3RXMA

Crystal structure of trypsin complexed with [2-(2-thienyl)thiazol-4-yl]methanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
molecule tags Hydrolase/hydrolase inhibitor
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxmA02
2O9QA 1GBLA 1O3OA 2B5TB 2V0BA 1EXFA 1VJAU 1Y3WA 2ZU5A 2A4RA 2UWLA 2FI3E 1NPMA 2Q6DA 2B8OH 2I6QA 2FOEA 3SU2A 2ZTZA 1IQKA 3KF2A 4ZMAH 1SOZA 2STAE 3ZZ3A 2VJ1A 1HAYB 5T6DA 3SV9A 2NU4E 1PJPA 5EPYA 2OBOA 1Q31A 2BVXH 3Q76A 1AVGH 2ZGCA 2ZCLP 3PMHB 4NFEA 3UR9A 1ZJKA 1BZXE 1HAGE 5K0HA 1GJBB 1NU7B 2XC5A 3MU4A 1MQ5A 1ELGA 3A82A 4IN1A 4ISHH 3A8BA 4K1EA 1GHVH 2BTCE 1NROH 3T5FH 1N6XA 4AB8A 1C4Y2 2ZIQH 3HK3B 4ZKSU 2ZU4A 1UCYE 3RXGA 3QGNB 4MPXA 4WMDA 3UQOA 4IN2A 1FNIA 4LXBH 5L6NH 1C2JA 1UCYK 2ZHDA 5FBEA 1ABJH 1HJ9A 1TBZH 3RXOA 5EG4A 2ZGXH 5ESTE 5JB9S 4A1VA 1O37A 4ISOA 3TGJE 1LPZB 2IN2A 1K2I1 1T7CA 3O8BA 2ANYA 3FANA 1WCZA 1GBCA 4TWYA 5A8XA 1AU8A 1Y3VA 2J2UA 3AAUA 3SUGA 1HDTH 3LGWA 1GJ8B 1TYNA 3F6UH 3BG4B 4B75A 1YLCA 2KAIA 1O0DH 3SN8A 1F7ZA 3H7TA 2P3FH 2YOLA 3RXMA 3T25A 3MU1A 3EA9A 1TMUH 5LPRA 2OQ5A 2A5AA 1TIOA 1HIAA 1GJDB 1B0FA 3DUXH 3MU5A 1CBWB 2ZKSA 5C3NA 3RXAA 2AGIX 1O3MA 3BTTE 2VIWA 1S82A 1RIWB 1MU8B 2CN0H 3SGQE 1QFKH 3GY2A 1BB0B 2ODYB 3IWMA 2R9PA 3MHWU 2P59A 1T4UH 3VB6A 4O03A 3F68H 3S7KB 1BRAA 3DFLA 1EJNA 3A87A 3A81A 3VB7A 2STBE 1MQ6A 3L33A 1DY8A 1IQGA 1O31A 4X6NA 1JIMA 1YPJH 3TNTA 3QTVH 1HBTH 4TPIZ 3M7QA 1YPMH 1HPGA 1YCPK 1O3HA 3RXFA 2OC7A 1GJ9B 1V2PT 1GDUA 2ZCHP 1DUEA 2WUCA 4NA7A 2EI8A 2FTLE 1RTFB 2TIOA 1QRXA 4MLFB 1SGNE 5DP8A 4X1RU 1GMDG 1SGRE 2TRMA 1B7XB 2G8TA 4TYDA 2YNAA 5BRRE 1EATA 1GBHA 1P04A 1UTNA 1ELDE 5E2PA 1O3AA 5IYTA 1SC8U 5EQSA 3SGAE 2BZAA 4O9VA 3V7TA 1HAHH 2P3UB 4U01A 1F0TA 3MO3A 4GSOA 1O2IA 5ESBA 1MD7A 1SOTA 5A8ZA 4D8NA 2SGAA 4YOGA 1VITH 1XXDA 3Q3XA 2V35A 1EASA 5HM2A 3RXCA 2D26C 2OINA 3QLPH 4CRFA 1MBQA 1UVOA 7GCHG 1W10U 1F2SE 5F8ZA 1KXAA 1LPGB 2VVUA 2WINI 1AE5A 1TGCA 1EP6A 5GCHF 4MNXA 4IMQA 3M5OA 4AGJA 2CXVA 3OU0A 3LGTA 1Z8RA 1KLIH 1WBGB 1WU1A 4NZQA 4DG4A 1A0LA 1GJ5H 2FMJA 1H4WA 4ABHA 1AKSB 2GCTB 2H1UA 3ZYDA 1H1BA 4H6SB 2OD3B 2ALVA 1NFXA 2EI7A 3U8TH 1GJ6A 1P10A 5FBIA 8KME2 1N6YA 1O3NA 1ZPZA 1ZMNA 2SGEE 1RXPA 1W3CA 4TY6A 2CMYA 1CU1A 3UNRA 1CGJE 2GVFA 1NM6A 1IHTH 1Z7KA 3GCHB 5I25A 4D9RA 2OBQA 2FI4E 1PPHE 1O2ZA 1S84A 1O3JA 2RA0A 2JH5D 1LVBA 1OWHA 4FU7A 1O2HA 3ZZDA 1OOKB 2FIRH 4U30A 1SL3A 3SV7A 1W7GH 1ZYOA 1O30A 3JZ2B 1ETSH 2D1JA 1VCPA 2ZFRH 4GLYA 4AFQA 1DE7H 2G00A 2QV1A 4FU8A 2ZDNA 4Y11E 3GYLB 1KTSB 2H2ZA 2A5KA 2J9NA 2A0QB 4Y8ZA 1RTKA 1O5GH 3PO1B 2VWNA 1FJSA 1A3EH 2XWBI 1CSOE 1GL1A 1V2ST 1WQVH 5LH8A 1C2MA 5JBAS 4BXSA 3S9AA 4BNRA 4WMEA 2ALPA 2GZ8A 2HNTF 3F1SB 3ZZ4A 4AX9H 1YLDA 2AERH 1VGCC 2BDGA 7LPRA 3KL6A 3I29A 2PV9B 1OWDA 2GD4B 4K5ZA 3SJ9A 2BX3A 3R3GB 1N8OC 1AVWA 2ZHEH 5HXFA 1C9PA 1MD8A 3EQ0H 3U98H 3TJOA 1QB6A 3SNDA 3A83A 2J34A 1N1LA 4X2XA 3UREA 2ZTYA 4B74A 3SHAH 4Y8XA 3SV8A 4NCYA 1P3EA 4ZXYH 3HK6B 2ZFPH 1V3XA 3P17H 1IQEA 1MCTA 3E8LA 3SJIA 4CRDA 5FCRA 1FXYA 1Z8IB 3P92A 1UVSH 5HGGA 3M3VA 3PTNA 1UTKA 3KHVA 2JH6D 1W2KH 2ZHWH 4IBLH 4Y6DA 5IDKA 1C1PA 3I77A 1K1NA 1O3FA 2FX4A 4RKOB 1P12E 1G30B 1O3LA 4ZHMU 1SHHB 2VH6A 3GDSA 1SBWA 4DURA 1O5FH 2HGTH 3L3TA 3RUOA 2FDAA 1SLXB 1F0SA 2A4QA 2BD4A 1EAIA 3FFGA 2AIPA 3PLBA 2WV5A 2WPKS 3QDZB 1INCA 1UO6A 3M61U 4GUXA 4RKJB 1G2MA 1KXCA 1BUIA 3H7OA 1QL8A 2PFEA 5DJ7A 1C1UH 1C5SA 1GHWH 1GCTC 4X1QU 1J15A 4NA8A 3SGBE 2FX6A 4O3TA 4GPGA 1PQ5A 4INKA 1NN6A 2RDLA 4K3JA 1BBRH 1FY4A 2R2MB 2BD2A 1C4V2 3S69A 4K1SA 1TNLA 2F91A 1QY6A 5I46H 3KQEA 1YCPM 4XBBA 3SU6A 1C5PA 1GI1A 4A1XA 3RU4E 3MWIU 1AFEH 1EP5A 2M5TA 1GGDB 3D65E 2Y82A 2HRVA 1TA6A 3ZV9A 1O2QA 1ZMJA 1D6WA 1HGTH 5EQQA 3GCNA 3UTUH 3ZV8A 3B23B 3NWUA 1FIZA 2GV7A 2PUXB 3S9BA 1HAZB 4TWWA 4X1NU 1SLVB 4DIHH 3GYMA 2AYWA 3AW1A 3E16B 3LT3A 1SGQE 1A1RA 3SW2B 2FOFA 1O34A 4WH8A 1OWKA 3SV2H 4X2VA 2WUBA 2TBSA 2LPRA 3MNBA 4I32A 3K65B 1BHXF 2XNIA 2VINA 1OP0A 1A3BH 4XBCA 3DD2H 1TGSZ 2VGCC 2Y5GA 1Z6EA 1KTTB 3SUFA 1K22H 5F03A 1MTUA 1W7XH 3TGKE 1DITH 1MKXK 1O32A 4INLA 3PMJA 1GVLA 3AAVA 1UMAH 2ZU1A 1ZTLA 2BD3A 1QL7A 1UTLM 1O3IA 2B0FA 2A45B 1MH0A 2ZDVH 4Y71A 1HUTH 2XCFA 2GDEH 2JH0D 5GPIB 1W8BH 2ILNA 1KYNA 3KEEA 4CBNA 2GV6A 3LJOA 5AFYH 1EZSC 4X8VH 1GWAA 1GBJA 1NRPH 3A80A 3ZVCA 1AMHA 5CMXH 5DG6A 6ESTA 1LO6A 1D3PB 1W14U 2ZU3A 3RC6A 2I6SA 1O2XA 5DGJA 2ZI2H 1S81A 2PKAA 2J95A 2HALA 4A92A 1E35B 3E0NB 3MYWA 4HTCH 2J94A 1OX1A 2ZHFH 2GCTC 1E0FD 3Q77A 1V2WT 3A8AA 2ODPA 1NRRH 1BQYA 3RXIA 2FLBH 4ABEA 1ANDA 3P8OA 3SORA 1YPLH 1CHOF 3MU0A 1NTPA 1PYTC 3OX7U 3BEIB 3SI3H 2BXUH 4K8BA 4TY7A 1TAWA 3FP7E 1QCPA 2EEKA 1SMFE 2XC0A 1AN1E 1IQNA 3DFJA 1GI0A 3FZZA 4GCHF 4ISLA 3GOVB 2BY6X 5CHAB 2XBYA 2FPZA 4KTSA 1ETTH 1ANEA 1EPTC 3T26A 4ABGA 2VWOA 1V2UT 1GBTA 4JZ1A 1DSTA 1DOJA 2R3YA 1UHBB 4MVNA 2FEQH 1SHYA 3CP7A 3ATWA 4BAMB 1GL0E 4E05H 1NO9H 2UUFB 2Z9IA 1TOCB 1O3KA 2ZDKA 1VITG 1Y8TA 1QJ1B 4NIYA 5FPSA 3V13A 2HPQH 1MZAA 5C1YA 1VZQH 4AFUA 1C9TA 1P2NA 1O2PA 4LZ1H 1PPZA 1EUFA 4Y7BA 2OUAA 1W11U 1EOLA 2JETC 3URCA 5TJXA 1DWCH 1C1SA 1MKXH 1HCGA 3M35A 2FXRA 1OXGA 3MH7A 1W12U 4JZDH 1THRH 4ZKRU 5EXLA 3A85A 1P9SA 3URDA 1NFUA 1YPKH 2IJOB 4MPVA 3RMLH 5FHTA 2PGBB 3UR6A 1MTNC 3M5LA 4NA9H 1BMMH 1XX9A 2A32A 3LC3A 3ZZAA 2ZU2A 1UTPA 3UY9A 2Q6GA 4JK6A 1O38A 1HJAC 1J17T 1G3DA 1YP9A 1XM1A 2Z6BD 1ZGVA 1FUJA 2AH4X 4UDWH 2WYGA 2C3SA 3BTFE 2BY9X 2ASUB 4ZXXH 3PYHA 4MNYA 1JMOH 1FN8A 1O5AB 1YM0A 3A7TA 1C2LA 2VIPA 1E38B 1JRTA 3VGCB 1FIWA 1TWXB 2XRCA 1ZTJA 1C1MA 1UVPA 3NKKA 1NC6A 4ISNA 1Y3UA 5DP4A 2EI6A 1IAUA 1BDAA 3RDZA 4HGCA 4AFZA 5C67A 1H8IH 3GY4A 3O8DA 2FI5E 4AYYB 1EJAA 1O2UA 4HZHA 3BEUA 4OS1A 1O5BB 1BJUA 2Y5HA 1WOFA 3I78A 1SR5C 3ZVFA 3QN7A 4A5TS 1CA8B 3RXJA 2ZNKH 5T6FA 4J1YA 3RXBA 1K1JA 3VFEA 2ZQ2A 3QWCH 1HAVA 3SI4H 1F0RA 3A88A 1EB2A 3RLWH 2NU2E 1JRSA 1OPHB 2NU1E 1WUNH 2F9NA 3BIUH 2YNBA 2V3HH 3Q3KA 3K2UA 1C5NH 2OC0A 1BBRK 1K28D 1RJXB 1SFIA 3F9HA 2PLXA 1TMTH 1QURH 1FQ3A 2AGGX 1FY1A 1V2TT 1GJCB 2CJIA 2UUKB 1TX7A 1BHXB 1O39A 1GI3A 3SZNA 1S0RA 2A2QH 1H9IE 2FOBA 4Y8YA 2PGQB 2R0KA 2IOTA 1FN6A 1CT0E 4NSYA 4CRCA 2GZ7A 3FVFB 1W13U 1ZHRA 3ELAH 1ZHPA 4B1TA 2W5EA 1C2GA 1QRWA 3P8NA 3BSQA 1HAXB 3VB5A 5DPAA 1NRQH 3MFJA 4IGDA 4YLQH 2G52A 2C8XB 2ZF0H 2SGQE 4YT7H 5FXLA 1D3DB 2GDDA 1A5GH 4MPWA 3RXUA 4ASHA 1D3QB 2Y7ZA 1BJVA 4IMZA 4DW2U 5GDSH 1ZRBA 4XSKU 2GGVB 2FP7B 3HKIB 4WJG2 1K1PA 2Z9GA 2XWAA 5E0JA 2PKAB 5AFZH 3LGIA 5TCCA 5DP3A 5A2MH 1GVKB 2CHAC 1C5ZB 1Y3YA 1O2KA 2OLGA 5EGMA 1PPGE 4AG2A 2AMQA 1NFWA 4FUEA 3SU4A 2QYIA 2A31A 1C1RA 3VPKA 4ABJA 1GMCF 5FX6A 1O2RA 4CRGA 2HNTE 2Z3CA 1QJ6B 3M3SA 1C5MD 1G3BA 1YGCH 3SQEE 3EAJA 4JMYA 1BTZA 2Y80A 1UK3A 4K60A 1P0SH 4ESTE 1TLDA 4UFGH 6CHAB 3P70B 1GVZA 4B71A 3T29A 1P2OA 1S85A 1F5RA 2A1DB 5HYOA 3A8DA 2VWMA 4Z6AH 4FVBA 1EAUA 1EZQA 1G9IE 3FP6E 2ZHQH 4CHAC 3P6ZB 1L1JA 3ZZ7A 2IPHA 4ZHAA 5L2YH 8GCHG 4D76A 2G5VA 1YPHE 1C1VH 1Z6JH 1FY5A 1CGHA 2CGAA 3VB4A 3U1IB 1KXDA 1GBEA 1VCQA 2BDAA 3UPEA 2FWWA 1GHAG 1C1TA 3BIVH 3ZVDA 4FUJA 1CA0C 4U32A 1A4WH 2ZDMA 1ZTKA 1P2IA 5EOKA 1A61H 2LNCA 2O8LA 1XUHA 1Y5AT 1HRTH 3UOPA 4ABAA 1QTFA 1GI5A 3W94A 4YT6H 5C5NA 2D8WA 4ABBA 3DA9B 2FOMB 4Q7YA 3A7WA 4FUIA 1D9IA 2SGFE 2PSXA 2QY0B 4I8HA 3PMAB 1C1OA 1T8NA 3C1KA 1HB0B 2NU3E 1U6QA 1TRYA 3D62A 4KKDA 3SJ8A 3A86A 3EYDA 1C2IA 2VIVA 3FP8E 3SV6A 2H5CA 1ELFA 2H9TH 1FY8E 2A7JA 2ZFFH 3KNXA 4ZROA 4E7RG 2R3UA 2SNWA 1UTQA 4DOQA 4AOQA 4CHAB 2DE8A 3RMMH 3AVZA 4H42U 2ZG0H 3S7HB 2V6NA 1PPCE 1XXFA 1J16A 3LJJA 1GMHG 4JYTA 3EDXB 1LHFH 3OY6U 2C93B 1UTJA 4Y79A 1FONA 4X8SH 2GTBA 2ZFSA 1EQ9A 2QCYA 1JOUB 3P95A 1K1MA 1AWHB 2C8YB 4MG3A 4HI3A 4UFDH 1UK4A 9LPRA 3BTWE 3O8CA 1GHZA 3BTQE 3UUZA 1TQ0B 1O5DH 5C20A 1UHBA 2GCHF 2JKHA 4WWYA 1SGCA 5ETXA 1E36B 4AN7A 1OYTH 3FZDA 4NGAH 3AW0A 4OS2A 1DXPA 1Q2WA 1QIXB 1O33A 4YLUA 4TPYA 5LGOA 1P09A 5BPEA 2A7HA 1OP8A 3OSYA 4XOJA 1YKTA 1EPTA 4HFPB 1JIRA 1UK2A 3NUMA 1QQUA 4NWLA 1GJ4H 2W7SA 2P94A 1V2KT 1A46H 2ZDLA 3E3TA 4DGJA 5LPEA 1SGPE 1BIOA 2D2DA 3QGJA 5GXPA 4X6PA 1AVXA 1AZZA 1CVWH 1ESTA 1A0HB 5L30H 1NU9A 4MPUA 1O2GH 1BBRE 1BRBE 1BTXA 2FM2A 3BF6H 4ABIA 5JBCS 3QK1A 5EPNA 1NS3A 4F4OC 4OS4A 1ESBA 1C5LH 2SNVA 2GZ9A 4CREA 1AKSA 2BZ6H 1CQQA 1NT1A 4KP0A 2BVSH 4CH2B 1FI8A 1DANH 1HXFH 3TITA 1SGEE 1XUKA 1BRCE 1GG6B 2PR3A 1MCVA 2QAAA 3UNQA 3ZVAA 2RA3A 5EW2H 3GY3A 1FAXA 1VCWA 4GHTA 3RXQA 3SU1A 3TJNA 1GPZA 1QBOA 1ABIH 1P05A 1BMAA 1CHGA 1THSH 2PTCE 3LGUA 1MMJN 1DWEH 1O2OA 3GDUA 4B2AA 3MH4A 4I8JA 3LKWA 2HPPH 4FUHA 3LGYA 1QB1A 1AZ8A 3M5NA 3OY5U 3BTKE 4AG1A 1FAKH 4WXVA 1S6HA 1D3TB 1C5YB 1VGCB 2W3IA 5E0GA 4CRBA 1H9LB 1J9CH 2O8UA 1AFQB 4YZUA 1BTHH 1SSXA 1A5IA 1WTGH 1GJAB 1SQOA 1Q3XA 1SG8B 4BTTB 4I31A 1HYLA 1ELCA 2BQWB 4KTCA 1C1WH 5EW1H 2TGPZ 5T6GA 2ZCKP 3RMOH 1YPEH 4DIIH 5EQRA 1IQFA 1Y5BT 1LKBA 2BDBA 4WXIA 3ZZ8A 3TU7H 4X6OA 5E8EH 1GHAF 3ZVEA 1ZSJA 2UWPA 1O2TA 1B5GH 4BAQB 3SO3A 2ZQ1A 2ZO3H 1P2JA 1QR3E 1SGTA 1O2JA 1AIXH 3TVJB 1HAPH 1A0JA 3QX5H 2BX4A 3ATIA 1GHBF 1LVMA 4E06H 4ZHLU 1SFQB 3ITIA 1C5TA 2H5DA 1S6FA 1TPAE 1KDQA 4RN6A 4UONA 3M7TA 1ARBA 3O8RA 2RCEA 3PLPA 3FAOA 2UWOA 2BY5X 4VGCC 1OWJA 1GCDA 3P8FA 2HNTC 3M36A 4OS7A 1ZR0A 4A7IB 3SJOA 3SU0A 1O2WA 1JWTA 1HLTH 1TRMA 1AUJA 1ORFA 1ETRH 2BDCA 2PW8H 1BTWA 1OKXA 1UVTH 1ZSKA 1EOJA 3LDXH 1MTNB 2SGPE 1LDTT 4FXGH 4E7NA 2A4OA 1S5SA 1C2KA 4K1TA 1E34B 1HIAB 1ELBA 3S9CA 1MU6B 2BXTH 2ZWLH 1L4ZA 2FO9A 4OGYA 1FMGA 1UTOA 3ODDA 1B0EA 1GBAA 3U9AH 4I8KA 1V2OT 4LK4A 5DO4H 2O8WA 3V12A 4UFFH 4YO9A 2O8MA 2P8OC 3BG8A 4INHA 1G36A 2Z94A 1GBKA 1TGTA 2Q1JA 1HJ8A 3TH4H 2CF9H 3B8JA 1W0ZU 4JYVH 4KTUA 1V2QT 4FU9A 5FAHA 3SU3A 1BMLA 2FOCA 1C2HA 4B2CA 1TONA 3ENSB 3LC5A 3STJA 5A09A 6CHAC 2C90B 4GVUA 6LPRA 1O3EA 1TALA 2V3OH 1SGIB 4JK5A 4X1PU 1ZMLA 2FESH 4X0WU 1GHXH 1GHYH 1ZZZA 2FS8A 2AIQA 4I33A 1VR1H 4UE7H 2ZZUH 2BLWA 1C1QA 1XUJA 1GBDA 1LVOA 1OWEA 3MH6A 5FX5A 1P3CA 1T8LA 2BLVA 1IQJA 4AFSA 1P03A 2Z7FE 1ELEE 1DICA 1F0UA 2BB4A 1NZQH 4BTUB 1T31A 3HGNA 1TX8A 1BRUP 3K6ZA 5DP6A 1V2LT 4ABDA 2BOHB 1HAOH 4VGCB 1EB1H 1DWDH 3WY8A 7KMEH 2OTVA 2BYAX 1EJMA 3H5CB 4WY3A 2GT8A 1KXEA 3TK5A 3LH1A 3TGIE 1O3BA 3TJUA 1QGFA 2TGTA 4ZUHA 1V6DA 5B6OA 1V2JT 1XVOA 2ESTE 4A6LA 5FCKA 2XBXA 2CV3A 2UUYA 1IOEA 1TQ7B 1CE5A 3GCOA 2VVVA 1ELTA 1OSSA 4Q7XA 5JDUB 1EPTB 1JBUH 3RXPA 2A7CA 1DLEA 3VEQB 2OXSA 1K1LA 2QF0A 1AY6H 1PPEE 3GY7A 2PUQH 2A5IA 1Z8GA 1G3CA 2BQ6B 3M3TA 1ACBE 1MTWA 2PTNA 3GDVA 3E91A 1RGQA 1LQEA 3GY5A 1DUAA 2HLCA 1HV7A 1O35A 1F5KU 3SBKA 3GCTF 1BTYA 3HPTB 1P2KA 1Y59T 1GI9B 3RXRA 2FYRA 1TE0A 1MBMA 2BVRH 2XXLA 1EZUC 2Y81A 1QB9A 1D4PB 1QBVH 5SGAE 1P02A 4Q80A 1OP2A 4R8TB 4D9QA 1DLKB 1DX5M 4B76A 2VIDA 1YBWA 2XBVA 3U8OH 1RFNA 5JPMH 4H6TA 1RD3B 2BLQA 5JBBS 3EA8A 3UQVA 1DVAH 3OYPA 4MTBA 4I7YH 1TFXA 2FOAA 1O2LA 3M37A 1WQSA 1CGIE 3RM2H 2KAIB 1SQAA 4GCHG 4DVAU 1PFXC 5F6MA 2FOHA 1LTOA 2HWLB 3LONA 1OS8A 3JZ1B 3V3MA 4THNH 1PPFE 7ESTE 3MNCA 1O5EH 1TBQH 4GHQA 4AGKA 1TPOA 1TOMH 1Z71A 3B9FH 3LGVA 3PM3A 3MNSA 2ZTXA 3PWCA 1EAXA 2VH0A 1GBFA 2ZGBH 2CHAB 1XUGA 2AMDA 5DK1A 3A7XA 4XDEA 4YM9A 4YESB 1KIGH 2UUJB 4JCNA 2BD5A 2J4IA 3SQHE 3RMNH 5HM9A 3S0NA 2WPIS 2WYJA 9ESTA 1C2EA 1KLTA 3ATKA 3RM0H 1AFQC 3LIWA 1TPSA 1J14A 3RXLA 4Y10E 4AZ2B 3EGKH 1EZXC 1TRNA 5EODA 1TNJA 2BQ7B 4A1TA 3SOSA 3P8GA 4NIWA 1UVUH 1E37B 4RSPA 4B2BA 2XYAA 3ODFA 1O36A 1KY9A 1KXFA 1ELVA 1L1GA 4ZH8A 3ATLA 1AQ7A 2H9EH 5A0CA 1ID5H 4NIXA 4MQAA 5FPTA 1GMDF 3PROA 2A2XH 2TPIZ 2WPHS 2Y5FA 3MO9A 3VXEH 5C1XA 3QTOH 4JYUH 2BM2A 2QXGA 2BY7X 1SGFA 3E90B 5PTPA 1QRZA 1P11E 5GJ4B 2AMPA 3C27B 2VWLA 4KGAA 2VNTA 1FZZA 3MMGA 3TLOA 1XKAC 4JZEH 1AB9B 3F9EA 2FOGA 2R0LA 1K21H 3A89A 1O5CB 1A5HA 2ZGHA 1L0ZA 2ZPRA 3IITA 4ZKNU 2FODA 1SVPA 7GCHF 2OC8A 2HVXA 4B73A 3TJVA 2Z3EA 1C2FA 1UTMA 3QZQA 1LPKB 4UD9H 1YYY1 1NFYA 5GCHG 2BY8X 3PLKA 2WPJS 3BV9B 4BANB 1EX3A 1MUEB 4F49A 4NSVA 2R2WU 5DKMA 1P57B 1QNJA 4NWKA 3PTBA 1QBNA 2ZFQH 1O3GA 1WV7H 1IQLA 1ZRKA 1ANBA 1TGBA 1QA7A 4IC6A 5TCAA 1IHSH 2QA9E 2QXIA 1ZLRA 4OGXA 1CT2E 5A0AE 1YC0A 1MKWH 1WTHD 5T3HA 1C5RA 2AS9A 1IQHA 4U2WA 2DUCA 1FY3A 3QZRA 1MTSA 3KQCA 1DT2A 1AGJA 2BDIA 2F9VA 4X8UH 1Y5UT 3DT0H 5AVDA 5K7RA 5J4QA 1JXPA 4QT8C 1GI8B 2FTMA 1AHTH 1SQTA 1K9OE 4Q2KA 1GI2A 3RC4A 3ZVGA 2QXJA 1O2YA 1HXEH 4Y0ZE 2C4FH 3MO6A 3RU4D 1WAYB 4J2YB 1N8OB 1J8AA 2ZEBA 1ZGIA 4K8YA 3TPIZ 1S83A 1L2EA 3VGCC 1HNEE 1QJ7B 3TIUA 2G4TA 1GG6C 1A2CH 1C5UA 1GDNA 1P9UA 1SGDE 1MTVA 4YOIA 3RXHA 4DY7B 4K69A 1NRNH 2BLOA 2BD9A 2ZPSA 3R0FA 1DM4B 4NZLA 2PWXA 1AO5A 4FUGA 2P3TB 5JB8S 3CENA 2GKVE 1GHBG 4XBDA 1H9HE 5EU8A 5C1UA 2QIQA 2P95A 3BG4C 1RTLA 1G37A 1GDQA 4XE4A 2ZC9H 1NRSH 2G51A 4WMFA 3T2NA 1IQIA 1C4U2 3L6PA 2F9BH 1C5VA 2THFB 1YPGH 3LPRA 1LVYA 1L1NA 3ESTA 1NY22 3MNXA 1D6RA 2ZDAH 4K2YA 3RXSA 2G55A 3SNCA 1CA0B 3PMBB 2PKSB 3EA7A 1HJAB 2XC4A 1V2MT 1PPBH 3KIDU 4I8GA 4GAWA 4UEHH 3UIRA 1BA8B 1BT7A 1Y3XA 1GMCG 1O2VA 5C5OA 1TNHA 2TGAA 3A7ZA 4CR9A 2VU8E 3BTDE 4JZIA 3TK9A 3U1JB 4ZKOU 4DCDA 2ZGJA 1F5LA 3RXEA 2SGDE 3HGPA 1MKWK 1ZPCA 2BD7A 5AHGH 3W95A 4O3UA 4CR5A 2Y7XA 1GBMA 2SFAA 4YOJA 3D23A 1ZPBA 4Y76A 4LZ4B 1SPJA 1YF4A 4FVDA 1W0YH 3HATH 3F9FA 2P93A 2BOKA 3LH3A 2J38A 1DWBH 5E2OA 2HOBA 1ZHMA 1T8MA 3UWJH 1T32A 1G32B 2XW9A 3TH3H 2OP9A 1IQMA 4R0IA 1HAIH 2TGDA 4SGAE 5EXNA 5CE1A 3NPSA 4WF8A 2OQUA 3E1XB 1DFPA 2BDHA 3MTYA 3MH5A 4LOYH 2NWNA 2OCVB 1O3CA 2AGEX 3A7VA 3QUMP 1YPHC 4CBOA 5H4IB 2BD8A 1LMWB 4Z0KA 2C8WB 5GIBA 4I8LA 2ODQA 1KLJH 4YTAA 5FPYA 4OS6A 1OWIA 1UJ1A 3BTEE 1TA2A 1V2RT 1O3PB 2ULLA 3BTME 1O2NA 2GT7A 3TH2H 1SLWB 1QQ4A 4AYVB 1DS2E 3V0XA 1ZOMA 1QA0A 2ZPQA 3PB1E 3RP2A 3VXFH 1LHDH 3GCHC 4M7GA 1AE8H 1O3DA 1Z8JB 2FLRH 1ZSLA 3U69H 2H9HA 1CO7E 1VITF 3RXVA 4JZFH 3SNBA 2VVCA 3TK6A 2ZECA 2FYQA 1HAVB 3RXDA 1GGDC 6GCHF 1TX6A 4D7GA 1GMHF 1XUFA 2W26A 1CBWC 3ZZ6A 3KCGH 4ZAEA 1P8VC 2ZA5A 3RXTA 1CT4E 1O2SA 2Y6TA 2G4UA 1A7SA 3RU4T 1C5WB 1TB6H 1SGFG 1SGYE 1L4DA 1M9UA 4SGBE 2VB0A 3LOXA 2VGCB 8LPRA 5JBTA 1BTPA 2Z9LA 1SLUB 3M7UA 5A8YA 3NZIA 2K1QA 5AF9H 2XCNA 1C5XB 4WH6A 3MU8A 3KGPA 3MOCA 2VIQA 2PSYA 3STIA 1HFDA 3K6YA 4X2YA 4DJZB 4PROA 1GI7B 1XUIA 2F9UA 4BXWA 3KQBA 1CHOG 3GICB 1Z1IA 3ATMA 1C5QA 2ANWA 1EKBB 5F8XA 1MAYA 1DXWA 3GCTG 5E0HA 3VB3A 1OYQA 1RS0A 1P2QA 2B9LA 2GP9B 2EC9H 1BTUA 2F9OA 1C2DA 5L2ZH 3GISB 3UWIA 4D7FA 1O2MA 2P8OB 5DP5A 1SB1H 4BOHA 3ZZCA 3BTHE 4NG9H 1P06A 1P01A 3DHKH 1AB9C 4FUFA 3T27A 3MI4A 4H4FA 1G3EA 2W7UA 1LQDB 1C1NA 2AFQB 3KQDA 1V2NT 1GBBA 1XKBC 1FDPA 3SUEA 1BITA 5G4BA 1FV9A 2JETB 4BAOB 2Z9KA 5DP9A 3A7YA 2DE9A 2CF8H 3PWBA 4MNWA 1T8OA 3NXPA 1S0QA 1KXBA 1THPB 4Y7AA 2PKSC 2P16A 4X8TH 4AORA 4CRAA 8ESTE 2G5NA 5EXMA 2AEIH 1LHEH 1DY9A 5DP7A 5ABWA 5F8TA 4MDSA 1SI5H 3T62A 1YCPH 2BMGB 1AWFH 4FUCA 3UOUA 2G81E 3BEFB 1FPHH 1PQ8A 2Z3DA 3SNAA 4BAKB 3A84A 1T4VH 2BDYA 3HKJB 3T28A 2QGRA 2FZZA 4Y0YE 3TNSA 1ZJDA 2VIOA 1DDJA 3QO6A 3NCLA 3G01A 4UFEH 5CHAC 1ANCA 5C2ZA 2F83A 3F9GA 5LPFA 3CS7A 5JYIA 1VJ9U 1QL9A 1LKAA 1XVMA 3LU9B 3BTGE 2GMTB 4CH8B 4BTIB 2WV4A 1MZDA 3SU5A 1TABE 3M5MA 3Q00A 1TNGA 1QHRB 3CS0A 5A0BA 3RC5A 1GJ7B 2RG3A 4ISIH 4OS5A 2ANMH 2WPMS 5GWZA 3AASA 1GBIA 2O8TA 4O97A 1GI4A 1BMNH 3RLYH 2Q6FA 1TPPA 1EAWA 1DPOA 2XBWA 3NK8A 3SJKA 3IG6B 4XFQA 3BN9A 3D49H 4X1SU 2QF3A 1KDQB 2A4GA 5HMAA 3E0PB 4Q7ZA 1C5OH 3EE0B 1H8DH 5J4SA 1AD8H 2BHGA 4KELA 4FUBA 3KN2A 1LHGH 1P2MA 1RIWC 2GMTC 1RRKA 2F3CE 4NFFA 1LCYA 1X7AC 1PQ7A 2WPLS 1GI6A 1TGNA 1ELAA 2C8ZB 4IW4E 4X2WA 2GX4A 1BOQA 1MAXA 1UCYH 1DSUA 2W3KA 4NIVA 3ZZ5A 2OC1A 2XTTB 3E6PH 1Z1JA 1TMBH 4MNVA 3PO1C 1G2LA 3A8CA 1TNIA 4BAHB 2ZFTA 4WVPE 3RXKA 1WYKA 3GY6A 2ZP0H 1FPCH 2QC2A 3Q3YA 1GCTB 4DT7B 2NU0E 2H6MA 3K9XB 3N7OA 2J92A 1F92A 1TNKA 3OTJE 3SHCH 1AI8H 2GCHG 3UFAA 3SNEA 3GY8A 1NESE 2B7DH 4X6MA 3UNSA 3ZZ9A 2Z9JA 2FS9A 2QXHA 3U8RH 3ZYEA 2PHBA 6GCHG 1BCUH 1KSNA 3PV4A 1WSSH 4ABFA 4AB9A 3ZZBA 1K1IA 1LHCH 3ZVBA 1PYTD 1PQAA 1XMNB 1ARCA 2F9PA 4FUDA 8GCHF 4IS5A 4IC5A 1FLEE 1ESAA 1K1OA 2ANKH 1AUTC 2EA3A 3SUDA 1TBRH 2QN5T 1V2VT
chains in the Genus database with same CATH superfamily
2O9QA 1GBLA 1O3OA 2B5TB 2V0BA 1EXFA 1VJAU 1Y3WA 2ZU5A 2A4RA 2UWLA 2FI3E 4Q4LA 1NPMA 2Q6DA 2B8OH 2I6QA 2FOEA 2LP6A 3SU2A 2ZTZA 5FL7D 1IQKA 3KF2A 4ZMAH 1SOZA 2STAE 3ZZ3A 2VJ1A 1HAYB 2CK3D 5T6DA 3SV9A 2NU4E 1PJPA 5EPYA 3ZIAD 2OBOA 1Q31A 2BVXH 3Q76A 1AVGH 2ZGCA 2ZCLP 3PMHB 4NFEA 3UR9A 1ZJKA 1BZXE 2QE7D 1HAGE 5K0HA 1GJBB 1NU7B 2XC5A 5HIZA 3MU4A 1MQ5A 1ELGA 3A82A 4IN1A 4ISHH 3A8BA 4K1EA 1GHVH 2BTCE 1NROH 3T5FH 1W0KD 1N6XA 4AB8A 1C4Y2 2ZIQH 3HK3B 4ZKSU 2ZU4A 1UCYE 3RXGA 3QGNB 4MPXA 4WMDA 3UQOA 4IN2A 1FNIA 4LXBH 5L6NH 1C2JA 1UCYK 2ZHDA 5EJZA 5FBEA 1ABJH 1HJ9A 1TBZH 3RXOA 5EG4A 2ZGXH 5ESTE 5JB9S 4A1VA 1O37A 4ISOA 3TGJE 1LPZB 2IN2A 1K2I1 1T7CA 3O8BA 2ANYA 2J5UA 3FANA 1WCZA 1GBCA 4TWYA 5A8XA 1AU8A 1Y3VA 2J2UA 3AAUA 3SUGA 1HDTH 3LGWA 1GJ8B 1TYNA 3F6UH 3BG4B 4B75A 1YLCA 2KAIA 1O0DH 3SN8A 1F7ZA 3H7TA 1SKYE 1EFRD 2P3FH 2YOLA 3RXMA 3T25A 3MU1A 3EA9A 1TMUH 5LPRA 2OQ5A 2A5AA 1TIOA 1HIAA 1GJDB 1B0FA 3DUXH 3MU5A 1CBWB 2ZKSA 5C3NA 3RXAA 2AGIX 1O3MA 3BTTE 2VIWA 1S82A 1RIWB 1MU8B 2CN0H 3SGQE 1QFKH 3GY2A 1BB0B 2ODYB 3IWMA 2R9PA 3MHWU 2P59A 1T4UH 5KECA 3VB6A 4O03A 3F68H 3S7KB 1BRAA 3DFLA 3OFND 1EJNA 3A87A 3A81A 3VB7A 2STBE 1MQ6A 3L33A 1DY8A 1IQGA 1O31A 4X6NA 1JIMA 1YPJH 3TNTA 3QTVH 1HBTH 4TPIZ 3M7QA 1YPMH 1HPGA 1YCPK 1O3HA 3RXFA 2OC7A 1GJ9B 1V2PT 1GDUA 2ZCHP 1DUEA 2WUCA 4NA7A 2EI8A 2FTLE 2TIOA 1RTFB 1QRXA 4MLFB 1SGNE 5DP8A 4X1RU 1GMDG 1SGRE 2TRMA 1B7XB 2G8TA 4TYDA 2WPDD 2YNAA 5BRRE 1EATA 1GBHA 1P04A 1UTNA 1ELDE 5E2PA 1O3AA 5IYTA 1SC8U 5EQSA 3SGAE 2BZAA 4O9VA 3V7TA 1HAHH 2P3UB 4U01A 1F0TA 3MO3A 4GSOA 1O2IA 5ESBA 1MD7A 1SOTA 5A8ZA 4D8NA 2SGAA 4YOGA 1VITH 1XXDA 2V3MA 3Q3XA 2V35A 1EASA 5HM2A 4DT4A 3RXCA 2D26C 2OINA 3QLPH 4CRFA 1MBQA 2GJGA 1UVOA 7GCHG 1W10U 1F2SE 5F8ZA 1KXAA 1LPGB 2JDID 2VVUA 2WINI 1AE5A 1TGCA 1EP6A 5GCHF 4MNXA 4IMQA 3M5OA 4AGJA 2CXVA 3F2GA 3OU0A 3U28C 3LGTA 1Z8RA 1KLIH 1WBGB 1WU1A 4NZQA 4DG4A 1A0LA 1GJ5H 2FMJA 1H4WA 4ABHA 1AKSB 3WWFA 2GCTB 2H1UA 3ZYDA 1H1BA 4H6SB 2OD3B 3PV5A 2ALVA 1NFXA 2EI7A 3U8TH 1GJ6A 1P10A 5FBIA 8KME2 1N6YA 1O3NA 1ZPZA 1ZMNA 2SGEE 1RXPA 1W3CA 4TY6A 2CMYA 1CU1A 3PRBA 3UNRA 1CGJE 2GVFA 1NM6A 1IHTH 1Z7KA 3GCHB 5I25A 4D9RA 2OBQA 2FI4E 1PPHE 2KFWA 1O2ZA 1S84A 1O3JA 2JJ1D 2RA0A 2JH5D 1LVBA 1OWHA 4FU7A 1O2HA 3ZZDA 1OOKB 2FIRH 4U30A 1SL3A 3SV7A 1W7GH 1ZYOA 1O30A 3JZ2B 1ETSH 2D1JA 1VCPA 2ZFRH 4GLYA 4AFQA 1DE7H 2G00A 2QV1A 4FU8A 2ZDNA 4Y11E 3GYLB 1KTSB 2H2ZA 2A5KA 2J9NA 1QZ8A 2A0QB 4Y8ZA 2WHXA 1RTKA 1O5GH 3PO1B 2VWNA 1FJSA 1A3EH 2XWBI 1CSOE 1GL1A 1V2ST 1WQVH 5LH8A 1C2MA 5JBAS 4BXSA 3S9AA 4BNRA 4WMEA 2ALPA 2GZ8A 2HNTF 3F1SB 3ZZ4A 4AX9H 1YLDA 2AERH 1VGCC 2BDGA 7LPRA 3KL6A 3I29A 2PV9B 1OWDA 2GD4B 4K5ZA 3SJ9A 2K8IA 2BX3A 3R3GB 4YXWD 1N8OC 1AVWA 2ZHEH 5HXFA 1C9PA 1MD8A 2RFKC 3EQ0H 3U98H 3TJOA 1YWUA 1QB6A 3SNDA 3A83A 2J34A 1N1LA 2QF4A 4X2XA 3UREA 2ZTYA 4B74A 4RT0A 3SHAH 4Y8XA 3SV8A 4NCYA 1P3EA 3OTPA 4ZXYH 3HK6B 2ZFPH 1V3XA 3P17H 1IQEA 1MCTA 3E8LA 3SJIA 4CRDA 5FCRA 1FXYA 1Z8IB 3P92A 1UVSH 5HGGA 3M3VA 3PTNA 1UTKA 3KHVA 2JH6D 1W2KH 2ZHWH 4IBLH 4Y6DA 5IDKA 1C1PA 3I77A 1K1NA 1O3FA 2FX4A 4RKOB 3N7DA 1P12E 1G30B 1O3LA 4ZHMU 1SHHB 2VH6A 3GDSA 1SBWA 4DURA 1O5FH 2HGTH 3L3TA 3RUOA 2FDAA 1SLXB 1F0SA 2A4QA 2BD4A 1EAIA 3FFGA 2AIPA 3PLBA 2WV5A 2WPKS 3QDZB 1INCA 1UO6A 3M61U 4GUXA 4RKJB 1G2MA 2W6JD 1KXCA 1BUIA 3H7OA 1QL8A 2PFEA 5DJ7A 1C1UH 1C5SA 1GHWH 1GCTC 4X1QU 1J15A 4NA8A 3SGBE 2FX6A 4O3TA 4GPGA 1PQ5A 4INKA 1NN6A 2RDLA 4K3JA 1BBRH 1FY4A 2R2MB 2BD2A 1C4V2 3S69A 4K1SA 1TNLA 2HVYB 2F91A 1QY6A 5I46H 3KQEA 1YCPM 4XBBA 3SU6A 1C5PA 1GI1A 4A1XA 3RU4E 3MWIU 1AFEH 1EP5A 2M5TA 1GGDB 3D65E 2Y82A 2HRVA 1TA6A 3ZV9A 1O2QA 1ZMJA 1D6WA 1HGTH 5EQQA 3GCNA 3UTUH 3ZV8A 3B23B 3NWUA 1FIZA 2GV7A 4FETA 2PUXB 3S9BA 1HAZB 4TWWA 4X1NU 1SLVB 4DIHH 3GYMA 2AYWA 3AW1A 3E16B 3LT3A 1SGQE 1A1RA 3SW2B 2FOFA 1O34A 4WH8A 1OWKA 3SV2H 4X2VA 2WUBA 2TBSA 2LPRA 3MNBA 4I32A 3K65B 1BHXF 2K0QA 2XNIA 2VINA 1OP0A 1A3BH 4XBCA 3DD2H 1TGSZ 2VGCC 2Y5GA 1Z6EA 1KTTB 3SUFA 1K22H 5F03A 1MTUA 1W7XH 3TGKE 1DITH 1MKXK 1O32A 4INLA 3PMJA 1GVLA 3AAVA 1UMAH 2ZU1A 1ZTLA 2BD3A 1QL7A 1UTLM 1O3IA 2B0FA 2A45B 1W0JD 1MH0A 2ZDVH 1UW7A 4Y71A 1HUTH 2XCFA 2GDEH 2JH0D 5GPIB 1W8BH 2ILNA 1KYNA 3KEEA 4CBNA 2W6ID 2GV6A 3LJOA 5AFYH 1EZSC 4X8VH 1GWAA 1GBJA 1NRPH 3A80A 3ZVCA 1AMHA 5CMXH 5DG6A 6ESTA 1LO6A 1D3PB 1W14U 2ZU3A 3RC6A 2I6SA 1O2XA 5DGJA 2ZI2H 1S81A 2PKAA 2J95A 2HALA 4A92A 1E35B 3E0NB 3MYWA 4HTCH 2J94A 1OX1A 2ZHFH 2GCTC 1E0FD 3Q77A 1V2WT 3EE7A 3A8AA 2ODPA 4FOUC 1NRRH 1BQYA 3RXIA 2FLBH 4ABEA 1ANDA 2EQNA 3P8OA 3SORA 1YPLH 1CHOF 3MU0A 1NTPA 1PYTC 3OX7U 3BEIB 3SI3H 2BXUH 4K8BA 4TY7A 1TAWA 3FP7E 4B6FA 1QCPA 2EEKA 1SMFE 2XC0A 1AN1E 1IQNA 3DFJA 1GI0A 3FZZA 4GCHF 4ISLA 3GOVB 2BY6X 5CHAB 2XBYA 2FPZA 4KTSA 1ETTH 1ANEA 1EPTC 3T26A 4ABGA 2VWOA 1V2UT 2L6OA 1GBTA 4JZ1A 1DSTA 1DOJA 2R3YA 1UHBB 4MVNA 2FEQH 1SHYA 3CP7A 3ATWA 4BAMB 1GL0E 4E05H 1NO9H 2UUFB 2Z9IA 1TOCB 1O3KA 2ZDKA 1VITG 1Y8TA 1QJ1B 4NIYA 5FPSA 3V13A 2HPQH 1MZAA 5C1YA 1VZQH 4AFUA 1C9TA 1P2NA 4ZCNA 1O2PA 4LZ1H 1PPZA 1EUFA 4Y7BA 2OUAA 1W11U 1EOLA 2JETC 3URCA 5TJXA 1DWCH 1C1SA 1MKXH 1HCGA 3M35A 2FXRA 1OXGA 3MH7A 1W12U 4JZDH 1THRH 4ZKRU 5EXLA 3A85A 1P9SA 3URDA 1NFUA 1YPKH 2IJOB 4MPVA 3RMLH 5FHTA 2PGBB 3UR6A 1MTNC 3M5LA 4NA9H 1BMMH 1XX9A 2A32A 2VBCA 1E79D 3LC3A 3ZZAA 2ZU2A 1UTPA 3UY9A 2Q6GA 4JK6A 1O38A 1HJAC 1J17T 1G3DA 1YP9A 1XM1A 2M2AA 2Z6BD 1ZGVA 2J97A 1FUJA 2AH4X 4UDWH 2C3SA 2WYGA 3BTFE 2BY9X 2ASUB 4ZXXH 3WW7A 3PYHA 4MNYA 1JMOH 1FN8A 1O5AB 1YM0A 3A7TA 1C2LA 1E38B 1JRTA 2VIPA 3VGCB 1FIWA 1TWXB 2XRCA 1ZTJA 1C1MA 1UVPA 3NKKA 1NC6A 4ISNA 1Y3UA 5DP4A 2EI6A 1IAUA 1BDAA 3RDZA 4HGCA 4AFZA 5C67A 3FKSD 1H8IH 3GY4A 3O8DA 2FI5E 4AYYB 1EJAA 1O2UA 4HZHA 3BEUA 4OS1A 4ACAA 1O5BB 1BJUA 2Y5HA 1WOFA 3I78A 1SR5C 3ZVFA 3QN7A 4A5TS 1CA8B 3RXJA 2ZNKH 5T6FA 4J1YA 3F2HA 3RXBA 1K1JA 3VFEA 3F0PA 2ZQ2A 3QWCH 1HAVA 3SI4H 1F0RA 3A88A 1EB2A 3RLWH 2NU2E 1JRSA 1OPHB 2NU1E 1WUNH 3WWBA 2F9NA 3BIUH 2YNBA 2V3HH 3Q3KA 3K2UA 1C5NH 2OC0A 1BBRK 1K28D 1RJXB 1SFIA 3F9HA 4HG6A 2PLXA 4P00A 1TMTH 1QURH 1FQ3A 2AGGX 1FY1A 1V2TT 1GJCB 2CJIA 2UUKB 3SZEA 1TX7A 1BHXB 1O39A 1GI3A 3SZNA 5CDFE 1S0RA 2A2QH 1H9IE 2FOBA 4Y8YA 2PGQB 2R0KA 2IOTA 1FN6A 1CT0E 4NSYA 4CRCA 2GZ7A 3FVFB 1W13U 1ZHRA 2KCAA 3ELAH 4AC9A 1ZHPA 4B1TA 2W5EA 1C2GA 1QRWA 3P8NA 3BSQA 1HAXB 4Q63A 3VB5A 5DPAA 1NRQH 3MFJA 4IGDA 4YLQH 3KQ5A 2G52A 2C8XB 2ZF0H 2SGQE 4YT7H 5FXLA 1D3DB 2GDDA 1A5GH 4MPWA 3RXUA 4ASHA 1D3QB 2Y7ZA 1BJVA 4IMZA 4DW2U 5GDSH 1ZRBA 4XSKU 2GGVB 2FP7B 3HKIB 4WJG2 2YMSB 1K1PA 2Z9GA 2XWAA 5E0JA 2PKAB 5AFZH 3LGIA 5TCCA 5DP3A 5A2MH 1GVKB 2CHAC 1C5ZB 1Y3YA 1O2KA 2OLGA 5EGMA 1PPGE 4AG2A 2AMQA 1NFWA 4FUEA 3SU4A 2QYIA 2A31A 5EIYA 1C1RA 3VPKA 4ABJA 1GMCF 5FX6A 1O2RA 4CRGA 2HNTE 2Z3CA 1QJ6B 3M3SA 1C5MD 4TT3D 1G3BA 2OK5A 1YGCH 3SQEE 3EAJA 4JMYA 1BTZA 2Y80A 1UK3A 4K60A 1P0SH 4ESTE 1TLDA 4UFGH 6CHAB 3P70B 1GVZA 4B71A 3T29A 1P2OA 1S85A 1F5RA 2A1DB 5DN6D 5HYOA 3A8DA 2VWMA 4Z6AH 4FVBA 1EAUA 1H8ED 1EZQA 1G9IE 3FP6E 2ZHQH 4CHAC 3P6ZB 1L1JA 3ZZ7A 2IPHA 4ZHAA 5L2YH 8GCHG 4D76A 2G5VA 1YPHE 1C1VH 1Z6JH 1FY5A 1CGHA 2CGAA 3VB4A 3U1IB 1KXDA 2AHME 1GBEA 1VCQA 2BDAA 3UPEA 2FWWA 1GHAG 1C1TA 3BIVH 3ZVDA 4FUJA 1CA0C 4U32A 3W1EA 1A4WH 2ZDMA 1ZTKA 1P2IA 5EOKA 1A61H 2LNCA 2O8LA 1XUHA 1Y5AT 1HRTH 3UOPA 4ABAA 1QTFA 1GI5A 3W94A 4YT6H 5C5NA 2D8WA 1WXRA 4ABBA 3DA9B 2FOMB 4Q7YA 3A7WA 4FUIA 1D9IA 2SGFE 2PSXA 2QY0B 4I8HA 5B6LA 3PMAB 1C1OA 1T8NA 3C1KA 1HB0B 2NU3E 3DSGA 1U6QA 1TRYA 3D62A 4KKDA 3SJ8A 3A86A 3EYDA 1C2IA 2VIVA 3FP8E 3SV6A 2H5CA 1ELFA 2H9TH 1FY8E 2A7JA 2ZFFH 3KNXA 4ZROA 4E7RG 2R3UA 2SNWA 1UTQA 4DOQA 4AOQA 4CHAB 2DE8A 3RMMH 3AVZA 4H42U 2ZG0H 3S7HB 1PPCE 1XXFA 1J16A 2V6NA 3LJJA 1GMHG 4JYTA 3EDXB 1LHFH 3F3BA 3OY6U 2C93B 1UTJA 4Y79A 1FONA 4X8SH 1H8HD 2GTBA 2ZFSA 1EQ9A 2QCYA 1JOUB 3P95A 3KYGA 5HIYA 1K1MA 1AWHB 2C8YB 4MG3A 4HI3A 4UFDH 1UK4A 9LPRA 3BTWE 3O8CA 1GHZA 3BTQE 3UUZA 1TQ0B 1O5DH 5C20A 1UHBA 2GCHF 2JKHA 4WWYA 1SGCA 5ETXA 1E36B 4AN7A 1OYTH 3FZDA 4NGAH 2IPQX 3AW0A 4OS2A 1WDIA 1DXPA 1Q2WA 1QIXB 1O33A 4XD7D 4YLUA 4TPYA 5LGOA 1P09A 5BPEA 2PP6A 2A7HA 1OP8A 3OSYA 4XOJA 1YKTA 1EPTA 4HFPB 1JIRA 1UK2A 3NUMA 1QQUA 4NWLA 1GJ4H 2W7SA 2P94A 1V2KT 1A46H 2ZDLA 3E3TA 4DGJA 5LPEA 1SGPE 1BIOA 2D2DA 3QGJA 5GXPA 4X6PA 1AVXA 3SYJA 1AZZA 1CVWH 1ESTA 3AK5A 1A0HB 5L30H 1NU9A 4MPUA 1O2GH 1BBRE 1BRBE 1BTXA 2FM2A 3BF6H 4ABIA 5JBCS 3QK1A 5EPNA 1NS3A 4F4OC 2KCPA 4M9FA 1ESBA 4OS4A 1C5LH 2KM0A 2SNVA 2GZ9A 4CREA 1AKSA 2BZ6H 1CQQA 1NT1A 4KP0A 2BVSH 4CH2B 1FI8A 1DANH 1HXFH 3TITA 1SGEE 1XUKA 1BRCE 5C94A 1GG6B 2PR3A 1MCVA 2QAAA 3UNQA 3ZVAA 2RA3A 5EW2H 3GY3A 1FAXA 1VCWA 4GHTA 3RXQA 3SU1A 3TJNA 1GPZA 1QBOA 1ABIH 3OEED 1P05A 1BMAA 1CHGA 1THSH 2PTCE 3LGUA 1MMJN 1DWEH 1O2OA 3GDUA 4B2AA 3MH4A 4F55A 4I8JA 5KEDA 3LKWA 2HPPH 4FUHA 3LGYA 1QB1A 1AZ8A 3M5NA 3OY5U 3BTKE 4AG1A 1FAKH 4WXVA 1S6HA 1D3TB 1C5YB 1VGCB 2W3IA 5E0GA 4CRBA 1H9LB 1J9CH 2O8UA 1AFQB 3PV2A 4YZUA 1BTHH 1SSXA 1A5IA 1WTGH 1GJAB 1SQOA 5DSFA 1Q3XA 1SG8B 4BTTB 4I31A 1HYLA 1ELCA 2BQWB 4KTCA 1C1WH 5EW1H 2TGPZ 5T6GA 2ZCKP 3RMOH 1YPEH 4DIIH 5EQRA 1IQFA 1Y5BT 1LKBA 2BDBA 4WXIA 3ZZ8A 3TU7H 4X6OA 5E8EH 1GHAF 3OEHD 3ZVEA 5C0UA 1ZSJA 2UWPA 1O2TA 1B5GH 4BAQB 3SO3A 2ZQ1A 2ZO3H 1P2JA 1QR3E 2JJ2D 1SGTA 1O2JA 1AIXH 3FOAA 3TVJB 1HAPH 1A0JA 3QX5H 2BX4A 3ATIA 1GHBF 1LVMA 4E06H 5IK2D 4ZHLU 1SFQB 3ITIA 1C5TA 2H5DA 1S6FA 1TPAE 1KDQA 4RN6A 4UONA 3M7TA 1SQRA 1ARBA 3O8RA 2RCEA 3PLPA 3FAOA 2UWOA 2BY5X 4VGCC 1OWJA 1GCDA 3P8FA 2HNTC 3M36A 4OS7A 1ZR0A 4A7IB 3SJOA 3SU0A 1O2WA 1JWTA 1HLTH 1TRMA 1AUJA 1ORFA 1ETRH 2BDCA 2PW8H 1BTWA 1OKXA 1UVTH 1ZSKA 1EOJA 3LDXH 1MTNB 2SGPE 1LDTT 4FXGH 1YY3A 4E7NA 3PRDA 2A4OA 1S5SA 1C2KA 4K1TA 1E34B 1HIAB 1ELBA 3S9CA 1MU6B 2BXTH 2ZWLH 1L4ZA 2FO9A 4OGYA 1FMGA 1UTOA 3ODDA 1B0EA 1GBAA 3U9AH 2QF5A 4I8KA 1V2OT 4LK4A 5DO4H 2O8WA 3V12A 4UFFH 4YO9A 2O8MA 2P8OC 3BG8A 3F0OA 4INHA 1G36A 2Z94A 1S6LA 1GBKA 5EJ1A 1TGTA 2Q1JA 1HJ8A 3TH4H 2CF9H 3B8JA 1W0ZU 4JYVH 4KTUA 1V2QT 4FU9A 5FAHA 3SU3A 1BMLA 2FOCA 1C2HA 4B2CA 1TONA 3ENSB 3LC5A 3STJA 5A09A 6CHAC 2C90B 4GVUA 6LPRA 1O3EA 1TALA 2V3OH 1SGIB 4JK5A 4X1PU 1ZMLA 2FESH 4X0WU 1GHXH 1GHYH 1ZZZA 2FS8A 2AIQA 4I33A 1VR1H 4UE7H 2ZZUH 1COWD 2BLWA 4TSFD 1C1QA 1XUJA 5GNDA 1GBDA 1LVOA 1OWEA 3MH6A 5FX5A 1P3CA 1T8LA 2BLVA 1IQJA 4AFSA 1P03A 2WZQA 2Z7FE 1ELEE 1DICA 1F0UA 2BB4A 1NZQH 4BTUB 1T31A 3HGNA 1TX8A 3FO8D 1BRUP 3K6ZA 5DP6A 1V2LT 4ABDA 2BOHB 1HAOH 4VGCB 1EB1H 1DWDH 3WY8A 7KMEH 2OTVA 2BYAX 1EJMA 3H5CB 4WY3A 2GT8A 1KXEA 3TK5A 3LH1A 2KZ4A 3TGIE 1O3BA 3TJUA 4ASUD 1QGFA 2TGTA 4ZUHA 1V6DA 5B6OA 1V2JT 1XVOA 2ESTE 4A6LA 5FCKA 2XBXA 2CV3A 2UUYA 1IOEA 1TQ7B 1CE5A 3GCOA 2VVVA 1ELTA 1OSSA 4Q7XA 5JDUB 1EPTB 1JBUH 3RXPA 2A7CA 1DLEA 3VEQB 2EY4C 2OXSA 1K1LA 2QF0A 1AY6H 1PPEE 3GY7A 2PUQH 2A5IA 1Z8GA 1G3CA 2BQ6B 3M3TA 1ACBE 1MTWA 2PTNA 3GDVA 3E91A 1RGQA 1LQEA 3GY5A 1DUAA 2HLCA 4ACBA 1HV7A 1O35A 1F5KU 3SBKA 3GCTF 1BTYA 3HPTB 1P2KA 1Y59T 1GI9B 3RXRA 2FYRA 1TE0A 5C17A 1MBMA 2BVRH 2XXLA 1EZUC 2Y81A 1QB9A 1D4PB 1QBVH 5SGAE 1P02A 4Q80A 1OP2A 4R8TB 4D9QA 1DLKB 1DX5M 4B76A 2VIDA 1YBWA 2XBVA 3U8OH 1RFNA 5JPMH 4H6TA 1RD3B 2BLQA 5JBBS 3EA8A 3UQVA 1DVAH 3OYPA 4MTBA 4I7YH 1TFXA 2FOAA 1O2LA 3M37A 1WQSA 1CGIE 3RM2H 2KAIB 1SQAA 4GCHG 4DVAU 1PFXC 5F6MA 2XNDD 2FOHA 1LTOA 2HWLB 3LONA 1OS8A 3JZ1B 3V3MA 4THNH 1PPFE 7ESTE 3MNCA 1O5EH 1TBQH 4GHQA 4AGKA 1TPOA 1TOMH 1Z71A 3B9FH 3LGVA 3PM3A 3MNSA 2ZTXA 3PWCA 1EAXA 2VH0A 1GBFA 2ZGBH 2CHAB 1XUGA 2AMDA 5DK1A 3A7XA 1E1QD 4XDEA 4YM9A 4YESB 3N99A 1KIGH 2UUJB 4JCNA 2BD5A 2J4IA 3SQHE 3RMNH 5HM9A 3S0NA 2WPIS 2WYJA 9ESTA 1C2EA 1KLTA 2L74A 3ATKA 3RM0H 2WV9A 1AFQC 3LIWA 1TPSA 1J14A 3RXLA 4Y10E 4AZ2B 3EGKH 1EZXC 1TRNA 5EODA 1TNJA 2BQ7B 4A1TA 3SOSA 3P8GA 3F2FA 4NIWA 1UVUH 1E37B 4RSPA 4B2BA 2XYAA 3ODFA 1O36A 1KY9A 1KXFA 1ELVA 1L1GA 4ZH8A 3ATLA 1AQ7A 2H9EH 5A0CA 1ID5H 4NIXA 3KYFA 4MQAA 5FPTA 1GMDF 3PROA 2A2XH 2TPIZ 2WPHS 2Y5FA 3MO9A 3VXEH 5C1XA 3QTOH 4JYUH 2BM2A 2QXGA 2BY7X 1SGFA 3E90B 5PTPA 1QRZA 1P11E 4RT1A 5GJ4B 2AMPA 3C27B 1MABB 2VWLA 4KGAA 2VNTA 1FZZA 3MMGA 3TLOA 1XKAC 4JZEH 1AB9B 3F9EA 2FOGA 2R0LA 2KR7A 1K21H 3A89A 1O5CB 1A5HA 1YLNA 2ZGHA 1L0ZA 2ZPRA 3IITA 4ZKNU 2FODA 1SVPA 7GCHF 2OC8A 2HVXA 4B73A 3TJVA 2Z3EA 1C2FA 1UTMA 3QZQA 1LPKB 4UD9H 1YYY1 1NFYA 5GCHG 2BY8X 3PLKA 2WPJS 3BV9B 4BANB 1EX3A 2YMSD 1MUEB 4F49A 4NSVA 2R2WU 5DKMA 1P57B 1QNJA 3DSPA 4NWKA 3PTBA 1QBNA 2ZFQH 1O3GA 1WV7H 1IQLA 1ZRKA 1ANBA 1TGBA 1QA7A 4IC6A 5TCAA 1IHSH 2QA9E 1BMFD 2QXIA 1ZLRA 4OGXA 1CT2E 5A0AE 1YC0A 1MKWH 1WTHD 5T3HA 1C5RA 2AS9A 1IQHA 4U2WA 2DUCA 1FY3A 3QZRA 1MTSA 3KQCA 1DT2A 1AGJA 2F9VA 2BDIA 4X8UH 1Y5UT 3DT0H 5AVDA 5K7RA 5J4QA 1JXPA 2J98B 4QT8C 1GI8B 2FTMA 1AHTH 1SQTA 1K9OE 2KCYA 4Q2KA 1GI2A 3RC4A 3ZVGA 2QXJA 1O2YA 1HXEH 4Y0ZE 2C4FH 3MO6A 3RU4D 1WAYB 4J2YB 1N8OB 1J8AA 2ZEBA 1ZGIA 4K8YA 3TPIZ 1S83A 1L2EA 3VGCC 1HNEE 1QJ7B 3TIUA 2G4TA 3NRLA 3UAIC 1GG6C 1A2CH 2F4LA 1C5UA 2F43B 1GDNA 1P9UA 1SGDE 1MTVA 4XRNA 4YOIA 3RXHA 4DY7B 4K69A 1NRNH 2BLOA 2BD9A 2ZPSA 3R0FA 1DM4B 4NZLA 2PWXA 1AO5A 4FUGA 2P3TB 5JB8S 3CENA 2GKVE 1GHBG 4XBDA 1H9HE 5EU8A 5C1UA 2QIQA 2P95A 3BG4C 1RTLA 1G37A 1GDQA 4XE4A 2ZC9H 1NRSH 2G51A 4WMFA 3T2NA 1IQIA 1C4U2 3L6PA 2F9BH 5C0TA 1C5VA 2THFB 1YPGH 2WSSD 4B6EA 3LPRA 1LVYA 1L1NA 3ESTA 1NY22 3MNXA 1D6RA 2ZDAH 4K2YA 3RXSA 2G55A 3SNCA 1CA0B 3PMBB 2PKSB 3EA7A 3DCLA 1HJAB 2XC4A 1V2MT 1PPBH 3KIDU 4I8GA 4GAWA 4UEHH 3UIRA 1BA8B 1BT7A 1Y3XA 1GMCG 1O2VA 3FN8A 5KGOA 5C5OA 1TNHA 2TGAA 3A7ZA 4CR9A 2VU8E 3BTDE 4JZIA 3TK9A 5HKKD 3U1JB 4ZKOU 4DCDA 2ZGJA 1E1RD 1K0HA 1F5LA 3RXEA 2SGDE 3HGPA 1MKWK 3UB0A 1ZPCA 2BD7A 5AHGH 3W95A 1VKYA 4O3UA 4CR5A 2Y7XA 1GBMA 2SFAA 4YOJA 3D23A 1ZPBA 4Y76A 4LZ4B 1SPJA 1YF4A 4FVDA 1W0YH 3HATH 3F9FA 2P93A 2BOKA 3LH3A 2J38A 1DWBH 5E2OA 2HOBA 1ZHMA 2YMSC 1T8MA 3UWJH 1T32A 1G32B 2XW9A 3TH3H 2OP9A 1IQMA 4R0IA 1HAIH 2TGDA 4SGAE 5EXNA 5CE1A 3NPSA 4WF8A 2OQUA 3E1XB 1DFPA 2BDHA 2KX4A 3MTYA 3MH5A 4LOYH 2NWNA 1KMHB 2OCVB 1O3CA 2AGEX 3A7VA 3QUMP 1YPHC 4CBOA 5H4IB 2BD8A 1LMWB 4Z0KA 2C8WB 5GIBA 4I8LA 2ODQA 1KLJH 4YTAA 5FPYA 4OS6A 3VG8A 1OWIA 1UJ1A 3BTEE 1TA2A 1V2RT 1O3PB 2ULLA 3BTME 1O2NA 2GT7A 3TH2H 1SLWB 1NBME 1QQ4A 4AYVB 1DS2E 3V0XA 1ZOMA 1QA0A 5F53A 2ZPQA 3PB1E 3RP2A 3VXFH 1LHDH 3GCHC 4M7GA 1AE8H 1O3DA 1Z8JB 2FLRH 1ZSLA 3U69H 2H9HA 1CO7E 1VITF 3RXVA 4JZFH 3SNBA 2VVCA 3TK6A 2ZECA 2FYQA 1HAVB 3RXDA 1GGDC 6GCHF 1TX6A 4D7GA 1GMHF 1XUFA 5CHBA 2W26A 1CBWC 3ZZ6A 3KCGH 5EJLA 4ZAEA 1P8VC 2ZA5A 3RXTA 1CT4E 1O2SA 2Y6TA 2G4UA 1A7SA 3RU4T 1C5WB 2LELA 1TB6H 1SGFG 1SGYE 1L4DA 1M9UA 4SGBE 2VB0A 3LOXA 2VGCB 8LPRA 5JBTA 1BTPA 2Z9LA 1SLUB 3DSOA 3M7UA 5A8YA 3NZIA 2K1QA 5AF9H 2XCNA 1C5XB 4WH6A 5T1VA 3MU8A 3KGPA 3MOCA 2VIQA 2PSYA 3STIA 1HFDA 3K6YA 4X2YA 4DJZB 4PROA 1GI7B 1XUIA 2F9UA 4BXWA 3KQBA 1CHOG 3GICB 1Z1IA 3ATMA 1C5QA 3OAAD 2ANWA 1EKBB 5F8XA 1MAYA 1DXWA 3GCTG 5E0HA 3VB3A 1OYQA 1RS0A 1P2QA 2B9LA 2GP9B 2EC9H 1BTUA 2F9OA 1C2DA 5L2ZH 3GISB 3UWIA 4D7FA 1O2MA 2P8OB 3OE7D 1SB1H 5DP5A 4BOHA 3ZZCA 3BTHE 4NG9H 1P06A 2XOKD 1P01A 4I86A 3DHKH 1AB9C 4FUFA 3T27A 3MI4A 4H4FA 1G3EA 2W7UA 1LQDB 1C1NA 2AFQB 3KQDA 1V2NT 1GBBA 1XKBC 1FDPA 3SUEA 1BITA 5G4BA 1FV9A 2JETB 4BAOB 2Z9KA 5DP9A 3A7YA 2DE9A 2CF8H 3PWBA 4MNWA 1T8OA 3NXPA 1S0QA 1KXBA 1THPB 4Y7AA 2PKSC 2P16A 4X8TH 4AORA 4CRAA 8ESTE 2G5NA 5EXMA 2AEIH 1LHEH 1DY9A 5DP7A 5ABWA 5F8TA 1OHHD 4MDSA 1SI5H 3T62A 1YCPH 2BMGB 1AWFH 4FUCA 3UOUA 2G81E 3BEFB 1FPHH 1PQ8A 2Z3DA 3SNAA 4BAKB 3A84A 1T4VH 2BDYA 3HKJB 3T28A 2QGRA 2FZZA 4Y0YE 3TNSA 1ZJDA 2VIOA 1DDJA 3QO6A 4F48B 2HLDD 4Z1MD 3NCLA 3G01A 4UFEH 5CHAC 1ANCA 5C2ZA 2F83A 3F9GA 5LPFA 3CS7A 5JYIA 1VJ9U 1QL9A 2KCOA 1LKAA 1XVMA 3LU9B 3BTGE 2GMTB 1NBMD 4CH8B 4BTIB 2WV4A 1MZDA 3SU5A 1TABE 3M5MA 3Q00A 1TNGA 1QHRB 3CS0A 5A0BA 3RC5A 1GJ7B 2RG3A 4ISIH 4OS5A 2ANMH 2WPMS 5GWZA 2V7QD 3AASA 1GBIA 2O8TA 4O97A 1GI4A 1BMNH 3RLYH 2Q6FA 1TPPA 1EAWA 1DPOA 2XBWA 3NK8A 3SJKA 3IG6B 4XFQA 3BN9A 3D49H 4X1SU 2QF3A 1KDQB 2A4GA 5HMAA 3E0PB 4Q7ZA 1C5OH 3EE0B 1H8DH 5J4SA 1AD8H 2RDEA 2BHGA 4KELA 4FUBA 3KN2A 1LHGH 1P2MA 1RIWC 2GMTC 3GS9A 1RRKA 4OM9A 2F3CE 4NFFA 1LCYA 1X7AC 1PQ7A 2WPLS 1GI6A 1TGNA 1ELAA 2C8ZB 4IW4E 4X2WA 2GX4A 1BOQA 1MAXA 1UCYH 1DSUA 2W3KA 1FX0B 4NIVA 3ZZ5A 2OC1A 2XTTB 3E6PH 2J98A 1Z1JA 1TMBH 4MNVA 3PO1C 4RI0A 1G2LA 3A8CA 1TNIA 4BAHB 2ZFTA 4WVPE 3RXKA 1WYKA 3GY6A 2ZP0H 1FPCH 2QC2A 3Q3YA 1GCTB 4P02A 4DT7B 2NU0E 2H6MA 2JIZD 3K9XB 2J92A 3N7OA 1F92A 1TNKA 3OTJE 3SHCH 1AI8H 2GCHG 3UFAA 3SNEA 3GY8A 1NESE 2B7DH 4X6MA 3UNSA 3ZZ9A 2Z9JA 2FS9A 2QXHA 3U8RH 3ZYEA 3H09A 2PHBA 3N7EA 6GCHG 1BCUH 2IJD1 1KSNA 3PV4A 1WSSH 3MQKC 4ABFA 4AB9A 3ZZBA 1K1IA 1LHCH 3ZVBA 1PYTD 1PQAA 1XMNB 1ARCA 2F9PA 4FUDA 8GCHF 4IS5A 4IC5A 1FLEE 3CNRA 1ESAA 1K1OA 2ANKH 1AUTC 2EA3A 3SUDA 1TBRH 2QN5T 1V2VT
chains in the Genus database with same CATH topology
2O9QA 1GBLA 1O3OA 2B5TB 2V0BA 1EXFA 1VJAU 1Y3WA 2ZU5A 2A4RA 2UWLA 2FI3E 1NPMA 2Q6DA 2B8OH 2I6QA 2FOEA 3SU2A 2ZTZA 1IQKA 3KF2A 4ZMAH 1SOZA 2STAE 3ZZ3A 2VJ1A 1HAYB 5T6DA 3SV9A 2NU4E 1PJPA 5EPYA 2OBOA 1Q31A 2BVXH 3Q76A 1AVGH 2ZGCA 2ZCLP 3PMHB 4NFEA 3UR9A 1ZJKA 1BZXE 1HAGE 5K0HA 1GJBB 1NU7B 2XC5A 3MU4A 1MQ5A 1ELGA 3A82A 4IN1A 4ISHH 3A8BA 4K1EA 1GHVH 2BTCE 1NROH 3T5FH 1N6XA 4AB8A 1C4Y2 2ZIQH 3HK3B 4ZKSU 2ZU4A 1UCYE 3RXGA 3QGNB 4MPXA 4WMDA 3UQOA 4IN2A 1FNIA 4LXBH 5L6NH 1C2JA 1UCYK 2ZHDA 5FBEA 1ABJH 1HJ9A 1TBZH 3RXOA 5EG4A 2ZGXH 5ESTE 5JB9S 4A1VA 1O37A 4ISOA 3TGJE 1LPZB 2IN2A 1K2I1 1T7CA 3O8BA 2ANYA 3FANA 1WCZA 1GBCA 4TWYA 5A8XA 1AU8A 1Y3VA 2J2UA 3AAUA 3SUGA 1HDTH 3LGWA 1GJ8B 1TYNA 3F6UH 3BG4B 4B75A 1YLCA 2KAIA 1O0DH 3SN8A 1F7ZA 3H7TA 2P3FH 2YOLA 3RXMA 3T25A 3MU1A 3EA9A 1TMUH 5LPRA 2OQ5A 2A5AA 1TIOA 1HIAA 1GJDB 1B0FA 3DUXH 3MU5A 1CBWB 2ZKSA 5C3NA 3RXAA 2AGIX 1O3MA 3BTTE 2VIWA 1S82A 1RIWB 1MU8B 2CN0H 3SGQE 1QFKH 3GY2A 1BB0B 2ODYB 3IWMA 2R9PA 3MHWU 2P59A 1T4UH 3VB6A 4O03A 3F68H 3S7KB 1BRAA 3DFLA 1EJNA 3A87A 3A81A 3VB7A 2STBE 1MQ6A 3L33A 1DY8A 1IQGA 1O31A 4X6NA 1JIMA 1YPJH 3TNTA 3QTVH 1HBTH 4TPIZ 3M7QA 1YPMH 1HPGA 1YCPK 1O3HA 3RXFA 2OC7A 1GJ9B 1V2PT 1GDUA 2ZCHP 1DUEA 2WUCA 4NA7A 2EI8A 2FTLE 1RTFB 2TIOA 1QRXA 4MLFB 1SGNE 5DP8A 4X1RU 1GMDG 1SGRE 2TRMA 1B7XB 2G8TA 4TYDA 2YNAA 5BRRE 1EATA 1GBHA 1P04A 1UTNA 1ELDE 5E2PA 1O3AA 5IYTA 1SC8U 5EQSA 3SGAE 2BZAA 4O9VA 3V7TA 1HAHH 2P3UB 4U01A 1F0TA 3MO3A 4GSOA 1O2IA 5ESBA 1MD7A 1SOTA 5A8ZA 4D8NA 2SGAA 4YOGA 1VITH 1XXDA 3Q3XA 2V35A 1EASA 5HM2A 3RXCA 2D26C 2OINA 3QLPH 4CRFA 1MBQA 1UVOA 7GCHG 1W10U 1F2SE 5F8ZA 1KXAA 1LPGB 2VVUA 2WINI 1AE5A 1TGCA 1EP6A 5GCHF 4MNXA 4IMQA 3M5OA 4AGJA 2CXVA 3OU0A 3LGTA 1Z8RA 1KLIH 1WBGB 1WU1A 4NZQA 4DG4A 1A0LA 1GJ5H 2FMJA 1H4WA 4ABHA 1AKSB 2GCTB 2H1UA 3ZYDA 1H1BA 4H6SB 2OD3B 2ALVA 1NFXA 2EI7A 3U8TH 1GJ6A 1P10A 5FBIA 8KME2 1N6YA 1O3NA 1ZPZA 1ZMNA 2SGEE 1RXPA 1W3CA 4TY6A 2CMYA 1CU1A 3UNRA 1CGJE 2GVFA 1NM6A 1IHTH 1Z7KA 3GCHB 5I25A 4D9RA 2OBQA 2FI4E 1PPHE 1O2ZA 1S84A 1O3JA 2RA0A 2JH5D 1LVBA 1OWHA 4FU7A 1O2HA 3ZZDA 1OOKB 2FIRH 4U30A 1SL3A 3SV7A 1W7GH 1ZYOA 1O30A 3JZ2B 1ETSH 2D1JA 1VCPA 2ZFRH 4GLYA 4AFQA 1DE7H 2G00A 2QV1A 4FU8A 2ZDNA 4Y11E 3GYLB 1KTSB 2H2ZA 2A5KA 2J9NA 2A0QB 4Y8ZA 1RTKA 1O5GH 3PO1B 2VWNA 1FJSA 1A3EH 2XWBI 1CSOE 1GL1A 1V2ST 1WQVH 5LH8A 1C2MA 5JBAS 4BXSA 3S9AA 4BNRA 4WMEA 2ALPA 2GZ8A 2HNTF 3F1SB 3ZZ4A 4AX9H 1YLDA 2AERH 1VGCC 2BDGA 7LPRA 3KL6A 3I29A 2PV9B 1OWDA 2GD4B 4K5ZA 3SJ9A 2BX3A 3R3GB 1N8OC 1AVWA 2ZHEH 5HXFA 1C9PA 1MD8A 3EQ0H 3U98H 3TJOA 1QB6A 3SNDA 3A83A 2J34A 1N1LA 4X2XA 3UREA 2ZTYA 4B74A 3SHAH 4Y8XA 3SV8A 4NCYA 1P3EA 4ZXYH 3HK6B 2ZFPH 1V3XA 3P17H 1IQEA 1MCTA 3E8LA 3SJIA 4CRDA 5FCRA 1FXYA 1Z8IB 3P92A 1UVSH 5HGGA 3M3VA 3PTNA 1UTKA 3KHVA 2JH6D 1W2KH 2ZHWH 4IBLH 4Y6DA 5IDKA 1C1PA 3I77A 1K1NA 1O3FA 2FX4A 4RKOB 1P12E 1G30B 1O3LA 4ZHMU 1SHHB 2VH6A 3GDSA 1SBWA 4DURA 1O5FH 2HGTH 3L3TA 3RUOA 2FDAA 1SLXB 1F0SA 2A4QA 2BD4A 1EAIA 3FFGA 2AIPA 3PLBA 2WV5A 2WPKS 3QDZB 1INCA 1UO6A 3M61U 4GUXA 4RKJB 1G2MA 1KXCA 1BUIA 3H7OA 1QL8A 2PFEA 5DJ7A 1C1UH 1C5SA 1GHWH 1GCTC 4X1QU 1J15A 4NA8A 3SGBE 2FX6A 4O3TA 4GPGA 1PQ5A 4INKA 1NN6A 2RDLA 4K3JA 1BBRH 1FY4A 2R2MB 2BD2A 1C4V2 3S69A 4K1SA 1TNLA 2F91A 1QY6A 5I46H 3KQEA 1YCPM 4XBBA 3SU6A 1C5PA 1GI1A 4A1XA 3RU4E 3MWIU 1AFEH 1EP5A 2M5TA 1GGDB 3D65E 2Y82A 2HRVA 1TA6A 3ZV9A 1O2QA 1ZMJA 1D6WA 1HGTH 5EQQA 3GCNA 3UTUH 3ZV8A 3B23B 3NWUA 1FIZA 2GV7A 2PUXB 3S9BA 1HAZB 4TWWA 4X1NU 1SLVB 4DIHH 3GYMA 2AYWA 3AW1A 3E16B 3LT3A 1SGQE 1A1RA 3SW2B 2FOFA 1O34A 4WH8A 1OWKA 3SV2H 4X2VA 2WUBA 2TBSA 2LPRA 3MNBA 4I32A 3K65B 1BHXF 2XNIA 2VINA 1OP0A 1A3BH 4XBCA 3DD2H 1TGSZ 2VGCC 2Y5GA 1Z6EA 1KTTB 3SUFA 1K22H 5F03A 1MTUA 1W7XH 3TGKE 1DITH 1MKXK 1O32A 4INLA 3PMJA 1GVLA 3AAVA 1UMAH 2ZU1A 1ZTLA 2BD3A 1QL7A 1UTLM 1O3IA 2B0FA 2A45B 1MH0A 2ZDVH 4Y71A 1HUTH 2XCFA 2GDEH 2JH0D 5GPIB 1W8BH 2ILNA 1KYNA 3KEEA 4CBNA 2GV6A 3LJOA 5AFYH 1EZSC 4X8VH 1GWAA 1GBJA 1NRPH 3A80A 3ZVCA 1AMHA 5CMXH 5DG6A 6ESTA 1LO6A 1D3PB 1W14U 2ZU3A 3RC6A 2I6SA 1O2XA 5DGJA 2ZI2H 1S81A 2PKAA 2J95A 2HALA 4A92A 1E35B 3E0NB 3MYWA 4HTCH 2J94A 1OX1A 2ZHFH 2GCTC 1E0FD 3Q77A 1V2WT 3A8AA 2ODPA 1NRRH 1BQYA 3RXIA 2FLBH 4ABEA 1ANDA 3P8OA 3SORA 1YPLH 1CHOF 3MU0A 1NTPA 1PYTC 3OX7U 3BEIB 3SI3H 2BXUH 4K8BA 4TY7A 1TAWA 3FP7E 1QCPA 2EEKA 1SMFE 2XC0A 1AN1E 1IQNA 3DFJA 1GI0A 3FZZA 4GCHF 4ISLA 3GOVB 2BY6X 5CHAB 2XBYA 2FPZA 4KTSA 1ETTH 1ANEA 1EPTC 3T26A 4ABGA 2VWOA 1V2UT 1GBTA 4JZ1A 1DSTA 1DOJA 2R3YA 1UHBB 4MVNA 2FEQH 1SHYA 3CP7A 3ATWA 4BAMB 1GL0E 4E05H 1NO9H 2UUFB 2Z9IA 1TOCB 1O3KA 2ZDKA 1VITG 1Y8TA 1QJ1B 4NIYA 5FPSA 3V13A 2HPQH 1MZAA 5C1YA 1VZQH 4AFUA 1C9TA 1P2NA 1O2PA 4LZ1H 1PPZA 1EUFA 4Y7BA 2OUAA 1W11U 1EOLA 2JETC 3URCA 5TJXA 1DWCH 1C1SA 1MKXH 1HCGA 3M35A 2FXRA 1OXGA 3MH7A 1W12U 4JZDH 1THRH 4ZKRU 5EXLA 3A85A 1P9SA 3URDA 1NFUA 1YPKH 2IJOB 4MPVA 3RMLH 5FHTA 2PGBB 3UR6A 1MTNC 3M5LA 4NA9H 1BMMH 1XX9A 2A32A 3LC3A 3ZZAA 2ZU2A 1UTPA 3UY9A 2Q6GA 4JK6A 1O38A 1HJAC 1J17T 1G3DA 1YP9A 1XM1A 2Z6BD 1ZGVA 1FUJA 2AH4X 4UDWH 2WYGA 2C3SA 3BTFE 2BY9X 2ASUB 4ZXXH 3PYHA 4MNYA 1JMOH 1FN8A 1O5AB 1YM0A 3A7TA 1C2LA 2VIPA 1E38B 1JRTA 3VGCB 1FIWA 1TWXB 2XRCA 1ZTJA 1C1MA 1UVPA 3NKKA 1NC6A 4ISNA 1Y3UA 5DP4A 2EI6A 1IAUA 1BDAA 3RDZA 4HGCA 4AFZA 5C67A 1H8IH 3GY4A 3O8DA 2FI5E 4AYYB 1EJAA 1O2UA 4HZHA 3BEUA 4OS1A 1O5BB 1BJUA 2Y5HA 1WOFA 3I78A 1SR5C 3ZVFA 3QN7A 4A5TS 1CA8B 3RXJA 2ZNKH 5T6FA 4J1YA 3RXBA 1K1JA 3VFEA 2ZQ2A 3QWCH 1HAVA 3SI4H 1F0RA 3A88A 1EB2A 3RLWH 2NU2E 1JRSA 1OPHB 2NU1E 1WUNH 2F9NA 3BIUH 2YNBA 2V3HH 3Q3KA 3K2UA 1C5NH 2OC0A 1BBRK 1K28D 1RJXB 1SFIA 3F9HA 2PLXA 1TMTH 1QURH 1FQ3A 2AGGX 1FY1A 1V2TT 1GJCB 2CJIA 2UUKB 1TX7A 1BHXB 1O39A 1GI3A 3SZNA 1S0RA 2A2QH 1H9IE 2FOBA 4Y8YA 2PGQB 2R0KA 2IOTA 1FN6A 1CT0E 4NSYA 4CRCA 2GZ7A 3FVFB 1W13U 1ZHRA 3ELAH 1ZHPA 4B1TA 2W5EA 1C2GA 1QRWA 3P8NA 3BSQA 1HAXB 3VB5A 5DPAA 1NRQH 3MFJA 4IGDA 4YLQH 2G52A 2C8XB 2ZF0H 2SGQE 4YT7H 5FXLA 1D3DB 2GDDA 1A5GH 4MPWA 3RXUA 4ASHA 1D3QB 2Y7ZA 1BJVA 4IMZA 4DW2U 5GDSH 1ZRBA 4XSKU 2GGVB 2FP7B 3HKIB 4WJG2 1K1PA 2Z9GA 2XWAA 5E0JA 2PKAB 5AFZH 3LGIA 5TCCA 5DP3A 5A2MH 1GVKB 2CHAC 1C5ZB 1Y3YA 1O2KA 2OLGA 5EGMA 1PPGE 4AG2A 2AMQA 1NFWA 4FUEA 3SU4A 2QYIA 2A31A 1C1RA 3VPKA 4ABJA 1GMCF 5FX6A 1O2RA 4CRGA 2HNTE 2Z3CA 1QJ6B 3M3SA 1C5MD 1G3BA 1YGCH 3SQEE 3EAJA 4JMYA 1BTZA 2Y80A 1UK3A 4K60A 1P0SH 4ESTE 1TLDA 4UFGH 6CHAB 3P70B 1GVZA 4B71A 3T29A 1P2OA 1S85A 1F5RA 2A1DB 5HYOA 3A8DA 2VWMA 4Z6AH 4FVBA 1EAUA 1EZQA 1G9IE 3FP6E 2ZHQH 4CHAC 3P6ZB 1L1JA 3ZZ7A 2IPHA 4ZHAA 5L2YH 8GCHG 4D76A 2G5VA 1YPHE 1C1VH 1Z6JH 1FY5A 1CGHA 2CGAA 3VB4A 3U1IB 1KXDA 1GBEA 1VCQA 2BDAA 3UPEA 2FWWA 1GHAG 1C1TA 3BIVH 3ZVDA 4FUJA 1CA0C 4U32A 1A4WH 2ZDMA 1ZTKA 1P2IA 5EOKA 1A61H 2LNCA 2O8LA 1XUHA 1Y5AT 1HRTH 3UOPA 4ABAA 1QTFA 1GI5A 3W94A 4YT6H 5C5NA 2D8WA 4ABBA 3DA9B 2FOMB 4Q7YA 3A7WA 4FUIA 1D9IA 2SGFE 2PSXA 2QY0B 4I8HA 3PMAB 1C1OA 1T8NA 3C1KA 1HB0B 2NU3E 1U6QA 1TRYA 3D62A 4KKDA 3SJ8A 3A86A 3EYDA 1C2IA 2VIVA 3FP8E 3SV6A 2H5CA 1ELFA 2H9TH 1FY8E 2A7JA 2ZFFH 3KNXA 4ZROA 4E7RG 2R3UA 2SNWA 1UTQA 4DOQA 4AOQA 4CHAB 2DE8A 3RMMH 3AVZA 4H42U 2ZG0H 3S7HB 2V6NA 1PPCE 1XXFA 1J16A 3LJJA 1GMHG 4JYTA 3EDXB 1LHFH 3OY6U 2C93B 1UTJA 4Y79A 1FONA 4X8SH 2GTBA 2ZFSA 1EQ9A 2QCYA 1JOUB 3P95A 1K1MA 1AWHB 2C8YB 4MG3A 4HI3A 4UFDH 1UK4A 9LPRA 3BTWE 3O8CA 1GHZA 3BTQE 3UUZA 1TQ0B 1O5DH 5C20A 1UHBA 2GCHF 2JKHA 4WWYA 1SGCA 5ETXA 1E36B 4AN7A 1OYTH 3FZDA 4NGAH 3AW0A 4OS2A 1DXPA 1Q2WA 1QIXB 1O33A 4YLUA 4TPYA 5LGOA 1P09A 5BPEA 2A7HA 1OP8A 3OSYA 4XOJA 1YKTA 1EPTA 4HFPB 1JIRA 1UK2A 3NUMA 1QQUA 4NWLA 1GJ4H 2W7SA 2P94A 1V2KT 1A46H 2ZDLA 3E3TA 4DGJA 5LPEA 1SGPE 1BIOA 2D2DA 3QGJA 5GXPA 4X6PA 1AVXA 1AZZA 1CVWH 1ESTA 1A0HB 5L30H 1NU9A 4MPUA 1O2GH 1BBRE 1BRBE 1BTXA 2FM2A 3BF6H 4ABIA 5JBCS 3QK1A 5EPNA 1NS3A 4F4OC 4OS4A 1ESBA 1C5LH 2SNVA 2GZ9A 4CREA 1AKSA 2BZ6H 1CQQA 1NT1A 4KP0A 2BVSH 4CH2B 1FI8A 1DANH 1HXFH 3TITA 1SGEE 1XUKA