4GLYA

Human urokinase-type plasminogen activator upa in complex with the two-disulfide bridge peptide uk504
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Bicyclic Peptide Ligands Pulled out of Cysteine-Rich Peptide Libraries.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4glyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4glyA01
3ATMA 2CN0H 2RCEA 1AVWA 3LGYA 1F5RA 2C93B 1AUJA 1HLTH 1BRBE 3PLPA 1KDQA 1NFYA 5JBBS 3DHKH 1O5GH 1N6YA 3K2UA 2NU2E 4XE4A 3V0XA 1C2JA 1G37A 4K1EA 5LPRA 3I78A 2XCFA 3T62A 1TBRH 1HJAB 1CSOE 1L1NA 1J14A 3E91A 1C2EA 1J9CH 1DY8A 3M7QA 4ZHAA 9LPRA 1BBRH 2QXGA 2C90B 1AB9C 2I6SA 4Y8ZA 2IN2A 1NRNH 2ALPA 1DS2E 1RTLA 2ZDKA 1HCGA 2R3UA 4GHQA 1MKWK 3DFJA 3RXHA 1P9SA 2K1QA 3RC5A 4CR9A 1ZHMA 1SLVB 3I29A 3BTHE 1O38A 1SOZA 3RMLH 2ZO3H 2OBQA 1S0RA 1DXPA 3L3TA 4YM9A 1EOLA 3UOPA 1TE0A 3SV8A 1ETTH 4Y0ZE 5ESTE 3M35A 1NTPA 1W12U 3OX7U 3UQOA 4U01A 1SGEE 4A1VA 1NRQH 2HLCA 1EASA 3A7VA 2R2WU 3D49H 2CF9H 1MQ6A 1AWHB 4BOHA 4Q7XA 1GG6C 2J2UA 1YPHE 1FXYA 1XUFA 1QJ7B 1IQNA 1V6DA 2H9TH 5EPYA 3P6ZB 5DP4A 1KSNA 1UCYH 2BD2A 4K3JA 4IS5A 5FBEA 3ZZ7A 2BDYA 4ISOA 3SU2A 1C5SA 2OBOA 1C4U2 1TGNA 3TH2H 1P8VC 2BQWB 1JRTA 4YLUA 5K7RA 3RLYH 3SNBA 1W10U 1RTFB 2G8TA 1IQGA 1TBQH 3GCNA 1SQAA 1C5XB 1O3DA 2XC0A 5E0HA 2EEKA 4I8GA 4JZFH 1CBWB 5LGOA 1A5HA 4MQAA 2DE9A 1C2GA 2ZTXA 1P2JA 2BDHA 1N8OB 1PJPA 1Q2WA 4E7NA 2KAIA 3BG4C 1V2RT 3RM0H 4MNVA 1VZQH 3QN7A 3U9AH 4WMFA 3LJJA 3EGKH 3KEEA 2ZP0H 1ETRH 2XXLA 2WV5A 1VCWA 2P93A 2PSXA 2XWBI 1BQYA 3PMBB 3SHAH 1EAIA 2R2MB 5E0GA 2QGRA 3SW2B 5I25A 2Y81A 1GCTB 3K6YA 1BBRE 4NG9H 4BAMB 1H1BA 3MO3A 1C5TA 4ZAEA 5EXNA 2QXJA 4K5ZA 4ZMAH 1Z71A 3LONA 1UHBA 2AIQA 2TGAA 1HAVA 3M3VA 1Z8IB 2XC4A 3BTKE 4F4OC 1ELEE 1SGQE 4CBOA 2Z9LA 2HNTE 4IBLH 3GCHC 2BTCE 1RFNA 1ESBA 4X8TH 3E1XB 1EJAA 3NK8A 7LPRA 2HRVA 1BCUH 5GJ4B 4D9RA 2XTTB 2ZEBA 1S82A 2AGEX 3MFJA 2B7DH 3PO1C 2VWMA 4D7FA 4KTCA 4YOIA 4TWWA 1BRUP 1F7ZA 1MH0A 1P05A 1QL7A 1GBEA 1MAXA 1UCYE 2VH0A 1Z8GA 3LOXA 4YT6H 1GVKB 1S6FA 1MCTA 1E38B 1MD8A 3F9HA 1A3BH 2QF0A 1GBHA 4ABGA 1GHBF 2D8WA 3TH3H 3TU7H 3IWMA 1UCYK 1AU8A 2J94A 3ATIA 1DITH 2NU1E 4I7YH 1ESAA 3FZDA 3KGPA 4MTBA 4ABDA 1BTYA 2SGAA 3QWCH 5TCCA 2R3YA 1C1PA 3STJA 3BIUH 1P2QA 2SGFE 1PPEE 1Z6EA 4OS1A 4AOQA 1AB9B 2G5NA 2PKSC 2BQ6B 4BANB 1K1IA 2OQUA 5A09A 1GBBA 1ZMJA 4DG4A 1J17T 1OKXA 2ZPQA 2WPLS 4UFEH 1O36A 1O32A 5TJXA 1TFXA 1V2KT 1HB0B 5G4BA 2FOGA 4AGJA 5HYOA 4B1TA 1UVOA 2Y6TA 3TVJB 5AF9H 3OU0A 3LDXH 3UY9A 2RA0A 1TNLA 1WCZA 3P8OA 2A0QB 4YO9A 1HAXB 3Q3KA 1D3PB 4INKA 3PROA 1T32A 2PWXA 4HFPB 4E06H 1BDAA 2PUXB 1W7GH 2HWLB 2JKHA 1FAKH 3ODDA 4O3UA 1UTNA 3LC3A 2GT8A 3VB3A 1CT2E 1O3IA 2QY0B 1O31A 2ZIQH 2VIVA 1BTWA 1LHDH 1Q31A 3RXTA 2H2ZA 1TBZH 4ASHA 3MTYA 2BDBA 2W3KA 3A89A 4Q80A 1FIWA 4O97A 1GJ5H 3RXGA 1GJ8B 3M3TA 1BUIA 1LHFH 2TBSA 1ANBA 4Y10E 1A46H 1THSH 2OC8A 2Z3CA 1P3CA 3H7OA 2M5TA 1YPJH 1DVAH 1CE5A 1B7XB 1K1NA 4GSOA 1Y3XA 3TJNA 1TYNA 4A7IB 1TLDA 5L6NH 3F9EA 1GI3A 5HMAA 1SGPE 1TMUH 4I8KA 2P94A 2PTCE 7KMEH 2GVFA 1S84A 3UPEA 3MH4A 4DURA 4GUXA 1HFDA 2A4OA 1A0HB 2Q6FA 4JZ1A 2A31A 1O33A 1H8DH 1T8LA 4VGCC 1QJ1B 3SBKA 1YCPM 4O3TA 3SU4A 1GMHG 2Z9JA 1C5YB 3SUGA 3TGJE 4FUHA 1FV9A 3ZZ4A 3MU8A 1AI8H 1KY9A 2OTVA 8GCHF 1KXAA 4JZDH 4X1PU 4O03A 4I32A 1SQOA 1C2LA 3KQDA 1YCPK 2R0LA 1E37B 4Y6DA 1CA8B 1WYKA 2Z3EA 3UNRA 5F8XA 1V2VT 3FZZA 5DJ7A 4FU9A 4WXIA 1C1SA 4MNXA 1TGBA 1ZTLA 3F9FA 3TNSA 5DP5A 5T6GA 1DWBH 2H9HA 1L2EA 1O3JA 1YKTA 2Y82A 1C5NH 3RU4E 2A32A 1E0FD 4H4FA 3M5MA 3TIUA 1O2YA 1GHVH 2ANKH 1O2SA 1TNIA 1AMHA 1ZZZA 1HJ9A 1O2MA 1GJBB 1H4WA 1BHXF 1LHEH 2Q1JA 4AG1A 3MHWU 1RXPA 2PW8H 2YNBA 1BZXE 5IDKA 3HKJB 1P02A 1VITF 1T7CA 3M5NA 4UEHH 3AAVA 1O3CA 3SV9A 1A1RA 1V3XA 2BD8A 1K1PA 4FU7A 4AB8A 5GDSH 1ELDE 4ZKRU 3SN8A 5JB9S 4SGAE 4AFSA 1YPEH 1AN1E 2F9UA 3SGBE 3QZQA 3EAJA 3T29A 3UQVA 5EOKA 1P2OA 5EQQA 1OP0A 1SPJA 2G4UA 3ZVBA 1F92A 3HPTB 3TK6A 1PQ8A 1QRWA 3HK6B 1SGDE 1TOCB 2P3TB 3A7ZA 4ZHMU 1LPGB 1AQ7A 3LGWA 3TNTA 1AKSB 3TH4H 1O3AA 3LU9B 1IHSH 1ZPCA 2CXVA 1BA8B 1UVSH 1EP6A 4K1TA 3S9BA 3MH7A 4M7GA 2FOHA 3S0NA 1DPOA 4HI3A 1HAHH 1ELGA 2OC7A 3A8BA 1V2TT 4UONA 5FPSA 1C5VA 1P12E 1YP9A 1XUIA 1XXDA 2ZTZA 1MUEB 1SR5C 4TYDA 2VINA 4X2YA 1QBVH 4MPXA 1HJAC 4I31A 2ZHQH 1QFKH 2WUCA 3VXEH 3IG6B 2B9LA 3Q3YA 1D6WA 4AFUA 1TWXB 1MU8B 2WPHS 1SFQB 3HGPA 4Y7BA 1P2KA 1IAUA 1TX7A 1SFIA 3PTNA 4CH8B 2FLBH 4YLQH 2GV7A 2A5IA 3FP6E 4O9VA 5JDUB 1SI5H 1LVBA 2WUBA 4Q2KA 3LGTA 3SJOA 3ZZAA 3GDVA 3KN2A 1G2MA 3EYDA 1KXFA 3MU0A 1G36A 4DIHH 2VB0A 3RXDA 1MQ5A 5BRRE 2IJOB 1P03A 4Y76A 4NFEA 3H5CB 1BOQA 2O8LA 1C5QA 5GIBA 1DDJA 4K2YA 3PM3A 5FAHA 4K1SA 4D7GA 2O8MA 2W7UA 4YTAA 1CHOF 2QXHA 1IQEA 2YNAA 1NRSH 4NIVA 1UO6A 1K9OE 2GT7A 3ZVDA 4NSYA 1HAIH 3UFAA 1TNGA 4CRFA 1OWKA 2AH4X 3ZZBA 3GISB 4FUEA 2BY5X 2I6QA 1EB1H 1EQ9A 4H6SB 1W0YH 1MTNB 3EDXB 2ANMH 1SMFE 1QBNA 2GGVB 2GX4A 1QQ4A 2YOLA 1P3EA 4NFFA 1AZ8A 1CBWC 3OTJE 1GPZA 1BTHH 1S0QA 1W13U 2QN5T 4THNH 3SUDA 1N8OC 1XUGA 2FMJA 4ABEA 2BYAX 2VJ1A 3LC5A 1VJAU 1UTOA 4KTSA 1O30A 1DUAA 5AFYH 7GCHF 4FUJA 5H4IB 2Y7ZA 2BD5A 1YPMH 1C5RA 2ZCKP 2R9PA 1GCTC 2PGBB 2ZHWH 1O5AB 2O8TA 5EGMA 1FZZA 3EA8A 1O2UA 4CBNA 1V2NT 3UIRA 1QB6A 1P9UA 2ZDNA 4I8HA 3Q76A 3M3SA 2P95A 1BRCE 4X6PA 1DX5M 3V3MA 5C1XA 3C1KA 3SORA 3ZVFA 3GCTF 1C1RA 2HNTF 3RMNH 1BRAA 1GDUA 3Q77A 3O8BA 3GCTG 2W7SA 1WU1A 2VIDA 3GY3A 3SUFA 2FZZA 3G01A 4UFDH 3SU1A 1RD3B 1MTWA 2VU8E 3H7TA 4INHA 1CO7E 1GI5A 3PLBA 3F6UH 1O5FH 4XSKU 1O5EH 4Y8YA 2ZHDA 1ORFA 3SU3A 1DANH 1AVGH 1C1WH 1QA7A 1GMDG 5DK1A 1AWFH 4YESB 2GZ8A 2FYRA 5FBIA 2FXRA 1UVTH 4X6OA 2EI8A 2SNWA 3C27B 5EXMA 3BTWE 4NIXA 1TGCA 1BMAA 1AE8H 1TRMA 5K0HA 4SGBE 1O2LA 3E16B 4OS2A 4ZROA 1OXGA 3SI4H 3A87A 2BDCA 1GWAA 1TPPA 1WQVH 3SJIA 2BZAA 1ZGVA 2JH0D 3VGCB 1GI7B 5GWZA 2V3OH 1F0UA 1P57B 1BHXB 3ZYEA 4YOJA 3ZVEA 4JK6A 1EJNA 1A5IA 1AKSA 3RXLA 2XC5A 2ZGCA 3SJKA 3S7HB 1VGCB 3FVFB 2XRCA 1SQTA 1EPTB 4BAQB 4NA8A 3CENA 3URCA 1DLEA 4X6NA 4QT8C 1UTQA 3BTTE 1M9UA 1V2WT 1P2IA 2BY7X 3BG8A 1HUTH 1YGCH 2IOTA 1SGRE 3CP7A 3U1JB 1QA0A 4ISNA 5DGJA 3FP7E 1TIOA 3E0PB 1HPGA 3FANA 1SGFG 4ABBA 5C20A 4IN2A 3RXKA 4WJG2 1ELAA 1GBFA 1UJ1A 1GI6A 1ARBA 2O8WA 1G3BA 2NWNA 5HXFA 1U6QA 1P01A 1O34A 3MYWA 1UMAH 2P8OB 5FCKA 1C2DA 4X8SH 1ZLRA 1ANDA 3LJOA 2GKVE 1Y3VA 2RDLA 1GJ7B 3MNSA 3T26A 2Z3DA 3CS0A 2B8OH 3LGUA 2TGPZ 1BMMH 5FXLA 1SVPA 2P16A 1O3EA 2FOFA 2HVXA 1MTSA 1DSTA 3MWIU 1Z6JH 2Z9KA 2BXUH 3HGNA 1DWDH 1TNKA 2CMYA 2BZ6H 1K2I1 4XFQA 1C5MD 1Z8JB 2F9PA 2ZDVH 4BTIB 2LNCA 1UTKA 1C5ZB 1XMNB 2AIPA 5C2ZA 3MU5A 2SNVA 1T8MA 1BJUA 3E3TA 2G4TA 4JMYA 4X1RU 2W5EA 5JPMH 4JZEH 4OGYA 3KF2A 2WYJA 2GMTB 2WYGA 3QO6A 1YLCA 1NC6A 1W7XH 2G00A 4NIYA 1AVXA 4JZIA 3MU4A 1W0ZU 2Y7XA 3NUMA 5AFZH 4Q7ZA 1ANCA 3PWCA 3EQ0H 1KTSB 1K28D 1ZR0A 2H1UA 4FUDA 3VPKA 3TITA 2AFQB 2Y5GA 2FS8A 3A7YA 1QQUA 1C4V2 1SBWA 2PUQH 6LPRA 4CHAB 1ABJH 2AS9A 4ESTE 4Y7AA 1ETSH 1GBJA 1SLWB 4E7RG 4BAHB 3TPIZ 2BD7A 3SNEA 1EAUA 3SJ8A 2JETB 4GAWA 4MPUA 1V2OT 3PMAB 2GZ9A 1C9PA 5F6MA 2A7CA 2HPPH 3SO3A 3LGIA 1ZJDA 1EKBB 5EW2H 3MO6A 1NN6A 1GBLA 3ZVGA 1P04A 5CE1A 2ZU3A 1Y3YA 3VEQB 1GHBG 4MPVA 1C1UH 1DOJA 2BHGA 5E2PA 4YZUA 4MNYA 2PTNA 1GJ9B 4Y71A 2CJIA 2V3HH 1ZSJA 1V2MT 4X1SU 4B2CA 2ZPSA 2CHAB 1HV7A 3B8JA 3P17H 4K60A 5AVDA 5GCHF 5C1UA 1YCPH 2BDIA 3UNQA 2VIPA 1RIWB 2EA3A 3LH1A 1ELFA 1DWCH 3RXSA 1XUJA 2BX4A 5JBAS 4MG3A 2XBYA 5FPTA 1A2CH 3U69H 4NCYA 1V2LT 3LIWA 1P2NA 3RC6A 1FQ3A 1MZAA 1OWIA 2JH6D 2WPIS 1ZTJA 3M7TA 5FX5A 4LXBH 2F3CE 1TNJA 1EUFA 6CHAB 4I8JA 4MDSA 3FFGA 1O3NA 5A0CA 2FI4E 4KP0A 1S83A 3ESTA 3M36A 4TPYA 5J4QA 1ZSKA 3LPRA 2BX3A 1MBQA 2SGQE 2OXSA 5DP8A 2F83A 1IQMA 2G81E 1SGTA 1NO9H 1QB1A 5LPEA 3TGIE 2FDAA 3KNXA 1EPTA 1KLTA 2B0FA 1O2PA 5A8ZA 1AFQB 1GBTA 3PLKA 2CF8H 1A0JA 2OINA 3NXPA 3VXFH 5CMXH 4UFGH 2ZTYA 5BPEA 1Y59T 1C2MA 1O3LA 2A2QH 2G51A 4X0WU 4AORA 1W11U 4CREA 1TAWA 3RXJA 5DPAA 5T3HA 4BNRA 3D65E 2FP7B 1GI9B 2PLXA 1GJ4H 1UTMA 2GDDA 2BXTH 1MAYA 4U30A 1RS0A 1CA0B 1O2OA 3SV6A 1PPFE 2SFAA 3TLOA 7ESTE 3Q3XA 3E0NB 5L30H 5PTPA 2AMDA 2ZF0H 4AG2A 4ZXXH 2ZKSA 3BF6H 5IYTA 1SGYE 2Y5HA 1BITA 4UDWH 3KCGH 3OY6U 8LPRA 4DIIH 2H5DA 1CT0E 4MVNA 2OQ5A 3SZNA 3U98H 3VB6A 1BTUA 1DWEH 1CU1A 3BTQE 2SGDE 4FUIA 2FODA 1ZYOA 2GCTB 8GCHG 1JBUH 2CGAA 4KKDA 1GHWH 1QTFA 1ZOMA 3QUMP 4NZQA 2J38A 1VCPA 1QGFA 3R3GB 1XVMA 1TPAE 1MTNC 1CGJE 2ZG0H 2UWPA 2ZGBH 1K22H 3R0FA 4WF8A 1LDTT 4ABJA 1ZHRA 2PKAB 1TX8A 3VFEA 1JRSA 4RKJB 2VNTA 2TPIZ 2FEQH 2A7HA 4K8YA 1O5CB 5FX6A 1P2MA 1TX6A 5ABWA 2FX6A 2J9NA 2AMQA 5EPNA 2BLQA 3VB4A 1GL0E 3V7TA 1DXWA 1QL8A 4KELA 4XBBA 1SC8U 2VH6A 3RMMH 4J2YB 2RG3A 4B74A 3ZVCA 2UWOA 1F2SE 1P10A 4F49A 2PSYA 1K21H 4RSPA 1G3CA 3M5OA 3BEUA 2J34A 4NA9H 5E8EH 1UK4A 5DP7A 1UTJA 1W14U 4JYVH 3MNXA 1GGDB 2VIQA 1C5PA 1V2PT 4MPWA 1V2UT 1FN8A 3L33A 2Q6DA 1AE5A 3KL6A 3HKIB 2HOBA 1ZRBA 1WQSA 4FVDA 2ZHEH 1NU9A 1KLIH 1O2HA 1G9IE 1VITG 3ODFA 4U2WA 1L4DA 4WH6A 2A5AA 4ZH8A 1C5WB 1Z7KA 4OS7A 4CR5A 1GMCF 1L0ZA 3A8CA 3QDZB 3LH3A 1RGQA 1CHGA 3MOCA 4FXGH 1PYTC 4AN7A 1D3TB 1QURH 2BY6X 4FUFA 1IHTH 2ZDMA 4B2BA 2LPRA 2XBVA 3UTUH 1THRH 4CRDA 1T8NA 2H9EH 1B0EA 3QTVH 4IC5A 1IQLA 2P3FH 1ZRKA 1E34B 3T28A 4CRAA 1LQDB 2ZFFH 1ZPZA 2TGDA 2FYQA 1ZHPA 3ZV9A 5T6FA 3RXBA 5C3NA 3RXOA 2ANYA 3ZZ6A 3AW0A 2ZGHA 3P8FA 3VB5A 2VGCB 1DLKB 1EAXA 1EXFA 2BOHB 2ZWLH 4WWYA 2PHBA 2IPHA 3VGCC 4BXWA 4GCHF 1MD7A 2AGIX 1XVOA 4GCHG 8ESTE 3SV7A 3S9CA 2C8YB 3QTOH 3ZZ5A 1FY4A 1IQKA 1LVOA 1W3CA 2ZA5A 4X2XA 1S81A 1VGCC 1EZSC 4WMDA 4CRCA 4FUCA 2A45B 1EPTC 3PB1E 2ODPA 1ARCA 2H6MA 1HAOH 1C5LH 1VCQA 1G3EA 4CRBA 1GBMA 2ZU2A 4TPIZ 3OSYA 3AVZA 1TQ7B 1ZMNA 3GY2A 2OC0A 4NSVA 3A86A 5A0BA 2ZGJA 1MBMA 1NRPH 1W2KH 1FY3A 1HGTH 2F9NA 3DT0H 2ILNA 3GY8A 2ALVA 1HRTH 2QCYA 3RXMA 5FHTA 1DSUA 3GOVB 1DT2A 1NZQH 2DUCA 3AAUA 3PYHA 3RU4T 1EP5A 5B6OA 1CHOG 2Y5FA 3RXUA 4ISLA 1GVLA 3S9AA 3UREA 3SI3H 1LMWB 4ABHA 1WV7H 2F9VA 3GY5A 1Q3XA 2P8OC 1NS3A 5LPFA 4B73A 3L6PA 1FI8A 4IC6A 2QV1A 1SL3A 3GDUA 1O2NA 2BQ7B 2ZFRH 1YM0A 1O3KA 3SHCH 4AGKA 2F91A 3ZZ8A 1F5KU 1T31A 1C2HA 1YYY1 1GDQA 2FX4A 3P70B 1SGNE 2FESH 1C4Y2 1FONA 1T4VH 1YC0A 3RXFA 2XYAA 5CHAB 1LO6A 1ANEA 2BOKA 5A0AE 3BTGE 7GCHG 2ZDAH 2HGTH 1D9IA 1GI0A 1SGFA 1W8BH 3MH5A 3AASA 3ZZCA 4JCNA 3ENSB 4A1TA 3BEIB 2QXIA 1PFXC 5LH8A 1O35A 6GCHF 2GMTC 2ZU1A 4UE7H 1ZTKA 1HAVB 5F8ZA 2XBWA 1YPHC 1C1OA 4KGAA 3ZYDA 1F5LA 3EA7A 2VVUA 2ULLA 1O3BA 1SG8B 1KXCA 2J95A 1LQEA 1GBCA 1QR3E 1PPGE 4X8UH 4INLA 1O2IA 1GJAB 1ELVA 3MMGA 3MNCA 1FJSA 1SOTA 3ITIA 3PTBA 2FTMA 4I33A 1L4ZA 5A8YA 3RMOH 3ZV8A 1GJDB 2VIWA 1C1TA 4Y0YE 1O3PB 4CHAC 2GZ7A 1JXPA 1P06A 1NFUA 4MNWA 4NZLA 2BDAA 1MCVA 3RUOA 2ZC9H 2JETC 2ZFQH 3A81A 1PQ5A 5TCAA 1HJ8A 2Z7FE 1PQ7A 2Z94A 1A0LA 1RRKA 4YOGA 1OP8A 2BB4A 4PROA 3SV2H 2BLWA 1GJCB 4K8BA 1TRNA 1K1MA 2VWOA 1NFWA 2BM2A 2ZQ2A 1DE7H 1Y3UA 3T27A 3Q00A 1DUEA 1Y5BT 1CVWH 5E0JA 1Z8RA 2ZU5A 1THPB 2THFB 5EXLA 5JBCS 4A92A 2EI6A 4A5TS 4H42U 3T25A 4J1YA 5JBTA 1GI8B 2QIQA 1HXFH 3SU5A 1LHCH 1E35B 3BSQA 2CHAC 5C5OA 2QAAA 1YPLH 3T5FH 3TJUA 1FNIA 1O3FA 1RIWC 2FTLE 2ZCLP 4GLYA 1UVPA 1AHTH 2NU3E 2VVCA 3MO9A 4X2VA 3HK3B 2XWAA 1O2QA 3LGVA 1TABE 2DE8A 4CRGA 3NWUA 4ISIH 4IMZA 2V6NA 4BTUB 1Y3WA 2A7JA 4IGDA 1O2XA 4Q7YA 1WOFA 3P8NA 2C4FH 2HNTC 1LVYA 6CHAC 3I77A 4RN6A 1S85A 4OGXA 2PV9B 1TA2A 3UR6A 1GJ6A 4AFQA 5EQSA 2SGEE 1O3HA 2UUKB 2ZZUH 5ETXA 1P0SH 1O2RA 2D2DA 1PYTD 3SQHE 3VB7A 2ZDLA 1EOJA 5ESBA 5E2OA 1Y5UT 1A5GH 1AFQC 4IN1A 1FY1A 3BTEE 1GBIA 2ZQ1A 2AEIH 4ABIA 1O2JA 3GICB 4FUGA 1FAXA 1O37A 4HTCH 4R0IA 2A4QA 2FWWA 1PPCE 1BIOA 5I46H 1C2IA 3UUZA 5DKMA 4JK5A 5L2YH 4ZKSU 1OWEA 2FOCA 4E05H 2F9OA 1XXFA 2BVXH 2HPQH 3AW1A 2XW9A 1DM4B 3RLWH 1O39A 1ELBA 1SLUB 1L1GA 1ZGIA 2AERH 4GHTA 2FOBA 1NPMA 1LKAA 1TOMH 4ZHLU 3URDA 2PFEA 2C3SA 3QZRA 2A4GA 2O9QA 1CA0C 1B0FA 4YT7H 3LT3A 5AHGH 5J4SA 1WSSH 4AFZA 1UK3A 2ZECA 4WXVA 1BMNH 1TONA 3EE0B 4XBCA 4IMQA 4TY6A 3GDSA 4JYTA 2EC9H 1HIAB 3PMJA 3GYLB 4ZKOU 2STBE 2G55A 2FOAA 1MZDA 1QB9A 2A5KA 4TY7A 2OLGA 3BV9B 3TJOA 3GY7A 3WY8A 4LOYH 1V2QT 2F9BH 3MNBA 2WINI 1N1LA 2GCTC 2UUFB 2HALA 3F1SB 3QGJA 4AZ2B 1ESTA 3JZ2B 1NM6A 1O3GA 1PPHE 5HM2A 1SGIB 3NPSA 9ESTA 1OWDA 2ZFTA 1ZMLA 1JIMA 4DT7B 4NIWA 3E8LA 3RDZA 1HAPH 1AIXH 1TPOA 1PQAA 1TMBH 2OP9A 4ZUHA 1IQHA 3ZZDA 3DA9B 5GXPA 5T6DA 2STAE 3RXQA 1O5DH 2J4IA 3SGAE 5DG6A 1UK2A 2FIRH 4ABFA 3V13A 1BBRK 1JWTA 3RC4A 2O8UA 4NWLA 1HBTH 3P95A 1BTZA 3TJVA 1C1QA 1FIZA 1NY22 3O8CA 4D76A 1OYTH 2FOEA 2JH5D 3RXAA 1KIGH 4D9QA 5EG4A 3BEFB 1EATA 1GDNA 1GGDC 1EZQA 1D6RA 3A82A 1TQ0B 4ZXYH 1C1MA 1AY6H 1KXBA 3F68H 2AMPA 1QIXB 1AD8H 1ZSLA 4AX9H 1FPCH 1A7SA 2VWNA 1HAYB 2P59A 1G2LA 1EZUC 1QHRB 1A4WH 2OCVB 4X1QU 4BXSA 1O5BB 2XNIA 5EQRA 2QYIA 1TMTH 2UUJB 5GCHG 3DFLA 1FPHH 4WMEA 1ID5H 3UOUA 8KME2 4LZ1H 1QRXA 2QF3A 1GHYH 1L1JA 2Z9IA 3DUXH 4BAKB 1UVUH 1ELCA 1O3MA 2A1DB 2XCNA 2R0KA 1GL1A 3SJ9A 1AFEH 1KXDA 5A2MH 1NESE 4CH2B 2FOMB 3U8RH 1K1JA 4FUBA 2ESTE 2ZFSA 2B5TB 3QGNB 2ASUB 4K69A 2WV4A 4A1XA 1T4UH 3T2NA 5EU8A 2VGCC 1O2ZA 1H9HE 3QX5H 3UR9A 1K1LA 2TGTA 4Y11E 1LHGH 2FI3E 3KQCA 4Z0KA 1NFXA 2GDEH 2SGPE 3BIVH 1TPSA 5DP9A 1EZXC 4OS6A 3A88A 1GG6B 1QY6A 3BN9A 1TB6H 3RXRA 5C67A 1KXEA 5A8XA 1LPKB 1MKXH 3NCLA 1V2ST 1WUNH 4BTTB 1ZJKA 4NGAH 1VJ9U 4Z6AH 1LVMA 4A6LA 1MTVA 1YPKH 2Q6GA 4AYVB 2BVRH 3RXIA 3F9GA 2ZNKH 5JYIA 1G3DA 4DVAU 1GBAA 3PMHB 4U32A 1NT1A 2BY9X 1D3QB 2G5VA 3E6PH 1TA6A 2BDGA 4UFFH 3S69A 1O2TA 1P11E 3MH6A 5F8TA 4ISHH 3EA9A 3FP8E 1GHXH 3M7UA 1P09A 1G32B 3BG4B 3K9XB 1YBWA 4LZ4B 1TALA 1F0SA 3SNAA 3ZVAA 1YPGH 1CQQA 3A7XA 3GY6A 3M5LA 1IQJA 2BD9A 4FU8A 3NZIA 4WH8A 6ESTA 4X2WA 3RM2H 1GI2A 1GMHF 4HZHA 1S5SA 1FDPA 3FAOA 1OP2A 1GBKA 1J8AA 1HIAA 1C1NA 2RA3A 4ABAA 4RKOB 4XBDA 2ANWA 3ATLA 3RXEA 2P3UB 3MU1A 1E36B 3A83A 2TRMA 2OC1A 2BY8X 1QL9A 1XX9A 5HM9A 1KLJH 5FCRA 1AO5A 1X7AC 2ZHFH 5CHAC 5L2ZH 1SSXA 1QRZA 4XOJA 1OWHA 1BTPA 1OX1A 1WTHD 3P92A 2FLRH 2ZI2H 3O8RA 1O3OA 1HDTH 1A3EH 1XKBC 3GCHB 3V12A 1O0DH 4B75A 1O2WA 1WAYB 4LK4A 3TGKE 2GTBA 3PO1B 3A84A 1Z1JA 1BT7A 5GPIB 2FO9A 4GPGA 4D8NA 1IQFA 3OYPA 1J15A 4X8VH 1NRRH 3SGQE 5EW1H 4DGJA 1GBDA 3SNDA 3ATWA 2ZCHP 1GMCG 4OS5A 1DICA 1MKXK 1GCDA 1CGIE 3ZZ3A 4ZKNU 4H6TA 1YLDA 2VVVA 4KTUA 1OOKB 4I8LA 3GCOA 5F03A 1JMOH 1LTOA 5HGGA 4B76A 2H5CA 1BB0B 3UWIA 3SUEA 3UWJH 1K1OA 1RTKA 2D26C 3D23A 3SOSA 5C5NA 1AUTC 3A7TA 4B71A 3KHVA 2FPZA 4DW2U 1KDQB 2AGGX 1LKBA 1XM1A 4Y79A 2C8WB 2ZU4A 2PKSB 4AB9A 1SHHB 1B5GH 3N7OA 1KYNA 1PPZA 1N6XA 4R8TB 2Z6BD 2FI5E 2BMGB 2GP9B 3K65B 4DJZB 1C2KA 3A8AA 1HNEE 3K6ZA 3RXVA 1EAWA 1C5OH 1NROH 3PWBA 2Y80A 2ZPRA 1LCYA 4BAOB 1CT4E 1LPZB 2TIOA 3M37A 3RXCA 3TK5A 3D62A 1O2GH 3BTME 1IOEA 2BD4A 3LKWA 1C2FA 2V35A 3CS7A 1AZZA 1D4PB 3W95A 3SNCA 2PR3A 1EB2A 1QCPA 3W94A 3E90B 3PV4A 1PPBH 1XUKA 1ZPBA 1WTGH 3STIA 5FPYA 2NU0E 1FY5A 1DFPA 1GHAF 2G52A 3JZ1B 1WBGB 1ELTA 4WVPE 1V2JT 4TWYA 1GHAG 1XUHA 3O8DA 1TGSZ 3ELAH 3IITA 2VWLA 1HAZB 1TRYA 1VITH 2W3IA 4DOQA 2V0BA 1ACBE 1FY8E 1HAGE 1QBOA 3A80A 1Y5AT 3RXPA 1ABIH 3GY4A 1OSSA 3KIDU 1F0RA 5SGAE 2A4RA 3UNSA 2NU4E 1FLEE 1C9TA 1H9LB 1YF4A 2WPKS 3U8OH 2BD3A 3QLPH 4X6MA 3SU6A 1TNHA 4UD9H 2ZGXH 1MMJN 1MTUA 2W26A 2VIOA 5JB8S 2D1JA 4VGCB 4B2AA 2KAIB 3DD2H 3BTDE 1HYLA 5DP3A 5C1YA 3RU4D 2UUYA 4GVUA 2J92A 4AYYB 1QNJA 1D3DB 1H8IH 3S7KB 4OS4A 1IQIA 1JIRA 5DP6A 1F0TA 3ZZ9A 4DCDA 4NA7A 1H9IE 2EI7A 1S6HA 2A2XH 2GV6A 3A7WA 1JOUB 1SGCA 1G30B 1Y8TA 1UTLM 1GI1A 1MKWH 2C8ZB 1OWJA 1TGTA 4FVBA 2GCHF 1UHBB 1HXEH 2BLVA 4MLFB 2ZFPH 3B9FH 2FM2A 1SB1H 2BVSH 2PKAA 2GCHG 1OPHB 2FS9A 6GCHG 1FUJA 3RP2A 3SQEE 1CGHA 1AGJA 1GVZA 1C5UA 1GHZA 3NKKA 4HGCA 2XBXA 2PGQB 3OY5U 2QC2A 3QK1A 1RJXB 5EODA 3U8TH 3TK9A 1BJVA 2OUAA 3KQBA 1BMLA 2AYWA 1C1VH 4DY7B 3BTFE 3SU0A 2ODQA 1KTTB 4IW4E 1OS8A 4XDEA 2QA9E 1BTXA 2WPMS 2ODYB 2CV3A 2WPJS 3A85A 1DY9A 3B23B 3P8GA 4JYUH 1A61H 1SHYA 2GD4B 3U1IB 1T8OA 1XKAC 1INCA 1Z1IA 3HATH 4NWKA 1MU6B 1O2KA 3A8DA 4WY3A 1FN6A 1NU7B 1GI4A 1EX3A 3M61U 2C8XB 3KQEA 1QJ6B 4X1NU 3GYMA 4Y8XA 3MI4A 5DO4H 1VR1H 1GMDF 1OYQA 1SLXB 1O2VA 2UWLA 1UTPA 3ATKA 2OD3B 1J16A 2Z9GA 2BLOA 1EJMA 1FMGA
chains in the Genus database with same CATH superfamily
3ATMA 2CN0H 2RCEA 1AVWA 3LGYA 1F5RA 5KECA 2C93B 1AUJA 1HLTH 1BRBE 3PLPA 1KDQA 2PP6A 1NFYA 5JBBS 3DHKH 1O5GH 1N6YA 3K2UA 2NU2E 4XE4A 1YWUA 3V0XA 1C2JA 1G37A 4K1EA 5LPRA 3I78A 2XCFA 3T62A 1TBRH 1HJAB 1CSOE 4OM9A 1L1NA 1J14A 3E91A 1C2EA 1J9CH 1DY8A 3M7QA 4ZHAA 9LPRA 1BBRH 2QXGA 2C90B 1AB9C 2I6SA 4Y8ZA 2IN2A 1NRNH 2ALPA 1DS2E 1RTLA 2ZDKA 1HCGA 2R3UA 4GHQA 4AC9A 1MKWK 3DFJA 3RXHA 1P9SA 2K1QA 3RC5A 4CR9A 1ZHMA 1SLVB 3I29A 2HVYB 3BTHE 1O38A 2KCYA 1SOZA 3RMLH 2ZO3H 2OBQA 1S0RA 1DXPA 3L3TA 4YM9A 1EOLA 3UOPA 1TE0A 3SV8A 1ETTH 4Y0ZE 5ESTE 4HG6A 3M35A 1NTPA 1W12U 3OX7U 3UQOA 4U01A 1SGEE 4A1VA 1NRQH 2HLCA 1EASA 3A7VA 2JJ1D 2R2WU 2CF9H 3D49H 1MQ6A 2YMSB 1AWHB 4BOHA 4Q7XA 1GG6C 2J2UA 1YPHE 1FXYA 1XUFA 1QJ7B 1IQNA 3PRBA 1V6DA 2H9TH 5EPYA 3P6ZB 5DP4A 1KSNA 1UCYH 2BD2A 4K3JA 4IS5A 5FBEA 3ZZ7A 2BDYA 4ISOA 3SU2A 1C5SA 2OBOA 1C4U2 3FO8D 1TGNA 3TH2H 1P8VC 2BQWB 1JRTA 4YLUA 5K7RA 3RLYH 4P02A 3SNBA 1W10U 1RTFB 2G8TA 1IQGA 1TBQH 3GCNA 1SQAA 1C5XB 1O3DA 2XC0A 5E0HA 2EEKA 4I8GA 4JZFH 1CBWB 5LGOA 1A5HA 4MQAA 2DE9A 1C2GA 2ZTXA 1P2JA 1NBMD 2BDHA 1N8OB 1PJPA 1Q2WA 2J5UA 4E7NA 2KAIA 3BG4C 1V2RT 3RM0H 4MNVA 1VZQH 3QN7A 3U9AH 4WMFA 3LJJA 3EGKH 3KEEA 2ZP0H 1ETRH 2XXLA 2WV5A 1VCWA 2P93A 1E79D 2PSXA 2XWBI 1BQYA 3PMBB 3KQ5A 3SHAH 1EAIA 2R2MB 5E0GA 2QGRA 3SW2B 2WV9A 5I25A 2Y81A 1GCTB 3K6YA 2LP6A 1BBRE 2KR7A 4NG9H 4BAMB 1H1BA 3MO3A 1C5TA 4ZAEA 5EXNA 2QXJA 4K5ZA 4ZMAH 1Z71A 3LONA 1UHBA 2AIQA 2TGAA 1HAVA 3M3VA 1MABB 1Z8IB 2XC4A 3BTKE 4F4OC 1ELEE 1SGQE 4CBOA 2Z9LA 2HNTE 4IBLH 3GCHC 2BTCE 1RFNA 1ESBA 4X8TH 3E1XB 1EJAA 3NK8A 7LPRA 2HRVA 1BCUH 5GJ4B 4D9RA 2XTTB 2ZEBA 1S82A 2AGEX 3MFJA 2B7DH 3PO1C 2VWMA 4D7FA 4KTCA 4YOIA 3FN8A 4TWWA 1BRUP 1F7ZA 1MH0A 1P05A 1QL7A 1GBEA 1MAXA 1UCYE 2VH0A 1Z8GA 3LOXA 4YT6H 1GVKB 1S6FA 1MCTA 1E38B 1MD8A 3F9HA 1A3BH 2QF0A 1GBHA 4ABGA 1GHBF 2D8WA 3TH3H 3TU7H 3IWMA 1UCYK 1AU8A 2J94A 3ATIA 1DITH 2NU1E 4I7YH 1ESAA 3FZDA 3KGPA 4MTBA 4ABDA 1BTYA 2SGAA 3QWCH 5TCCA 2R3YA 1C1PA 3STJA 3BIUH 1P2QA 2SGFE 1PPEE 1Z6EA 4OS1A 4AOQA 1AB9B 2G5NA 2PKSC 2BQ6B 4BANB 1K1IA 2OQUA 5A09A 1GBBA 1ZMJA 2LELA 4DG4A 1J17T 1OKXA 2ZPQA 2WPLS 4UFEH 1O36A 1O32A 3W1EA 5TJXA 1TFXA 1V2KT 1HB0B 2WHXA 5G4BA 5EJ1A 2FOGA 4AGJA 5HYOA 4B1TA 1UVOA 2Y6TA 3TVJB 5AF9H 3OU0A 3LDXH 3UY9A 2RA0A 1TNLA 1WCZA 3P8OA 2A0QB 4YO9A 1HAXB 3Q3KA 1D3PB 4INKA 3PROA 1T32A 2PWXA 5B6LA 4HFPB 3DSOA 4E06H 1BDAA 2PUXB 1W7GH 2HWLB 2JKHA 1FAKH 3ODDA 4O3UA 1UTNA 3LC3A 2GT8A 3VB3A 1CT2E 1O3IA 2QY0B 1O31A 2ZIQH 2VIVA 1BTWA 1LHDH 1Q31A 3RXTA 2H2ZA 1TBZH 4ASHA 3MTYA 2BDBA 2W3KA 3A89A 3N7EA 4Q80A 1FIWA 4O97A 1GJ5H 3RXGA 1GJ8B 3M3TA 1BUIA 2EY4C 1LHFH 2TBSA 1ANBA 4Y10E 1A46H 1THSH 2OC8A 2Z3CA 1P3CA 3H7OA 2M5TA 1YPJH 1DVAH 1CE5A 1B7XB 1K1NA 4GSOA 1Y3XA 3TJNA 1TYNA 3DSGA 4A7IB 1TLDA 5L6NH 3F9EA 1GI3A 5HMAA 1SGPE 1TMUH 4I8KA 2P94A 2PTCE 7KMEH 2GVFA 1S84A 3UPEA 3MH4A 4DURA 4GUXA 1HFDA 1QZ8A 2A4OA 2KM0A 1A0HB 2Q6FA 4JZ1A 2A31A 1O33A 1H8DH 1T8LA 4VGCC 1QJ1B 3SBKA 1YCPM 4O3TA 3SU4A 1GMHG 2Z9JA 1C5YB 3SUGA 3TGJE 4FUHA 1FV9A 3ZZ4A 3MU8A 1AI8H 1KY9A 2OTVA 8GCHF 2KCOA 1KXAA 4JZDH 4X1PU 4O03A 4I32A 1SQOA 5C94A 1C2LA 2QF4A 3KQDA 1YCPK 2R0LA 1E37B 4Y6DA 1CA8B 1WYKA 2Z3EA 3UNRA 5F8XA 1V2VT 3FZZA 5DJ7A 4FU9A 4WXIA 1C1SA 4MNXA 1TGBA 1ZTLA 3F9FA 3TNSA 5DP5A 5T6GA 1DWBH 2H9HA 4TSFD 1L2EA 1O3JA 1YKTA 2IPQX 2Y82A 1C5NH 3RU4E 2A32A 1E0FD 4H4FA 3M5MA 3TIUA 1O2YA 2K0QA 1GHVH 2ANKH 4P00A 1O2SA 1TNIA 1AMHA 3SYJA 1ZZZA 1HJ9A 1O2MA 1GJBB 1H4WA 1BHXF 1LHEH 2Q1JA 4AG1A 3MHWU 1RXPA 2PW8H 2YNBA 1BZXE 5IDKA 3HKJB 1P02A 1VITF 1T7CA 3M5NA 4UEHH 3AAVA 1O3CA 2RDEA 3SV9A 1A1RA 1V3XA 2J98B 2BD8A 1K1PA 5IK2D 4FU7A 4AB8A 5GDSH 1ELDE 4ZKRU 3SN8A 5JB9S 4SGAE 4AFSA 4ACBA 1YPEH 1AN1E 2F9UA 3SGBE 3QZQA 3EAJA 3T29A 3UQVA 5EOKA 1P2OA 5EJLA 5EQQA 1OP0A 2V3MA 1SPJA 2G4UA 3ZVBA 1F92A 3HPTB 3TK6A 1PQ8A 1QRWA 3HK6B 1SGDE 1TOCB 2P3TB 3A7ZA 4ZHMU 1LPGB 1AQ7A 3LGWA 4XD7D 3TNTA 1AKSB 3TH4H 1O3AA 3LU9B 1IHSH 1ZPCA 2CXVA 1BA8B 1UVSH 1EP6A 4K1TA 5CDFE 3S9BA 3MH7A 4M7GA 2FOHA 3S0NA 1DPOA 4HI3A 1HAHH 1ELGA 2OC7A 3A8BA 1V2TT 4UONA 5FPSA 1C5VA 1P12E 1YP9A 1XUIA 1XXDA 2ZTZA 1MUEB 1SR5C 4TYDA 2VINA 4X2YA 1QBVH 4MPXA 1HJAC 4I31A 2ZHQH 2AHME 1WXRA 1QFKH 2WUCA 3VXEH 3IG6B 2B9LA 1COWD 3Q3YA 1D6WA 4AFUA 1TWXB 1MU8B 2WPHS 1SFQB 3HGPA 4Y7BA 1P2KA 1IAUA 1TX7A 1SFIA 3PTNA 4CH8B 2FLBH 4YLQH 2GV7A 2A5IA 3FP6E 4O9VA 5JDUB 1SI5H 1LVBA 2WUBA 4Q2KA 3LGTA 3SJOA 3ZZAA 3GDVA 3KN2A 1G2MA 3EYDA 1KXFA 3MU0A 1G36A 4DIHH 2VB0A 3RXDA 1MQ5A 5BRRE 2IJOB 1P03A 4Y76A 4NFEA 2YMSC 4TT3D 3H5CB 4Z1MD 1BOQA 2O8LA 2W6JD 1C5QA 5GIBA 1DDJA 4K2YA 3PM3A 5FAHA 4K1SA 4F48B 4D7GA 2O8MA 2W7UA 4YTAA 1CHOF 2QXHA 5C0UA 2KZ4A 1IQEA 2YNAA 1NRSH 4NIVA 1UO6A 1K9OE 2GT7A 3ZVDA 4NSYA 1HAIH 3UFAA 1TNGA 4CRFA 1OWKA 2AH4X 3ZZBA 3GISB 4FUEA 2BY5X 2I6QA 1EB1H 1EQ9A 4H6SB 1W0YH 1MTNB 3EDXB 2ANMH 1SMFE 1QBNA 2GGVB 2GX4A 1QQ4A 2YOLA 1P3EA 4NFFA 1AZ8A 1CBWC 3OTJE 1GPZA 1BTHH 1S0QA 1W13U 2QN5T 2J97A 4THNH 3SUDA 1N8OC 1XUGA 2FMJA 4ABEA 2BYAX 2VJ1A 3LC5A 1VJAU 1UTOA 4KTSA 1O30A 1DUAA 5AFYH 7GCHF 4FUJA 5H4IB 2Y7ZA 2BD5A 1YPMH 1C5RA 2ZCKP 2R9PA 1GCTC 2PGBB 2ZHWH 1O5AB 2O8TA 5EGMA 1FZZA 3EA8A 4M9FA 1O2UA 4CBNA 1V2NT 3UIRA 1QB6A 5EJZA 1P9UA 2ZDNA 4I8HA 3Q76A 3M3SA 1NBME 3F2HA 2P95A 1BRCE 2WSSD 4X6PA 1DX5M 3V3MA 5C1XA 3C1KA 3SORA 3ZVFA 3GCTF 1C1RA 2HNTF 3RMNH 1BRAA 1GDUA 3Q77A 3O8BA 3GCTG 2W7SA 1WU1A 2VIDA 3GY3A 3SUFA 2FZZA 3G01A 4UFDH 3SU1A 1RD3B 1MTWA 2VU8E 3H7TA 4INHA 1CO7E 1GI5A 3PLBA 3F6UH 1O5FH 4XSKU 1O5EH 4Y8YA 2ZHDA 1ORFA 3SU3A 1DANH 1AVGH 1C1WH 1QA7A 5C0TA 1GMDG 5DK1A 1AWFH 4YESB 2GZ8A 2FYRA 5FBIA 2FXRA 1UVTH 4X6OA 2EI8A 2SNWA 3C27B 5EXMA 3BTWE 4NIXA 1TGCA 1BMAA 3ZIAD 1AE8H 1TRMA 5K0HA 4SGBE 1O2LA 3E16B 4OS2A 4ZROA 1OXGA 3SI4H 3A87A 2BDCA 1GWAA 5HKKD 1TPPA 1WQVH 3SJIA 2BZAA 1ZGVA 2JH0D 3VGCB 1GI7B 5GWZA 2V3OH 1F0UA 1P57B 1BHXB 3ZYEA 4YOJA 3ZVEA 4JK6A 1EJNA 1A5IA 1AKSA 3RXLA 2XC5A 2ZGCA 1SQRA 3SJKA 3S7HB 1OHHD 1VGCB 3FVFB 2XRCA 1SQTA 1EPTB 1BMFD 4BAQB 4NA8A 3CENA 3URCA 1DLEA 4X6NA 4QT8C 1UTQA 3BTTE 1M9UA 1V2WT 1P2IA 2BY7X 3BG8A 1HUTH 1YGCH 2IOTA 1SGRE 3CP7A 3U1JB 1QA0A 4ISNA 5DGJA 3FP7E 1TIOA 3E0PB 1HPGA 3FANA 4DT4A 1SGFG 2CK3D 4ABBA 5C20A 2KFWA 4IN2A 3RXKA 3VG8A 4WJG2 1ELAA 1GBFA 1UJ1A 1GI6A 1ARBA 2O8WA 1G3BA 2NWNA 5HXFA 1U6QA 1P01A 1O34A 3MYWA 1UMAH 2P8OB 5FCKA 1C2DA 4X8SH 1ZLRA 1ANDA 1YY3A 3LJOA 2GKVE 1Y3VA 2RDLA 1GJ7B 3MNSA 3T26A 2Z3DA 3CS0A 2B8OH 3LGUA 2TGPZ 1BMMH 5FXLA 1SVPA 2P16A 1O3EA 2FOFA 2HVXA 1MTSA 1DSTA 3MWIU 1Z6JH 2Z9KA 2BXUH 3HGNA 1DWDH 1TNKA 2CMYA 2BZ6H 1K2I1 4XFQA 1C5MD 1Z8JB 2F9PA 2ZDVH 4BTIB 2LNCA 1UTKA 1C5ZB 1XMNB 2AIPA 5C2ZA 3MU5A 3UB0A 2SNVA 1T8MA 1BJUA 3E3TA 2G4TA 4JMYA 4X1RU 2W5EA 5JPMH 4JZEH 4OGYA 3KF2A 2WYJA 2GMTB 2WYGA 3QO6A 1YLCA 1NC6A 1W7XH 2G00A 4NIYA 1AVXA 4JZIA 3MU4A 1W0ZU 2Y7XA 3NUMA 5AFZH 4Q7ZA 1ANCA 3PWCA 3EQ0H 1KTSB 1K28D 1ZR0A 2H1UA 4FUDA 3VPKA 2YMSD 3TITA 2AFQB 2Y5GA 2FS8A 3A7YA 1QQUA 1C4V2 1SBWA 5T1VA 2K8IA 2PUQH 6LPRA 4CHAB 1ABJH 3DSPA 2AS9A 4ESTE 4Y7AA 1ETSH 1GBJA 1SLWB 4E7RG 4BAHB 3TPIZ 2BD7A 3SNEA 1EAUA 3SJ8A 2JETB 4GAWA 4MPUA 1V2OT 3PMAB 2GZ9A 1C9PA 5F6MA 2A7CA 2HPPH 3SO3A 3LGIA 1ZJDA 1EKBB 5EW2H 3F2FA 3MO6A 1NN6A 1GBLA 3ZVGA 1P04A 5CE1A 2ZU3A 1Y3YA 3VEQB 1GHBG 4MPVA 1C1UH 1DOJA 2BHGA 5E2PA 4YZUA 4MNYA 2PTNA 1GJ9B 4Y71A 2CJIA 2V3HH 1ZSJA 1V2MT 4X1SU 4B2CA 2ZPSA 2CHAB 1HV7A 3B8JA 3P17H 4K60A 5AVDA 5GCHF 5C1UA 1YCPH 2BDIA 3UNQA 2VIPA 1RIWB 2EA3A 3LH1A 1ELFA 1DWCH 3RXSA 1XUJA 2BX4A 5JBAS 4MG3A 2XBYA 5FPTA 1A2CH 3U69H 4NCYA 1V2LT 3LIWA 1P2NA 3RC6A 2EQNA 1FQ3A 1MZAA 1OWIA 2JH6D 2WPIS 1ZTJA 3M7TA 5FX5A 4LXBH 2F3CE 1TNJA 1EUFA 3KYGA 6CHAB 4I8JA 4MDSA 3FFGA 1O3NA 5A0CA 2FI4E 1FX0B 4KP0A 1S83A 3ESTA 3M36A 4TPYA 5J4QA 1ZSKA 3LPRA 2BX3A 1MBQA 4FOUC 3PRDA 2SGQE 2OXSA 5DP8A 2F83A 1IQMA 2G81E 1SGTA 2XNDD 1NO9H 1QB1A 5LPEA 3TGIE 2FDAA 3KNXA 1EPTA 1KLTA 2B0FA 1O2PA 5A8ZA 1AFQB 1GBTA 3PLKA 2CF8H 1A0JA 2OINA 3NXPA 3VXFH 5CMXH 4UFGH 2ZTYA 5BPEA 1Y59T 1C2MA 1O3LA 2A2QH 2G51A 4X0WU 4AORA 1W11U 4CREA 1TAWA 3RXJA 5DPAA 5T3HA 4BNRA 3D65E 4Q63A 2FP7B 4Q4LA 1GI9B 2PLXA 1GJ4H 1UTMA 2GDDA 2OK5A 2BXTH 1MAYA 1H8HD 4U30A 1RS0A 1CA0B 1O2OA 3SV6A 1PPFE 2SFAA 3TLOA 7ESTE 3Q3XA 3E0NB 5L30H 5PTPA 2AMDA 2ZF0H 4AG2A 4ZXXH 2ZKSA 3BF6H 5IYTA 1SGYE 2Y5HA 1BITA 4UDWH 3KCGH 3OY6U 8LPRA 4DIIH 2H5DA 1CT0E 4MVNA 2OQ5A 3SZNA 3U98H 3VB6A 1BTUA 1DWEH 1CU1A 3BTQE 2SGDE 4FUIA 2FODA 1ZYOA 2GCTB 8GCHG 1JBUH 2CGAA 3F0PA 4KKDA 1GHWH 1QTFA 1ZOMA 3QUMP 4NZQA 2J38A 1VCPA 1QGFA 3R3GB 1XVMA 1TPAE 1MTNC 1CGJE 2ZG0H 2UWPA 2ZGBH 1K22H 3R0FA 4WF8A 3CNRA 1LDTT 1W0KD 4ABJA 1ZHRA 2PKAB 3OEED 1TX8A 3VFEA 1JRSA 4RKJB 2VNTA 2TPIZ 2FEQH 2A7HA 4K8YA 1O5CB 5FX6A 1P2MA 1TX6A 5ABWA 2FX6A 2J9NA 2AMQA 5EPNA 2BLQA 3VB4A 1GL0E 3V7TA 1DXWA 1QL8A 2WPDD 4KELA 2VBCA 4XBBA 1SC8U 2VH6A 3RMMH 4J2YB 2RG3A 4B74A 3ZVCA 2UWOA 1F2SE 1P10A 4F49A 2PSYA 1K21H 4RSPA 1G3CA 3M5OA 3BEUA 2J34A 4NA9H 5E8EH 1UK4A 5DP7A 1UTJA 1W14U 4JYVH 3MNXA 1GGDB 2VIQA 1C5PA 1V2PT 4MPWA 1V2UT 1FN8A 3L33A 2Q6DA 1AE5A 3KL6A 3HKIB 2HOBA 1ZRBA 1WQSA 4FVDA 2ZHEH 1NU9A 1KLIH 1O2HA 1G9IE 1VITG 3F0OA 3ODFA 4U2WA 1L4DA 4WH6A 2A5AA 4ZH8A 1C5WB 1Z7KA 4OS7A 4CR5A 2RFKC 1K0HA 4B6FA 1GMCF 1L0ZA 3A8CA 3QDZB 3LH3A 1RGQA 1CHGA 3MOCA 4FXGH 1PYTC 4AN7A 1D3TB 5EIYA 1QURH 2BY6X 4FUFA 1IHTH 2ZDMA 4B2BA 2LPRA 2XBVA 3UTUH 1THRH 4CRDA 1T8NA 2H9EH 1B0EA 3QTVH 2F43B 4IC5A 1IQLA 2P3FH 1ZRKA 1E34B 3T28A 4CRAA 1LQDB 5DN6D 2ZFFH 1ZPZA 2TGDA 2FYQA 1ZHPA 3ZV9A 5T6FA 3RXBA 5C3NA 3RXOA 2ANYA 3ZZ6A 3AW0A 2ZGHA 3P8FA 3VB5A 2VGCB 1DLKB 3PV5A 1EAXA 1EXFA 2BOHB 2ZWLH 4WWYA 2PHBA 2IPHA 3VGCC 2W6ID 4BXWA 4GCHF 1MD7A 2AGIX 1XVOA 4GCHG 8ESTE 3SV7A 3S9CA 2C8YB 3QTOH 3ZZ5A 1FY4A 1IQKA 1LVOA 1W3CA 2ZA5A 4X2XA 1S81A 1VGCC 1EZSC 4WMDA 4CRCA 4FUCA 2A45B 1EPTC 3PB1E 2ODPA 1ARCA 2H6MA 1HAOH 1C5LH 1VCQA 1G3EA 4CRBA 1GBMA 2ZU2A 4TPIZ 4ASUD 3OSYA 3AVZA 1TQ7B 1ZMNA 3GY2A 2OC0A 4NSVA 3A86A 5A0BA 2ZGJA 1MBMA 1NRPH 1W2KH 1FY3A 1HGTH 2F9NA 3DT0H 2ILNA 3GY8A 1KMHB 2ALVA 1HRTH 2QCYA 3RXMA 5FHTA 1DSUA 3GOVB 1DT2A 1NZQH 2DUCA 1E1RD 3AAUA 3PYHA 3RU4T 1EP5A 5B6OA 1CHOG 2Y5FA 3RXUA 4ISLA 1GVLA 3S9AA 3UREA 3SI3H 1LMWB 4ABHA 3OAAD 1WV7H 2F9VA 3GY5A 1Q3XA 2P8OC 1NS3A 5LPFA 4B73A 3L6PA 1FI8A 4IC6A 3FKSD 2QV1A 1SL3A 3GDUA 1O2NA 2BQ7B 2ZFRH 1YM0A 1O3KA 4ACAA 3SHCH 4AGKA 1S6LA 2F91A 3ZZ8A 1F5KU 1T31A 1C2HA 1YYY1 1GDQA 2FX4A 3P70B 1SGNE 2FESH 1C4Y2 1FONA 1T4VH 1YC0A 2KX4A 3RXFA 2XYAA 5CHAB 1LO6A 1ANEA 2BOKA 5A0AE 3GS9A 3BTGE 7GCHG 2ZDAH 2HGTH 1D9IA 1GI0A 1SGFA 1W8BH 3MH5A 3AASA 3OFND 3ZZCA 4JCNA 3ENSB 4A1TA 3BEIB 2QXIA 1PFXC 5LH8A 1O35A 6GCHF 2GMTC 2V7QD 2ZU1A 4UE7H 1ZTKA 1HAVB 5F8ZA 2XBWA 1WDIA 1YPHC 1C1OA 3EE7A 4KGAA 3ZYDA 1F5LA 3EA7A 2VVUA 2ULLA 1O3BA 1SG8B 1KXCA 2J95A 1LQEA 1GBCA 1QR3E 1PPGE 4X8UH 4INLA 3NRLA 1O2IA 1GJAB 1ELVA 3MMGA 3MNCA 1FJSA 1SOTA 5GNDA 3ITIA 3PTBA 5FL7D 2FTMA 4I33A 1L4ZA 5A8YA 3RMOH 3ZV8A 1GJDB 2VIWA 4XRNA 1C1TA 4Y0YE 1O3PB 3OE7D 2GZ7A 1JXPA 4CHAC 1P06A 1NFUA 3F3BA 4MNWA 4NZLA 2BDAA 1MCVA 3RUOA 2ZC9H 2JETC 2ZFQH 3A81A 1PQ5A 5TCAA 2J98A 1HJ8A 2Z7FE 1PQ7A 2Z94A 1A0LA 1RRKA 4YOGA 1OP8A 2BB4A 4PROA 3SV2H 2BLWA 1GJCB 4K8BA 1TRNA 1K1MA 2VWOA 5KEDA 1NFWA 5F53A 1H8ED 2BM2A 2ZQ2A 1W0JD 1DE7H 1Y3UA 3T27A 3Q00A 1DUEA 1Y5BT 1CVWH 5E0JA 1Z8RA 2ZU5A 1THPB 3U28C 2THFB 5EXLA 5JBCS 4A92A 2EI6A 4A5TS 4H42U 3T25A 4J1YA 5JBTA 1GI8B 2QIQA 1HXFH 3SU5A 1LHCH 1E35B 3BSQA 2CHAC 5C5OA 2QAAA 1YPLH 3T5FH 3TJUA 1FNIA 1O3FA 1RIWC 5HIZA 2FTLE 2ZCLP 4GLYA 1UVPA 1AHTH 2NU3E 2VVCA 3MO9A 4X2VA 3HK3B 2XWAA 1O2QA 3LGVA 1TABE 2DE8A 4CRGA 3NWUA 4ISIH 4IMZA 2V6NA 4BTUB 1Y3WA 2A7JA 4IGDA 1O2XA 4Q7YA 1WOFA 3P8NA 2C4FH 2HNTC 1LVYA 6CHAC 3I77A 3UAIC 2L6OA 4RN6A 1S85A 4OGXA 2PV9B 1TA2A 3UR6A 1GJ6A 4AFQA 5EQSA 2SGEE 1O3HA 2UUKB 2ZZUH 5ETXA 1P0SH 2HLDD 1O2RA 2D2DA 1PYTD 3SQHE 3VB7A 2ZDLA 1EOJA 5ESBA 5E2OA 1Y5UT 1A5GH 1AFQC 4IN1A 1FY1A 3BTEE 1GBIA 2ZQ1A 2AEIH 4ABIA 1O2JA 3GICB 4FUGA 1FAXA 1O37A 4HTCH 4R0IA 2A4QA 2FWWA 1PPCE 1BIOA 5I46H 1C2IA 3UUZA 5DKMA 4JK5A 5L2YH 4ZKSU 1OWEA 2FOCA 4E05H 2F9OA 1XXFA 2BVXH 2HPQH 3AW1A 2XOKD 2XW9A 1VKYA 1DM4B 3RLWH 1O39A 1ELBA 1SLUB 1L1GA 1ZGIA 2AERH 4GHTA 2FOBA 1NPMA 1LKAA 1TOMH 4ZHLU 3URDA 2PFEA 2C3SA 3QZRA 2A4GA 2O9QA 1CA0C 1B0FA 4YT7H 3LT3A 5AHGH 5J4SA 1WSSH 4AFZA 1UK3A 2ZECA 4WXVA 1BMNH 1TONA 3EE0B 4XBCA 4IMQA 4TY6A 3GDSA 4JYTA 2EC9H 1HIAB 3PMJA 3GYLB 4ZKOU 2STBE 2G55A 2IJD1 2FOAA 1MZDA 1QB9A 2A5KA 4TY7A 2OLGA 3BV9B 3TJOA 3GY7A 3WY8A 4LOYH 1V2QT 2F9BH 3MNBA 2WINI 1N1LA 2GCTC 2UUFB 2HALA 3F1SB 3QGJA 4AZ2B 1ESTA 3JZ2B 1NM6A 1O3GA 1PPHE 5HM2A 1SGIB 3NPSA 9ESTA 1OWDA 2ZFTA 1ZMLA 1JIMA 4DT7B 4NIWA 3E8LA 3RDZA 1HAPH 1AIXH 1TPOA 1PQAA 1TMBH 2OP9A 4ZUHA 1IQHA 3ZZDA 3DA9B 3AK5A 5GXPA 5T6DA 2STAE 3RXQA 1O5DH 2J4IA 3SGAE 5DG6A 1UK2A 5KGOA 2FIRH 4ABFA 3V13A 1BBRK 1JWTA 3RC4A 2O8UA 4NWLA 1HBTH 3P95A 1BTZA 3TJVA 1C1QA 1FIZA 1NY22 2KCPA 4D76A 3O8CA 1OYTH 2FOEA 2JH5D 3RXAA 1KIGH 4D9QA 5EG4A 3BEFB 1EATA 1GDNA 1GGDC 1EZQA 3H09A 1D6RA 3A82A 1TQ0B 1E1QD 4ZXYH 1C1MA 1AY6H 1KXBA 3F68H 2AMPA 1QIXB 1AD8H 1ZSLA 4AX9H 1FPCH 1A7SA 3WWFA 2JJ2D 2VWNA 1HAYB 2P59A 1G2LA 3SZEA 1EZUC 1QHRB 1A4WH 2OCVB 4X1QU 4BXSA 1O5BB 2XNIA 5EQRA 2QYIA 1TMTH 2UUJB 5GCHG 3DFLA 1FPHH 4WMEA 1ID5H 3UOUA 8KME2 4LZ1H 1QRXA 2QF3A 1GHYH 1L1JA 2Z9IA 3DUXH 4BAKB 1UVUH 1ELCA 1O3MA 2A1DB 2XCNA 2R0KA 1GL1A 3SJ9A 1AFEH 1KXDA 5A2MH 1NESE 4CH2B 2FOMB 3U8RH 1K1JA 4FUBA 2ESTE 2ZFSA 2B5TB 3QGNB 2ASUB 4K69A 2WV4A 4A1XA 1T4UH 3T2NA 5EU8A 3N99A 2VGCC 1O2ZA 1H9HE 3QX5H 3UR9A 1K1LA 2TGTA 4Y11E 1LHGH 2FI3E 3KQCA 4Z0KA 1NFXA 2GDEH 2SGPE 3BIVH 1TPSA 5DP9A 1EZXC 4OS6A 3A88A 1GG6B 1QY6A 3BN9A 1TB6H 3RXRA 5C67A 3OEHD 1KXEA 5A8XA 1LPKB 1MKXH 3NCLA 1V2ST 1WUNH 4BTTB 1ZJKA 4NGAH 1VJ9U 4Z6AH 1LVMA 4A6LA 1MTVA 1YPKH 2Q6GA 4AYVB 2BVRH 3RXIA 3F9GA 2ZNKH 5JYIA 1G3DA 4DVAU 1GBAA 3PMHB 4U32A 1NT1A 2BY9X 1D3QB 2G5VA 3E6PH 1TA6A 2BDGA 4UFFH 3S69A 1O2TA 1P11E 3MH6A 5F8TA 4ISHH 3EA9A 3FP8E 1GHXH 3M7UA 1P09A 1G32B 3BG4B 3K9XB 1YBWA 4LZ4B 1TALA 1F0SA 2L74A 3SNAA 3ZVAA 1YPGH 1CQQA 3A7XA 3GY6A 3M5LA 1IQJA 2BD9A 4FU8A 3NZIA 4WH8A 6ESTA 4X2WA 3RM2H 1GI2A 1GMHF 4HZHA 1S5SA 1FDPA 3FAOA 4FETA 1OP2A 1GBKA 1J8AA 1HIAA 1C1NA 2RA3A 4ABAA 4RKOB 4XBDA 2ANWA 3ATLA 4RT1A 2P3UB 3MU1A 1E36B 3A83A 3FOAA 2TRMA 2OC1A 3RXEA 2BY8X 1QL9A 1XX9A 5HM9A 1KLJH 5FCRA 4ZCNA 1AO5A 1X7AC 2ZHFH 5CHAC 5L2ZH 1SSXA 1QRZA 4XOJA 1OWHA 1BTPA 1OX1A 1EFRD 1WTHD 3P92A 2FLRH 2ZI2H 3O8RA 1O3OA 1HDTH 2QE7D 1A3EH 1XKBC 3GCHB 3V12A 1O0DH 4B75A 4YXWD 1O2WA 1WAYB 4LK4A 3TGKE 2GTBA 3PO1B 3A84A 1Z1JA 1BT7A 2M2AA 5GPIB 2FO9A 4GPGA 4D8NA 1IQFA 3OYPA 1J15A 4X8VH 5HIYA 1YLNA 1NRRH 3SGQE 4I86A 5EW1H 4DGJA 1GBDA 3SNDA 3ATWA 2ZCHP 3PV2A 1GMCG 4OS5A 1DICA 1MKXK 1GCDA 1CGIE 3ZZ3A 4ZKNU 4H6TA 1YLDA 2VVVA 4KTUA 1OOKB 4I8LA 3GCOA 5F03A 1JMOH 1LTOA 5HGGA 4B76A 2H5CA 3MQKC 1BB0B 3UWIA 3SUEA 3UWJH 1K1OA 1RTKA 4F55A 2D26C 3D23A 3SOSA 5C5NA 1AUTC 3A7TA 4B71A 3KHVA 2FPZA 4DW2U 1KDQB 2AGGX 1LKBA 1XM1A 4Y79A 2C8WB 2ZU4A 2JIZD 2PKSB 2WZQA 4AB9A 1SHHB 1B5GH 3N7OA 1KYNA 1PPZA 1N6XA 4R8TB 2Z6BD 2FI5E 2BMGB 2GP9B 3K65B 4DJZB 1C2KA 3OTPA 3A8AA 1HNEE 3K6ZA 3RXVA 1EAWA 1C5OH 1NROH 4B6EA 3PWBA 2Y80A 2ZPRA 1LCYA 4BAOB 1CT4E 1LPZB 2TIOA 3DCLA 3M37A 3RXCA 3TK5A 3D62A 1O2GH 3BTME 1IOEA 2BD4A 3LKWA 1C2FA 2V35A 3CS7A 1AZZA 1D4PB 3W95A 3SNCA 2PR3A 1EB2A 1QCPA 3W94A 3E90B 3PV4A 1PPBH 1XUKA 3WWBA 1ZPBA 1WTGH 3STIA 5FPYA 2NU0E 1FY5A 1DFPA 1GHAF 2G52A 3JZ1B 1WBGB 1ELTA 4WVPE 1V2JT 4TWYA 1GHAG 1XUHA 2KCAA 3O8DA 1TGSZ 3ELAH 2QF5A 3IITA 2VWLA 1HAZB 1TRYA 1VITH 2W3IA 4DOQA 2V0BA 1ACBE 1FY8E 1HAGE 1QBOA 3A80A 1Y5AT 3RXPA 1ABIH 3GY4A 1OSSA 3KIDU 1F0RA 5SGAE 3N7DA 2A4RA 3UNSA 2NU4E 1FLEE 1C9TA 1H9LB 1YF4A 2WPKS 3U8OH 2BD3A 1SKYE 3QLPH 4X6MA 3SU6A 1TNHA 4UD9H 2ZGXH 1MMJN 1MTUA 2W26A 2VIOA 5JB8S 2D1JA 4VGCB 4B2AA 2KAIB 3DD2H 3BTDE 1HYLA 5DP3A 5C1YA 3RU4D 2UUYA 4GVUA 2J92A 4AYYB 1QNJA 3WW7A 1D3DB 1H8IH 3S7KB 4OS4A 1IQIA 1JIRA 5DP6A 1F0TA 3ZZ9A 4DCDA 4NA7A 4RI0A 1H9IE 2EI7A 1S6HA 3KYFA 2A2XH 2GV6A 3A7WA 1JOUB 1SGCA 1G30B 5C17A 1Y8TA 1UTLM 5DSFA 1GI1A 1MKWH 2C8ZB 1OWJA 1TGTA 4FVBA 2GCHF 1UHBB 1HXEH 2BLVA 4MLFB 2ZFPH 3B9FH 2FM2A 1SB1H 2BVSH 2PKAA 2GCHG 1OPHB 2FS9A 1UW7A 6GCHG 1FUJA 3RP2A 3SQEE 1CGHA 1AGJA 1GVZA 1C5UA 1GHZA 3NKKA 4HGCA 2XBXA 2PGQB 3OY5U 2QC2A 3QK1A 1RJXB 5EODA 3U8TH 3TK9A 1BJVA 2OUAA 3KQBA 1BMLA 2AYWA 4RT0A 1C1VH 4DY7B 3BTFE 3SU0A 2ODQA 1KTTB 4IW4E 1OS8A 4XDEA 2QA9E 1BTXA 2WPMS 2ODYB 2CV3A 2WPJS 3A85A 1DY9A 3B23B 3P8GA 4JYUH 1A61H 1SHYA 2GD4B 3U1IB 1T8OA 1XKAC 1INCA 1Z1IA 2GJGA 3HATH 4NWKA 1MU6B 1O2KA 2F4LA 3A8DA 4WY3A 1FN6A 5CHBA 1NU7B 1GI4A 1EX3A 3M61U 2C8XB 3KQEA 1QJ6B 4X1NU 3F2GA 3GYMA 4Y8XA 3MI4A 5DO4H 1VR1H 1GMDF 1OYQA 1SLXB 2JDID 1O2VA 2UWLA 1UTPA 3ATKA 2OD3B 1J16A 2Z9GA 2BLOA 1EJMA 1FMGA
chains in the Genus database with same CATH topology
3ATMA 2CN0H 2RCEA 1AVWA 3LGYA 1F5RA 2C93B 1AUJA 1HLTH 1BRBE 3PLPA 1KDQA 1NFYA 5JBBS 3DHKH 1O5GH 1N6YA 3K2UA 2NU2E 4XE4A 3V0XA 1C2JA 1G37A 4K1EA 5LPRA 3I78A 2XCFA 3T62A 1TBRH 1HJAB 1CSOE 1L1NA 1J14A 3E91A 1C2EA 1J9CH 1DY8A 3M7QA 4ZHAA 9LPRA 1BBRH 2QXGA 2C90B 1AB9C 2I6SA 4Y8ZA 2IN2A 1NRNH 2ALPA 1DS2E 1RTLA 2ZDKA 1HCGA 2R3UA 4GHQA 1MKWK 3DFJA 3RXHA 1P9SA 2K1QA 3RC5A 4CR9A 1ZHMA 1SLVB 3I29A 3BTHE 1O38A 1SOZA 3RMLH 2ZO3H 2OBQA 1S0RA 1DXPA 3L3TA 4YM9A 1EOLA 3UOPA 1TE0A 3SV8A 1ETTH 4Y0ZE 5ESTE 3M35A 1NTPA 1W12U 3OX7U 3UQOA 4U01A 1SGEE 4A1VA 1NRQH 2HLCA 1EASA 3A7VA 2R2WU 3D49H 2CF9H 1MQ6A 1AWHB 4BOHA 4Q7XA 1GG6C 2J2UA 1YPHE 1FXYA 1XUFA 1QJ7B 1IQNA 1V6DA 2H9TH 5EPYA 3P6ZB 5DP4A 1KSNA 1UCYH 2BD2A 4K3JA 4IS5A 5FBEA 3ZZ7A 2BDYA 4ISOA 3SU2A 1C5SA 2OBOA 1C4U2 1TGNA 3TH2H 1P8VC 2BQWB 1JRTA 4YLUA 5K7RA 3RLYH 3SNBA 1W10U 1RTFB 2G8TA 1IQGA 1TBQH 3GCNA 1SQAA 1C5XB 1O3DA 2XC0A 5E0HA 2EEKA 4I8GA 4JZFH 1CBWB 5LGOA 1A5HA 4MQAA 2DE9A 1C2GA 2ZTXA 1P2JA 2BDHA 1N8OB 1PJPA 1Q2WA 4E7NA 2KAIA 3BG4C 1V2RT 3RM0H 4MNVA 1VZQH 3QN7A 3U9AH 4WMFA 3LJJA 3EGKH 3KEEA 2ZP0H 1ETRH 2XXLA 2WV5A 1VCWA 2P93A 2PSXA 2XWBI 1BQYA 3PMBB 3SHAH 1EAIA 2R2MB 5E0GA 2QGRA 3SW2B 5I25A 2Y81A 1GCTB 3K6YA 1BBRE 4NG9H 4BAMB 1H1BA 3MO3A 1C5TA 4ZAEA 5EXNA 2QXJA 4K5ZA 4ZMAH 1Z71A 3LONA 1UHBA 2AIQA 2TGAA 1HAVA 3M3VA 1Z8IB 2XC4A 3BTKE 4F4OC 1ELEE 1SGQE 4CBOA 2Z9LA 2HNTE 4IBLH 3GCHC 2BTCE 1RFNA 1ESBA 4X8TH 3E1XB 1EJAA 3NK8A 7LPRA 2HRVA 1BCUH 5GJ4B 4D9RA 2XTTB 2ZEBA 1S82A 2AGEX 3MFJA 2B7DH 3PO1C 2VWMA 4D7FA 4KTCA 4YOIA 4TWWA 1BRUP 1F7ZA 1MH0A 1P05A 1QL7A 1GBEA 1MAXA 1UCYE 2VH0A 1Z8GA 3LOXA 4YT6H 1GVKB 1S6FA 1MCTA 1E38B 1MD8A 3F9HA 1A3BH 2QF0A 1GBHA 4ABGA 1GHBF 2D8WA 3TH3H 3TU7H 3IWMA 1UCYK 1AU8A 2J94A 3ATIA 1DITH 2NU1E 4I7YH 1ESAA 3FZDA 3KGPA 4MTBA 4ABDA 1BTYA 2SGAA 3QWCH 5TCCA 2R3YA 1C1PA 3STJA 3BIUH 1P2QA 2SGFE 1PPEE 1Z6EA 4OS1A 4AOQA 1AB9B 2G5NA 2PKSC 2BQ6B 4BANB 1K1IA 2OQUA 5A09A 1GBBA 1ZMJA 4DG4A 1J17T 1OKXA 2ZPQA 2WPLS 4UFEH 1O36A 1O32A 5TJXA 1TFXA 1V2KT 1HB0B 5G4BA 2FOGA 4AGJA 5HYOA 4B1TA 1UVOA 2Y6TA 3TVJB 5AF9H 3OU0A 3LDXH 3UY9A 2RA0A 1TNLA 1WCZA 3P8OA 2A0QB 4YO9A 1HAXB 3Q3KA 1D3PB 4INKA 3PROA 1T32A 2PWXA 4HFPB 4E06H 1BDAA 2PUXB 1W7GH 2HWLB 2JKHA 1FAKH 3ODDA 4O3UA 1UTNA 3LC3A 2GT8A 3VB3A 1CT2E 1O3IA 2QY0B 1O31A 2ZIQH 2VIVA 1BTWA 1LHDH 1Q31A 3RXTA 2H2ZA 1TBZH 4ASHA 3MTYA 2BDBA 2W3KA 3A89A 4Q80A 1FIWA 4O97A 1GJ5H 3RXGA 1GJ8B 3M3TA 1BUIA 1LHFH 2TBSA 1ANBA 4Y10E 1A46H 1THSH 2OC8A 2Z3CA 1P3CA 3H7OA 2M5TA 1YPJH 1DVAH 1CE5A 1B7XB 1K1NA 4GSOA 1Y3XA 3TJNA 1TYNA 4A7IB 1TLDA 5L6NH 3F9EA 1GI3A 5HMAA 1SGPE 1TMUH 4I8KA 2P94A 2PTCE 7KMEH 2GVFA 1S84A 3UPEA 3MH4A 4DURA 4GUXA 1HFDA 2A4OA 1A0HB 2Q6FA 4JZ1A 2A31A 1O33A 1H8DH 1T8LA 4VGCC 1QJ1B 3SBKA 1YCPM 4O3TA 3SU4A 1GMHG 2Z9JA 1C5YB 3SUGA 3TGJE 4FUHA 1FV9A 3ZZ4A 3MU8A 1AI8H 1KY9A 2OTVA 8GCHF 1KXAA 4JZDH 4X1PU 4O03A 4I32A 1SQOA 1C2LA 3KQDA 1YCPK 2R0LA 1E37B 4Y6DA 1CA8B 1WYKA 2Z3EA 3UNRA 5F8XA 1V2VT 3FZZA 5DJ7A 4FU9A 4WXIA 1C1SA 4MNXA 1TGBA 1ZTLA 3F9FA 3TNSA 5DP5A 5T6GA 1DWBH 2H9HA 1L2EA 1O3JA 1YKTA 2Y82A 1C5NH 3RU4E 2A32A 1E0FD 4H4FA 3M5MA 3TIUA 1O2YA 1GHVH 2ANKH 1O2SA 1TNIA 1AMHA 1ZZZA 1HJ9A 1O2MA 1GJBB 1H4WA 1BHXF 1LHEH 2Q1JA 4AG1A 3MHWU 1RXPA 2PW8H 2YNBA 1BZXE 5IDKA 3HKJB 1P02A 1VITF 1T7CA 3M5NA 4UEHH 3AAVA 1O3CA 3SV9A 1A1RA 1V3XA 2BD8A 1K1PA 4FU7A 4AB8A 5GDSH 1ELDE 4ZKRU 3SN8A 5JB9S 4SGAE 4AFSA 1YPEH 1AN1E 2F9UA 3SGBE 3QZQA 3EAJA 3T29A 3UQVA 5EOKA 1P2OA 5EQQA 1OP0A 1SPJA 2G4UA 3ZVBA 1F92A 3HPTB 3TK6A 1PQ8A 1QRWA 3HK6B 1SGDE 1TOCB 2P3TB 3A7ZA 4ZHMU 1LPGB 1AQ7A 3LGWA 3TNTA 1AKSB 3TH4H 1O3AA 3LU9B 1IHSH 1ZPCA 2CXVA 1BA8B 1UVSH 1EP6A 4K1TA 3S9BA 3MH7A 4M7GA 2FOHA 3S0NA 1DPOA 4HI3A 1HAHH 1ELGA 2OC7A 3A8BA 1V2TT 4UONA 5FPSA 1C5VA 1P12E 1YP9A 1XUIA 1XXDA 2ZTZA 1MUEB 1SR5C 4TYDA 2VINA 4X2YA 1QBVH 4MPXA 1HJAC 4I31A 2ZHQH 1QFKH 2WUCA 3VXEH 3IG6B 2B9LA 3Q3YA 1D6WA 4AFUA 1TWXB 1MU8B 2WPHS 1SFQB 3HGPA 4Y7BA 1P2KA 1IAUA 1TX7A 1SFIA 3PTNA 4CH8B 2FLBH 4YLQH 2GV7A 2A5IA 3FP6E 4O9VA 5JDUB 1SI5H 1LVBA 2WUBA 4Q2KA 3LGTA 3SJOA 3ZZAA 3GDVA 3KN2A 1G2MA 3EYDA 1KXFA 3MU0A 1G36A 4DIHH 2VB0A 3RXDA 1MQ5A 5BRRE 2IJOB 1P03A 4Y76A 4NFEA 3H5CB 1BOQA 2O8LA 1C5QA 5GIBA 1DDJA 4K2YA 3PM3A 5FAHA 4K1SA 4D7GA 2O8MA 2W7UA 4YTAA 1CHOF 2QXHA 1IQEA 2YNAA 1NRSH 4NIVA 1UO6A 1K9OE 2GT7A 3ZVDA 4NSYA 1HAIH 3UFAA 1TNGA 4CRFA 1OWKA 2AH4X 3ZZBA 3GISB 4FUEA 2BY5X 2I6QA 1EB1H 1EQ9A 4H6SB 1W0YH 1MTNB 3EDXB 2ANMH 1SMFE 1QBNA 2GGVB 2GX4A 1QQ4A 2YOLA 1P3EA 4NFFA 1AZ8A 1CBWC 3OTJE 1GPZA 1BTHH 1S0QA 1W13U 2QN5T 4THNH 3SUDA 1N8OC 1XUGA 2FMJA 4ABEA 2BYAX 2VJ1A 3LC5A 1VJAU 1UTOA 4KTSA 1O30A 1DUAA 5AFYH 7GCHF 4FUJA 5H4IB 2Y7ZA 2BD5A 1YPMH 1C5RA 2ZCKP 2R9PA 1GCTC 2PGBB 2ZHWH 1O5AB 2O8TA 5EGMA 1FZZA 3EA8A 1O2UA 4CBNA 1V2NT 3UIRA 1QB6A 1P9UA 2ZDNA 4I8HA 3Q76A 3M3SA 2P95A 1BRCE 4X6PA 1DX5M 3V3MA 5C1XA 3C1KA 3SORA 3ZVFA 3GCTF 1C1RA 2HNTF 3RMNH 1BRAA 1GDUA 3Q77A 3O8BA 3GCTG 2W7SA 1WU1A 2VIDA 3GY3A 3SUFA 2FZZA 3G01A 4UFDH 3SU1A 1RD3B 1MTWA 2VU8E 3H7TA 4INHA 1CO7E 1GI5A 3PLBA 3F6UH 1O5FH 4XSKU 1O5EH 4Y8YA 2ZHDA 1ORFA 3SU3A 1DANH 1AVGH 1C1WH 1QA7A 1GMDG 5DK1A 1AWFH 4YESB 2GZ8A 2FYRA 5FBIA 2FXRA 1UVTH 4X6OA 2EI8A 2SNWA 3C27B 5EXMA 3BTWE 4NIXA 1TGCA 1BMAA 1AE8H 1TRMA 5K0HA 4SGBE 1O2LA 3E16B 4OS2A 4ZROA 1OXGA 3SI4H 3A87A 2BDCA 1GWAA 1TPPA 1WQVH 3SJIA 2BZAA 1ZGVA 2JH0D 3VGCB 1GI7B 5GWZA 2V3OH 1F0UA 1P57B 1BHXB 3ZYEA 4YOJA 3ZVEA 4JK6A 1EJNA 1A5IA 1AKSA 3RXLA 2XC5A 2ZGCA 3SJKA 3S7HB 1VGCB 3FVFB 2XRCA 1SQTA 1EPTB 4BAQB 4NA8A 3CENA 3URCA 1DLEA 4X6NA 4QT8C 1UTQA 3BTTE 1M9UA 1V2WT 1P2IA 2BY7X 3BG8A 1HUTH 1YGCH 2IOTA 1SGRE 3CP7A 3U1JB 1QA0A 4ISNA 5DGJA 3FP7E 1TIOA 3E0PB 1HPGA 3FANA 1SGFG 4ABBA 5C20A 4IN2A 3RXKA 4WJG2 1ELAA 1GBFA 1UJ1A 1GI6A 1ARBA 2O8WA 1G3BA 2NWNA 5HXFA 1U6QA 1P01A 1O34A 3MYWA 1UMAH 2P8OB 5FCKA 1C2DA 4X8SH 1ZLRA 1ANDA 3LJOA 2GKVE 1Y3VA 2RDLA 1GJ7B 3MNSA 3T26A 2Z3DA 3CS0A 2B8OH 3LGUA 2TGPZ 1BMMH 5FXLA 1SVPA 2P16A 1O3EA 2FOFA 2HVXA 1MTSA 1DSTA 3MWIU 1Z6JH 2Z9KA 2BXUH 3HGNA 1DWDH 1TNKA 2CMYA 2BZ6H 1K2I1 4XFQA 1C5MD 1Z8JB 2F9PA 2ZDVH 4BTIB 2LNCA 1UTKA 1C5ZB 1XMNB 2AIPA 5C2ZA 3MU5A 2SNVA 1T8MA 1BJUA 3E3TA 2G4TA 4JMYA 4X1RU 2W5EA 5JPMH 4JZEH 4OGYA 3KF2A 2WYJA 2GMTB 2WYGA 3QO6A 1YLCA 1NC6A 1W7XH 2G00A 4NIYA 1AVXA 4JZIA 3MU4A 1W0ZU 2Y7XA 3NUMA 5AFZH 4Q7ZA 1ANCA 3PWCA 3EQ0H 1KTSB 1K28D 1ZR0A 2H1UA 4FUDA 3VPKA 3TITA 2AFQB 2Y5GA 2FS8A 3A7YA 1QQUA 1C4V2 1SBWA 2PUQH 6LPRA 4CHAB 1ABJH 2AS9A 4ESTE 4Y7AA 1ETSH 1GBJA 1SLWB 4E7RG 4BAHB 3TPIZ 2BD7A 3SNEA 1EAUA 3SJ8A 2JETB 4GAWA 4MPUA 1V2OT 3PMAB 2GZ9A 1C9PA 5F6MA 2A7CA 2HPPH 3SO3A 3LGIA 1ZJDA 1EKBB 5EW2H 3MO6A 1NN6A 1GBLA 3ZVGA 1P04A 5CE1A 2ZU3A 1Y3YA 3VEQB 1GHBG 4MPVA 1C1UH 1DOJA 2BHGA 5E2PA 4YZUA 4MNYA 2PTNA 1GJ9B 4Y71A 2CJIA 2V3HH 1ZSJA 1V2MT 4X1SU 4B2CA 2ZPSA 2CHAB 1HV7A 3B8JA 3P17H 4K60A 5AVDA 5GCHF 5C1UA 1YCPH 2BDIA 3UNQA 2VIPA 1RIWB 2EA3A 3LH1A 1ELFA 1DWCH 3RXSA 1XUJA 2BX4A 5JBAS 4MG3A 2XBYA 5FPTA 1A2CH 3U69H 4NCYA 1V2LT 3LIWA 1P2NA 3RC6A 1FQ3A 1MZAA 1OWIA 2JH6D 2WPIS 1ZTJA 3M7TA 5FX5A 4LXBH 2F3CE 1TNJA 1EUFA 6CHAB 4I8JA 4MDSA 3FFGA 1O3NA 5A0CA 2FI4E 4KP0A 1S83A 3ESTA 3M36A 4TPYA 5J4QA 1ZSKA 3LPRA 2BX3A 1MBQA 2SGQE 2OXSA 5DP8A 2F83A 1IQMA 2G81E 1SGTA 1NO9H 1QB1A 5LPEA 3TGIE 2FDAA 3KNXA 1EPTA 1KLTA 2B0FA 1O2PA 5A8ZA 1AFQB 1GBTA 3PLKA 2CF8H 1A0JA 2OINA 3NXPA 3VXFH 5CMXH 4UFGH 2ZTYA 5BPEA 1Y59T 1C2MA 1O3LA 2A2QH 2G51A 4X0WU 4AORA 1W11U 4CREA 1TAWA 3RXJA 5DPAA 5T3HA 4BNRA 3D65E 2FP7B 1GI9B 2PLXA 1GJ4H 1UTMA 2GDDA 2BXTH 1MAYA 4U30A 1RS0A 1CA0B 1O2OA 3SV6A 1PPFE 2SFAA 3TLOA 7ESTE 3Q3XA 3E0NB 5L30H 5PTPA 2AMDA 2ZF0H 4AG2A 4ZXXH 2ZKSA 3BF6H 5IYTA 1SGYE 2Y5HA 1BITA 4UDWH 3KCGH 3OY6U 8LPRA 4DIIH 2H5DA 1CT0E 4MVNA 2OQ5A 3SZNA 3U98H 3VB6A 1BTUA 1DWEH 1CU1A 3BTQE 2SGDE 4FUIA 2FODA 1ZYOA 2GCTB 8GCHG 1JBUH 2CGAA 4KKDA 1GHWH 1QTFA 1ZOMA 3QUMP 4NZQA 2J38A 1VCPA 1QGFA 3R3GB 1XVMA 1TPAE 1MTNC 1CGJE 2ZG0H 2UWPA 2ZGBH