4GLYA

Human urokinase-type plasminogen activator upa in complex with the two-disulfide bridge peptide uk504
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bicyclic Peptide Ligands Pulled out of Cysteine-Rich Peptide Libraries.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4glyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4glyA01
2BY8X 2CHAB 1AB9B 2DE8A 2XBVA 3STIA 3DUXH 1O2XA 1F0SA 3LKWA 2ZCHP 5BPEA 1CE5A 1T4VH 5EQQA 1ZLRA 1FY4A 5E2OA 1O2RA 4MNWA 2AEIH 1EZXC 4AN7A 1MTNC 1QB9A 2AIQA 1MAYA 2XYAA 5HMAA 3UQVA 1A4WH 3GY6A 3UR9A 1C4V2 3G01A 2XCNA 4HI3A 2ZGBH 5C2ZA 1O5GH 3C27B 1BTUA 2ZKSA 1WOFA 2HGTH 1ELCA 2ZTZA 4NFFA 2ZI2H 1LHFH 4GPGA 3E8LA 2H2ZA 1TONA 3HATH 1Z6EA 4NIVA 4OS7A 1C1UH 4UDWH 3PMJA 3ZVBA 2PW8H 1YCPK 3U98H 3F9HA 1NO9H 3SUFA 1V2PT 3SUGA 3RXQA 1YKTA 5F03A 2ZF0H 2C8ZB 2WV5A 1GI1A 1WSSH 3EAJA 5CMXH 2PKAA 1NPMA 4WJG2 2STAE 4UFEH 3RXPA 1C5TA 2EC9H 2VINA 3VB5A 1MU8B 3WY8A 3M37A 1HIAB 2O8MA 1UHBB 1O5DH 1SGRE 2Y7XA 3TU7H 2Q6DA 4SGBE 3B9FH 5C20A 1F5KU 3GY4A 1ABIH 3RC6A 2OLGA 1SQOA 1GG6B 2W7UA 3LGUA 2GZ9A 1JRSA 3K9XB 1G3DA 1TMUH 3RLWH 3SU4A 1EAIA 1FY5A 1YPHC 5EOKA 1DWBH 5A8YA 1C1NA 6ESTA 3SI4H 1Z8GA 1DWDH 3LGVA 1UK4A 1TPSA 1ESBA 1L4DA 2AFQB 4ISIH 1O2MA 1T7CA 2Z7FE 3T26A 5A09A 4XDEA 4ZKOU 2BD3A 5AHGH 2B8OH 1RTFB 3TGIE 1OX1A 3PM3A 2G8TA 4K69A 1QL9A 2BYAX 1RFNA 1GCDA 3KGPA 1GI9B 2VIOA 1JOUB 1FXYA 3PTBA 2Z3CA 4X6NA 1QRZA 3O8BA 1S83A 3SU6A 4IN1A 1J17T 2GT8A 3E16B 2HPQH 3SUDA 1OWEA 1TRYA 4CBNA 1AI8H 3SHCH 1BTWA 1O31A 1P12E 1SGQE 1Y8TA 2A4QA 2D1JA 3RDZA 1V2QT 2BDAA 4ZUHA 1F92A 3MOCA 4IN2A 1WV7H 4F4OC 1ZSJA 1AWHB 3HGPA 4MPXA 2W5EA 3CP7A 3U8RH 3KQBA 8LPRA 3GISB 4CRBA 2UWPA 3D49H 3M7UA 5SGAE 1OP8A 1QBOA 4GVUA 2HNTE 1DY9A 1UTNA 3RM0H 2IJOB 3MNCA 4CRGA 2EI8A 5C5NA 2ZDKA 1DX5M 1V2OT 4A6LA 1GG6C 1Z7KA 1ZJDA 4NIXA 2P3TB 3BTTE 3SU1A 1FDPA 2Q6FA 1IQGA 4BANB 1ZRBA 1BT7A 2WUCA 1O3NA 1G2LA 1K1MA 2ODQA 3M3TA 3TH4H 3E0PB 1QTFA 3RUOA 3A80A 1W7GH 4AFZA 1P57B 1TMTH 1YPLH 3U8OH 5LPFA 3CENA 3LC5A 1EB2A 2VNTA 4K1EA 1SMFE 1AY6H 1O2TA 5GDSH 2BHGA 5DP7A 3UQOA 1RIWB 2Y7ZA 1O2OA 1DICA 1O0DH 1IAUA 3F1SB 2PV9B 2M5TA 1LHGH 1GDUA 1JIMA 1FAKH 3FFGA 1NROH 1TRNA 2BDGA 2JETC 2Z94A 4MVNA 3ZZ9A 8GCHG 3RXIA 4D7FA 5TCCA 2J38A 1IQFA 1DS2E 5JB8S 4YLUA 1S81A 2HRVA 1O38A 1W14U 2HALA 5EXLA 4Q7XA 1VGCB 2K1QA 1O2HA 3LH1A 3E1XB 1YCPM 3RXUA 1EZSC 3FP8E 4MPUA 3MO3A 4MG3A 3PROA 1O2WA 1BMMH 1W0YH 3UWJH 3ZVFA 1DVAH 1C2KA 2GZ7A 3RXVA 4UFFH 2FWWA 1KDQB 1ZOMA 1BB0B 1E37B 1SGFA 3V3MA 3AW1A 5GIBA 1Z8RA 2PUXB 4X8UH 1LHCH 3ZZAA 1GBCA 1C1WH 1F2SE 1BBRE 4NZQA 1GJ7B 1ELFA 1K22H 3Q77A 1MTVA 1SGEE 1KIGH 2BOKA 2A7JA 2PTCE 2A4RA 2C90B 1SI5H 2FTLE 3JZ2B 1L4ZA 1UVOA 4IW4E 3T25A 2R3YA 3PWCA 2J9NA 1ACBE 4AG1A 2UUYA 3IWMA 3PMAB 3MFJA 2BXUH 3GICB 4ZROA 5FAHA 1G9IE 2GZ8A 1UTJA 2QXHA 1OYQA 3BTDE 2PKSB 3EA8A 5DP9A 3GCTF 4YOIA 2J94A 1EATA 3TH3H 3ZVDA 2PR3A 3SNCA 1ELTA 2BLWA 2ZCLP 4JZFH 1OPHB 1LQEA 2TBSA 3ZZ5A 4D7GA 4K2YA 4WH6A 2TPIZ 2BMGB 3KN2A 3E0NB 2A2XH 3A88A 1TPOA 1SGTA 1GJCB 1EASA 1DXPA 5FPYA 1QA0A 2QC2A 1HAYB 2C3SA 1RS0A 5GWZA 1HYLA 2XC4A 1O37A 3CS0A 4DIIH 1QJ7B 2V6NA 1AMHA 3ATIA 1P8VC 1UHBA 5AVDA 1O5BB 1TABE 1HJ9A 4E05H 1CA8B 5AFZH 4DURA 1FV9A 1HAHH 4YT6H 1MBMA 1GHZA 2VU8E 2EI7A 4JYTA 1GJAB 3RMMH 2QYIA 1WBGB 3KCGH 1FJSA 1WAYB 1HFDA 2ZA5A 2CHAC 1C1VH 1ESAA 2ULLA 2BXTH 2CMYA 3SNEA 1VJ9U 4NFEA 4Y0ZE 1O2UA 2A5IA 4WMFA 1DXWA 1G3CA 1MTWA 1ETTH 1T8OA 3TK6A 3FVFB 2NU2E 1V2TT 1PPZA 1O5CB 5EQRA 2A32A 3GCNA 1CGJE 1FN8A 3K6ZA 4E06H 4XSKU 1OS8A 3ATKA 1SGDE 4H6SB 1ANCA 1TGCA 3R3GB 4FUJA 1IHTH 4OS2A 4YESB 1XX9A 3R0FA 2FOGA 3MU4A 4JZEH 1AU8A 1QQ4A 5C1YA 1LVOA 2AIPA 1TQ7B 2ZCKP 3DFJA 1BTPA 3SOSA 2GTBA 1C4U2 1HUTH 3M36A 1DLKB 3MU5A 1O2PA 1ELEE 3KL6A 2TGDA 4A1TA 5DP8A 4GHTA 1GHBG 2C8YB 1O3FA 4AG2A 1KSNA 1D3PB 1BOQA 3OX7U 1UK2A 1UVTH 3TNTA 2FYQA 1QURH 3BTQE 3A7YA 1IQEA 1LO6A 3F9GA 2WINI 1F0TA 3QZQA 1DE7H 7LPRA 2CN0H 4LK4A 1JMOH 4I8KA 2FI3E 3M5LA 3LGYA 1J16A 3SI3H 1CHOG 1CHGA 2PFEA 3A7TA 3PWBA 1CU1A 2W7SA 1W3CA 1UMAH 1UTKA 3O8CA 2AGEX 1QL8A 5F8XA 3KHVA 4FUEA 2G52A 4ZKRU 5C1XA 1C4Y2 1HJAB 2ZGHA 1C1MA 2BVSH 1NRNH 3TPIZ 4TY7A 4O3TA 3KQEA 5GPIB 1H9IE 2Y5FA 1VZQH 5A0BA 1WCZA 3M3VA 2ZU1A 2FOFA 2ZDVH 4MNXA 3RXTA 5L2YH 3SU0A 3UNSA 2R9PA 2CJIA 1HCGA 1YYY1 2H1UA 2YOLA 4CRFA 3TGKE 1BCUH 1NESE 3O8DA 3AASA 1O2GH 1THSH 4HTCH 4Q80A 3ZZCA 4X2YA 4B2AA 1RXPA 1XXFA 1LPGB 2SGDE 1HAVB 3T27A 4THNH 1A2CH 1OSSA 4I8LA 4K60A 1GDQA 4H6TA 3ZZDA 1OWIA 1LHDH 3RXHA 1TX6A 4JCNA 3P8NA 5T6FA 3SGAE 4FU8A 3MO6A 1TYNA 7GCHG 2AS9A 1QHRB 1C5MD 1A3BH 2SGFE 2BY7X 3F9FA 4BAHB 3RXCA 2G5NA 4GSOA 1B7XB 2VIDA 1ZTKA 1C5NH 1IQIA 3TK9A 3UWIA 1ZHPA 4DT7B 2ZFSA 3ODDA 5E2PA 2IN2A 6LPRA 1OWHA 2ZHQH 4RN6A 1C9PA 1ARBA 2GCTB 1PPHE 1HAOH 3DHKH 1Y3XA 2BD4A 3QO6A 4Y6DA 1M9UA 1GBJA 5FHTA 1C5ZB 1GBFA 1EAWA 2Y82A 1C1PA 1BA8B 4ABEA 1GHAF 2XC5A 1SFQB 3BEUA 3D62A 1EKBB 3T28A 2UWLA 4CR9A 2ODYB 3V7TA 3MO9A 2KAIB 2BM2A 1V2UT 1NFUA 1Y59T 3OTJE 1HV7A 1P05A 1O2JA 1ZGIA 1CA0C 4LOYH 3FP7E 3BTGE 3GCOA 1LVYA 4ASHA 2QF0A 1S0QA 5GCHF 2HWLB 3BEIB 2VH0A 1A5GH 4CRDA 2AGGX 2YNAA 2O8UA 5DP3A 1TGTA 2ANMH 2UUKB 4NSYA 5A2MH 1P01A 2FOEA 4GLYA 3S9AA 3TGJE 1AUTC 2Y5HA 2ALVA 4RSPA 1C2GA 2VGCB 5B6OA 4Q7YA 1EPTA 4NZLA 1C5RA 5CE1A 4R0IA 1MCTA 1V2VT 5FX5A 3A8DA 5K7RA 1MKXH 1PPFE 2ZGCA 2XNIA 3E3TA 5GCHG 5T6DA 5C67A 2WYJA 4ABHA 3A8CA 4ZAEA 1ZTJA 4YM9A 5F6MA 3P17H 1P3EA 1K1JA 3P92A 4BAQB 1ZHMA 2H5CA 3A7ZA 1BTHH 3AAUA 2A1DB 1TIOA 1V2ST 1ZYOA 3VB4A 1T4UH 5J4QA 3GCHB 3GDSA 4FUGA 4AB8A 1ZMJA 1SGFG 2PUQH 3S9CA 2F9BH 1O36A 2PGBB 3UIRA 1QA7A 1A61H 1D4PB 1K1PA 1L2EA 3Q3XA 2FOHA 4JZIA 1DFPA 1TMBH 2A4GA 1IQKA 2QV1A 2RA3A 1GVLA 4A1VA 2ZU3A 2WPMS 1C5LH 4NWKA 3TJVA 1KDQA 4DCDA 1XUHA 2FX6A 5PTPA 3A89A 1FY1A 5JBBS 2PKSC 1P2MA 4Y8ZA 4WY3A 4GCHF 1H8DH 1BMAA 3TIUA 4LXBH 1QBNA 1EB1H 1P9SA 2FOAA 1NC6A 2VB0A 2PWXA 1FPHH 4ZHLU 2J95A 1GJ6A 4XFQA 1C9TA 5EXNA 3RXJA 1A46H 1QRWA 2QA9E 1BHXF 1L0ZA 2PLXA 1LKBA 3SJ9A 3E6PH 1HGTH 2SGAA 1XVMA 1CT0E 1NN6A 2LPRA 6CHAC 3HPTB 4K1SA 4KTUA 1AN1E 1GWAA 6CHAB 5EU8A 3KF2A 3N7OA 3K65B 4TWYA 2ZGJA 1ZMLA 1YF4A 2DE9A 4WXVA 1O3IA 2PTNA 3QN7A 3S7KB 3M5OA 3M5NA 1A1RA 2SGEE 8KME2 3RC5A 5LPRA 3PTNA 1P2QA 1L1NA 1TNIA 2FZZA 1QB6A 1J9CH 1P3CA 1W2KH 3BSQA 3ZZ8A 1D3TB 1EPTC 1NFXA 3TVJB 2A4OA 1Z1JA 3NUMA 3ATWA 1NFYA 3SZNA 1BUIA 1GBLA 1YPMH 2BTCE 1GBHA 1AVXA 1MQ5A 5LPEA 4LZ4B 1MU6B 4JK6A 1VITF 1SC8U 3EYDA 4BTUB 4MQAA 3QWCH 1CGIE 1SSXA 2ZPQA 2ZPRA 2GV6A 4FUIA 2W26A 2JKHA 1P09A 2FOBA 1ZGVA 1DDJA 2FS9A 4I33A 3ELAH 1SVPA 1BBRK 4I32A 3LGTA 1CVWH 1DY8A 3MYWA 1NU9A 1T8LA 4AYYB 1GJ5H 1KYNA 1GGDC 1BTZA 4YOJA 2XBYA 2OCVB 3M35A 2GT7A 4FVDA 1XUKA 2F9OA 1O32A 1MMJN 1YLCA 5E0JA 1H8IH 1AVGH 1L1GA 2ZECA 2R2MB 3EGKH 1TOMH 4K3JA 1PPCE 1EX3A 3PO1C 1WU1A 4MLFB 1GJBB 1KLJH 1NRSH 2G51A 1WYKA 2SFAA 3A84A 1TWXB 3B23B 4H42U 2TIOA 3A81A 3RXBA 2FEQH 4B2BA 3ZYEA 1VCWA 2ZFFH 4DOQA 5JB9S 3I77A 5HM9A 3RLYH 1KXCA 2ANWA 2G55A 1GBKA 5ESTE 1K9OE 1C5SA 4ISNA 1SGCA 1BRAA 1W12U 3OSYA 1HJAC 4NA9H 3LIWA 1G36A 1SGIB 1GPZA 1GJ8B 2VGCC 4K5ZA 1PPGE 2XC0A 4CR5A 5A0CA 1UVPA 1ELGA 2AGIX 2P93A 4F49A 1CA0B 3K2UA 1SGYE 4U2WA 4YOGA 4B76A 3RXFA 1ZZZA 2XW9A 4M7GA 9LPRA 2Z9LA 1O3CA 4Y0YE 2CV3A 1OWJA 4MPWA 4XBCA 4K8BA 4D76A 5T3HA 5C5OA 1QQUA 2ZHEH 7GCHF 5IYTA 1C5XB 4GAWA 1GVZA 4X1QU 4I7YH 1FNIA 3GY3A 2ZU5A 4X8VH 1AIXH 5E8EH 2GCTC 1UTQA 2Z3DA 2A2QH 3QZRA 3FP6E 1Z1IA 3T62A 2GCHF 2V0BA 2Z9GA 3S7HB 1P2OA 2VIQA 4BOHA 1A5IA 4OS1A 1FPCH 2ZFQH 3A82A 1O5EH 2BDBA 3HKJB 1PQ7A 1UO6A 1ANBA 5E0HA 2D2DA 1K1NA 2P3UB 5JPMH 5JYIA 2BY5X 3F6UH 1XUJA 1C2DA 1Y5UT 5JBTA 4K1TA 4X2WA 2BDCA 3A8BA 4KTCA 1FZZA 1GL0E 1RIWC 5FX6A 1CO7E 1C5YB 2GD4B 3AVZA 2GDDA 1MD7A 4QT8C 1HPGA 2FXRA 2EI6A 1NRRH 4ZXYH 1HAXB 2ZPSA 1TOCB 3MNXA 3LONA 2GDEH 4VGCC 2A7CA 4JK5A 2ZHWH 4ISLA 1TLDA 1V6DA 4INHA 1GI7B 3QUMP 2THFB 2A31A 1VGCC 3NZIA 1MH0A 1F5RA 3EA7A 1TA6A 2OQ5A 1YLDA 2RA0A 1O3KA 4Q7ZA 4R8TB 7KMEH 1HNEE 2F91A 3SV2H 4DG4A 3DT0H 4DIHH 2C4FH 2H9EH 2XXLA 1HLTH 4XE4A 5DKMA 1SG8B 1FIWA 3B8JA 4Y7AA 2BD2A 1GMHF 2BY6X 4D9QA 2VVCA 4OS5A 3PLBA 1P2JA 1EP5A 4NGAH 1T32A 1TGBA 1QY6A 1GHBF 1BMLA 1SLXB 4A5TS 1OP2A 2VWOA 3QGJA 5FBIA 2OUAA 1K21H 3UTUH 1SLWB 3GCHC 4VGCB 1ZTLA 2ANKH 1GI4A 3L3TA 3SGQE 1HAZB 1EJMA 1F7ZA 1GI3A 1SFIA 4JZ1A 1O2SA 1HAIH 1E38B 1P03A 3PMHB 2P8OB 3LPRA 1KXEA 5EGMA 3BG8A 1AD8H 1DM4B 1MKWH 3BTFE 2BX3A 1O3OA 4A7IB 1GJ4H 1GHXH 1C2JA 2ZQ1A 1IQMA 1YBWA 2V3HH 8GCHF 1GHWH 1ELBA 1XM1A 1DWEH 2ZP0H 5IDKA 5BRRE 4X6OA 2P59A 2ZDAH 1ELVA 1SHYA 3SQEE 1AWFH 1SQAA 2Y5GA 3P8GA 1Y3VA 2BQ6B 3IITA 1S85A 1P11E 1YPJH 2PHBA 2AMPA 3TITA 3FZZA 3MH7A 3NKKA 3BTWE 1DOJA 3BEFB 4CH2B 1BRUP 1ZR0A 2FM2A 4Y76A 3LH3A 5F8ZA 1Z8JB 5HYOA 1WQVH 1EJNA 5DJ7A 1V2MT 3UUZA 1UTOA 2FOMB 3RM2H 1Y5AT 4CBOA 1GVKB 1MCVA 1O2IA 4UEHH 3RXGA 3V13A 1HAPH 3VXEH 3RXRA 1VJAU 2J34A 3VGCB 3ZV8A 4O3UA 4MNYA 2EEKA 2BY9X 4JMYA 1IQJA 1KTSB 1RJXB 1EUFA 4UFDH 2J2UA 3HKIB 2R2WU 3ZVEA 2HLCA 3OU0A 3F9EA 5E0GA 1ABJH 3SU3A 1EAXA 3ODFA 2YNBA 4X2VA 2G4TA 3RXOA 4NA7A 1YM0A 2CXVA 3SJKA 1TX8A 3ZZBA 4IC6A 2OC1A 4UD9H 4BXSA 1C5VA 3SV8A 1QNJA 1AE5A 1KXBA 3E91A 1CBWB 1C2IA 2SNVA 4UONA 4U01A 3SV9A 4X8TH 1XKAC 3GDUA 2P95A 5EXMA 2FO9A 3SNDA 2PGQB 4SGAE 3M61U 4J2YB 2WV4A 1LDTT 2JH6D 2QY0B 2STBE 1KTTB 4D8NA 3A86A 2FPZA 2FYRA 4INKA 4HFPB 4GHQA 4X6PA 3F68H 1BBRH 5DP4A 3BF6H 3H7OA 4NIWA 4JZDH 2QGRA 1IQNA 1PYTC 4HZHA 2EA3A 1ELDE 2GP9B 2OC8A 3LGIA 3FAOA 4AZ2B 3PYHA 2QAAA 3OY5U 1SR5C 1GCTC 1JXPA 1Y3WA 2J92A 3VEQB 1DSTA 3L33A 2Z9JA 3P95A 1GBMA 3SJOA 1S0RA 3QGNB 3GY2A 1RTLA 2Z3EA 1O2KA 1OWDA 4NIYA 2FESH 2ZFTA 1LHEH 3HK3B 1THPB 1MTNB 1MZDA 1N8OC 1ZSKA 5K0HA 4D9RA 1S82A 1C5UA 3NCLA 3MNBA 1K28D 4DW2U 1TQ0B 1PQAA 4OS6A 3EQ0H 1HJ8A 1EOJA 1QL7A 3SNAA 5GXPA 1Y5BT 4WVPE 3RMOH 1C2MA 2FX4A 1HAVA 2ZU4A 3TJNA 2BD9A 1H4WA 1BIOA 1AO5A 1C2EA 1VCPA 1HXFH 5CHAC 2BVRH 4X2XA 5DPAA 4CREA 1SPJA 2WYGA 1NM6A 2FLRH 2XRCA 2VWMA 5ESBA 1C5WB 1T8MA 4AOQA 1EZUC 2C8WB 1BJUA 2NU4E 5TCAA 4ZMAH 3D65E 1TNLA 2ZGXH 3LJOA 5EW1H 2F9PA 3T29A 1GCTB 1QCPA 3KIDU 4TPYA 1YPHE 1GI6A 5ETXA 1SOZA 4LZ1H 1LPKB 4O97A 5C1UA 1FLEE 1NFWA 5H4IB 1O3MA 2ZHFH 4XOJA 1LQDB 1O34A 3PO1B 3BIUH 3MHWU 3O8RA 2H9HA 3SN8A 1ZSLA 2ZEBA 3T5FH 2RCEA 3UFAA 5GJ4B 3RXKA 1N8OB 3TLOA 1UTLM 4X1RU 1ELAA 3SGBE 1TAWA 4Y71A 2H9TH 4FUBA 4MTBA 3EE0B 3M7TA 3TJUA 1IQLA 1OYTH 1OP0A 3I29A 4A1XA 3PV4A 1OXGA 4X8SH 1QBVH 5FCRA 2ZNKH 2XWBI 4BTIB 1TBQH 2ZFPH 1MD8A 2HNTC 3RC4A 1Q31A 3RXLA 4CH8B 2A45B 3KNXA 5G4BA 1EXFA 3KEEA 2BD8A 3SNBA 4DGJA 4X1SU 1G3EA 3URDA 1Y3UA 2FODA 9ESTA 5C3NA 1BRCE 1S6HA 2VIPA 3LOXA 1K1LA 2OTVA 4WXIA 3L6PA 1CQQA 1A5HA 2BLOA 1V2WT 1TBZH 4TWWA 1HAGE 4ZXXH 4Y11E 3SV6A 3S0NA 3RU4E 1BRBE 1P0SH 4Z6AH 1ZPBA 1FY3A 1MQ6A 5DK1A 3W94A 1AB9C 3QTOH 1GMCF 1YPEH 2VJ1A 2PKAB 2C93B 2A7HA 1F5LA 4NA8A 1TPAE 2O9QA 2OINA 4XBBA 5EQSA 1BZXE 2B9LA 5HXFA 1H1BA 4ABIA 4KP0A 2P94A 5FXLA 4RKJB 1C2HA 1UTPA 2OP9A 1GBEA 3PLKA 3Q76A 1UCYH 2TRMA 3LC3A 3MNSA 4B2CA 5FBEA 1LKAA 2O8TA 3A7XA 3RU4T 1O3BA 2FTMA 1UK3A 2FIRH 3MH6A 2VIVA 1THRH 1DWCH 4OGXA 2ZWLH 2UWOA 4FUDA 1WUNH 1GBDA 1TX7A 1LCYA 1MAXA 1BTYA 3EA9A 4IBLH 1SQTA 2AYWA 5FPSA 2ESTE 1AUJA 4BXWA 4XBDA 2QIQA 3MU0A 1A3EH 1O2ZA 3TNSA 3PB1E 2ASUB 2FDAA 1UJ1A 1P10A 4FUFA 5F8TA 4J1YA 4CRCA 2B0FA 3TK5A 2QCYA 1HXEH 1XXDA 1PFXC 3RU4D 3VB3A 3JZ1B 1P2KA 1FN6A 1DSUA 2W3IA 2A0QB 3BIVH 4H4FA 1DPOA 4OGYA 2HVXA 4OS4A 2DUCA 4JYUH 1XUIA 4KELA 1P2NA 1QGFA 3U69H 2ZC9H 1N1LA 4FU7A 3RXEA 4ZH8A 3BG4B 1AFQC 1MZAA 1TE0A 5EPYA 3NXPA 1YGCH 3P6ZB 3UOPA 2F9VA 3ZVGA 1O2VA 2ZG0H 1GDNA 3SHAH 1NT1A 3SJ8A 1FIZA 4WMDA 1CSOE 2WPHS 2P16A 2PSYA 2F3CE 1LTOA 3A8AA 1AVWA 1HIAA 2RDLA 5DP6A 2OQUA 1UCYK 1O3PB 2BD7A 1IHSH 1X7AC 2JH0D 1ZPZA 3GY8A 2Q6GA 1Y3YA 3GOVB 2SGPE 3LGWA 2VWLA 1P2IA 3ZV9A 1W11U 2BOHB 4KGAA 3SQHE 3BTKE 4GCHG 3ITIA 2OXSA 3EDXB 3MTYA 1AQ7A 4AFSA 3UR6A 1E35B 1P02A 1TA2A 1O2QA 1P04A 1DLEA 1JBUH 1D9IA 1KLTA 2VWNA 2NU3E 1GBBA 3OYPA 1QJ1B 3VFEA 3ATMA 1DT2A 1G32B 4DY7B 3NWUA 4ISOA 2Z9IA 5DO4H 1UVUH 2R3UA 2B7DH 1ANEA 5FPTA 1TNHA 5JDUB 1EPTB 2ZTXA 2I6QA 2WPJS 5JBCS 2ZIQH 4DVAU 3P8FA 1J15A 4IMZA 1S6FA 3ESTA 4ISHH 1CGHA 5L6NH 1AHTH 2TGAA 1YCPH 3MH5A 4AORA 1GI0A 3UPEA 1ETSH 4YT7H 5AFYH 1XUGA 4Y8XA 2BDIA 3LT3A 5LH8A 4ZHAA 2C8XB 4GUXA 1C1TA 1V2KT 3HGNA 2OBQA 2VVUA 1AE8H 2P8OC 1BQYA 1O3HA 3W95A 4FU9A 1S5SA 5A8XA 4A92A 7ESTE 5I46H 1B0EA 2BQWB 1A0HB 1W13U 3ATLA 3MU1A 3SBKA 2WUBA 4NWLA 2QXGA 3NPSA 3GY7A 1GI5A 4X1NU 1PPEE 1KXFA 3GCTG 5JBAS 1Q3XA 5ABWA 1CHOF 4B74A 1G3BA 1MBQA 3NK8A 1C1QA 1GHVH 2FI4E 2G4UA 4AX9H 1A0LA 4ABAA 1V2NT 2GCHG 3U1IB 1EQ9A 3URCA 1LPZB 1RD3B 4O03A 4WH8A 6GCHF 4B73A 1NRPH 2Q1JA 3SU5A 3STJA 2BZAA 1TNGA 4IGDA 2NU1E 3UOUA 3AW0A 2OC7A 2Y80A 1YP9A 4DJZB 1MUEB 2F83A 3V12A 3VPKA 1ZHRA 3SV7A 4AGKA 4MNVA 3QDZB 1FAXA 1HBTH 1DITH 1MKWK 3MU8A 1O35A 1NY22 4NSVA 4Y8YA 3SJIA 1XVOA 1Q2WA 2VH6A 5DP5A 1KXAA 5FCKA 2WPIS 1G37A 1ETRH 2BX4A 1CT2E 1GGDB 2I6SA 3QX5H 3SO3A 1GBIA 8ESTE 1IQHA 1C2FA 5J4SA 1XMNB 1E34B 5L2ZH 4PROA 2H6MA 1BITA 2F9NA 1AFEH 2ZFRH 1GMDG 4Z0KA 3ZVAA 1Z8IB 1D6WA 1ID5H 1O2NA 2QN5T 1W7XH 2Z6BD 4TYDA 4BAKB 2R0LA 2KAIA 1C1RA 2SNWA 1E0FD 1W0ZU 1N6YA 4YLQH 3RXAA 3UREA 3C1KA 2ILNA 1YPKH 2BZ6H 1ZMNA 3GY5A 3Q3KA 1N6XA 1C5PA 4ESTE 1KY9A 1F0UA 1ESTA 2OBOA 3BTEE 2GGVB 1WTGH 1OKXA 1L1JA 1QFKH 1P06A 4YO9A 1OWKA 2UUFB 1KLIH 2XWAA 3V0XA 2Y81A 3RMLH 1PPBH 1WQSA 4BTTB 2BD5A 4ABDA 5HGGA 2D26C 3M5MA 1PYTD 1K2I1 3ZVCA 1O30A 2R0KA 1BTXA 1SOTA 1Z71A 1SL3A 2O8LA 2VVVA 2QXIA 3ENSB 4U30A 2GKVE 1O33A 4WF8A 4RKOB 3QK1A 3T2NA 3IG6B 3PMBB 2ZZUH 3S9BA 1FMGA 4UFGH 2Y6TA 5HM2A 1GBAA 4BAOB 3DD2H 2FP7B 2ANYA 1V2JT 4I8JA 1O5AB 4ABGA 1C5QA 1UVSH 4IC5A 2ZTYA 4X0WU 2NU0E 1OOKB 3A87A 5EODA 2SGQE 1VITG 2GV7A 4B71A 4AYVB 1ZRKA 1SHHB 2WPLS 5T6GA 1LVMA 1AZZA 3RXSA 2ODPA 3MI4A 1J8AA 2BDHA 4NCYA 3MH4A 2CF9H 3FZDA 1TGSZ 2G00A 2V3OH 4TPIZ 1AGJA 2JH5D 1O2LA 2AMQA 1O3LA 1O5FH 2ZDNA 1B5GH 1UTMA 4O9VA 2JETB 2OC0A 3P8OA 4MPVA 1EP6A 5DG6A 2XBXA 1WTHD 1RGQA 2ZDLA 3UNRA 2BVXH 2FS8A 1SGNE 1B0FA 2QF3A 1PQ5A 2ALPA 3HK6B 3UY9A 1QR3E 4YZUA 2UUJB 1EJAA 4INLA 2O8WA 1P9UA 1AFQB 3DFLA 1GI2A 4TY6A 1FQ3A 4E7RG 1NRQH 5EPNA 5I25A 4I8GA 1O3GA 3LDXH 1C2LA 1H9LB 1TALA 2ZDMA 2CGAA 3DA9B 1NU7B 1UCYE 2QXJA 4E7NA 2J4IA 2GX4A 1GL1A 3GDVA 3FANA 1SBWA 1O3DA 3U1JB 1T8NA 2IOTA 4I31A 5EG4A 2HPPH 4JYVH 2G81E 3ZZ4A 3K6YA 1IOEA 3U8TH 1K1IA 1GMDF 3P70B 3GYMA 1O3JA 2AMDA 3SW2B 1HB0B 2FMJA 4CHAB 1W10U 2BLQA 3M7QA 4Y10E 1GJDB 4BAMB 1AKSB 1GMHG 1FUJA 2A5AA 3A7WA 4BNRA 4AB9A 1ANDA 1G30B 2TGPZ 2WPKS 4WWYA 1TB6H 4K8YA 1BDAA 1BHXB 3VXFH 3H5CB 5CHAB 1SLVB 3VB6A 2HOBA 4Q2KA 1NS3A 4IS5A 3BV9B 1D3DB 4KTSA 1O2YA 2VIWA 1YC0A 6GCHG 1DUEA 1HRTH 1SLUB 3ZZ3A 3UNQA 3KQCA 1JRTA 3M3SA 2ZU2A 4FUCA 2NWNA 2ZO3H 1QIXB 4B1TA 3A7VA 1C5OH 1SGPE 2A5KA 4AGJA 2V35A 4X1PU 1QB1A 1H9HE 3SORA 3RP2A 3E90B 1BJVA 1RRKA 3H7TA 4CHAC 3PLPA 1NTPA 4KKDA 2GVFA 1TPPA 2XTTB 1D3QB 2GMTB 2RG3A 4HGCA 2CF8H 3Q00A 3D23A 2XBWA 3AAVA 3RXDA 1V3XA 1V2RT 1E36B 2G5VA 4FUHA 3TH2H 1ORFA 2AERH 3RMNH 3OY6U 3BTHE 1LMWB 4UE7H 1NZQH 4ABBA 1FI8A 1VCQA 1MTSA 3KQDA 4MDSA 4AFUA 2BLVA 1W8BH 2Z9KA 1GI8B 2W3KA 4ZKNU 5L30H 5LGOA 1V2LT 4U32A 1TNKA 1RTKA 4FVBA 3SUEA 1TGNA 3VB7A 1PJPA 2ZQ2A 2ZHDA 2B5TB 3RXMA 3BG4C 1QRXA 5A8ZA 1C1OA 5TJXA 1QJ6B 1GMCG 1F0RA 2FOCA 4CRAA 1GHYH 1ZJKA 4Y7BA 3ZZ7A 4YTAA 1INCA 1AKSA 2AH4X 1GHAG 1J14A 1CBWC 3BTME 4NG9H 2XCFA 5EW2H 2GMTC 1EZQA 2LNCA 3QLPH 3GYLB 1MTUA 2BQ7B 1O3AA 1BMNH 3VGCC 2P3FH 3LU9B 1GBTA 1FONA 1DANH 5AF9H 1JIRA 4X6MA 1A7SA 2BB4A 1FY8E 2FI5E 4ZHMU 4Y79A 1TBRH 1YPGH 2H5DA 2TGTA 1SB1H 4FXGH 1JWTA 1PQ8A 1XKBC 1TFXA 1U6QA 4ABJA 3A83A 3Q3YA 1AZ8A 3QTVH 1T31A 2HNTF 3LJJA 1CT4E 3U9AH 1K1OA 3MMGA 1LVBA 2IPHA 3A85A 1S84A 1TNJA 2FLBH 3BN9A 5A0AE 1XUFA 4I8HA 3S69A 2OD3B 2F9UA 1ARCA 1KXDA 4AFQA 3MWIU 3SU2A 1EOLA 1O39A 3CS7A 1C1SA 1Z6JH 3ZZ6A 1MKXK 1VITH 4ZKSU 1O3EA 1EAUA 1TRMA 1VR1H 1A0JA 4WMEA 1D6RA 4B75A 3TJOA 4IMQA 5DGJA 3ZYDA 1G2MA 1ZPCA 2D8WA 4ABFA 1DUAA 2BDYA 3I78A 1GJ9B 1HDTH 2PSXA
chains in the Genus database with same CATH superfamily
2BY8X 2CHAB 1AB9B 2DE8A 2XBVA 3STIA 3DUXH 1O2XA 1F0SA 3LKWA 2ZCHP 5BPEA 1CE5A 1T4VH 5EQQA 1ZLRA 1FY4A 5E2OA 1O2RA 4MNWA 2AEIH 1EZXC 4AN7A 1MTNC 1QB9A 2AIQA 1MAYA 2XYAA 5HMAA 3UQVA 1A4WH 3GY6A 3UR9A 1C4V2 3G01A 2XCNA 4HI3A 2ZGBH 2RDEA 5C2ZA 1O5GH 3C27B 1BTUA 2ZKSA 1NBME 1WOFA 2HGTH 3DCLA 1ELCA 2ZTZA 4NFFA 2ZI2H 1LHFH 4GPGA 3E8LA 2H2ZA 1TONA 3HATH 1Z6EA 4NIVA 4OS7A 1C1UH 2K0QA 4UDWH 3PMJA 3ZVBA 2PW8H 1YCPK 3U98H 3F9HA 1NO9H 3SUFA 1V2PT 3SUGA 3RXQA 1YKTA 5F03A 2ZF0H 2C8ZB 2WV5A 1GI1A 1WSSH 3EAJA 5CMXH 2PKAA 1NPMA 4WJG2 2STAE 4UFEH 3RXPA 1C5TA 2EC9H 2VINA 3VB5A 1MU8B 3WY8A 3M37A 5HIYA 1HIAB 2O8MA 1UHBB 1O5DH 1SGRE 2Y7XA 3TU7H 2Q6DA 2WV9A 4SGBE 3B9FH 5C20A 1F5KU 3GY4A 1ABIH 3RC6A 2OLGA 1SQOA 1GG6B 2KR7A 2W7UA 3LGUA 2GZ9A 1JRSA 3K9XB 1G3DA 1TMUH 3RLWH 3SU4A 1EAIA 1FY5A 1YPHC 5EOKA 1DWBH 5A8YA 1C1NA 6ESTA 3W1EA 3SI4H 3DSPA 1Z8GA 1DWDH 3LGVA 5EJ1A 1UK4A 1TPSA 3N7EA 1ESBA 1L4DA 2AFQB 4B6FA 3CNRA 2LP6A 4ISIH 1O2MA 1T7CA 2Z7FE 3T26A 5A09A 4XDEA 4ZKOU 2BD3A 5AHGH 2B8OH 1RTFB 3TGIE 1OX1A 3PM3A 2G8TA 4K69A 1QL9A 2BYAX 1RFNA 1GCDA 3KGPA 1GI9B 2VIOA 1JOUB 1FXYA 3PTBA 2Z3CA 4X6NA 1QRZA 2KZ4A 3O8BA 1S83A 3SU6A 4IN1A 1J17T 2GT8A 3E16B 2HPQH 4TSFD 3SUDA 1OWEA 1TRYA 4CBNA 1AI8H 3SHCH 1BTWA 1O31A 1P12E 1SGQE 1Y8TA 2A4QA 2D1JA 3RDZA 1V2QT 2BDAA 4ZUHA 1F92A 3MOCA 4IN2A 1WV7H 4F4OC 1ZSJA 2WZQA 4ASUD 1AWHB 3HGPA 4MPXA 2W5EA 3CP7A 3U8RH 3KQBA 8LPRA 3GISB 4CRBA 2UWPA 3D49H 3M7UA 5SGAE 1OP8A 1QBOA 4GVUA 2HNTE 1DY9A 1UTNA 3RM0H 2IJOB 3MNCA 4CRGA 2EI8A 5C5NA 2K8IA 1DX5M 2ZDKA 1V2OT 4A6LA 1GG6C 3SZEA 1Z7KA 1ZJDA 4NIXA 2P3TB 3BTTE 3SU1A 1FDPA 2Q6FA 1IQGA 2V7QD 4BANB 1ZRBA 1BT7A 2WUCA 1O3NA 1G2LA 1K1MA 2ODQA 3M3TA 3TH4H 3E0PB 1QTFA 3RUOA 3A80A 1W7GH 4AFZA 1P57B 1TMTH 1YPLH 3U8OH 5LPFA 3CENA 3LC5A 1EB2A 2VNTA 1COWD 4K1EA 1SMFE 1AY6H 1O2TA 5GDSH 2BHGA 5DP7A 3UQOA 1RIWB 2Y7ZA 1O2OA 1DICA 1O0DH 1IAUA 3F1SB 2PV9B 2M5TA 1LHGH 1GDUA 1JIMA 1FAKH 3FFGA 2JETC 1NROH 1TRNA 2BDGA 2Z94A 3FKSD 4MVNA 3ZZ9A 8GCHG 3RXIA 4D7FA 5TCCA 2J38A 1IQFA 1DS2E 5JB8S 4YLUA 1S81A 2HRVA 1O38A 1W14U 2HALA 5EXLA 4Q7XA 1VGCB 2K1QA 1O2HA 3LH1A 3E1XB 1YCPM 3RXUA 1EZSC 3FP8E 4MPUA 3MO3A 4Z1MD 4MG3A 3PROA 1O2WA 1BMMH 1W0YH 3UWJH 3OTPA 3ZVFA 1DVAH 1C2KA 3UAIC 2GZ7A 3RXVA 4UFFH 2FWWA 1KDQB 1ZOMA 1BB0B 1E37B 1SGFA 3V3MA 3AW1A 5GIBA 1Z8RA 2PUXB 4X8UH 1LHCH 3ZZAA 1GBCA 1C1WH 1F2SE 1BBRE 4NZQA 1GJ7B 1ELFA 1K22H 3Q77A 1MTVA 1SGEE 1KIGH 4TT3D 2BOKA 2A7JA 2PTCE 2A4RA 2C90B 1SI5H 2FTLE 3JZ2B 1L4ZA 1UVOA 4IW4E 3T25A 2R3YA 3PWCA 2J9NA 1ACBE 4AG1A 2UUYA 3IWMA 3PMAB 3MFJA 2BXUH 3GICB 4ZROA 5FAHA 1G9IE 2GZ8A 1UTJA 2QXHA 1OYQA 1YY3A 3BTDE 2PKSB 3EA8A 5DP9A 3GCTF 4YOIA 3WWBA 2J94A 1EATA 3TH3H 3H09A 3ZVDA 2PR3A 3SNCA 1ELTA 2BLWA 2ZCLP 4JZFH 1OPHB 1LQEA 2TBSA 3ZZ5A 4D7GA 4K2YA 4WH6A 2TPIZ 2BMGB 3KN2A 3E0NB 2A2XH 3A88A 1TPOA 1SGTA 1GJCB 1EASA 1DXPA 5FPYA 1QA0A 2QC2A 1HAYB 2C3SA 1RS0A 5GWZA 1HYLA 1O37A 2XC4A 3CS0A 5C0UA 4DIIH 1QJ7B 2V6NA 1AMHA 3ATIA 1P8VC 1UHBA 5AVDA 2RFKC 1O5BB 1TABE 1HJ9A 4E05H 3FN8A 1CA8B 2F43B 5AFZH 4DURA 1FV9A 3F0PA 1HAHH 4YT6H 1MBMA 1GHZA 2VU8E 2EI7A 4JYTA 1GJAB 3RMMH 2QYIA 1WBGB 3KCGH 1FJSA 1WAYB 1HFDA 2ZA5A 2CHAC 1C1VH 1ESAA 2ULLA 2GJGA 2BXTH 2CMYA 3SNEA 1VJ9U 4NFEA 4Y0ZE 1O2UA 2A5IA 4WMFA 1DXWA 1G3CA 1MTWA 1ETTH 1T8OA 3TK6A 3FVFB 2NU2E 1V2TT 1PPZA 1O5CB 5EQRA 2A32A 3GCNA 1CGJE 1FN8A 3K6ZA 4E06H 4XSKU 1OS8A 3ATKA 1SGDE 1K0HA 4H6SB 1ANCA 1TGCA 3R3GB 4FUJA 1IHTH 4OS2A 4YESB 1XX9A 3R0FA 2FOGA 4XRNA 3MU4A 3WW7A 4JZEH 1AU8A 1QQ4A 5C1YA 1LVOA 2AIPA 1TQ7B 2ZCKP 3DFJA 2M2AA 4M9FA 1BTPA 5CDFE 3SOSA 2GTBA 3EE7A 1C4U2 1HUTH 3M36A 1DLKB 3MU5A 1O2PA 1ELEE 3KL6A 2TGDA 4A1TA 5DP8A 4GHTA 1GHBG 2C8YB 1O3FA 4AG2A 1KSNA 1D3PB 1BOQA 3NRLA 3OX7U 1UK2A 1UVTH 3TNTA 2FYQA 1QURH 3BTQE 3A7YA 1IQEA 1LO6A 3F9GA 2WINI 1F0TA 3QZQA 1DE7H 7LPRA 2CN0H 4LK4A 1JMOH 4I8KA 2FI3E 3M5LA 3LGYA 1J16A 3SI3H 1CHOG 1CHGA 2PFEA 3A7TA 3PWBA 1CU1A 2W7SA 1W3CA 3PRBA 1UMAH 1UTKA 3O8CA 2AGEX 1QL8A 5F8XA 3KHVA 4FUEA 2G52A 4ZKRU 5C1XA 1C4Y2 1HJAB 2ZGHA 1C1MA 2BVSH 1NRNH 3TPIZ 4TY7A 4O3TA 4B6EA 3KQEA 5GPIB 1H9IE 2Y5FA 1VZQH 5A0BA 1WCZA 3M3VA 2YMSC 2FOFA 2ZDVH 2ZU1A 4MNXA 3RXTA 5L2YH 3SU0A 3UNSA 2R9PA 2CJIA 2KCPA 1HCGA 1YYY1 2H1UA 2YOLA 4CRFA 3TGKE 1BCUH 2J98A 1NESE 3O8DA 3AASA 1O2GH 1THSH 4HTCH 4Q80A 3ZZCA 4X2YA 4B2AA 1RXPA 1XXFA 1LPGB 2SGDE 2XNDD 1HAVB 3T27A 4THNH 1A2CH 5KGOA 1OSSA 4I8LA 4K60A 1GDQA 4H6TA 3ZZDA 1OWIA 1LHDH 3RXHA 1TX6A 4JCNA 3P8NA 5T6FA 3SGAE 4FU8A 3MO6A 1TYNA 7GCHG 2AS9A 1QHRB 1C5MD 1A3BH 2SGFE 2BY7X 3F9FA 4BAHB 3RXCA 2G5NA 4GSOA 1B7XB 2VIDA 5C94A 1ZTKA 1C5NH 1IQIA 3TK9A 3UWIA 1ZHPA 3UB0A 4DT7B 2ZFSA 3ODDA 5E2PA 2IN2A 6LPRA 1OWHA 2ZHQH 4RN6A 1C9PA 1ARBA 2GCTB 1PPHE 5DN6D 1HAOH 3DHKH 5HIZA 1Y3XA 2BD4A 3QO6A 4Y6DA 1M9UA 1GBJA 5FHTA 1C5ZB 1GBFA 1EAWA 2Y82A 2XOKD 1C1PA 1BA8B 4ABEA 1GHAF 2XC5A 1SFQB 3BEUA 3D62A 1EKBB 3T28A 2UWLA 4CR9A 2ODYB 3V7TA 3MO9A 2KAIB 2BM2A 2JJ2D 1V2UT 3OFND 1NFUA 1Y59T 3OTJE 1HV7A 1P05A 2KM0A 1O2JA 1ZGIA 1CA0C 4LOYH 3FP7E 3BTGE 3GCOA 1LVYA 4ASHA 2QF0A 1S0QA 5GCHF 2HWLB 3BEIB 2VH0A 1A5GH 4CRDA 2AGGX 2YNAA 2O8UA 5DP3A 1TGTA 2ANMH 2UUKB 4NSYA 5A2MH 1P01A 2FOEA 4GLYA 3S9AA 3TGJE 1AUTC 2Y5HA 2ALVA 4RSPA 1C2GA 2VGCB 5B6OA 4Q7YA 1EPTA 4NZLA 1C5RA 5CE1A 4R0IA 1MCTA 1V2VT 4RT0A 5FX5A 3A8DA 5K7RA 1MKXH 1PPFE 2ZGCA 2XNIA 3E3TA 5GCHG 5T6DA 5C67A 2WYJA 4ABHA 3A8CA 4ZAEA 1ZTJA 4YM9A 5F6MA 2IPQX 3P17H 1P3EA 1K1JA 3P92A 4BAQB 1ZHMA 2H5CA 3A7ZA 1BTHH 3AAUA 2A1DB 1TIOA 1V2ST 1ZYOA 3VB4A 1T4UH 5J4QA 3GCHB 3GDSA 4FUGA 4AB8A 1ZMJA 1SGFG 2PUQH 3S9CA 2F9BH 1O36A 2PGBB 3UIRA 1QA7A 1A61H 1D4PB 1K1PA 1L2EA 3Q3XA 2FOHA 4JZIA 1DFPA 1TMBH 2A4GA 1IQKA 2QV1A 2RA3A 1GVLA 4A1VA 2ZU3A 2WPMS 1C5LH 4NWKA 3TJVA 1KDQA 4DCDA 1XUHA 2FX6A 5PTPA 3A89A 1FY1A 5JBBS 5KECA 2PKSC 3PV2A 1P2MA 4Y8ZA 4WY3A 4GCHF 1H8DH 1BMAA 3TIUA 4LXBH 1QBNA 4P00A 1EB1H 1P9SA 2FOAA 3VG8A 1NC6A 2VB0A 2PWXA 1FPHH 4ZHLU 2J95A 1GJ6A 4XFQA 1C9TA 5EXNA 3RXJA 1A46H 1QRWA 2QA9E 1OHHD 1BHXF 1L0ZA 2PLXA 1LKBA 3SJ9A 3E6PH 1HGTH 2SGAA 1XVMA 1UW7A 3ZIAD 1CT0E 1NN6A 2LPRA 6CHAC 3HPTB 4K1SA 4KTUA 1AN1E 1GWAA 3F2GA 6CHAB 5EU8A 3KF2A 3N7OA 3K65B 4TWYA 2ZGJA 1ZMLA 1YF4A 2DE9A 2JDID 4WXVA 2LELA 1O3IA 2PTNA 3QN7A 3S7KB 3M5OA 3M5NA 1A1RA 2SGEE 8KME2 3RC5A 5LPRA 3PTNA 1P2QA 1L1NA 1S6LA 1TNIA 2FZZA 1QB6A 1J9CH 1P3CA 1W2KH 3BSQA 3ZZ8A 1D3TB 1EPTC 1NFXA 3TVJB 2A4OA 1Z1JA 3NUMA 3ATWA 1NFYA 1H8HD 3SZNA 1BUIA 1GBLA 1YPMH 2BTCE 1GBHA 1AVXA 1MQ5A 5EIYA 5LPEA 4LZ4B 1MU6B 4JK6A 1VITF 1SC8U 3EYDA 4BTUB 4MQAA 3QWCH 1CGIE 1SSXA 2ZPQA 2ZPRA 2GV6A 4FUIA 2W26A 2JKHA 1P09A 2FOBA 1ZGVA 1DDJA 2FS9A 4I33A 3ELAH 1SVPA 1BBRK 4I32A 3LGTA 1CVWH 1DY8A 3MYWA 1NU9A 1T8LA 4AYYB 1GJ5H 1KYNA 1GGDC 2HLDD 1BTZA 4YOJA 2XBYA 2OCVB 3M35A 2GT7A 5B6LA 4FVDA 1XUKA 1WDIA 2F9OA 1O32A 1MMJN 1YLCA 5E0JA 1H8IH 1AVGH 1L1GA 2ZECA 2R2MB 3EGKH 1TOMH 4K3JA 1PPCE 1EX3A 3PO1C 3KYFA 1WU1A 5GNDA 4MLFB 1GJBB 1KLJH 1NRSH 2G51A 1WYKA 2SFAA 3A84A 1TWXB 3B23B 4H42U 2TIOA 3A81A 3RXBA 2FEQH 4B2BA 3ZYEA 1VCWA 2ZFFH 4DOQA 5JB9S 3I77A 5HM9A 3RLYH 1KXCA 2ANWA 2G55A 1GBKA 5ESTE 1K9OE 1C5SA 4ISNA 1SGCA 1BRAA 1W12U 3OSYA 1HJAC 4NA9H 3LIWA 1G36A 1SGIB 1GPZA 1GJ8B 2VGCC 4K5ZA 1PPGE 2XC0A 1SQRA 4CR5A 5A0CA 1UVPA 1ELGA 2AGIX 2P93A 4F49A 1CA0B 3K2UA 1SGYE 4U2WA 4YOGA 4B76A 3RXFA 1ZZZA 2XW9A 4M7GA 9LPRA 2Z9LA 1O3CA 4Y0YE 2CV3A 1OWJA 4MPWA 4XBCA 4K8BA 3OEHD 5T3HA 4D76A 5C5OA 4FOUC 1QQUA 2ZHEH 7GCHF 5IYTA 1C5XB 4GAWA 1GVZA 4X1QU 4I7YH 1FNIA 3GY3A 2ZU5A 4X8VH 1AIXH 5E8EH 2PP6A 2GCTC 1UTQA 2Z3DA 2A2QH 3QZRA 3FP6E 1Z1IA 3T62A 2GCHF 2V0BA 2Z9GA 3S7HB 1P2OA 2VIQA 4BOHA 1A5IA 4OS1A 1FPCH 2ZFQH 3A82A 1O5EH 2BDBA 3HKJB 1PQ7A 1UO6A 1ANBA 5E0HA 2D2DA 1K1NA 2P3UB 5JPMH 5JYIA 2BY5X 3F6UH 1XUJA 1C2DA 3DSGA 1Y5UT 5JBTA 4K1TA 4X2WA 2BDCA 3A8BA 4KTCA 3FO8D 1FZZA 1GL0E 1RIWC 5FX6A 1CO7E 1C5YB 2GD4B 3AVZA 2QF4A 2GDDA 1MD7A 4QT8C 1HPGA 2FXRA 2EI6A 1NRRH 4ZXYH 1HAXB 2ZPSA 1TOCB 3MNXA 3LONA 2GDEH 2KFWA 4VGCC 2A7CA 4JK5A 2ZHWH 4ISLA 1TLDA 1V6DA 4INHA 2YMSD 1GI7B 3QUMP 2THFB 2A31A 1VGCC 3NZIA 1MH0A 1F5RA 3EA7A 1TA6A 2OQ5A 1YLDA 2RA0A 1O3KA 4Q7ZA 4R8TB 7KMEH 1HNEE 2F91A 3SV2H 4DG4A 3DT0H 4DIHH 2C4FH 2H9EH 2XXLA 1HLTH 4XE4A 5DKMA 1SG8B 2KCAA 1FIWA 3B8JA 4Y7AA 2BD2A 1GMHF 2BY6X 4D9QA 2VVCA 4OS5A 3PLBA 1P2JA 1EP5A 4NGAH 1T32A 1TGBA 1QY6A 1GHBF 1BMLA 1SLXB 4A5TS 1OP2A 2VWOA 3QGJA 5FBIA 2OUAA 1K21H 3UTUH 1SLWB 3GCHC 4VGCB 1ZTLA 2ANKH 1GI4A 3L3TA 3SGQE 1HAZB 1EJMA 1F7ZA 1GI3A 1SFIA 2W6JD 4JZ1A 1O2SA 1HAIH 1E38B 1P03A 3PMHB 2P8OB 3LPRA 2HVYB 1KXEA 5EGMA 3BG8A 1AD8H 1DM4B 1MKWH 3BTFE 2BX3A 1O3OA 4A7IB 1GJ4H 1GHXH 1C2JA 2ZQ1A 1IQMA 1YBWA 2V3HH 8GCHF 3AK5A 1GHWH 1ELBA 1XM1A 1DWEH 2ZP0H 5IDKA 5BRRE 4X6OA 2P59A 2ZDAH 1ELVA 1SHYA 3SQEE 1AWFH 1SQAA 2Y5GA 3P8GA 1Y3VA 2BQ6B 3IITA 1S85A 1P11E 1YPJH 1W0KD 2AMPA 2PHBA 3TITA 3FZZA 3F3BA 3MH7A 3NKKA 3BTWE 1DOJA 3BEFB 4CH2B 1BRUP 1ZR0A 2FM2A 4Y76A 3LH3A 5F8ZA 1Z8JB 5HYOA 1WQVH 1EJNA 5DJ7A 1V2MT 3UUZA 1UTOA 2FOMB 3RM2H 1Y5AT 4CBOA 1GVKB 1MCVA 1O2IA 4UEHH 3RXGA 3V13A 1HAPH 3VXEH 3RXRA 1VJAU 2J34A 3U28C 3VGCB 4O3UA 3ZV8A 4MNYA 3F2HA 2EEKA 2BY9X 4JMYA 1IQJA 1KTSB 1RJXB 1EUFA 4UFDH 2J2UA 3HKIB 2R2WU 3ZVEA 2HLCA 3OU0A 1SKYE 3F9EA 5E0GA 1ABJH 3SU3A 1EAXA 3ODFA 2YNBA 4X2VA 2G4TA 3RXOA 4NA7A 1YM0A 2CXVA 3SJKA 1TX8A 3ZZBA 4IC6A 2OC1A 4UD9H 4BXSA 1C5VA 3SV8A 1VKYA 1QNJA 5HKKD 2F4LA 1AE5A 1KXBA 3E91A 1CBWB 1C2IA 2SNVA 4UONA 4U01A 3N7DA 3SV9A 4X8TH 1XKAC 3GDUA 2P95A 5EXMA 2FO9A 4RT1A 3SNDA 2PGQB 4SGAE 3M61U 4J2YB 2WV4A 1LDTT 2JH6D 2QY0B 2STBE 1KTTB 4D8NA 3A86A 2FPZA 2FYRA 4INKA 4HFPB 4GHQA 4X6PA 3F68H 1BBRH 5DP4A 3BF6H 3H7OA 4NIWA 4JZDH 2QGRA 1IQNA 1PYTC 4ZCNA 2JIZD 4HZHA 2EA3A 1ELDE 2GP9B 2OC8A 2L74A 3LGIA 3FAOA 4AZ2B 5EJZA 3PYHA 2QAAA 3OY5U 1SR5C 1GCTC 1JXPA 1Y3WA 2J92A 3VEQB 1DSTA 3L33A 2Z9JA 3P95A 1GBMA 3SJOA 1S0RA 3QGNB 3GY2A 1RTLA 4HG6A 2Z3EA 1O2KA 1OWDA 4NIYA 2FESH 2ZFTA 1LHEH 3HK3B 1THPB 1MTNB 1MZDA 1N8OC 1ZSKA 5K0HA 4D9RA 1S82A 1C5UA 3NCLA 3MNBA 1K28D 5FL7D 4DW2U 1TQ0B 1PQAA 4OS6A 3EQ0H 1HJ8A 5T1VA 1EOJA 1QL7A 3SNAA 5GXPA 1Y5BT 4WVPE 3RMOH 1C2MA 2FX4A 1FX0B 1HAVA 2ZU4A 3TJNA 2BD9A 1H4WA 1BIOA 1AO5A 1C2EA 1VCPA 1HXFH 5CHAC 2BVRH 2L6OA 4X2XA 1MABB 5DPAA 4CREA 1SPJA 2WYGA 1NM6A 2FLRH 2XRCA 2VWMA 5ESBA 1C5WB 1T8MA 5C0TA 4AOQA 1EZUC 1H8ED 1W0JD 1BJUA 2C8WB 2NU4E 5TCAA 3WWFA 4ZMAH 3D65E 1TNLA 2ZGXH 3LJOA 5EW1H 2F9PA 3T29A 1GCTB 1QCPA 3KIDU 4TPYA 5C17A 5CHBA 1YPHE 1GI6A 5ETXA 1SOZA 4LZ1H 1LPKB 4O97A 5C1UA 1FLEE 1NFWA 5H4IB 1O3MA 2ZHFH 4XOJA 1LQDB 1O34A 3PO1B 3BIUH 3MHWU 3O8RA 2H9HA 3SN8A 1ZSLA 2ZEBA 1EFRD 3T5FH 2RCEA 3UFAA 2V3MA 5GJ4B 3RXKA 1N8OB 3TLOA 1UTLM 4X1RU 1ELAA 3SGBE 1E79D 1TAWA 4Y71A 2H9TH 4FUBA 4MTBA 3EE0B 3M7TA 3TJUA 1IQLA 1OYTH 1OP0A 3I29A 4A1XA 3PV4A 1OXGA 4X8SH 1QBVH 5FCRA 2ZNKH 2XWBI 4Q63A 4BTIB 1TBQH 2ZFPH 1MD8A 2HNTC 3RC4A 1Q31A 3RXLA 4CH8B 2A45B 3KNXA 5G4BA 1EXFA 3KEEA 2BD8A 3SNBA 4DGJA 4X1SU 1G3EA 3URDA 1Y3UA 2FODA 9ESTA 5C3NA 3PV5A 1BRCE 1S6HA 2VIPA 3LOXA 1K1LA 2OTVA 4WXIA 3L6PA 1CQQA 1A5HA 2BLOA 1V2WT 1TBZH 4TWWA 1HAGE 4ZXXH 4Y11E 3SV6A 3S0NA 3RU4E 1BRBE 1P0SH 4Z6AH 1ZPBA 2EY4C 1FY3A 1MQ6A 5DK1A 3W94A 1AB9C 3QTOH 3F0OA 1GMCF 1YPEH 2VJ1A 2PKAB 2C93B 2A7HA 3KQ5A 1F5LA 4I86A 3F2FA 4NA8A 1TPAE 2O9QA 2OINA 4XBBA 5EQSA 1BZXE 2B9LA 5HXFA 1H1BA 4ABIA 4KP0A 2P94A 5FXLA 2J5UA 4RKJB 1C2HA 1UTPA 2OP9A 1GBEA 3PLKA 3Q76A 1UCYH 2TRMA 3LC3A 3MNSA 4B2CA 2QF5A 5FBEA 1LKAA 2O8TA 3A7XA 3RU4T 3MQKC 1O3BA 2FTMA 1UK3A 2FIRH 3MH6A 2VIVA 1THRH 1DWCH 4OGXA 2ZWLH 2UWOA 4FUDA 1WUNH 1GBDA 1TX7A 1LCYA 1MAXA 1BTYA 3EA9A 4IBLH 1SQTA 2AYWA 5FPSA 2ESTE 1AUJA 4BXWA 4XBDA 2QIQA 3MU0A 1A3EH 1NBMD 1O2ZA 3TNSA 3PB1E 2ASUB 2FDAA 1UJ1A 1P10A 4FUFA 5F8TA 4J1YA 4CRCA 2B0FA 3FOAA 3TK5A 5IK2D 2QCYA 1HXEH 1XXDA 1PFXC 3RU4D 3VB3A 3JZ1B 1P2KA 1FN6A 1DSUA 2W3IA 2A0QB 3BIVH 4H4FA 1DPOA 4OGYA 3OAAD 2HVXA 4OS4A 2DUCA 4JYUH 1XUIA 4KELA 1P2NA 1QGFA 3U69H 2ZC9H 1N1LA 4FU7A 4F48B 3RXEA 4ZH8A 3BG4B 1AFQC 1MZAA 1TE0A 5EPYA 3NXPA 1YGCH 3P6ZB 3UOPA 2F9VA 3ZVGA 1O2VA 2ZG0H 1GDNA 3SHAH 1NT1A 3SJ8A 5F53A 1FIZA 4WMDA 1CSOE 2WPHS 2P16A 2PSYA 2F3CE 1LTOA 3A8AA 1AVWA 1HIAA 2RDLA 5DP6A 2OQUA 1YWUA 1UCYK 1O3PB 2BD7A 1IHSH 1X7AC 2JH0D 1ZPZA 3GY8A 2Q6GA 1Y3YA 3GOVB 2SGPE 3LGWA 2VWLA 1P2IA 3ZV9A 1W11U 2BOHB 4KGAA 3SQHE 3BTKE 3DSOA 4GCHG 3ITIA 2OXSA 3EDXB 3MTYA 1AQ7A 4AFSA 3UR6A 1E35B 1P02A 1TA2A 1O2QA 1P04A 1DLEA 1JBUH 1D9IA 1KLTA 2VWNA 2KCOA 2NU3E 1GBBA 3OYPA 1QJ1B 3VFEA 3ATMA 1DT2A 1G32B 4DY7B 4DT4A 3NWUA 4ISOA 2Z9IA 5DO4H 1UVUH 2R3UA 2B7DH 1ANEA 5FPTA 2WSSD 1TNHA 5JDUB 1EPTB 2ZTXA 2I6QA 2WPJS 5JBCS 2ZIQH 4Q4LA 4DVAU 3P8FA 1J15A 4IMZA 1S6FA 3ESTA 4ISHH 1CGHA 5L6NH 1AHTH 2TGAA 1YCPH 3MH5A 4AORA 1GI0A 3UPEA 1ETSH 4YT7H 2J98B 5AFYH 1XUGA 4Y8XA 2BDIA 3LT3A 5EJLA 5LH8A 4ZHAA 2C8XB 4GUXA 1C1TA 1V2KT 3HGNA 2OBQA 2VVUA 1AE8H 2P8OC 1BQYA 1O3HA 3W95A 4FU9A 1S5SA 5A8XA 4A92A 7ESTE 5I46H 1B0EA 2BQWB 1A0HB 1W13U 3ATLA 3MU1A 3SBKA 2WUBA 4NWLA 2QXGA 3NPSA 3GY7A 1GI5A 4X1NU 1PPEE 1KXFA 3GCTG 5JBAS 1Q3XA 5ABWA 1CHOF 4B74A 1G3BA 1MBQA 3NK8A 4F55A 1C1QA 1GHVH 2FI4E 2G4UA 2JJ1D 4AX9H 1A0LA 3GS9A 4ABAA 1V2NT 2GCHG 3U1IB 1EQ9A 3URCA 5DSFA 1LPZB 1RD3B 4O03A 4WH8A 2KX4A 6GCHF 4B73A 1NRPH 2Q1JA 2YMSB 3STJA 2BZAA 1TNGA 4IGDA 3SU5A 2NU1E 3UOUA 3AW0A 2OC7A 2Y80A 1YP9A 3OE7D 4DJZB 1MUEB 2F83A 3V12A 3VPKA 1ZHRA 4YXWD 3SV7A 4AGKA 4MNVA 3QDZB 1FAXA 1HBTH 1DITH 1MKWK 3MU8A 1O35A 1NY22 4NSVA 4Y8YA 3SJIA 1XVOA 1Q2WA 2VH6A 5DP5A 1KXAA 5FCKA 2WPIS 1G37A 1ETRH 2BX4A 1CT2E 1GGDB 2I6SA 3QX5H 3SO3A 4XD7D 1GBIA 8ESTE 1IQHA 1E1QD 1C2FA 5J4SA 1XMNB 1E34B 5L2ZH 4PROA 2H6MA 1BITA 2F9NA 1AFEH 2ZFRH 1GMDG 4Z0KA 3ZVAA 1Z8IB 1D6WA 1ID5H 1O2NA 2QN5T 1W7XH 2Z6BD 4TYDA 4BAKB 2R0LA 3N99A 2KAIA 1C1RA 2SNWA 1E0FD 1W0ZU 1N6YA 4YLQH 3RXAA 3UREA 4RI0A 3C1KA 2ILNA 1YPKH 2BZ6H 1ZMNA 3GY5A 3Q3KA 2QE7D 1N6XA 1C5PA 4ESTE 1KY9A 1F0UA 1ESTA 2OBOA 3BTEE 2GGVB 1WTGH 1OKXA 1L1JA 1QFKH 1P06A 4YO9A 1OWKA 2UUFB 2J97A 1KLIH 2XWAA 3V0XA 2Y81A 3RMLH 1PPBH 1WQSA 4BTTB 2BD5A 4ABDA 5HGGA 2D26C 3M5MA 2VBCA 1PYTD 1K2I1 3ZVCA 2IJD1 1O30A 2R0KA 1BTXA 1SOTA 1Z71A 1SL3A 2O8LA 2VVVA 2QXIA 3ENSB 2OK5A 3SYJA 4U30A 2GKVE 1O33A 4WF8A 4RKOB 3QK1A 5KEDA 3T2NA 3IG6B 3PMBB 2ZZUH 3S9BA 1FMGA 4UFGH 2Y6TA 5HM2A 1GBAA 4ACAA 4BAOB 3DD2H 2FP7B 2ANYA 3PRDA 1V2JT 4I8JA 1O5AB 1BMFD 4ABGA 1C5QA 1UVSH 4IC5A 2ZTYA 4X0WU 2NU0E 1OOKB 3A87A 5EODA 2SGQE 1VITG 2GV7A 4B71A 4AYVB 1ZRKA 1SHHB 2WPLS 5T6GA 1LVMA 1AZZA 3RXSA 2ODPA 3MI4A 1J8AA 2BDHA 4NCYA 3MH4A 2CF9H 3FZDA 1TGSZ 2G00A 2V3OH 4TPIZ 1AGJA 2JH5D 1O2LA 2AMQA 1O3LA 1O5FH 2ZDNA 1B5GH 1UTMA 4O9VA 2JETB 2OC0A 3P8OA 4MPVA 1EP6A 5DG6A 2XBXA 1WTHD 1RGQA 2ZDLA 3UNRA 2BVXH 2FS8A 1SGNE 1B0FA 2QF3A 1PQ5A 2ALPA 3HK6B 3UY9A 1QR3E 1E1RD 4YZUA 2UUJB 1EJAA 4INLA 2O8WA 1P9UA 1AFQB 2WHXA 3DFLA 1GI2A 4TY6A 1FQ3A 4E7RG 1NRQH 5EPNA 5I25A 4I8GA 1O3GA 3LDXH 1C2LA 1H9LB 1TALA 2ZDMA 2CGAA 3DA9B 1NU7B 1UCYE 2QXJA 4E7NA 2J4IA 2GX4A 1GL1A 3GDVA 3FANA 1SBWA 1O3DA 3U1JB 1T8NA 2IOTA 4I31A 5EG4A 2HPPH 4JYVH 2G81E 3ZZ4A 3K6YA 1IOEA 3U8TH 1K1IA 1GMDF 3P70B 3GYMA 1O3JA 2AMDA 3SW2B 1HB0B 2FMJA 4CHAB 1W10U 2W6ID 1KMHB 2BLQA 3M7QA 4Y10E 1GJDB 4BAMB 1AKSB 1GMHG 1FUJA 2A5AA 3A7WA 4BNRA 4AB9A 1ANDA 1G30B 2TGPZ 2WPKS 4WWYA 1TB6H 4K8YA 1BDAA 1BHXB 3VXFH 3H5CB 5CHAB 1SLVB 3VB6A 2HOBA 4Q2KA 1NS3A 4IS5A 3BV9B 1D3DB 4KTSA 1O2YA 2VIWA 4OM9A 1YC0A 6GCHG 1DUEA 1HRTH 1SLUB 3ZZ3A 3UNQA 3KQCA 1JRTA 3M3SA 2ZU2A 4FUCA 2NWNA 2ZO3H 1QIXB 4B1TA 3A7VA 1C5OH 1SGPE 2A5KA 4AGJA 2V35A 4X1PU 1QB1A 1H9HE 3SORA 3RP2A 3E90B 1BJVA 1RRKA 3H7TA 4CHAC 3PLPA 1NTPA 4KKDA 2GVFA 1TPPA 2XTTB 1D3QB 1YLNA 2GMTB 2RG3A 4HGCA 2CF8H 3Q00A 3D23A 2XBWA 3AAVA 3RXDA 1V3XA 1V2RT 1E36B 2G5VA 4FUHA 3TH2H 1ORFA 2AERH 3RMNH 3OY6U 3BTHE 1LMWB 4UE7H 1NZQH 4ABBA 1FI8A 1VCQA 1MTSA 3KQDA 4MDSA 4ACBA 4AFUA 2BLVA 1W8BH 2Z9KA 1GI8B 2W3KA 4ZKNU 5L30H 5LGOA 1V2LT 4U32A 1TNKA 1RTKA 4FETA 4FVBA 1QZ8A 3SUEA 1TGNA 3VB7A 1PJPA 2ZQ2A 2ZHDA 2B5TB 3RXMA 3BG4C 1QRXA 5A8ZA 1C1OA 5TJXA 1QJ6B 1GMCG 1F0RA 2FOCA 4CRAA 1GHYH 1ZJKA 4Y7BA 3ZZ7A 4YTAA 1INCA 1AKSA 2AH4X 1GHAG 1J14A 1CBWC 3BTME 4NG9H 2XCFA 5EW2H 2GMTC 1EZQA 2LNCA 3QLPH 3GYLB 1MTUA 2BQ7B 1O3AA 1BMNH 3VGCC 1WXRA 2P3FH 3LU9B 1GBTA 1FONA 1DANH 5AF9H 1JIRA 4X6MA 1A7SA 2BB4A 1FY8E 2FI5E 4ZHMU 4Y79A 1TBRH 2WPDD 1YPGH 2H5DA 2TGTA 1SB1H 4FXGH 1JWTA 1PQ8A 1XKBC 1TFXA 1U6QA 4ABJA 3A83A 3Q3YA 1AZ8A 2KCYA 1T31A 3OEED 3QTVH 2HNTF 4AC9A 3LJJA 1CT4E 3U9AH 1K1OA 3MMGA 1LVBA 2IPHA 3A85A 1S84A 1TNJA 2FLBH 3BN9A 5A0AE 1XUFA 4I8HA 3S69A 2OD3B 2F9UA 1ARCA 1KXDA 4AFQA 2CK3D 3MWIU 3SU2A 1EOLA 3KYGA 1O39A 3CS7A 1C1SA 1Z6JH 3ZZ6A 4P02A 1MKXK 1VITH 4ZKSU 1O3EA 1EAUA 1TRMA 1VR1H 1A0JA 2AHME 4WMEA 1D6RA 2EQNA 4B75A 3TJOA 4IMQA 5DGJA 3ZYDA 1G2MA 1ZPCA 2D8WA 4ABFA 1DUAA 2BDYA 3I78A 1GJ9B 1HDTH 2PSXA
chains in the Genus database with same CATH topology
2BY8X 2CHAB 1AB9B 2DE8A 2XBVA 3STIA 3DUXH 1O2XA 1F0SA 3LKWA 2ZCHP 5BPEA 1CE5A 1T4VH 5EQQA 1ZLRA 1FY4A 5E2OA 1O2RA 4MNWA 2AEIH 1EZXC 4AN7A 1MTNC 1QB9A 2AIQA 1MAYA 2XYAA 5HMAA 3UQVA 1A4WH 3GY6A 3UR9A 1C4V2 3G01A 2XCNA 4HI3A 2ZGBH 5C2ZA 1O5GH 3C27B 1BTUA 2ZKSA 1WOFA 2HGTH 1ELCA 2ZTZA 4NFFA 2ZI2H 1LHFH 4GPGA 3E8LA 2H2ZA 1TONA 3HATH 1Z6EA 4NIVA 4OS7A 1C1UH 4UDWH 3PMJA 3ZVBA 2PW8H 1YCPK 3U98H 3F9HA 1NO9H 3SUFA 1V2PT 3SUGA 3RXQA 1YKTA 5F03A 2ZF0H 2C8ZB 2WV5A 1GI1A 1WSSH 3EAJA 5CMXH 2PKAA 1NPMA 4WJG2 2STAE 4UFEH 3RXPA 1C5TA 2EC9H 2VINA 3VB5A 1MU8B 3WY8A 3M37A 1HIAB 2O8MA 1UHBB 1O5DH 1SGRE 2Y7XA 3TU7H 2Q6DA 4SGBE 3B9FH 5C20A 1F5KU 3GY4A 1ABIH 3RC6A 2OLGA 1SQOA 1GG6B 2W7UA 3LGUA 2GZ9A 1JRSA 3K9XB 1G3DA 1TMUH 3RLWH 3SU4A 1EAIA 1FY5A 1YPHC 5EOKA 1DWBH 5A8YA 1C1NA 6ESTA 3SI4H 1Z8GA 1DWDH 3LGVA 1UK4A 1TPSA 1ESBA 1L4DA 2AFQB 4ISIH 1O2MA 1T7CA 2Z7FE 3T26A 5A09A 4XDEA 4ZKOU 2BD3A 5AHGH 2B8OH 1RTFB 3TGIE 1OX1A 3PM3A 2G8TA 4K69A 1QL9A 2BYAX 1RFNA 1GCDA 3KGPA 1GI9B 2VIOA 1JOUB 1FXYA 3PTBA 2Z3CA 4X6NA 1QRZA 3O8BA 1S83A 3SU6A 4IN1A 1J17T 2GT8A 3E16B 2HPQH 3SUDA 1OWEA 1TRYA 4CBNA 1AI8H 3SHCH 1BTWA 1O31A 1P12E 1SGQE 1Y8TA 2A4QA 2D1JA 3RDZA 1V2QT 2BDAA 4ZUHA 1F92A 3MOCA 4IN2A 1WV7H 4F4OC 1ZSJA 1AWHB 3HGPA 4MPXA 2W5EA 3CP7A 3U8RH 3KQBA 8LPRA 3GISB 4CRBA 2UWPA 3D49H 3M7UA 5SGAE 1OP8A 1QBOA 4GVUA 2HNTE 1DY9A 1UTNA 3RM0H 2IJOB 3MNCA 4CRGA 2EI8A 5C5NA 2ZDKA 1DX5M 1V2OT 4A6LA 1GG6C 1Z7KA 1ZJDA 4NIXA 2P3TB 3BTTE 3SU1A 1FDPA 2Q6FA 1IQGA 4BANB 1ZRBA 1BT7A 2WUCA 1O3NA 1G2LA 1K1MA 2ODQA 3M3TA 3TH4H 3E0PB 1QTFA 3RUOA 3A80A 1W7GH 4AFZA 1P57B 1TMTH 1YPLH 3U8OH 5LPFA 3CENA 3LC5A 1EB2A 2VNTA 4K1EA 1SMFE 1AY6H 1O2TA 5GDSH 2BHGA 5DP7A 3UQOA 1RIWB 2Y7ZA 1O2OA 1DICA 1O0DH 1IAUA 3F1SB 2PV9B 2M5TA 1LHGH 1GDUA 1JIMA 1FAKH 3FFGA 1NROH 1TRNA 2BDGA 2JETC 2Z94A 4MVNA 3ZZ9A 8GCHG 3RXIA 4D7FA 5TCCA 2J38A 1IQFA 1DS2E 5JB8S 4YLUA 1S81A 2HRVA 1O38A 1W14U 2HALA 5EXLA 4Q7XA 1VGCB 2K1QA 1O2HA 3LH1A 3E1XB 1YCPM 3RXUA 1EZSC 3FP8E 4MPUA 3MO3A 4MG3A 3PROA 1O2WA 1BMMH 1W0YH 3UWJH 3ZVFA 1DVAH 1C2KA 2GZ7A 3RXVA 4UFFH 2FWWA 1KDQB 1ZOMA 1BB0B 1E37B 1SGFA 3V3MA 3AW1A 5GIBA 1Z8RA 2PUXB 4X8UH 1LHCH 3ZZAA 1GBCA 1C1WH 1F2SE 1BBRE 4NZQA 1GJ7B 1ELFA 1K22H 3Q77A 1MTVA 1SGEE 1KIGH 2BOKA 2A7JA 2PTCE 2A4RA 2C90B 1SI5H 2FTLE 3JZ2B 1L4ZA 1UVOA 4IW4E 3T25A 2R3YA 3PWCA 2J9NA 1ACBE 4AG1A 2UUYA 3IWMA 3PMAB 3MFJA 2BXUH 3GICB 4ZROA 5FAHA 1G9IE 2GZ8A 1UTJA 2QXHA 1OYQA 3BTDE 2PKSB 3EA8A 5DP9A 3GCTF 4YOIA 2J94A 1EATA 3TH3H 3ZVDA 2PR3A 3SNCA 1ELTA 2BLWA 2ZCLP 4JZFH 1OPHB 1LQEA 2TBSA 3ZZ5A 4D7GA 4K2YA 4WH6A 2TPIZ 2BMGB 3KN2A 3E0NB 2A2XH 3A88A 1TPOA 1SGTA 1GJCB 1EASA 1DXPA 5FPYA 1QA0A 2QC2A 1HAYB 2C3SA 1RS0A 5GWZA 1HYLA 2XC4A 1O37A 3CS0A 4DIIH 1QJ7B 2V6NA 1AMHA 3ATIA 1P8VC 1UHBA 5AVDA 1O5BB 1TABE 1HJ9A 4E05H 1CA8B 5AFZH 4DURA 1FV9A 1HAHH 4YT6H 1MBMA 1GHZA 2VU8E 2EI7A 4JYTA 1GJAB 3RMMH 2QYIA 1WBGB 3KCGH 1FJSA 1WAYB 1HFDA 2ZA5A 2CHAC 1C1VH 1ESAA 2ULLA 2BXTH 2CMYA 3SNEA 1VJ9U 4NFEA 4Y0ZE 1O2UA 2A5IA 4WMFA 1DXWA 1G3CA 1MTWA 1ETTH 1T8OA 3TK6A 3FVFB 2NU2E 1V2TT 1PPZA 1O5CB 5EQRA 2A32A 3GCNA 1CGJE 1FN8A 3K6ZA 4E06H 4XSKU 1OS8A 3ATKA 1SGDE 4H6SB 1ANCA 1TGCA 3R3GB 4FUJA 1IHTH 4OS2A 4YESB 1XX9A 3R0FA 2FOGA 3MU4A 4JZEH 1AU8A 1QQ4A 5C1YA 1LVOA 2AIPA 1TQ7B 2ZCKP 3DFJA 1BTPA 3SOSA 2GTBA 1C4U2 1HUTH 3M36A 1DLKB 3MU5A 1O2PA 1ELEE 3KL6A 2TGDA 4A1TA 5DP8A 4GHTA 1GHBG 2C8YB 1O3FA 4AG2A 1KSNA 1D3PB 1BOQA 3OX7U 1UK2A 1UVTH 3TNTA 2FYQA 1QURH 3BTQE 3A7YA 1IQEA 1LO6A 3F9GA 2WINI 1F0TA 3QZQA 1DE7H 7LPRA 2CN0H 4LK4A 1JMOH 4I8KA 2FI3E 3M5LA 3LGYA 1J16A 3SI3H 1CHOG 1CHGA 2PFEA 3A7TA 3PWBA 1CU1A 2W7SA 1W3CA 1UMAH 1UTKA 3O8CA 2AGEX 1QL8A 5F8XA 3KHVA 4FUEA 2G52A 4ZKRU 5C1XA 1C4Y2 1HJAB 2ZGHA 1C1MA 2BVSH 1NRNH 3TPIZ 4TY7A 4O3TA 3KQEA 5GPIB 1H9IE 2Y5FA 1VZQH 5A0BA 1WCZA 3M3VA 2ZU1A 2FOFA 2ZDVH 4MNXA 3RXTA 5L2YH 3SU0A 3UNSA 2R9PA 2CJIA 1HCGA 1YYY1 2H1UA 2YOLA 4CRFA 3TGKE 1BCUH 1NESE 3O8DA 3AASA 1O2GH 1THSH 4HTCH 4Q80A 3ZZCA 4X2YA 4B2AA 1RXPA 1XXFA 1LPGB 2SGDE 1HAVB 3T27A 4THNH 1A2CH 1OSSA 4I8LA 4K60A 1GDQA 4H6TA 3ZZDA 1OWIA 1LHDH 3RXHA 1TX6A 4JCNA 3P8NA 5T6FA 3SGAE 4FU8A 3MO6A 1TYNA 7GCHG 2AS9A 1QHRB 1C5MD 1A3BH 2SGFE 2BY7X 3F9FA 4BAHB 3RXCA 2G5NA 4GSOA 1B7XB 2VIDA 1ZTKA 1C5NH 1IQIA 3TK9A 3UWIA 1ZHPA 4DT7B 2ZFSA 3ODDA 5E2PA 2IN2A 6LPRA 1OWHA 2ZHQH 4RN6A 1C9PA 1ARBA 2GCTB 1PPHE 1HAOH 3DHKH 1Y3XA 2BD4A 3QO6A 4Y6DA 1M9UA 1GBJA 5FHTA 1C5ZB 1GBFA 1EAWA 2Y82A 1C1PA 1BA8B 4ABEA 1GHAF 2XC5A 1SFQB 3BEUA 3D62A 1EKBB 3T28A 2UWLA 4CR9A 2ODYB 3V7TA 3MO9A 2KAIB 2BM2A 1V2UT 1NFUA 1Y59T 3OTJE 1HV7A 1P05A 1O2JA 1ZGIA 1CA0C 4LOYH 3FP7E 3BTGE 3GCOA 1LVYA 4ASHA 2QF0A 1S0QA 5GCHF 2HWLB 3BEIB 2VH0A 1A5GH 4CRDA 2AGGX 2YNAA 2O8UA 5DP3A 1TGTA 2ANMH 2UUKB 4NSYA 5A2MH 1P01A 2FOEA 4GLYA 3S9AA 3TGJE 1AUTC 2Y5HA 2ALVA 4RSPA 1C2GA 2VGCB 5B6OA 4Q7YA 1EPTA 4NZLA 1C5RA 5CE1A 4R0IA 1MCTA 1V2VT 5FX5A 3A8DA 5K7RA 1MKXH 1PPFE 2ZGCA 2XNIA 3E3TA 5GCHG 5T6DA 5C67A 2WYJA 4ABHA 3A8CA 4ZAEA 1ZTJA 4YM9A 5F6MA 3P17H 1P3EA 1K1JA 3P92A 4BAQB 1ZHMA 2H5CA 3A7ZA 1BTHH 3AAUA 2A1DB 1TIOA 1V2ST 1ZYOA 3VB4A 1T4UH 5J4QA 3GCHB 3GDSA 4FUGA 4AB8A 1ZMJA 1SGFG 2PUQH 3S9CA 2F9BH 1O36A 2PGBB 3UIRA 1QA7A 1A61H 1D4PB 1K1PA 1L2EA 3Q3XA 2FOHA 4JZIA 1DFPA 1TMBH 2A4GA 1IQKA 2QV1A 2RA3A 1GVLA 4A1VA 2ZU3A 2WPMS 1C5LH 4NWKA 3TJVA 1KDQA 4DCDA 1XUHA 2FX6A 5PTPA 3A89A 1FY1A 5JBBS 2PKSC 1P2MA 4Y8ZA 4WY3A 4GCHF 1H8DH 1BMAA 3TIUA 4LXBH 1QBNA 1EB1H 1P9SA 2FOAA 1NC6A 2VB0A 2PWXA 1FPHH 4ZHLU 2J95A 1GJ6A 4XFQA 1C9TA 5EXNA 3RXJA 1A46H 1QRWA 2QA9E 1BHXF 1L0ZA 2PLXA 1LKBA 3SJ9A 3E6PH 1HGTH 2SGAA 1XVMA 1CT0E 1NN6A 2LPRA 6CHAC 3HPTB 4K1SA 4KTUA 1AN1E 1GWAA 6CHAB 5EU8A 3KF2A 3N7OA 3K65B 4TWYA 2ZGJA 1ZMLA 1YF4A 2DE9A 4WXVA 1O3IA 2PTNA 3QN7A 3S7KB 3M5OA 3M5NA 1A1RA 2SGEE 8KME2 3RC5A 5LPRA 3PTNA 1P2QA 1L1NA 1TNIA 2FZZA 1QB6A 1J9CH 1P3CA 1W2KH 3BSQA 3ZZ8A 1D3TB 1EPTC 1NFXA 3TVJB 2A4OA 1Z1JA 3NUMA 3ATWA 1NFYA 3SZNA 1BUIA 1GBLA 1YPMH 2BTCE 1GBHA 1AVXA 1MQ5A 5LPEA 4LZ4B 1MU6B 4JK6A 1VITF 1SC8U 3EYDA 4BTUB 4MQAA 3QWCH 1CGIE 1SSXA 2ZPQA 2ZPRA 2GV6A 4FUIA 2W26A 2JKHA 1P09A 2FOBA 1ZGVA 1DDJA 2FS9A 4I33A 3ELAH 1SVPA 1BBRK 4I32A 3LGTA 1CVWH 1DY8A 3MYWA 1NU9A 1T8LA 4AYYB 1GJ5H 1KYNA 1GGDC 1BTZA 4YOJA 2XBYA 2OCVB 3M35A 2GT7A 4FVDA 1XUKA 2F9OA 1O32A 1MMJN 1YLCA 5E0JA 1H8IH 1AVGH 1L1GA 2ZECA 2R2MB 3EGKH 1TOMH 4K3JA 1PPCE 1EX3A 3PO1C 1WU1A 4MLFB 1GJBB 1KLJH 1NRSH 2G51A 1WYKA 2SFAA 3A84A 1TWXB 3B23B 4H42U 2TIOA 3A81A 3RXBA 2FEQH 4B2BA 3ZYEA 1VCWA 2ZFFH 4DOQA 5JB9S 3I77A 5HM9A 3RLYH 1KXCA 2ANWA 2G55A 1GBKA 5ESTE 1K9OE 1C5SA 4ISNA 1SGCA 1BRAA 1W12U 3OSYA 1HJAC 4NA9H 3LIWA 1G36A 1SGIB 1GPZA 1GJ8B 2VGCC 4K5ZA 1PPGE 2XC0A 4CR5A 5A0CA 1UVPA 1ELGA 2AGIX 2P93A 4F49A 1CA0B 3K2UA 1SGYE 4U2WA 4YOGA 4B76A 3RXFA 1ZZZA 2XW9A 4M7GA 9LPRA 2Z9LA 1O3CA 4Y0YE 2CV3A 1OWJA 4MPWA 4XBCA 4K8BA 4D76A 5T3HA 5C5OA 1QQUA 2ZHEH 7GCHF 5IYTA 1C5XB 4GAWA 1GVZA 4X1QU 4I7YH 1FNIA 3GY3A 2ZU5A 4X8VH 1AIXH 5E8EH 2GCTC 1UTQA 2Z3DA 2A2QH 3QZRA 3FP6E 1Z1IA 3T62A 2GCHF 2V0BA 2Z9GA 3S7HB 1P2OA 2VIQA 4BOHA 1A5IA 4OS1A 1FPCH 2ZFQH 3A82A 1O5EH 2BDBA 3HKJB 1PQ7A 1UO6A 1ANBA 5E0HA 2D2DA 1K1NA 2P3UB 5JPMH 5JYIA 2BY5X 3F6UH 1XUJA 1C2DA 1Y5UT 5JBTA 4K1TA 4X2WA 2BDCA 3A8BA 4KTCA 1FZZA 1GL0E 1RIWC 5FX6A 1CO7E 1C5YB 2GD4B 3AVZA 2GDDA 1MD7A 4QT8C 1HPGA 2FXRA 2EI6A 1NRRH 4ZXYH 1HAXB 2ZPSA 1TOCB 3MNXA 3LONA 2GDEH 4VGCC 2A7CA 4JK5A 2ZHWH 4ISLA 1TLDA 1V6DA 4INHA 1GI7B 3QUMP 2THFB 2A31A 1VGCC 3NZIA 1MH0A 1F5RA 3EA7A 1TA6A 2OQ5A 1YLDA 2RA0A 1O3KA 4Q7ZA 4R8TB 7KMEH 1HNEE 2F91A 3SV2H 4DG4A 3DT0H 4DIHH 2C4FH 2H9EH 2XXLA 1HLTH 4XE4A 5DKMA 1SG8B 1FIWA 3B8JA 4Y7AA 2BD2A 1GMHF 2BY6X 4D9QA 2VVCA 4OS5A 3PLBA 1P2JA 1EP5A 4NGAH 1T32A 1TGBA 1QY6A 1GHBF 1BMLA 1SLXB 4A5TS 1OP2A 2VWOA 3QGJA 5FBIA 2OUAA 1K21H 3UTUH 1SLWB 3GCHC 4VGCB 1ZTLA 2ANKH 1GI4A 3L3TA 3SGQE 1HAZB 1EJMA 1F7ZA 1GI3A 1SFIA 4JZ1A 1O2SA 1HAIH 1E38B 1P03A 3PMHB 2P8OB 3LPRA 1KXEA 5EGMA