1QB6A

Bovine trypsin 3,3'-[3,5-difluoro-4-methyl-2, 6-pyridinediylbis(oxy)]bis(benzenecarboximidamide) (zk-805623) complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb6A02
2Y82A 2WINI 1TE0A 1NM6A 3G01A 1GJ4H 1O3HA 5EOKA 2ZFQH 1SFIA 3CP7A 5GXPA 1O32A 1QBVH 1YPMH 3IWMA 3SU4A 1O3LA 3B9FH 2ZC9H 1XUFA 1O3EA 2QIQA 2NU1E 3LC3A 5JB9S 2ZU2A 1IQIA 1V2UT 3GCOA 1AZZA 1NS3A 2B8OH 1VITH 2GZ7A 1GI9B 1GHBF 1AUTC 1BTXA 3P70B 4RKOB 4ZKRU 1EPTB 1GG6B 2BX4A 5DKMA 3PWCA 1D4PB 4O3TA 2Y81A 4K60A 3RXAA 4TWWA 1YPJH 1EJNA 1OX1A 1DY8A 3TJOA 1AI8H 2XBYA 1GJ8B 4U01A 1CGIE 2CF8H 2SGAA 3M37A 2B0FA 1Y8TA 3SGAE 1C2DA 4YT7H 5JBCS 3AVZA 1P0SH 2AIPA 2TPIZ 4CR9A 3LGYA 2PTCE 1DUEA 2PWXA 1TRNA 1EAWA 3AW0A 4J2YB 3ENSB 3SHCH 1A5HA 4TPYA 1AUJA 1C4U2 2CGAA 4MNWA 1B0FA 1KXBA 3A87A 1OP8A 4CRCA 3S0NA 2FI5E 1AWFH 3U1IB 1A2CH 1C1NA 1F0SA 2IJOB 5C3NA 5TCAA 4DIHH 1GJCB 3LJOA 1GBTA 5K0HA 4ZHMU 3SU1A 1AFEH 1SL3A 2ZFPH 1GVZA 1LQEA 4A5TS 1FQ3A 4AGJA 1GHAG 1NFWA 1WSSH 1THSH 1K1PA 1ELAA 4DW2U 3SNAA 1ANCA 1IQNA 3TNTA 4BNRA 1ZPBA 7LPRA 1N6YA 1SFQB 1S84A 3RXTA 2F91A 1ARBA 4BAQB 1K9OE 3UUZA 1C2JA 4XOJA 1MTNC 1L4ZA 2G8TA 3A88A 1J9CH 1Z8RA 2ZDVH 3PM3A 4X2WA 1DICA 1GL0E 3C1KA 3PTBA 2AMPA 3ATMA 1AU8A 3I29A 3TH3H 4YLQH 1MZDA 2ZDLA 1BHXB 1V2QT 1BBRE 1OSSA 3JZ1B 1TOMH 5AFYH 1NFXA 3SZNA 2P16A 1CA0C 1H8DH 2D8WA 2GV6A 1O2IA 4I31A 4E06H 1O3JA 3FAOA 1GJ5H 4Z6AH 2A5KA 1O30A 2Z9LA 5GCHG 1AKSB 1YP9A 3D62A 1GWAA 2Z3CA 3QDZB 1EAUA 3F9EA 2FI3E 5A0AE 1F0TA 1ZHPA 1AGJA 1GI0A 2ZI2H 4FXGH 4UEHH 3RM0H 3VB5A 3OSYA 5FPTA 2ZDMA 4LXBH 2TGAA 1WAYB 5GJ4B 2QYIA 3QZRA 1CHGA 1TNLA 1MTUA 3Q3XA 1K1JA 1O2OA 2PKSC 1GGDC 1HB0B 2ZU4A 3E6PH 1JWTA 4HGCA 4CH8B 2BD2A 3BTWE 5IDKA 2GD4B 4WXIA 4INKA 1LO6A 3QTOH 4K5ZA 1CO7E 2W26A 4WMDA 4H6SB 2XWAA 1H4WA 3UNSA 5JB8S 3PWBA 2FX4A 4X6PA 1SGFG 1P3CA 2BDAA 2FOMB 3SJOA 2FIRH 3TH2H 1VITF 4X1PU 1DS2E 2FDAA 1V2MT 2OBQA 1O5CB 1C2IA 3PTNA 4KTCA 1AO5A 1BBRK 3TIUA 3MO3A 2EA3A 1UMAH 1DOJA 1NESE 2G5VA 4OGXA 4SGAE 3TK6A 1T8LA 3OU0A 1SGTA 4Y11E 1GHWH 2J34A 3P8GA 4K8YA 1C5XB 4CRDA 4JK5A 2ILNA 3MNSA 1WQVH 1TMTH 4WH8A 1AFQB 1PYTD 5FPYA 1N6XA 5C1XA 1CHOG 2C8ZB 1WCZA 2ZIQH 3RXKA 1KDQA 2G4TA 1GBLA 1DLKB 1SHYA 1C2GA 1TLDA 5JPMH 3V12A 1TB6H 2G55A 2CXVA 2ZHDA 2HPQH 1IOEA 1TBZH 5C1YA 1K28D 1TNIA 2BOHB 3M3VA 1Z6EA 2BDBA 3P8FA 1YPHC 2IPHA 3ZV8A 1IQKA 2ZP0H 1AVWA 1K2I1 2A7HA 5FXLA 2C90B 1B5GH 1FJSA 1O3MA 1T8OA 2HNTC 3DT0H 1YPEH 4WWYA 2ZFRH 3ZYDA 1FN8A 1BOQA 1IQEA 4NA7A 1HAIH 2PFEA 3A82A 3BN9A 2ZGBH 1EATA 3S7HB 5EQQA 3LC5A 4WVPE 1BITA 5GPIB 1P05A 5FX5A 1V2LT 3KQEA 1AE5A 1GHBG 2VGCB 3EGKH 1FNIA 4KTSA 1CBWB 3TJUA 2C8YB 4ASHA 2ZO3H 3EQ0H 3SU3A 1KYNA 1LKBA 3A84A 3ATLA 3M5OA 1P2JA 2GP9B 4Y8XA 2ALVA 4ISNA 5L6NH 4AFZA 2ZHWH 2VNTA 4GPGA 3ZZCA 3P17H 3LIWA 1ELEE 1YGCH 3ELAH 1RFNA 1TX6A 2BQWB 1ZOMA 3S7KB 2PSXA 4UFFH 2DE8A 3U8RH 5I46H 4I32A 1T32A 2AMDA 3DUXH 3IITA 4MDSA 2AEIH 4OS4A 1BTWA 3ZZ3A 1FY4A 4JZFH 2UUKB 8GCHF 3EA7A 5DK1A 1AB9C 2J94A 3BG4C 4AX9H 3K65B 1QIXB 1T8NA 1GMCF 1E37B 1XUJA 1ZTKA 4CR5A 2QCYA 2D26C 4BAHB 4Y8ZA 4ZXYH 2PGQB 1QTFA 2BY8X 1VGCC 2A4OA 2ZHQH 2BLVA 5J4SA 4CRBA 3MH5A 3RLYH 4U30A 1P2IA 3ESTA 1SGDE 1UVUH 3SU6A 4BXWA 1CE5A 1C5WB 4AB8A 4D7GA 3DFJA 3I77A 3RXRA 1BTUA 2FOGA 3A7XA 5FX6A 2BX3A 1WU1A 5L2ZH 3FP8E 2VINA 1HRTH 4ABDA 1ZLRA 2ZNKH 3DD2H 1F7ZA 1MBQA 2ANKH 2ODYB 2VIVA 4UONA 3ZVFA 3A80A 1E36B 2B7DH 4Q7XA 4D76A 1EOLA 1UO6A 1FXYA 3LKWA 3LOXA 5G4BA 4B2AA 3M5LA 2F9UA 3VXEH 4I8KA 4I8LA 4DY7B 4YOGA 5ETXA 2TIOA 1HAZB 5DGJA 3A8BA 2CV3A 4FU9A 3A85A 3LPRA 4ABEA 3V7TA 2P8OC 3SUGA 4WXVA 3HK6B 3MU8A 1W14U 4Y71A 1P2KA 2G81E 4BAMB 1C5LH 1OWDA 2FYQA 2Z94A 3MHWU 1HAYB 1Y59T 4ZUHA 2A5IA 3L33A 1L1GA 2BLWA 3RC4A 1C9PA 2ALPA 2XW9A 2FLRH 1SGNE 1Y3WA 2PUQH 1FV9A 4D7FA 2ZEBA 4B2BA 5BPEA 2W7UA 1SGEE 4MNVA 1TGCA 2WPHS 4UFGH 4JMYA 4Q2KA 1F0RA 4KTUA 5EQRA 1A1RA 1H9LB 1O2LA 1TQ0B 3HGNA 1BB0B 1ZGIA 2VIDA 3SJIA 4A7IB 2XBVA 4J1YA 5EGMA 3CENA 1D3TB 1PJPA 4XFQA 3V0XA 3VB4A 4K1SA 1RTKA 4XDEA 2STBE 1UHBA 1D9IA 3URCA 1AVXA 1NRNH 4OGYA 5PTPA 2BDIA 1C5NH 1P09A 4RN6A 2FP7B 4Y0YE 1F2SE 2FMJA 1J14A 4TYDA 1HV7A 1KLIH 3RUOA 2R3UA 1GI8B 1DSUA 1LVOA 1B7XB 2OINA 1C2MA 1C9TA 4HFPB 3PMJA 2VIPA 1S0QA 1ANBA 2XTTB 5L2YH 2A7JA 2TBSA 1S6FA 1IQFA 1VITG 2A5AA 3MH7A 4KKDA 1LPZB 5LPFA 1QGFA 2WPLS 4MPUA 1C1RA 2AGEX 3LGVA 1CQQA 3M36A 1O38A 1IHSH 4K2YA 1C1VH 3QO6A 1QL9A 2BDGA 2QXGA 5H4IB 4IGDA 2FPZA 1B0EA 2QF0A 1XMNB 3QUMP 1GDNA 3FFGA 2BVXH 1HXEH 2VB0A 4NCYA 4DVAU 4MNYA 3S9AA 3P95A 1GBKA 1BJUA 4GSOA 3TVJB 3ZZ9A 1MH0A 3QLPH 3VB6A 3BEIB 4X2YA 5E8EH 3HK3B 3UQVA 1TPSA 3BTEE 4Q7ZA 3F9GA 4Q7YA 5A8ZA 5F8TA 1SQTA 2OQUA 1BZXE 1TX7A 1A61H 1ESAA 3GY7A 3RC6A 7GCHF 1AZ8A 5EW2H 3RXEA 4AFSA 2AGGX 3K6ZA 4B73A 2ZGXH 2R2MB 1ZRKA 5FHTA 2Q6FA 5HM9A 1WBGB 4OS5A 4DT7B 5JDUB 5EPYA 2Z6BD 5SGAE 1ZGVA 1XUGA 4MVNA 4BANB 2C93B 2Y7XA 3ZZAA 1V2OT 1DM4B 1O3NA 1O2KA 2VWMA 1DXWA 1KXDA 4FUCA 1BTPA 2C3SA 1T7CA 2VIWA 1RTFB 4F49A 1K1LA 4JYVH 2BDYA 2A7CA 2LNCA 4K69A 2DUCA 2SGEE 3ATKA 3U98H 1KTSB 4Y8YA 2J95A 3KNXA 3NXPA 1SGFA 1OYQA 5C1UA 1O3KA 1NN6A 1O31A 1NY22 3SV6A 3AAVA 3HKIB 4O3UA 1MUEB 6LPRA 4HTCH 3TU7H 4ABIA 1DWEH 2FOHA 1E35B 1BA8B 3PLKA 2EI8A 1AQ7A 2FO9A 1O5BB 1ANEA 1G3DA 5DG6A 1GMHF 1KLJH 4IBLH 8GCHG 1AFQC 5A09A 5TCCA 1W0ZU 2CHAC 2QXJA 1GMCG 4KGAA 2ZA5A 3RXCA 3H7OA 3MU0A 4NFFA 4ABJA 1FY1A 4Z0KA 1HJ9A 3SGQE 3F9FA 3P6ZB 3QGNB 1TABE 2OBOA 2KAIA 1A0LA 2NWNA 1C1MA 1NTPA 5DP9A 1QCPA 3MNBA 2ZDKA 1T4VH 1K21H 3D65E 2BB4A 3M5MA 1MU8B 4WF8A 1SGIB 1YLCA 1L1NA 2EEKA 2VH6A 4B76A 4NZLA 3PLBA 2ZQ1A 5E0HA 1J8AA 3GY5A 4WH6A 1XXFA 2GV7A 3SJ9A 5LPRA 1IQHA 1ZMLA 1HJAC 1YBWA 2I6QA 3GYLB 1S0RA 3R3GB 1GBDA 4Y6DA 1O2WA 1O34A 1RJXB 1A0HB 2SGFE 5GDSH 3OY5U 6CHAB 1YYY1 1O2RA 3PLPA 4MQAA 3QGJA 1INCA 2VGCC 1UVOA 4AG2A 1J15A 3KQCA 4PROA 6GCHF 3SU2A 4AGKA 4NG9H 3CS0A 3E91A 1ZMJA 1YCPM 3M35A 1Z1JA 1C1QA 1DITH 3MO6A 1GDQA 4KP0A 2UWPA 1NFUA 3KIDU 1XM1A 5AVDA 4CRFA 1ABIH 1PPEE 1XXDA 2ZDNA 3TH4H 1G2LA 1PQAA 3GY4A 4CH2B 1D6RA 2FM2A 1SI5H 4YO9A 3F9HA 1DWDH 2VU8E 3A7TA 3UREA 1OP2A 1OXGA 2FZZA 5EXMA 3BEFB 1MTSA 5J4QA 5LH8A 4CREA 5HXFA 1P2OA 1U6QA 5GIBA 2H1UA 1BJVA 2O8UA 4MLFB 4ZHLU 1K1MA 1K1NA 1ZJDA 1L0ZA 2ANMH 2K1QA 3RXLA 1GI3A 2O9QA 1CGHA 1AD8H 1G3CA 4DURA 4JYTA 3O8BA 4KELA 1FPHH 2XBXA 5AF9H 2P3FH 2GX4A 1C2FA 3QN7A 1GI4A 1NZQH 2A45B 2AFQB 3F1SB 5ESBA 3KL6A 1G32B 1TMUH 4X1NU 3UR9A 2SNWA 2Z9JA 4CHAB 2QA9E 3T2NA 3LT3A 3ZVCA 3RU4T 3GDSA 2EI6A 5FCKA 4XBCA 2QAAA 2XCFA 5T6FA 3GY3A 1WUNH 1NRRH 1QQ4A 1Y3UA 3ATWA 1TMBH 1N8OB 2BZ6H 3LGWA 2Y80A 3O8RA 1O2SA 1LQDB 5A8YA 1HYLA 1ZYOA 1DY9A 2GMTC 3GY2A 1O2NA 1PQ8A 3UOPA 4LK4A 2ANWA 1TBQH 1VJAU 1ZHMA 3SQEE 1L2EA 3GY8A 1O37A 1GJDB 4HI3A 2A4GA 1GMDF 1NRQH 2P3TB 2BXUH 4XE4A 1EP5A 2ZPSA 2YNBA 2QY0B 3SNDA 3SUDA 2ZHFH 3JZ2B 3BTFE 1C5VA 3BTKE 2XWBI 1EX3A 1HLTH 1QRZA 1V2ST 2BVSH 1O3FA 2NU4E 3KQBA 3RXUA 2OTVA 1YKTA 1RIWB 3RU4E 2XNIA 3PMHB 3T25A 2ZCKP 2ZTXA 3VPKA 3A7YA 1KTTB 5LPEA 4DJZB 3GCHB 2GZ9A 7GCHG 3QTVH 2YOLA 1O33A 1ZRBA 2BD8A 1KLTA 2Z9KA 3VGCC 4B75A 1EZQA 2Z7FE 1O2HA 5F03A 3EA8A 1UK4A 1EJAA 3BTHE 1ABJH 1PFXC 1IQLA 2OXSA 1DT2A 2UUJB 1KXFA 2GCHF 1HAVA 1KIGH 4JZDH 1O35A 2ZU5A 4I8HA 2FOCA 3BIUH 3DA9B 1FDPA 2WPMS 4ZROA 3UQOA 2FOEA 2XXLA 3EYDA 4UDWH 1GCTC 4X2XA 4XBDA 1DUAA 1EASA 2BD5A 2QGRA 3LH1A 1ZTJA 2WYGA 4NGAH 2UUFB 1NT1A 1Z7KA 3Q3YA 4JZEH 2PHBA 1GL1A 5EPNA 3E0PB 1QJ1B 3BTME 2ZGHA 1P01A 2W5EA 2JETC 1UTLM 4YM9A 2GZ8A 2H2ZA 1GBCA 2UUYA 2AMQA 2GCTC 4ZKNU 1V2PT 4E05H 3B8JA 4H4FA 1DPOA 2XRCA 4D9RA 1YPLH 2PSYA 3GDUA 1GI5A 3ZZDA 3A8CA 1W8BH 3W95A 4VGCC 1PYTC 2A32A 5E2OA 2RDLA 1W0YH 2Z3EA 2M5TA 1O3GA 1GMHG 3ZVAA 1UK3A 4Y0ZE 4TY7A 3SNCA 1UTPA 1HUTH 2A31A 1YC0A 3KF2A 1THPB 1T8MA 1CGJE 2GTBA 2PKAB 1Y5BT 1C2EA 4LZ1H 4ZMAH 3ZVDA 1TRYA 1ZPZA 3RXPA 2ZU1A 1BMNH 8LPRA 9ESTA 4IC5A 1V3XA 2F83A 2ZPRA 1GPZA 1YPHE 2XYAA 3RXQA 3EE0B 4FUDA 4CRGA 4NIVA 5C67A 3UIRA 4ISOA 1K1IA 4A92A 3D23A 2H9EH 2WPKS 4MNXA 4AG1A 1LPKB 1QNJA 3TJVA 4TWYA 2HNTE 1O2JA 2OD3B 2BD9A 1GBMA 5EXLA 1GI2A 1SLWB 2H6MA 3RMLH 1NFYA 1QBNA 1CVWH 1FN6A 2J38A 1V2NT 1P04A 2HOBA 1K1OA 2P95A 2RCEA 4I8GA 2ZGCA 1O36A 3SN8A 9LPRA 3H5CB 3URDA 1QB1A 5CMXH 2OCVB 3M3TA 1AY6H 1A7SA 2ZKSA 3H7TA 3SU5A 3ZVGA 1ZJKA 1TIOA 2ZU3A 4IC6A 3CS7A 5LGOA 1CA8B 1W13U 4FUEA 4R0IA 3KHVA 3B23B 4QT8C 3U8OH 1TPOA 2OUAA 2HGTH 4E7RG 2TRMA 1C5UA 1GBAA 1O2ZA 1BCUH 1TGTA 1V2TT 1V2WT 3UY9A 4FUIA 1MTNB 2Z3DA 2A2XH 3UWJH 1O3DA 3ITIA 3PO1C 4I7YH 2ULLA 2J92A 3P92A 3C27B 1O3IA 4JCNA 3S69A 1SOTA 3SHAH 3O8DA 2SNVA 4YOJA 3EA9A 1ORFA 1W2KH 4YOIA 3E3TA 4AZ2B 5A0CA 1H9HE 2CF9H 3OY6U 5CE1A 4FUFA 3GYMA 2VH0A 2FOBA 1ESTA 2IOTA 4YTAA 3RP2A 4X6MA 1CA0B 5FPSA 1EPTC 1F92A 1GG6C 3BTQE 4JK6A 5DP8A 1SHHB 3K9XB 1TA6A 3BEUA 2F3CE 1OP0A 3ZVBA 3RXVA 2EC9H 2AYWA 3GCTF 1ELCA 2ZDAH 1FIZA 2ZWLH 3A86A 4GAWA 1C1WH 1JIRA 1OWKA 4AN7A 3A8DA 1TX8A 2IN2A 2BYAX 3MYWA 5CHAB 5EU8A 2RA0A 1Y3YA 1KDQB 4UFDH 1GBFA 3MTYA 4DCDA 1S83A 3KN2A 1P03A 1X7AC 2ZFSA 4X0WU 4FUBA 3W94A 1SR5C 1Z6JH 3MO9A 5BRRE 1DX5M 2UWOA 1CU1A 1T31A 4JYUH 2VWOA 1TNJA 2PKSB 1ACBE 1GGDB 2P93A 1M9UA 2G4UA 2H9TH 3BTGE 1GMDG 2ZTZA 3T5FH 3E16B 1GHAF 1EB1H 1RD3B 2WPJS 2FODA 5HM2A 3RMNH 4A1VA 3ZVEA 4BTTB 2FLBH 5DP7A 2RA3A 4ISLA 1HDTH 3M5NA 1QHRB 2LPRA 1V2VT 2ZQ2A 3VEQB 1NC6A 1EPTA 1C5TA 3TNSA 1QJ7B 1J16A 2ZCHP 1W7GH 4FUHA 1IQMA 2EI7A 2V3OH 3TK5A 1TPPA 1HIAB 3E0NB 1MKXK 4GHTA 1LVYA 1G3BA 3MU1A 1TGSZ 2OLGA 1QB9A 3NWUA 5F6MA 1NRPH 1XVMA 4CRAA 1C5SA 1UVTH 1BMLA 2WUCA 1MTVA 2HRVA 1GDUA 1UTQA 4AORA 7KMEH 2R3YA 1A5GH 2GCHG 1C4Y2 1XKAC 3I78A 1PPGE 4X8UH 3ZZBA 1F0UA 3HPTB 2G00A 3MH4A 4Y7BA 1GBIA 4DGJA 5AHGH 3SJKA 3UFAA 3UTUH 1OPHB 1T4UH 3ZYEA 4B1TA 1MAXA 3RDZA 1ZSLA 1P12E 3O8CA 2NU0E 2H9HA 5DP6A 1GVLA 3ZZ6A 1P9SA 1P8VC 5JYIA 3P8NA 2FWWA 1G37A 2V3HH 1GJ7B 3K2UA 3TGJE 1JBUH 3SU0A 3T62A 1TONA 3RXMA 2BY9X 1ARCA 3ODDA 3PB1E 1W12U 2Y5FA 3GICB 3SO3A 4D8NA 1XUIA 2R2WU 1PQ5A 3M61U 3A89A 3ODFA 3SQHE 1C1PA 4IMZA 5C5OA 3QWCH 5E0GA 1TNGA 5FBEA 3SV2H 3A8AA 4X1RU 1O2TA 1QQUA 1UJ1A 1QRXA 2GDDA 1C2KA 2OC1A 2BD7A 2Z9GA 2BOKA 5T3HA 1SLUB 1EOJA 1V2RT 5DPAA 1SQOA 1MD7A 2OP9A 1W7XH 3UOUA 3MWIU 1QRWA 2BTCE 2Y6TA 5DO4H 1LVMA 1O2YA 1YCPH 4ESTE 3EDXB 1FZZA 2HWLB 4MG3A 1C5MD 4E7NA 4FU8A 2JH5D 2XCNA 1A0JA 4NA8A 3S9CA 1QA7A 4GHQA 4X8TH 3MU5A 4YT6H 1NROH 1ZHRA 3PROA 4AFQA 1D3DB 4DG4A 1AB9B 1LHDH 1N1LA 4Y79A 2BHGA 2VWNA 4NSYA 3BG4B 2AIQA 3N7OA 1QL7A 4R8TB 1SQAA 1AKSA 1RTLA 1DLEA 1WYKA 1O2VA 1KY9A 2FOFA 4M7GA 1DVAH 4ZHAA 3TLOA 1LVBA 2BLOA 3LONA 3V3MA 1THRH 5ABWA 2ZPQA 3EAJA 1VCQA 2ZGJA 1WV7H 5DP3A 1VGCB 3SV7A 1Z8JB 3U9AH 3SBKA 2QF3A 4BTUB 2OQ5A 3OTJE 3QK1A 1AMHA 4ISHH 4ZH8A 1IQJA 1LHFH 1O2XA 3SV9A 1OKXA 1LCYA 2QXHA 4H6TA 2OC7A 1XKBC 1GVKB 5FBIA 1V6DA 1GJ9B 1KXAA 4HZHA 5EG4A 3SUFA 1PPZA 1VR1H 3RXOA 3T28A 2GT7A 1LTOA 8ESTE 1XUKA 3IG6B 1EXFA 1ZMNA 1C5RA 3SORA 1P3EA 4X8VH 1EZSC 5T6GA 3SOSA 1UHBB 1IAUA 2BD3A 4O9VA 3ATIA 1LPGB 1MBMA 3A7VA 2FEQH 3SJ8A 1MD8A 3STJA 1MKWK 4TPIZ 4ABBA 1O2GH 1DFPA 1TOCB 2VVUA 1QR3E 2PTNA 1LHCH 2BVRH 2HALA 3UNRA 1TPAE 1Z8IB 2WUBA 1BRAA 1AVGH 1D3QB 2P8OB 3TITA 1ZTLA 3RXSA 1FI8A 4NWKA 2O8WA 1MU6B 3NCLA 1XX9A 2XC5A 4B71A 4ABGA 1W10U 5A8XA 1CBWC 1ELFA 2PR3A 4ABAA 1XVOA 6ESTA 1C5ZB 3QX5H 5K7RA 1EJMA 3E8LA 1PPBH 1GJ6A 3SV8A 1A46H 1BMAA 4ABFA 5JBBS 4FUGA 4JZIA 3RXJA 2F9BH 1HAOH 3GCTG 3FANA 2Q1JA 2ZZUH 1O2UA 1TYNA 1ESBA 4DIIH 1C5PA 4INLA 1SC8U 1F5LA 3M3SA 3MH6A 4Y10E 1L1JA 3U1JB 3VXFH 4SGBE 2SGDE 1BRBE 3NKKA 4MPWA 1GI6A 1FIWA 1OWIA 2W7SA 1C5YB 1CT0E 1O3CA 3SI4H 1NPMA 2W3KA 1C5QA 2ZTYA 2SGQE 2FOAA 1HAGE 3PV4A 2ZHEH 1SVPA 1AN1E 3P8OA 5DP4A 1GBJA 1BTHH 4K1EA 1BT7A 1DDJA 3RXFA 1C1TA 4CBOA 3KGPA 2PKAA 2BMGB 3U69H 1W3CA 1SGPE 3UPEA 1ZSKA 2H5DA 2PUXB 1PQ7A 2FTMA 3LH3A 2G52A 3RU4D 4WJG2 1WTGH 1G9IE 1E38B 2ZCLP 2ZECA 4D9QA 1UTOA 2RG3A 1C4V2 4OS1A 1ETRH 3MI4A 2FS9A 2JH6D 3MNCA 1LHEH 1KXEA 1C1SA 3SNEA 3AW1A 1GI1A 4O03A 4B74A 4GCHF 1A5IA 1Q2WA 2WV4A 2FYRA 2R0KA 5EQSA 2ESTE 1W11U 3RM2H 2HVXA 2TGTA 1BDAA 1YPGH 4AYVB 3NPSA 1CSOE 1QFKH 4XSKU 2FTLE 2BLQA 1HXFH 1SGQE 2JKHA 1EKBB 3RXBA 2BY7X 1HCGA 4NIYA 3MMGA 2V6NA 2ANYA 3F6UH 1SLXB 4X8SH 1BTYA 2TGPZ 2VIQA 4FVBA 3A7WA 4NIWA 1ZR0A 1G2MA 2GGVB 3DHKH 3ZZ8A 2QXIA 5CHAC 4BXSA 5JBTA 1EZUC 1G3EA 3MNXA 3FP6E 1GHVH 1TNHA 3SUEA 1GI7B 1QJ6B 1MTWA 2VWLA 1MKXH 1GHZA 1MCVA 1MZAA 1F5RA 4Y76A 1BUIA 4NFEA 4IMQA 3T29A 1SGYE 1Y5AT 1JOUB 1HPGA 2XC0A 2KAIB 3UNQA 2CMYA 1PPHE 2B9LA 4ABHA 1YLDA 4X2VA 3NZIA 2ODPA 2PW8H 1RS0A 4IN2A 3RXHA 4RSPA 1RXPA 1FY3A 2TGDA 8KME2 5HMAA 2J4IA 4Q80A 4IN1A 1MAYA 2HLCA 5T6DA 1YCPK 3Q77A 3Q76A 1WQSA 2NU3E 1P2QA 1AE8H 4IS5A 1BTZA 1FY5A 4NIXA 2J2UA 4WY3A 2A0QB 2GKVE 5F8XA 3MU4A 1BQYA 1WTHD 2AGIX 2CHAB 1BRUP 1EAIA 1EP6A 1TFXA 3T27A 2PV9B 2R9PA 3U8TH 1ELVA 4OS2A 1ELTA 1FLEE 1O2PA 2AH4X 4X1QU 7ESTE 3Q00A 1UTJA 1SG8B 4K3JA 5HGGA 4X6NA 1TRMA 2C8XB 3AAUA 5HYOA 1SMFE 3D49H 1HAXB 3BTDE 1OWJA 2A1DB 1Z71A 4WMFA 5TJXA 1LMWB 4BAOB 4X6OA 2ZFTA 3MOCA 5I25A 3Q3KA 1EZXC 4AOQA 1BIOA 1O5FH 1UTMA 1TBRH 2CJIA 3BG8A 1XUHA 4NWLA 1QL8A 2Z9IA 1SB1H 3KCGH 1AIXH 2VIOA 2P59A 5EODA 2JH0D 1S5SA 3WY8A 1P57B 5A2MH 1HJAB 1GBHA 2HNTF 1GHYH 1O5AB 2BDHA 1HIAA 3R0FA 1EUFA 1Q31A 2B5TB 4THNH 1HAHH 5L30H 2QC2A 1DSTA 2Y5HA 1S6HA 1Z8GA 5DP5A 1JMOH 1OWEA 4LOYH 2PGBB 1P11E 4CBNA 4XBBA 1VJ9U 2THFB 1SLVB 2A2QH 1UCYH 2C8WB 1FAXA 1UVPA 2GVFA 1QBOA 1C2LA 1MMJN 1TQ7B 1A4WH 2J9NA 1CT2E 2BXTH 6GCHG 1BMMH 2WYJA 3VB7A 2R0LA 2Y5GA 4K8BA 4BOHA 1NRSH 4UD9H 3UR6A 4A6LA 2I6SA 1C1OA 1HFDA 2O8MA 5FAHA 1GCDA 1O5DH 4JZ1A 4FU7A 3BSQA 4Y7AA 1Z1IA 3FVFB 2P3UB 4DOQA 1P02A 3GISB 4A1TA 1YM0A 3S9BA 2PLXA 2QV1A 3BV9B 3SI3H 1EAXA 3SNBA 1JXPA 2YNAA 1MQ5A 1MKWH 4BAKB 4OS7A 2CN0H 1S81A 2Y7ZA 5E0JA 2O8LA 1G36A 1JRTA 2XC4A 3FZDA 1S82A 1QA0A 4ZKSU 3UWIA 2AS9A 2HPPH 1P10A 5C20A 5GWZA 1KSNA 2V0BA 2BY6X 2FX6A 3NUMA 1SSXA 1Y3XA 1TA2A 3L3TA 4AB9A 1ZSJA 2BM2A 4MTBA 1DWCH 3HATH 4U2WA 3MFJA 4BTIB 2OC0A 3PYHA 5EW1H 1HGTH 2XBWA 1E0FD 1GJBB 1P2MA 3RXGA 2UWLA 4IW4E 1HNEE 2FESH 1SOZA 3M7TA 1HAVB 1VCWA 1EB2A 3BF6H 3F68H 2F9PA 2GMTB 3BTTE 3LGIA 5A0BA 1AWHB 4MPXA 1HJ8A 2ASUB 3V13A 2P94A 2ODQA 2W3IA 1DXPA 1J17T 2Q6GA 2BY5X 3FP7E 2NU2E 1YF4A 1UVSH 3RC5A 1LHGH 1Q3XA 1GJAB 4GCHG 3E1XB 3RXDA 2WV5A 1OWHA 3GDVA 1PPFE 3L6PA 6CHAC 2A4RA 1ZZZA 2WPIS 1LKAA 4OS6A 1NO9H 5AFZH 1DWBH 1H1BA 1UK2A 5IYTA 3GY6A 4AFUA 3TGIE 2GT8A 3M7UA 2GDEH 3LU9B 1P9UA 1MQ6A 1JIMA 4FUJA 4FVDA 2BQ6B 1O2MA 1F5KU 1AHTH 1P06A 3VFEA 1H8IH 2FS8A 3LJJA 2SGPE 3VGCB 1O3PB 3A81A 2BDCA 4I33A 1TNKA 3TK9A 1QURH 2ZFFH 2BZAA 3SGBE 1D3PB 1NU7B 2F9NA 1GBEA 1V2KT 3AASA 1TWXB 2DE9A 4NSVA 3RLWH 3DFLA 4LZ4B 3FZZA 3RXIA 2AERH 3HKJB 5F8ZA 1C5OH 1MCTA 3TPIZ 3KQDA 1FY8E 4GUXA 1Y5UT 1GCTB 1DE7H 3TJNA 1GBBA 1ELGA 3STIA 1TGBA 2FXRA 3HGPA 4YESB 4WMEA 3RMOH 3OYPA 1VCPA 4NA9H 1RRKA 2VVVA 1WOFA 1ANDA 4A1XA 3KEEA 2JETB 1TGNA 3RMMH 4INHA 1O3BA 4X1SU 2GCTB 1G30B 1OS8A 5GCHF 4CHAC 3LDXH 1FMGA 3GOVB 2BQ7B 1FONA 5JBAS 2O8TA 3A7ZA 3PMBB 1HBTH 1IQGA 1TAWA 4O97A 3QZQA 2G5NA 4I8JA 1ELBA 2G51A 4VGCB 1FPCH 1N8OC 3VB3A 3BIVH 2ZF0H 1BRCE 5ESTE 2F9OA 2VJ1A 1YPKH 5FCRA 4ZKOU 1UCYE 4ISIH 2BD4A 4TY6A 1UTNA 1ZPCA 1H9IE 1O2QA 2Q6DA 3ZZ4A 2C4FH 5C5NA 2A4QA 1S85A 1UTKA 1OOKB 1IHTH 1NU9A 1ETSH 3A83A 3NK8A 5B6OA 1BHXF 1SGCA 1O3OA 4AYYB 1TALA 3OX7U 3K6YA 3LGUA 1V2JT 1FAKH 4ZAEA 3M7QA 3ZV9A 1P2NA 3T26A 4MPVA 1Y3VA 4H42U 4K1TA 1JRSA 1ELDE 1O5GH 1O3AA 1C1UH 1O0DH 1RIWC 4RKJB 1O5EH 4U32A 1FUJA 1BBRH 4GLYA 1LDTT 4GVUA 1C2HA 1QY6A 5DJ7A 2VVCA 1O39A 4NZQA 3GCHC 5EXNA 2QN5T 1K22H 3ZZ5A 1GHXH 1CT4E 2FI4E 1SGRE 4YLUA 1DANH 1OYTH 3LGTA 2V35A 4F4OC 1CHOF 3TGKE 4UE7H 3ZZ7A 1L4DA 5E2PA 2D1JA 1A3BH 1E34B 1D6WA 1HAPH 1PPCE 1KXCA 2STAE 1EQ9A 2SFAA 3GCNA 1UCYK 1ETTH 3PMAB 3SW2B 4B2CA 1SBWA 2OC8A 2D2DA 1A3EH 1VZQH 3E90B 1RGQA 5C2ZA 1ID5H 1SPJA 1QB6A 2ZG0H 4YZUA 4UFEH 4ZXXH 2H5CA 2F9VA 3PO1B
chains in the Genus database with same CATH superfamily
2Y82A 2YMSC 2WINI 1TE0A 5FL7D 1NM6A 3G01A 1GJ4H 1O3HA 5EOKA 2ZFQH 1SFIA 3CP7A 5GXPA 1O32A 1QBVH 1YPMH 3IWMA 3SU4A 1O3LA 2KCAA 2ZC9H 3B9FH 1XUFA 1O3EA 2QIQA 2NU1E 3LC3A 5JB9S 2ZU2A 1IQIA 1V2UT 3GCOA 1AZZA 1NS3A 2B8OH 1VITH 2GZ7A 1GI9B 1GHBF 1AUTC 1BTXA 3P70B 4RKOB 4ZKRU 1EPTB 1GG6B 2BX4A 5DKMA 3PWCA 1D4PB 4O3TA 2Y81A 4K60A 3RXAA 4TWWA 1YPJH 1EJNA 1OX1A 1DY8A 3TJOA 1AI8H 2XBYA 1GJ8B 4U01A 1CGIE 2CF8H 2SGAA 3M37A 2B0FA 4ZCNA 1Y8TA 3SGAE 1C2DA 4YT7H 5JBCS 3AVZA 1P0SH 2AIPA 2TPIZ 4CR9A 1OHHD 3LGYA 2PTCE 1DUEA 2PWXA 1TRNA 1EAWA 3AW0A 4J2YB 3ENSB 3SHCH 1A5HA 4TPYA 1AUJA 1C4U2 2CGAA 4MNWA 1B0FA 1KXBA 3A87A 1OP8A 4CRCA 3S0NA 2FI5E 1AWFH 3U1IB 1A2CH 1C1NA 1F0SA 2IJOB 5C3NA 5TCAA 4DIHH 1GJCB 3LJOA 1GBTA 5K0HA 4ZHMU 3SU1A 1AFEH 1SL3A 2ZFPH 1GVZA 1LQEA 4A5TS 1FQ3A 2K0QA 3F2HA 4AGJA 1GHAG 1NFWA 1WSSH 1THSH 1K1PA 1ELAA 4DW2U 3SNAA 1ANCA 1IQNA 3TNTA 4BNRA 1ZPBA 7LPRA 1N6YA 1SFQB 1S84A 3RXTA 2CK3D 2F91A 1ARBA 4BAQB 1K9OE 3UUZA 2WZQA 1C2JA 2WSSD 4XOJA 1MTNC 1EFRD 1L4ZA 5EJ1A 2G8TA 3A88A 1J9CH 1Z8RA 2ZDVH 3PM3A 4X2WA 1DICA 1GL0E 3C1KA 3PTBA 2AMPA 3ATMA 2QF4A 1AU8A 3I29A 3TH3H 4YLQH 1MZDA 2ZDLA 1BHXB 1V2QT 1BBRE 1OSSA 3JZ1B 1TOMH 5AFYH 2JDID 1NFXA 3SZNA 2P16A 1NBMD 1CA0C 1H8DH 2D8WA 2GV6A 2WHXA 1O2IA 4I31A 4E06H 1O3JA 3FAOA 1GJ5H 4Z6AH 2A5KA 1O30A 2Z9LA 5GCHG 1AKSB 1YP9A 3D62A 1GWAA 2Z3CA 3QDZB 1EAUA 3F9EA 2FI3E 5A0AE 3F3BA 1F0TA 1ZHPA 1AGJA 1GI0A 2ZI2H 4FXGH 4UEHH 3RM0H 3VB5A 3OSYA 5FPTA 2ZDMA 4LXBH 2TGAA 1WAYB 5GJ4B 2QYIA 3QZRA 1CHGA 1TNLA 1MTUA 3Q3XA 1K1JA 1O2OA 2PKSC 1GGDC 1HB0B 2ZU4A 3E6PH 1JWTA 4HGCA 2KCYA 4CH8B 2BD2A 3BTWE 5IDKA 2GD4B 4WXIA 2J98A 4INKA 1LO6A 3QTOH 4K5ZA 1CO7E 2W26A 4WMDA 2M2AA 4H6SB 3SYJA 2XWAA 1H4WA 3UNSA 5JB8S 3PWBA 1NBME 2FX4A 4X6PA 1SGFG 1P3CA 2BDAA 2FOMB 3SJOA 2FIRH 3TH2H 1VITF 4X1PU 1DS2E 2FDAA 1V2MT 2OBQA 1O5CB 1C2IA 3PTNA 4KTCA 1AO5A 1BBRK 3TIUA 3MO3A 2EA3A 1UMAH 1DOJA 1NESE 2G5VA 3PV5A 4OGXA 4Z1MD 4SGAE 3TK6A 1T8LA 3OU0A 1SGTA 4Y11E 1GHWH 2J34A 3P8GA 4K8YA 1C5XB 4CRDA 4JK5A 2ILNA 3MNSA 1WQVH 1TMTH 4WH8A 1AFQB 1PYTD 5FPYA 1N6XA 5C1XA 1CHOG 2C8ZB 1WCZA 2ZIQH 3RXKA 1KDQA 2G4TA 1GBLA 3FOAA 1DLKB 1SHYA 1C2GA 1TLDA 5JPMH 3V12A 1TB6H 2G55A 2CXVA 2W6JD 2ZHDA 2HPQH 1IOEA 1TBZH 4TT3D 5C1YA 1K28D 1TNIA 2BOHB 3M3VA 1Z6EA 2BDBA 3P8FA 1YPHC 2IPHA 3ZV8A 4B6FA 1IQKA 2ZP0H 1AVWA 1K2I1 2A7HA 5FXLA 2C90B 1B5GH 3OAAD 1FJSA 1FX0B 1W0KD 1O3MA 1T8OA 2HNTC 3DT0H 1YPEH 4WWYA 2ZFRH 3ZYDA 4HG6A 1FN8A 1BOQA 1IQEA 4NA7A 1HAIH 2PFEA 1H8ED 3A82A 3BN9A 2ZGBH 1EATA 3S7HB 3N7DA 3OEHD 5EQQA 5C17A 3LC5A 4WVPE 1BITA 5GPIB 1P05A 5FX5A 1V2LT 3KQEA 1AE5A 1GHBG 2VGCB 3EGKH 1FNIA 4KTSA 1CBWB 3TJUA 2C8YB 4ASHA 3F2GA 2ZO3H 3EQ0H 3SU3A 1KYNA 1LKBA 3A84A 3ATLA 2EY4C 1P2JA 3M5OA 2GP9B 4Y8XA 2ALVA 4ISNA 5L6NH 4AFZA 2ZHWH 2VNTA 4GPGA 3ZZCA 3P17H 3LIWA 1ELEE 1YGCH 3ELAH 1RFNA 1TX6A 2BQWB 1ZOMA 3S7KB 2PSXA 4UFFH 2DE8A 3U8RH 5I46H 4I32A 1T32A 2AMDA 3DUXH 3IITA 4MDSA 2AEIH 4OS4A 1BTWA 3ZZ3A 1FY4A 4JZFH 2UUKB 8GCHF 3EA7A 5DK1A 1AB9C 2J94A 3BG4C 4AX9H 3K65B 1QIXB 1T8NA 1GMCF 1E37B 1XUJA 1ZTKA 4CR5A 1KMHB 4ACBA 2QCYA 2D26C 4BAHB 4Y8ZA 4ZXYH 2PGQB 1QTFA 2RFKC 2BY8X 4RT0A 1VGCC 2A4OA 2ZHQH 2BLVA 5J4SA 4CRBA 3GS9A 3MH5A 4U30A 3RLYH 1P2IA 3ESTA 1SGDE 1UVUH 3SU6A 4BXWA 1CE5A 1C5WB 4AB8A 4D7GA 3DFJA 3I77A 3RXRA 1BTUA 2FOGA 3A7XA 5FX6A 2BX3A 1WU1A 5L2ZH 3FP8E 2VINA 1HRTH 4ABDA 1ZLRA 2ZNKH 3DD2H 1F7ZA 3FKSD 5EJZA 2EQNA 1MBQA 2ANKH 2ODYB 2VIVA 4UONA 3ZVFA 3A80A 1E36B 2OK5A 1E1RD 2B7DH 4Q7XA 4D76A 1EOLA 1UO6A 1FXYA 3LKWA 3LOXA 5G4BA 4B2AA 3M5LA 2F9UA 3VXEH 4I8KA 4I8LA 4DY7B 4YOGA 5ETXA 2TIOA 1HAZB 5DGJA 3A8BA 2CV3A 4FU9A 3A85A 3LPRA 4ABEA 3V7TA 2P8OC 4Q4LA 3SUGA 4WXVA 3FO8D 3HK6B 3MU8A 1W14U 4Y71A 1P2KA 2G81E 4BAMB 1C5LH 1OWDA 2FYQA 2Z94A 3MHWU 1HAYB 1Y59T 4ZUHA 2A5IA 3L33A 1L1GA 2BLWA 3RC4A 1C9PA 2ALPA 2XW9A 2FLRH 1SGNE 1Y3WA 2PUQH 1FV9A 4D7FA 2ZEBA 4B2BA 5BPEA 2W7UA 1SGEE 4MNVA 1TGCA 2WPHS 4UFGH 4JMYA 4Q2KA 1F0RA 4KTUA 5EQRA 1A1RA 1H9LB 1O2LA 1TQ0B 3HGNA 1BB0B 1ZGIA 2VIDA 3SJIA 4A7IB 2XBVA 4J1YA 5EGMA 3CENA 1D3TB 1PJPA 4XFQA 3V0XA 3VB4A 4K1SA 1RTKA 4XDEA 2STBE 1UHBA 1D9IA 3URCA 1AVXA 1NRNH 4OGYA 5PTPA 2BDIA 1C5NH 1H8HD 1P09A 2FP7B 4RN6A 4Y0YE 1F2SE 2FMJA 2V7QD 2AHME 1J14A 4TYDA 1HV7A 1KLIH 3RUOA 3WWBA 2R3UA 1GI8B 1DSUA 1LVOA 1B7XB 2OINA 1C2MA 1C9TA 4HFPB 3PMJA 2VIPA 1S0QA 1ANBA 2XTTB 5L2YH 2A7JA 2TBSA 1S6FA 1IQFA 1VITG 2A5AA 3MH7A 4KKDA 1LPZB 4OM9A 5LPFA 1QGFA 2WPLS 4MPUA 1C1RA 2AGEX 3LGVA 5C94A 1CQQA 3M36A 1O38A 1IHSH 4K2YA 1C1VH 3QO6A 1QL9A 2BDGA 2QXGA 3H09A 5H4IB 1YWUA 4IGDA 2FPZA 1B0EA 2QF0A 1XMNB 3QUMP 1GDNA 3FFGA 2BVXH 1HXEH 2VB0A 4NCYA 4DVAU 4MNYA 3S9AA 3P95A 2HVYB 1GBKA 1BJUA 4GSOA 3TVJB 3ZZ9A 1MH0A 3KQ5A 3QLPH 3VB6A 3BEIB 4X2YA 5E8EH 3HK3B 3UQVA 1TPSA 3BTEE 4Q7ZA 3F9GA 4Q7YA 5A8ZA 5F8TA 1SQTA 2OQUA 2WPDD 1BZXE 1TX7A 1A61H 1ESAA 3GY7A 3RC6A 7GCHF 1AZ8A 3PRDA 5EW2H 3RXEA 4AFSA 2AGGX 3K6ZA 1SQRA 4RI0A 4B73A 2ZGXH 2R2MB 1ZRKA 5FHTA 2Q6FA 5HM9A 1WBGB 3OEED 4OS5A 4DT7B 5JDUB 5EPYA 2Z6BD 5SGAE 1ZGVA 2XNDD 1XUGA 4MVNA 3SZEA 4BANB 2C93B 2Y7XA 3ZZAA 1V2OT 1DM4B 1O3NA 1O2KA 2VWMA 1DXWA 1KXDA 4FUCA 1BTPA 2C3SA 1T7CA 2VIWA 1RTFB 4F49A 2L6OA 1K1LA 2QF5A 4JYVH 2BDYA 2A7CA 1S6LA 2LNCA 4K69A 2DUCA 2SGEE 3ATKA 3U98H 1KTSB 4Y8YA 2J95A 3KNXA 3NXPA 1SGFA 1OYQA 5C1UA 1O3KA 1NN6A 1O31A 1NY22 3SV6A 3AAVA 3HKIB 4O3UA 1MUEB 6LPRA 4HTCH 3TU7H 5T1VA 4ABIA 2YMSD 1DWEH 2FOHA 1E35B 2QE7D 1BA8B 3PLKA 2EI8A 2GJGA 1AQ7A 2FO9A 1O5BB 1ANEA 1G3DA 5DG6A 1GMHF 1KLJH 4IBLH 8GCHG 1AFQC 5A09A 5TCCA 1W0ZU 2CHAC 2QXJA 1GMCG 4KGAA 2ZA5A 3RXCA 3H7OA 3MU0A 4NFFA 4ABJA 1FY1A 4Z0KA 1HJ9A 3SGQE 3F9FA 3P6ZB 3QGNB 1TABE 2OBOA 2KAIA 4F55A 1A0LA 2NWNA 1C1MA 1NTPA 2K8IA 5DP9A 1QCPA 3MNBA 2ZDKA 1T4VH 1K21H 3D65E 2BB4A 3M5MA 1MU8B 4WF8A 1SGIB 1YLCA 1L1NA 2EEKA 2VH6A 4B76A 4NZLA 3PLBA 2ZQ1A 5E0HA 1J8AA 3GY5A 4WH6A 1XXFA 2GV7A 3SJ9A 5LPRA 1IQHA 1ZMLA 1HJAC 1YBWA 2I6QA 3GYLB 1S0RA 3R3GB 1GBDA 4Y6DA 5C0UA 1O2WA 1O34A 1RJXB 1A0HB 2SGFE 5GDSH 3OY5U 6CHAB 1YYY1 1O2RA 3PLPA 4MQAA 3QGJA 1INCA 2VGCC 1UVOA 4AG2A 5CHBA 1J15A 3KQCA 4PROA 6GCHF 3SU2A 4AGKA 4NG9H 3CS0A 3E91A 1ZMJA 1YCPM 3M35A 1Z1JA 1C1QA 1DITH 3MO6A 1GDQA 4KP0A 2UWPA 1NFUA 3KIDU 1XM1A 5AVDA 4CRFA 1ABIH 1PPEE 1XXDA 2ZDNA 3TH4H 1G2LA 1PQAA 3GY4A 4CH2B 1D6RA 2FM2A 1SI5H 4YO9A 3F9HA 1DWDH 2VU8E 3A7TA 3UREA 1OP2A 1OXGA 2FZZA 5EXMA 4F48B 3BEFB 1MTSA 5J4QA 5LH8A 4CREA 5HXFA 1P2OA 1U6QA 5GIBA 2H1UA 1BJVA 2O8UA 3F0PA 4MLFB 4ZHLU 4RT1A 1K1MA 1K1NA 1ZJDA 1L0ZA 2ANMH 2K1QA 3RXLA 1GI3A 2O9QA 1CGHA 1AD8H 1G3CA 4DURA 4JYTA 3O8BA 4KELA 1FPHH 2XBXA 5AF9H 2P3FH 2GX4A 1C2FA 3QN7A 1GI4A 1NZQH 2A45B 2AFQB 3F1SB 4ASUD 5ESBA 3KL6A 5C0TA 1G32B 1TMUH 4X1NU 3UR9A 2SNWA 2Z9JA 4CHAB 2QA9E 3T2NA 3LT3A 3ZVCA 3RU4T 3GDSA 2EI6A 5FCKA 4XBCA 2QAAA 2XCFA 5T6FA 3GY3A 1WUNH 1NRRH 1QQ4A 1Y3UA 3ATWA 1TMBH 1N8OB 2BZ6H 3LGWA 2Y80A 3O8RA 1O2SA 1LQDB 5A8YA 1HYLA 1ZYOA 1DY9A 2GMTC 3GY2A 1O2NA 1PQ8A 3UOPA 4LK4A 2ANWA 1TBQH 3DSGA 1VJAU 1ZHMA 3SQEE 1L2EA 3GY8A 1O37A 1GJDB 4HI3A 2A4GA 1GMDF 1NRQH 2P3TB 2BXUH 4XE4A 1EP5A 2ZPSA 2YNBA 2QY0B 3SNDA 4I86A 3SUDA 2ZHFH 3JZ2B 3BTFE 1C5VA 3BTKE 2XWBI 1EX3A 1HLTH 1QRZA 1V2ST 4XD7D 2BVSH 1O3FA 2KM0A 2NU4E 5KGOA 3KQBA 3RXUA 2OTVA 1WXRA 1YKTA 1RIWB 3RU4E 3AK5A 2XNIA 3PMHB 3T25A 2ZCKP 2ZTXA 3VPKA 3A7YA 1KTTB 5LPEA 4DJZB 3GCHB 2GZ9A 7GCHG 3QTVH 2YOLA 1O33A 2J97A 1ZRBA 1COWD 2BD8A 1KLTA 2Z9KA 3VGCC 4B75A 1EZQA 2Z7FE 1O2HA 5F03A 3EA8A 1UK4A 1EJAA 3BTHE 1ABJH 1PFXC 1IQLA 2OXSA 1DT2A 2UUJB 1KXFA 2GCHF 1HAVA 1KIGH 4JZDH 1O35A 2WV9A 2ZU5A 4I8HA 2FOCA 3BIUH 3DA9B 1FDPA 2WPMS 4ZROA 3UQOA 2FOEA 2XXLA 2F4LA 3EYDA 4UDWH 1GCTC 4X2XA 4XBDA 1DUAA 1EASA 2BD5A 2QGRA 3LH1A 1ZTJA 2WYGA 4FETA 4NGAH 2UUFB 1NT1A 1Z7KA 3Q3YA 4JZEH 2PHBA 1GL1A 5EPNA 3E0PB 1QJ1B 3BTME 2ZGHA 1P01A 2W5EA 2JETC 1UTLM 4YM9A 2GZ8A 2H2ZA 1GBCA 2KZ4A 2UUYA 2AMQA 2GCTC 2YMSB 4ZKNU 1V2PT 2IPQX 4E05H 3B8JA 4H4FA 1DPOA 2XRCA 4D9RA 1YPLH 2PSYA 3GDUA 1GI5A 3ZZDA 3A8CA 1W8BH 3W95A 4VGCC 1PYTC 2A32A 5E2OA 3PV2A 2RDLA 1W0YH 2Z3EA 2M5TA 1O3GA 1GMHG 3ZVAA 1UK3A 4Y0ZE 4TY7A 3SNCA 1UTPA 1HUTH 2A31A 1YC0A 3KF2A 1THPB 1T8MA 1CGJE 2GTBA 2PKAB 1Y5BT 1C2EA 4LZ1H 4ZMAH 3ZVDA 1TRYA 1ZPZA 4TSFD 3WWFA 3RXPA 2ZU1A 1BMNH 8LPRA 9ESTA 4IC5A 1V3XA 2F83A 2ZPRA 1GPZA 1YPHE 2XYAA 3RXQA 3EE0B 4FUDA 4CRGA 4NIVA 5C67A 3UIRA 4ISOA 1K1IA 4A92A 3D23A 2H9EH 2WPKS 4MNXA 4AG1A 1LPKB 1QNJA 3TJVA 4TWYA 2HNTE 1O2JA 2OD3B 2BD9A 1GBMA 5EXLA 1GI2A 1SLWB 2H6MA 3RMLH 1NFYA 1QBNA 5EIYA 1CVWH 1FN6A 2J38A 1V2NT 1P04A 2HOBA 1K1OA 2P95A 2RCEA 4I8GA 2ZGCA 1O36A 3SN8A 9LPRA 3H5CB 3URDA 1QB1A 5CMXH 2OCVB 3M3TA 1AY6H 1A7SA 2ZKSA 3H7TA 3SU5A 3U28C 3ZVGA 1ZJKA 1TIOA 2ZU3A 4IC6A 3CS7A 5LGOA 1CA8B 1W13U 4FUEA 4R0IA 3KHVA 3B23B 4QT8C 2KCPA 3U8OH 1TPOA 2OUAA 2HGTH 4E7RG 2TRMA 1C5UA 1GBAA 1O2ZA 1BCUH 1TGTA 1V2TT 1V2WT 3UY9A 4FUIA 1MTNB 2Z3DA 2A2XH 2JJ1D 1O3DA 3UWJH 3ITIA 5KECA 3PO1C 4I7YH 2ULLA 2J92A 3P92A 3C27B 1O3IA 4JCNA 3S69A 1K0HA 2J98B 1SOTA 3SHAH 3O8DA 2SNVA 4YOJA 3EA9A 1ORFA 1W2KH 4YOIA 3E3TA 4AZ2B 5A0CA 1H9HE 2CF9H 2W6ID 3OY6U 5CE1A 4FUFA 3GYMA 2VH0A 2FOBA 1ESTA 2IOTA 4YTAA 3RP2A 4X6MA 1CA0B 5FPSA 1EPTC 1F92A 1GG6C 3BTQE 4JK6A 5DP8A 1SHHB 3K9XB 1TA6A 3BEUA 2F3CE 1OP0A 3ZVBA 3RXVA 2EC9H 2AYWA 3GCTF 1ELCA 2ZDAH 1FIZA 2ZWLH 3A86A 4GAWA 1C1WH 1JIRA 1OWKA 4AN7A 3A8DA 1TX8A 2IN2A 2BYAX 3MYWA 5CHAB 5EU8A 2RA0A 1Y3YA 1KDQB 4UFDH 1GBFA 3MTYA 4DCDA 1S83A 3KN2A 1P03A 1X7AC 2ZFSA 4X0WU 4FUBA 3W94A 1SR5C 1Z6JH 3MO9A 5BRRE 1DX5M 2UWOA 1CU1A 1T31A 4JYUH 2VWOA 1TNJA 2PKSB 1ACBE 1GGDB 2P93A 1M9UA 2G4UA 2H9TH 3BTGE 1GMDG 2ZTZA 3T5FH 3E16B 1GHAF 1EB1H 1RD3B 2WPJS 2FODA 5HM2A 3RMNH 4A1VA 3ZVEA 4BTTB 2FLBH 5DP7A 2RA3A 4ISLA 1HDTH 3M5NA 1QHRB 2LPRA 1V2VT 2ZQ2A 3VEQB 1E79D 1NC6A 1EPTA 1C5TA 3TNSA 1QJ7B 1J16A 2ZCHP 1W7GH 4FUHA 1IQMA 2EI7A 2V3OH 3TK5A 1TPPA 1HIAB 3E0NB 1MKXK 4GHTA 1LVYA 1G3BA 3MU1A 1TGSZ 2OLGA 1QB9A 2PP6A 3NWUA 5F6MA 1NRPH 1XVMA 4CRAA 1C5SA 1UVTH 1BMLA 2WUCA 1MTVA 2HRVA 1GDUA 1UTQA 4AORA 7KMEH 2R3YA 1A5GH 2GCHG 1C4Y2 1XKAC 3I78A 1PPGE 4X8UH 3ZZBA 1F0UA 3HPTB 2G00A 3MH4A 4Y7BA 1GBIA 4DGJA 5AHGH 3SJKA 3UFAA 3UTUH 1OPHB 1T4UH 3ZYEA 4B1TA 1MAXA 3RDZA 1ZSLA 1P12E 3O8CA 2NU0E 2H9HA 5DP6A 1GVLA 3ZZ6A 1P9SA 1P8VC 5JYIA 3P8NA 2FWWA 2JIZD 1G37A 2V3HH 1GJ7B 3K2UA 3TGJE 1JBUH 3SU0A 3T62A 2KX4A 1TONA 2KR7A 3RXMA 2BY9X 1ARCA 3ODDA 3PB1E 1W12U 2Y5FA 3GICB 3SO3A 4D8NA 1XUIA 2R2WU 1PQ5A 3M61U 3A89A 3ODFA 3SQHE 1C1PA 4IMZA 5C5OA 3QWCH 5E0GA 4YXWD 1TNGA 5FBEA 3SV2H 3A8AA 4X1RU 1O2TA 1QQUA 1UJ1A 1QRXA 2GDDA 1SKYE 1C2KA 2OC1A 5KEDA 2BD7A 2Z9GA 1UW7A 5IK2D 2BOKA 5T3HA 1SLUB 1EOJA 1V2RT 5DPAA 1SQOA 1MD7A 2OP9A 1W7XH 3UOUA 3MWIU 1QRWA 2BTCE 2Y6TA 5DO4H 1LVMA 1O2YA 1YCPH 4ESTE 3EDXB 1FZZA 2HWLB 4MG3A 1C5MD 4E7NA 4FU8A 2JH5D 2XCNA 1A0JA 4NA8A 3S9CA 1QA7A 4GHQA 4X8TH 3MU5A 4YT6H 1NROH 1ZHRA 3PROA 4AFQA 1D3DB 4DG4A 1AB9B 1LHDH 1N1LA 4Y79A 2BHGA 2VWNA 4NSYA 3BG4B 2AIQA 3N7OA 1QL7A 4R8TB 1SQAA 1AKSA 1RTLA 1DLEA 1WYKA 1O2VA 1KY9A 2FOFA 4M7GA 1DVAH 4ZHAA 3TLOA 1LVBA 2BLOA 3LONA 3V3MA 1THRH 5ABWA 2ZPQA 3EAJA 1VCQA 1YY3A 2ZGJA 1WV7H 5DP3A 1VGCB 3SV7A 1Z8JB 3U9AH 3SBKA 2QF3A 4BTUB 2OQ5A 3OFND 3OTJE 3QK1A 3DCLA 1AMHA 4ISHH 4ZH8A 1IQJA 1LHFH 1O2XA 3DSPA 3SV9A 1OKXA 1LCYA 2QXHA 4H6TA 2OC7A 1BMFD 1XKBC 1GVKB 5FBIA 1V6DA 1GJ9B 1KXAA 4HZHA 5EG4A 3SUFA 1PPZA 3MQKC 1VR1H 3RXOA 3T28A 2GT7A 1QZ8A 1LTOA 8ESTE 3W1EA 1XUKA 3IG6B 1EXFA 1ZMNA 1C5RA 3SORA 3WW7A 1P3EA 4X8VH 1EZSC 5T6GA 3SOSA 1UHBB 1IAUA 2BD3A 4O9VA 3ATIA 1LPGB 1MBMA 3A7VA 2FEQH 3SJ8A 1MD8A 5HIZA 3STJA 1MKWK 4TPIZ 4ABBA 1O2GH 1DFPA 1TOCB 2VVUA 1QR3E 2PTNA 1LHCH 2BVRH 2HALA 3UNRA 1TPAE 1Z8IB 2WUBA 1BRAA 1AVGH 1D3QB 2P8OB 3TITA 1ZTLA 3RXSA 1FI8A 4NWKA 2O8WA 1MU6B 3NCLA 1XX9A 2XC5A 4B71A 4ABGA 1W10U 5A8XA 1CBWC 1ELFA 2PR3A 3OTPA 1XVOA 4ABAA 6ESTA 1C5ZB 3QX5H 5K7RA 1EJMA 3E8LA 1PPBH 1GJ6A 3SV8A 1A46H 1BMAA 4ABFA 5JBBS 4FUGA 4JZIA 3RXJA 2F9BH 1HAOH 3GCTG 3FANA 2Q1JA 2ZZUH 1O2UA 2IJD1 1TYNA 1ESBA 4DIIH 4ACAA 1C5PA 4INLA 1SC8U 1F5LA 3M3SA 4B6EA 3MH6A 4Y10E 1L1JA 3U1JB 3VXFH 4SGBE 2SGDE 1BRBE 2J5UA 3NKKA 4MPWA 1GI6A 5HKKD 1FIWA 1OWIA 2RDEA 1C5YB 1CT0E 1O3CA 2W7SA 3SI4H 1NPMA 2W3KA 1C5QA 2ZTYA 2SGQE 2FOAA 1HAGE 3PV4A 2ZHEH 1SVPA 1AN1E 3P8OA 5DP4A 4DT4A 1GBJA 1BTHH 4K1EA 1BT7A 1DDJA 3RXFA 1C1TA 4CBOA 3KGPA 5CDFE 2PKAA 2BMGB 3U69H 1W3CA 1SGPE 3UPEA 3CNRA 4M9FA 1ZSKA 2H5DA 2PUXB 1PQ7A 2FTMA 3LH3A 2G52A 3FN8A 4WJG2 1WTGH 3RU4D 1G9IE 1E38B 2ZCLP 2ZECA 4D9QA 1UTOA 2RG3A 1C4V2 5F53A 4OS1A 1ETRH 3MI4A 2FS9A 2JH6D 3MNCA 1LHEH 1KXEA 1C1SA 3SNEA 3AW1A 1GI1A 4O03A 4B74A 4GCHF 1A5IA 1Q2WA 3KYFA 2WV4A 2FYRA 2R0KA 5EQSA 2ESTE 1W11U 3RM2H 2HVXA 2TGTA 1BDAA 1YPGH 4AYVB 3NPSA 1CSOE 1QFKH 4XSKU 2FTLE 2BLQA 1HXFH 1SGQE 2JKHA 1EKBB 3RXBA 2BY7X 1HCGA 4NIYA 3MMGA 2V6NA 2VBCA 2ANYA 3F6UH 1SLXB 4X8SH 1BTYA 2TGPZ 2VIQA 4FVBA 3A7WA 4NIWA 1ZR0A 1G2MA 2GGVB 3DHKH 3ZZ8A 2QXIA 5CHAC 4BXSA 5JBTA 1EZUC 1G3EA 3MNXA 3FP6E 1GHVH 1TNHA 3SUEA 1GI7B 1QJ6B 1MTWA 2VWLA 1MKXH 1GHZA 1MCVA 1MZAA 1F5RA 4Y76A 1BUIA 4NFEA 4IMQA 3PRBA 3T29A 1SGYE 1Y5AT 1JOUB 1HPGA 2XC0A 2KAIB 3UNQA 2CMYA 1PPHE 2B9LA 4ABHA 1YLDA 4X2VA 3NZIA 2ODPA 2PW8H 1RS0A 4IN2A 3RXHA 4RSPA 1RXPA 1FY3A 2TGDA 8KME2 5HMAA 2J4IA 4Q80A 4IN1A 1MAYA 2HLCA 5T6DA 1YLNA 1YCPK 3Q77A 3Q76A 1WQSA 2NU3E 1P2QA 1AE8H 4IS5A 3KYGA 1BTZA 1FY5A 4NIXA 2J2UA 4WY3A 2A0QB 2HLDD 2GKVE 5F8XA 3MU4A 1BQYA 3EE7A 1WTHD 2AGIX 2CHAB 1BRUP 1EAIA 1EP6A 1TFXA 3T27A 2PV9B 2R9PA 3U8TH 1ELVA 4OS2A 1ELTA 1FLEE 1O2PA 2AH4X 4X1QU 7ESTE 3Q00A 1UTJA 1SG8B 4K3JA 5HGGA 4X6NA 1TRMA 2C8XB 3AAUA 5HYOA 1SMFE 3D49H 1HAXB 3BTDE 1OWJA 2A1DB 1Z71A 4WMFA 5TJXA 1LMWB 4BAOB 4X6OA 2ZFTA 3MOCA 5I25A 3Q3KA 1EZXC 4AOQA 1BIOA 1O5FH 1UTMA 1TBRH 2CJIA 3BG8A 1XUHA 4NWLA 1QL8A 2Z9IA 1SB1H 3KCGH 1AIXH 2VIOA 2P59A 5EODA 2JH0D 1S5SA 3WY8A 1P57B 5A2MH 1HJAB 1GBHA 2HNTF 1GHYH 1O5AB 2BDHA 1HIAA 5HIYA 3R0FA 1EUFA 1Q31A 2B5TB 4THNH 1HAHH 5L30H 2QC2A 1DSTA 2Y5HA 1S6HA 1Z8GA 5DP5A 1JMOH 1OWEA 4LOYH 2PGBB 1P11E 4CBNA 4XBBA 1VJ9U 2THFB 1SLVB 2A2QH 1UCYH 2C8WB 1FAXA 1UVPA 2GVFA 3DSOA 1QBOA 4Q63A 1C2LA 1MMJN 1TQ7B 1A4WH 5DN6D 2J9NA 1CT2E 2BXTH 6GCHG 1BMMH 2WYJA 3VB7A 2R0LA 2Y5GA 4K8BA 4BOHA 1NRSH 4UD9H 3UR6A 4A6LA 2I6SA 3UAIC 1C1OA 1HFDA 2O8MA 5FAHA 1GCDA 1O5DH 4JZ1A 2KCOA 4FU7A 3BSQA 4Y7AA 1Z1IA 3FVFB 2P3UB 4DOQA 1P02A 3GISB 4A1TA 1YM0A 3S9BA 2PLXA 2QV1A 3BV9B 3SI3H 1EAXA 3SNBA 1JXPA 2YNAA 1MQ5A 1MKWH 4BAKB 4OS7A 2CN0H 1S81A 2Y7ZA 5E0JA 2O8LA 1G36A 1JRTA 2XC4A 3FZDA 1S82A 1QA0A 4ZKSU 3UWIA 2AS9A 2HPPH 1P10A 5C20A 5GWZA 1KSNA 2V0BA 2BY6X 2FX6A 3NUMA 1SSXA 1Y3XA 1TA2A 3L3TA 4AB9A 1ZSJA 2BM2A 4MTBA 1W0JD 1DWCH 3HATH 4U2WA 3MFJA 4BTIB 2OC0A 3PYHA 5EW1H 1HGTH 2XBWA 1E0FD 1GJBB 1P2MA 3RXGA 2UWLA 4IW4E 1HNEE 2FESH 1SOZA 3M7TA 1HAVB 1VCWA 1EB2A 3BF6H 3F68H 2F9PA 2GMTB 3BTTE 3LGIA 5A0BA 1AWHB 4MPXA 1HJ8A 2ASUB 3V13A 2P94A 2ODQA 2W3IA 1DXPA 1J17T 2Q6GA 2BY5X 3FP7E 2NU2E 1YF4A 1UVSH 3RC5A 1LHGH 1Q3XA 1GJAB 4GCHG 3E1XB 3RXDA 2WV5A 1OWHA 3GDVA 1PPFE 3L6PA 6CHAC 2A4RA 1ZZZA 2WPIS 1LKAA 3OE7D 4OS6A 1NO9H 5AFZH 1DWBH 1H1BA 1UK2A 4XRNA 5IYTA 3GY6A 4AFUA 3TGIE 2GT8A 3M7UA 2GDEH 3LU9B 1P9UA 5EJLA 1MQ6A 1JIMA 4FUJA 4FVDA 2BQ6B 1O2MA 1F5KU 1AHTH 3N99A 1P06A 3VFEA 1H8IH 2FS8A 3LJJA 4P02A 2SGPE 1VKYA 3VGCB 1O3PB 3A81A 2BDCA 4I33A 1TNKA 3TK9A 2LELA 1QURH 2ZFFH 2BZAA 3SGBE 1D3PB 1NU7B 2F9NA 1GBEA 1V2KT 3AASA 1TWXB 2DE9A 4NSVA 3RLWH 3DFLA 4LZ4B 3FZZA 3RXIA 2AERH 3HKJB 3N7EA 5F8ZA 3UB0A 1C5OH 1MCTA 3TPIZ 3KQDA 1FY8E 4GUXA 1Y5UT 1GCTB 3VG8A 1DE7H 3TJNA 1GBBA 1ELGA 3STIA 1TGBA 2FXRA 3HGPA 4YESB 4WMEA 3RMOH 4AC9A 3OYPA 1VCPA 4NA9H 1RRKA 2VVVA 1WOFA 1MABB 1ANDA 2JJ2D 4A1XA 3KEEA 2JETB 1TGNA 3RMMH 4INHA 1O3BA 4X1SU 2GCTB 1G30B 1OS8A 2L74A 5GCHF 4CHAC 3LDXH 1FMGA 3GOVB 2BQ7B 1FONA 5JBAS 2O8TA 3A7ZA 3PMBB 1HBTH 1IQGA 1TAWA 4O97A 3QZQA 2G5NA 4I8JA 1ELBA 2G51A 4VGCB 1FPCH 1N8OC 3VB3A 3BIVH 2ZF0H 1BRCE 5ESTE 2F9OA 2VJ1A 3F2FA 1YPKH 5FCRA 4ZKOU 5GNDA 1UCYE 4ISIH 2F43B 2BD4A 4TY6A 1UTNA 1ZPCA 1H9IE 1O2QA 2Q6DA 3ZZ4A 2C4FH 5C5NA 2A4QA 1S85A 1UTKA 1OOKB 1IHTH 1NU9A 1ETSH 3A83A 3NK8A 5B6OA 1BHXF 1SGCA 1O3OA 4AYYB 1TALA 3OX7U 3K6YA 3LGUA 1V2JT 1FAKH 2V3MA 4P00A 3M7QA 4ZAEA 3ZV9A 1P2NA 5B6LA 3T26A 4MPVA 1Y3VA 4H42U 4K1TA 1JRSA 1ELDE 1O5GH 1O3AA 1C1UH 1O0DH 1RIWC 4RKJB 1O5EH 4U32A 1FUJA 1BBRH 1WDIA 4GLYA 1LDTT 4GVUA 5DSFA 1C2HA 1QY6A 5DJ7A 2VVCA 1O39A 4NZQA 3GCHC 5EXNA 2QN5T 3NRLA 1K22H 2LP6A 3ZZ5A 1GHXH 1CT4E 2FI4E 1SGRE 4YLUA 1DANH 1OYTH 3LGTA 2V35A 2XOKD 4F4OC 1CHOF 3TGKE 4UE7H 3F0OA 3ZZ7A 1L4DA 5E2PA 2D1JA 1A3BH 1E34B 1D6WA 3ZIAD 1HAPH 1PPCE 4FOUC 1KXCA 1E1QD 2STAE 1EQ9A 2SFAA 3GCNA 1UCYK 1ETTH 3PMAB 3SW2B 4B2CA 1SBWA 2OC8A 2D2DA 2KFWA 1A3EH 1VZQH 3E90B 1RGQA 5C2ZA 1ID5H 1SPJA 1QB6A 2ZG0H 4YZUA 4UFEH 4ZXXH 2H5CA 2F9VA 3PO1B
chains in the Genus database with same CATH topology
2Y82A 2WINI 1TE0A 1NM6A 3G01A 1GJ4H 1O3HA 5EOKA 2ZFQH 1SFIA 3CP7A 5GXPA 1O32A 1QBVH 1YPMH 3IWMA 3SU4A 1O3LA 3B9FH 2ZC9H 1XUFA 1O3EA 2QIQA 2NU1E 3LC3A 5JB9S 2ZU2A 1IQIA 1V2UT 3GCOA 1AZZA 1NS3A 2B8OH 1VITH 2GZ7A 1GI9B 1GHBF 1AUTC 1BTXA 3P70B 4RKOB 4ZKRU 1EPTB 1GG6B 2BX4A 5DKMA 3PWCA 1D4PB 4O3TA 2Y81A 4K60A 3RXAA 4TWWA 1YPJH 1EJNA 1OX1A 1DY8A 3TJOA 1AI8H 2XBYA 1GJ8B 4U01A 1CGIE 2CF8H 2SGAA 3M37A 2B0FA 1Y8TA 3SGAE 1C2DA 4YT7H 5JBCS 3AVZA 1P0SH 2AIPA 2TPIZ 4CR9A 3LGYA 2PTCE 1DUEA 2PWXA 1TRNA 1EAWA 3AW0A 4J2YB 3ENSB 3SHCH 1A5HA 4TPYA 1AUJA 1C4U2 2CGAA 4MNWA 1B0FA 1KXBA 3A87A 1OP8A 4CRCA 3S0NA 2FI5E 1AWFH 3U1IB 1A2CH 1C1NA 1F0SA 2IJOB 5C3NA 5TCAA 4DIHH 1GJCB 3LJOA 1GBTA 5K0HA 4ZHMU 3SU1A 1AFEH 1SL3A 2ZFPH 1GVZA 1LQEA 4A5TS 1FQ3A 4AGJA 1GHAG 1NFWA 1WSSH 1THSH 1K1PA 1ELAA 4DW2U 3SNAA 1ANCA 1IQNA 3TNTA 4BNRA 1ZPBA 7LPRA 1N6YA 1SFQB 1S84A 3RXTA 2F91A 1ARBA 4BAQB 1K9OE 3UUZA 1C2JA 4XOJA 1MTNC 1L4ZA 2G8TA 3A88A 1J9CH 1Z8RA 2ZDVH 3PM3A 4X2WA 1DICA 1GL0E 3C1KA 3PTBA 2AMPA 3ATMA 1AU8A 3I29A 3TH3H 4YLQH 1MZDA 2ZDLA 1BHXB 1V2QT 1BBRE 1OSSA 3JZ1B 1TOMH 5AFYH 1NFXA 3SZNA 2P16A 1CA0C 1H8DH 2D8WA 2GV6A 1O2IA 4I31A 4E06H 1O3JA 3FAOA 1GJ5H 4Z6AH 2A5KA 1O30A 2Z9LA 5GCHG 1AKSB 1YP9A 3D62A 1GWAA 2Z3CA 3QDZB 1EAUA 3F9EA 2FI3E 5A0AE 1F0TA 1ZHPA 1AGJA 1GI0A 2ZI2H 4FXGH 4UEHH 3RM0H 3VB5A 3OSYA 5FPTA 2ZDMA 4LXBH 2TGAA 1WAYB 5GJ4B 2QYIA 3QZRA 1CHGA 1TNLA 1MTUA 3Q3XA 1K1JA 1O2OA 2PKSC 1GGDC 1HB0B 2ZU4A 3E6PH 1JWTA 4HGCA 4CH8B 2BD2A 3BTWE 5IDKA 2GD4B 4WXIA 4INKA 1LO6A 3QTOH 4K5ZA 1CO7E 2W26A 4WMDA 4H6SB 2XWAA 1H4WA 3UNSA 5JB8S 3PWBA 2FX4A 4X6PA 1SGFG 1P3CA 2BDAA 2FOMB 3SJOA 2FIRH 3TH2H 1VITF 4X1PU 1DS2E 2FDAA 1V2MT 2OBQA 1O5CB 1C2IA 3PTNA 4KTCA 1AO5A 1BBRK 3TIUA 3MO3A 2EA3A 1UMAH 1DOJA 1NESE 2G5VA 4OGXA 4SGAE 3TK6A 1T8LA 3OU0A 1SGTA 4Y11E 1GHWH 2J34A 3P8GA 4K8YA 1C5XB 4CRDA 4JK5A 2ILNA 3MNSA 1WQVH 1TMTH 4WH8A 1AFQB 1PYTD 5FPYA 1N6XA 5C1XA 1CHOG 2C8ZB 1WCZA 2ZIQH 3RXKA 1KDQA 2G4TA 1GBLA 1DLKB 1SHYA 1C2GA 1TLDA 5JPMH 3V12A 1TB6H 2G55A 2CXVA 2ZHDA 2HPQH 1IOEA 1TBZH 5C1YA 1K28D 1TNIA 2BOHB 3M3VA 1Z6EA 2BDBA 3P8FA 1YPHC 2IPHA 3ZV8A 1IQKA 2ZP0H 1AVWA 1K2I1 2A7HA 5FXLA 2C90B 1B5GH 1FJSA 1O3MA 1T8OA 2HNTC 3DT0H 1YPEH 4WWYA 2ZFRH 3ZYDA 1FN8A 1BOQA 1IQEA 4NA7A 1HAIH 2PFEA 3A82A 3BN9A 2ZGBH 1EATA 3S7HB 5EQQA 3LC5A 4WVPE 1BITA 5GPIB 1P05A 5FX5A 1V2LT 3KQEA 1AE5A 1GHBG 2VGCB 3EGKH 1FNIA 4KTSA 1CBWB 3TJUA 2C8YB 4ASHA 2ZO3H 3EQ0H 3SU3A 1KYNA 1LKBA 3A84A 3ATLA 3M5OA 1P2JA 2GP9B 4Y8XA 2ALVA 4ISNA 5L6NH 4AFZA 2ZHWH 2VNTA 4GPGA 3ZZCA 3P17H 3LIWA 1ELEE 1YGCH 3ELAH 1RFNA 1TX6A 2BQWB 1ZOMA 3S7KB 2PSXA 4UFFH 2DE8A 3U8RH 5I46H 4I32A 1T32A 2AMDA 3DUXH 3IITA 4MDSA 2AEIH 4OS4A 1BTWA 3ZZ3A 1FY4A 4JZFH 2UUKB 8GCHF 3EA7A 5DK1A 1AB9C 2J94A 3BG4C 4AX9H 3K65B 1QIXB 1T8NA 1GMCF 1E37B 1XUJA 1ZTKA 4CR5A 2QCYA 2D26C 4BAHB 4Y8ZA 4ZXYH 2PGQB 1QTFA 2BY8X 1VGCC 2A4OA 2ZHQH 2BLVA 5J4SA 4CRBA 3MH5A 3RLYH 4U30A 1P2IA 3ESTA 1SGDE 1UVUH 3SU6A 4BXWA 1CE5A 1C5WB 4AB8A 4D7GA 3DFJA 3I77A 3RXRA 1BTUA 2FOGA 3A7XA 5FX6A 2BX3A 1WU1A 5L2ZH 3FP8E 2VINA 1HRTH 4ABDA 1ZLRA 2ZNKH 3DD2H 1F7ZA 1MBQA 2ANKH 2ODYB 2VIVA 4UONA 3ZVFA 3A80A 1E36B 2B7DH 4Q7XA 4D76A 1EOLA 1UO6A 1FXYA 3LKWA 3LOXA 5G4BA 4B2AA 3M5LA 2F9UA 3VXEH 4I8KA 4I8LA 4DY7B 4YOGA 5ETXA 2TIOA 1HAZB 5DGJA 3A8BA 2CV3A 4FU9A 3A85A 3LPRA 4ABEA 3V7TA 2P8OC 3SUGA 4WXVA 3HK6B 3MU8A 1W14U 4Y71A 1P2KA 2G81E 4BAMB 1C5LH 1OWDA 2FYQA 2Z94A 3MHWU 1HAYB 1Y59T 4ZUHA 2A5IA 3L33A 1L1GA 2BLWA 3RC4A 1C9PA 2ALPA 2XW9A 2FLRH 1SGNE 1Y3WA 2PUQH 1FV9A 4D7FA 2ZEBA 4B2BA 5BPEA 2W7UA 1SGEE 4MNVA 1TGCA 2WPHS 4UFGH 4JMYA 4Q2KA 1F0RA 4KTUA 5EQRA 1A1RA 1H9LB 1O2LA 1TQ0B 3HGNA 1BB0B 1ZGIA 2VIDA 3SJIA 4A7IB 2XBVA 4J1YA 5EGMA 3CENA 1D3TB 1PJPA 4XFQA 3V0XA 3VB4A 4K1SA 1RTKA 4XDEA 2STBE 1UHBA 1D9IA 3URCA 1AVXA 1NRNH 4OGYA 5PTPA 2BDIA 1C5NH 1P09A 4RN6A 2FP7B 4Y0YE 1F2SE 2FMJA 1J14A 4TYDA 1HV7A 1KLIH 3RUOA 2R3UA 1GI8B 1DSUA 1LVOA 1B7XB 2OINA 1C2MA 1C9TA 4HFPB 3PMJA 2VIPA 1S0QA 1ANBA 2XTTB 5L2YH 2A7JA 2TBSA 1S6FA 1IQFA 1VITG 2A5AA 3MH7A 4KKDA 1LPZB 5LPFA 1QGFA 2WPLS 4MPUA 1C1RA 2AGEX 3LGVA 1CQQA 3M36A 1O38A 1IHSH 4K2YA 1C1VH 3QO6A 1QL9A 2BDGA 2QXGA 5H4IB 4IGDA 2FPZA 1B0EA 2QF0A 1XMNB 3QUMP 1GDNA 3FFGA 2BVXH 1HXEH 2VB0A 4NCYA 4DVAU 4MNYA 3S9AA 3P95A 1GBKA 1BJUA 4GSOA 3TVJB 3ZZ9A 1MH0A 3QLPH 3VB6A 3BEIB 4X2YA 5E8EH 3HK3B 3UQVA 1TPSA 3BTEE 4Q7ZA 3F9GA 4Q7YA 5A8ZA 5F8TA 1SQTA 2OQUA 1BZXE 1TX7A 1A61H 1ESAA 3GY7A 3RC6A 7GCHF 1AZ8A 5EW2H 3RXEA 4AFSA 2AGGX 3K6ZA 4B73A 2ZGXH 2R2MB 1ZRKA 5FHTA 2Q6FA 5HM9A 1WBGB 4OS5A 4DT7B 5JDUB 5EPYA 2Z6BD 5SGAE 1ZGVA 1XUGA 4MVNA 4BANB 2C93B 2Y7XA 3ZZAA 1V2OT 1DM4B 1O3NA 1O2KA 2VWMA 1DXWA 1KXDA 4FUCA 1BTPA 2C3SA 1T7CA 2VIWA 1RTFB 4F49A 1K1LA 4JYVH 2BDYA 2A7CA 2LNCA 4K69A 2DUCA 2SGEE 3ATKA 3U98H 1KTSB 4Y8YA 2J95A 3KNXA 3NXPA 1SGFA 1OYQA 5C1UA 1O3KA 1NN6A 1O31A 1NY22 3SV6A 3AAVA 3HKIB 4O3UA 1MUEB 6LPRA 4HTCH 3TU7H 4ABIA 1DWEH 2FOHA 1E35B 1BA8B 3PLKA 2EI8A 1AQ7A 2FO9A 1O5BB 1ANEA 1G3DA 5DG6A 1GMHF 1KLJH 4IBLH 8GCHG 1AFQC 5A09A 5TCCA 1W0ZU 2CHAC 2QXJA 1GMCG 4KGAA 2ZA5A 3RXCA 3H7OA 3MU0A 4NFFA 4ABJA 1FY1A 4Z0KA 1HJ9A 3SGQE 3F9FA 3P6ZB 3QGNB 1TABE 2OBOA 2KAIA 1A0LA 2NWNA 1C1MA 1NTPA 5DP9A 1QCPA 3MNBA 2ZDKA 1T4VH 1K21H 3D65E 2BB4A 3M5MA 1MU8B 4WF8A 1SGIB 1YLCA 1L1NA 2EEKA 2VH6A 4B76A 4NZLA 3PLBA 2ZQ1A 5E0HA 1J8AA 3GY5A 4WH6A 1XXFA 2GV7A 3SJ9A 5LPRA 1IQHA 1ZMLA 1HJAC 1YBWA 2I6QA 3GYLB 1S0RA 3R3GB 1GBDA 4Y6DA 1O2WA 1O34A 1RJXB 1A0HB 2SGFE 5GDSH 3OY5U 6CHAB 1YYY1 1O2RA 3PLPA 4MQAA 3QGJA 1INCA 2VGCC 1UVOA 4AG2A 1J15A 3KQCA 4PROA 6GCHF 3SU2A 4AGKA 4NG9H 3CS0A 3E91A 1ZMJA 1YCPM 3M35A 1Z1JA 1C1QA 1DITH 3MO6A 1GDQA 4KP0A 2UWPA 1NFUA 3KIDU 1XM1A 5AVDA 4CRFA 1ABIH 1PPEE 1XXDA 2ZDNA 3TH4H 1G2LA 1PQAA 3GY4A 4CH2B 1D6RA 2FM2A 1SI5H 4YO9A 3F9HA 1DWDH 2VU8E 3A7TA 3UREA 1OP2A 1OXGA 2FZZA 5EXMA 3BEFB 1MTSA 5J4QA 5LH8A 4CREA 5HXFA 1P2OA 1U6QA 5GIBA 2H1UA 1BJVA 2O8UA 4MLFB 4ZHLU 1K1MA 1K1NA 1ZJDA 1L0ZA 2ANMH 2K1QA 3RXLA 1GI3A 2O9QA 1CGHA 1AD8H 1G3CA 4DURA 4JYTA 3O8BA 4KELA 1FPHH 2XBXA 5AF9H 2P3FH 2GX4A 1C2FA 3QN7A 1GI4A 1NZQH 2A45B 2AFQB 3F1SB 5ESBA 3KL6A 1G32B 1TMUH 4X1NU 3UR9A 2SNWA 2Z9JA 4CHAB 2QA9E 3T2NA 3LT3A 3ZVCA 3RU4T 3GDSA 2EI6A 5FCKA 4XBCA 2QAAA 2XCFA 5T6FA 3GY3A 1WUNH 1NRRH 1QQ4A 1Y3UA 3ATWA 1TMBH 1N8OB 2BZ6H 3LGWA 2Y80A 3O8RA 1O2SA 1LQDB 5A8YA 1HYLA 1ZYOA 1DY9A 2GMTC 3GY2A 1O2NA 1PQ8A 3UOPA 4LK4A 2ANWA 1TBQH 1VJAU 1ZHMA 3SQEE 1L2EA 3GY8A 1O37A 1GJDB 4HI3A 2A4GA 1GMDF 1NRQH 2P3TB 2BXUH 4XE4A 1EP5A 2ZPSA 2YNBA 2QY0B 3SNDA 3SUDA 2ZHFH 3JZ2B 3BTFE 1C5VA 3BTKE 2XWBI 1EX3A 1HLTH 1QRZA 1V2ST 2BVSH 1O3FA 2NU4E 3KQBA 3RXUA 2OTVA 1YKTA 1RIWB 3RU4E 2XNIA 3PMHB 3T25A 2ZCKP 2ZTXA 3VPKA 3A7YA 1KTTB 5LPEA 4DJZB 3GCHB 2GZ9A 7GCHG 3QTVH 2YOLA 1O33A 1ZRBA 2BD8A 1KLTA 2Z9KA 3VGCC 4B75A 1EZQA 2Z7FE 1O2HA 5F03A 3EA8A 1UK4A 1EJAA 3BTHE 1ABJH 1PFXC 1IQLA 2OXSA 1DT2A 2UUJB 1KXFA 2GCHF 1HAVA 1KIGH 4JZDH 1O35A 2ZU5A 4I8HA 2FOCA 3BIUH 3DA9B 1FDPA 2WPMS 4ZROA 3UQOA 2FOEA 2XXLA 3EYDA 4UDWH 1GCTC 4X2XA 4XBDA 1DUAA 1EASA 2BD5A 2QGRA 3LH1A 1ZTJA 2WYGA 4NGAH 2UUFB 1NT1A 1Z7KA 3Q3YA 4JZEH 2PHBA 1GL1A 5EPNA 3E0PB 1QJ1B 3BTME 2ZGHA 1P01A 2W5EA 2JETC 1UTLM 4YM9A 2GZ8A 2H2ZA 1GBCA 2UUYA 2AMQA 2GCTC 4ZKNU 1V2PT 4E05H 3B8JA 4H4FA 1DPOA 2XRCA 4D9RA 1YPLH 2PSYA 3GDUA 1GI5A 3ZZDA 3A8CA 1W8BH 3W95A 4VGCC 1PYTC 2A32A 5E2OA 2RDLA 1W0YH 2Z3EA 2M5TA 1O3GA 1GMHG 3ZVAA 1UK3A 4Y0ZE 4TY7A 3SNCA 1UTPA 1HUTH 2A31A 1YC0A 3KF2A 1THPB 1T8MA 1CGJE 2GTBA 2PKAB 1Y5BT 1C2EA 4LZ1H 4ZMAH 3ZVDA 1TRYA 1ZPZA 3RXPA 2ZU1A 1BMNH 8LPRA 9ESTA 4IC5A 1V3XA 2F83A 2ZPRA 1GPZA 1YPHE 2XYAA 3RXQA 3EE0B 4FUDA 4CRGA 4NIVA 5C67A 3UIRA 4ISOA 1K1IA 4A92A 3D23A 2H9EH 2WPKS 4MNXA 4AG1A 1LPKB 1QNJA 3TJVA 4TWYA 2HNTE 1O2JA 2OD3B 2BD9A 1GBMA 5EXLA 1GI2A 1SLWB 2H6MA 3RMLH 1NFYA 1QBNA 1CVWH 1FN6A 2J38A 1V2NT 1P04A 2HOBA 1K1OA 2P95A 2RCEA 4I8GA 2ZGCA 1O36A 3SN8A 9LPRA 3H5CB 3URDA 1QB1A 5CMXH 2OCVB 3M3TA 1AY6H 1A7SA </