3RXMA

Crystal structure of trypsin complexed with [2-(2-thienyl)thiazol-4-yl]methanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxmA02
1A5HA 2B9LA 1W13U 4Q7YA 3A85A 4I8GA 1RRKA 4ZMAH 3B23B 4NGAH 2BHGA 1KLTA 7GCHG 1YKTA 2FXRA 1W7XH 1G3BA 3LGVA 1SHHB 1GDQA 1P10A 1GHAG 1NRPH 4IC5A 2PHBA 4X1QU 2WPHS 3E8LA 1HUTH 3SU0A 1AU8A 1QL7A 3A7TA 3PTBA 1O2JA 1ZPZA 3R3GB 2CHAC 1Q31A 2XC0A 4INHA 1O5FH 2C90B 3ZYDA 1VZQH 5C5OA 4ZKOU 4Y71A 2ODPA 2SGEE 2CV3A 1N6YA 1HAOH 2AEIH 3MH6A 2ZP0H 1PYTD 1UVSH 1EOJA 1ABJH 2WPMS 3LGUA 5JYIA 3EE0B 3RXSA 4X2YA 2H5DA 1H9LB 1NROH 3BEUA 1LKBA 1NRRH 3QUMP 1C2HA 1C4U2 1GBEA 2Y6TA 2STBE 3OYPA 4HGCA 4NSYA 1Y3WA 3STJA 2WUBA 2VINA 1MD8A 3HGPA 4XDEA 3W94A 2W26A 3P95A 2UUKB 2SNWA 5C20A 1UTJA 8GCHG 2GV6A 5TJXA 1SPJA 1SGCA 4Y6DA 2AMPA 4NIWA 4KTUA 1RGQA 1SGQE 3AW1A 2OC7A 2P94A 4D9QA 1ID5H 4BNRA 3RXIA 2AYWA 1Y3VA 4TYDA 1N8OC 2OBQA 1NRSH 4BAQB 3M3TA 3LC5A 3N7OA 5C5NA 2XTTB 3PO1B 3KQCA 2AFQB 4RKJB 2PSYA 4IMQA 4NZLA 3V0XA 1UCYE 3Q00A 5DGJA 4VGCB 1QJ1B 1Y5AT 4B71A 1MZAA 2W5EA 3GOVB 1O2KA 1GHYH 2VH0A 3NCLA 3RXGA 3GCOA 2FX6A 4OS4A 3I78A 5A0AE 3MI4A 1NY22 3A84A 4DGJA 2D26C 2FS9A 1P06A 1EQ9A 3ESTA 3QZQA 1TB6H 4I33A 1J9CH 3EAJA 2ZCHP 5DP3A 1D6WA 5LPEA 2A31A 1C1QA 2ZU5A 5HM2A 2PGQB 4UE7H 2G8TA 2ZEBA 5AHGH 1AN1E 4LZ1H 2IOTA 1BBRK 1NTPA 2YNAA 1V3XA 1MTSA 2P3FH 2UWOA 3RXEA 1V2NT 1HAIH 5C1YA 1AWFH 2VVUA 3KNXA 2F9VA 4AB9A 1UHBA 1DANH 1LHGH 5JBCS 1RXPA 2ZHWH 2W3KA 4YOGA 1G36A 1O2MA 1DITH 2BTCE 4YT7H 3KCGH 1AE5A 1EJNA 1BTUA 2HOBA 1VCWA 1UMAH 1MQ6A 4MTBA 2Z6BD 3TJVA 2C8YB 1P11E 1YPGH 4OGXA 1FY1A 3K2UA 2FOEA 3SUEA 1TFXA 3FZZA 2RDLA 3P92A 1C1TA 1EPTB 7ESTE 1LCYA 4LZ4B 5HYOA 2PKSB 1QRXA 1EJMA 3GCHB 3A80A 3RMOH 2BQ7B 4ABHA 1BMAA 1TBQH 1CO7E 1WTHD 2VWOA 1ELVA 3ZVEA 2ZDMA 1SLWB 3F9HA 1EUFA 1T32A 2AIPA 1ZHPA 4AORA 3U8TH 4NA7A 1IQLA 1BRUP 3ODFA 1N1LA 5BPEA 1ZMNA 2A4OA 1F0TA 2FIRH 2OQUA 1XUGA 3RXLA 3HKIB 3SNAA 2XBWA 1PYTC 2PR3A 2EEKA 1V2RT 2THFB 1G3EA 1TE0A 1Z8RA 3ZVGA 2HVXA 1EOLA 1O3NA 1WYKA 3BTHE 1QL9A 3HKJB 1O5AB 1NFUA 1PJPA 2EI7A 4FU8A 1DY9A 1ELAA 5EPYA 1HAHH 3MO6A 3M37A 2VIVA 2FEQH 2QN5T 3ZZ3A 5LGOA 1B0FA 3A8BA 2CHAB 4JYTA 1GHXH 1BBRH 3E91A 3S7KB 1YPEH 2QC2A 1DWCH 1MU6B 2C8WB 3LGWA 5FX5A 1Z1JA 2HWLB 2C8ZB 2TBSA 1BHXB 2O8MA 1O33A 4OS7A 5DP8A 1CHOG 1ELTA 3GYMA 1G3DA 3GY8A 1GBHA 1SFQB 4ABEA 3M3SA 4AG2A 1DUEA 1CA0B 2F9BH 1GBKA 4OS5A 1DPOA 1FZZA 3SGAE 4ABGA 1AFEH 1QIXB 2FO9A 2XWAA 1O3OA 1SLVB 5C3NA 3MNXA 1V2MT 2BD4A 1HRTH 1OWJA 3U1JB 3RUOA 2QCYA 4TY7A 2J94A 5A0BA 1SGRE 4ZUHA 4MNYA 1C1WH 3CENA 1FV9A 4XBCA 5F8ZA 1H4WA 2W7UA 1BB0B 1GJ8B 1O3CA 2XBYA 1BCUH 4KELA 2ZG0H 3VB7A 1IAUA 2V6NA 1P2NA 1GI4A 1IHSH 1C5WB 1O39A 1K1JA 1G2MA 2VNTA 3P17H 3ZVDA 3Q3YA 5DO4H 1K9OE 1EASA 2QAAA 5FPSA 3UWJH 1VITG 2XCNA 1L1NA 1S6HA 4FUBA 3M5MA 5LPRA 1CBWB 1OP0A 1L4DA 6CHAB 1UTNA 1EAWA 1O3KA 2OUAA 1O5CB 3QGNB 8KME2 4R8TB 1S85A 1V2LT 1RFNA 3JZ2B 3RM2H 3RLYH 1YP9A 3TPIZ 1PQ8A 1BUIA 2BD8A 3DT0H 4OGYA 4B2AA 1J15A 1D3PB 3SU4A 4BOHA 1HB0B 1C9TA 2BLVA 7GCHF 3MFJA 3TLOA 4WXIA 2SGFE 1BJVA 1TGCA 3TH2H 2A5IA 2AH4X 5DK1A 3SZNA 1SGFG 3SBKA 1MKXH 5JBTA 1QRWA 1XUJA 2A1DB 2WPJS 1XKBC 1YPMH 3TGKE 4IBLH 1C1NA 1F2SE 1NESE 3LJOA 4ISHH 3VB5A 1FIWA 2BX3A 2A7JA 1ZHRA 4X6OA 5A09A 4ZKRU 1CT2E 3BIVH 3ITIA 1C1UH 1K1IA 5DP5A 4A6LA 3QTVH 2K1QA 4WXVA 4JZDH 2ZZUH 1O38A 5EXNA 2VJ1A 3CP7A 4GUXA 4WH8A 2ULLA 4Q80A 4XFQA 3MTYA 4H6SB 1V2UT 3SV6A 4X1PU 2H1UA 2W3IA 4CHAB 1TGBA 1KXAA 4INKA 1BTWA 1MTVA 4K2YA 2OD3B 2R2WU 4CBNA 1TMUH 3O8CA 3LT3A 1QBVH 1OWEA 1UTPA 1ZGIA 5CMXH 4AYYB 3RC6A 1ELEE 1TGTA 2Z9KA 3RC5A 1YYY1 1V2KT 5C67A 1BTHH 2AGGX 5GCHF 1VGCB 1C4V2 1ZR0A 3RXFA 2ZFRH 4X1SU 2ZI2H 3MYWA 4THNH 3ZZDA 2BLWA 4YLUA 2TPIZ 1O3AA 2VB0A 1JXPA 2QF3A 4MNWA 2BY7X 2FOMB 1ELCA 1AI8H 1AUJA 1D6RA 1K1MA 1TPSA 4FVDA 2Y5GA 1ZSJA 1O35A 1WV7H 1O2LA 1AZZA 1MU8B 4ESTE 3ZV9A 1U6QA 3UFAA 2B5TB 3SI3H 2Z9GA 2GMTC 1T7CA 2A4GA 5FPTA 1O3IA 1QGFA 3MU1A 1O3MA 3BTKE 4AX9H 1HDTH 4RN6A 3S9AA 1CE5A 4VGCC 2ZTZA 1DM4B 2ZGJA 1HBTH 1BMMH 2XW9A 3ZZ7A 4K1EA 1C5PA 1HPGA 1Q2WA 2F83A 3HPTB 3QDZB 1A5GH 3SUFA 1GPZA 4Q7XA 4ZHLU 5EXLA 2EC9H 2UWLA 3E90B 5ETXA 4AGJA 2BD3A 1TNLA 4NIYA 2C8XB 1TMTH 1GHBF 2FDAA 3A8DA 1BITA 4YTAA 4O97A 1RIWB 2ASUB 2ZGBH 3BTTE 1MBQA 1O2VA 4LXBH 1JWTA 1LVOA 4X1NU 2FS8A 3ZVFA 1ZTLA 1ZMJA 1HJAB 3SNEA 1O0DH 1KSNA 3L33A 1T8NA 2ZFFH 4AGKA 1AZ8A 3S7HB 1S83A 3SV7A 2ZPSA 3URDA 3T26A 1BBRE 1C2MA 1CQQA 1A61H 1TOMH 2ESTE 2BM2A 3DA9B 1TX6A 1SI5H 5C1UA 1BTXA 3H7OA 1C5NH 1TQ0B 1YPKH 1GGDB 3K9XB 1V2QT 3UNSA 3SJ9A 1C2GA 1TX7A 1HAVB 4FU9A 3M7QA 5L30H 1QNJA 1GBTA 3A7VA 1FAKH 4WMFA 5F8XA 3VXFH 1UTKA 1SLUB 1KXEA 1QTFA 1K1PA 1GI5A 3RXAA 1OWDA 1GBCA 4E7NA 2J4IA 2G81E 5CHAC 3GISB 4Y10E 1FPHH 1GHWH 1C5YB 2CJIA 1SGEE 1QJ6B 3ZVCA 5IDKA 1UJ1A 1V2OT 1ZGVA 2A32A 1P12E 1GMHG 2QF0A 3T28A 3ATWA 1SHYA 1C2LA 3E16B 1P05A 2FOHA 3OSYA 5IYTA 1GI0A 4ABFA 1IQFA 5T3HA 4X8SH 1ANEA 1T8LA 3SV2H 2BMGB 1DXPA 5E0JA 3RM0H 3E0PB 2ZC9H 1WU1A 1CU1A 1ZMLA 2G4UA 3T5FH 3TJOA 1ETTH 3M35A 1UK4A 3W95A 2QY0B 4NSVA 3ATKA 1XUKA 2QV1A 2A2QH 4K8BA 3SO3A 1C5VA 3SNDA 2VIOA 4ABDA 4I8LA 4FXGH 2G51A 3MH7A 1GHBG 1Z71A 3B9FH 1K2I1 2ZFQH 4MPUA 1Z1IA 3TK6A 1DS2E 1EJAA 1XXDA 4WMEA 1H8IH 2J34A 4H6TA 2FOGA 1C2IA 5AF9H 5B6OA 3BTGE 1GG6C 3BTEE 4NFEA 4Y0ZE 3HK6B 1LKAA 2GVFA 3GICB 4X6PA 2BOKA 3EA7A 1BMNH 1UTQA 1D4PB 1QQ4A 1T8OA 3MWIU 1LHCH 3PLPA 2GZ9A 4ISIH 1JOUB 1ETRH 4D8NA 2F9PA 4I8HA 1W3CA 2JKHA 1O32A 1C5OH 2O9QA 2BY8X 2P8OC 3LGTA 2P8OB 1YBWA 1FMGA 2CN0H 1NZQH 2WYJA 1DUAA 3ZV8A 1GCDA 2BY5X 2QXJA 2HGTH 3KGPA 1Z6EA 2F9NA 3SU1A 1IQNA 3F9FA 1IQKA 1PQAA 1O2HA 2FMJA 1FPCH 1XVMA 1ZJKA 2P95A 9ESTA 2ALVA 1P01A 9LPRA 1FNIA 1ZTJA 4O3TA 3BG4B 4BTIB 4KKDA 1K22H 1MQ5A 4X2WA 1BRAA 3V7TA 2PLXA 2BQ6B 4IN2A 2GZ7A 1ZHMA 4ABJA 1GVLA 1SGFA 4M7GA 2I6SA 4U01A 4F49A 1E34B 3UWIA 2DE9A 4WY3A 1YPLH 1HJ8A 1CGJE 3KQDA 3T62A 5F03A 3ATMA 5LH8A 2OTVA 2FI4E 1EP5A 3A82A 1IQJA 2AGEX 3A7XA 2HNTC 1YF4A 2YNBA 2A4RA 1WBGB 2FOCA 3A86A 2M5TA 4JYVH 4A1VA 2ZGHA 2ODQA 1A7SA 3BG4C 2F3CE 4MG3A 3UUZA 5E0GA 1KXDA 1SR5C 3BG8A 4CREA 3V13A 3SQEE 2LNCA 2NU4E 3P8FA 1ESTA 3K6ZA 4UEHH 1MKWH 1TNKA 4DCDA 1NC6A 3LKWA 1UTLM 2YOLA 4IN1A 4Y76A 4DURA 2VWNA 2ZF0H 1AFQC 4MDSA 1WCZA 1N6XA 1K1NA 5EQRA 1QB9A 1GHZA 4FUGA 1G32B 4K1TA 4H42U 3VGCC 2ZU3A 2W7SA 4BTTB 1AD8H 4Q7ZA 1YPHC 3UNRA 3P8NA 3V3MA 1ARCA 1G30B 1OX1A 2AGIX 3GDSA 2TRMA 5T6DA 5JB8S 1VJAU 2FODA 1BTPA 1TNJA 1DVAH 1ORFA 2JH0D 1ZPCA 1J16A 3MH5A 2FOAA 1KLJH 1PQ5A 4CRCA 2FOFA 1LPZB 1MMJN 1QR3E 1XX9A 3TH4H 2ZDAH 1LQEA 4FU7A 1NS3A 1Y3YA 3EGKH 4Y8ZA 1GMCF 3A89A 3RXQA 2QIQA 2P3TB 1NFXA 1SG8B 3KN2A 4LOYH 1Y5BT 1TPAE 3LH3A 1SVPA 1FUJA 1UVOA 6LPRA 3NZIA 4GVUA 2ANKH 2AERH 2WPIS 2BD5A 1C2EA 4D9RA 1D3TB 5JBAS 2R3YA 5GXPA 3SU3A 1BDAA 1WQVH 1AHTH 1XUFA 2ZCLP 1HXFH 1DWDH 1FY5A 3I29A 1YPHE 2ANWA 1EAUA 1MUEB 2FPZA 1KIGH 1P57B 2R0LA 1AIXH 4OS1A 3RXDA 1GI3A 1TALA 2FM2A 4DG4A 4CH8B 2WV4A 3EDXB 5F6MA 2Z94A 5ABWA 4I7YH 1E0FD 4MLFB 3PV4A 1IQHA 1DDJA 1O2GH 1TGNA 3VB3A 2IPHA 5EQSA 3O8DA 3ZZ6A 2J92A 1Y3UA 4I8JA 4NWLA 4AB8A 1EAIA 2A7CA 1UHBB 2CXVA 1EB1H 1EB2A 4BAHB 1HIAB 1A2CH 1LPKB 1S81A 3AAVA 4FUEA 1OWKA 4KTSA 4BAKB 3A88A 2BVXH 4A7IB 2AIQA 2RCEA 2ZKSA 1QQUA 5K0HA 1AFQB 1IQMA 1OKXA 1GL0E 1P2IA 4CRFA 3T25A 3QK1A 2STAE 4B73A 3BTME 1PPEE 1Y8TA 3RXPA 1BRBE 2J95A 1OYTH 5GWZA 4ISOA 2HPPH 1K28D 1C4Y2 4MNXA 2RG3A 1DWEH 4NCYA 1CGHA 1MTWA 4MPXA 1GJ4H 3PWCA 3L6PA 1BIOA 3KQEA 1A1RA 4O3UA 2R0KA 1C1PA 2A0QB 2OC1A 1V2TT 1O5EH 2WPKS 4E06H 1W11U 5A0CA 1ZRKA 1O3HA 3EYDA 2GV7A 1ZPBA 3RXTA 2BVSH 3P70B 1CHOF 1LTOA 3VEQB 1DWBH 2BD9A 1O2IA 1SGIB 2VGCC 1O34A 3MU5A 1O3JA 2UUYA 1MAXA 2BDCA 5DP7A 1XXFA 2BD2A 1AB9B 4IS5A 3TNTA 2TIOA 1SGTA 4BANB 1F0SA 1MAYA 3SI4H 4JZ1A 1O2NA 4ZHAA 1FY8E 3DD2H 1BQYA 1JIRA 3ELAH 4D7FA 1O5GH 4FUJA 2GCHF 5E2PA 1IQEA 1C5ZB 2ZO3H 3BTDE 4XBBA 3A81A 1DT2A 5LPFA 1GJ7B 1FJSA 1ZLRA 5GJ4B 1O3GA 1GMDF 3TJUA 1GGDC 3CS0A 3SHAH 1SL3A 3NPSA 1NFYA 5E0HA 2Z9JA 3MHWU 3MU4A 3M3VA 3RMNH 2C93B 2G4TA 2XBVA 3ZZBA 3GYLB 1C5XB 1P2KA 1EP6A 5EOKA 5EGMA 1O31A 2ZQ2A 3EQ0H 3KEEA 2C4FH 3A7WA 3E1XB 1E38B 4B74A 4NFFA 1RJXB 4QT8C 4YZUA 2VIDA 5PTPA 1IHTH 1L4ZA 2B7DH 1ABIH 3FP7E 2A2XH 2IN2A 3RXBA 4MNVA 1LVMA 1J8AA 3RXHA 1AVXA 2GCTB 3CS7A 4Y0YE 1SQOA 2Q6GA 2EI6A 2XXLA 3I77A 2VWLA 1ZZZA 2PWXA 1GVKB 1P9SA 3PLKA 2Y7XA 1W0YH 3P8OA 3RXKA 1Y59T 2HNTE 4CHAC 3SV9A 3C27B 2Z3EA 3UR6A 4JMYA 1F92A 1QHRB 3MU0A 2GD4B 3GCHC 2SNVA 1J17T 1GMCG 1NRNH 2PKSC 2ZQ1A 1FXYA 3QGJA 5K7RA 3UIRA 1YLDA 3QTOH 1QBNA 2ZHFH 3S9CA 4F4OC 3SQHE 1WQSA 1FI8A 2NU1E 4ZXXH 1VITF 4WF8A 1A4WH 4NWKA 1S0QA 4K8YA 1MD7A 4XE4A 1TNGA 3OTJE 3RXVA 2A7HA 2FTMA 1BOQA 4ZAEA 2BLOA 2KAIA 3WY8A 4H4FA 3O8RA 4X8TH 2ZFTA 3T2NA 4Y11E 5DP4A 1L0ZA 2HNTF 3UOUA 1F0RA 5A8ZA 4FUFA 1AVWA 2I6QA 4A92A 1PPHE 3RU4E 2V3OH 4IGDA 1O2OA 3LPRA 1XMNB 2FLRH 1KDQB 2O8UA 3NKKA 3VFEA 1VR1H 3K6YA 1QURH 1SGPE 3OX7U 3GDVA 1WSSH 4FUDA 6GCHG 4CRAA 4X6NA 2ODYB 3FZDA 2ZA5A 2VVVA 3M7UA 1GBJA 4AFQA 1UVUH 3G01A 3TK5A 4TPIZ 2O8WA 1D3QB 1WTGH 2FYRA 1T8MA 1ACBE 1S84A 2FI3E 1IQIA 4I31A 1O3PB 2WINI 5H4IB 4ABBA 3UPEA 2OQ5A 3LGYA 5BRRE 3K65B 3LONA 1X7AC 2ZCKP 8GCHF 1ELBA 3PYHA 2GP9B 5EG4A 3UR9A 1C2JA 3QZRA 1LHFH 3ZZCA 1FN6A 1HYLA 1ANCA 3TITA 3M5NA 2BDYA 1WOFA 4Z0KA 2OP9A 1V2ST 1GBFA 1OP8A 2FOBA 3FFGA 1GI2A 1N8OB 3D49H 1RIWC 5EXMA 1O2ZA 2RA0A 2VIPA 1S82A 1SMFE 5EU8A 1VJ9U 4B76A 2Z9IA 1TRMA 4J1YA 1ELFA 2JH6D 3RC4A 1SGYE 1EZXC 2BOHB 1CA0C 1GJAB 2G00A 1P8VC 3KIDU 1QB1A 3M5OA 3UQOA 2KAIB 5DG6A 3LGIA 1PFXC 3D65E 1KTTB 1W8BH 4Y8YA 4E7RG 1EZQA 1ZRBA 1GVZA 2FX4A 1P04A 2TGAA 1CVWH 3TNSA 1PQ7A 5CE1A 2BDAA 2WV5A 1O2TA 3AVZA 5GDSH 5J4QA 4FUHA 5EW2H 1C1OA 5HM9A 1P3CA 2ZTYA 2WUCA 1GJ5H 4ASHA 3V12A 1TA6A 4BXWA 5FBEA 4AYVB 1EX3A 2OCVB 1BA8B 2OBOA 2BB4A 2SFAA 4K3JA 3D23A 1GDNA 4U2WA 2BY9X 3S9BA 1TRYA 4GCHF 1QL8A 2PTNA 2GDEH 1CT4E 4DJZB 1SB1H 4B1TA 1DLKB 1ETSH 3BEFB 1BHXF 1AGJA 5FPYA 1SQAA 1XVOA 5TCCA 1VITH 5AFYH 1W14U 1AVGH 1KXBA 1TBZH 1FLEE 1PPGE 3FANA 1YPJH 3PLBA 3ZZ5A 1C5QA 1HAYB 2QXHA 1B0EA 2PV9B 3UQVA 4TWWA 3KL6A 3MNCA 2H6MA 3Q3XA 5DKMA 1EPTC 2OLGA 1HNEE 4CRDA 1DX5M 2DE8A 1TWXB 4NIXA 2Z3DA 6ESTA 1MTUA 1K1LA 1A3BH 1EAXA 5J4SA 1OSSA 1UCYH 1MCTA 2ZPQA 1AKSB 1GHAF 1KXCA 1EPTA 4JZFH 4JZEH 3SUGA 3A7YA 2P3UB 3U1IB 1JRTA 1Z7KA 3TU7H 5DJ7A 1GI8B 2QXIA 5JBBS 4ZROA 3RU4T 4GHQA 1HJ9A 3U8OH 4UD9H 1JBUH 1AWHB 4YOIA 3T27A 1A0JA 1A46H 4NZQA 2R9PA 5FXLA 3MH4A 2O8TA 1WUNH 3B8JA 5JDUB 1C2KA 3IG6B 1HV7A 1NU9A 2ZGXH 3RXMA 4UFGH 2ZNKH 2PFEA 1CA8B 5FX6A 1MKWK 1C1SA 4ZH8A 1GCTB 2OINA 4ZKSU 2Y7ZA 5I46H 2Z9LA 1AY6H 1W10U 4JK6A 2CF8H 2BQWB 1Z6JH 3OY5U 3SV8A 3GDUA 1YCPM 5A2MH 4O9VA 1VGCC 4UDWH 2ZHQH 1H8DH 2JH5D 2ZU1A 1P9UA 3F6UH 2BVRH 1FIZA 1G37A 2JETC 4PROA 4GAWA 2FI5E 1KTSB 1F5KU 2FZZA 4ZXYH 3U8RH 1CBWC 6CHAC 2BZ6H 1NO9H 1SOTA 2AS9A 4HI3A 1JRSA 1TX8A 1AUTC 4AFUA 4Y8XA 4X8VH 1YCPH 4DT7B 2Y81A 4K5ZA 1TOCB 1RD3B 2AMQA 3GY5A 1GI6A 1M9UA 1S6FA 4GPGA 2FYQA 4JK5A 2QGRA 1ELGA 2ALPA 1BTZA 1EATA 1GG6B 4NA9H 3PWBA 1VCQA 4RSPA 3ENSB 1DFPA 2GZ8A 1KXFA 2VU8E 4AFSA 2HPQH 3LDXH 1O30A 3EA8A 3GCTF 4BXSA 2O8LA 1OS8A 2ZWLH 1ZOMA 1DICA 1EXFA 1NN6A 1OP2A 4RKOB 3U9AH 3VXEH 4B75A 3TVJB 1J14A 1W12U 3GY3A 4BTUB 5A8YA 3SU2A 1GI9B 2H9HA 1DY8A 2GTBA 3PROA 3ZZ4A 3RU4D 1TBRH 1FONA 5DP6A 5HGGA 4U32A 4HTCH 3T29A 2NWNA 1C2FA 3VPKA 2XWBI 1JIMA 2VH6A 1YCPK 2GDDA 4BAOB 3ZVBA 3SGBE 1F5LA 3DUXH 3ZVAA 1RS0A 3LC3A 1GBLA 2VIWA 4Y7BA 2Z7FE 4K1SA 3VB6A 3UNQA 1O2RA 1TRNA 1T31A 1EZSC 1TIOA 2XYAA 1ZTKA 3AASA 4MPVA 1RTLA 1GMHF 3IITA 4UFFH 4O03A 3GY2A 4J2YB 1W7GH 4I32A 2Q1JA 5T6FA 1B7XB 3UTUH 2SGQE 3VGCB 3BIUH 2PSXA 3A8CA 2CGAA 1HCGA 3ATLA 1EKBB 2GCHG 3SOSA 1F7ZA 3HATH 3U69H 2ZIQH 3BTWE 5FCRA 4DIHH 1DE7H 1O5DH 3F68H 5HXFA 3RXOA 2BY6X 5AVDA 3PTNA 3UREA 1AO5A 1OWHA 1D9IA 4ABAA 3EA9A 2GX4A 1GBIA 1V2PT 5G4BA 3SHCH 1C1VH 1H9IE 1OXGA 3S69A 3BTFE 5E2OA 1THSH 3KHVA 2G5NA 2PUXB 1O2XA 5EW1H 2B0FA 3ZZAA 1CGIE 1XUIA 2NU2E 1FQ3A 1TLDA 4YO9A 1A0LA 1THPB 3DFLA 3RXCA 1LVBA 4X6MA 5FAHA 2V3HH 1IOEA 2PKAB 1QRZA 1TNIA 3DFJA 1MZDA 2F9OA 4UFEH 6GCHF 2FESH 3SJIA 1HAPH 3PM3A 2G55A 1V2VT 4LK4A 2VVCA 1INCA 4XSKU 2PUQH 1YLCA 4ZHMU 2ZHDA 3F9GA 3ZYEA 3BF6H 5EQQA 2VWMA 4UONA 4XBDA 4DY7B 7LPRA 2GCTC 4JZIA 3C1KA 3H5CB 2P59A 4AG1A 3LU9B 4WWYA 1FAXA 1ARBA 2OC0A 3MO9A 5I25A 3OU0A 1XUHA 4AOQA 1L1GA 2B8OH 4B2CA 4Y79A 4Z6AH 1OYQA 1O3DA 2ANMH 2WPLS 1E35B 2Y82A 1FY4A 1OWIA 1P2QA 1YGCH 1CHGA 1MTNC 1A3EH 3RLWH 1GI1A 2J38A 4FUIA 4INLA 2D8WA 3M7TA 1KLIH 1G9IE 1GJCB 5EODA 2D1JA 3PMJA 1UVPA 4JYUH 2BX4A 1DOJA 4A1XA 4WMDA 1Y3XA 4ZKNU 1BT7A 1GMDG 2QYIA 1KYNA 2NU0E 3QWCH 1C1RA 2PTCE 1QA7A 4AFZA 1F5RA 1OPHB 1NPMA 1C9PA 1ZYOA 1ANDA 1GJ6A 2D2DA 2Q6DA 1LHDH 2XRCA 1BZXE 2A45B 3FAOA 1V2WT 1LO6A 1GBMA 1P03A 5GIBA 1GJBB 2NU3E 2H2ZA 1O2UA 4K69A 3LIWA 3NK8A 1GCTC 2HRVA 1VCPA 1UTOA 2ZU4A 4YT6H 2J2UA 2OC8A 2A5AA 3PMHB 1HIAA 1P2OA 4DIIH 1BJUA 3M5LA 1QFKH 3A87A 2Q6FA 2ZDNA 2ZGCA 1DSUA 2UWPA 8LPRA 1D3DB 1A5IA 3SJKA 4CRBA 5DP9A 1HAZB 4K60A 5GPIB 2SGDE 1DXWA 3PMAB 1SFIA 3ODDA 3A7ZA 3PB1E 2BXTH 4FVBA 1T4VH 3UOPA 1HFDA 3HGNA 3BSQA 1BTYA 3DHKH 3QO6A 1MCVA 1AMHA 1Q3XA 2H9EH 4WVPE 4IMZA 3TJNA 5EPNA 8ESTE 3U98H 1CT0E 3TGJE 1ESBA 4FUCA 4YLQH 2ZDVH 1P09A 3PO1C 1SGDE 2ZFSA 3AW0A 1SOZA 1LVYA 1FDPA 1P2MA 3QLPH 3NWUA 1MKXK 3BTQE 2HALA 4OS2A 3JZ1B 2FP7B 3FP8E 1V2JT 3F9EA 1GWAA 2GGVB 4YESB 3STIA 2EI8A 1GI7B 5TCAA 2F9UA 4OS6A 5ESTE 4CR9A 1SBWA 2ZDKA 1THRH 2C3SA 3E3TA 3Q3KA 4KP0A 1SLXB 3PMBB 3GCTG 2HLCA 1MH0A 1QJ7B 2XNIA 3TK9A 3MU8A 4YM9A 1DLEA 5JB9S 1AB9C 3Q76A 2AMDA 5L6NH 1G3CA 4ISNA 1UCYK 1C5UA 4I8KA 5AFZH 3UY9A 4HZHA 3RMMH 3SGQE 2DUCA 5L2YH 4KGAA 1LHEH 2BD7A 3KQBA 2BDIA 2R3UA 5F8TA 4X2XA 1C1MA 1HJAC 3M36A 4X8UH 2ZECA 1GJ9B 2CMYA 4NA8A 1XM1A 2SGAA 2VIQA 5C1XA 1NFWA 2A5KA 1QY6A 1IQGA 1L1JA 1SC8U 2TGDA 3SORA 3SUDA 3NUMA 1ZSLA 5DPAA 1S0RA 1UVTH 4CRGA 2RA3A 4BAMB 2Z3CA 2PKAA 3IWMA 1O36A 1LPGB 1K21H 2ZU2A 1O3LA 1RTFB 2FLBH 1EZUC 1JMOH 1OOKB 5FHTA 5L2ZH 4AN7A 1GL1A 3RXRA 2ZHEH 3RP2A 1KY9A 1Z8IB 1O2QA 3GY6A 2JETB 3H7TA 4TWYA 4TPYA 1ZSKA 1UK3A 3SU6A 4YOJA 1AQ7A 4B2BA 2BXUH 1W0ZU 4ISLA 2P16A 1H1BA 4IC6A 4WJG2 5E8EH 5FCKA 1KDQA 2GMTB 1TONA 4KTCA 1H9HE 4SGAE 4SGBE 2TGPZ 5CHAB 3RMLH 4JCNA 1MTNB 2V35A 1P0SH 2GKVE 4HFPB 1GHVH 3SJOA 2LPRA 1SQTA 1V6DA 3LH1A 3LJJA 2OXSA 1O3EA 1AKSA 1QCPA 1TPOA 3RDZA 3TGIE 1QA0A 1C5TA 2Y5HA 3HK3B 3P8GA 4X1RU 4DVAU 1P3EA 4CBOA 3O8BA 1C5LH 4CH2B 3BV9B 3BN9A 1ZJDA 1E36B 4X2VA 2ZPRA 1TPPA 2BLQA 1G2LA 4R0IA 2BDGA 3ZZ9A 5C2ZA 4DW2U 1UTMA 2ZTXA 1FN8A 2P93A 1AE8H 5T6GA 1MBMA 2SGPE 3R0FA 1O2PA 3SW2B 2XBXA 1NRQH 2BDHA 5A8XA 3NXPA 4Q2KA 1GDUA 2V0BA 2ZFPH 5GCHG 3VB4A 1UK2A 1YC0A 4XOJA 1F0UA 1W2KH 4GLYA 2GT7A 1NU7B 1C5RA 1QB6A 1B5GH 1T4UH 2BZAA 1LDTT 1O2YA 2TGTA 2XC5A 2BYAX 2GT8A 2H9TH 2J9NA 3QX5H 4GHTA 1K1OA 4Y7AA 2PGBB 3BEIB 3GCNA 1XKAC 3QN7A 1C5SA 5SGAE 4AZ2B 2IJOB 3E0NB 5HMAA 1LQDB 1TAWA 3RXJA 3L3TA 1TQ7B 1HAXB 2A4QA 3FVFB 1TA2A 4ABIA 5FBIA 1ELDE 3MNSA 1Y5UT 1PPFE 1GBAA 1SGNE 4NIVA 1ANBA 4A1TA 3M61U 3A8AA 1DSTA 2UUFB 3SNBA 1LMWB 3ATIA 1Z8GA 1C2DA 3F1SB 2PW8H 1YM0A 2G5VA 3MO3A 4TY6A 1P2JA 1E37B 3D62A 1GBDA 2ILNA 3FP6E 4IW4E 4GCHG 3P6ZB 2UUJB 4WH6A 1TNHA 1NM6A 4X0WU 2R2MB 2QXGA 2H5CA 2Y80A 2ANYA 2G52A 1O2SA 4DOQA 3TIUA 4A5TS 1WAYB 1TYNA 2FTLE 2BDBA 4MVNA 2EA3A 3MNBA 3SNCA 3ZZ8A 4MQAA 2WYGA 3E6PH 4CR5A 5JPMH 1A0HB 3MOCA 1O5BB 4GSOA 3MMGA 3SU5A 2CF9H 3TH3H 2QA9E 4D7GA 1O3FA 1S5SA 1SSXA 1BRCE 1L2EA 5ESBA 1GBBA 1HGTH 7KMEH 1CSOE 1HXEH 1ESAA 1O2WA 4E05H 2Y5FA 1BMLA 3URCA 1UO6A 1PPZA 1RTKA 1PPBH 2XC4A 2FWWA 1HAVA 1GJDB 3Q77A 4D76A 1TMBH 1PPCE 1Z8JB 3OY6U 1P02A 3SN8A 1HLTH 1TGSZ 1TABE 3GY4A 2XCFA 4UFDH 1C5MD 1NT1A 3GY7A 4MPWA 3LOXA 1FY3A 2F91A 3KF2A 2VGCB 3S0NA 1QBOA 1O3BA 3AAUA 1O37A 3SJ8A 2ZDLA 1HAGE 4U30A 3RXUA 3A83A 4NG9H
chains in the Genus database with same CATH superfamily
1A5HA 2B9LA 1W13U 4Q7YA 3A85A 4I8GA 1RRKA 4ZMAH 3B23B 4NGAH 2BHGA 1KLTA 7GCHG 1YKTA 2FXRA 1W7XH 1G3BA 3LGVA 4F55A 1SHHB 1GDQA 1P10A 1GHAG 2J98B 1NRPH 2JJ2D 4IC5A 2PHBA 4X1QU 2WPHS 2RFKC 3PV5A 3E8LA 1HUTH 3SU0A 1YY3A 2V7QD 1AU8A 1QL7A 3A7TA 3PTBA 1O2JA 1ZPZA 3R3GB 2CHAC 1Q31A 2XC0A 4INHA 1O5FH 2C90B 3ZYDA 5FL7D 1VZQH 5C5OA 2L74A 4ZKOU 1BMFD 4Y71A 2ODPA 2SGEE 2CV3A 1N6YA 1HAOH 2AEIH 3MH6A 2ZP0H 1PYTD 1UVSH 1EOJA 1ABJH 2WPMS 3LGUA 5JYIA 3EE0B 3RXSA 4X2YA 2H5DA 1H9LB 1NROH 3BEUA 1LKBA 1NRRH 3QUMP 1C2HA 1C4U2 2J5UA 3GS9A 1GBEA 2Y6TA 2STBE 3OYPA 4HGCA 4NSYA 1Y3WA 3STJA 2WUBA 2VINA 1MD8A 3HGPA 3PRDA 4XDEA 3W94A 2W26A 3P95A 2UUKB 2SNWA 5C20A 1UTJA 8GCHG 3F3BA 2GV6A 5TJXA 1SPJA 1SGCA 1YLNA 4Y6DA 2AMPA 4NIWA 4KTUA 1RGQA 1SGQE 3AW1A 2OC7A 2P94A 5B6LA 3WW7A 4D9QA 1ID5H 3EE7A 4BNRA 3RXIA 2AYWA 1Y3VA 4TYDA 1N8OC 2OBQA 1NRSH 4BAQB 3M3TA 3LC5A 3N7OA 5C5NA 2XTTB 2HLDD 3PO1B 3KQCA 2AFQB 4RKJB 2PSYA 4IMQA 2EQNA 4NZLA 3V0XA 1UCYE 3Q00A 5DGJA 4VGCB 1QJ1B 5KEDA 1Y5AT 4B71A 1MZAA 3F0OA 2W5EA 3GOVB 1O2KA 1GHYH 2XOKD 2VH0A 3NCLA 3RXGA 3GCOA 2FX6A 4OS4A 3I78A 5A0AE 3MI4A 1NY22 3A84A 4DGJA 2D26C 1WXRA 2FS9A 1P06A 1EQ9A 3ESTA 1E79D 1TB6H 3QZQA 4I33A 1J9CH 3EAJA 2ZCHP 5DP3A 1D6WA 5LPEA 2A31A 1C1QA 2ZU5A 5HM2A 5HIZA 2PGQB 4UE7H 2G8TA 2ZEBA 5AHGH 1AN1E 4LZ1H 2IOTA 1BBRK 1NTPA 2YNAA 1V3XA 1MTSA 2P3FH 2UWOA 3RXEA 5T1VA 1V2NT 1HAIH 5C1YA 1AWFH 2VVUA 2PP6A 4TT3D 3KNXA 2F9VA 4AB9A 1UHBA 1DANH 1LHGH 5JBCS 1RXPA 2ZHWH 2W3KA 4YOGA 1G36A 1O2MA 1DITH 4HG6A 2BTCE 4YT7H 3KCGH 1AE5A 1EJNA 1BTUA 1H8ED 2HOBA 1VCWA 3F0PA 1UMAH 1MQ6A 4MTBA 2Z6BD 3TJVA 2C8YB 1P11E 1YPGH 4OGXA 1FY1A 3K2UA 2FOEA 3SUEA 1TFXA 3FOAA 3FZZA 1W0KD 2RDLA 3P92A 1C1TA 1EPTB 7ESTE 1LCYA 4LZ4B 5HYOA 2PKSB 1QRXA 1EJMA 3GCHB 3A80A 3RMOH 2BQ7B 4ABHA 1BMAA 1TBQH 1CO7E 1WTHD 2VWOA 1ELVA 3ZVEA 2ZDMA 1SLWB 3F9HA 1EUFA 1T32A 2AIPA 1ZHPA 4AORA 3U8TH 4NA7A 1IQLA 1BRUP 2JIZD 3ODFA 1N1LA 5BPEA 4AC9A 1ZMNA 2A4OA 1F0TA 2FIRH 2OQUA 1XUGA 3RXLA 3HKIB 3SNAA 2XBWA 1PYTC 2PR3A 2EEKA 1V2RT 2THFB 5DSFA 1G3EA 1TE0A 1Z8RA 3ZVGA 2HVXA 1EOLA 1O3NA 1WYKA 3BTHE 1QL9A 3HKJB 1O5AB 1NFUA 1PJPA 2EI7A 4FU8A 1DY9A 1ELAA 5EPYA 1HAHH 3MO6A 3M37A 2VIVA 2FEQH 2QN5T 3ZZ3A 5LGOA 1B0FA 3A8BA 4YXWD 2CHAB 4JYTA 1GHXH 1BBRH 3E91A 3S7KB 1YPEH 2QC2A 1DWCH 1MU6B 2C8WB 3LGWA 5FX5A 1Z1JA 2HWLB 2C8ZB 2TBSA 1BHXB 2O8MA 1O33A 4OS7A 5DP8A 1CHOG 1ELTA 3GYMA 1G3DA 3GY8A 1GBHA 1SFQB 3OEHD 3M3SA 4ABEA 1DUEA 1CA0B 4AG2A 2F9BH 1GBKA 2EY4C 4OS5A 1DPOA 1FZZA 3SGAE 4ABGA 1AFEH 1QIXB 2FO9A 2XWAA 1O3OA 1SLVB 5C3NA 3MNXA 1V2MT 2BD4A 1HRTH 1OWJA 3U1JB 3RUOA 2QCYA 4TY7A 2F43B 2J94A 5A0BA 1SGRE 4ZUHA 4MNYA 1C1WH 3CENA 1FV9A 4XBCA 5F8ZA 1H4WA 2W7UA 1BB0B 1GJ8B 1O3CA 2XBYA 1BCUH 4KELA 2ZG0H 3VB7A 1IAUA 1P2NA 1GI4A 2V6NA 1IHSH 1C5WB 1O39A 1K1JA 2L6OA 4RI0A 1G2MA 2VNTA 3P17H 3ZVDA 3Q3YA 5DO4H 1K9OE 1EASA 2QAAA 5FPSA 3UWJH 1VITG 2XCNA 1L1NA 1S6HA 4FUBA 3M5MA 5LPRA 1CBWB 1OP0A 1L4DA 6CHAB 1UTNA 1EAWA 1O3KA 2OUAA 5EJZA 1O5CB 3UAIC 3QGNB 8KME2 4R8TB 1S85A 1V2LT 1RFNA 3JZ2B 3RM2H 3RLYH 1YP9A 3TPIZ 1PQ8A 1BUIA 2BD8A 3DT0H 4OGYA 4B2AA 1J15A 1D3PB 3SU4A 4BOHA 1HB0B 1C9TA 2BLVA 7GCHF 3MFJA 3TLOA 4WXIA 2SGFE 1BJVA 1TGCA 3TH2H 2A5IA 2AH4X 5DK1A 3SZNA 1SGFG 3SBKA 1MKXH 5JBTA 1QRWA 1XUJA 2A1DB 2WPJS 1XKBC 1YPMH 3TGKE 4IBLH 1C1NA 1F2SE 1NESE 3LJOA 4ISHH 3VB5A 1FIWA 2WZQA 2BX3A 2A7JA 1ZHRA 4X6OA 5A09A 4ZKRU 3SZEA 1CT2E 3BIVH 3ITIA 1C1UH 1K1IA 5DP5A 4A6LA 3QTVH 1WDIA 3F2FA 2K1QA 4WXVA 4JZDH 2ZZUH 1O38A 5EXNA 2VJ1A 3CP7A 4GUXA 4WH8A 2ULLA 4ACAA 4Q80A 4XFQA 3MTYA 4H6SB 1V2UT 3SV6A 4X1PU 2H1UA 2W3IA 4RT0A 4CHAB 1TGBA 1KXAA 3H09A 4INKA 1BTWA 1MTVA 4K2YA 2OD3B 2R2WU 4CBNA 1TMUH 3O8CA 3LT3A 1QBVH 1OWEA 1UTPA 1ZGIA 5CMXH 4AYYB 3RC6A 1ELEE 1TGTA 2Z9KA 3RC5A 1YYY1 1V2KT 5C67A 1BTHH 2AGGX 5GCHF 1VGCB 2M2AA 4FOUC 1C4V2 1ZR0A 3RXFA 2ZFRH 4Q4LA 4X1SU 4B6FA 2ZI2H 3MYWA 4THNH 3ZZDA 2BLWA 4YLUA 2TPIZ 1O3AA 2VB0A 1JXPA 2QF3A 4MNWA 2BY7X 2FOMB 1ELCA 1AI8H 1AUJA 1D6RA 1K1MA 1TPSA 4FVDA 2Y5GA 1ZSJA 1O35A 1WV7H 1O2LA 1AZZA 1MU8B 4ESTE 3ZV9A 1U6QA 3UFAA 2B5TB 3SI3H 1YWUA 2Z9GA 2GMTC 1T7CA 2A4GA 5FPTA 1O3IA 1QGFA 3MU1A 1O3MA 3BTKE 4AX9H 1HDTH 4RN6A 3S9AA 1CE5A 4VGCC 2ZTZA 1DM4B 2ZGJA 1HBTH 1BMMH 2XW9A 3ZZ7A 4K1EA 1C5PA 1HPGA 1Q2WA 2F83A 3HPTB 3QDZB 1A5GH 3SUFA 1GPZA 4Q7XA 4ZHLU 5EXLA 2EC9H 2UWLA 3E90B 5ETXA 5KECA 4AGJA 2BD3A 1TNLA 4NIYA 2C8XB 2KR7A 1TMTH 1GHBF 2FDAA 3A8DA 1BITA 4YTAA 4O97A 1RIWB 2ASUB 4ZCNA 2ZGBH 3BTTE 1MBQA 1O2VA 4LXBH 1JWTA 1LVOA 4X1NU 2FS8A 2JJ1D 3ZVFA 1ZTLA 1ZMJA 1HJAB 3SNEA 1O0DH 1KSNA 3L33A 1T8NA 2ZFFH 4AGKA 1AZ8A 3S7HB 1S83A 3SV7A 2ZPSA 3URDA 3T26A 1BBRE 4P00A 1C2MA 1CQQA 1A61H 1TOMH 2ESTE 2BM2A 3DA9B 1TX6A 1SI5H 5C1UA 1BTXA 3H7OA 1C5NH 1TQ0B 1YPKH 1GGDB 3K9XB 1V2QT 2K0QA 3UNSA 3SJ9A 1C2GA 1TX7A 1HAVB 4FU9A 3M7QA 5L30H 1QNJA 1GBTA 3A7VA 1FAKH 4WMFA 5F8XA 3VXFH 1UTKA 1SLUB 1KXEA 1QTFA 1K1PA 1GI5A 3RXAA 1OWDA 1E1QD 1GBCA 4E7NA 2J4IA 2G81E 5CHAC 3GISB 4Y10E 1FPHH 1GHWH 1C5YB 2CJIA 1SGEE 1QJ6B 3ZVCA 5IDKA 1UJ1A 1V2OT 1ZGVA 2LP6A 2A32A 1P12E 1GMHG 2QF0A 5HIYA 3T28A 3ATWA 2W6ID 1SHYA 1C2LA 3E16B 1P05A 2FOHA 3WWFA 3OSYA 4Q63A 5IYTA 1GI0A 4ABFA 1IQFA 5T3HA 4X8SH 3CNRA 1ANEA 1T8LA 3SV2H 2BMGB 1DXPA 5E0JA 3RM0H 3E0PB 2ZC9H 1WU1A 1CU1A 1ZMLA 4RT1A 2G4UA 3T5FH 3TJOA 1ETTH 3M35A 1UK4A 3W95A 2QY0B 4NSVA 3ATKA 1XUKA 2QV1A 2A2QH 4K8BA 3SO3A 1C5VA 3SNDA 2VIOA 4ABDA 4I8LA 4FXGH 2G51A 3MH7A 1GHBG 1Z71A 2CK3D 3B9FH 1K2I1 2ZFQH 4MPUA 1Z1IA 3TK6A 1DS2E 1EJAA 1XXDA 4WMEA 1H8IH 2J34A 4H6TA 2FOGA 1C2IA 5AF9H 5B6OA 3BTGE 1GG6C 3BTEE 4NFEA 4Y0ZE 3HK6B 1LKAA 2GVFA 3GICB 4X6PA 2BOKA 3EA7A 1BMNH 1UTQA 3SYJA 1D4PB 1QQ4A 1T8OA 3MWIU 1LHCH 3PLPA 4P02A 2GZ9A 4ISIH 1JOUB 1ETRH 4D8NA 2F9PA 1OHHD 4I8HA 1W3CA 2JKHA 1O32A 1C5OH 2O9QA 2BY8X 2P8OC 3LGTA 2P8OB 1YBWA 2KM0A 1FMGA 2CN0H 1NZQH 2WYJA 1DUAA 3ZV8A 2QF4A 1GCDA 2BY5X 2QXJA 2HGTH 3KGPA 1Z6EA 2F9NA 3SU1A 1IQNA 3F9FA 1IQKA 1PQAA 1O2HA 2FMJA 1FPCH 1XVMA 1ZJKA 2P95A 9ESTA 2ALVA 1P01A 9LPRA 1FNIA 1ZTJA 4O3TA 3BG4B 4BTIB 4KKDA 1K22H 1MQ5A 4X2WA 1BRAA 3V7TA 2PLXA 2BQ6B 4IN2A 2GZ7A 1ZHMA 4ABJA 1GVLA 1SGFA 4M7GA 2I6SA 4U01A 4F49A 1E34B 3UWIA 2DE9A 4WY3A 1YPLH 1HJ8A 1CGJE 3KQDA 3T62A 5F03A 3ATMA 5LH8A 2OTVA 2FI4E 1EP5A 3A82A 1IQJA 2AGEX 3A7XA 2K8IA 2HNTC 1YF4A 2YNBA 2A4RA 1WBGB 2FOCA 3A86A 2M5TA 4JYVH 4A1VA 2ZGHA 2ODQA 1A7SA 3BG4C 2F3CE 4MG3A 2YMSC 3UUZA 5E0GA 1KXDA 1SR5C 3BG8A 4CREA 3V13A 3SQEE 2LNCA 2NU4E 3P8FA 1ESTA 3K6ZA 4UEHH 1MKWH 1TNKA 4DCDA 1NC6A 3LKWA 1UTLM 2YOLA 4IN1A 4Y76A 4DURA 2VWNA 2ZF0H 1AFQC 3KQ5A 4MDSA 1WCZA 1N6XA 1K1NA 5EQRA 1QB9A 1GHZA 4FUGA 1G32B 4K1TA 4H42U 3VGCC 2ZU3A 2W7SA 4BTTB 1AD8H 4Q7ZA 1YPHC 3UNRA 3P8NA 3V3MA 1ARCA 1G30B 1OX1A 2AGIX 3GDSA 2TRMA 5T6DA 5JB8S 1VJAU 2FODA 1BTPA 1TNJA 1DVAH 1ORFA 2JH0D 1ZPCA 1S6LA 1J16A 3MH5A 2FOAA 1KLJH 1PQ5A 4CRCA 2IPQX 2FOFA 1LPZB 1MMJN 1QR3E 1XX9A 3TH4H 2ZDAH 1LQEA 4FU7A 1NS3A 1Y3YA 3EGKH 1UW7A 4Y8ZA 1GMCF 3A89A 3RXQA 2QIQA 2KCOA 2P3TB 1NFXA 1SG8B 3KN2A 4LOYH 1Y5BT 1TPAE 3LH3A 1SVPA 1FUJA 1W0JD 1UVOA 6LPRA 3NZIA 4GVUA 2ANKH 2AERH 2WPIS 2BD5A 1C2EA 4D9RA 1D3TB 5JBAS 1KMHB 2R3YA 5GXPA 3SU3A 1BDAA 1WQVH 1AHTH 1XUFA 2ZCLP 1HXFH 1DWDH 3PRBA 1FY5A 3I29A 1YPHE 2ANWA 1EAUA 1MUEB 2FPZA 1KIGH 1P57B 2R0LA 1AIXH 4OS1A 3RXDA 1GI3A 1TALA 2FM2A 4DG4A 5HKKD 4CH8B 2WV4A 3EDXB 5F6MA 2Z94A 5ABWA 4I7YH 1E0FD 4MLFB 3PV4A 1IQHA 1DDJA 1O2GH 1TGNA 3VB3A 2IPHA 5EQSA 3O8DA 3ZZ6A 2J92A 1Y3UA 4I8JA 4NWLA 4AB8A 1COWD 1EAIA 2A7CA 1UHBB 2CXVA 1EB1H 1EB2A 4BAHB 1HIAB 1A2CH 1LPKB 1S81A 3AAVA 4FUEA 1OWKA 4KTSA 4BAKB 3A88A 2BVXH 4A7IB 2AIQA 2RCEA 2ZKSA 1QQUA 5K0HA 1AFQB 1IQMA 1OKXA 1GL0E 1P2IA 4CRFA 3T25A 3QK1A 2STAE 4B73A 3BTME 1PPEE 1Y8TA 3RXPA 1BRBE 2J95A 1OYTH 5GWZA 4ISOA 2HPPH 1K28D 1C4Y2 4MNXA 2RG3A 1DWEH 4NCYA 1CGHA 1MTWA 4MPXA 1GJ4H 3PWCA 2QE7D 3L6PA 1BIOA 3KQEA 1A1RA 4O3UA 3FO8D 2R0KA 1C1PA 2A0QB 2OC1A 1V2TT 1O5EH 2WPKS 5CHBA 4E06H 1W11U 5A0CA 1ZRKA 1O3HA 3EYDA 5KGOA 2GV7A 1ZPBA 3RXTA 2BVSH 3P70B 1CHOF 1LTOA 3VEQB 1DWBH 2BD9A 5C0TA 1O2IA 1SGIB 2VGCC 1O34A 3MU5A 1O3JA 2UUYA 1MAXA 2BDCA 5DP7A 1XXFA 2BD2A 3PV2A 1AB9B 4IS5A 3TNTA 2TIOA 4ACBA 1SGTA 4BANB 1F0SA 1MAYA 3SI4H 4JZ1A 1O2NA 4ZHAA 1FY8E 3DD2H 1BQYA 1JIRA 3ELAH 4D7FA 1O5GH 4FUJA 2GCHF 5E2PA 2WPDD 1IQEA 1C5ZB 1NBME 2ZO3H 3BTDE 4XBBA 3A81A 1DT2A 3DSOA 1GJ7B 5LPFA 1FJSA 1ZLRA 5GJ4B 1O3GA 1GMDF 3TJUA 1GGDC 3CS0A 3SHAH 1SL3A 3NPSA 1NFYA 5E0HA 2Z9JA 3MHWU 3MU4A 3M3VA 3RMNH 2C93B 2G4TA 2XBVA 3ZZBA 3GYLB 1C5XB 1P2KA 3FN8A 1EP6A 3FKSD 5EOKA 5EGMA 3AK5A 1O31A 2ZQ2A 3EQ0H 2WV9A 3KEEA 2C4FH 3A7WA 3E1XB 1E38B 4B74A 4NFFA 1RJXB 4QT8C 4YZUA 2VIDA 5PTPA 1IHTH 1L4ZA 2B7DH 1ABIH 3FP7E 3N99A 2A2XH 2IN2A 3RXBA 4MNVA 1LVMA 1J8AA 3RXHA 1AVXA 2GCTB 3CS7A 4Y0YE 1SQOA 2Q6GA 2EI6A 2XXLA 3I77A 2VWLA 1ZZZA 2PWXA 1GVKB 1P9SA 3PLKA 2Y7XA 5C0UA 2AHME 1W0YH 3P8OA 5C94A 3RXKA 1Y59T 2HNTE 4CHAC 3SV9A 3C27B 4F48B 2Z3EA 3UR6A 3DSGA 4JMYA 1F92A 1QHRB 3MU0A 2GD4B 3F2GA 3GCHC 2SNVA 1J17T 1GMCG 1NRNH 2PKSC 2ZQ1A 1FXYA 3QGJA 2F4LA 5K7RA 3UIRA 1YLDA 3QTOH 1QBNA 2ZHFH 3S9CA 4F4OC 3SQHE 1WQSA 1FI8A 2NU1E 4ZXXH 1VITF 4WF8A 1A4WH 4NWKA 1S0QA 4K8YA 1MD7A 4XE4A 1TNGA 3OTJE 3RXVA 2A7HA 2FTMA 1BOQA 4ZAEA 2BLOA 2KAIA 3WY8A 4H4FA 3O8RA 4X8TH 2ZFTA 3T2NA 4Y11E 5DP4A 1L0ZA 2HNTF 3UOUA 1F0RA 5A8ZA 4FUFA 1AVWA 2I6QA 2WHXA 4A92A 1PPHE 3RU4E 2V3OH 4IGDA 1O2OA 3LPRA 1XMNB 2FLRH 1KDQB 2O8UA 3NKKA 3VFEA 1VR1H 3K6YA 1QURH 1SGPE 3OX7U 3GDVA 1WSSH 2V3MA 4FUDA 4CRAA 6GCHG 4X6NA 2ODYB 3FZDA 2ZA5A 2VVVA 3M7UA 1GBJA 4AFQA 5C17A 4I86A 1UVUH 3G01A 3TK5A 4TPIZ 2O8WA 1D3QB 1WTGH 2FYRA 1T8MA 1ACBE 1S84A 2FI3E 4ASUD 1IQIA 4I31A 5F53A 1O3PB 2WINI 5H4IB 4ABBA 3UPEA 2OQ5A 3LGYA 5BRRE 3K65B 1NBMD 3LONA 1X7AC 2ZCKP 8GCHF 1ELBA 3PYHA 2GP9B 5EG4A 3UR9A 1C2JA 3QZRA 1LHFH 3ZZCA 1FN6A 1HYLA 1ANCA 5EIYA 3TITA 3M5NA 2BDYA 1WOFA 4Z0KA 2OP9A 2VBCA 1V2ST 1GBFA 1OP8A 2FOBA 3FFGA 1GI2A 1N8OB 3D49H 1E1RD 1RIWC 5EXMA 1O2ZA 2RA0A 2VIPA 1S82A 1SMFE 5EU8A 1VJ9U 4B76A 2Z9IA 1TRMA 4J1YA 1ELFA 2JH6D 3RC4A 1SGYE 1EZXC 2BOHB 1CA0C 1GJAB 2G00A 1P8VC 3KIDU 1QB1A 3M5OA 3UQOA 2KAIB 5DG6A 3LGIA 1PFXC 3D65E 5EJ1A 1KTTB 1W8BH 4Y8YA 4E7RG 1EZQA 1ZRBA 1GVZA 2FX4A 1P04A 2TGAA 1CVWH 3TNSA 1PQ7A 5CE1A 2BDAA 2WV5A 1O2TA 3AVZA 5GDSH 5J4QA 4FUHA 5EW2H 1C1OA 2W6JD 5HM9A 1P3CA 5DN6D 2ZTYA 2WUCA 1GJ5H 4ASHA 3V12A 1TA6A 4BXWA 5FBEA 4AYVB 1EX3A 2OCVB 1BA8B 2OBOA 2BB4A 2SFAA 4K3JA 3D23A 1GDNA 5CDFE 4U2WA 2BY9X 3S9BA 1TRYA 4GCHF 1QL8A 2PTNA 2GDEH 1CT4E 4DJZB 1SB1H 4B1TA 1DLKB 1ETSH 3BEFB 1BHXF 1AGJA 5FPYA 1SQAA 1XVOA 5TCCA 1VITH 5AFYH 1W14U 1AVGH 1KXBA 2LELA 1TBZH 1FLEE 1PPGE 3FANA 1YPJH 3PLBA 3ZZ5A 1C5QA 1HAYB 2QXHA 1B0EA 2PV9B 3UQVA 4TWWA 3KL6A 3MNCA 2H6MA 3Q3XA 5DKMA 1EPTC 2OLGA 1HNEE 4CRDA 1DX5M 2DE8A 1TWXB 4NIXA 2Z3DA 6ESTA 1MTUA 1K1LA 1A3BH 1EAXA 5J4SA 1OSSA 2JDID 1UCYH 1MCTA 2ZPQA 1AKSB 1GHAF 1KXCA 1EPTA 4JZFH 3MQKC 4JZEH 3SUGA 3A7YA 2P3UB 3U1IB 2YMSD 1JRTA 1Z7KA 3TU7H 5DJ7A 1GI8B 2QXIA 5JBBS 4ZROA 3RU4T 4GHQA 1HJ9A 3U8OH 4UD9H 1JBUH 1AWHB 4YOIA 3T27A 1A0JA 1A46H 4NZQA 2R9PA 5FXLA 3MH4A 2O8TA 1WUNH 3B8JA 5JDUB 1C2KA 3IG6B 2KZ4A 4OM9A 1HV7A 1NU9A 2ZGXH 3RXMA 4UFGH 2ZNKH 2PFEA 1CA8B 5FX6A 1MKWK 1C1SA 4ZH8A 1GCTB 2OINA 4ZKSU 2Y7ZA 5I46H 2Z9LA 1AY6H 1W10U 4JK6A 2CF8H 2BQWB 1Z6JH 3OY5U 3SV8A 3GDUA 1YCPM 3N7DA 5A2MH 4O9VA 1VGCC 4UDWH 2ZHQH 1H8DH 2JH5D 2OK5A 2ZU1A 1P9UA 3F6UH 2BVRH 1FIZA 1G37A 2JETC 4PROA 3NRLA 4GAWA 2FI5E 1KTSB 1F5KU 2FZZA 4ZXYH 3UB0A 3U8RH 1CBWC 6CHAC 2BZ6H 1NO9H 1SOTA 2AS9A 4HI3A 1JRSA 1TX8A 1AUTC 4AFUA 4Y8XA 4X8VH 1YCPH 4DT7B 2Y81A 4K5ZA 1TOCB 1RD3B 2AMQA 3GY5A 1GI6A 1M9UA 1S6FA 4GPGA 2FYQA 4JK5A 2QGRA 1ELGA 2ALPA 1BTZA 1EATA 1GG6B 4NA9H 3PWBA 1VCQA 4RSPA 3ENSB 1DFPA 2GZ8A 1KXFA 2VU8E 4AFSA 2HPQH 3LDXH 1O30A 3EA8A 2KCAA 3GCTF 4BXSA 2O8LA 1OS8A 2ZWLH 1ZOMA 1DICA 1EXFA 1NN6A 1OP2A 4RKOB 3U9AH 3VXEH 4B75A 3TVJB 1J14A 1W12U 3GY3A 4BTUB 5A8YA 3SU2A 1GI9B 2H9HA 1DY8A 2GTBA 1SKYE 3PROA 3ZZ4A 3RU4D 1TBRH 3OEED 1FONA 5DP6A 5HGGA 4U32A 4HTCH 3T29A 2NWNA 1C2FA 3VPKA 2XWBI 1JIMA 2VH6A 1YCPK 2GDDA 4BAOB 3ZVBA 3SGBE 1F5LA 3DUXH 3ZVAA 1RS0A 3LC3A 1GBLA 2KCYA 2VIWA 4Y7BA 3F2HA 2Z7FE 4K1SA 4M9FA 3VB6A 3UNQA 1O2RA 1TRNA 1T31A 1EZSC 1TIOA 2XYAA 1ZTKA 3AASA 4MPVA 1RTLA 1VKYA 1GMHF 3IITA 4UFFH 4O03A 3GY2A 4J2YB 1W7GH 3OTPA 4I32A 2Q1JA 5T6FA 1B7XB 3UTUH 2SGQE 3VGCB 1FX0B 3BIUH 5EJLA 2PSXA 3A8CA 2CGAA 1HCGA 3ATLA 2GJGA 1EKBB 2GCHG 3SOSA 1F7ZA 3HATH 3U69H 2ZIQH 3BTWE 5FCRA 4DIHH 1DE7H 1O5DH 3F68H 5HXFA 3RXOA 2BY6X 2WSSD 3PTNA 5AVDA 3UREA 1AO5A 1OWHA 1D9IA 4ABAA 1K0HA 3EA9A 2GX4A 1GBIA 1V2PT 5G4BA 3SHCH 1C1VH 1H9IE 1OXGA 3S69A 3BTFE 5E2OA 1THSH 3KHVA 2PUXB 2G5NA 1O2XA 2KCPA 5EW1H 2B0FA 3ZZAA 1CGIE 4FETA 1XUIA 2NU2E 1FQ3A 1TLDA 4YO9A 1A0LA 1THPB 3DFLA 3RXCA 1LVBA 4X6MA 5FAHA 2V3HH 1IOEA 2PKAB 1QRZA 1TNIA 3DFJA 1MZDA 2F9OA 4UFEH 6GCHF 2FESH 3SJIA 1HAPH 3PM3A 2G55A 1V2VT 4LK4A 2VVCA 1INCA 4XSKU 2PUQH 1YLCA 4ZHMU 2KX4A 2ZHDA 3F9GA 3ZYEA 3BF6H 5EQQA 2VWMA 4UONA 4XBDA 4DY7B 7LPRA 2GCTC 4JZIA 3C1KA 3H5CB 2P59A 4AG1A 3LU9B 4WWYA 1FAXA 1ARBA 2OC0A 3MO9A 5I25A 3OU0A 1XUHA 4AOQA 1L1GA 2B8OH 4B2CA 4Y79A 1SQRA 4Z6AH 1OYQA 1O3DA 2ANMH 2WPLS 1E35B 2Y82A 1FY4A 1OWIA 1P2QA 1YGCH 1CHGA 1MTNC 1A3EH 3RLWH 1GI1A 2J38A 4FUIA 4INLA 2D8WA 3M7TA 1KLIH 1G9IE 1GJCB 5EODA 2D1JA 3PMJA 1UVPA 4JYUH 2BX4A 1DOJA 4A1XA 4WMDA 1Y3XA 4ZKNU 1BT7A 1GMDG 2QYIA 1KYNA 4Z1MD 2NU0E 3QWCH 1C1RA 2PTCE 1QA7A 4AFZA 1F5RA 1OPHB 1NPMA 1C9PA 1QZ8A 1ZYOA 1ANDA 1GJ6A 2D2DA 2Q6DA 1LHDH 2XRCA 1BZXE 2A45B 3FAOA 1V2WT 1LO6A 1GBMA 1P03A 5GIBA 1GJBB 2NU3E 2H2ZA 1O2UA 4K69A 3LIWA 3NK8A 1GCTC 2HRVA 1VCPA 1UTOA 2ZU4A 4YT6H 2J2UA 3DSPA 2OC8A 3OAAD 2A5AA 3PMHB 1HIAA 3VG8A 1P2OA 4DIIH 1BJUA 3M5LA 1QFKH 3A87A 2Q6FA 2ZDNA 2ZGCA 1DSUA 2UWPA 8LPRA 1D3DB 3OFND 1A5IA 3SJKA 4CRBA 5DP9A 1HAZB 4K60A 5GPIB 2SGDE 1DXWA 3PMAB 1SFIA 3ODDA 3A7ZA 3PB1E 2BXTH 4FVBA 1T4VH 3UOPA 1HFDA 3HGNA 3BSQA 1BTYA 3DHKH 3QO6A 1MCVA 1AMHA 1Q3XA 2H9EH 4WVPE 4IMZA 3TJNA 5EPNA 8ESTE 3U98H 1CT0E 3TGJE 1ESBA 4FUCA 4YLQH 2ZDVH 1P09A 3PO1C 1SGDE 2ZFSA 3AW0A 1SOZA 1LVYA 2IJD1 1FDPA 1P2MA 3QLPH 3NWUA 1MKXK 3BTQE 2HALA 4OS2A 3JZ1B 2FP7B 3FP8E 1V2JT 3F9EA 1GWAA 2GGVB 4YESB 3STIA 3KYFA 3W1EA 2EI8A 1GI7B 5TCAA 2F9UA 4OS6A 5ESTE 4CR9A 1SBWA 2ZDKA 3KYGA 1THRH 2YMSB 2C3SA 3E3TA 3Q3KA 4KP0A 1SLXB 3PMBB 3GCTG 2HLCA 1MH0A 1QJ7B 2XNIA 3TK9A 3MU8A 4YM9A 1DLEA 5JB9S 1AB9C 3Q76A 2AMDA 5L6NH 1G3CA 4ISNA 1UCYK 4DT4A 4B6EA 1C5UA 4I8KA 5AFZH 3UY9A 4HZHA 3RMMH 3SGQE 2DUCA 5L2YH 4KGAA 1LHEH 2BD7A 3KQBA 2BDIA 2R3UA 5F8TA 4X2XA 1C1MA 1HJAC 3M36A 4X8UH 2ZECA 1GJ9B 2CMYA 4NA8A 1XM1A 2SGAA 2VIQA 5C1XA 1NFWA 2A5KA 1QY6A 1IQGA 1L1JA 1SC8U 2TGDA 3SORA 3SUDA 3NUMA 1ZSLA 5DPAA 1S0RA 1UVTH 4CRGA 4XD7D 2RA3A 4BAMB 2Z3CA 2PKAA 3IWMA 1O36A 1LPGB 1K21H 2ZU2A 1O3LA 1RTFB 2FLBH 3N7EA 1EZUC 1JMOH 1OOKB 5FHTA 5L2ZH 4AN7A 1GL1A 3RXRA 2ZHEH 3RP2A 1KY9A 1Z8IB 1O2QA 3GY6A 2JETB 3H7TA 4TWYA 4TPYA 1ZSKA 1UK3A 3SU6A 4YOJA 1AQ7A 4B2BA 2BXUH 1W0ZU 4ISLA 2P16A 1H1BA 4IC6A 4WJG2 5E8EH 5FCKA 1KDQA 2GMTB 1TONA 4KTCA 1H9HE 4SGAE 4SGBE 2TGPZ 5CHAB 3RMLH 4JCNA 1MTNB 2V35A 1P0SH 2GKVE 4HFPB 1GHVH 3SJOA 2LPRA 1SQTA 1V6DA 3LH1A 3LJJA 2OXSA 1O3EA 1AKSA 1QCPA 1TPOA 3RDZA 3TGIE 1QA0A 1C5TA 2Y5HA 3HK3B 3P8GA 4X1RU 4DVAU 1P3EA 4CBOA 3O8BA 1C5LH 3ZIAD 4XRNA 4CH2B 3BV9B 3BN9A 1ZJDA 1E36B 4X2VA 2ZPRA 1TPPA 2BLQA 1G2LA 4R0IA 2BDGA 3ZZ9A 5C2ZA 4DW2U 1UTMA 2ZTXA 1FN8A 2P93A 1AE8H 5T6GA 1MBMA 2SGPE 3R0FA 1O2PA 3SW2B 2XBXA 1NRQH 2BDHA 5A8XA 1MABB 3NXPA 4Q2KA 1GDUA 2V0BA 2ZFPH 5GCHG 3VB4A 1UK2A 1YC0A 4XOJA 1F0UA 1W2KH 4GLYA 2GT7A 1NU7B 1C5RA 1QB6A 1B5GH 2J98A 1T4UH 2BZAA 2XNDD 1LDTT 1O2YA 2TGTA 2XC5A 2BYAX 2GT8A 2H9TH 2J9NA 3QX5H 4GHTA 1K1OA 4Y7AA 2PGBB 2HVYB 3BEIB 3GCNA 1XKAC 3QN7A 4TSFD 1C5SA 5SGAE 5GNDA 4AZ2B 2IJOB 3E0NB 5HMAA 1LQDB 1TAWA 3RXJA 3L3TA 1TQ7B 1HAXB 2A4QA 2J97A 3FVFB 1TA2A 4ABIA 5FBIA 1ELDE 3MNSA 1Y5UT 1PPFE 1GBAA 1SGNE 4NIVA 1ANBA 4A1TA 1H8HD 3M61U 3A8AA 1DSTA 2UUFB 3SNBA 1LMWB 3ATIA 1Z8GA 1C2DA 3F1SB 1EFRD 2PW8H 1YM0A 2G5VA 3MO3A 4TY6A 1P2JA 1E37B 3U28C 3D62A 1GBDA 2ILNA 3FP6E 4IW4E 3DCLA 4GCHG 3P6ZB 2UUJB 4WH6A 1TNHA 1NM6A 4X0WU 2R2MB 2QXGA 2H5CA 2Y80A 2ANYA 2G52A 1O2SA 4DOQA 2RDEA 3TIUA 4A5TS 1WAYB 1TYNA 2FTLE 2BDBA 4MVNA 2EA3A 3MNBA 3SNCA 3ZZ8A 4MQAA 2WYGA 3E6PH 4CR5A 5JPMH 1A0HB 3MOCA 1O5BB 4GSOA 3MMGA 3SU5A 2KFWA 2CF9H 3TH3H 2QA9E 4D7GA 1O3FA 1S5SA 1SSXA 1BRCE 1L2EA 5ESBA 1GBBA 1HGTH 7KMEH 1CSOE 1HXEH 1ESAA 1O2WA 4E05H 2Y5FA 1BMLA 3URCA 1UO6A 1PPZA 3WWBA 1RTKA 1PPBH 2XC4A 2FWWA 1HAVA 1GJDB 3Q77A 5IK2D 4D76A 1TMBH 1PPCE 3OE7D 1Z8JB 3OY6U 1P02A 3SN8A 1HLTH 1TGSZ 1TABE 3GY4A 2XCFA 4UFDH 1C5MD 1NT1A 3GY7A 4MPWA 3LOXA 1FY3A 2QF5A 2F91A 2VGCB 3KF2A 3S0NA 1QBOA 1O3BA 3AAUA 1O37A 3SJ8A 2ZDLA 1HAGE 4U30A 3RXUA 3A83A 4NG9H
chains in the Genus database with same CATH topology
1A5HA 2B9LA 1W13U 4Q7YA 3A85A 4I8GA 1RRKA 4ZMAH 3B23B 4NGAH 2BHGA 1KLTA 7GCHG 1YKTA 2FXRA 1W7XH 1G3BA 3LGVA 1SHHB 1GDQA 1P10A 1GHAG 1NRPH 4IC5A 2PHBA 4X1QU 2WPHS 3E8LA 1HUTH 3SU0A 1AU8A 1QL7A 3A7TA 3PTBA 1O2JA 1ZPZA 3R3GB 2CHAC 1Q31A 2XC0A 4INHA 1O5FH 2C90B 3ZYDA 1VZQH 5C5OA 4ZKOU 4Y71A 2ODPA 2SGEE 2CV3A 1N6YA 1HAOH 2AEIH 3MH6A 2ZP0H 1PYTD 1UVSH 1EOJA 1ABJH 2WPMS 3LGUA 5JYIA 3EE0B 3RXSA 4X2YA 2H5DA 1H9LB 1NROH 3BEUA 1LKBA 1NRRH 3QUMP 1C2HA 1C4U2 1GBEA 2Y6TA 2STBE 3OYPA 4HGCA 4NSYA 1Y3WA 3STJA 2WUBA 2VINA 1MD8A 3HGPA 4XDEA 3W94A 2W26A 3P95A 2UUKB 2SNWA 5C20A 1UTJA 8GCHG 2GV6A 5TJXA 1SPJA 1SGCA 4Y6DA 2AMPA 4NIWA 4KTUA 1RGQA 1SGQE 3AW1A 2OC7A 2P94A 4D9QA 1ID5H 4BNRA 3RXIA 2AYWA 1Y3VA 4TYDA 1N8OC 2OBQA 1NRSH 4BAQB 3M3TA 3LC5A 3N7OA 5C5NA 2XTTB 3PO1B 3KQCA 2AFQB 4RKJB 2PSYA 4IMQA 4NZLA 3V0XA 1UCYE 3Q00A 5DGJA 4VGCB 1QJ1B 1Y5AT 4B71A 1MZAA 2W5EA 3GOVB 1O2KA 1GHYH 2VH0A 3NCLA 3RXGA 3GCOA 2FX6A 4OS4A 3I78A 5A0AE 3MI4A 1NY22 3A84A 4DGJA 2D26C 2FS9A 1P06A 1EQ9A 3ESTA 3QZQA 1TB6H 4I33A 1J9CH 3EAJA 2ZCHP 5DP3A 1D6WA 5LPEA 2A31A 1C1QA 2ZU5A 5HM2A 2PGQB 4UE7H 2G8TA 2ZEBA 5AHGH 1AN1E 4LZ1H 2IOTA 1BBRK 1NTPA 2YNAA 1V3XA 1MTSA 2P3FH 2UWOA 3RXEA 1V2NT 1HAIH 5C1YA 1AWFH 2VVUA 3KNXA 2F9VA 4AB9A 1UHBA 1DANH 1LHGH 5JBCS 1RXPA 2ZHWH 2W3KA 4YOGA 1G36A 1O2MA 1DITH 2BTCE 4YT7H 3KCGH 1AE5A 1EJNA 1BTUA 2HOBA 1VCWA 1UMAH 1MQ6A 4MTBA 2Z6BD 3TJVA 2C8YB 1P11E 1YPGH 4OGXA 1FY1A 3K2UA 2FOEA 3SUEA 1TFXA 3FZZA 2RDLA 3P92A 1C1TA 1EPTB 7ESTE 1LCYA 4LZ4B 5HYOA 2PKSB 1QRXA 1EJMA 3GCHB 3A80A 3RMOH 2BQ7B 4ABHA 1BMAA 1TBQH 1CO7E 1WTHD 2VWOA 1ELVA 3ZVEA 2ZDMA 1SLWB 3F9HA 1EUFA 1T32A 2AIPA 1ZHPA 4AORA 3U8TH 4NA7A 1IQLA 1BRUP 3ODFA 1N1LA 5BPEA 1ZMNA 2A4OA 1F0TA 2FIRH 2OQUA 1XUGA 3RXLA 3HKIB 3SNAA 2XBWA 1PYTC 2PR3A 2EEKA 1V2RT 2THFB 1G3EA 1TE0A 1Z8RA 3ZVGA 2HVXA 1EOLA 1O3NA 1WYKA 3BTHE 1QL9A 3HKJB 1O5AB 1NFUA 1PJPA 2EI7A 4FU8A 1DY9A 1ELAA 5EPYA 1HAHH 3MO6A 3M37A 2VIVA 2FEQH 2QN5T 3ZZ3A 5LGOA 1B0FA 3A8BA 2CHAB 4JYTA 1GHXH 1BBRH 3E91A 3S7KB 1YPEH 2QC2A 1DWCH 1MU6B 2C8WB 3LGWA 5FX5A 1Z1JA 2HWLB 2C8ZB 2TBSA 1BHXB 2O8MA 1O33A 4OS7A 5DP8A 1CHOG 1ELTA 3GYMA 1G3DA 3GY8A 1GBHA 1SFQB 4ABEA 3M3SA 4AG2A 1DUEA 1CA0B 2F9BH 1GBKA 4OS5A 1DPOA 1FZZA 3SGAE 4ABGA 1AFEH 1QIXB 2FO9A 2XWAA 1O3OA 1SLVB 5C3NA 3MNXA 1V2MT 2BD4A 1HRTH 1OWJA 3U1JB 3RUOA 2QCYA 4TY7A 2J94A 5A0BA 1SGRE 4ZUHA 4MNYA 1C1WH 3CENA 1FV9A 4XBCA 5F8ZA 1H4WA 2W7UA 1BB0B 1GJ8B 1O3CA 2XBYA 1BCUH 4KELA 2ZG0H 3VB7A 1IAUA 2V6NA 1P2NA 1GI4A 1IHSH 1C5WB 1O39A 1K1JA 1G2MA 2VNTA 3P17H 3ZVDA 3Q3YA 5DO4H 1K9OE 1EASA 2QAAA 5FPSA 3UWJH 1VITG 2XCNA 1L1NA 1S6HA 4FUBA 3M5MA 5LPRA 1CBWB 1OP0A 1L4DA 6CHAB 1UTNA 1EAWA 1O3KA 2OUAA 1O5CB 3QGNB 8KME2 4R8TB 1S85A 1V2LT 1RFNA 3JZ2B 3RM2H 3RLYH 1YP9A 3TPIZ 1PQ8A 1BUIA 2BD8A 3DT0H 4OGYA 4B2AA 1J15A 1D3PB 3SU4A 4BOHA 1HB0B 1C9TA 2BLVA 7GCHF 3MFJA 3TLOA 4WXIA 2SGFE 1BJVA 1TGCA 3TH2H 2A5IA 2AH4X 5DK1A 3SZNA 1SGFG 3SBKA 1MKXH 5JBTA 1QRWA 1XUJA 2A1DB 2WPJS 1XKBC 1YPMH 3TGKE 4IBLH 1C1NA 1F2SE 1NESE 3LJOA 4ISHH 3VB5A 1FIWA 2BX3A 2A7JA 1ZHRA 4X6OA 5A09A 4ZKRU 1CT2E 3BIVH 3ITIA 1C1UH 1K1IA 5DP5A 4A6LA 3QTVH 2K1QA 4WXVA 4JZDH 2ZZUH 1O38A 5EXNA 2VJ1A 3CP7A 4GUXA 4WH8A 2ULLA 4Q80A 4XFQA 3MTYA 4H6SB 1V2UT 3SV6A 4X1PU 2H1UA 2W3IA 4CHAB 1TGBA 1KXAA 4INKA 1BTWA 1MTVA 4K2YA 2OD3B 2R2WU 4CBNA 1TMUH 3O8CA 3LT3A 1QBVH 1OWEA 1UTPA 1ZGIA 5CMXH 4AYYB 3RC6A 1ELEE 1TGTA 2Z9KA 3RC5A 1YYY1 1V2KT 5C67A 1BTHH 2AGGX 5GCHF 1VGCB 1C4V2 1ZR0A 3RXFA 2ZFRH 4X1SU 2ZI2H 3MYWA 4THNH 3ZZDA 2BLWA 4YLUA 2TPIZ 1O3AA 2VB0A 1JXPA 2QF3A 4MNWA 2BY7X 2FOMB 1ELCA 1AI8H 1AUJA 1D6RA 1K1MA 1TPSA 4FVDA 2Y5GA 1ZSJA 1O35A 1WV7H 1O2LA 1AZZA 1MU8B 4ESTE 3ZV9A 1U6QA 3UFAA 2B5TB 3SI3H 2Z9GA 2GMTC 1T7CA 2A4GA 5FPTA 1O3IA 1QGFA 3MU1A 1O3MA 3BTKE 4AX9H 1HDTH 4RN6A 3S9AA 1CE5A 4VGCC 2ZTZA 1DM4B 2ZGJA 1HBTH 1BMMH 2XW9A 3ZZ7A 4K1EA 1C5PA 1HPGA 1Q2WA 2F83A 3HPTB 3QDZB 1A5GH 3SUFA 1GPZA 4Q7XA 4ZHLU 5EXLA 2EC9H 2UWLA 3E90B 5ETXA 4AGJA 2BD3A 1TNLA 4NIYA 2C8XB 1TMTH 1GHBF 2FDAA 3A8DA 1BITA 4YTAA 4O97A 1RIWB 2ASUB 2ZGBH 3BTTE 1MBQA 1O2VA 4LXBH 1JWTA 1LVOA 4X1NU 2FS8A 3ZVFA 1ZTLA 1ZMJA 1HJAB 3SNEA 1O0DH 1KSNA 3L33A 1T8NA 2ZFFH 4AGKA 1AZ8A 3S7HB 1S83A 3SV7A 2ZPSA 3URDA 3T26A 1BBRE 1C2MA 1CQQA 1A61H 1TOMH 2ESTE 2BM2A 3DA9B 1TX6A 1SI5H 5C1UA 1BTXA 3H7OA 1C5NH 1TQ0B 1YPKH 1GGDB 3K9XB 1V2QT 3UNSA 3SJ9A 1C2GA 1TX7A 1HAVB 4FU9A 3M7QA 5L30H 1QNJA 1GBTA 3A7VA 1FAKH 4WMFA 5F8XA 3VXFH 1UTKA 1SLUB 1KXEA 1QTFA 1K1PA 1GI5A 3RXAA 1OWDA 1GBCA 4E7NA 2J4IA 2G81E 5CHAC 3GISB 4Y10E 1FPHH 1GHWH 1C5YB 2CJIA 1SGEE 1QJ6B 3ZVCA 5IDKA 1UJ1A 1V2OT 1ZGVA 2A32A 1P12E 1GMHG 2QF0A 3T28A 3ATWA 1SHYA 1C2LA 3E16B 1P05A 2FOHA 3OSYA 5IYTA 1GI0A 4ABFA 1IQFA 5T3HA 4X8SH 1ANEA 1T8LA 3SV2H 2BMGB 1DXPA 5E0JA 3RM0H 3E0PB 2ZC9H 1WU1A 1CU1A 1ZMLA 2G4UA 3T5FH 3TJOA 1ETTH 3M35A 1UK4A 3W95A 2QY0B 4NSVA 3ATKA 1XUKA 2QV1A 2A2QH 4K8BA 3SO3A 1C5VA 3SNDA 2VIOA 4ABDA 4I8LA 4FXGH 2G51A 3MH7A 1GHBG 1Z71A 3B9FH 1K2I1 2ZFQH 4MPUA 1Z1IA 3TK6A 1DS2E 1EJAA 1XXDA 4WMEA 1H8IH 2J34A 4H6TA 2FOGA 1C2IA 5AF9H 5B6OA 3BTGE 1GG6C 3BTEE 4NFEA 4Y0ZE 3HK6B 1LKAA 2GVFA 3GICB 4X6PA 2BOKA 3EA7A 1BMNH 1UTQA 1D4PB 1QQ4A 1T8OA 3MWIU 1LHCH 3PLPA 2GZ9A 4ISIH 1JOUB 1ETRH 4D8NA 2F9PA 4I8HA 1W3CA 2JKHA 1O32A 1C5OH 2O9QA 2BY8X 2P8OC 3LGTA 2P8OB 1YBWA 1FMGA 2CN0H 1NZQH 2WYJA 1DUAA 3ZV8A 1GCDA 2BY5X 2QXJA 2HGTH 3KGPA 1Z6EA 2F9NA 3SU1A 1IQNA 3F9FA 1IQKA 1PQAA 1O2HA 2FMJA 1FPCH 1XVMA 1ZJKA 2P95A 9ESTA 2ALVA 1P01A 9LPRA 1FNIA 1ZTJA 4O3TA 3BG4B 4BTIB 4KKDA 1K22H 1MQ5A 4X2WA 1BRAA 3V7TA 2PLXA 2BQ6B 4IN2A 2GZ7A 1ZHMA 4ABJA 1GVLA 1SGFA 4M7GA 2I6SA 4U01A 4F49A 1E34B 3UWIA 2DE9A 4WY3A 1YPLH 1HJ8A 1CGJE 3KQDA 3T62A 5F03A 3ATMA 5LH8A 2OTVA 2FI4E 1EP5A 3A82A 1IQJA 2AGEX 3A7XA 2HNTC 1YF4A 2YNBA 2A4RA 1WBGB 2FOCA 3A86A 2M5TA 4JYVH 4A1VA 2ZGHA 2ODQA 1A7SA 3BG4C 2F3CE 4MG3A 3UUZA 5E0GA 1KXDA 1SR5C 3BG8A 4CREA 3V13A 3SQEE 2LNCA 2NU4E 3P8FA 1ESTA 3K6ZA 4UEHH 1MKWH 1TNKA 4DCDA 1NC6A 3LKWA 1UTLM 2YOLA 4IN1A 4Y76A 4DURA 2VWNA 2ZF0H 1AFQC 4MDSA 1WCZA 1N6XA 1K1NA 5EQRA 1QB9A 1GHZA 4FUGA 1G32B 4K1TA 4H42U 3VGCC 2ZU3A 2W7SA 4BTTB 1AD8H 4Q7ZA 1YPHC 3UNRA 3P8NA 3V3MA 1ARCA 1G30B 1OX1A 2AGIX 3GDSA 2TRMA 5T6DA 5JB8S 1VJAU 2FODA 1BTPA 1TNJA 1DVAH 1ORFA 2JH0D 1ZPCA 1J16A 3MH5A 2FOAA 1KLJH 1PQ5A 4CRCA 2FOFA 1LPZB 1MMJN 1QR3E 1XX9A 3TH4H 2ZDAH 1LQEA 4FU7A 1NS3A 1Y3YA 3EGKH 4Y8ZA 1GMCF 3A89A 3RXQA 2QIQA 2P3TB 1NFXA 1SG8B 3KN2A 4LOYH 1Y5BT 1TPAE 3LH3A 1SVPA 1FUJA 1UVOA 6LPRA 3NZIA 4GVUA 2ANKH 2AERH 2WPIS 2BD5A 1C2EA 4D9RA 1D3TB 5JBAS 2R3YA 5GXPA 3SU3A 1BDAA 1WQVH 1AHTH 1XUFA 2ZCLP 1HXFH 1DWDH 1FY5A 3I29A 1YPHE 2ANWA 1EAUA 1MUEB 2FPZA 1KIGH 1P57B 2R0LA 1AIXH 4OS1A 3RXDA 1GI3A 1TALA 2FM2A 4DG4A 4CH8B 2WV4A 3EDXB 5F6MA 2Z94A 5ABWA 4I7YH 1E0FD 4MLFB 3PV4A 1IQHA 1DDJA 1O2GH 1TGNA 3VB3A 2IPHA 5EQSA 3O8DA 3ZZ6A 2J92A 1Y3UA 4I8JA 4NWLA 4AB8A 1EAIA 2A7CA 1UHBB 2CXVA 1EB1H 1EB2A 4BAHB 1HIAB 1A2CH 1LPKB 1S81A 3AAVA 4FUEA 1OWKA 4KTSA 4BAKB 3A88A 2BVXH 4A7IB 2AIQA 2RCEA 2ZKSA 1QQUA 5K0HA 1AFQB 1IQMA 1OKXA 1GL0E 1P2IA 4CRFA 3T25A 3QK1A 2STAE 4B73A 3BTME 1PPEE 1Y8TA 3RXPA 1BRBE 2J95A 1OYTH 5GWZA 4ISOA 2HPPH 1K28D 1C4Y2 4MNXA 2RG3A 1DWEH 4NCYA 1CGHA 1MTWA 4MPXA 1GJ4H 3PWCA 3L6PA 1BIOA 3KQEA 1A1RA 4O3UA 2R0KA 1C1PA 2A0QB 2OC1A 1V2TT 1O5EH 2WPKS 4E06H 1W11U 5A0CA 1ZRKA 1O3HA 3EYDA 2GV7A 1ZPBA 3RXTA 2BVSH 3P70B 1CHOF 1LTOA 3VEQB 1DWBH 2BD9A 1O2IA 1SGIB 2VGCC 1O34A 3MU5A 1O3JA 2UUYA 1MAXA 2BDCA 5DP7A 1XXFA 2BD2A 1AB9B 4IS5A 3TNTA 2TIOA 1SGTA 4BANB 1F0SA 1MAYA 3SI4H 4JZ1A 1O2NA 4ZHAA 1FY8E 3DD2H 1BQYA 1JIRA 3ELAH 4D7FA 1O5GH 4FUJA 2GCHF 5E2PA 1IQEA 1C5ZB 2ZO3H 3BTDE 4XBBA 3A81A 1DT2A 5LPFA 1GJ7B 1FJSA 1ZLRA 5GJ4B 1O3GA 1GMDF 3TJUA 1GGDC 3CS0A 3SHAH 1SL3A 3NPSA 1NFYA 5E0HA 2Z9JA 3MHWU 3MU4A 3M3VA 3RMNH 2C93B 2G4TA 2XBVA 3ZZBA 3GYLB 1C5XB 1P2KA 1EP6A 5EOKA 5EGMA 1O31A 2ZQ2A 3EQ0H 3KEEA 2C4FH 3A7WA 3E1XB 1E38B 4B74A 4NFFA 1RJXB 4QT8C 4YZUA 2VIDA 5PTPA 1IHTH