4GLYA

Human urokinase-type plasminogen activator upa in complex with the two-disulfide bridge peptide uk504
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Bicyclic Peptide Ligands Pulled out of Cysteine-Rich Peptide Libraries.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4glyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4glyA01
1ELEE 2O8LA 3RXCA 2J9NA 1TGBA 2SGAA 4BXSA 1GCTC 2BD7A 1V2ST 3TGIE 1TALA 1D3TB 3GCTF 4NIXA 1P8VC 4CHAB 6GCHF 1GDUA 1Q2WA 1SBWA 1EJAA 2Y7ZA 1L1GA 5DG6A 2OUAA 3A88A 3RC6A 1RGQA 3SHCH 2Z9KA 3LJJA 3K2UA 4MNXA 2OBQA 1ELTA 4WVPE 5E2PA 2OQUA 2ZGBH 2GZ9A 1O30A 1Z7KA 1O2NA 5JPMH 5K7RA 1TBQH 4JK6A 3NPSA 5E8EH 1AFQC 1CA0C 2WPKS 4X1NU 1OPHB 4X2WA 3URDA 3VXEH 3SNBA 1ZRBA 3JZ2B 1GI1A 3MH4A 1YPLH 3TK6A 3UR6A 1ZGIA 3GYLB 1O33A 4THNH 3KL6A 2GZ7A 5DO4H 5EXLA 1BOQA 4X8TH 2OLGA 3PMBB 5CHAB 2Y80A 2PUQH 1EAWA 3SBKA 1B0EA 1C1SA 2BDHA 1LKBA 4Y8YA 1MTVA 1FY3A 4KGAA 5FPSA 1LVMA 3HGNA 1YPJH 1GHWH 1TRYA 4FU8A 4FUHA 4FUCA 1MU8B 2GT7A 1TQ0B 4Y71A 5LPFA 2EEKA 1QBOA 1SQTA 1Z8IB 3BTWE 3U1JB 1JMOH 1F5KU 1Q31A 2BOKA 1GI0A 2BX3A 3KHVA 1BHXF 1BRAA 5TCCA 2ZFQH 4O97A 3PTNA 5J4QA 3PROA 3M3TA 4DGJA 1O3KA 4RKOB 4MPXA 1QJ1B 1UCYE 2CV3A 2QIQA 2A4RA 5HM9A 2WV5A 4FU7A 2A2QH 8ESTE 3SUEA 1M9UA 2ZPQA 3FZDA 3OSYA 1A61H 3V7TA 3SU4A 4IMZA 3T26A 1F0TA 1E36B 2JH5D 1BA8B 3FANA 4XFQA 1P10A 2RA0A 2GCTC 3D65E 2BMGB 2W7UA 1EB1H 1UMAH 2EI6A 2A1DB 1Y3UA 2ZU3A 1NZQH 4LZ1H 4ESTE 2BDBA 1OP0A 3M36A 5HM2A 1C2GA 3TH4H 3MYWA 1WQVH 2GV6A 2PV9B 2G55A 4CRAA 1SLVB 1KLTA 3DUXH 3T5FH 2Z3DA 1GBMA 2P8OB 4OS2A 5FAHA 3ZVGA 1SGEE 1BTZA 4K8BA 1YF4A 5FXLA 4KKDA 2PKAA 4ZHLU 1QRZA 1BIOA 5AVDA 1SGQE 3RM0H 1ZOMA 2VINA 3MO6A 3W95A 1G3DA 2BY8X 3QGNB 1Z6EA 2ZDNA 5ESBA 4B71A 1O36A 2ZKSA 1DVAH 2O8WA 5BPEA 4JZDH 1CHOF 1OP2A 2FO9A 3SZNA 4X1QU 2FWWA 5EU8A 2ZTXA 1RTFB 3O8DA 3QN7A 1UTPA 4DIHH 3P8NA 3FVFB 5EGMA 2B5TB 2BY7X 1C5UA 2QXJA 1K1IA 2R9PA 1HBTH 4D7FA 2TRMA 4DOQA 3ENSB 3FFGA 1BTXA 1H1BA 1BRBE 4A7IB 1F2SE 7GCHG 1PQ5A 1ZJDA 1UTKA 1FPHH 1K1MA 1O38A 4I7YH 1D3DB 1JWTA 1SGYE 1NY22 3MO9A 2ZCHP 2OINA 2QC2A 2M5TA 1MU6B 1AB9B 4RSPA 1QJ6B 2ZHDA 4Z0KA 2XWAA 3MFJA 4KTSA 5A8ZA 2BHGA 4MTBA 2F9OA 4B76A 1G2MA 1AWHB 3F68H 1C4V2 4TY7A 1FY8E 1O3FA 3STJA 4YLUA 3BTHE 2G5VA 2ZIQH 4NWLA 1TNIA 3SNAA 2V35A 2W3IA 1W3CA 2CXVA 2Y5GA 4NSVA 4JK5A 4Q7YA 2BQ7B 4DURA 2PGQB 4CH2B 1FAXA 1GI8B 4YESB 2O8TA 2ZF0H 2QAAA 1GHBF 3LOXA 1LTOA 4X8UH 5F8XA 2R2WU 1SB1H 3SJ8A 2BOHB 2PKSB 1ABJH 1P2OA 2AGGX 2GT8A 4XOJA 1O2KA 1P04A 3E0NB 3MHWU 3ZZ7A 1QA7A 3BV9B 1HGTH 5DP7A 1O3OA 3MH7A 4AB8A 1TIOA 3PV4A 4ISIH 3KGPA 1XXFA 4TYDA 4K5ZA 1NS3A 3DFJA 4CR9A 5A0CA 5PTPA 2QXGA 3RXFA 2ANWA 1GJ5H 4TWWA 2CHAC 1Y8TA 1VGCB 2BDCA 1FMGA 4R8TB 5ABWA 5ETXA 1GBLA 4YOIA 3A87A 2GDEH 1IOEA 3CP7A 3SQEE 1AE5A 1GI9B 1DE7H 3QDZB 3GCNA 2KAIA 1V2JT 1E34B 3MO3A 2ZDVH 4OS6A 1QBVH 3RU4D 2BVSH 1ABIH 1C5RA 4WWYA 1GWAA 4ZKSU 1ZR0A 2F9UA 1OXGA 1YKTA 4WXIA 1WAYB 3A7XA 1ELDE 4HGCA 2GCHF 2XBYA 2ZU5A 1BTHH 3SOSA 2FPZA 2SGDE 1A1RA 1DT2A 3A7YA 3HGPA 1T4VH 2XYAA 1UK4A 1ESBA 4FUGA 2HVXA 1P02A 3HKIB 1P06A 3GCOA 1D6RA 4X6MA 1P12E 3BIVH 2ZQ2A 3UNSA 1MD7A 1QJ7B 1PPEE 1GMCF 5L2ZH 2GZ8A 3PWCA 1S83A 3P8FA 2UUYA 4ZHAA 3HK6B 3VEQB 8LPRA 2C93B 3ZZAA 1ID5H 5IDKA 2ZHEH 1E37B 2PFEA 2R2MB 1J14A 1QB9A 1GJ8B 1GI3A 1V2TT 1DM4B 9LPRA 3GY4A 3EDXB 2ZDMA 1NRQH 1BMLA 1TMBH 3RMOH 4YT6H 2J4IA 2HRVA 2FM2A 1E35B 1GI4A 4AN7A 1BBRE 4A1VA 3BSQA 1HDTH 3UY9A 1QQ4A 1P2MA 1DXWA 3ATLA 1WUNH 3SNCA 1W12U 1RTKA 5EQSA 3ZVBA 5C1YA 2IJOB 4M7GA 3F1SB 3GOVB 2EI7A 3SI4H 1C9PA 1K1LA 3ZZ6A 2G00A 1KDQA 1SMFE 1NU7B 1D4PB 4KP0A 3TJNA 1UHBA 5E2OA 4I31A 1VITG 2I6SA 4BAKB 1A0LA 5B6OA 1ARBA 4XE4A 1IQIA 1OP8A 2P94A 4MNWA 4WY3A 1HAXB 1EZUC 1GMDG 3M61U 4CRFA 1EPTB 1GDQA 1MKWK 1ZPCA 2J94A 3GCHB 1YCPM 4OS1A 1F0SA 2A4OA 4ZH8A 1ZYOA 2ZDLA 1O2QA 1O3MA 1C2EA 1P01A 3QLPH 3PLBA 3TJUA 4Y0YE 3E6PH 1UVSH 3VB3A 2R3UA 1HIAA 1LDTT 1ELFA 1GJBB 2VIOA 2VWLA 1JXPA 1J17T 1BHXB 3LU9B 2FMJA 2WV4A 1FY4A 3P95A 2BLQA 1H9HE 4BAHB 2JETB 3BEIB 2BD9A 3H7OA 3PB1E 4K1EA 1QY6A 1GGDB 3CS7A 1CBWC 2P16A 4H4FA 2QGRA 4IC5A 4ISOA 2A5KA 4U30A 4D9QA 2QF3A 3LONA 1QRXA 3CENA 1UCYH 2SNVA 3RU4T 2XNIA 4WXVA 5I46H 4YZUA 2PHBA 1LVYA 1S81A 3KNXA 4KTUA 1LHCH 3HK3B 2HNTE 3VPKA 4I8HA 1OWKA 1MQ6A 1TE0A 3EAJA 1KIGH 4NCYA 4NWKA 2AIPA 2VIPA 3UNRA 3SU0A 1O2IA 4Z6AH 1O2TA 1OKXA 1GJ4H 1YPGH 2STBE 2VWMA 3SV8A 5A8XA 5SGAE 1K21H 1UTNA 2DUCA 1FONA 2J38A 1P2IA 2NWNA 1BCUH 4UFGH 5F8ZA 2ZI2H 2BDAA 3S7HB 3RM2H 5EG4A 3ZYEA 2IN2A 2OC0A 4TY6A 2BD2A 2FI4E 4HFPB 4I8GA 3RXOA 1EB2A 2HNTC 1AVXA 3BTEE 4J2YB 3LPRA 3AVZA 3P92A 1LHEH 2O8MA 1TAWA 3LGIA 2Y6TA 8GCHF 1OWEA 6GCHG 1T4UH 3SJKA 1RXPA 2AS9A 4ABDA 1ANDA 1HLTH 3PYHA 1YPHE 3QTOH 1O2YA 2JH0D 2FZZA 3A8BA 4X1RU 1TLDA 7KMEH 4DW2U 1HAVB 2PKSC 2PWXA 3H7TA 1IQGA 1NM6A 2FI5E 1P3CA 2PSYA 4SGAE 1P9SA 1P11E 4I8JA 3QTVH 3GY3A 2FYQA 4Y7AA 5JB8S 2NU1E 5HMAA 4ISLA 1EOLA 1BMNH 1E0FD 2W5EA 1QL7A 3UIRA 2XCNA 5EW2H 3GICB 3VB4A 2XC5A 3S9AA 4AGJA 1YPHC 1SGPE 1FY1A 3MU0A 3E8LA 2ZA5A 3RP2A 1C1RA 1UO6A 1DFPA 4MDSA 1ETSH 1HB0B 3PWBA 2Y82A 3U9AH 3EE0B 4TPIZ 3TGJE 4JCNA 1KXAA 3UTUH 5C5OA 1H9IE 2WUCA 2Z94A 1ANEA 1GBBA 3FAOA 4X2VA 2BXTH 2HNTF 1WOFA 4PROA 1AVGH 1EPTA 1GL1A 1O3CA 5GCHF 3K6ZA 3ELAH 3V13A 1NFYA 1Y5AT 2D2DA 2ZZUH 1QTFA 1PPHE 1NRRH 5JDUB 2FXRA 1W7XH 4YTAA 1TOCB 5GXPA 5EQQA 1QHRB 2A2XH 3GDSA 1RD3B 5DKMA 1TBZH 1F5LA 1TPSA 1UJ1A 1QL8A 3AAVA 1OSSA 1GBIA 1VCPA 1TX7A 1K1JA 3NK8A 3ZVAA 2UWPA 4DVAU 4AFUA 3PO1B 5GWZA 2P95A 2Y5FA 2H9TH 4CBNA 2PKAB 1P0SH 4E05H 3NKKA 2ILNA 1SR5C 2Q6GA 4UONA 3MH5A 3T28A 1LO6A 3SGAE 2AIQA 3S69A 4FUDA 4IS5A 2GX4A 4X0WU 1IQHA 4ZMAH 4BANB 3BN9A 4YT7H 1UVOA 1Q3XA 1THPB 4ABGA 1T31A 2J92A 1GBFA 5F8TA 4GHQA 2WPMS 4DIIH 1VJ9U 3DFLA 1EJNA 1QCPA 2VNTA 1W7GH 2IOTA 5E0HA 1CGIE 3P6ZB 4NFFA 1C5ZB 7LPRA 1TGNA 4DCDA 2ANYA 4TPYA 1TGCA 1SFQB 4U32A 1O5GH 3CS0A 2C8YB 3ZVDA 1XUIA 1L4DA 3TU7H 1TA6A 2WPIS 3OU0A 1CHOG 5C1UA 3SHAH 1FDPA 2HALA 1C1WH 4GHTA 2P3UB 2CGAA 3E16B 2Q1JA 4NGAH 2TGPZ 1OWHA 1EATA 4ZXYH 3OY6U 1GJ9B 3RXMA 1G3CA 5EODA 1NRSH 3ZZCA 1B7XB 1TRMA 1BBRH 2C8WB 5LPEA 3Q77A 3ZZ9A 5JBBS 1JRSA 1RJXB 1ZMJA 1TMTH 4RN6A 2XC4A 4LZ4B 4X8VH 2JETC 1S82A 2OC1A 1IHSH 5DPAA 2VH0A 1N8OB 1OOKB 1PPZA 2D1JA 5EQRA 2YNAA 2BYAX 2ZU4A 1RFNA 2BXUH 1A3EH 1HAVA 3UFAA 4GVUA 1AY6H 2LPRA 4IW4E 3OY5U 1O3LA 3GY8A 4OGXA 4GCHG 2FTMA 3W94A 1GBKA 4ABAA 1GJ7B 3QGJA 1HJ8A 1PQ8A 1ZHMA 1LVBA 3U98H 1Y3WA 1MH0A 1SQAA 4K3JA 2IPHA 1XKBC 1G9IE 1GHBG 2B9LA 3GY5A 2ESTE 3ZVEA 3A81A 2KAIB 2P59A 4ZAEA 1C2IA 5A2MH 2XC0A 4D8NA 4TWYA 4Y0ZE 1K9OE 1O3NA 4ZHMU 3KCGH 4Y76A 3S9CA 1GJ6A 1OYQA 4VGCB 1T8OA 1H9LB 4AORA 3F6UH 1AMHA 1TPPA 1ZSJA 3MI4A 3GISB 4FUBA 3KN2A 3L6PA 2ZDKA 2FOAA 2VVUA 1O2MA 1O2PA 3D49H 4Y8XA 4FUIA 1O3DA 2FOBA 1HXFH 5T6FA 1GI5A 3SV6A 1UTOA 4KELA 5JBAS 1LHFH 3IG6B 3TGKE 3FZZA 1HCGA 1SGCA 1Y3VA 3RXHA 1D9IA 5H4IB 1DSUA 3SV2H 3VGCC 1GI6A 3QO6A 1HJAC 2ZHQH 2VH6A 1BTPA 1MTNC 2GCHG 1VJAU 2VWOA 5FX5A 3SJ9A 1BTWA 3ITIA 4A6LA 3AAUA 2ZC9H 2BLOA 1P2KA 1RIWB 1Z8GA 1XUJA 1QB1A 1SG8B 1AUJA 5E0JA 1P2QA 2ZHFH 1IQLA 1C5MD 3EGKH 1C1PA 2RA3A 1W11U 2FIRH 5EPYA 4Y6DA 2HPPH 2AMPA 4RKJB 2LNCA 1NESE 1QBNA 1V2WT 2VGCC 3M3VA 1V6DA 1HAGE 1ZJKA 3H5CB 5TJXA 4CREA 1DLKB 2GMTC 4MNYA 4B1TA 1HUTH 3UREA 2Z3EA 1MZAA 1KDQB 3A83A 3I78A 3MNSA 4GSOA 4I8LA 1UHBB 2V6NA 1V3XA 4ABHA 1GHZA 1EAIA 1MCTA 3M5MA 1ETRH 4A1TA 1EJMA 2VJ1A 1QL9A 1W0YH 2ZGXH 1CA8B 3NXPA 2WYGA 1NFUA 5A0AE 3BTKE 5FPYA 1SGDE 3ZZBA 5IYTA 3SGBE 1C2MA 4YOGA 4Y11E 1CGHA 1TQ7B 1RS0A 4Y7BA 1HIAB 2ZDAH 1EKBB 3FP7E 6CHAC 1H8IH 1ZLRA 2BQWB 1XX9A 1MKXH 4UE7H 3B8JA 2F9NA 1C5XB 1LCYA 3BG4C 2BD4A 3SU3A 4YOJA 1F0UA 3TNTA 4R0IA 3RXRA 1G37A 2O8UA 3HKJB 2V3HH 3M35A 4X6NA 4Y8ZA 5EOKA 3PLKA 5F03A 1VCWA 2PTCE 4DY7B 4AX9H 2ZTYA 5EPNA 1AUTC 2BZ6H 3Q3KA 2NU2E 1G36A 1GG6C 2FYRA 4INLA 2ALPA 1L0ZA 2QXIA 2UWLA 1QGFA 1Z1JA 1A5GH 3SJOA 2XCFA 2GTBA 2ODYB 4BOHA 2BZAA 3A7ZA 1WQSA 1YLCA 1FJSA 1EZQA 4INKA 3T27A 1TNJA 4MVNA 1SGRE 2XXLA 3SI3H 1T32A 5DGJA 3RXQA 1GMHG 3SJIA 1V2MT 1VR1H 2Z3CA 2VIWA 4CHAC 4B2AA 1BB0B 5C67A 1MTWA 2TPIZ 3L3TA 3WY8A 1V2KT 4ABEA 1V2OT 3LGTA 2JKHA 3A89A 1IAUA 1SGFG 2SNWA 1KSNA 1KXCA 4LXBH 1C2FA 2H9EH 3T2NA 3D62A 3M3SA 1TYNA 3BG8A 1SGFA 3SN8A 1AN1E 3RLWH 4UFEH 1FI8A 4AYYB 3TK5A 3V12A 4NIVA 2VIDA 1TNHA 2K1QA 4D76A 5F6MA 1XXDA 1OX1A 4BAMB 1HPGA 1OS8A 1O2LA 1C1VH 1THRH 1MUEB 2GKVE 1F5RA 1MCVA 1TABE 4ABFA 1SLXB 1HXEH 1FNIA 1DWCH 2ASUB 2ZHWH 1N6YA 1C5TA 4FVBA 1LMWB 5CHAC 5T6DA 2JH6D 1O35A 1O3PB 1DS2E 3TH3H 2W7SA 2UUJB 4B74A 1FZZA 3ZV9A 5C3NA 1YCPK 2G4TA 2A7HA 1S6FA 1K1PA 4HZHA 1HAYB 1EAUA 2GVFA 3PMAB 1S6HA 2FDAA 1YPMH 3BTDE 3RXLA 3PM3A 3UOPA 1THSH 3TNSA 1A0HB 1GBDA 2GGVB 1DX5M 1W13U 4IMQA 4XBBA 4IN1A 4ISNA 2C90B 2BLVA 5DJ7A 2OP9A 4E06H 4K1SA 4AB9A 5LH8A 2FP7B 3S9BA 3A8DA 1P2JA 2FI3E 1IQFA 1GHXH 3ZV8A 4Y79A 1XUHA 2BVXH 3ZVFA 3R3GB 1HAHH 3K9XB 4ZXXH 3SW2B 1DLEA 4IGDA 3EQ0H 1GCTB 3DT0H 2XBVA 3K6YA 1L1NA 4Q2KA 2OC8A 2TGAA 1V2UT 1OYTH 3ESTA 4NA7A 3UWJH 1MMJN 3ZYDA 3RLYH 1ZTKA 3FP8E 4GLYA 4BTTB 4Y10E 1T8MA 2C8XB 5FHTA 3VB5A 2P8OC 1LHGH 2AERH 4WMFA 4F4OC 3TPIZ 2F9VA 3GDVA 1DICA 5DK1A 2VVVA 3QUMP 1EOJA 3SU5A 1EASA 1YBWA 1TGTA 4JYUH 1YC0A 3LC5A 3ZZ4A 1UVUH 2ZFSA 1WSSH 1GPZA 2FOHA 1AFQB 4XBDA 1CA0B 4ABJA 3QWCH 4KTCA 4MPUA 5DP8A 3RU4E 1Y3YA 2NU0E 4H42U 4LK4A 2GDDA 1SGIB 1TRNA 3LH3A 1O2WA 2W26A 3LIWA 1TX8A 1O32A 1CU1A 4CRBA 1EAXA 1AE8H 1ZHRA 4AYVB 5K0HA 2ZCKP 1MKWH 3UNQA 3VB7A 1YPKH 1C5PA 1CSOE 3HPTB 4ZUHA 5JB9S 1AB9C 2RDLA 1RRKA 2WUBA 1DY8A 1ZSLA 4NA8A 1O3EA 3C1KA 4AFQA 1Y5UT 1PJPA 2ZCLP 1O31A 2AGEX 4WMEA 4BNRA 1Z1IA 1UTLM 2QF0A 4ZROA 3GCTG 1HAIH 1UK2A 3LGYA 4U01A 3SUDA 3DHKH 8KME2 3MMGA 2HPQH 3EYDA 4ISHH 2A0QB 2B0FA 3VFEA 1WTHD 3IWMA 3SU2A 2BTCE 2FEQH 4D7GA 1O2HA 2FODA 3ZZ5A 1GBAA 1SOZA 1C5LH 1ELGA 4CBOA 2F3CE 1SGTA 3A80A 4FUFA 1K2I1 1V2VT 4INHA 2GCTB 3Q3XA 3BEUA 1MTUA 1ELCA 4X2YA 4OS5A 2RCEA 2A5IA 2BDYA 1C1TA 1VGCC 1V2QT 4FXGH 3MNBA 1FUJA 1P05A 4A1XA 1IQJA 3P8OA 1GBHA 3BIUH 1A7SA 2AFQB 3SV9A 3M7UA 1VITF 1TPOA 4DJZB 4NSYA 2TGDA 3FP6E 1O2OA 3LGWA 1KTSB 4K1TA 2D26C 1NT1A 3LGUA 1PFXC 1JIMA 2ZNKH 3PMHB 3BTFE 3A7WA 3RXJA 1C5VA 5AFYH 1AFEH 1S85A 1YYY1 1ELAA 2H5CA 1TBRH 3LH1A 1KXEA 1GI2A 1TPAE 2G52A 1EUFA 1F0RA 1FY5A 2ZPRA 2J95A 6LPRA 1FN6A 5L6NH 2HLCA 3SNDA 2BDGA 3UR9A 4Q7XA 1V2RT 3URCA 3LT3A 5L2YH 1P57B 2CMYA 5T3HA 1MD8A 2Z7FE 5DP3A 2Z9LA 3Q3YA 3RMMH 1P9UA 1ZZZA 2OTVA 1Y59T 1GVZA 1UVPA 1OWIA 1CT4E 1O5BB 3A7TA 1K28D 1TGSZ 4BTIB 1O2UA 2QXHA 1GVKB 1Y3XA 4YM9A 1GHAF 3PTBA 2BM2A 2OQ5A 2I6QA 3TITA 1O39A 2R3YA 1AGJA 2SGPE 1NU9A 1DWEH 2BVRH 1H4WA 2BDIA 1LVOA 1O2VA 1O5CB 2PW8H 3KQCA 2UWOA 4BAOB 1GI7B 2ZU2A 3U8RH 4IC6A 2G5NA 3RXUA 3RDZA 1CE5A 2A45B 4JZFH 1X7AC 1A0JA 4X1PU 4B2BA 1LKAA 4X6OA 1O5FH 1EPTC 1DANH 3MNCA 1DPOA 3GCHC 4FVDA 2GD4B 2XBXA 1HNEE 1EQ9A 2CHAB 1DUEA 3KF2A 4Q7ZA 2G81E 3M7TA 2F9BH 3QZRA 3STIA 1O3JA 4LOYH 3GY2A 2PLXA 4DG4A 1ARCA 3UQOA 4CRGA 1C2DA 3ZZ3A 2CF9H 4UFDH 2DE9A 2A7JA 2Z6BD 1KXBA 3I29A 1ZHPA 3NWUA 4K8YA 4XBCA 3GY6A 3MWIU 3QK1A 5HXFA 1BITA 3IITA 3BTQE 3L33A 1GGDC 1XUGA 3VB6A 1D6WA 2ZFPH 1GCDA 1TONA 1JBUH 2Y5HA 3I77A 4MNVA 3LGVA 4FUJA 5GIBA 5T6GA 1G30B 3LDXH 1A5IA 4DT7B 1PPFE 1SGNE 2THFB 1GJAB 1IQMA 2C8ZB 1HAZB 1S84A 2SGFE 1BDAA 1GHVH 3LC3A 2FLBH 1T7CA 1IQEA 1UTMA 3P17H 1PQAA 2YOLA 1FV9A 3ODDA 3TLOA 1PPCE 5L30H 1QR3E 3RXTA 1FQ3A 3EA7A 1K22H 3U8TH 1SHYA 2Z9JA 3MU1A 5EXMA 1BTUA 3M37A 1EP5A 5FBEA 2Q6FA 1O3AA 2FOGA 3KIDU 1C1QA 1UK3A 1C4U2 1PYTD 2EA3A 1F92A 1H8DH 2FOMB 2UUKB 3MU5A 1XMNB 2QN5T 2UUFB 1UTQA 4ASHA 1A2CH 2FTLE 2A4GA 3F9GA 3P70B 4O3UA 1IQNA 3DD2H 1V2PT 1AVWA 2BD3A 1B5GH 2D8WA 1XM1A 1NTPA 3OTJE 1VITH 4NFEA 1ESAA 4ABBA 1FLEE 1Y5BT 1YGCH 1CT2E 3RXBA 3MU4A 1TNKA 1MZDA 2XRCA 1DWBH 2ULLA 2QYIA 5CMXH 2BD8A 1V2NT 3LKWA 3BTME 1O5DH 1QFKH 3RXIA 1O3BA 2PUXB 2PGBB 1BMAA 4OS7A 2FOFA 3QX5H 2XWBI 4A92A 1C1MA 1C2KA 2F9PA 2CJIA 2BQ6B 1BJUA 1L1JA 1BUIA 2P93A 3TK9A 2BB4A 4NIYA 3SUGA 5A09A 1ANBA 3E91A 1DSTA 1CHGA 3OYPA 2WPHS 2BY9X 1GMCG 4ZKNU 1J9CH 1MKXK 2P3TB 3S7KB 4WH8A 4BAQB 3EA9A 4B73A 3NZIA 3E1XB 4YLQH 5JYIA 2H2ZA 1O5AB 2OXSA 4K60A 1W14U 3RXGA 4WJG2 1CBWB 2EI8A 6ESTA 3A7VA 2RG3A 2PTNA 1AKSA 1ANCA 4MLFB 1DY9A 1C4Y2 1C5WB 1WCZA 2HOBA 1MTSA 2C4FH 2SGEE 4X8SH 3U8OH 1LPZB 4X2XA 1ZGVA 1MAXA 2AYWA 2Z9GA 1B0FA 2A31A 3RC5A 1NO9H 1C5SA 1RTLA 1ZRKA 3TJVA 3A84A 3RMNH 5AF9H 2FOEA 2AMDA 3B23B 2ZU1A 2ALVA 1HAOH 3RXSA 1C1UH 4NA9H 5I25A 2TIOA 2ZG0H 3O8BA 1KLIH 3ZZ8A 1FIZA 7ESTE 1ZPBA 4K2YA 2AGIX 2TBSA 2FOCA 3MNXA 1FXYA 3SO3A 3ODFA 3MH6A 1S0RA 2GV7A 1GL0E 2B7DH 3G01A 3BTTE 3PO1C 3RC4A 1AQ7A 4ABIA 1U6QA 2ZPSA 3C27B 4AG1A 4CR5A 2EC9H 3RXAA 1A5HA 4MQAA 5ESTE 3A8AA 1NFWA 3RMLH 4UD9H 4GCHF 3TIUA 1E38B 3U69H 3V3MA 2NU3E 3U1IB 1LPKB 5LGOA 3SGQE 2A4QA 1TB6H 1C2JA 2ZFTA 2WPJS 5FCRA 3SU1A 1WYKA 4A5TS 2ANKH 2G4UA 4OS4A 5BRRE 1A4WH 1C1OA 1S5SA 2F91A 2ANMH 1A46H 1QIXB 4AFZA 1Z8RA 3M5NA 5FCKA 4Q80A 1XVOA 1NRNH 1TNGA 1ELVA 1DDJA 2FLRH 3T25A 3SU6A 2H5DA 4NZQA 3O8CA 1XVMA 1K1NA 1YM0A 1JIRA 3B9FH 4K69A 1CQQA 4HTCH 3ATWA 1F7ZA 2G8TA 4I8KA 2SGQE 4UDWH 1ORFA 4AG2A 1SHHB 1OWJA 1MBQA 1XUFA 1KY9A 1PYTC 2PR3A 1W8BH 1HFDA 3AW1A 1SFIA 1OWDA 1G32B 4WH6A 1QB6A 2ODQA 2OBOA 1C2HA 1K1OA 1O0DH 1WBGB 1T8LA 1A3BH 1O3HA 2HGTH 5GDSH 1N8OC 3TVJB 1ETTH 1O2ZA 3RXEA 1C5QA 1CO7E 2V0BA 2ZECA 1AWFH 1QQUA 2BD5A 2J2UA 4WF8A 4XDEA 1GDNA 2ODPA 1LQDB 5AHGH 1FAKH 1MBMA 2ZGJA 2BY6X 4I33A 1EXFA 1P09A 3E3TA 2GP9B 2AEIH 8GCHG 1IHTH 3AW0A 3ATIA 5E0GA 1J16A 1C5YB 1DITH 3SORA 2A5AA 1O2XA 4GUXA 5FBIA 2WINI 1EX3A 1KXDA 3K65B 2AH4X 4E7NA 2Y81A 4WMDA 5TCAA 3SNEA 1GBCA 5DP9A 3D23A 3PMJA 3VXFH 2VU8E 3JZ1B 2BY5X 4B2CA 3UOUA 3T62A 2WYJA 4D9RA 1AD8H 7GCHF 4UEHH 1MAYA 1TMUH 1PPGE 1YP9A 3A8CA 4VGCC 4X1SU 4MPVA 1SOTA 1W2KH 1SQOA 3KQBA 3ATKA 1SLWB 1UCYK 2A32A 1KXFA 1AHTH 1ZSKA 1NRPH 1GBJA 1W0ZU 1NFXA 4ZKOU 5EXNA 2NU4E 3M7QA 1HV7A 1W10U 3OX7U 4MPWA 1GVLA 1KTTB 1BTYA 4ZKRU 1DUAA 4JYVH 1C5OH 1QURH 3M5OA 3NCLA 5FX6A 1HRTH 4H6TA 1J15A 5G4BA 3TJOA 5FPTA 4YO9A 3HATH 1NROH 3RXPA 2FS9A 3QZQA 4JZ1A 4BTUB 5CE1A 1ZTJA 4QT8C 2ZGHA 2VIVA 4XSKU 3RXVA 3GYMA 4OGYA 1TFXA 1CT0E 2A7CA 3DA9B 4O3TA 1YLDA 4SGBE 2Z9IA 5GCHG 1RIWC 1SSXA 1GBTA 1T8NA 1PPBH 2OD3B 1BRUP 1P3EA 5C2ZA 2V3OH 1XUKA 1YCPH 2G51A 2Q6DA 1P2NA 1EZSC 4BXWA 4J1YA 1AI8H 1JOUB 2VWNA 1UTJA 2Y7XA 1O2GH 4FU9A 5C20A 1HYLA 1L4ZA 3GDUA 5HYOA 1EP6A 1KYNA 5AFZH 1N1LA 4JZIA 5JBTA 5J4SA 1GMHF 2O9QA 3A85A 3Q76A 1VZQH 2QCYA 1O3GA 5HGGA 5A0BA 1GHYH 3NUMA 3F9HA 3UQVA 3V0XA 1G2LA 1GHAG 2H6MA 4GPGA 3TH2H 2BX4A 3KQDA 4IN2A 1ZTLA 1C9TA 1WTGH 2AMQA 3BTGE 2HWLB 1D3QB 1C2LA 5DP6A 1CGJE 5C5NA 1CVWH 2R0LA 1L2EA 1KLJH 4U2WA 2CF8H 1ACBE 2OCVB 1J8AA 1S0QA 1FN8A 1BMMH 1TNLA 1SLUB 1AU8A 2ZTZA 2ZFRH 5DP5A 1LPGB 1AZZA 1SL3A 1WV7H 4HI3A 1O34A 2SFAA 2B8OH 4NG9H 4H6SB 1EZXC 2ZFFH 1QNJA 2YNBA 3RXKA 1NPMA 3BEFB 3KQEA 2WPLS 1MQ5A 1C1NA 1BT7A 3PLPA 1TOMH 4AFSA 4CH8B 5C1XA 1SI5H 1FIWA 1O37A 1ESTA 2ZGCA 4CRCA 4F49A 3VGCB 2W3KA 1QA0A 4O03A 1HJAB 3LJOA 2VVCA 1MTNB 2QA9E 3KEEA 3Q00A 4NIWA 3GY7A 2XTTB 1O2RA 1BJVA 1LQEA 2DE8A 5LPRA 1HJ9A 3R0FA 1FPCH 3AASA 1DWDH 2R0KA 3MOCA 5A8YA 1PQ7A 1BZXE 1D3PB 3BF6H 2BLWA 1HAPH 3UPEA 2P3FH 2TGTA 1GMDF 1AZ8A 2ZP0H 1O5EH 4FUEA 4NZLA 3EA8A 2VGCB 5DP4A 3O8RA 4B75A 3F9EA 2FESH 2FS8A 3N7OA 3RUOA 4I32A 1BQYA 1YPEH 1XKAC 1IQKA 2GMTB 4GAWA 1AIXH 3T29A 2H1UA 2C3SA 1GBEA 1O2JA 1NC6A 1SPJA 1ZMNA 1QRWA 1SC8U 2F83A 5EW1H 1VCQA 2ZO3H 2QV1A 1N6XA 1TWXB 1ZMLA 4IBLH 2PSXA 3P8GA 2FX4A 2J34A 3UUZA 1V2LT 1Z6JH 2XBWA 1O2SA 4MG3A 2OC7A 1AO5A 4UFFH 1NN6A 1UVTH 4X6PA 3SQHE 4AOQA 1DXPA 2QY0B 1G3EA 1O3IA 4CRDA 4E7RG 4JZEH 1DOJA 1JRTA 3UWIA 1P03A 3E90B 3S0NA 3F9FA 4AZ2B 6CHAB 3ATMA 3A86A 4O9VA 1BBRK 3MU8A 9ESTA 2XW9A 3BG4B 3E0PB 1G3BA 1TA2A 2ZWLH 5GPIB 3A82A 1GJDB 3RXDA 2H9HA 3SUFA 1GJCB 1Z8JB 1LHDH 2ZQ1A 1SVPA 1AKSB 2FX6A 1TX6A 4JYTA 3ZZDA 1ZPZA 1ELBA 3M5LA 2VIQA 1GG6B 1Z71A 3SV7A 4AGKA 1WU1A 1C5NH 3ZVCA 2STAE 2VB0A 2CN0H 5GJ4B 1BRCE 5JBCS 3MTYA 2ZEBA 1INCA 4JMYA
chains in the Genus database with same CATH superfamily
1ELEE 2O8LA 3RXCA 2J9NA 2KCOA 1TGBA 2SGAA 4BXSA 1GCTC 2BD7A 2KCYA 1V2ST 3TGIE 1TALA 1D3TB 3GCTF 4NIXA 1P8VC 4CHAB 6GCHF 1OHHD 2WPDD 1GDUA 5KECA 1YLNA 1Q2WA 1SBWA 1EJAA 2WSSD 2Y7ZA 1L1GA 5DG6A 2OUAA 2WZQA 4I86A 3A88A 3RC6A 1RGQA 3SHCH 2Z9KA 3LJJA 3K2UA 4MNXA 2OBQA 1ELTA 1BMFD 4WVPE 5E2PA 2OQUA 2ZGBH 2GZ9A 1O30A 1Z7KA 1O2NA 5JPMH 5K7RA 1K0HA 1TBQH 4JK6A 3NPSA 5E8EH 1AFQC 1CA0C 2WPKS 4X1NU 1OPHB 4X2WA 3URDA 3VXEH 3SNBA 3OE7D 1ZRBA 3JZ2B 1GI1A 3MH4A 1YPLH 3TK6A 2L74A 3UR6A 1ZGIA 3GYLB 1O33A 4THNH 3KL6A 2GZ7A 5DO4H 5EXLA 1BOQA 4X8TH 2OLGA 3PMBB 5CHAB 2Y80A 2PUQH 1EAWA 3SBKA 1B0EA 1C1SA 3ZIAD 2BDHA 1LKBA 4Y8YA 1MTVA 1FY3A 4KGAA 5HKKD 5FPSA 1LVMA 3HGNA 1YPJH 1GHWH 3SZEA 1TRYA 4FU8A 4FUHA 4FUCA 1MU8B 2GT7A 1TQ0B 4Y71A 5LPFA 2EEKA 1QBOA 1SQTA 1Z8IB 3BTWE 3U1JB 1JMOH 1F5KU 1Q31A 2BOKA 1GI0A 2BX3A 3KHVA 1BHXF 4AC9A 1BRAA 2WHXA 5TCCA 2ZFQH 4O97A 3PTNA 5J4QA 3PROA 3M3TA 4DGJA 1O3KA 4RKOB 4MPXA 1QJ1B 1UCYE 2CV3A 2QIQA 2A4RA 1YY3A 5HM9A 2WV5A 4FU7A 2A2QH 8ESTE 3SUEA 1M9UA 4OM9A 2ZPQA 3FZDA 3OSYA 1A61H 3V7TA 2IPQX 3SU4A 4IMZA 3T26A 1F0TA 1E36B 2JH5D 1BA8B 3FANA 4XFQA 1P10A 2RA0A 2GCTC 3D65E 2BMGB 2W7UA 1EB1H 1UMAH 2EI6A 2A1DB 1Y3UA 2ZU3A 1NZQH 4LZ1H 4ESTE 2BDBA 1OP0A 3M36A 5HM2A 1C2GA 3TH4H 3MYWA 1WQVH 2GV6A 2PV9B 2G55A 4CRAA 1SLVB 1KLTA 3DUXH 3T5FH 2Z3DA 2KCPA 1GBMA 2P8OB 4OS2A 5FAHA 1QZ8A 3ZVGA 1SGEE 1BTZA 4K8BA 1YF4A 5FXLA 4KKDA 2PKAA 4ZHLU 1QRZA 1BIOA 5AVDA 1SGQE 3RM0H 1ZOMA 2VINA 3MO6A 3W95A 1G3DA 2BY8X 3QGNB 1Z6EA 2ZDNA 5ESBA 4B71A 1O36A 2ZKSA 1DVAH 2O8WA 5BPEA 4JZDH 1CHOF 1OP2A 2FO9A 3SZNA 4X1QU 2FWWA 5EU8A 2ZTXA 1RTFB 3O8DA 3QN7A 1UTPA 4DIHH 3P8NA 3FVFB 5EGMA 2B5TB 2BY7X 1C5UA 2QXJA 1K1IA 2R9PA 1HBTH 4D7FA 2TRMA 4DOQA 3ENSB 3FFGA 1BTXA 1H1BA 1BRBE 4A7IB 1F2SE 7GCHG 1PQ5A 1ZJDA 1UTKA 1FPHH 1K1MA 1O38A 4I7YH 1D3DB 1JWTA 1SGYE 1NY22 3MO9A 2ZCHP 2JJ2D 2OINA 2QC2A 2M5TA 1MU6B 1AB9B 4RSPA 1QJ6B 2ZHDA 4Z0KA 2XWAA 3MFJA 5C94A 4KTSA 4FETA 5A8ZA 2BHGA 4MTBA 2F9OA 4B76A 5EJLA 1G2MA 1AWHB 3F0OA 3F68H 1C4V2 4TY7A 1FY8E 1O3FA 3STJA 1E79D 4YLUA 3BTHE 2G5VA 2ZIQH 4NWLA 1TNIA 3SNAA 2V35A 2W3IA 1W3CA 2CXVA 2Y5GA 4NSVA 4JK5A 4Q7YA 2BQ7B 4DURA 2PGQB 4CH2B 1FAXA 1GI8B 4YESB 2O8TA 2ZF0H 2QAAA 2V7QD 1GHBF 3LOXA 4ASUD 1LTOA 4X8UH 5F8XA 2R2WU 1SB1H 3SJ8A 2BOHB 2PKSB 1ABJH 1P2OA 2AGGX 2GT8A 4XOJA 1O2KA 1P04A 3E0NB 3MHWU 3ZZ7A 1QA7A 3BV9B 1HGTH 5DP7A 1O3OA 3MH7A 4AB8A 1TIOA 3PV4A 4ISIH 3KGPA 1XXFA 4TYDA 4K5ZA 1NS3A 3DFJA 4CR9A 5A0CA 3FOAA 2QXGA 5PTPA 3RXFA 2ANWA 1GJ5H 4TWWA 2CHAC 1Y8TA 1VGCB 2BDCA 1FMGA 4R8TB 5ABWA 5ETXA 1GBLA 4YOIA 3A87A 2GDEH 1IOEA 3CP7A 3SQEE 1AE5A 1GI9B 1DE7H 3QDZB 3GCNA 2KAIA 1V2JT 1E34B 3MO3A 2ZDVH 4OS6A 1QBVH 3RU4D 2BVSH 1ABIH 1C5RA 4WWYA 1GWAA 4ZKSU 1ZR0A 2F9UA 1OXGA 1YKTA 4WXIA 1WAYB 3A7XA 1ELDE 4HGCA 2GCHF 2XBYA 2ZU5A 2W6ID 1BTHH 3SOSA 2FPZA 2SGDE 1A1RA 1DT2A 2EQNA 3A7YA 3HGPA 1T4VH 2XYAA 1UK4A 1ESBA 4FUGA 2HVXA 1P02A 3HKIB 1P06A 3GCOA 1D6RA 4X6MA 1P12E 3BIVH 2ZQ2A 3UNSA 1MD7A 1QJ7B 1PPEE 1GMCF 5L2ZH 2GZ8A 3PWCA 1S83A 3P8FA 2UUYA 4ZHAA 3HK6B 3VEQB 8LPRA 2C93B 3ZZAA 5GNDA 1ID5H 5IDKA 2ZHEH 1E37B 2PFEA 2R2MB 1J14A 1QB9A 1GJ8B 1GI3A 1V2TT 1DM4B 9LPRA 3GY4A 3EDXB 2ZDMA 1NRQH 1BMLA 1TMBH 3RMOH 3UAIC 1E1QD 4YT6H 2J4IA 3N7DA 2HRVA 2FM2A 1E35B 3OFND 1GI4A 4AN7A 1BBRE 4A1VA 3SYJA 3BSQA 1HDTH 3UY9A 1QQ4A 1P2MA 1DXWA 3ATLA 1WUNH 3SNCA 2KFWA 1W12U 1RTKA 5EQSA 3ZVBA 4TSFD 5C1YA 2IJOB 4M7GA 3F1SB 3GOVB 2EI7A 3SI4H 1C9PA 1K1LA 3ZZ6A 2G00A 1KDQA 1SMFE 1NU7B 1D4PB 4KP0A 3TJNA 1UHBA 5E2OA 4I31A 2I6SA 1VITG 4BAKB 1A0LA 5B6OA 1ARBA 4XE4A 1IQIA 1OP8A 2P94A 4MNWA 4WY3A 1HAXB 1EZUC 1GMDG 3M61U 4CRFA 1EPTB 1GDQA 1MKWK 1ZPCA 2J94A 3GCHB 1YCPM 4OS1A 2CK3D 1F0SA 2A4OA 2LP6A 4ZH8A 1ZYOA 2ZDLA 1O2QA 1O3MA 1C2EA 1P01A 2JDID 3QLPH 3PLBA 3TJUA 4Y0YE 3E6PH 1UVSH 3VB3A 2R3UA 1HIAA 1LDTT 1ELFA 4P00A 1GJBB 2YMSB 2VIOA 2VWLA 1JXPA 2JIZD 1J17T 1BHXB 3LU9B 3U28C 2FMJA 2WV4A 1FY4A 3P95A 2BLQA 1H9HE 3VG8A 4BAHB 2JETB 3BEIB 2BD9A 3H7OA 3PB1E 4K1EA 4DT4A 1QY6A 1GGDB 3NRLA 5HIYA 3CS7A 1CBWC 2P16A 4H4FA 2QGRA 4IC5A 4ISOA 2A5KA 4U30A 4D9QA 2QF3A 3LONA 1QRXA 3WW7A 3CENA 1UCYH 2SNVA 3RU4T 2XNIA 4WXVA 5I46H 4YZUA 2PHBA 1LVYA 1S81A 3KNXA 4KTUA 1LHCH 3HK3B 2HNTE 3VPKA 4I8HA 1S6LA 1OWKA 1MQ6A 1TE0A 3EAJA 1KIGH 4NCYA 4NWKA 2AIPA 2VIPA 3UNRA 2WV9A 3SU0A 1O2IA 4Z6AH 1O2TA 1OKXA 1GJ4H 1YPGH 2STBE 2VWMA 3SV8A 5A8XA 5SGAE 1K21H 1UTNA 2DUCA 1FONA 2YMSD 2J38A 1P2IA 4XD7D 2NWNA 1BCUH 4UFGH 5F8ZA 2ZI2H 2BDAA 3S7HB 3RM2H 5EG4A 3ZYEA 2IN2A 2OC0A 4TY6A 2BD2A 2FI4E 4HFPB 4I8GA 3RXOA 1EB2A 2HNTC 1AVXA 4F48B 3BTEE 4J2YB 3LPRA 3AVZA 3P92A 1LHEH 2O8MA 1TAWA 3LGIA 2Y6TA 8GCHF 1OWEA 6GCHG 1T4UH 3SJKA 1RXPA 2AS9A 4ACBA 4ABDA 1ANDA 1HLTH 3PYHA 1YPHE 3QTOH 1O2YA 2JH0D 1H8ED 2FZZA 3A8BA 4X1RU 1TLDA 7KMEH 4DW2U 1HAVB 2PKSC 2PWXA 3H7TA 1IQGA 1NM6A 2FI5E 1P3CA 2PSYA 4SGAE 1P9SA 1P11E 4I8JA 3QTVH 5CHBA 3GY3A 2FYQA 4Y7AA 5JB8S 2NU1E 5HMAA 4ISLA 1EOLA 1BMNH 1E0FD 2W5EA 1QL7A 3UIRA 2XCNA 5EW2H 3GICB 3VB4A 2XC5A 3S9AA 4AGJA 1YPHC 1SGPE 1FY1A 3PRBA 3MU0A 3E8LA 2ZA5A 3RP2A 1C1RA 1UO6A 1DFPA 4MDSA 1ETSH 1HB0B 2W6JD 3PWBA 2Y82A 3U9AH 3EE0B 4TPIZ 1NBME 3TGJE 4JCNA 1KXAA 3UTUH 2K8IA 5C5OA 1H9IE 2WUCA 2Z94A 1ANEA 1GBBA 3FAOA 4X2VA 2BXTH 2HNTF 1WOFA 4PROA 1AVGH 1EPTA 1GL1A 1O3CA 5GCHF 3K6ZA 3ELAH 3V13A 1NFYA 1Y5AT 2D2DA 2ZZUH 1QTFA 1PPHE 1NRRH 2J98B 5JDUB 2FXRA 1W7XH 4YTAA 1TOCB 4P02A 5GXPA 5EQQA 1QHRB 2A2XH 3GDSA 1RD3B 5DKMA 1TBZH 1F5LA 1TPSA 2J5UA 1UJ1A 1QL8A 1EFRD 3AAVA 1OSSA 1GBIA 1VCPA 1TX7A 1K1JA 3NK8A 3ZVAA 2UWPA 4DVAU 4AFUA 3PO1B 5GWZA 2VBCA 5CDFE 2P95A 2Y5FA 2H9TH 2L6OA 4CBNA 2PKAB 1P0SH 4E05H 3NKKA 5HIZA 2ILNA 1SR5C 2Q6GA 4UONA 3MH5A 3T28A 1LO6A 3SGAE 2AIQA 3S69A 4FUDA 4IS5A 2GX4A 4X0WU 1IQHA 4ZMAH 4BANB 4RI0A 3BN9A 4YT7H 1UVOA 1Q3XA 1THPB 4ABGA 1T31A 2J92A 1GBFA 5F8TA 4GHQA 2WPMS 4DIIH 1VJ9U 3DFLA 1EJNA 2KM0A 1QCPA 2VNTA 1W7GH 2IOTA 5E0HA 1CGIE 3P6ZB 4NFFA 1C5ZB 7LPRA 1TGNA 4DCDA 2ANYA 4TPYA 1TGCA 1SFQB 4U32A 1O5GH 3CS0A 2C8YB 2AHME 3OTPA 3ZVDA 1XUIA 1L4DA 3TU7H 1TA6A 2WPIS 2KZ4A 3OU0A 3PRDA 1CHOG 5C1UA 3SHAH 1FDPA 2HALA 3DSGA 1C1WH 4GHTA 2P3UB 2CGAA 3E16B 2Q1JA 4NGAH 2J97A 2TGPZ 1OWHA 1EATA 4ZXYH 3OY6U 1GJ9B 3RXMA 1G3CA 5EODA 1NRSH 3ZZCA 1B7XB 1TRMA 1BBRH 2C8WB 5LPEA 3Q77A 3ZZ9A 5JBBS 1JRSA 1RJXB 1ZMJA 1TMTH 4RN6A 2XC4A 4LZ4B 1E1RD 2JETC 4X8VH 1S82A 2OC1A 1IHSH 5DPAA 2VH0A 1N8OB 1OOKB 1PPZA 2D1JA 5EQRA 2YNAA 2BYAX 2ZU4A 1RFNA 2BXUH 1A3EH 1HAVA 3UFAA 4GVUA 1AY6H 2LPRA 4IW4E 3OY5U 1O3LA 3GY8A 4OGXA 4GCHG 2FTMA 3W94A 1GBKA 4ABAA 1GJ7B 3QGJA 1HJ8A 2RDEA 1YWUA 2HLDD 1PQ8A 1ZHMA 1LVBA 3U98H 1Y3WA 1MH0A 1SQAA 3F2GA 4K3JA 2IPHA 1XKBC 1G9IE 1GHBG 2B9LA 3GY5A 2ESTE 3ZVEA 3A81A 2KAIB 2P59A 4ZAEA 1C2IA 2RFKC 5A2MH 2XC0A 4D8NA 4Z1MD 4TWYA 5FL7D 4Y0ZE 1K9OE 1O3NA 4ZHMU 3KCGH 4Y76A 3S9CA 1GJ6A 1OYQA 4VGCB 1T8OA 1H9LB 4AORA 3F6UH 1AMHA 1TPPA 1ZSJA 3KYGA 3MI4A 3GISB 4FUBA 3KN2A 3L6PA 2ZDKA 2FOAA 2VVUA 1O2MA 1O2PA 3D49H 4Y8XA 4FUIA 1O3DA 2FOBA 1HXFH 5T6FA 1GI5A 3SV6A 1UTOA 4KELA 5JBAS 1LHFH 3IG6B 3TGKE 2J98A 3FZZA 1HCGA 1SGCA 1Y3VA 3RXHA 1D9IA 5H4IB 1DSUA 3SV2H 3VGCC 1GI6A 3QO6A 1HJAC 2ZHQH 2VH6A 1BTPA 1MTNC 2GCHG 1VJAU 2VWOA 5FX5A 3SJ9A 1BTWA 3ITIA 4A6LA 2QE7D 3AAUA 2ZC9H 2BLOA 1P2KA 1RIWB 1Z8GA 1XUJA 1QB1A 1SG8B 1AUJA 5E0JA 1P2QA 2ZHFH 1IQLA 1C5MD 1H8HD 1C1PA 2RA3A 3EGKH 1W11U 2FIRH 5EPYA 4Y6DA 2HPPH 2AMPA 4RKJB 2LNCA 1NESE 1QBNA 1V2WT 2VGCC 3M3VA 1V6DA 1HAGE 1ZJKA 3H5CB 5TJXA 4CREA 1DLKB 2GMTC 4MNYA 4B1TA 1HUTH 3UREA 4B6FA 2Z3EA 1MZAA 1KDQB 3A83A 3I78A 3MNSA 4GSOA 4I8LA 1UHBB 2V6NA 1V3XA 4ABHA 1GHZA 1EAIA 1MCTA 3M5MA 1ETRH 4A1TA 1EJMA 2VJ1A 1QL9A 1W0YH 2ZGXH 1CA8B 3NXPA 2WYGA 1NFUA 5A0AE 3BTKE 5FPYA 1SGDE 3FO8D 3ZZBA 5IYTA 3SGBE 1C2MA 2K0QA 4YOGA 4Y11E 1CGHA 1TQ7B 1RS0A 2KR7A 4Y7BA 1HIAB 2ZDAH 1EKBB 3FP7E 6CHAC 1H8IH 1ZLRA 2BQWB 1XX9A 2EY4C 1MKXH 4UE7H 3B8JA 2F9NA 1C5XB 1LCYA 3BG4C 2BD4A 3SU3A 4YOJA 1F0UA 3TNTA 4R0IA 3WWFA 3RXRA 1G37A 2O8UA 3HKJB 2V3HH 3M35A 4X6NA 4Y8ZA 5EOKA 3PLKA 5F03A 1VCWA 2PTCE 4DY7B 4AX9H 2ZTYA 5EPNA 1AUTC 4TT3D 2BZ6H 3Q3KA 2NU2E 2FYRA 1G36A 1GG6C 4INLA 1SQRA 2ALPA 3WWBA 1L0ZA 2QXIA 2UWLA 1QGFA 1Z1JA 1A5GH 3SJOA 2XCFA 2GTBA 2ODYB 4BOHA 2BZAA 3A7ZA 1WQSA 1YLCA 1FJSA 1EZQA 4INKA 3T27A 1TNJA 4MVNA 1SGRE 2XXLA 3SI3H 1T32A 5DGJA 1WDIA 3RXQA 1GMHG 3SJIA 1V2MT 1VR1H 2Z3CA 2VIWA 4CHAC 4B2AA 1BB0B 5C67A 1MTWA 2TPIZ 3L3TA 3WY8A 1V2KT 4ABEA 1V2OT 3LGTA 2JKHA 3A89A 1IAUA 1SGFG 2SNWA 1KSNA 1KXCA 4LXBH 1C2FA 2H9EH 3T2NA 3D62A 3M3SA 4HG6A 1TYNA 2KCAA 3BG8A 1SGFA 3SN8A 1AN1E 3RLWH 4UFEH 1FI8A 4AYYB 3TK5A 3V12A 4NIVA 2VIDA 2PP6A 1TNHA 2K1QA 4D76A 5F6MA 1XXDA 1OX1A 4BAMB 1HPGA 1OS8A 1O2LA 1C1VH 1THRH 1MUEB 2GKVE 1F5RA 1MCVA 1TABE 4ABFA 1SLXB 1HXEH 1FNIA 1DWCH 2ASUB 2ZHWH 1N6YA 1C5TA 5DN6D 4FVBA 1LMWB 5CHAC 5T6DA 2JH6D 1O35A 1O3PB 1DS2E 3TH3H 3CNRA 2W7SA 2UUJB 4B74A 1FZZA 3ZV9A 2QF4A 5C3NA 1YCPK 2G4TA 2A7HA 1S6FA 1K1PA 4HZHA 1HAYB 1EAUA 2GVFA 3PMAB 1S6HA 2FDAA 1YPMH 3BTDE 3RXLA 3PM3A 3UOPA 1THSH 3TNSA 4Q63A 1A0HB 1GBDA 2GGVB 1DX5M 1W13U 4IMQA 4XBBA 4IN1A 2IJD1 4ISNA 2C90B 2BLVA 5DJ7A 2OP9A 4E06H 4K1SA 4AB9A 5LH8A 2FP7B 3S9BA 3A8DA 1P2JA 2FI3E 1IQFA 1GHXH 3ZV8A 4Y79A 1XUHA 2BVXH 3ZVFA 3R3GB 1HAHH 3K9XB 4ZXXH 3SW2B 1DLEA 4IGDA 3EQ0H 4ACAA 1GCTB 3DT0H 2XBVA 3K6YA 1L1NA 4Q2KA 2OC8A 2TGAA 5C17A 1V2UT 1OYTH 3ESTA 4NA7A 3UWJH 1MMJN 3ZYDA 3RLYH 1ZTKA 2F4LA 3FP8E 4GLYA 4BTTB 4Y10E 1T8MA 2C8XB 5FHTA 3VB5A 2P8OC 1LHGH 2AERH 4WMFA 4F4OC 1NBMD 3TPIZ 2F9VA 3GDVA 1DICA 5DK1A 2VVVA 3QUMP 3PV5A 1EOJA 3SU5A 1EASA 1YBWA 1TGTA 4JYUH 1YC0A 3LC5A 3ZZ4A 1UVUH 2ZFSA 1WSSH 1GPZA 2FOHA 1AFQB 4XBDA 1CA0B 4ABJA 3QWCH 3F3BA 4KTCA 4MPUA 5DP8A 3RU4E 1Y3YA 2NU0E 4H42U 4LK4A 2GDDA 1SGIB 1TRNA 3LH3A 1O2WA 2W26A 3LIWA 1TX8A 1O32A 1CU1A 4CRBA 4F55A 1EAXA 1AE8H 1ZHRA 3F2FA 4AYVB 5K0HA 2ZCKP 1MKWH 3UNQA 3VB7A 1YPKH 1C5PA 1CSOE 3HPTB 4ZUHA 5JB9S 1SKYE 1AB9C 2RDLA 1RRKA 2WUBA 1DY8A 1ZSLA 4NA8A 1O3EA 3C1KA 4RT1A 1Y5UT 4AFQA 1PJPA 2ZCLP 1O31A 2AGEX 4WMEA 4BNRA 1Z1IA 1UTLM 2QF0A 4ZROA 3GCTG 1HAIH 1UK2A 3LGYA 4U01A 3SUDA 3DHKH 8KME2 3MMGA 3OEED 2HPQH 3EYDA 4ISHH 2A0QB 2B0FA 3VFEA 1WTHD 3IWMA 3SU2A 2BTCE 2FEQH 4D7GA 1O2HA 2FODA 3PV2A 3ZZ5A 1GBAA 1SOZA 1C5LH 1ELGA 4CBOA 2F3CE 1SGTA 3A80A 4FUFA 1K2I1 1V2VT 4INHA 2GCTB 3Q3XA 3BEUA 1MTUA 1ELCA 4X2YA 4OS5A 2RCEA 2A5IA 2BDYA 5EJ1A 1C1TA 1VGCC 1V2QT 4FXGH 4Q4LA 3MNBA 1FUJA 3F2HA 1P05A 4A1XA 2OK5A 1IQJA 3P8OA 1GBHA 3BIUH 1A7SA 2AFQB 3SV9A 3M7UA 1VITF 1TPOA 4DJZB 4NSYA 2TGDA 3FP6E 1O2OA 3LGWA 1KTSB 4K1TA 2D26C 1NT1A 3LGUA 1PFXC 1JIMA 2ZNKH 3PMHB 3BTFE 2JJ1D 3A7WA 3RXJA 1C5VA 5AFYH 1AFEH 4XRNA 1S85A 1YYY1 1ELAA 2H5CA 1TBRH 3LH1A 1KXEA 1GI2A 1TPAE 2G52A 1EUFA 1F0RA 1FY5A 2ZPRA 2J95A 6LPRA 1FN6A 3OEHD 5L6NH 2HLCA 3SNDA 2BDGA 3UR9A 4Q7XA 1V2RT 3URCA 3LT3A 5L2YH 1P57B 2CMYA 5T3HA 1MD8A 2Z7FE 5DP3A 2Z9LA 4YXWD 3Q3YA 3RMMH 1P9UA 1ZZZA 2OTVA 1Y59T 1GVZA 3N7EA 1UVPA 1OWIA 1MABB 1CT4E 1O5BB 3A7TA 1K28D 1TGSZ 4BTIB 1O2UA 2QXHA 1GVKB 1Y3XA 4YM9A 1GHAF 3PTBA 2BM2A 2OQ5A 2I6QA 3TITA 1O39A 2R3YA 1AGJA 2SGPE 1NU9A 1DWEH 2BVRH 1H4WA 2BDIA 1LVOA 1O2VA 1O5CB 2PW8H 3KQCA 2UWOA 4BAOB 1GI7B 2ZU2A 3U8RH 4IC6A 2G5NA 3RXUA 3RDZA 1CE5A 3MQKC 2A45B 4JZFH 1X7AC 1A0JA 4X1PU 5B6LA 4B2BA 1LKAA 4X6OA 1O5FH 5DSFA 1EPTC 1VKYA 1DANH 3MNCA 5F53A 1DPOA 3GCHC 4FVDA 2GD4B 2XBXA 1HNEE 1EQ9A 2CHAB 5EIYA 1DUEA 3KF2A 4Q7ZA 2G81E 3M7TA 2F9BH 3QZRA 3STIA 1O3JA 4LOYH 3GY2A 2PLXA 4DG4A 1ARCA 3UQOA 4CRGA 1C2DA 3ZZ3A 2CF9H 4UFDH 5C0TA 2DE9A 2A7JA 2Z6BD 1KXBA 3I29A 2YMSC 1ZHPA 3NWUA 4K8YA 4XBCA 3GY6A 3MWIU 3QK1A 5HXFA 1BITA 3IITA 3BTQE 3L33A 3N99A 1GGDC 1XUGA 3VB6A 1D6WA 2ZFPH 1GCDA 1TONA 1JBUH 2Y5HA 3I77A 4MNVA 3LGVA 4FUJA 5GIBA 5T6GA 1G30B 3LDXH 1A5IA 4DT7B 2KX4A 1PPFE 1SGNE 2THFB 1GJAB 1IQMA 2C8ZB 1HAZB 1S84A 2SGFE 1BDAA 1GHVH 3LC3A 2FLBH 1T7CA 1IQEA 1UTMA 3P17H 1PQAA 2YOLA 1FV9A 4FOUC 3ODDA 3TLOA 1PPCE 5L30H 1QR3E 3RXTA 1FQ3A 3EA7A 1K22H 3U8TH 1SHYA 2Z9JA 3MU1A 5EXMA 1BTUA 3M37A 1COWD 1EP5A 5FBEA 2Q6FA 1O3AA 2FOGA 3KIDU 1C1QA 1UK3A 1C4U2 1PYTD 2EA3A 1F92A 1H8DH 2FOMB 2UUKB 3MU5A 1XMNB 2QN5T 2UUFB 5KGOA 1UTQA 4ASHA 1A2CH 2FTLE 2A4GA 3F9GA 3P70B 4O3UA 1IQNA 3DD2H 1V2PT 1AVWA 2BD3A 1B5GH 2D8WA 1XM1A 1NTPA 3OTJE 1VITH 4NFEA 1ESAA 4ABBA 1FLEE 1Y5BT 1YGCH 1CT2E 3RXBA 3MU4A 4B6EA 1TNKA 1MZDA 2XRCA 1DWBH 2ULLA 2QYIA 5CMXH 2BD8A 1V2NT 3LKWA 3BTME 1O5DH 1QFKH 3RXIA 1O3BA 2PUXB 2PGBB 1BMAA 4OS7A 2FOFA 3QX5H 2XWBI 4A92A 1C1MA 1C2KA 2F9PA 2CJIA 2BQ6B 1BJUA 1L1JA 1BUIA 2P93A 3TK9A 2BB4A 4NIYA 3SUGA 5A09A 1ANBA 3E91A 1DSTA 1CHGA 1WXRA 3OYPA 2WPHS 2BY9X 1GMCG 4ZKNU 1J9CH 1MKXK 2P3TB 3S7KB 4WH8A 4BAQB 3EA9A 4B73A 3NZIA 3E1XB 4YLQH 5JYIA 2H2ZA 1O5AB 2OXSA 3DCLA 4K60A 1W14U 3RXGA 4WJG2 1CBWB 2EI8A 6ESTA 3A7VA 2M2AA 2RG3A 2PTNA 1AKSA 1ANCA 3KYFA 4MLFB 1DY9A 1C4Y2 1C5WB 1WCZA 2HOBA 1MTSA 2C4FH 2SGEE 4X8SH 3U8OH 1LPZB 4X2XA 1ZGVA 1MAXA 2AYWA 2Z9GA 1B0FA 2A31A 3RC5A 1NO9H 1C5SA 1RTLA 1ZRKA 3TJVA 3A84A 3RMNH 5AF9H 2FOEA 2AMDA 3B23B 2ZU1A 2ALVA 1HAOH 3RXSA 1C1UH 4NA9H 5I25A 2TIOA 2ZG0H 3O8BA 1KLIH 3ZZ8A 1FIZA 1W0JD 1ZPBA 7ESTE 4K2YA 2AGIX 2TBSA 4ZCNA 2FOCA 3MNXA 1FXYA 3SO3A 3ODFA 3MH6A 1S0RA 2GV7A 1GL0E 2B7DH 3G01A 3BTTE 3PO1C 3RC4A 1AQ7A 4ABIA 1U6QA 2ZPSA 3C27B 4AG1A 4CR5A 2EC9H 3RXAA 1A5HA 4MQAA 5ESTE 3A8AA 1NFWA 3RMLH 4UD9H 4GCHF 3TIUA 1E38B 5T1VA 3U69H 2NU3E 3V3MA 3DSOA 3U1IB 1LPKB 5LGOA 3SGQE 3AK5A 3UB0A 2A4QA 1TB6H 1C2JA 2ZFTA 2WPJS 5FCRA 3SU1A 1WYKA 4A5TS 2ANKH 2G4UA 4OS4A 5BRRE 1A4WH 1C1OA 1S5SA 2F91A 2LELA 2ANMH 2XNDD 1A46H 1QIXB 4AFZA 1Z8RA 5EJZA 3M5NA 5FCKA 4Q80A 1XVOA 1NRNH 1TNGA 1KMHB 1ELVA 1DDJA 2FLRH 3T25A 3SU6A 2H5DA 4NZQA 3O8CA 1XVMA 1K1NA 1YM0A 1JIRA 3B9FH 4K69A 1CQQA 4HTCH 3ATWA 1F7ZA 2G8TA 4I8KA 2SGQE 4UDWH 1ORFA 4AG2A 1SHHB 1OWJA 1MBQA 1XUFA 1KY9A 1PYTC 2PR3A 1W8BH 1HFDA 3AW1A 1SFIA 1OWDA 1G32B 4WH6A 1QB6A 2ODQA 2OBOA 1C2HA 1K1OA 1O0DH 1WBGB 1T8LA 1A3BH 1O3HA 2HGTH 5GDSH 1N8OC 3TVJB 1ETTH 1O2ZA 3RXEA 1C5QA 1CO7E 2V0BA 2ZECA 1AWFH 4M9FA 1QQUA 2BD5A 2J2UA 4WF8A 4XDEA 1GDNA 2ODPA 1LQDB 5AHGH 1FAKH 1MBMA 2ZGJA 2BY6X 4I33A 1EXFA 1P09A 3E3TA 2GP9B 2AEIH 8GCHG 1IHTH 3AW0A 3ATIA 5E0GA 1J16A 1C5YB 1DITH 3SORA 2A5AA 1O2XA 4GUXA 5FBIA 2WINI 1EX3A 1KXDA 3K65B 2AH4X 4E7NA 2Y81A 4WMDA 5TCAA 1W0KD 3SNEA 1GBCA 3FKSD 3D23A 5DP9A 3PMJA 3VXFH 2VU8E 3JZ1B 2BY5X 4B2CA 3UOUA 3T62A 2WYJA 4D9RA 1AD8H 7GCHF 2XOKD 3W1EA 4UEHH 1MAYA 1TMUH 1PPGE 1YP9A 3A8CA 4VGCC 4X1SU 4MPVA 1SOTA 1W2KH 1SQOA 3KQBA 3ATKA 1SLWB 1UCYK 2A32A 1KXFA 1AHTH 1ZSKA 1NRPH 1GBJA 1W0ZU 1NFXA 4ZKOU 2F43B 5EXNA 2NU4E 3M7QA 1HV7A 1W10U 3OX7U 4MPWA 1GVLA 1KTTB 1BTYA 4ZKRU 1DUAA 4JYVH 1C5OH 1QURH 3M5OA 3NCLA 5FX6A 1HRTH 4H6TA 1J15A 1FX0B 5G4BA 3TJOA 5FPTA 4YO9A 3HATH 1NROH 3RXPA 2FS9A 3QZQA 4JZ1A 4BTUB 5CE1A 1ZTJA 4QT8C 2ZGHA 2VIVA 4XSKU 3RXVA 3GYMA 4OGYA 1TFXA 1CT0E 2A7CA 3DA9B 4O3TA 1YLDA 4SGBE 2Z9IA 5GCHG 1RIWC 1SSXA 1GBTA 1T8NA 1PPBH 2OD3B 1BRUP 1P3EA 5C2ZA 2V3OH 1XUKA 1YCPH 2G51A 2Q6DA 1P2NA 1EZSC 4BXWA 4J1YA 1AI8H 1JOUB 2VWNA 1UTJA 2Y7XA 1O2GH 4FU9A 5C20A 1HYLA 3KQ5A 1L4ZA 3GDUA 5HYOA 1EP6A 1KYNA 5AFZH 1N1LA 4JZIA 5JBTA 5J4SA 5IK2D 1GMHF 2O9QA 3A85A 3Q76A 2GJGA 1VZQH 2QCYA 1O3GA 5HGGA 5A0BA 1GHYH 3NUMA 3F9HA 3UQVA 3V0XA 1G2LA 1GHAG 2H6MA 4GPGA 3TH2H 2BX4A 2HVYB 3KQDA 4IN2A 1ZTLA 1C9TA 1WTGH 2AMQA 3BTGE 2HWLB 1D3QB 1C2LA 5DP6A 1CGJE 5C5NA 1CVWH 2R0LA 1L2EA 1KLJH 4U2WA 2CF8H 1ACBE 2OCVB 1J8AA 1S0QA 1FN8A 1BMMH 1TNLA 2QF5A 1SLUB 1AU8A 2ZTZA 3FN8A 2ZFRH 5DP5A 1LPGB 1AZZA 1SL3A 1WV7H 4HI3A 1O34A 2SFAA 2B8OH 4NG9H 4H6SB 1EZXC 2ZFFH 1QNJA 2YNBA 3RXKA 5C0UA 1NPMA 3BEFB 3KQEA 2WPLS 1MQ5A 1C1NA 1BT7A 3PLPA 1TOMH 4AFSA 4CH8B 5C1XA 1SI5H 1FIWA 1O37A 1ESTA 2ZGCA 4CRCA 4F49A 3VGCB 2W3KA 1QA0A 4O03A 1HJAB 3LJOA 2VVCA 1MTNB 2QA9E 3KEEA 3Q00A 4NIWA 3GY7A 2XTTB 1O2RA 1BJVA 1LQEA 2DE8A 5LPRA 1HJ9A 3R0FA 1FPCH 3AASA 1DWDH 2R0KA 3MOCA 5A8YA 1PQ7A 1BZXE 1D3PB 3BF6H 2BLWA 1HAPH 3UPEA 2P3FH 2TGTA 1GMDF 1AZ8A 2ZP0H 1O5EH 4FUEA 4NZLA 3EA8A 2VGCB 5DP4A 3O8RA 3H09A 4B75A 3F9EA 2FESH 2FS8A 3N7OA 3RUOA 4I32A 4RT0A 1BQYA 1YPEH 1XKAC 1IQKA 2GMTB 4GAWA 1AIXH 3T29A 2H1UA 2C3SA 1GBEA 1O2JA 1NC6A 1SPJA 1ZMNA 1QRWA 3EE7A 1SC8U 2F83A 5EW1H 1VCQA 2ZO3H 2QV1A 1N6XA 1TWXB 1ZMLA 4IBLH 2PSXA 3P8GA 2FX4A 2J34A 3UUZA 1V2LT 1Z6JH 2XBWA 1O2SA 3OAAD 4MG3A 2OC7A 1AO5A 4UFFH 1NN6A 1UVTH 4X6PA 3SQHE 4AOQA 1DXPA 2QY0B 1G3EA 1O3IA 4CRDA 4E7RG 4JZEH 1DOJA 1JRTA 3UWIA 1P03A 3E90B 3S0NA 3F9FA 4AZ2B 6CHAB 3ATMA 3A86A 4O9VA 1BBRK 3MU8A 9ESTA 2XW9A 3BG4B 3E0PB 1G3BA 3GS9A 1TA2A 2ZWLH 5GPIB 3A82A 1GJDB 3RXDA 2H9HA 3SUFA 1GJCB 2V3MA 1Z8JB 3F0PA 1LHDH 2ZQ1A 1SVPA 1AKSB 1UW7A 2FX6A 1TX6A 4JYTA 3ZZDA 1ZPZA 1ELBA 3M5LA 2VIQA 1GG6B 1Z71A 5KEDA 3SV7A 4AGKA 1WU1A 1C5NH 3ZVCA 2STAE 2VB0A 2CN0H 3DSPA 1BRCE 5GJ4B 5JBCS 3MTYA 2ZEBA 1INCA 4JMYA
chains in the Genus database with same CATH topology
1ELEE 2O8LA 3RXCA 2J9NA 1TGBA 2SGAA 4BXSA 1GCTC 2BD7A 1V2ST 3TGIE 1TALA 1D3TB 3GCTF 4NIXA 1P8VC 4CHAB 6GCHF 1GDUA 1Q2WA 1SBWA 1EJAA 2Y7ZA 1L1GA 5DG6A 2OUAA 3A88A 3RC6A 1RGQA 3SHCH 2Z9KA 3LJJA 3K2UA 4MNXA 2OBQA 1ELTA 4WVPE 5E2PA 2OQUA 2ZGBH 2GZ9A 1O30A 1Z7KA 1O2NA 5JPMH 5K7RA 1TBQH 4JK6A 3NPSA 5E8EH 1AFQC 1CA0C 2WPKS 4X1NU 1OPHB 4X2WA 3URDA 3VXEH 3SNBA 1ZRBA 3JZ2B 1GI1A 3MH4A 1YPLH 3TK6A 3UR6A 1ZGIA 3GYLB 1O33A 4THNH 3KL6A 2GZ7A 5DO4H 5EXLA 1BOQA 4X8TH 2OLGA 3PMBB 5CHAB 2Y80A 2PUQH 1EAWA 3SBKA 1B0EA 1C1SA 2BDHA 1LKBA 4Y8YA 1MTVA 1FY3A 4KGAA 5FPSA 1LVMA 3HGNA 1YPJH 1GHWH 1TRYA 4FU8A 4FUHA 4FUCA 1MU8B 2GT7A 1TQ0B 4Y71A 5LPFA 2EEKA 1QBOA 1SQTA 1Z8IB 3BTWE 3U1JB 1JMOH 1F5KU 1Q31A 2BOKA 1GI0A 2BX3A 3KHVA 1BHXF 1BRAA 5TCCA 2ZFQH 4O97A 3PTNA 5J4QA 3PROA 3M3TA 4DGJA 1O3KA 4RKOB 4MPXA 1QJ1B 1UCYE 2CV3A 2QIQA 2A4RA 5HM9A 2WV5A 4FU7A 2A2QH 8ESTE 3SUEA 1M9UA 2ZPQA 3FZDA 3OSYA 1A61H 3V7TA 3SU4A 4IMZA 3T26A 1F0TA 1E36B 2JH5D 1BA8B 3FANA 4XFQA 1P10A 2RA0A 2GCTC 3D65E 2BMGB 2W7UA 1EB1H 1UMAH 2EI6A 2A1DB 1Y3UA 2ZU3A 1NZQH 4LZ1H 4ESTE 2BDBA 1OP0A 3M36A 5HM2A 1C2GA 3TH4H 3MYWA 1WQVH 2GV6A 2PV9B 2G55A 4CRAA 1SLVB 1KLTA 3DUXH 3T5FH 2Z3DA 1GBMA 2P8OB 4OS2A 5FAHA 3ZVGA 1SGEE 1BTZA 4K8BA 1YF4A 5FXLA 4KKDA 2PKAA 4ZHLU 1QRZA 1BIOA 5AVDA 1SGQE 3RM0H 1ZOMA 2VINA 3MO6A 3W95A 1G3DA 2BY8X 3QGNB 1Z6EA 2ZDNA 5ESBA 4B71A 1O36A 2ZKSA 1DVAH 2O8WA 5BPEA 4JZDH 1CHOF 1OP2A 2FO9A 3SZNA 4X1QU 2FWWA 5EU8A 2ZTXA 1RTFB 3O8DA 3QN7A 1UTPA 4DIHH 3P8NA 3FVFB 5EGMA 2B5TB 2BY7X 1C5UA 2QXJA 1K1IA 2R9PA 1HBTH 4D7FA 2TRMA 4DOQA 3ENSB 3FFGA 1BTXA 1H1BA 1BRBE 4A7IB 1F2SE 7GCHG 1PQ5A 1ZJDA 1UTKA 1FPHH 1K1MA 1O38A 4I7YH 1D3DB 1JWTA 1SGYE 1NY22 3MO9A 2ZCHP 2OINA 2QC2A 2M5TA 1MU6B 1AB9B 4RSPA 1QJ6B 2ZHDA 4Z0KA 2XWAA 3MFJA 4KTSA 5A8ZA 2BHGA 4MTBA 2F9OA 4B76A 1G2MA 1AWHB 3F68H 1C4V2 4TY7A 1FY8E 1O3FA 3STJA 4YLUA 3BTHE 2G5VA 2ZIQH 4NWLA 1TNIA 3SNAA 2V35A 2W3IA 1W3CA 2CXVA 2Y5GA 4NSVA 4JK5A 4Q7YA 2BQ7B 4DURA 2PGQB 4CH2B 1FAXA 1GI8B 4YESB 2O8TA 2ZF0H 2QAAA 1GHBF 3LOXA 1LTOA 4X8UH 5F8XA 2R2WU 1SB1H 3SJ8A 2BOHB 2PKSB 1ABJH 1P2OA 2AGGX 2GT8A 4XOJA 1O2KA 1P04A 3E0NB 3MHWU 3ZZ7A 1QA7A 3BV9B 1HGTH 5DP7A 1O3OA 3MH7A 4AB8A 1TIOA 3PV4A 4ISIH 3KGPA 1XXFA 4TYDA 4K5ZA 1NS3A 3DFJA 4CR9A 5A0CA 5PTPA 2QXGA 3RXFA 2ANWA 1GJ5H 4TWWA 2CHAC 1Y8TA 1VGCB 2BDCA 1FMGA 4R8TB 5ABWA 5ETXA 1GBLA 4YOIA 3A87A 2GDEH 1IOEA 3CP7A 3SQEE 1AE5A 1GI9B 1DE7H 3QDZB 3GCNA 2KAIA 1V2JT 1E34B 3MO3A 2ZDVH 4OS6A 1QBVH 3RU4D 2BVSH 1ABIH 1C5RA 4WWYA 1GWAA 4ZKSU 1ZR0A 2F9UA 1OXGA 1YKTA 4WXIA 1WAYB 3A7XA 1ELDE 4HGCA 2GCHF 2XBYA 2ZU5A 1BTHH 3SOSA 2FPZA 2SGDE 1A1RA 1DT2A 3A7YA 3HGPA 1T4VH 2XYAA 1UK4A 1ESBA 4FUGA 2HVXA 1P02A 3HKIB 1P06A 3GCOA 1D6RA 4X6MA 1P12E 3BIVH 2ZQ2A 3UNSA 1MD7A 1QJ7B 1PPEE 1GMCF 5L2ZH 2GZ8A 3PWCA 1S83A 3P8FA 2UUYA 4ZHAA 3HK6B 3VEQB 8LPRA 2C93B 3ZZAA 1ID5H 5IDKA 2ZHEH 1E37B 2PFEA 2R2MB 1J14A 1QB9A 1GJ8B 1GI3A 1V2TT 1DM4B 9LPRA 3GY4A 3EDXB 2ZDMA 1NRQH 1BMLA 1TMBH 3RMOH 4YT6H 2J4IA 2HRVA 2FM2A 1E35B 1GI4A 4AN7A 1BBRE 4A1VA 3BSQA 1HDTH 3UY9A 1QQ4A 1P2MA 1DXWA 3ATLA 1WUNH 3SNCA 1W12U 1RTKA 5EQSA 3ZVBA 5C1YA 2IJOB 4M7GA 3F1SB 3GOVB 2EI7A 3SI4H 1C9PA 1K1LA 3ZZ6A 2G00A 1KDQA 1SMFE 1NU7B 1D4PB 4KP0A 3TJNA 1UHBA 5E2OA 4I31A 1VITG 2I6SA 4BAKB 1A0LA 5B6OA 1ARBA 4XE4A 1IQIA 1OP8A 2P94A 4MNWA 4WY3A 1HAXB 1EZUC 1GMDG 3M61U 4CRFA 1EPTB 1GDQA 1MKWK 1ZPCA 2J94A 3GCHB 1YCPM 4OS1A 1F0SA 2A4OA 4ZH8A 1ZYOA 2ZDLA 1O2QA 1O3MA 1C2EA 1P01A 3QLPH 3PLBA 3TJUA 4Y0YE 3E6PH 1UVSH 3VB3A 2R3UA 1HIAA 1LDTT 1ELFA 1GJBB 2VIOA 2VWLA 1JXPA 1J17T 1BHXB 3LU9B 2FMJA 2WV4A 1FY4A 3P95A 2BLQA 1H9HE 4BAHB 2JETB 3BEIB 2BD9A 3H7OA 3PB1E 4K1EA 1QY6A 1GGDB 3CS7A 1CBWC 2P16A 4H4FA 2QGRA 4IC5A 4ISOA 2A5KA 4U30A 4D9QA 2QF3A 3LONA 1QRXA 3CENA 1UCYH 2SNVA 3RU4T 2XNIA 4WXVA 5I46H 4YZUA 2PHBA 1LVYA 1S81A 3KNXA 4KTUA 1LHCH 3HK3B 2HNTE 3VPKA 4I8HA 1OWKA 1MQ6A 1TE0A 3EAJA 1KIGH 4NCYA 4NWKA 2AIPA 2VIPA 3UNRA 3SU0A 1O2IA 4Z6AH 1O2TA 1OKXA 1GJ4H 1YPGH 2STBE 2VWMA 3SV8A 5A8XA 5SGAE 1K21H 1UTNA 2DUCA 1FONA 2J38A 1P2IA 2NWNA 1BCUH 4UFGH 5F8ZA 2ZI2H 2BDAA 3S7HB 3RM2H 5EG4A 3ZYEA 2IN2A 2OC0A 4TY6A 2BD2A 2FI4E 4HFPB 4I8GA 3RXOA 1EB2A 2HNTC 1AVXA 3BTEE 4J2YB 3LPRA 3AVZA 3P92A 1LHEH 2O8MA 1TAWA 3LGIA 2Y6TA 8GCHF 1OWEA 6GCHG 1T4UH 3SJKA 1RXPA 2AS9A 4ABDA 1ANDA 1HLTH 3PYHA 1YPHE 3QTOH 1O2YA 2JH0D 2FZZA 3A8BA 4X1RU 1TLDA 7KMEH 4DW2U 1HAVB 2PKSC 2PWXA 3H7TA 1IQGA 1NM6A 2FI5E 1P3CA 2PSYA 4SGAE 1P9SA 1P11E 4I8JA 3QTVH 3GY3A 2FYQA 4Y7AA 5JB8S 2NU1E 5HMAA 4ISLA 1EOLA 1BMNH 1E0FD 2W5EA 1QL7A 3UIRA 2XCNA 5EW2H 3GICB 3VB4A 2XC5A 3S9AA 4AGJA 1YPHC 1SGPE 1FY1A 3MU0A 3E8LA 2ZA5A 3RP2A 1C1RA 1UO6A 1DFPA 4MDSA 1ETSH 1HB0B 3PWBA 2Y82A 3U9AH 3EE0B 4TPIZ 3TGJE 4JCNA 1KXAA 3UTUH 5C5OA 1H9IE 2WUCA 2Z94A 1ANEA 1GBBA 3FAOA 4X2VA 2BXTH 2HNTF 1WOFA 4PROA 1AVGH 1EPTA 1GL1A 1O3CA 5GCHF 3K6ZA 3ELAH 3V13A 1NFYA 1Y5AT 2D2DA 2ZZUH 1QTFA 1PPHE 1NRRH 5JDUB 2FXRA 1W7XH 4YTAA 1TOCB 5GXPA 5EQQA 1QHRB 2A2XH 3GDSA 1RD3B 5DKMA 1TBZH 1F5LA 1TPSA 1UJ1A 1QL8A 3AAVA 1OSSA 1GBIA 1VCPA 1TX7A 1K1JA 3NK8A 3ZVAA 2UWPA 4DVAU 4AFUA 3PO1B 5GWZA 2P95A 2Y5FA 2H9TH 4CBNA 2PKAB 1P0SH 4E05H 3NKKA 2ILNA 1SR5C 2Q6GA 4UONA 3MH5A 3T28A 1LO6A 3SGAE 2AIQA 3S69A 4FUDA 4IS5A 2GX4A 4X0WU 1IQHA 4ZMAH 4BANB 3BN9A 4YT7H 1UVOA 1Q3XA 1THPB 4ABGA 1T31A 2J92A 1GBFA 5F8TA 4GHQA 2WPMS 4DIIH 1VJ9U 3DFLA 1EJNA 1QCPA 2VNTA 1W7GH 2IOTA 5E0HA 1CGIE 3P6ZB 4NFFA 1C5ZB 7LPRA 1TGNA 4DCDA 2ANYA 4TPYA 1TGCA 1SFQB 4U32A 1O5GH 3CS0A 2C8YB 3ZVDA 1XUIA 1L4DA 3TU7H 1TA6A 2WPIS 3OU0A 1CHOG 5C1UA 3SHAH 1FDPA 2HALA 1C1WH 4GHTA 2P3UB 2CGAA 3E16B 2Q1JA 4NGAH 2TGPZ 1OWHA 1EATA 4ZXYH 3OY6U 1GJ9B 3RXMA 1G3CA 5EODA 1NRSH 3ZZCA 1B7XB 1TRMA 1BBRH 2C8WB 5LPEA 3Q77A 3ZZ9A 5JBBS 1JRSA 1RJXB 1ZMJA 1TMTH 4RN6A 2XC4A 4LZ4B 4X8VH 2JETC 1S82A 2OC1A 1IHSH 5DPAA 2VH0A 1N8OB 1OOKB 1PPZA 2D1JA 5EQRA 2YNAA 2BYAX 2ZU4A 1RFNA 2BXUH 1A3EH 1HAVA 3UFAA 4GVUA 1AY6H 2LPRA 4IW4E 3OY5U 1O3LA 3GY8A 4OGXA 4GCHG 2FTMA 3W94A 1GBKA 4ABAA 1GJ7B 3QGJA 1HJ8A 1PQ8A 1ZHMA 1LVBA 3U98H 1Y3WA 1MH0A 1SQAA 4K3JA 2IPHA 1XKBC 1G9IE 1GHBG 2B9LA 3GY5A 2ESTE 3ZVEA 3A81A 2KAIB 2P59A 4ZAEA 1C2IA 5A2MH 2XC0A 4D8NA 4TWYA 4Y0ZE 1K9OE 1O3NA 4ZHMU 3KCGH 4Y76A 3S9CA 1GJ6A 1OYQA 4VGCB 1T8OA 1H9LB 4AORA 3F6UH 1AMHA 1TPPA 1ZSJA 3MI4A 3GISB 4FUBA 3KN2A 3L6PA 2ZDKA 2FOAA 2VVUA 1O2MA 1O2PA 3D49H 4Y8XA 4FUIA 1O3DA 2FOBA 1HXFH 5T6FA 1GI5A 3SV6A 1UTOA 4KELA 5JBAS 1LHFH 3IG6B 3TGKE 3FZZA 1HCGA 1SGCA 1Y3VA 3RXHA 1D9IA 5H4IB 1DSUA 3SV2H 3VGCC 1GI6A 3QO6A 1HJAC 2ZHQH 2VH6A 1BTPA 1MTNC 2GCHG 1VJAU 2VWOA 5FX5A 3SJ9A 1BTWA 3ITIA 4A6LA 3AAUA 2ZC9H 2BLOA 1P2KA 1RIWB 1Z8GA 1XUJA 1QB1A 1SG8B 1AUJA 5E0JA 1P2QA 2ZHFH 1IQLA 1C5MD 3EGKH 1C1PA 2RA3A 1W11U 2FIRH 5EPYA 4Y6DA 2HPPH 2AMPA 4RKJB 2LNCA 1NESE 1QBNA 1V2WT 2VGCC 3M3VA 1V6DA 1HAGE 1ZJKA 3H5CB 5TJXA 4CREA 1DLKB 2GMTC 4MNYA 4B1TA 1HUTH 3UREA 2Z3EA 1MZAA 1KDQB 3A83A 3I78A 3MNSA 4GSOA 4I8LA 1UHBB 2V6NA 1V3XA 4ABHA 1GHZA 1EAIA 1MCTA 3M5MA 1ETRH 4A1TA 1EJMA 2VJ1A 1QL9A 1W0YH 2ZGXH 1CA8B 3NXPA 2WYGA 1NFUA 5A0AE 3BTKE 5FPYA 1SGDE 3ZZBA 5IYTA 3SGBE 1C2MA 4YOGA 4Y11E 1CGHA 1TQ7B 1RS0A 4Y7BA 1HIAB 2ZDAH 1EKBB 3FP7E 6CHAC 1H8IH 1ZLRA 2BQWB 1XX9A 1MKXH 4UE7H 3B8JA 2F9NA 1C5XB 1LCYA 3BG4C 2BD4A 3SU3A 4YOJA 1F0UA 3TNTA 4R0IA 3RXRA 1G37A 2O8UA 3HKJB 2V3HH 3M35A 4X6NA 4Y8ZA 5EOKA 3PLKA 5F03A 1VCWA 2PTCE 4DY7B 4AX9H 2ZTYA 5EPNA 1AUTC 2BZ6H 3Q3KA 2NU2E 1G36A 1GG6C 2FYRA 4INLA 2ALPA 1L0ZA 2QXIA 2UWLA 1QGFA 1Z1JA 1A5GH 3SJOA 2XCFA 2GTBA 2ODYB 4BOHA 2BZAA 3A7ZA 1WQSA 1YLCA 1FJSA 1EZQA 4INKA 3T27A 1TNJA 4MVNA 1SGRE 2XXLA 3SI3H 1T32A 5DGJA 3RXQA 1GMHG 3SJIA 1V2MT 1VR1H 2Z3CA 2VIWA 4CHAC 4B2AA 1BB0B 5C67A 1MTWA 2TPIZ 3L3TA 3WY8A 1V2KT 4ABEA 1V2OT 3LGTA 2JKHA 3A89A 1IAUA 1SGFG 2SNWA 1KSNA 1KXCA 4LXBH 1C2FA 2H9EH 3T2NA 3D62A 3M3SA 1TYNA 3BG8A 1SGFA 3SN8A 1AN1E 3RLWH 4UFEH 1FI8A 4AYYB 3TK5A 3V12A 4NIVA 2VIDA 1TNHA 2K1QA 4D76A 5F6MA 1XXDA 1OX1A 4BAMB