPA 2P3TB 4AORA 4DGJA 3DSGA 2W3KA 1GBEA 2A2XH 4B2BA 5C0UA 2Z9KA 2OCVB 3LC3A 1WXRA 1NROH
chains in the Genus database with same CATH topology
2Z3CA 3SUDA 1C9TA 2TIOA 4Z6AH 1NT1A 1MTVA 5DKMA 3CS0A 3SHAH 1TABE 1ZHRA 4X2XA 2HNTE 1MTNC 1NS3A 2BY6X 1BMAA 3P17H 5FPSA 2BTCE 1GHZA 3RMNH 1AUJA 1GDNA 1MTUA 1V2JT 1NU9A 1MH0A 1P3CA 1GI9B 1O3FA 2VWNA 3P8OA 4FVBA 2AERH 1OWDA 1B5GH 4LK4A 3GY2A 4DVAU 3ZV9A 2CGAA 3TK6A 1C2GA 2GV6A 2F3CE 3V13A 2FOEA 1THSH 3UNSA 2ZFQH 4YESB 2ZFPH 1HAYB 3ZVGA 1ELGA 2RA0A 4J1YA 4JK6A 1C5OH 4UD9H 1TPSA 3FP8E 1GI4A 3DA9B 4O3TA 4ZROA 1GJCB 1G2LA 1S84A 3RXCA 3SU2A 1PYTD 3ZVDA 1EPTA 2J4IA 1F5KU 3U69H 1A7SA 3PROA 1TAWA 1XX9A 1F2SE 9LPRA 4U2WA 3EA7A 5L2ZH 2ZDMA 1HXFH 1HJAB 5T6DA 1O2GH 2BXUH 3PMAB 1GI2A 4M7GA 1XKBC 1DY8A 5FPYA 3W94A 5C20A 2I6QA 5IYTA 2NU2E 2VIDA 1BMMH 4BAMB 3NCLA 2Q6GA 4E06H 1TB6H 1KDQB 3KN2A 1E34B 1CGHA 1MAYA 3STIA 4I8KA 3RXJA 3E3TA 3KIDU 4GHTA 4Q7YA 3SQHE 5A8ZA 2XC0A 1MBMA 1Q2WA 1GGDB 1KLIH 3M37A 1LQEA 2FOCA 1TNGA 1KXEA 1P9UA 1RFNA 1YLDA 2QY0B 4ISNA 4OS5A 3SO3A 2Y80A 2HOBA 2IN2A 1DOJA 3BTHE 5EQRA 1ZYOA 2K1QA 1O2NA 1GBIA 3PYHA 1SGRE 3QN7A 2AH4X 1FPCH 2ZDVH 2ZC9H 4MNVA 1GJAB 3P92A 5SGAE 3EA9A 1QURH 3H7OA 5FHTA 1GHXH 1MAXA 1J16A 1O3JA 3A82A 2BHGA 3PMJA 1E35B 1O2XA 4MPWA 3D65E 1Y59T 3E16B 1FIZA 1KXAA 2HALA 1C9PA 1AD8H 4I8JA 4IC5A 1AB9B 1ESBA 1PQAA 3ZZCA 1V2ST 1O2IA 1OOKB 4JZFH 5GDSH 1W14U 2CMYA 3TH3H 4JZ1A 1NRQH 2J38A 2TGTA 3MH7A 1P01A 3UR9A 4WMEA 1ZPCA 1GI6A 2CF9H 3BG8A 1NFXA 1QCPA 2V3HH 3MWIU 2ANWA 3JZ1B 3PMHB 1VR1H 3A7WA 1P03A 1DWEH 2A32A 4ZKSU 2ZHEH 3MI4A 4THNH 1LHEH 1G3BA 1YPGH 3NWUA 2R2MB 2ZDKA 1O3AA 4OS1A 1NZQH 1FAXA 1TNKA 4MDSA 1NC6A 1BTXA 1S83A 2PR3A 3SBKA 4BTIB 4CH8B 1GBHA 1QY6A 3PO1C 3ZV8A 3BEUA 3HPTB 2PSYA 4X1SU 1YCPH 4K1TA 5E8EH 1UVOA 3MU4A 2ZG0H 4DW2U 2PGBB 2ALVA 2GGVB 1TGNA 5ABWA 1UVUH 2PKSB 3GDVA 3OU0A 1QR3E 2PKAA 5GCHF 1P12E 4D7FA 1G37A 3B8JA 1LPGB 1GI0A 4JMYA 1DE7H 2Z6BD 5FBIA 1P2OA 1SSXA 7KMEH 2XNIA 1EZSC 1UCYE 3I77A 1O2JA 1K21H 1FN8A 4ZHMU 1BUIA 1V2KT 3TPIZ 4X2WA 1BJUA 3BF6H 2QGRA 2ZEBA 1GBCA 2BOHB 4ABDA 1OWHA 1EB1H 1TGTA 2ANYA 5F8ZA 2ZIQH 2ZTYA 5FPTA 1QBNA 1TPPA 4OS7A 3A89A 2C90B 1RS0A 1TPOA 1RXPA 1ZRBA 5JYIA 1DPOA 1UK4A 3SUGA 3RU4T 1FONA 2GVFA 2PW8H 3T2NA 1AFQB 1OYTH 3HGNA 2FEQH 1NFUA 2B0FA 1P2NA 4TYDA 2ODYB 3EGKH 1T31A 2A5KA 2FZZA 4Y8YA 2R0LA 4X6NA 4BTUB 1ZJDA 3ZZ3A 1Z8GA 1O2WA 1Z6EA 3SI3H 1SGFA 2OP9A 1A0JA 3LC5A 2GX4A 4NFFA 3M35A 1V3XA 1Z1JA 3KCGH 3PLPA 5I46H 2BVRH 3M61U 1FY1A 2O9QA 4Y11E 3K6ZA 2RG3A 1LHFH 3SU3A 1QRZA 3K65B 3LGYA 2WV4A 3GCHB 1BRCE 1ESTA 2A1DB 2BDYA 4Y0ZE 1GBDA 1ELAA 5EW2H 3A7ZA 2UUKB 1UK3A 3VPKA 4HFPB 1UTPA 4YT7H 1ELVA 2R2WU 1C4U2 1DXPA 5JB8S 1HJAC 5DJ7A 1YC0A 3SHCH 2ILNA 1ESAA 2O8TA 5GPIB 1O3LA 3BTQE 1TRYA 1LO6A 2D8WA 1GI7B 3F9HA 3U1IB 1PPZA 1Q31A 1V6DA 4GSOA 1ID5H 1BTZA 2ZQ2A 4H4FA 3DFLA 2GT8A 2HPQH 1CBWB 1ZR0A 2XBXA 3Q00A 3RXAA 1WQVH 4GVUA 3BSQA 4O3UA 1FUJA 4FUIA 4FXGH 1WV7H 3BEIB 4U30A 2ULLA 3RDZA 1Y5UT 1H8IH 1A3EH 1O3NA 2R0KA 1SG8B 1C1TA 1GI8B 1GGDC 1LPZB 4DCDA 4JYTA 4CRCA 3KNXA 3SQEE 2C8ZB 4Q80A 3NZIA 4ZMAH 2A7JA 1BB0B 3ZZ6A 3SUFA 1TOCB 1CT0E 1ZTLA 1BBRE 2ZU3A 3ZVCA 1DLEA 2ZDLA 3E6PH 2VVUA 1PPHE 2ZFSA 3R0FA 5AFYH 1ZLRA 2VIOA 3PLBA 1YPLH 3F9FA 3LGTA 1O2HA 2KAIA 3A86A 3QTOH 3MO3A 1AB9C 3SNDA 3U1JB 2VGCB 1QL7A 5AVDA 4ISIH 3SJKA 4R8TB 2BLWA 1GVKB 2PFEA 1ZSLA 1TQ0B 1GDUA 1P3EA 2GKVE 3IG6B 4LZ4B 1DLKB 2R3YA 3QTVH 1EAWA 3LIWA 5CHAC 3S7HB 1C1VH 4X1RU 1BJVA 5A8XA 2ZGCA 2C93B 2F83A 3A81A 2A0QB 3M5MA 1YPMH 5EXMA 1BRAA 2J94A 2ZDAH 2FTLE 1OSSA 5IDKA 1MQ6A 3ATMA 6CHAB 5G4BA 4MQAA 2B9LA 1TQ7B 3A87A 2QV1A 1WTGH 2GD4B 3LJOA 2FOFA 1P2MA 4HI3A 2P95A 2P59A 5GCHG 1C2KA 4FVDA 4GHQA 3P8NA 4DOQA 1O5EH 5DK1A 4WWYA 4IN2A 2ZTZA 3RLYH 1QQ4A 2PKSC 3QZQA 3ZVFA 3LONA 1ACBE 1GCDA 2XW9A 3SI4H 4XBCA 1XUJA 3MFJA 1QA0A 1TBRH 1PPEE 2FS9A 2A7HA 4YOJA 1EOJA 1V2QT 5FX5A 1WUNH 2ZHFH 1ARCA 4NIXA 5F8XA 2VU8E 2ZGJA 2DE9A 2ZNKH 4X1QU 3ZZ9A 4YT6H 4VGCB 5JDUB 1RTLA 1INCA 4JYVH 3KQCA 2ZGXH 1O3HA 3M5OA 4DG4A 3BTGE 4ZHAA 2BD5A 2DUCA 1THRH 1GHBG 1T8LA 1NESE 5J4QA 3GY4A 4KTSA 1QGFA 4TPYA 3PWBA 2ZTXA 1ZRKA 5FXLA 1VCPA 2A5IA 1AHTH 1PPCE 1Z8IB 3P6ZB 3FZDA 4HGCA 3RXDA 2A4RA 1AFQC 3Q3YA 3SU1A 8ESTE 3M3SA 1ZTJA 6ESTA 2RCEA 4CBNA 2CHAB 1O3MA 4WMFA 1GBJA 2OQUA 5DP5A 1GL0E 4MPXA 3TH2H 1LHDH 1EZXC 4ABBA 1DWBH 2BQWB 1V2VT 2BX3A 1A5HA 3RXEA 2VVCA 1MU8B 1NFYA 1D3TB 1BDAA 4CR5A 1O3KA 3U98H 1BRBE 1GMHF 3GCHC 2PTNA 2BXTH 1AE8H 1OP8A 4NIVA 1S0QA 1SI5H 2AS9A 4LZ1H 4IW4E 1E36B 1UO6A 5BPEA 3SOSA 1V2OT 1MQ5A 3Q3KA 2QXHA 3SORA 2B5TB 3SNAA 4AFUA 3UR6A 1IHTH 1MD8A 1VZQH 4CRGA 3KHVA 4WH6A 3MNBA 4TPIZ 3Q77A 4I33A 4O97A 1XUGA 3I29A 1ELBA 1O2UA 3PV4A 1H9LB 1C5RA 4X8TH 3T26A 3MNCA 3L33A 5J4SA 2ZCLP 1TX6A 1CBWC 1BBRH 1XXDA 4JCNA 5C1XA 4IGDA 5LPEA 1PQ8A 3D23A 1B7XB 2VH0A 4XFQA 2A5AA 1VITH 1C5TA 1TA2A 1C2MA 1NFWA 3AASA 3K9XB 4DIHH 1F5RA 3EQ0H 3A84A 3MNSA 1AVXA 3EA8A 1GBKA 1SFQB 2QF3A 1SOZA 3M5NA 4GCHG 3LOXA 3N7OA 4X6MA 4TWWA 4FUFA 2PKAB 1HYLA 5JBTA 2VIQA 1OYQA 2Z9LA 2GT7A 1NRPH 3S9AA 2C8WB 1EB2A 1A61H 1H9HE 2Z9JA 2SGFE 2ZGHA 4H6SB 2WYJA 2R3UA 3BIUH 1ZPZA 3UTUH 2Q6FA 3CP7A 2PWXA 1A1RA 2SGPE 2C8YB 2VNTA 4JZIA 4BAQB 2OC1A 2CJIA 5HM2A 5CMXH 2VINA 2VGCC 2A4OA 5EU8A 2HVXA 1G2MA 3MYWA 1BTHH 4MPVA 1O3CA 2XWBI 3GICB 1TX7A 3Q3XA 5TCCA 3SNBA 1FZZA 3RXPA 1QBVH 1ZMNA 1AI8H 2FWWA 4D9RA 2FX4A 1IQJA 3DFJA 2ZPSA 1TRNA 1GBLA 1GI3A 4XE4A 3ENSB 3UUZA 2Z9IA 3TGKE 1V2MT 5FBEA 2UWPA 4CBOA 2FDAA 3SNEA 2IJOB 1O31A 4UFEH 4X1PU 6CHAC 1H9IE 3UOPA 4WMDA 1P2JA 1SQTA 1G3CA 3I78A 2CXVA 3F9GA 1SB1H 1SGDE 1YGCH 2FODA 6GCHF 2AEIH 1JOUB 1G36A 2G4TA 3KQDA 5E0GA 5C67A 2Y5HA 3SZNA 5DG6A 4DJZB 1EPTC 1EASA 4TWYA 4ABGA 1XXFA 1O34A 4CRBA 2AGEX 5LH8A 1SR5C 2G8TA 1EQ9A 4AG2A 1HDTH 3UQVA 1C5SA 1LKBA 1VCQA 1GI1A 1O2OA 3E91A 1IOEA 2V35A 2H5DA 3LGVA 2TGDA 1DWDH 4VGCC 1FY5A 1BMNH 1DWCH 1T8MA 4A92A 1V2WT 2F9BH 1YCPK 1GDQA 1FXYA 3RXHA 5JBCS 4Q7XA 1SGEE 2JH5D 3V3MA 3PB1E 4GPGA 1QFKH 1Y3UA 5HMAA 1UHBB 4X8VH 3RLWH 1JRTA 2TBSA 1GPZA 1SGQE 3EYDA 3ZZ4A 3OTJE 1DSTA 3HKIB 3ZYEA 1BMLA 3C27B 3M3TA 1C1PA 2JH6D 5DO4H 1ELFA 3A85A 3T5FH 1GMDG 2Z94A 1TOMH 2OBOA 4K60A 5FCRA 3FZZA 1EP6A 2QXIA 3RXVA 2CHAC 2ZPRA 2ANKH 1VCWA 2F9VA 2PSXA 4RN6A 2Y81A 5E0JA 1C5XB 1ABJH 1O3EA 1O2TA 3ITIA 3SJ9A 4BXWA 1UTNA 1GMHG 3ATLA 3ZZDA 2C3SA 4UE7H 1EJNA 1QL8A 1C2LA 1KXBA 3SJ8A 1KLJH 1GVZA 1LCYA 1G30B 3RM2H 4GUXA 3T25A 3S9BA 1F0UA 1BRUP 4E7NA 2KAIB 1LDTT 1BTUA 4I31A 1GBTA 4OS4A 3SV7A 2NU3E 1QJ7B 1ZTKA 4Y10E 1DITH 2AMDA 3U9AH 3UY9A 5CHAB 2GCTB 2GDDA 3M7TA 4XDEA 1GVLA 1HXEH 3ZZBA 2TGPZ 3DHKH 3TIUA 1QHRB 1FY8E 1GHVH 2BM2A 3A8CA 1TBQH 2ZHQH 1TLDA 4Y8XA 1L4ZA 2P16A 4A1TA 1O2RA 4WVPE 2OTVA 1FI8A 1QBOA 1NM6A 3O8DA 2XWAA 3R3GB 3GY6A 4YTAA 1MUEB 2OLGA 2D26C 1GJ8B 1HUTH 1N1LA 3BTKE 1H4WA 4AYYB 4AGKA 3SU5A 3RXUA 2P3UB 3SV2H 1C4Y2 1GMCF 4UDWH 3VEQB 3RC4A 1H8DH 4I7YH 1TPAE 2BY9X 3QZRA 1VGCB 1AN1E 1T8OA 1MTWA 2FYQA 3RC5A 1O3DA 3F68H 4B73A 2ZPQA 1L1GA 1BITA 1AGJA 4HZHA 1XUKA 5DP4A 1AE5A 5GXPA 4NFEA 1G32B 2EA3A 3MU0A 4QT8C 2F9OA 3T29A 1N6YA 1HIAA 1LPKB 1YKTA 2FO9A 4KKDA 3RC6A 1TNJA 1TGBA 4FUJA 2EI7A 1ZPBA 1D6RA 2QXJA 2W26A 1FDPA 1EAUA 3RXBA 4CRFA 2FXRA 1S85A 2FLBH 2QXGA 2VVVA 1WYKA 2AIPA 1W8BH 3LJJA 1KIGH 1Y3VA 1GJ4H 3LH1A 5C3NA 5FCKA 4A1XA 3RXMA 3TGIE 1DICA 2AGIX 2C8XB 5EXNA 1DUAA 4WXIA 4B2AA 3E1XB 3UNRA 1UJ1A 1LHCH 4AFQA 3IWMA 1HNEE 1ZZZA 4F4OC 3WY8A 1QJ1B 2J92A 3GCTF 4B75A 4FU9A 3DD2H 1KLTA 4Y76A 2XBVA 3RXOA 6GCHG 2ZCKP 4AYVB 4RKOB 1AKSB 1O32A 1ARBA 1CQQA 1CT2E 1K9OE 2GDEH 3K2UA 2Y7XA 2F9PA 3UREA 2ZFTA 3ZVAA 1ELCA 1C2EA 2O8UA 2OBQA 5H4IB 1M9UA 3BN9A 2SNVA 1Y8TA 4IN1A 3SW2B 4D8NA 3SGQE 1C1OA 3P70B 5A0CA 1XUHA 3RMLH 4LOYH 1BHXF 3L3TA 8KME2 1ZMLA 1H1BA 2BDGA 2G51A 3C1KA 3D49H 3ZVBA 3EAJA 1O35A 1QA7A 3A7XA 1EAXA 2AYWA 4MTBA 3RM0H 4JZDH 5FX6A 4K69A 1OWJA 3GY3A 1SLVB 2JETC 5L6NH 1AVGH 5DP3A 2SFAA 3U8OH 3HGPA 1OX1A 2UWOA 3MO6A 2AIQA 3UIRA 2H6MA 1XUFA 3M36A 2WV5A 1A0LA 1K2I1 2PHBA 3ESTA 1ZHMA 3RMMH 4FU7A 5DPAA 1QB1A 3QUMP 4F49A 1T4VH 2GV7A 3LT3A 1UMAH 5HM9A 3GY7A 3QGNB 5A8YA 3GCOA 1G3EA 3A80A 3O8CA 1SBWA 4H42U 4NCYA 1FY3A 3BTWE 3PM3A 4WXVA 2G52A