4GLYA

Human urokinase-type plasminogen activator upa in complex with the two-disulfide bridge peptide uk504
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Bicyclic Peptide Ligands Pulled out of Cysteine-Rich Peptide Libraries.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4glyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4glyA01
4FUCA 3TITA 1Y8TA 3ZZ6A 1MZAA 1QBNA 4IW4E 2BMGB 2BD9A 2JETC 1FNIA 4AYYB 4BXSA 2EI8A 2EI7A 1MTWA 2BZAA 3EGKH 3LT3A 5L2YH 1DANH 1KDQB 1BHXF 4ZAEA 4O97A 1FIWA 2FIRH 3UQOA 2ZU1A 3P8OA 2BY6X 4YT6H 2UWOA 3MI4A 3UTUH 1A0HB 1A0LA 1UCYK 2ZDMA 4LXBH 1GGDB 1EJMA 5JYIA 1RD3B 5FX6A 1A1RA 2VIOA 1Q31A 1TGSZ 3UOUA 1WAYB 2BQ7B 3TJOA 1GJDB 5C3NA 3TJUA 3MWIU 1BDAA 1DX5M 1OWEA 1CHOG 1UVOA 1SG8B 1AKSA 1SLVB 1D3TB 1W11U 4GSOA 1JIMA 1LVYA 2TGPZ 1YF4A 3S9CA 1KIGH 3PWCA 2GT7A 1YKTA 2D8WA 3M3VA 3SJ9A 3I29A 1V2OT 5DP9A 1DS2E 2CN0H 4UDWH 5CHAC 2OCVB 1Z71A 3SJIA 1GHBF 1O5AB 1TLDA 2F9PA 4LOYH 3H7TA 2VWLA 5EODA 2D26C 3LDXH 1OP2A 2I6QA 5EW2H 1O37A 2F9BH 1AMHA 4FUHA 3ZZ7A 4AB8A 1O3PB 2FI4E 4KP0A 1GHXH 4E7RG 3BIUH 1MTUA 2PTCE 2Q6FA 3SNCA 1YLDA 3A8CA 4WY3A 5ABWA 2ZKSA 1DXPA 1K1MA 1TNHA 2BD4A 3SNDA 2VGCC 2ZDVH 1NO9H 5DP5A 1SGIB 1DWCH 1EZSC 1FN8A 2TPIZ 1GWAA 2W3IA 1ELBA 5AHGH 1ZTKA 1BOQA 3NWUA 3QZQA 1TABE 1SGPE 2R2WU 1SOTA 2ZHFH 4IN1A 2GVFA 3G01A 2QYIA 2ZF0H 1F0TA 3P95A 4FUIA 1GBIA 1V2UT 4NWLA 1YPGH 2BLOA 2ZFSA 5FPSA 1AZ8A 1GJ8B 3GICB 2ZFFH 4JZDH 1ZMJA 4BTTB 1WBGB 1T31A 2ZHQH 3S7HB 3LOXA 3K65B 4E7NA 2ZU4A 1SBWA 3BEIB 3SV2H 1HAZB 1GI9B 1TNGA 1OP0A 1GVZA 4CH2B 5SGAE 1Y59T 1ZTJA 2FI3E 1RJXB 3LGTA 4X0WU 4SGAE 1DSTA 2ZDAH 1SFIA 1C2IA 3Q76A 3BTTE 1LQDB 1Z7KA 3A87A 3S69A 5A0BA 3RXKA 1O5GH 2ZGBH 3ZZ9A 4OS6A 4Q7XA 1BT7A 2ZNKH 3LJOA 4U01A 4WWYA 1O5CB 1WQVH 2A5AA 3A81A 2BY9X 1ZPCA 1ETRH 1LPGB 1FXYA 2QN5T 2HNTF 2A7CA 1MMJN 3MNBA 1QA7A 1Q3XA 1CGIE 2GKVE 3NK8A 4D9QA 1C2JA 4CHAB 3ATKA 1P01A 2HVXA 1V2RT 1UVSH 2SGQE 3BTGE 1NY22 3RXCA 2BXTH 4O3UA 2O8UA 1SLWB 4NZQA 3ZVAA 1KLTA 4TPIZ 2BLWA 4A1TA 4AB9A 2IN2A 2J2UA 4XBDA 2VVUA 3SBKA 1GI7B 1XVMA 1XKBC 2SGPE 1V2LT 1Z6EA 1EKBB 2BD8A 4Y7AA 2AMQA 1NRQH 2FP7B 4FUGA 5HYOA 3V13A 3PWBA 3BIVH 5EXMA 5GXPA 1EP6A 3O8BA 4K8YA 3RXOA 1C4U2 1LHFH 1H9LB 3B23B 3AW1A 1P0SH 4ESTE 1O2IA 5DPAA 3ODDA 3E6PH 1OYQA 3FP6E 3M5OA 2HOBA 2OC0A 4JCNA 2Y6TA 3E0PB 1YPKH 1FMGA 1O5DH 3KHVA 1GJ6A 2JH5D 2VVVA 3TJVA 3M7QA 1YC0A 4O9VA 3V12A 2OC8A 2UUYA 5GCHF 1VCPA 2P8OC 4UFFH 1PPZA 2QIQA 2P3TB 5FCKA 1UVPA 1RXPA 3ZV8A 2ZGHA 1XKAC 1C1TA 1G3CA 1HGTH 3QLPH 2B7DH 1GBJA 2H9HA 5JBAS 1UJ1A 3DUXH 1GHZA 1SQAA 2FLBH 3EAJA 2QGRA 3QX5H 1HYLA 1SGTA 2GCTB 1B5GH 3MO3A 4AFUA 1Q2WA 3MU4A 1Z6JH 3O8CA 2ZDKA 1OP8A 3SGAE 4DOQA 7GCHG 4BAHB 1G9IE 1GJCB 1TPOA 4K60A 1THRH 1NRPH 2CMYA 3T26A 4ZHAA 1IOEA 1RIWC 2B5TB 2ASUB 4FVDA 1AN1E 2W3KA 1SPJA 1C5OH 4CRBA 4BXWA 2QC2A 3F6UH 1GBFA 1TNKA 1WV7H 1HJ9A 4KTSA 3LGUA 2FOMB 1OWKA 4IN2A 3VFEA 4I32A 2GCHG 1AO5A 1DITH 5T6GA 3SV6A 3DFLA 2GV6A 2Q6GA 2WYJA 1EAXA 4B1TA 1W13U 2HPQH 2O8LA 1TX8A 1SL3A 5GIBA 3KQBA 1DWDH 1TGBA 1VITH 1RTFB 4NCYA 1C2DA 3W94A 2XNIA 4MNYA 1ESBA 1O34A 1FY1A 3KL6A 3A7TA 4ISOA 4X2WA 1GBHA 1CA8B 8ESTE 1W7GH 4Z6AH 2VVCA 3A7VA 3A7YA 1W10U 2BYAX 1LHCH 4B74A 1TX7A 1UK3A 1P12E 4ABEA 5C2ZA 1SHYA 3ATMA 4GHTA 2HPPH 1ZSKA 1ETSH 5PTPA 5DGJA 1YBWA 2HLCA 1BTYA 2EEKA 3BTKE 3E90B 3IWMA 5L30H 3K6YA 1NROH 1MD7A 4ZMAH 1UCYE 3OY5U 5E0JA 4FUJA 1TA6A 1XUHA 2QF0A 4DCDA 2D2DA 4X6PA 4ISLA 4RSPA 2FOHA 4BOHA 4MVNA 3SV7A 1ORFA 1KDQA 1FDPA 6LPRA 3TLOA 3TH4H 1S85A 1KLIH 1P11E 1O2TA 1T32A 1T4VH 2FOAA 3R0FA 3MNSA 3KEEA 3I78A 2ZI2H 1XUIA 1C1SA 3CP7A 3QK1A 2C8YB 2BD5A 3O8DA 3GDSA 2CXVA 1SGFA 3EA8A 1K1NA 3F9EA 2Y5FA 3SNBA 1QJ6B 1ID5H 2A1DB 2F3CE 1G2MA 2WPJS 3D65E 1ZZZA 2AMPA 6CHAC 4A92A 3K6ZA 1N8OB 2PV9B 1DDJA 2A7HA 1EXFA 2DE8A 1YPEH 1XUFA 1O3KA 1AWFH 1VITF 2ODPA 3K9XB 4Y6DA 1GJAB 2BD2A 4ABJA 2BVSH 1SMFE 2M5TA 4BAKB 2ZGXH 5FCRA 2CHAC 4OS7A 1SR5C 5F6MA 2P59A 1NT1A 4YO9A 1XX9A 3A82A 3UFAA 6GCHF 2ZTXA 2P3FH 5LPFA 3RXHA 1SGQE 5H4IB 1TYNA 1D9IA 1BBRK 1K21H 1LPKB 2H5CA 1C1RA 1C1WH 4IS5A 1P2NA 4Q7YA 5JB8S 2WUBA 2A45B 1V2QT 1P3EA 2V3OH 3KQDA 4Y10E 5LPEA 1GBMA 1QQ4A 2STAE 4K8BA 2WUCA 3E91A 1UVUH 1SGEE 2UUFB 2F9OA 4YLQH 5J4QA 4OS1A 2C8WB 2WV5A 4AFQA 1CT0E 1TMTH 2CV3A 2BD7A 4IBLH 4I8KA 3E0NB 2XBXA 5FPYA 3TH3H 1CE5A 4GHQA 1V3XA 1WUNH 4AGKA 1BCUH 4JZEH 3GY8A 4X1NU 4GVUA 1K1OA 1ZOMA 1TGCA 2A0QB 2IPHA 1G36A 1YPJH 3MHWU 1QRZA 3TVJB 1CT2E 1OWHA 4B2BA 4AGJA 1G3DA 1B0FA 3K2UA 1O2NA 1TNJA 4K5ZA 2NWNA 3RXAA 3RXGA 3Q3XA 1NFWA 1DWEH 1HAHH 1AE8H 3C1KA 3VB6A 2OD3B 4AYVB 1C2HA 2Q6DA 1TNLA 4GLYA 1SHHB 1F92A 4AFZA 3RMOH 1GHAF 3U69H 2GMTC 1P02A 2R0LA 5AVDA 3A83A 2BLVA 1L4ZA 3M3TA 1GCDA 4ZKOU 3TK6A 1BHXB 2Y7ZA 1O3NA 3A80A 2G8TA 2P93A 1SSXA 5IYTA 3VXFH 1O2XA 1C1PA 3SU4A 4YT7H 1GVLA 4INKA 1ZGIA 1EX3A 1L1NA 2OUAA 1NRNH 1ELFA 1GI3A 3SORA 2R9PA 3CENA 2PHBA 2Q1JA 4IMQA 2GT8A 1ANEA 3TPIZ 1MCVA 3WY8A 2QCYA 1Z8IB 1TQ0B 2ZP0H 3RXIA 1AFQB 3Q3KA 2QXIA 1FQ3A 4Y0ZE 3MU1A 2UUJB 2XXLA 2SFAA 4TY6A 1C5WB 2GZ8A 1MBQA 2Z9GA 4X1RU 1ELTA 4NIYA 3LGVA 1EJAA 2O9QA 4JYUH 2AYWA 1O35A 1BRBE 3FAOA 3H5CB 3PTBA 3F1SB 3ZV9A 1BTUA 1ZMNA 1D6RA 1C2GA 2ALPA 3LGWA 4NIVA 1VGCB 3TNTA 3KNXA 1GMCG 1TBRH 3ODFA 1CGHA 2UUKB 3RXFA 5LPRA 1EUFA 1WYKA 4XBBA 1GGDC 3F9FA 2BM2A 5K0HA 2WPKS 1UK2A 2TGDA 1GI8B 1QL9A 1EB2A 1P9UA 3RMLH 3TIUA 1UTLM 2A32A 1P2MA 2QY0B 1THSH 2ANYA 1ZHPA 2ZDLA 3ZVFA 4TWYA 2ZPSA 2HGTH 3M7UA 3W95A 5HM9A 1BTHH 3E8LA 5A2MH 2V6NA 1DUAA 1N6YA 2BXUH 4Y11E 3HGPA 1S82A 3MH5A 4Y7BA 2RA0A 1FY3A 1V2JT 3V0XA 2C4FH 4ZXYH 4YOJA 1K2I1 4F4OC 1FV9A 1PQ7A 1CHOF 1T8LA 2ANWA 3SUDA 1O0DH 3A7ZA 3PLBA 1ANDA 1TRNA 1GG6C 1C2LA 1J15A 3SU3A 1UO6A 2WINI 4UONA 3B9FH 1A4WH 1HAGE 2TGAA 3GYLB 4CRCA 4MPVA 1SLUB 1O2WA 4WMFA 2HNTC 2AGEX 1SGRE 1NRSH 4H6SB 3SN8A 1F5LA 4FUDA 4THNH 1MAYA 2DUCA 1W8BH 3A7XA 1O2YA 3RXLA 1MQ6A 4QT8C 5GDSH 2XC5A 2GZ7A 2OXSA 1L1GA 4BTUB 3RMNH 1FI8A 1F0UA 1BRAA 3SQEE 1BMNH 2OC7A 7ESTE 1CGJE 1GI6A 4B71A 2YNAA 2HWLB 3M5MA 1DVAH 3SU0A 2SGAA 3E16B 1H8IH 1T7CA 1S5SA 4TYDA 1AD8H 5EXLA 4A6LA 4D7GA 1GI0A 1P3CA 3SGBE 1GBTA 4XFQA 1XM1A 1OX1A 1HDTH 2PUQH 4CRFA 1GG6B 4WMEA 1QY6A 1JMOH 1TFXA 1ABIH 1PQ5A 1OWIA 5JBBS 2FO9A 2THFB 4CR9A 4XDEA 1TGTA 1WTHD 3L6PA 2UWLA 2AGIX 4CR5A 1EOLA 3GOVB 3ZVBA 2GGVB 4DY7B 2ZFRH 1UCYH 3FP7E 1SVPA 3NUMA 1HLTH 1P06A 4HI3A 3F9GA 2PSYA 1CBWB 5JDUB 1K9OE 2A7JA 2AIPA 3BN9A 4GUXA 1LQEA 3HK6B 2PW8H 1ZHMA 1WTGH 3GY7A 4ZKRU 4ABBA 1TMBH 4Q2KA 2AGGX 3PLKA 4FU8A 1MTSA 1L1JA 1O2QA 3M37A 1KY9A 3ATLA 3AW0A 2OTVA 1V2NT 1SLXB 1IQJA 3MMGA 1HPGA 1KXEA 2VH6A 2A2QH 1S84A 2WPIS 4X2XA 5GJ4B 1BTPA 1VJ9U 4HTCH 1FY5A 3LPRA 3MH6A 1Y5AT 2FOGA 1A61H 3RXBA 1MTNC 5F03A 1UTMA 3RXUA 1O3OA 2Z9IA 4KELA 3A7WA 4UD9H 4CHAC 3AAUA 4E05H 1B7XB 1W7XH 1IAUA 1ZTLA 2ZC9H 3SZNA 5CMXH 1O3AA 2FYRA 1ELCA 1THPB 5E0GA 5I25A 3N7OA 2ZEBA 1BBRE 3M7TA 1BTXA 1BJVA 2BZ6H 4X1QU 5F8ZA 1BRUP 2ZPRA 2ZGJA 5TCAA 2V3HH 1EB1H 1HXFH 4LZ1H 3QTOH 1ARBA 3PROA 3RXQA 3BG8A 3PLPA 5F8TA 1SGFG 1AVGH 3I77A 1E35B 2ANKH 2ZPQA 1C5TA 3SW2B 1MTNB 3SI3H 4NSYA 3MTYA 9ESTA 1AB9C 4ABAA 4CH8B 1TPAE 4H42U 1TIOA 4TPYA 2A31A 1MQ5A 2FM2A 2AERH 3P8FA 5C67A 2J9NA 1P2QA 3VGCB 5FPTA 2OP9A 1UTNA 3ZVCA 5FHTA 3MU5A 2XRCA 1WU1A 2HRVA 2W5EA 1P10A 3UPEA 3S9AA 2BX3A 1MKWK 2BY8X 1LKAA 1PYTC 1TMUH 5DO4H 4MG3A 1LO6A 1KTTB 1AHTH 3BSQA 3TK5A 3A86A 2C90B 2F83A 2GCTC 3BTFE 2QXGA 3LONA 1GBEA 1C5UA 1P2OA 1HCGA 1CQQA 1AB9B 1PPBH 1O2JA 2NU4E 4FU9A 1O2ZA 1KYNA 1F5KU 3DD2H 5BPEA 1YYY1 2BDAA 3HPTB 3LGYA 1HFDA 2XYAA 1HBTH 3STIA 2O8WA 5A8XA 1TALA 7GCHF 1BMAA 1AUJA 1ELAA 1EPTA 1QURH 2FYQA 2BX4A 3LC5A 1YP9A 3OTJE 4BTIB 2FOEA 1HAVB 1S0QA 3ESTA 2XWBI 3OU0A 2GX4A 2ZDNA 4FUBA 1GJ7B 5HMAA 1O3IA 1QR3E 4UEHH 3P17H 3JZ1B 5TCCA 3A8AA 1OS8A 1QJ1B 1FN6A 1JXPA 2ZGCA 1DLKB 2GCHF 2PTNA 1L0ZA 2RCEA 1QRXA 3BTHE 4MPUA 2C93B 4ZUHA 1IQIA 2DE9A 1P04A 1SQOA 6ESTA 1A3EH 1C2EA 1VZQH 1YPHC 3TNSA 1H8DH 1HV7A 4NIWA 4DVAU 1QFKH 1PQAA 4DIIH 3BTEE 3SQHE 1BZXE 1TOCB 1IQMA 1TWXB 1O33A 1GI5A 4RKOB 2BDCA 4A7IB 4DG4A 5ESTE 4CREA 2V0BA 3M3SA 1Y3WA 2BVRH 1NC6A 1FLEE 1Z8GA 5AF9H 2F91A 2FODA 4BANB 2PKSB 1WQSA 3JZ2B 4ZROA 1CVWH 2ULLA 3KF2A 2W7SA 1QRWA 3OY6U 5A8ZA 3IITA 1L4DA 4AX9H 4WXIA 4NA8A 1Z1IA 1UVTH 4ISHH 1QNJA 4E06H 4WMDA 1GDQA 2ZFQH 1NFYA 1YM0A 4MPXA 2AFQB 1CA0B 3VB3A 1E37B 4I8JA 2ZQ2A 4KTUA 1ZPZA 1N8OC 4OS4A 1B0EA 1GI2A 4AN7A 1GMDG 1V2WT 1RS0A 2PFEA 4X8VH 4BAOB 1SGYE 2VWOA 1O2GH 2G4TA 2V35A 3LIWA 3KN2A 3MO9A 3R3GB 3MH7A 1ANBA 3RXVA 1HIAB 1UMAH 2ZZUH 1V2KT 1TE0A 4JK6A 1C2KA 1GHWH 2J38A 2BD3A 4LK4A 3EA7A 1G37A 3BG4B 3V3MA 2AH4X 3AVZA 5FXLA 1DLEA 1HRTH 1OPHB 2VH0A 2ZTYA 3UUZA 1PPHE 5ETXA 5AFYH 1QBOA 2HALA 9LPRA 1O2RA 1C5QA 3RXDA 5GWZA 2GTBA 5C5OA 1O2KA 5L2ZH 1BTZA 1EATA 1M9UA 3LKWA 1QCPA 2H1UA 1ANCA 3UR6A 2FTMA 1INCA 1GMHF 1C5PA 2RG3A 5DP3A 5J4SA 2VNTA 1YLCA 1O2UA 1ZSJA 1A5IA 2Z9JA 5E2OA 4Y8ZA 3RC4A 1C5NH 4CRAA 1XUGA 1RFNA 4AORA 2NU0E 2QA9E 3GY5A 4OS2A 1JOUB 1O3HA 3GCOA 4CBOA 1EZQA 4B75A 3BTWE 1BA8B 4FU7A 3Q3YA 1QGFA 3M35A 8GCHG 3U8OH 2VIWA 4X8TH 3RDZA 1C5SA 1TBZH 4YZUA 2PWXA 1XMNB 3PM3A 1SGCA 1GJ5H 2XWAA 1GVKB 2PLXA 1HUTH 1GDNA 1O2MA 1DE7H 1ABJH 2CF8H 1LHGH 3GCTF 2TIOA 4F49A 2STBE 3URCA 2H9EH 1RTLA 1H4WA 1MCTA 4NA9H 2FXRA 3MNCA 1QL7A 1QB1A 4X2YA 1KXBA 3PV4A 4DW2U 4I7YH 1EZXC 1TAWA 4B73A 3A84A 2PGBB 1VJAU 1HAOH 4UFDH 1P2JA 2BOKA 3A88A 1EPTC 1ESAA 4INHA 1YCPK 5B6OA 2ZU2A 1LDTT 3ELAH 2BY5X 4NZLA 3TU7H 5T3HA 2A4RA 1P2IA 2RDLA 2O8MA 3PTNA 1VITG 2FPZA 1UTKA 3S0NA 1HXEH 2XC4A 1C4Y2 1NM6A 3DHKH 3F9HA 1OSSA 1Z8JB 1T4UH 4NGAH 3LGIA 2OBOA 1O2SA 1O3MA 2FX6A 3UWIA 1NU9A 3SNAA 3RMMH 1F0RA 4X8SH 2PUXB 4Y71A 1YPMH 1BRCE 2XC0A 3EYDA 4JZIA 4MLFB 4NIXA 5EQSA 3BTDE 1XXFA 4GPGA 3RC5A 4R8TB 5LH8A 1EAWA 1S6FA 4U30A 3M5NA 3KQEA 1GCTB 1NS3A 3QTVH 1BITA 3QDZB 3QWCH 3SU6A 1BBRH 1HAXB 4GCHG 4I8HA 4Y0YE 1AFQC 5T6FA 1O2LA 1EPTB 5G4BA 1F2SE 5EQRA 2OQUA 4XSKU 1LMWB 1ZRBA 3B8JA 2PKAB 4UE7H 3Q00A 2VJ1A 1AIXH 1W0ZU 1TOMH 3GISB 5DP6A 2BDIA 4K1EA 4IC5A 3PO1B 4KGAA 1SGDE 2A2XH 2AIQA 1KXFA 1DWBH 2ZU3A 2JH0D 4OS5A 1E38B 1GBKA 1E0FD 3KCGH 5F8XA 1VGCC 1O3FA 3HATH 1O3GA 4NA7A 5EG4A 1E36B 2SGFE 3CS0A 4AZ2B 1C5YB 5EPYA 1GJ4H 3D49H 3LH1A 2OLGA 1GMCF 1MKXK 1YPLH 2P16A 4X6MA 1MZDA 4I31A 1BMMH 1UTPA 3BV9B 4YLUA 2WYGA 4ABHA 4D76A 1WCZA 2ESTE 2FTLE 4X2VA 4YOIA 4ABFA 5HXFA 1KXCA 3MO6A 5HM2A 3RXSA 2QXJA 1MU6B 2FX4A 2FEQH 3TGKE 1UTQA 3QGNB 2WPLS 1HJAB 4FXGH 4ABDA 5C1XA 4Y79A 2K1QA 1F0SA 5A8YA 1O3EA 3D62A 1GHYH 1O2OA 1ZHRA 1OWDA 1TONA 1O39A 1O2VA 2WPMS 1F7ZA 2ZCHP 1V2PT 1C9TA 4B76A 3GCNA 2XTTB 1BJUA 3E3TA 3LC3A 1K1LA 3FZDA 1AFEH 3MNXA 1T8NA 4AOQA 2C8XB 1UTJA 3ZZ8A 1NESE 2Z9KA 2NU3E 8KME2 1NZQH 1PJPA 2B9LA 2FOCA 1AQ7A 1O38A 3U8RH 3DT0H 3GY3A 2CF9H 3P8NA 3GCHB 1EQ9A 3A8BA 1UHBB 2R3YA 1FIZA 1A5GH 1V2MT 3HKIB 1O5EH 3ATIA 2QF3A 4I8LA 4KKDA 1HAVA 4DGJA 1NN6A 4K1TA 1WOFA 1ELDE 4IMZA 3GDVA 4WH8A 4XOJA 7KMEH 2IJOB 3SHAH 1ZJKA 5E2PA 1GI4A 1V2ST 3GDUA 4WH6A 4X8UH 1UTOA 4JMYA 1AY6H 2LNCA 3L33A 1ZPBA 3T5FH 1GHVH 1O3BA 2Z6BD 3U1JB 2ZHDA 5JBCS 3U8TH 3QO6A 4X1PU 3URDA 4CRGA 4ISIH 2R0KA 4X1SU 2BQWB 4UFGH 4FUFA 1Z1JA 2XCFA 1K28D 1JWTA 3D23A 3TK9A 2YOLA 1FPCH 1CBWC 1P8VC 4U2WA 3EE0B 4LZ4B 2Y7XA 3ZVGA 3RM2H 1G3BA 3AAVA 2W7UA 3MU8A 2I6SA 4ISNA 2QAAA 1C5MD 2SGEE 2Y5HA 2F9NA 1AZZA 1AU8A 1D3DB 2A4QA 4Q80A 1ZYOA 3UWJH 1GBCA 3TGJE 1OXGA 1DXWA 1S0RA 3ZZ4A 1C2FA 1FAXA 1BIOA 1FUJA 3U9AH 3FVFB 2JETB 2FMJA 2TBSA 1YGCH 5E0HA 4D8NA 3GY4A 4AG2A 1LKBA 4JYTA 5BRRE 3RP2A 2ANMH 3GY6A 1W0YH 1Y5UT 5GPIB 1GI1A 1DM4B 1V6DA 1VCQA 1PPFE 2D1JA 1H9IE 3RXEA 3RXPA 1O31A 3LU9B 2UWPA 3DFJA 4KTCA 2FZZA 4O3TA 1DY9A 3UNRA 1K1IA 3UY9A 1OYTH 3ZZBA 4J2YB 1SQTA 1QHRB 1HIAA 1L2EA 1ACBE 1QQUA 1XUKA 5FBEA 3SGQE 3OSYA 3A85A 1AVWA 1DPOA 5A0AE 5EW1H 1GHBG 1SGNE 3EDXB 1W2KH 5I46H 5EXNA 4JYVH 1A3BH 1P05A 1QL8A 1ZLRA 2WV4A 1ESTA 2ZO3H 2BOHB 2Z94A 5CHAB 2SNVA 3PB1E 5LGOA 1PQ8A 4DJZB 4ASHA 1S6HA 3VGCC 1D4PB 4U32A 1OWJA 2J34A 3BEUA 1CU1A 4MDSA 1S81A 2J95A 3S9BA 3FFGA 2AMDA 1O5FH 2OINA 1J8AA 1KLJH 1D3PB 2LPRA 5A09A 3UIRA 1C5XB 1FJSA 2XBWA 3VB5A 3RU4D 2CGAA 3GYMA 4BAMB 3UQVA 3S7KB 1OOKB 1FY4A 2VGCB 4NG9H 4YOGA 3RM0H 1K1PA 2OBQA 1P09A 3RU4T 2G5VA 4H6TA 4A1VA 1HAPH 2PSXA 2P3UB 1IQHA 2VU8E 4WVPE 1DT2A 1VCWA 5E8EH 1C5ZB 1KSNA 1UK4A 4M7GA 1Z8RA 3BTQE 3RLWH 1C1VH 2A4GA 1NFXA 5EGMA 3UNQA 1MU8B 1IQLA 4A5TS 1IQKA 3P70B 4MNVA 1HNEE 4NWKA 2NU2E 1A5HA 1EAUA 1PFXC 1H9HE 1CHGA 1P9SA 2GDEH 2ILNA 3PYHA 3M36A 2ZHEH 1G3EA 1C4V2 2FLRH 2SNWA 3U98H 3MYWA 3ZVDA 1GJBB 2QXHA 5EPNA 3U1IB 1LCYA 3M61U 2J92A 2KAIB 4Z0KA 1P57B 2ZFTA 1O32A 1ELEE 3LH3A 4DIHH 2A5IA 4Y8YA 2Y81A 3ZZAA 4SGBE 1C2MA 3RU4E 1HAYB 1AWHB 4ABIA 1XXDA 3HKJB 1MAXA 1O30A 1RRKA 3EQ0H 3FZZA 1ZMLA 3PMBB 4MTBA 1J16A 3VB4A 1IQFA 2NU1E 2SGDE 3MU0A 1W12U 1NRRH 2H5DA 1ZJDA 4HGCA 4D9RA 4JZ1A 1E34B 3RXTA 3A8DA 2IOTA 1O3LA 3C27B 3SV8A 3ZYDA 2FWWA 4GAWA 3E1XB 3SO3A 1C1OA 2G55A 2Z3EA 3T29A 3SJ8A 2J4IA 3LJJA 1IQGA 2ZWLH 5T6DA 2F9VA 1T8MA 5EU8A 1JIRA 1TBQH 4AFSA 2XCNA 3RXMA 2PKAA 2VWNA 2C8ZB 2ZCKP 1EZUC 2PKSC 3MFJA 2EI6A 4K3JA 1D6WA 4WJG2 1LHDH 5CE1A 1WSSH 1SC8U 1N6XA 1SFQB 1VR1H 1DICA 3UOPA 3GY2A 2FI5E 1K22H 4IC6A 3TH2H 1QB6A 3IG6B 3QUMP 1MKWH 4A1XA 1GPZA 2EC9H 3SJKA 3ZYEA 4MQAA 3A89A 2Z9LA 3T25A 3BTME 2OQ5A 1A7SA 1FONA 3NZIA 1CA0C 2GDDA 3SNEA 4NFEA 3ZZ3A 5JPMH 4ZKNU 1U6QA 1LTOA 2G51A 4K2YA 5HGGA 1TB6H 3RC6A 5EOKA 5GCHG 1KXAA 2BVXH 2FS8A 4UFEH 4BNRA 1Y3YA 2G52A 4XBCA 1GBAA 1H1BA 1GMDF 3SUEA 5K7RA 1AKSB 2VINA 5DP8A 1XUJA 4WXVA 1GL1A 1C5RA 3BG4C 1SOZA 2P8OB 3ZZCA 1JRSA 2P94A 1ZGVA 5C20A 1ELGA 2EA3A 1O3CA 1C1UH 1EASA 2ZA5A 3P92A 4B2CA 1AUTC 1LVMA 2BQ6B 3RXRA 3L3TA 2VIDA 5L6NH 2BB4A 2FDAA 3OX7U 5A0CA 3FP8E 4H4FA 1V2TT 5FAHA 2A4OA 3QZRA 2FOFA 4JK5A 1G32B 1GDUA 4Q7ZA 1MTVA 1UHBA 2B0FA 1RIWB 2GP9B 3T28A 3UR9A 1K1JA 2XBVA 4TY7A 3VB7A 1LHEH 3STJA 2HNTE 1W3CA 4NSVA 4B2AA 1MH0A 4X6OA 1CO7E 1AI8H 1PPEE 2Z7FE 4ZXXH 3H7OA 5C1YA 2ZIQH 3SJOA 4DT7B 8GCHF 1P2KA 3FANA 1QBVH 1XVOA 2Y82A 4ZKSU 2H9TH 2B8OH 2ZECA 1EJNA 1J9CH 1QJ7B 1DY8A 1S83A 1ZSLA 2RA3A 4OGXA 5FBIA 3TJNA 4DURA 1ZRKA 2ZU5A 5C5NA 4OGYA 1Y3XA 3PMAB 3M5LA 3ATWA 5DK1A 1FY8E 1DUEA 4CBNA 3CS7A 1DFPA 1O2PA 1QA0A 1J14A 1O3JA 1DSUA 2A5KA 2OC1A 1ELVA 3TGIE 1A2CH 2FOBA 1ETTH 1CSOE 2JKHA 4RN6A 3SU5A 2Z3CA 1C9PA 1MBMA 2O8TA 1MUEB 2H2ZA 1SI5H 4PROA 2PGQB 2VIQA 5JB9S 2VB0A 3QGJA 1NTPA 4MNXA 1F5RA 1JRTA 1OKXA 2G4UA 3NXPA 4HZHA 2ZCLP 3KGPA 1GCTC 3ZZDA 1DOJA 2XW9A 1GMHG 1SB1H 2Z3DA 2VWMA 2VIVA 3NKKA 3EA9A 4AG1A 1NPMA 2G81E 3ENSB 5DP4A 1KXDA 3P8GA 2ZTZA 1BUIA 3PO1C 3O8RA 1TRYA 1C1MA 2FS9A 3UNSA 1LVBA 3VXEH 4GCHF 6CHAB 3PMJA 1O2HA 3HK3B 1IQEA 2BTCE 2J94A 1C5LH 3T27A 2R3UA 1CT4E 2AEIH 3MOCA 5ESBA 6GCHG 3SV9A 1GBDA 2R2MB 4RKJB 2FESH 1W14U 1A46H 1ZR0A 2C3SA 3GCTG 4X6NA 4ZHLU 1AVXA 1MD8A 4ZHMU 2CHAB 1C5VA 5EQQA 4MPWA 2ZFPH 4J1YA 4O03A 1PYTD 3AASA 2BDGA 3OYPA 4ABGA 2F9UA 2GZ9A 1G2LA 2BLQA 3RLYH 1FZZA 1TRMA 2ZHWH 3PMHB 3V7TA 2Y80A 2BY7X 1HB0B 4MNWA 2WPHS 1Y3VA 2TRMA 1HAIH 3RXJA 1Y5BT 1Y3UA 5DKMA 2ODQA 1LPZB 3SUFA 3UREA 1TQ7B 4YM9A 1RTKA 2Y5GA 3P6ZB 1HJAC 3ZZ5A 4I8GA 1JBUH 1PPCE 4ZH8A 1YCPH 1AE5A 5DJ7A 1V2VT 1C1QA 3Q77A 4FVBA 5AFZH 5C1UA 3SOSA 1O36A 1BQYA 2BDBA 1BTWA 1GBBA 3SHCH 3DA9B 5DP7A 2QV1A 1GL0E 4K69A 4K1SA 1P03A 4WF8A 2BHGA 4CRDA 3HGNA 5DG6A 3BEFB 2G5NA 1IHTH 1IHSH 4HFPB 4NFFA 3SU2A 1GJ9B 1AGJA 1QB9A 1BB0B 4I33A 5IDKA 1TPPA 2AS9A 3F68H 2G00A 2VIPA 3GCHC 4FUEA 2GD4B 1A0JA 1EOJA 4XE4A 2BDYA 1GBLA 1GHAG 4R0IA 3T2NA 1BMLA 2ZQ1A 1FPHH 4D7FA 2P95A 1QTFA 4VGCC 1EAIA 2ODYB 1C1NA 1LVOA 7LPRA 2H6MA 2BDHA 1O3DA 4YESB 3NPSA 1G30B 1PPGE 1X7AC 1D3QB 2GV7A 2KAIA 1IQNA 3KQCA 2JH6D 1ARCA 1QIXB 2W26A 3T62A 2GMTB 3BF6H 1T8OA 5TJXA 4Y8XA 2TGTA 1EP5A 1TX6A 1KTSB 4JZFH 1YCPM 3VEQB 1NFUA 1TGNA 1J17T 4IGDA 3SUGA 3MH4A 2CJIA 1TA2A 1TNIA 2XBYA 4YTAA 4TWWA 3RUOA 1O5BB 2YNBA 3ITIA 4Y76A 1N1LA 1HJ8A 5JBTA 1NU7B 3SI4H 3VPKA 1TPSA 2PR3A 3NCLA 1MKXH 5FX5A 4BAQB 1RGQA 4VGCB 8LPRA 1FAKH 3ZVEA 2ALVA 3KIDU 3SU1A 4INLA 2ZG0H 3QN7A 1YPHE
chains in the Genus database with same CATH superfamily
3F2HA 4FUCA 3TITA 1Y8TA 3ZZ6A 1MZAA 1QBNA 4IW4E 2BMGB 2BD9A 2JETC 2KCAA 1FNIA 4AYYB 4BXSA 2EI8A 2EI7A 1MTWA 2BZAA 3EGKH 3LT3A 5L2YH 1DANH 2EQNA 1KDQB 1BHXF 4ZAEA 4O97A 1FIWA 2FIRH 3UQOA 2ZU1A 3P8OA 2BY6X 4YT6H 2UWOA 3MI4A 3UTUH 1A0HB 1A0LA 1UCYK 2ZDMA 4LXBH 1GGDB 2J98A 1EJMA 5JYIA 1RD3B 5FX6A 1A1RA 2VIOA 1Q31A 1TGSZ 3UOUA 1WAYB 2BQ7B 3TJOA 1GJDB 5C3NA 3TJUA 3MWIU 1BDAA 1DX5M 1OWEA 1CHOG 1UVOA 1SG8B 1AKSA 1SLVB 1D3TB 1W11U 4GSOA 1JIMA 1LVYA 2TGPZ 1YF4A 3S9CA 1KIGH 3PWCA 2GT7A 1YKTA 2D8WA 3M3VA 3SJ9A 3I29A 1V2OT 5DP9A 1DS2E 2CN0H 4UDWH 5CHAC 2OCVB 1Z71A 3SJIA 1GHBF 1O5AB 1TLDA 2F9PA 4LOYH 3H7TA 2VWLA 5EODA 2D26C 3LDXH 1OP2A 2I6QA 5EW2H 1O37A 2F9BH 1AMHA 4FUHA 3ZZ7A 4AB8A 1O3PB 2CK3D 2FI4E 4KP0A 1GHXH 4E7RG 2J97A 3BIUH 1MTUA 2PTCE 2Q6FA 3SNCA 1YLDA 3A8CA 4WY3A 5ABWA 2ZKSA 1DXPA 1K1MA 1TNHA 2BD4A 3SNDA 2VGCC 2ZDVH 1NO9H 5C0UA 5DP5A 1SGIB 1DWCH 1EZSC 1FN8A 4RT1A 2TPIZ 1GWAA 2W3IA 1ELBA 5AHGH 1ZTKA 2YMSB 1BOQA 3NWUA 3QZQA 1TABE 1SGPE 2R2WU 1SOTA 2ZHFH 4IN1A 2GVFA 3G01A 2QYIA 2ZF0H 1F0TA 3P95A 4FUIA 1GBIA 1V2UT 4NWLA 1YPGH 2BLOA 2ZFSA 5EJZA 5FPSA 1AZ8A 1GJ8B 3GICB 2ZFFH 4JZDH 1ZMJA 4BTTB 1WBGB 1T31A 2ZHQH 3KYGA 3S7HB 3LOXA 3K65B 4E7NA 2ZU4A 1SBWA 3BEIB 3OEED 3SV2H 1HAZB 1UW7A 1GI9B 1TNGA 1QZ8A 1OP0A 1GVZA 4CH2B 5SGAE 1Y59T 1ZTJA 2FI3E 1RJXB 3LGTA 4X0WU 4SGAE 1DSTA 2ZDAH 1SFIA 1C2IA 3Q76A 3BTTE 1LQDB 1Z7KA 3A87A 3S69A 5A0BA 5GNDA 3RXKA 1O5GH 2ZGBH 3ZZ9A 4OS6A 4Q7XA 1BT7A 2ZNKH 3LJOA 4U01A 4WWYA 1O5CB 1WQVH 2A5AA 3A81A 2BY9X 1ZPCA 1ETRH 1LPGB 1FXYA 2QN5T 2HNTF 2A7CA 1MMJN 3MNBA 1QA7A 1Q3XA 1CGIE 4Q63A 2GKVE 3NK8A 4D9QA 1C2JA 4CHAB 3ATKA 1P01A 2HVXA 1V2RT 1UVSH 2SGQE 3BTGE 1NY22 2QE7D 3RXCA 2BXTH 4O3UA 2O8UA 1SLWB 4NZQA 2HVYB 3ZVAA 1KLTA 4TPIZ 2BLWA 4A1TA 4AB9A 2IN2A 2J2UA 4XBDA 2VVUA 3SBKA 1GI7B 1XVMA 1XKBC 2WHXA 2SGPE 1V2LT 1Z6EA 1EKBB 1YLNA 2BD8A 4Y7AA 2AMQA 1NRQH 2FP7B 4FUGA 5HYOA 3V13A 3PWBA 3BIVH 5EXMA 5GXPA 1EP6A 3O8BA 4K8YA 3RXOA 1C4U2 1LHFH 5CHBA 1H9LB 3B23B 3AW1A 1P0SH 4ESTE 1O2IA 5DPAA 3ODDA 3E6PH 1OYQA 3FP6E 3M5OA 4F55A 2HOBA 2OC0A 4JCNA 2Y6TA 3E0PB 1YPKH 1FMGA 1O5DH 3KHVA 1GJ6A 2JH5D 2VVVA 3TJVA 3M7QA 1YC0A 4O9VA 3V12A 2OC8A 2UUYA 5GCHF 1VCPA 2P8OC 4UFFH 1PPZA 2QIQA 2P3TB 5FCKA 1UVPA 1RXPA 1W0JD 2ZGHA 5T1VA 1XKAC 3ZV8A 1C1TA 1G3CA 1HGTH 3QLPH 2B7DH 1GBJA 2H9HA 2WPDD 5JBAS 1UJ1A 3DCLA 3DUXH 1GHZA 1SQAA 2FLBH 3ZIAD 3EAJA 2QGRA 3QX5H 1HYLA 1SGTA 2GCTB 1B5GH 3MO3A 4AFUA 1Q2WA 2J98B 3MU4A 1Z6JH 3O8CA 2ZDKA 3WWFA 1OP8A 3SGAE 4DOQA 7GCHG 4BAHB 1G9IE 1GJCB 1TPOA 4K60A 1THRH 1NRPH 2CMYA 3T26A 4ZHAA 1IOEA 1RIWC 2B5TB 2ASUB 4FVDA 3UB0A 1AN1E 4RI0A 2W3KA 1SPJA 1C5OH 4CRBA 4BXWA 2QC2A 3F6UH 4P02A 1GBFA 1TNKA 1WV7H 1HJ9A 4KTSA 3LGUA 2FOMB 1OWKA 4IN2A 3VFEA 4I32A 2GCHG 1AO5A 1DITH 5T6GA 3SV6A 3DFLA 2GV6A 2Q6GA 2WYJA 1EAXA 4B1TA 1W13U 2HPQH 2O8LA 1TX8A 1SL3A 5GIBA 3KQBA 5KEDA 1DWDH 1TGBA 1VITH 1RTFB 3U28C 4NCYA 1C2DA 3W94A 2XNIA 4MNYA 1ESBA 1O34A 1FY1A 3KL6A 3A7TA 4ISOA 4X2WA 1GBHA 1K0HA 1CA8B 2V7QD 8ESTE 1W7GH 4Z6AH 2VVCA 3A7VA 2RDEA 3A7YA 1W10U 2BYAX 1LHCH 4B74A 1TX7A 1UK3A 1P12E 4ABEA 5C2ZA 5IK2D 1SHYA 3ATMA 4GHTA 2HPPH 1ZSKA 1ETSH 5PTPA 5DGJA 1YBWA 2HLCA 1BTYA 2EEKA 3BTKE 3E90B 3IWMA 5L30H 3K6YA 1NROH 1MD7A 4ZMAH 1UCYE 3OY5U 5E0JA 4FUJA 1TA6A 1XUHA 2QF0A 4DCDA 2D2DA 4X6PA 3W1EA 4ISLA 4RSPA 2FOHA 3OAAD 4BOHA 4MVNA 2M2AA 3FKSD 3SV7A 1ORFA 1KDQA 1FDPA 6LPRA 3TLOA 3TH4H 1S85A 1KLIH 1P11E 1O2TA 1OHHD 1T32A 1T4VH 2FOAA 3R0FA 3MNSA 3KEEA 3I78A 2ZI2H 1XUIA 1C1SA 3CP7A 3QK1A 2C8YB 2BD5A 3O8DA 3GDSA 2CXVA 1SGFA 3EA8A 1K1NA 3F9EA 2Y5FA 3SNBA 1QJ6B 1ID5H 2A1DB 2F3CE 1G2MA 2WPJS 3D65E 1ZZZA 2AMPA 6CHAC 4A92A 3K6ZA 1N8OB 1S6LA 1DDJA 2A7HA 1EXFA 2DE8A 2PV9B 1YPEH 1XUFA 1O3KA 1AWFH 1VITF 2ODPA 3K9XB 4Y6DA 1GJAB 2BD2A 4ABJA 2BVSH 1SMFE 2M5TA 4BAKB 2ZGXH 5FCRA 2CHAC 4OS7A 1SR5C 5F6MA 2P59A 1NT1A 4YO9A 1XX9A 3A82A 3UFAA 6GCHF 2ZTXA 2P3FH 4XD7D 3UAIC 5LPFA 3RXHA 1SGQE 5H4IB 1TYNA 1D9IA 1BBRK 1K21H 3N7EA 1LPKB 2H5CA 1C1RA 1C1WH 4IS5A 1P2NA 4Q7YA 5JB8S 2WUBA 2A45B 1V2QT 1P3EA 2V3OH 3KQDA 4Y10E 5LPEA 1GBMA 1QQ4A 2STAE 4K8BA 2WUCA 3E91A 1UVUH 1SGEE 4XRNA 2UUFB 5B6LA 2F9OA 4YLQH 5J4QA 4OS1A 2C8WB 2WV5A 4AFQA 1CT0E 1TMTH 2CV3A 2BD7A 4IBLH 4I8KA 3E0NB 2XBXA 5FPYA 3TH3H 1CE5A 3FOAA 4GHQA 1V3XA 1WUNH 4AGKA 1BCUH 4JZEH 3GY8A 4X1NU 4GVUA 1K1OA 1ZOMA 1TGCA 2A0QB 2IPHA 1G36A 1YPJH 3MHWU 1QRZA 3TVJB 1CT2E 3F2FA 1OWHA 4B2BA 4AGJA 1G3DA 1B0FA 3K2UA 1O2NA 1TNJA 4K5ZA 2NWNA 3RXAA 3RXGA 3Q3XA 1NFWA 1DWEH 1HAHH 1AE8H 3C1KA 3VB6A 2OD3B 4AYVB 1C2HA 2Q6DA 1TNLA 4GLYA 1SHHB 1F92A 3F0PA 4AFZA 3RMOH 1GHAF 3U69H 2GMTC 1P02A 2R0LA 5AVDA 2LELA 3A83A 2BLVA 1L4ZA 3M3TA 1GCDA 4ZKOU 3TK6A 1BHXB 2Y7ZA 1O3NA 3A80A 2G8TA 2P93A 1SSXA 5IYTA 3VXFH 1O2XA 1C1PA 3SU4A 4YT7H 3N7DA 1GVLA 4INKA 3CNRA 1ZGIA 1EX3A 1L1NA 2OUAA 1NRNH 1ELFA 1GI3A 3SORA 2R9PA 3CENA 2PHBA 2Q1JA 4IMQA 1BMFD 2GT8A 1ANEA 3TPIZ 1MCVA 2IJD1 2QCYA 3WY8A 1Z8IB 1TQ0B 2ZP0H 3RXIA 1AFQB 3Q3KA 2QXIA 1FQ3A 4Y0ZE 3MU1A 2UUJB 2XXLA 1E79D 2SFAA 4TY6A 1C5WB 2GZ8A 1MBQA 2Z9GA 4X1RU 1ELTA 4NIYA 3LGVA 1EJAA 2O9QA 4JYUH 3DSOA 2AYWA 1O35A 1BRBE 3FAOA 3H5CB 3PTBA 3F1SB 3ZV9A 1BTUA 1ZMNA 1D6RA 1C2GA 2ALPA 4Z1MD 3LGWA 4NIVA 1VGCB 3TNTA 3KNXA 1GMCG 1TBRH 3ODFA 1CGHA 2UUKB 3RXFA 5LPRA 1EUFA 1WYKA 4XBBA 1GGDC 3F9FA 2BM2A 5K0HA 2WPKS 1UK2A 2TGDA 1GI8B 1QL9A 1EB2A 1P9UA 3FO8D 3RMLH 3PRDA 1UTLM 3TIUA 2A32A 1P2MA 2QY0B 3F0OA 1THSH 2ANYA 1ZHPA 2ZDLA 3ZVFA 4TWYA 2ZPSA 2HGTH 3M7UA 3W95A 5HM9A 1BTHH 3E8LA 5A2MH 2V6NA 1DUAA 1N6YA 2BXUH 4DT4A 4Y11E 3HGPA 1S82A 3MH5A 4Y7BA 2RA0A 1FY3A 1V2JT 3V0XA 2C4FH 4ZXYH 4YOJA 1K2I1 3OFND 4TT3D 1FV9A 4F4OC 1PQ7A 1CHOF 1T8LA 2ANWA 3SUDA 5FL7D 1O0DH 3A7ZA 3PLBA 1ANDA 1TRNA 1GG6C 1C2LA 1J15A 3SU3A 1UO6A 2WINI 4UONA 3B9FH 1A4WH 1HAGE 2TGAA 3GYLB 4CRCA 4MPVA 1SLUB 3DSPA 1O2WA 4WMFA 2HNTC 2AGEX 1SGRE 1NRSH 4H6SB 3SN8A 1F5LA 4FUDA 4FOUC 4THNH 1MAYA 2DUCA 2AHME 1W8BH 3A7XA 1O2YA 3RXLA 1MQ6A 4QT8C 5GDSH 2XC5A 2GZ7A 2OXSA 1L1GA 2K0QA 4BTUB 3RMNH 1FI8A 1F0UA 2YMSC 1BRAA 3SQEE 1BMNH 2OC7A 7ESTE 1CGJE 1GI6A 4B71A 2YNAA 2HWLB 3M5MA 1DVAH 3SU0A 2SGAA 3E16B 1H8IH 1T7CA 1S5SA 4TYDA 1AD8H 5EXLA 4A6LA 4D7GA 1GI0A 1P3CA 3SGBE 1GBTA 4XFQA 1XM1A 1OX1A 1HDTH 2PUQH 3AK5A 4CRFA 1GG6B 4WMEA 1QY6A 1JMOH 1TFXA 1ABIH 1PQ5A 1OWIA 3PV5A 2FO9A 2THFB 5JBBS 4XDEA 4CR9A 1TGTA 1WTHD 3L6PA 2UWLA 2AGIX 4CR5A 1EOLA 3GOVB 3ZVBA 2GGVB 4DY7B 2ZFRH 1UCYH 3FP7E 3H09A 1SVPA 3NUMA 1HLTH 1P06A 4HI3A 3F9GA 2PSYA 1CBWB 5JDUB 1K9OE 2A7JA 2AIPA 3BN9A 4GUXA 1LQEA 3HK6B 2PW8H 1ZHMA 1WTGH 3GY7A 4ZKRU 4ABBA 1TMBH 4Q2KA 2AGGX 3PLKA 4FU8A 1MTSA 1L1JA 1O2QA 3M37A 1KY9A 3ATLA 3AW0A 2OTVA 1V2NT 1SLXB 1IQJA 3MMGA 1HPGA 1KXEA 2VH6A 2A2QH 1S84A 2WPIS 4X2XA 5GJ4B 3MQKC 1BTPA 1VJ9U 2WSSD 4HTCH 1FY5A 3LPRA 3MH6A 1Y5AT 2JJ2D 3PV2A 2FOGA 1A61H 3RXBA 1MTNC 5F03A 1UTMA 3RXUA 1O3OA 2Z9IA 4KELA 3A7WA 4UD9H 4CHAC 3AAUA 4E05H 1B7XB 1W7XH 1IAUA 1ZTLA 2ZC9H 3SZNA 5CMXH 3OEHD 1O3AA 2FYRA 1ELCA 1THPB 5E0GA 5I25A 3N7OA 2ZEBA 1BBRE 3M7TA 1BTXA 1BJVA 2BZ6H 4X1QU 5F8ZA 1BRUP 2ZPRA 2ZGJA 5TCAA 2V3HH 2KX4A 1EB1H 1HXFH 4LZ1H 3QTOH 1ARBA 3PROA 3RXQA 3BG8A 3PLPA 5F8TA 1SGFG 1AVGH 3I77A 1E35B 2ANKH 2ZPQA 1C5TA 3SW2B 1MTNB 3SI3H 4NSYA 2KZ4A 3MTYA 1AB9C 9ESTA 4ABAA 4CH8B 1TPAE 2KR7A 4H42U 1TIOA 4TPYA 2A31A 1MQ5A 2FM2A 1VKYA 2AERH 3P8FA 5C67A 2J9NA 1P2QA 3OE7D 3VGCB 5FPTA 2OP9A 1UTNA 3ZVCA 5FHTA 3MU5A 2XRCA 1WU1A 2HRVA 2W5EA 1P10A 3UPEA 3S9AA 2BX3A 1MKWK 2BY8X 1LKAA 1PYTC 1TMUH 5DO4H 4MG3A 1LO6A 1KTTB 1AHTH 3BSQA 3TK5A 3A86A 2C90B 2F83A 2GCTC 2VBCA 3BTFE 2QXGA 3LONA 1GBEA 1C5UA 1H8HD 1P2OA 1HCGA 1CQQA 1AB9B 1PPBH 1O2JA 2NU4E 4FU9A 1O2ZA 1KYNA 1F5KU 3DD2H 5BPEA 1YYY1 2BDAA 3HPTB 3LGYA 1HFDA 2XYAA 1HBTH 3STIA 2O8WA 5A8XA 2HLDD 1TALA 7GCHF 1BMAA 1AUJA 1ELAA 1EPTA 1QURH 1SQRA 2FYQA 2BX4A 3LC5A 1YP9A 3OTJE 4BTIB 2FOEA 1HAVB 1S0QA 3ESTA 2KCPA 2XWBI 3OU0A 2GX4A 2ZDNA 4FUBA 1GJ7B 5HMAA 1O3IA 1QR3E 4UEHH 3P17H 3JZ1B 5TCCA 3A8AA 1OS8A 1QJ1B 1FN6A 1JXPA 2ZGCA 1DLKB 2GCHF 2PTNA 1L0ZA 2RCEA 1QRXA 3BTHE 4MPUA 2C93B 4ZUHA 1IQIA 2DE9A 1P04A 1SQOA 6ESTA 1A3EH 1C2EA 1VZQH 1YPHC 3TNSA 1H8DH 1HV7A 4NIWA 4DVAU 1QFKH 1PQAA 4DIIH 3BTEE 3SQHE 1BZXE 1TOCB 1IQMA 1TWXB 1O33A 1GI5A 4RKOB 2BDCA 4A7IB 4DG4A 5ESTE 4CREA 2V0BA 3M3SA 1Y3WA 3GS9A 2BVRH 1NC6A 1FLEE 3WWBA 1Z8GA 5AF9H 2F91A 2FODA 4BANB 2PKSB 1WQSA 3JZ2B 5C0TA 4ZROA 1CVWH 2ULLA 3KF2A 2W7SA 1QRWA 3OY6U 5A8ZA 3IITA 1L4DA 4AX9H 4WXIA 4NA8A 1Z1IA 1UVTH 3EE7A 4ISHH 1QNJA 4E06H 4WMDA 1GDQA 2ZFQH 1NFYA 1YM0A 4MPXA 2AFQB 1CA0B 3VB3A 1E37B 4I8JA 2ZQ2A 4KTUA 1ZPZA 1N8OC 4OS4A 1B0EA 1GI2A 4AN7A 1GMDG 1V2WT 1RS0A 2PFEA 4X8VH 4BAOB 1SGYE 2VWOA 1O2GH 5KECA 2G4TA 2V35A 3LIWA 3KN2A 3MO9A 3R3GB 3MH7A 1ANBA 3RXVA 1HIAB 1UMAH 2ZZUH 1V2KT 1TE0A 4JK6A 1C2KA 1GHWH 2J38A 2BD3A 4LK4A 3EA7A 1G37A 3BG4B 3V3MA 2AH4X 3AVZA 5FXLA 1DLEA 1HRTH 1OPHB 2VH0A 2ZTYA 3UUZA 1PPHE 5ETXA 5AFYH 1QBOA 2HALA 4HG6A 9LPRA 1O2RA 1C5QA 5EJLA 3RXDA 5GWZA 2GTBA 5C5OA 1O2KA 5L2ZH 1BTZA 2JJ1D 1EATA 1M9UA 3LKWA 1QCPA 2H1UA 4M9FA 1ANCA 3UR6A 2FTMA 1INCA 4ASUD 1GMHF 1C5PA 2RG3A 5DP3A 5J4SA 2VNTA 1YLCA 1O2UA 1ZSJA 1A5IA 2Z9JA 5E2OA 4Y8ZA 3RC4A 1C5NH 4CRAA 1XUGA 1RFNA 4AORA 2NU0E 2QA9E 3GY5A 4OS2A 1JOUB 1O3HA 3GCOA 4CBOA 4TSFD 2WV9A 1EZQA 4B75A 3BTWE 1BA8B 4FU7A 2JIZD 3Q3YA 1QGFA 3M35A 8GCHG 3U8OH 2VIWA 4X8TH 3RDZA 1C5SA 1TBZH 4YZUA 3WW7A 2PWXA 1XMNB 3PM3A 1SGCA 1GJ5H 2PP6A 2XWAA 1GVKB 2PLXA 1HUTH 1GDNA 1O2MA 1DE7H 1ABJH 2CF8H 1LHGH 3GCTF 2TIOA 4F49A 2STBE 3URCA 2H9EH 1RTLA 1H4WA 1MCTA 4NA9H 2FXRA 3MNCA 1QL7A 1QB1A 4X2YA 1KXBA 2RFKC 2W6ID 3PV4A 4DW2U 5EIYA 4I7YH 1EZXC 1TAWA 4AC9A 4B73A 3A84A 2PGBB 1VJAU 1HAOH 4UFDH 2XNDD 1P2JA 2BOKA 3A88A 4P00A 1EPTC 1ESAA 4INHA 1YCPK 5B6OA 2ZU2A 1LDTT 3ELAH 2BY5X 4NZLA 3TU7H 5T3HA 2A4RA 1P2IA 2RDLA 2O8MA 3PTNA 1VITG 2FPZA 1UTKA 3S0NA 1HXEH 2XC4A 1C4Y2 1SKYE 1NM6A 3DHKH 3F9HA 1OSSA 1Z8JB 1T4UH 4NGAH 3LGIA 2OBOA 1O2SA 1O3MA 2FX6A 3UWIA 1NU9A 3SNAA 3RMMH 1F0RA 2K8IA 4X8SH 2PUXB 4Y71A 1YPMH 1BRCE 2XC0A 3EYDA 4JZIA 4MLFB 4NIXA 5EQSA 3BTDE 1XXFA 4GPGA 3RC5A 4R8TB 5LH8A 1EAWA 1S6FA 4U30A 3M5NA 3KQEA 1GCTB 1NS3A 3QTVH 1BITA 3QDZB 3QWCH 3SU6A 1BBRH 1HAXB 4GCHG 4I8HA 4Y0YE 1AFQC 5T6FA 1O2LA 1EPTB 5G4BA 1F2SE 5EQRA 2OQUA 4XSKU 1LMWB 1ZRBA 3B8JA 2PKAB 4UE7H 3Q00A 2VJ1A 1AIXH 1W0ZU 1TOMH 3GISB 5DP6A 2BDIA 4K1EA 4IC5A 3PO1B 4KGAA 1SGDE 2A2XH 2AIQA 1KXFA 1DWBH 2ZU3A 2JH0D 4OS5A 1E38B 1GBKA 1E0FD 3KCGH 5F8XA 1VGCC 1O3FA 3HATH 1O3GA 4NA7A 5EG4A 1E1QD 1E36B 2SGFE 3CS0A 4AZ2B 1C5YB 5EPYA 1GJ4H 3D49H 3LH1A 2OLGA 1GMCF 1MKXK 1YPLH 2P16A 4X6MA 1MZDA 5F53A 4I31A 1BMMH 1UTPA 3BV9B 4YLUA 2WYGA 4ABHA 4D76A 1WCZA 2ESTE 2FTLE 4X2VA 4YOIA 4ABFA 5HXFA 1KXCA 5HKKD 3MO6A 5HM2A 3RXSA 2QXJA 1MU6B 2FX4A 1H8ED 2FEQH 3TGKE 1UTQA 3QGNB 2WPLS 1HJAB 4FXGH 4ABDA 5C1XA 4Y79A 2K1QA 1F0SA 5A8YA 1O3EA 3D62A 1GHYH 1O2OA 1ZHRA 3DSGA 4ACAA 1OWDA 1TONA 1O39A 1O2VA 2WPMS 1F7ZA 2ZCHP 2F4LA 1V2PT 1C9TA 4B76A 3GCNA 2XTTB 1BJUA 3E3TA 3LC3A 1K1LA 3FZDA 1AFEH 3MNXA 1T8NA 4AOQA 2C8XB 1UTJA 3ZZ8A 1NESE 2Z9KA 2NU3E 5HIZA 8KME2 1NZQH 1PJPA 2B9LA 2FOCA 1AQ7A 1O38A 3U8RH 3DT0H 3GY3A 2CF9H 3P8NA 3GCHB 1EQ9A 3A8BA 1UHBB 2R3YA 1FIZA 1A5GH 1V2MT 3HKIB 1O5EH 2XOKD 3ATIA 2QF3A 4I8LA 4KKDA 1HAVA 4DGJA 1NN6A 4K1TA 1WOFA 1ELDE 4IMZA 3GDVA 4WH8A 4XOJA 7KMEH 2IJOB 3SHAH 1ZJKA 5E2PA 1GI4A 1V2ST 3GDUA 4WH6A 4X8UH 1UTOA 4JMYA 4F48B 1AY6H 2LNCA 3L33A 1ZPBA 3T5FH 1GHVH 3SZEA 1O3BA 2Z6BD 3U1JB 2ZHDA 5JBCS 3U8TH 3QO6A 4X1PU 3URDA 4CRGA 4ISIH 2R0KA 4X1SU 2BQWB 4UFGH 4FUFA 1Z1JA 2XCFA 1K28D 2JDID 1JWTA 3D23A 3TK9A 2YOLA 1FPCH 1CBWC 1P8VC 1WDIA 4U2WA 3EE0B 4LZ4B 2Y7XA 3ZVGA 3RM2H 1G3BA 3AAVA 2W7UA 3MU8A 2I6SA 4ISNA 2IPQX 2QAAA 1C5MD 1E1RD 2SGEE 2Y5HA 2F9NA 1AZZA 1AU8A 1D3DB 1KMHB 2A4QA 4Q80A 1ZYOA 3UWJH 1GBCA 3TGJE 1OXGA 1DXWA 1S0RA 3ZZ4A 1C2FA 1FAXA 1BIOA 1FUJA 3U9AH 3FVFB 2JETB 2FMJA 2TBSA 1YGCH 5E0HA 4D8NA 3GY4A 4AG2A 3SYJA 1LKBA 4JYTA 5BRRE 3RP2A 2ANMH 3GY6A 1W0YH 1Y5UT 5GPIB 1GI1A 1DM4B 1V6DA 1VCQA 1PPFE 2D1JA 2KCOA 1H9IE 3RXEA 3RXPA 1O31A 3LU9B 2UWPA 3DFJA 4KTCA 2FZZA 2KFWA 4O3TA 1DY9A 3UNRA 1K1IA 3UY9A 1OYTH 3ZZBA 4J2YB 1SQTA 1QHRB 1HIAA 1L2EA 4RT0A 1ACBE 1QQUA 1XUKA 5FBEA 3SGQE 3OSYA 3A85A 1AVWA 1DPOA 5A0AE 2QF5A 5EW1H 1GHBG 1SGNE 3EDXB 1W2KH 5I46H 5EXNA 4JYVH 1YWUA 1A3BH 1P05A 1QL8A 1ZLRA 2WV4A 1ESTA 2ZO3H 2BOHB 2Z94A 5CHAB 2SNVA 3PB1E 5LGOA 1PQ8A 4DJZB 4ASHA 1S6HA 3VGCC 1D4PB 4U32A 1OWJA 2J34A 3BEUA 1CU1A 4MDSA 1S81A 2J95A 3S9BA 3FFGA 2AMDA 1O5FH 2OINA 1J8AA 1KLJH 4I86A 3NRLA 1D3PB 2LPRA 5A09A 3UIRA 1C5XB 1FJSA 2XBWA 3VB5A 3RU4D 2CGAA 3GYMA 4BAMB 3UQVA 3S7KB 1OOKB 1FY4A 2VGCB 4NG9H 4YOGA 3RM0H 1K1PA 2OBQA 1P09A 3RU4T 2G5VA 2LP6A 4H6TA 4A1VA 1HAPH 2PSXA 2P3UB 1IQHA 1W0KD 2VU8E 4WVPE 1DT2A 1VCWA 2L6OA 5E8EH 1C5ZB 1KSNA 1UK4A 4M7GA 1Z8RA 3BTQE 3RLWH 1C1VH 2A4GA 1NFXA 5EGMA 3UNQA 1MU8B 1IQLA 4A5TS 1IQKA 3F3BA 3P70B 4MNVA 1HNEE 4NWKA 2NU2E 1A5HA 1EAUA 1PFXC 1NBMD 1H9HE 1CHGA 1P9SA 2GDEH 2ILNA 3PYHA 3M36A 2ZHEH 1G3EA 1C4V2 2FLRH 2SNWA 3U98H 3MYWA 3ZVDA 1GJBB 2QXHA 3FN8A 5EPNA 3U1IB 1LCYA 3M61U 2J92A 2KAIB 4Z0KA 1P57B 2ZFTA 1O32A 1ELEE 3LH3A 4DIHH 2A5IA 4Y8YA 2Y81A 3ZZAA 4SGBE 1C2MA 3RU4E 2J5UA 4ACBA 1HAYB 1AWHB 2L74A 4ABIA 1XXDA 2OK5A 3HKJB 1MAXA 1O30A 1RRKA 3EQ0H 3FZZA 1ZMLA 3PMBB 4MTBA 1J16A 3VB4A 1IQFA 2NU1E 2SGDE 3MU0A 1W12U 1NRRH 2H5DA 1ZJDA 4HGCA 4D9RA 4JZ1A 1E34B 3RXTA 3F2GA 3A8DA 2IOTA 1O3LA 3C27B 3SV8A 3ZYDA 2FWWA 4GAWA 3E1XB 3SO3A 1C1OA 2G55A 2Z3EA 3T29A 3SJ8A 1FX0B 2J4IA 3LJJA 1IQGA 2ZWLH 5T6DA 2F9VA 1T8MA 5EU8A 1JIRA 1TBQH 4AFSA 2XCNA 3RXMA 2PKAA 2VWNA 2C8ZB 2ZCKP 1EZUC 1NBME 2PKSC 3MFJA 2EI6A 4K3JA 1D6WA 4WJG2 1LHDH 5CE1A 1WSSH 1SC8U 1N6XA 1SFQB 1VR1H 1DICA 3UOPA 3GY2A 2FI5E 1K22H 4IC6A 3TH2H 1QB6A 3IG6B 3QUMP 1MKWH 4A1XA 1GPZA 2EC9H 3SJKA 3ZYEA 4MQAA 3A89A 2Z9LA 3T25A 3BTME 2OQ5A 1A7SA 1FONA 3NZIA 2W6JD 1CA0C 2GDDA 3SNEA 4NFEA 3ZZ3A 5JPMH 4ZKNU 1U6QA 1LTOA 2G51A 4K2YA 5HGGA 1TB6H 2EY4C 3RC6A 5EOKA 5GCHG 1KXAA 2BVXH 2FS8A 4UFEH 4BNRA 1Y3YA 2G52A 4XBCA 1GBAA 1H1BA 1GMDF 3SUEA 5K7RA 1AKSB 2F43B 3KQ5A 2VINA 5DP8A 1XUJA 4WXVA 1GL1A 1C5RA 3BG4C 1SOZA 2P8OB 3ZZCA 1JRSA 2P94A 1ZGVA 5C20A 1ELGA 2EA3A 5EJ1A 1O3CA 2YMSD 1C1UH 1EASA 2ZA5A 3P92A 4B2CA 1AUTC 1LVMA 2BQ6B 3RXRA 2GJGA 3L3TA 2VIDA 5L6NH 2BB4A 2FDAA 3OX7U 5A0CA 3FP8E 4H4FA 1V2TT 5FAHA 3PRBA 2A4OA 2KCYA 3QZRA 2FOFA 4JK5A 1G32B 1GDUA 4Q7ZA 1MTVA 1UHBA 1COWD 1RIWB 2B0FA 2GP9B 3T28A 3UR9A 1K1JA 2XBVA 4TY7A 3VB7A 1LHEH 5DN6D 3STJA 2HNTE 1W3CA 4NSVA 4B2AA 3OTPA 1MH0A 4X6OA 1CO7E 1AI8H 1PPEE 2Z7FE 4ZXXH 3H7OA 5C1YA 2ZIQH 3SJOA 4DT7B 8GCHF 1P2KA 3FANA 1QBVH 1XVOA 2Y82A 4ZKSU 2H9TH 2B8OH 2ZECA 1EJNA 1J9CH 1QJ7B 1DY8A 1S83A 1ZSLA 2RA3A 4OGXA 5FBIA 3TJNA 4DURA 1ZRKA 2ZU5A 5C5NA 2QF4A 4OGYA 1Y3XA 3PMAB 3M5LA 3ATWA 5DK1A 1FY8E 1DUEA 1EFRD 4CBNA 3CS7A 1DFPA 1O2PA 1QA0A 1J14A 1O3JA 1DSUA 2A5KA 2OC1A 4OM9A 1ELVA 3TGIE 1A2CH 2FOBA 1ETTH 1CSOE 2JKHA 4RN6A 3SU5A 5CDFE 2Z3CA 1C9PA 1MBMA 1MUEB 2O8TA 2H2ZA 1SI5H 4PROA 2PGQB 2VIQA 5JB9S 5C94A 2VB0A 3QGJA 1NTPA 4MNXA 1F5RA 1JRTA 1OKXA 2G4UA 3NXPA 4HZHA 2ZCLP 3KGPA 1GCTC 3ZZDA 1DOJA 2XW9A 3N99A 1GMHG 1SB1H 2Z3DA 2VWMA 2VIVA 3NKKA 3EA9A 4AG1A 5DSFA 1NPMA 2G81E 3ENSB 5DP4A 1KXDA 3P8GA 2ZTZA 1BUIA 3PO1C 3O8RA 1TRYA 1C1MA 2FS9A 3UNSA 1LVBA 3VXEH 4GCHF 6CHAB 3PMJA 1O2HA 3HK3B 1IQEA 2BTCE 2J94A 1C5LH 3T27A 2R3UA 1CT4E 2AEIH 3MOCA 5ESBA 6GCHG 3SV9A 1GBDA 2R2MB 4RKJB 2FESH 4Q4LA 1W14U 1A46H 1ZR0A 2C3SA 3GCTG 4X6NA 4YXWD 4ZHLU 1AVXA 1MD8A 4ZHMU 5KGOA 2CHAB 3KYFA 1C5VA 5EQQA 4MPWA 2ZFPH 4J1YA 4O03A 1PYTD 3AASA 2BDGA 3OYPA 4ABGA 2F9UA 2GZ9A 1G2LA 2BLQA 3RLYH 1FZZA 1TRMA 2ZHWH 3PMHB 3V7TA 2Y80A 2BY7X 1HB0B 4MNWA 4FETA 2WPHS 1Y3VA 2TRMA 1HAIH 3RXJA 1Y5BT 1Y3UA 1YY3A 5DKMA 2ODQA 1LPZB 3SUFA 3UREA 1TQ7B 4YM9A 1RTKA 2Y5GA 3P6ZB 1HJAC 2V3MA 3ZZ5A 4I8GA 1JBUH 1PPCE 4ZH8A 1YCPH 1AE5A 5DJ7A 1V2VT 1C1QA 3Q77A 4FVBA 5AFZH 5C1UA 3SOSA 1O36A 1BQYA 2BDBA 2WZQA 1BTWA 1GBBA 3SHCH 3DA9B 5DP7A 2QV1A 1GL0E 4K69A 4K1SA 1P03A 4WF8A 2BHGA 4CRDA 3HGNA 5DG6A 1WXRA 3BEFB 2G5NA 1IHTH 1IHSH 4HFPB 4NFFA 3SU2A 1MABB 1GJ9B 1AGJA 1QB9A 4B6FA 1BB0B 4I33A 5IDKA 1TPPA 2AS9A 3F68H 2G00A 2VIPA 3GCHC 4FUEA 2GD4B 1A0JA 1EOJA 4XE4A 2BDYA 1GBLA 1GHAG 4R0IA 3T2NA 1BMLA 2ZQ1A 1FPHH 4D7FA 2P95A 1QTFA 4VGCC 1EAIA 2ODYB 1C1NA 1LVOA 7LPRA 2H6MA 2BDHA 1O3DA 4ZCNA 4YESB 3NPSA 1G30B 1PPGE 1X7AC 1D3QB 2GV7A 2KAIA 1IQNA 3KQCA 2JH6D 1ARCA 1QIXB 4B6EA 2W26A 3T62A 2GMTB 3BF6H 1T8OA 5TJXA 4Y8XA 2TGTA 1EP5A 1TX6A 1KTSB 4JZFH 1YCPM 3VEQB 1NFUA 1TGNA 1J17T 4IGDA 3SUGA 3MH4A 2KM0A 2CJIA 1TA2A 1TNIA 2XBYA 4YTAA 4TWWA 3RUOA 1O5BB 2YNBA 5C17A 3ITIA 4Y76A 1N1LA 1HJ8A 5JBTA 1NU7B 3SI4H 3VPKA 1TPSA 2PR3A 3NCLA 5HIYA 1MKXH 5FX5A 4BAQB 1RGQA 3VG8A 4VGCB 8LPRA 1FAKH 3ZVEA 2ALVA 3KIDU 3SU1A 4INLA 2ZG0H 3QN7A 1YPHE
chains in the Genus database with same CATH topology
4FUCA 3TITA 1Y8TA 3ZZ6A 1MZAA 1QBNA 4IW4E 2BMGB 2BD9A 2JETC 1FNIA 4AYYB 4BXSA 2EI8A 2EI7A 1MTWA 2BZAA 3EGKH 3LT3A 5L2YH 1DANH 1KDQB 1BHXF 4ZAEA 4O97A 1FIWA 2FIRH 3UQOA 2ZU1A 3P8OA 2BY6X 4YT6H 2UWOA 3MI4A 3UTUH 1A0HB 1A0LA 1UCYK 2ZDMA 4LXBH 1GGDB 1EJMA 5JYIA 1RD3B 5FX6A 1A1RA 2VIOA 1Q31A 1TGSZ 3UOUA 1WAYB 2BQ7B 3TJOA 1GJDB 5C3NA 3TJUA 3MWIU 1BDAA 1DX5M 1OWEA 1CHOG 1UVOA 1SG8B 1AKSA 1SLVB 1D3TB 1W11U 4GSOA 1JIMA 1LVYA 2TGPZ 1YF4A 3S9CA 1KIGH 3PWCA 2GT7A 1YKTA 2D8WA 3M3VA 3SJ9A 3I29A 1V2OT 5DP9A 1DS2E 2CN0H 4UDWH 5CHAC 2OCVB 1Z71A 3SJIA 1GHBF 1O5AB 1TLDA 2F9PA 4LOYH 3H7TA 2VWLA 5EODA 2D26C 3LDXH 1OP2A 2I6QA 5EW2H 1O37A 2F9BH 1AMHA 4FUHA 3ZZ7A 4AB8A 1O3PB 2FI4E 4KP0A 1GHXH 4E7RG 3BIUH 1MTUA 2PTCE 2Q6FA 3SNCA 1YLDA 3A8CA 4WY3A 5ABWA 2ZKSA 1DXPA 1K1MA 1TNHA 2BD4A 3SNDA 2VGCC 2ZDVH 1NO9H 5DP5A 1SGIB 1DWCH 1EZSC 1FN8A 2TPIZ 1GWAA 2W3IA 1ELBA 5AHGH 1ZTKA 1BOQA 3NWUA 3QZQA 1TABE 1SGPE 2R2WU 1SOTA 2ZHFH 4IN1A 2GVFA 3G01A 2QYIA 2ZF0H 1F0TA 3P95A 4FUIA 1GBIA 1V2UT 4NWLA 1YPGH 2BLOA 2ZFSA 5FPSA 1AZ8A 1GJ8B 3GICB 2ZFFH 4JZDH 1ZMJA 4BTTB 1WBGB 1T31A 2ZHQH 3S7HB 3LOXA 3K65B 4E7NA 2ZU4A 1SBWA 3BEIB 3SV2H 1HAZB 1GI9B 1TNGA 1OP0A 1GVZA 4CH2B 5SGAE 1Y59T 1ZTJA 2FI3E 1RJXB 3LGTA 4X0WU 4SGAE 1DSTA 2ZDAH 1SFIA 1C2IA 3Q76A 3BTTE 1LQDB 1Z7KA 3A87A 3S69A 5A0BA 3RXKA 1O5GH 2ZGBH 3ZZ9A 4OS6A 4Q7XA 1BT7A 2ZNKH 3LJOA 4U01A 4WWYA 1O5CB 1WQVH 2A5AA 3A81A 2BY9X 1ZPCA 1ETRH 1LPGB 1FXYA 2QN5T 2HNTF 2A7CA 1MMJN 3MNBA 1QA7A 1Q3XA 1CGIE 2GKVE 3NK8A 4D9QA 1C2JA 4CHAB 3ATKA 1P01A 2HVXA 1V2RT 1UVSH 2SGQE 3BTGE 1NY22 3RXCA 2BXTH 4O3UA 2O8UA 1SLWB 4NZQA 3ZVAA 1KLTA 4TPIZ 2BLWA 4A1TA 4AB9A 2IN2A 2J2UA 4XBDA 2VVUA 3SBKA 1GI7B 1XVMA 1XKBC 2SGPE 1V2LT 1Z6EA 1EKBB 2BD8A 4Y7AA 2AMQA 1NRQH 2FP7B 4FUGA 5HYOA 3V13A 3PWBA 3BIVH 5EXMA 5GXPA 1EP6A 3O8BA 4K8YA 3RXOA 1C4U2 1LHFH 1H9LB 3B23B 3AW1A 1P0SH 4ESTE 1O2IA 5DPAA 3ODDA 3E6PH 1OYQA 3FP6E 3M5OA 2HOBA 2OC0A 4JCNA 2Y6TA 3E0PB 1YPKH 1FMGA 1O5DH 3KHVA 1GJ6A 2JH5D 2VVVA 3TJVA 3M7QA 1YC0A 4O9VA 3V12A 2OC8A 2UUYA 5GCHF 1VCPA 2P8OC 4UFFH 1PPZA 2QIQA 2P3TB 5FCKA 1UVPA 1RXPA 3ZV8A 2ZGHA 1XKAC 1C1TA 1G3CA 1HGTH 3QLPH 2B7DH 1GBJA 2H9HA 5JBAS 1UJ1A 3DUXH 1GHZA 1SQAA 2FLBH 3EAJA 2QGRA 3QX5H 1HYLA 1SGTA 2GCTB 1B5GH 3MO3A 4AFUA 1Q2WA 3MU4A 1Z6JH 3O8CA 2ZDKA 1OP8A 3SGAE 4DOQA 7GCHG 4BAHB 1G9IE 1GJCB 1TPOA 4K60A 1THRH 1NRPH 2CMYA 3T26A 4ZHAA 1IOEA 1RIWC 2B5TB 2ASUB 4FVDA 1AN1E 2W3KA 1SPJA 1C5OH 4CRBA 4BXWA 2QC2A 3F6UH 1GBFA 1TNKA 1WV7H 1HJ9A 4KTSA 3LGUA 2FOMB 1OWKA 4IN2A 3VFEA 4I32A 2GCHG 1AO5A 1DITH 5T6GA 3SV6A 3DFLA 2GV6A 2Q6GA 2WYJA 1EAXA 4B1TA 1W13U 2HPQH 2O8LA 1TX8A 1SL3A 5GIBA 3KQBA 1DWDH 1TGBA 1VITH 1RTFB 4NCYA 1C2DA 3W94A 2XNIA 4MNYA 1ESBA 1O34A 1FY1A 3KL6A 3A7TA 4ISOA 4X2WA 1GBHA 1CA8B 8ESTE 1W7GH 4Z6AH 2VVCA 3A7VA 3A7YA 1W10U 2BYAX 1LHCH 4B74A 1TX7A 1UK3A 1P12E 4ABEA 5C2ZA 1SHYA 3ATMA 4GHTA 2HPPH 1ZSKA 1ETSH 5PTPA 5DGJA 1YBWA 2HLCA 1BTYA 2EEKA 3BTKE 3E90B 3IWMA 5L30H 3K6YA 1NROH 1MD7A 4ZMAH 1UCYE 3OY5U 5E0JA 4FUJA 1TA6A 1XUHA 2QF0A 4DCDA 2D2DA 4X6PA 4ISLA 4RSPA 2FOHA 4BOHA 4MVNA 3SV7A 1ORFA 1KDQA 1FDPA 6LPRA 3TLOA 3TH4H 1S85A 1KLIH 1P11E 1O2TA 1T32A 1T4VH 2FOAA 3R0FA 3MNSA 3KEEA 3I78A 2ZI2H 1XUIA 1C1SA 3CP7A 3QK1A 2C8YB 2BD5A 3O8DA 3GDSA 2CXVA 1SGFA 3EA8A 1K1NA 3F9EA 2Y5FA 3SNBA 1QJ6B 1ID5H 2A1DB 2F3CE 1G2MA 2WPJS 3D65E 1ZZZA 2AMPA 6CHAC 4A92A 3K6ZA 1N8OB 2PV9B 1DDJA 2A7HA 1EXFA 2DE8A 1YPEH 1XUFA 1O3KA 1AWFH 1VITF 2ODPA 3K9XB 4Y6DA 1GJAB 2BD2A 4ABJA 2BVSH 1SMFE 2M5TA 4BAKB 2ZGXH 5FCRA 2CHAC 4OS7A 1SR5C 5F6MA 2P59A 1NT1A 4YO9A 1XX9A 3A82A 3UFAA 6GCHF 2ZTXA 2P3FH 5LPFA 3RXHA 1SGQE 5H4IB 1TYNA 1D9IA 1BBRK 1K21H 1LPKB 2H5CA 1C1RA 1C1WH 4IS5A 1P2NA 4Q7YA 5JB8S 2WUBA 2A45B 1V2QT 1P3EA 2V3OH 3KQDA 4Y10E 5LPEA 1GBMA 1QQ4A 2STAE 4K8BA 2WUCA 3E91A 1UVUH 1SGEE 2UUFB 2F9OA 4YLQH 5J4QA 4OS1A 2C8WB 2WV5A 4AFQA 1CT0E 1TMTH 2CV3A 2BD7A 4IBLH 4I8KA 3E0NB 2XBXA 5FPYA 3TH3H 1CE5A 4GHQA 1V3XA 1WUNH 4AGKA 1BCUH 4JZEH 3GY8A 4X1NU 4GVUA 1K1OA 1ZOMA 1TGCA 2A0QB 2IPHA 1G36A 1YPJH 3MHWU 1QRZA 3TVJB 1CT2E 1OWHA 4B2BA 4AGJA 1G3DA 1B0FA 3K2UA 1O2NA 1TNJA 4K5ZA 2NWNA 3RXAA 3RXGA 3Q3XA 1NFWA 1DWEH 1HAHH 1AE8H 3C1KA 3VB6A 2OD3B 4AYVB 1C2HA 2Q6DA 1TNLA 4GLYA 1SHHB 1F92A 4AFZA 3RMOH 1GHAF 3U69H 2GMTC 1P02A 2R0LA 5AVDA 3A83A 2BLVA 1L4ZA 3M3TA 1GCDA 4ZKOU 3TK6A 1BHXB 2Y7ZA 1O3NA 3A80A 2G8TA 2P93A 1SSXA 5IYTA 3VXFH 1O2XA 1C1PA 3SU4A 4YT7H 1GVLA 4INKA 1ZGIA 1EX3A 1L1NA 2OUAA 1NRNH 1ELFA 1GI3A 3SORA 2R9PA 3CENA 2PHBA 2Q1JA 4IMQA 2GT8A 1ANEA 3TPIZ 1MCVA 3WY8A 2QCYA 1Z8IB 1TQ0B 2ZP0H 3RXIA 1AFQB 3Q3KA 2QXIA 1FQ3A 4Y0ZE 3MU1A 2UUJB 2XXLA 2SFAA 4TY6A 1C5WB 2GZ8A 1MBQA 2Z9GA 4X1RU 1ELTA 4NIYA 3LGVA 1EJAA 2O9QA 4JYUH 2AYWA 1O35A 1BRBE 3FAOA 3H5CB 3PTBA 3F1SB 3ZV9A 1BTUA 1ZMNA 1D6RA 1C2GA 2ALPA 3LGWA 4NIVA 1VGCB 3TNTA 3KNXA 1GMCG 1TBRH 3ODFA 1CGHA 2UUKB 3RXFA 5LPRA 1EUFA 1WYKA 4XBBA 1GGDC 3F9FA 2BM2A 5K0HA 2WPKS 1UK2A 2TGDA 1GI8B 1QL9A 1EB2A 1P9UA 3RMLH 3TIUA 1UTLM 2A32A 1P2MA 2QY0B 1THSH 2ANYA 1ZHPA 2ZDLA 3ZVFA 4TWYA 2ZPSA 2HGTH 3M7UA 3W95A 5HM9A 1BTHH 3E8LA 5A2MH 2V6NA 1DUAA 1N6YA 2BXUH 4Y11E 3HGPA 1S82A 3MH5A 4Y7BA 2RA0A 1FY3A 1V2JT 3V0XA 2C4FH 4ZXYH 4YOJA 1K2I1 4F4OC 1FV9A 1PQ7A 1CHOF 1T8LA 2ANWA 3SUDA 1O0DH 3A7ZA 3PLBA 1ANDA 1TRNA 1GG6C 1C2LA 1J15A 3SU3A 1UO6A 2WINI 4UONA 3B9FH 1A4WH 1HAGE 2TGAA 3GYLB 4CRCA 4MPVA 1SLUB 1O2WA 4WMFA 2HNTC 2AGEX 1SGRE 1NRSH 4H6SB 3SN8A 1F5LA 4FUDA 4THNH 1MAYA 2DUCA 1W8BH 3A7XA 1O2YA 3RXLA 1MQ6A 4QT8C 5GDSH 2XC5A 2GZ7A 2OXSA 1L1GA 4BTUB 3RMNH 1FI8A 1F0UA 1BRAA 3SQEE 1BMNH 2OC7A 7ESTE 1CGJE 1GI6A 4B71A 2YNAA 2HWLB 3M5MA 1DVAH 3SU0A 2SGAA 3E16B 1H8IH 1T7CA 1S5SA 4TYDA 1AD8H 5EXLA 4A6LA 4D7GA 1GI0A 1P3CA 3SGBE 1GBTA 4XFQA 1XM1A 1OX1A 1HDTH 2PUQH 4CRFA 1GG6B 4WMEA 1QY6A 1JMOH 1TFXA 1ABIH 1PQ5A 1OWIA 5JBBS 2FO9A 2THFB 4CR9A 4XDEA 1TGTA 1WTHD 3L6PA 2UWLA 2AGIX 4CR5A 1EOLA 3GOVB 3ZVBA 2GGVB 4DY7B 2ZFRH 1UCYH 3FP7E 1SVPA 3NUMA 1HLTH 1P06A 4HI3A 3F9GA 2PSYA 1CBWB 5JDUB 1K9OE 2A7JA 2AIPA 3BN9A 4GUXA 1LQEA 3HK6B 2PW8H 1ZHMA 1WTGH 3GY7A 4ZKRU 4ABBA 1TMBH 4Q2KA 2AGGX 3PLKA 4FU8A 1MTSA 1L1JA 1O2QA 3M37A 1KY9A 3ATLA 3AW0A 2OTVA 1V2NT 1SLXB 1IQJA 3MMGA 1HPGA 1KXEA 2VH6A 2A2QH 1S84A 2WPIS 4X2XA 5GJ4B 1BTPA 1VJ9U 4HTCH 1FY5A 3LPRA 3MH6A 1Y5AT 2FOGA 1A61H 3RXBA 1MTNC 5F03A 1UTMA 3RXUA 1O3OA 2Z9IA 4KELA 3A7WA 4UD9H 4CHAC 3AAUA 4E05H 1B7XB 1W7XH 1IAUA 1ZTLA 2ZC9H 3SZNA 5CMXH 1O3AA 2FYRA 1ELCA 1THPB 5E0GA 5I25A 3N7OA 2ZEBA 1BBRE 3M7TA 1BTXA 1BJVA 2BZ6H 4X1QU 5F8ZA 1BRUP 2ZPRA 2ZGJA 5TCAA 2V3HH 1EB1H 1HXFH 4LZ1H 3QTOH 1ARBA 3PROA 3RXQA 3BG8A 3PLPA 5F8TA 1SGFG 1AVGH 3I77A 1E35B 2ANKH 2ZPQA 1C5TA 3SW2B 1MTNB 3SI3H 4NSYA 3MTYA 9ESTA 1AB9C 4ABAA 4CH8B 1TPAE 4H42U 1TIOA 4TPYA 2A31A 1MQ5A 2FM2A 2AERH 3P8FA 5C67A 2J9NA 1P2QA 3VGCB 5FPTA 2OP9A 1UTNA 3ZVCA 5FHTA 3MU5A 2XRCA 1WU1A 2HRVA 2W5EA 1P10A 3UPEA 3S9AA 2BX3A 1MKWK 2BY8X 1LKAA 1PYTC 1TMUH 5DO4H 4MG3A 1LO6A 1KTTB 1AHTH 3BSQA 3TK5A 3A86A 2C90B 2F83A 2GCTC 3BTFE 2QXGA 3LONA 1GBEA 1C5UA 1P2OA 1HCGA 1CQQA 1AB9B 1PPBH 1O2JA 2NU4E 4FU9A 1O2ZA 1KYNA 1F5KU 3DD2H 5BPEA 1YYY1 2BDAA 3HPTB 3LGYA 1HFDA 2XYAA 1HBTH 3STIA 2O8WA 5A8XA 1TALA 7GCHF 1BMAA 1AUJA 1ELAA 1EPTA 1QURH 2FYQA 2BX4A 3LC5A 1YP9A 3OTJE 4BTIB 2FOEA 1HAVB 1S0QA 3ESTA 2XWBI 3OU0A 2GX4A 2ZDNA 4FUBA 1GJ7B 5HMAA 1O3IA 1QR3E 4UEHH 3P17H 3JZ1B 5TCCA 3A8AA 1OS8A 1QJ1B 1FN6A 1JXPA 2ZGCA 1DLKB 2GCHF 2PTNA 1L0ZA 2RCEA 1QRXA 3BTHE 4MPUA 2C93B 4ZUHA 1IQIA 2DE9A 1P04A 1SQOA 6ESTA 1A3EH 1C2EA 1VZQH 1YPHC 3TNSA 1H8DH 1HV7A 4NIWA 4DVAU 1QFKH 1PQAA 4DIIH 3BTEE 3SQHE 1BZXE 1TOCB 1IQMA 1TWXB 1O33A 1GI5A 4RKOB 2BDCA 4A7IB 4DG4A 5ESTE 4CREA 2V0BA 3M3SA 1Y3WA 2BVRH 1NC6A 1FLEE 1Z8GA 5AF9H 2F91A 2FODA 4BANB 2PKSB 1WQSA 3JZ2B 4ZROA 1CVWH 2ULLA 3KF2A 2W7SA 1QRWA 3OY6U 5A8ZA 3IITA 1L4DA 4AX9H 4WXIA 4NA8A 1Z1IA 1UVTH 4ISHH 1QNJA 4E06H 4WMDA 1GDQA 2ZFQH 1NFYA 1YM0A 4MPXA 2AFQB 1CA0B 3VB3A 1E37B 4I8JA 2ZQ2A 4KTUA 1ZPZA