3RXMA

Crystal structure of trypsin complexed with [2-(2-thienyl)thiazol-4-yl]methanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxmA02
1O32A 3M37A 5GXPA 4Q80A 4DIIH 5EPYA 1AB9C 4IW4E 3SJOA 1T4UH 1INCA 1ESAA 2PWXA 3AASA 2ZQ2A 1QBOA 2WINI 1BHXF 2TIOA 3PTNA 3FZDA 2XC5A 3P92A 2Z6BD 4D76A 2Z9LA 1EP5A 3RXGA 2HNTC 2ZWLH 4NIVA 3F6UH 1C5NH 3TU7H 1AWFH 1XUHA 4ABEA 2ZDLA 2VINA 1GHZA 1O3EA 4Q7XA 3Q76A 3RXAA 3U1JB 1GBLA 2H1UA 1OWKA 2H9HA 1XVMA 1Y5BT 1BA8B 3IG6B 2ODQA 4DG4A 1FIWA 1YPEH 1SGNE 1AQ7A 3L3TA 1MAXA 2NU4E 3SUEA 1RTLA 1SLUB 1GCDA 2JETB 4AORA 1RTKA 3M3VA 3UQVA 2ILNA 2FO9A 1HAIH 2VIVA 4ABHA 2P8OC 4E06H 1W12U 3GCOA 1LHEH 4K5ZA 1S83A 1O2RA 3LKWA 2IPHA 1TPSA 2QCYA 2J9NA 1C1OA 3NKKA 1IQIA 3U69H 3ODDA 3SV9A 1ZSLA 2B7DH 3UNRA 2GCHF 1YLCA 4OS1A 1DUAA 4YZUA 1SGTA 2R2WU 1BTZA 2BB4A 2UWLA 2ESTE 3UTUH 1BBRK 4I33A 1UVPA 1G9IE 4ZKRU 1HAOH 1WAYB 1C2GA 2BLWA 1Q2WA 1BUIA 2ANYA 1C1WH 1ORFA 2VB0A 3PO1C 1MCVA 1P0SH 1GCTB 3KNXA 1BOQA 3W94A 1C9TA 4YTAA 3W95A 3NPSA 1LHGH 4ZHMU 1SI5H 4AYYB 2C8WB 5DP9A 1BT7A 3QWCH 1LVOA 1SHHB 1L1JA 2J94A 2AERH 1OOKB 2HVXA 4BAOB 3EA8A 1T7CA 4NIWA 3RXDA 1P04A 1TMTH 2XTTB 1IQLA 2BDGA 4A6LA 4K69A 3ZYEA 1KXBA 1F2SE 5C5NA 1MTNC 1HJ9A 1A3BH 3LH1A 3SORA 1A4WH 5J4QA 1SGEE 3TLOA 2GCTC 1NTPA 1MKXH 3RXMA 8KME2 4A7IB 1WQVH 1O5AB 3C1KA 1QJ1B 1ZMJA 1GI0A 1S6FA 5EG4A 2Y5GA 2CGAA 3RP2A 1QBVH 4Q2KA 1C2FA 2O9QA 3LGTA 2GZ8A 2A32A 2Z94A 4YESB 3UWJH 4INHA 4UFFH 1B5GH 1UK4A 2C90B 3A8CA 2WPKS 2A5IA 1MU6B 4NG9H 1YM0A 5SGAE 1EPTA 3H7OA 5DP4A 3T28A 2V3OH 2AMQA 4U2WA 5E2PA 1C5QA 1AHTH 4Y7AA 1OKXA 1AVXA 2ANMH 3OX7U 3MHWU 5F6MA 2Q6DA 2HPQH 4FUHA 3LGVA 4Y0YE 5GPIB 1HNEE 2RA3A 4NWLA 3ATWA 5AFYH 1CSOE 3QLPH 2VNTA 3UIRA 1P9SA 1O2YA 1PPBH 2XW9A 3A84A 4O97A 3ZVBA 1AFEH 1ETTH 5E0HA 1C2HA 2CF9H 3VPKA 3E6PH 4A1TA 4YLUA 1P2MA 2A4OA 1UTPA 4TWWA 4CREA 1AE5A 4MNWA 4X8TH 1VCPA 4ABJA 8ESTE 4GHQA 1OYTH 5AFZH 3ZZ9A 1QIXB 2VGCC 5FX5A 4XDEA 3UNSA 1BRUP 1HJAB 4WF8A 2ZHWH 1K1LA 1GHVH 2O8WA 1GG6B 1TPOA 1L0ZA 1QFKH 2O8MA 2QGRA 3DHKH 1QQUA 1O2ZA 5TJXA 3SNAA 2BQ7B 2A31A 4RSPA 1DITH 1QL9A 4XBCA 2AEIH 2AMDA 4DOQA 1GHAG 1VZQH 2P59A 4Y7BA 2YOLA 4A5TS 2A5AA 3LGUA 2IOTA 1KIGH 3NUMA 2EI7A 4I8LA 2BQ6B 1BIOA 4HGCA 1C5LH 4UONA 4DGJA 5EW1H 2BVSH 2ASUB 1ELCA 1GBJA 1GMCG 1WOFA 2B0FA 3TK9A 1AB9B 4BAKB 3FAOA 1WU1A 3E8LA 3KEEA 1DPOA 1LHCH 1MTWA 1UTQA 3HGNA 2WPMS 1KXFA 4ZROA 3RXEA 1J17T 3LGIA 2XCNA 1EASA 2PUQH 4UFGH 3M36A 4FU7A 1SLWB 4B73A 4BOHA 3A7WA 3SGQE 3RXKA 3SI3H 1C1MA 2QN5T 1IQEA 1ARBA 3LONA 2A7CA 1D3TB 2ZCLP 1YPMH 4YT7H 1OP2A 1TGNA 2Z9JA 1FY1A 3SI4H 5L6NH 1HAYB 2VIOA 1GBKA 1WUNH 4FVDA 1NRNH 2P8OB 1W8BH 1UVSH 3DT0H 1FUJA 2BXTH 2FPZA 1E36B 1J8AA 3A83A 1Y59T 2R2MB 3KQEA 4JK6A 2A4QA 1IQGA 2ZHDA 1C5ZB 4JZ1A 5ESBA 1KXCA 4X1PU 2NU1E 1GJ7B 1Y3WA 1D3PB 1TX8A 4OGXA 3P95A 1VITF 2OUAA 3BTEE 4B74A 1VR1H 1B0EA 1TA6A 5AHGH 3SU1A 3PMBB 4WY3A 1EKBB 3PTBA 3PO1B 3K9XB 3CENA 1A2CH 4YOGA 3S69A 2ZG0H 1C2JA 1PPZA 2H9TH 3RMNH 1KY9A 1UTNA 3BTWE 2DE8A 1QBNA 3QGNB 1HAXB 3U8RH 4RKOB 3VXFH 3M7QA 2ZHFH 3E90B 3F9EA 3RXRA 5E2OA 1K1IA 2JH0D 4BAMB 1FDPA 3R3GB 2BYAX 4YLQH 1J15A 1RS0A 1OWEA 3S7KB 1O2MA 2FOMB 2O8UA 3P70B 3T62A 1Z1JA 1P3CA 1MTNB 3UOUA 3ZVAA 1GJ9B 2AMPA 2CF8H 2W26A 1GJDB 2GP9B 2XBYA 2GCTB 1ZMNA 1C5PA 3V13A 4OGYA 1THSH 2HWLB 2YNBA 1EAIA 3IWMA 1KTSB 3RC6A 1QA0A 3GY3A 1BITA 2PKAB 1OWJA 3DFLA 5K0HA 1ID5H 1YGCH 2EI8A 1CT0E 1SBWA 3GY7A 1KXEA 1XUKA 1C5WB 1UK3A 2SNVA 5E8EH 5DP8A 1IQKA 3BIVH 3MH4A 4MVNA 2BD7A 4JCNA 1ZLRA 1ZHMA 1O35A 1MD7A 2ZTYA 5EQSA 3S9BA 3RXJA 4OS2A 1GJ6A 1Z6JH 1ANCA 1YPKH 2SNWA 1RTFB 3RMLH 3GYLB 3B23B 3KL6A 5E0JA 4X1QU 1L4DA 3P17H 1PPFE 3A7VA 3NZIA 4GCHG 3JZ1B 4YOIA 3ATIA 3SQEE 3G01A 1O5GH 4GSOA 2BDHA 3BTTE 1EAWA 1C5UA 2DUCA 1FJSA 1AZZA 2ZKSA 5JBBS 3MNCA 1G3BA 1AIXH 1O33A 3SUDA 1J9CH 1HRTH 4A1VA 2PTCE 1AZ8A 1BMLA 4FUGA 1TBQH 2F9OA 2VGCB 3LDXH 2XC0A 1BBRH 1HGTH 1V2QT 3RXOA 1YBWA 1THPB 3VB5A 2UUFB 2Z9KA 5C2ZA 4ZH8A 1S0RA 3SJKA 1GJBB 3SNBA 1QRZA 1OWIA 3AVZA 1P10A 3UPEA 1UTOA 2OC8A 1FXYA 1DXPA 2ZPRA 1BMNH 3HK6B 3ZVGA 2A5KA 2W3KA 3V3MA 1NROH 1SGQE 1DM4B 1GJ4H 1BJUA 3PLKA 1DXWA 1SVPA 2F9UA 1GDNA 1C5SA 3UR6A 3RDZA 1GL0E 1O2GH 5ESTE 4DT7B 1ELEE 3JZ2B 3AAVA 4ZHAA 4HTCH 1PPEE 4GPGA 5HXFA 1DWCH 2FS8A 3SUFA 1UTLM 2C4FH 3VXEH 1TABE 5FX6A 5JBCS 1OPHB 1TA2A 1C2IA 1Y5UT 4KTUA 2Y7XA 1PQAA 2ZFTA 8GCHG 4K1SA 4O3UA 5JBTA 1G3DA 4X6MA 3TIUA 4CH8B 4CRDA 4E7NA 1V2RT 2FESH 1WTHD 5A09A 1MQ5A 2M5TA 1HAVB 2LPRA 2G52A 4HZHA 4ZAEA 1E0FD 3DUXH 1L1GA 2SGPE 2R3YA 2XWAA 1HXFH 2Z3CA 1MKWK 2OBQA 4NSVA 1SGYE 3SW2B 1A0LA 1LVBA 1XMNB 2P94A 1C5TA 2ZP0H 3RXSA 1Y8TA 3U1IB 1P02A 1C2DA 4DURA 4X6OA 3F9FA 1BRBE 1H9LB 4JMYA 1ACBE 5AVDA 3ATKA 3MO9A 3TVJB 1JBUH 2AIPA 4F4OC 9LPRA 1GI1A 1JMOH 3ZZAA 3K6ZA 4B2CA 2ZC9H 4J2YB 2G5VA 1MU8B 5DK1A 3M5LA 4KTSA 2ZGBH 3TJUA 4TPYA 3V12A 1FY3A 4NSYA 2PSYA 4WXVA 2BD4A 2WV5A 3GDUA 2C3SA 1C1RA 3PV4A 2WPHS 1T32A 2IJOB 3T2NA 3Q3KA 2BOKA 3A89A 3A7TA 1AVGH 3MO6A 2Z3EA 4AFUA 1A1RA 2VH0A 4ISNA 5DP3A 3TJVA 2VWMA 1OP8A 1G3EA 1NS3A 2H9EH 2QXHA 4NIYA 2G8TA 1GHAF 2WUBA 1LKAA 3HPTB 1ZTLA 1ZGVA 3LIWA 3FP6E 3DA9B 4Y6DA 5LPRA 1XX9A 2THFB 1O2XA 1D9IA 1MCTA 2R9PA 4VGCC 5PTPA 4UEHH 2STAE 4OS4A 3BTHE 1GMCF 2CJIA 3M5OA 3NWUA 1H9IE 5EQQA 2HPPH 3E16B 1W14U 2ZFSA 1WYKA 3HKJB 2HGTH 4OS5A 1BDAA 1FAXA 3BTGE 3TK5A 1ANDA 1H1BA 1QTFA 3URDA 1ZGIA 2UWPA 1P06A 2Y81A 1UCYE 4ABGA 2GV6A 4CRBA 5T6FA 2FP7B 1MTSA 1V2JT 3RXLA 3Q00A 1ZJKA 2FTLE 3QTOH 3UUZA 1O5CB 4NZQA 4AX9H 1UK2A 3TH3H 4Y11E 7ESTE 1QCPA 1QB9A 1O5EH 1C1TA 2P3UB 4IMZA 1S0QA 1TGTA 2BDCA 1NO9H 4TWYA 4E7RG 2EA3A 2CN0H 4WJG2 1P09A 4Y79A 3ZZ7A 1OP0A 2GDEH 3UNQA 2C93B 2J2UA 3SJ8A 1NT1A 1EOJA 1NRSH 1QQ4A 4BTIB 1O37A 2EC9H 1IOEA 1KDQB 4NFFA 2A7JA 2GX4A 2RCEA 1CGJE 4Y71A 1OWDA 2Z7FE 1KLIH 4ASHA 3LPRA 1SPJA 4FUCA 2TGDA 1GMHG 2XRCA 1XUIA 1GI9B 1MBMA 2G4TA 2G5NA 2CV3A 1UMAH 3K6YA 1V2ST 1A7SA 5L2YH 3CS0A 2SGDE 3LC5A 1C2EA 1DUEA 2GT8A 4J1YA 2SGQE 1N8OC 1P01A 1HXEH 3GDVA 2BTCE 1TNJA 2BVXH 1FIZA 1GDUA 1TX7A 3FP7E 5EXMA 1V2KT 1G36A 1W7XH 1E34B 1C5YB 5DG6A 2KAIB 2FOGA 3EAJA 2FLRH 1N1LA 1OXGA 1PJPA 2A4RA 4RN6A 3O8DA 1K22H 2PGBB 2TGPZ 5FBEA 2Y5FA 4XSKU 3EDXB 3C27B 1GI2A 5C20A 5JB8S 1D6WA 3PWBA 1IQNA 3LGWA 2AGEX 1AMHA 1V2MT 2FOFA 5DP6A 1NFXA 5A0CA 3MMGA 1AU8A 4INLA 6CHAC 3A86A 3U8OH 7GCHG 2QF0A 1C2KA 2H6MA 5CHAC 1DFPA 1W0ZU 3LH3A 1L1NA 1Y3YA 2ZPQA 1G32B 3UWIA 1P8VC 4LXBH 1GHXH 4DVAU 4NA9H 3VEQB 2J95A 5F8ZA 1ELFA 3QTVH 5HM2A 3F9HA 2QYIA 2XC4A 3T26A 3BSQA 2WYGA 3D65E 4NFEA 3T5FH 4FU8A 3ZZ3A 4WH6A 1EQ9A 1O3OA 2ZF0H 1W13U 3M5MA 1GDQA 1A5HA 1P2JA 1HIAB 1N6XA 3F68H 4AFQA 3SV6A 2PFEA 2ZCKP 4B2BA 1DY9A 1A5IA 5LH8A 1GVLA 2P3TB 1ZPCA 1P2NA 2FI3E 2OC7A 1X7AC 1YP9A 1GI7B 5C5OA 4KGAA 3LJJA 5GWZA 1WV7H 2ZCHP 4CRGA 2ZEBA 4GCHF 1SQAA 3SV2H 3DD2H 4X1RU 3A7YA 4CRAA 1P2IA 1BB0B 2VIPA 2ZDNA 3S9AA 5DP7A 4BAHB 1LCYA 1YCPM 1YKTA 1F0TA 1K21H 2ZZUH 1H9HE 3GOVB 3TGJE 1YPGH 1VCQA 3SU3A 1EATA 1NN6A 1WTGH 2FLBH 2HALA 1GJ8B 1IHTH 2W5EA 1XUFA 2Z9GA 3SHCH 5G4BA 4Y8ZA 1ESTA 1DS2E 2VU8E 2FOCA 4B71A 3A82A 1TMBH 3ZVEA 1EX3A 4D7FA 1Y3XA 2BD2A 1CT4E 3FP8E 5FCKA 3MFJA 3PMHB 1S81A 3T29A 1O5FH 2ZNKH 1QB1A 3KGPA 1JWTA 2BDYA 4RKJB 2Y7ZA 1YCPH 1QHRB 2PKAA 2QF3A 4CHAC 1TNIA 4VGCB 1HBTH 1ZTKA 1J14A 4MPVA 2TBSA 1ELAA 2GTBA 4LZ1H 2ALPA 4UD9H 1SC8U 1O2UA 4B76A 2F9NA 3BV9B 5DGJA 2SGEE 4IC6A 3PM3A 2ANKH 5EU8A 4AGJA 4I31A 1AE8H 1NC6A 1SFIA 3I29A 8GCHF 1F0UA 1QGFA 4FUFA 1RJXB 4ZXYH 3MU8A 4ABIA 1O2NA 3QGJA 1DVAH 3QO6A 1LQEA 2FX6A 2P95A 5FCRA 2ODPA 1C5RA 1O2IA 2BDAA 4GHTA 3M35A 1SGPE 3KCGH 1DE7H 4MQAA 4CR9A 4R8TB 1AKSB 2HRVA 1ZSKA 3O8RA 4MPWA 1Z8IB 4X2VA 4JK5A 5TCAA 1SGDE 1XKAC 3RLWH 1SGRE 3FANA 2NU0E 5L2ZH 4WXIA 3NCLA 4I7YH 4Y8YA 1SLXB 3STJA 5A8YA 4CRFA 2A4GA 1GWAA 3UR9A 1Z8RA 3FZZA 1NFYA 1GBCA 3ZVDA 2FZZA 3SQHE 1MZDA 3E0PB 3BG8A 2BLVA 2XWBI 5C1XA 2OD3B 4MG3A 1DSUA 1JIRA 2ALVA 1VGCC 2G00A 4DJZB 1RGQA 1P57B 3RXUA 2QV1A 2BZ6H 5A8XA 3EE0B 1ZRKA 3MYWA 1GBIA 7LPRA 1N8OB 4CBNA 2WPIS 1LDTT 2SFAA 4X6NA 1GBBA 3GY4A 4CH2B 3LOXA 2ULLA 3HATH 5JDUB 1RXPA 2ZGHA 2XBXA 4JYTA 4XE4A 5GDSH 1KYNA 1HAZB 1CHGA 6GCHG 1O2VA 2FODA 4MDSA 2J4IA 2UUKB 1TFXA 1O2PA 3QN7A 1ZMLA 1NZQH 4IC5A 3UOPA 5F8XA 2G4UA 5A0AE 1YPLH 6CHAB 1NY22 1J16A 2OXSA 1EUFA 5CHAB 1GBEA 3RXTA 2AFQB 1HAVA 1VJ9U 1UCYK 3BTDE 3O8CA 1W3CA 1Z8JB 4THNH 1IQMA 2BHGA 3OYPA 3RU4E 1G2LA 4ZKOU 3KQCA 3F1SB 1SGCA 4D9RA 3A8AA 1AO5A 1KXDA 3ENSB 1UTKA 4CBOA 1SFQB 1CVWH 4ISHH 2BD3A 2BLQA 4AB9A 1BTHH 1KTTB 3AW1A 2VIWA 4IN1A 2R0KA 1NRQH 2F9VA 2FM2A 3URCA 1W11U 5EXLA 3KF2A 5DPAA 2Y6TA 3RXFA 1GHBG 1DDJA 1O2JA 1SSXA 2H2ZA 2Z3DA 3HK3B 2VVCA 5IDKA 1C1VH 2RDLA 2OC1A 3RC4A 3CS7A 4AYVB 1FY4A 1FI8A 3TNTA 1DANH 1Z1IA 1TAWA 2D1JA 1SGFA 1C2LA 1QL7A 3OSYA 1SR5C 4OS7A 1G30B 4WH8A 2FOEA 5EGMA 1O3NA 2AS9A 2XXLA 1F5KU 2AIQA 3VGCC 2PR3A 3EA7A 1TNHA 4GAWA 3SZNA 1ZSJA 4XBBA 1GMHF 2GT7A 2ZI2H 3STIA 3RM2H 1QL8A 1AUJA 1ZHPA 1EZSC 1UVUH 1SQTA 1MTVA 1WQSA 2GZ7A 4DCDA 4K1TA 1E37B 2AH4X 1YC0A 1HB0B 1K1MA 4I32A 2H5DA 5GCHG 3UREA 4Z0KA 2FI4E 3E1XB 3ZZ5A 1BMAA 1LHFH 1EJNA 1C4V2 3MU4A 3KIDU 4O3TA 1TPPA 4TYDA 2WPJS 1O3AA 5DO4H 2V35A 1Z7KA 4K3JA 1EB2A 1DICA 1T4VH 1VITH 3BG4C 3P6ZB 4B75A 1V6DA 1FONA 2V6NA 2SGAA 4HFPB 4ZHLU 1QRXA 2FI5E 1HAPH 4CHAB 2ZFRH 3M5NA 1MMJN 1NRPH 4UE7H 4BNRA 1IQHA 3T25A 3D49H 3QDZB 5ABWA 7GCHF 4H42U 2NU3E 1FAKH 1CU1A 4I8GA 3RXBA 3A7ZA 2JH6D 3SU5A 1SLVB 2ZPSA 1TOMH 4D7GA 3A88A 1LMWB 3N7OA 4A92A 2C8YB 3GCTG 1BTXA 1H8DH 4ABBA 1THRH 1PPCE 4BXSA 3MH7A 4FU9A 1V2LT 4Y76A 1F0RA 1K1JA 1KLJH 1S85A 2AGGX 1EJMA 3QK1A 3TITA 1O3GA 1C1SA 1DT2A 3S0NA 1Z8GA 2GV7A 2BVRH 1K2I1 1KDQA 1IAUA 3MU5A 3HGPA 2PLXA 1CE5A 2XCFA 2PW8H 1HFDA 4SGBE 1NESE 1TRMA 3QZRA 1EZXC 1SL3A 5EQRA 1N6YA 1GVKB 3SU6A 4YT6H 2OC0A 3P8NA 3A81A 4MLFB 1BHXB 1PPGE 4LOYH 1VGCB 2BY7X 3T27A 1FN8A 3LT3A 3BEIB 1V3XA 2EI6A 2GGVB 2OTVA 4Y10E 8LPRA 1SGIB 3ZYDA 5BRRE 1AI8H 3E91A 1AFQC 2KAIA 5JBAS 4NIXA 3SU4A 2UUYA 1ZYOA 3TJNA 1SOZA 3GY8A 1O2HA 1BTWA 1OX1A 3FFGA 2BX3A 3TJOA 3GY2A 1B7XB 1FQ3A 2FTMA 1C5OH 2V3HH 3MTYA 2QY0B 3SHAH 3PLPA 1O36A 2ZECA 1TPAE 1ARCA 2PTNA 3ZZCA 1KLTA 2LNCA 2JH5D 2UWOA 2BD8A 2J34A 1O2TA 1MZAA 3K2UA 1IQJA 1TGSZ 1ZZZA 4KKDA 4D8NA 4K60A 3ZV9A 2VVUA 1O3LA 1GJAB 1HAHH 1FN6A 1A61H 1GHWH 1FNIA 1RD3B 1D3DB 1GPZA 2VIDA 1OYQA 2BY8X 1B0FA 3RU4D 5GJ4B 1NU9A 2BXUH 3BIUH 6ESTA 3BTQE 1HIAA 1ANBA 5EODA 4M7GA 1UHBB 2PKSC 1YLDA 4X2XA 1Y3VA 4IS5A 1ELVA 3ZZ8A 2I6SA 3RXCA 3LU9B 1T8LA 1GBDA 2VIQA 1QR3E 1CHOG 1IQFA 1MUEB 4FUDA 5CMXH 4NGAH 1EXFA 1O3MA 3QZQA 3IITA 3LGYA 1LHDH 4INKA 1FY8E 3RMOH 4ABFA 1W0YH 2C8XB 4X1SU 5K7RA 1GBTA 2ZU1A 3PWCA 1PPHE 2ZDVH 4I8HA 1HUTH 4UDWH 1P12E 1QURH 3RXVA 1BRCE 1K28D 1NM6A 1O3BA 5FBIA 1A46H 1EP6A 4X1NU 4BAQB 4DIHH 1GJCB 2ODYB 1GI5A 3PB1E 1AGJA 3SGAE 2FEQH 4X0WU 2AYWA 1SHYA 4SGAE 2F83A 3VGCB 1PQ5A 1TRNA 3VB7A 2QIQA 4Y0ZE 4KELA 2OINA 4LK4A 1P2OA 1F5LA 5HMAA 3U9AH 3PYHA 1JRTA 2CXVA 3P8GA 1NFUA 3QUMP 1KSNA 2D2DA 1C1UH 1XM1A 1UVOA 4FUBA 2VWOA 2VWNA 1P2KA 2P93A 3I78A 4MPXA 2CHAC 4ABDA 2P3FH 4MNXA 4X8SH 2ZGXH 4YOJA 1DWBH 1DWEH 1ZPZA 1CGIE 2BD9A 4WWYA 1DX5M 1G2MA 5C3NA 1O0DH 3AAUA 4FUEA 1TB6H 2FXRA 2BDIA 3RM0H 1HDTH 1P05A 1A5GH 2P16A 4IN2A 1EPTC 1C4Y2 3BG4B 4Z6AH 6GCHF 5F8TA 1Y3UA 5L30H 3VB6A 1XKBC 3A85A 1YPJH 2OQ5A 4BXWA 3M3TA 2Q6FA 2ZU5A 5LPFA 1CT2E 1UO6A 1PQ8A 2QXIA 2VH6A 1EAUA 3KQBA 1ESBA 1V2UT 2W7SA 3TNSA 3ZVFA 1KXAA 2QC2A 1GBHA 4AN7A 1LPZB 4ESTE 3ZZ4A 3ZZDA 2XBVA 1HLTH 1UCYH 1IHSH 2GDDA 1GHYH 1GBAA 2BY6X 5JB9S 1GI6A 1AKSA 1PYTC 4FUIA 2A0QB 4ZKSU 1DLKB 1GBFA 1O3FA 2OBOA 3GCHC 1Y5AT 2ZHEH 1C5VA 1PYTD 1O34A 1EOLA 2ZGJA 1O3CA 1H8IH 5B6OA 2NWNA 1FLEE 1EAXA 3MH6A 1W7GH 1JXPA 1TX6A 1TQ7B 4AOQA 4JYVH 5TCCA 1F7ZA 2QXJA 3TH4H 2RA0A 2NU2E 1C5XB 2CMYA 3PLBA 1BJVA 5CE1A 3SV8A 4XOJA 2BD5A 4YO9A 1TNKA 2XBWA 4ISOA 3TPIZ 5HM9A 1NPMA 1GHBF 1OS8A 2PHBA 2FMJA 1TGBA 2A2QH 3GDSA 4NA7A 2GMTC 4FXGH 2EEKA 1QNJA 3U98H 2QA9E 1JRSA 3O8BA 1SG8B 5C1UA 1EZQA 4H6TA 3EQ0H 1ABIH 3S9CA 1SMFE 1O38A 1MAYA 1LO6A 3SV7A 2ZO3H 1K1OA 1AFQB 1GGDC 1PQ7A 4WMFA 3KN2A 3SJIA 2ZFFH 3SNDA 2Y80A 1V2OT 1FPCH 3UQOA 1ANEA 2J38A 1K1NA 1O3PB 2A45B 3D62A 2BX4A 1DWDH 2BM2A 1BTPA 3PROA 5H4IB 1PFXC 2A2XH 2ZQ1A 2FIRH 5GCHF 1BRAA 2I6QA 3L33A 2V0BA 1MQ6A 1S6HA 2F9PA 4MPUA 1O2KA 2O8TA 4X2WA 1S84A 2WUCA 1BTYA 1LVMA 1JIMA 2ZU3A 2B8OH 4TY6A 4KTCA 4ZKNU 1ETSH 1WCZA 3AW0A 1O3DA 1GMDG 1SQOA 1GL1A 1E38B 2SGFE 4MNVA 1XVOA 3K65B 2VJ1A 3EGKH 1ABJH 1TOCB 3SJ9A 1O30A 1RRKA 4X6PA 4R0IA 1V2TT 1BTUA 1GI4A 3OU0A 1HYLA 2FOBA 4DW2U 1ELGA 2OLGA 3BEFB 4GVUA 1LTOA 1Z6EA 1OSSA 2BY5X 5C1YA 5LPEA 4GLYA 3GY6A 4H6SB 4NZLA 2ZTZA 2PKSB 2ANWA 3TH2H 1TBRH 3E0NB 2ZHQH 3ZZBA 1O2WA 1MD8A 3GCTF 1O5DH 2VVVA 4A1XA 5LGOA 1CA0C 2ZIQH 5I25A 1C4U2 2A1DB 4AGKA 1QJ7B 1UTJA 3SU2A 1O2LA 3SNEA 2FYQA 3ATMA 1CQQA 3EA9A 2FOHA 5FXLA 3M61U 1O3IA 3MNBA 1XXFA 2WPLS 4BTTB 1VCWA 5DP5A 1HPGA 1MKWH 4I8KA 1DY8A 2HLCA 2TRMA 2QAAA 5J4SA 1D4PB 2TGAA 1YYY1 1FV9A 2TPIZ 1ZRBA 4K8BA 4IBLH 4UFDH 1EB1H 2FOAA 1CBWC 1E35B 3OTJE 3TGIE 3PMJA 5T3HA 2B5TB 2G55A 2WYJA 2TGTA 3MI4A 1U6QA 3OY6U 3RXQA 1C1PA 3F9GA 1GBMA 2O8LA 1OWHA 5I46H 2CHAB 3M3SA 4U30A 1AN1E 1AY6H 4U32A 2J92A 1TQ0B 1LVYA 3V0XA 6LPRA 3BTKE 2YNAA 4FVBA 1SGFG 3GYMA 5E0GA 4PROA 1V2PT 1VJAU 3NK8A 4Q7YA 1WBGB 1S82A 1YPHE 2BZAA 1NFWA 3M7UA 1EPTB 2R0LA 3R0FA 3GICB 3H7TA 1NU7B 1QB6A 1K1PA 1W2KH 2OP9A 1O2QA 2BDBA 4HI3A 1TONA 3H5CB 1TGCA 5HGGA 2R3UA 1C9PA 1DLEA 2GCHG 3NXPA 5EXNA 1LPGB 1HCGA 1AUTC 1LPKB 4ISLA 4FUJA 3SNCA 2Y82A 3DFJA 5FPYA 1UJ1A 1ZPBA 3D23A 4GUXA 3BEUA 3GCHB 1RIWC 4JZIA 1C1QA 3SU0A 1H4WA 5DKMA 4JYUH 2IN2A 3LC3A 1ZR0A 2G51A 3L6PA 1P2QA 2A7HA 3VFEA 1CHOF 1G3CA 2G81E 3B8JA 3I77A 1BBRE 1O3JA 3MH5A 3A7XA 3BN9A 5IYTA 1F0SA 4O03A 3GY5A 2FS9A 2ZDKA 1S5SA 3RXPA 2HNTF 1BQYA 1GI8B 2ZDAH 4WMEA 2VWLA 1M9UA 1AVWA 4ZMAH 1ZJDA 4F49A 4MNYA 2QXGA 1WSSH 2C8ZB 2GMTB 5BPEA 1TMUH 3SN8A 5EOKA 3ATLA 1CA8B 1TYNA 3ZV8A 1MKXK 2JKHA 3A80A 1DSTA 1QRWA 4TPIZ 1Q31A 1TWXB 2BMGB 3VB4A 3BF6H 4JZEH 4BTUB 5AF9H 4CR5A 1GGDB 3RUOA 2F3CE 3MU1A 1V2NT 2FDAA 3P8OA 1C1NA 1CGHA 2ZFPH 4U01A 3RC5A 5A0BA 1O5BB 3MNSA 3UFAA 4ZUHA 4XBDA 2GZ9A 1DOJA 1EJAA 1L2EA 3M7TA 1K9OE 1JOUB 2HNTE 3CP7A 2RG3A 3A8BA 3Q3YA 1T8OA 2JETC 3V7TA 1UVTH 1TBZH 3U8TH 3B9FH 5ETXA 1TE0A 3GISB 1T31A 3SGBE 5FHTA 3SOSA 2ZA5A 5FAHA 4AZ2B 1A0JA 4B1TA 1P03A 1UHBA 4OS6A 3ESTA 3Q3XA 4MTBA 4NA8A 1BCUH 2BOHB 1P11E 2PUXB 4D9QA 3RMMH 1O3HA 2FWWA 3ZVCA 1A0HB 1MBQA 1ZTJA 1GVZA 1FMGA 2OCVB 2Q6GA 2AGIX 1O39A 3BTFE 5A2MH 1W10U 4YM9A 3QX5H 1G37A 4K8YA 1LQDB 1GCTC 1ELDE 1CA0B 3GCNA 3ITIA 3RLYH 5EW2H 3KHVA 5JYIA 2Q1JA 2BQWB 3EYDA 1NRRH 1YCPK 2XNIA 1CO7E 3UY9A 2Y5HA 1HJ8A 3BTME 2K1QA 2B9LA 3E3TA 1F5RA 1O2SA 3VB3A 5T6DA 1ETRH 2PSXA 2Z9IA 4AB8A 4ABAA 3P8FA 1HV7A 5DJ7A 1ZHRA 5HYOA 4JZFH 2GKVE 4K1EA 3TGKE 2HOBA 1SB1H 2XYAA 3SBKA 4DY7B 4ZXXH 3MO3A 1F92A 1CBWB 4Y8XA 1BZXE 1ELTA 2OQUA 3S7HB 3KQDA 4K2YA 3ELAH 4AG2A 4XFQA 4QT8C 4I8JA 1P9UA 1V2VT 1MH0A 4X2YA 4ISIH 1AD8H 4NCYA 1QY6A 3Q77A 1O31A 1QJ6B 1D3QB 1ELBA 1MTUA 4O9VA 4JZDH 1D6RA 3A8DA 3SO3A 1RFNA 4UFEH 4WVPE 5C67A 1YPHC 2STBE 3OY5U 1TLDA 4H4FA 4IMQA 3WY8A 3RXIA 2H5CA 2WV4A 2D26C 4X8VH 4B2AA 5GIBA 1YF4A 4BANB 4KP0A 5EPNA 1LKBA 2FX4A 1GI3A 4LZ4B 1SOTA 2GVFA 4WMDA 1TNLA 4CRCA 4NWKA 1QA7A 3PMAB 2BY9X 1XXDA 3MWIU 4X8UH 1ZOMA 5F03A 3LJOA 3ODFA 3A87A 1GMDF 2ZTXA 7KMEH 5A8ZA 2F91A 1TRYA 1C2MA 1P3EA 1HAGE 2PV9B 1A3EH 1VITG 4E05H 4Q7ZA 5JPMH 3MNXA 1V2WT 1XUJA 2W7UA 1T8NA 5T6GA 2ZFQH 3RU4T 1XUGA 1Z71A 1BMMH 2FYRA 4AFZA 1RIWB 2D8WA 1C5MD 2ZU4A 1HJAC 1TALA 2ZDMA 1Q3XA 2W3IA 3TK6A 2BLOA 1L4ZA 1UTMA 1GG6C 2UUJB 2DE9A 1TIOA 1T8MA 1O3KA 4AFSA 1FY5A 3MU0A 1FPHH 2GD4B 4AG1A 1GJ5H 3RXHA 1FZZA 3MOCA 2F9BH 2ZGCA 2ZU2A 3HKIB 2PGQB 1AWHB 3SUGA 9ESTA 3FVFB 1TNGA 1EZUC 4IGDA 1O2OA 3ZZ6A 5FPSA 5FPTA 4TY7A
chains in the Genus database with same CATH superfamily
1O32A 3M37A 5GXPA 4Q80A 4DIIH 5EPYA 1AB9C 4IW4E 3SJOA 1T4UH 1INCA 1ESAA 2PWXA 3AASA 2ZQ2A 2KM0A 1QBOA 2WINI 1BHXF 2TIOA 3PTNA 3FZDA 2XC5A 3P92A 2Z6BD 4D76A 2Z9LA 1EP5A 4AC9A 3RXGA 2HNTC 2ZWLH 4NIVA 3UAIC 3F6UH 1C5NH 3TU7H 1AWFH 1XUHA 4ABEA 2ZDLA 2VINA 1GHZA 1O3EA 4Q7XA 3Q76A 3RXAA 3U1JB 1GBLA 2H1UA 1OWKA 2H9HA 1XVMA 1Y5BT 1BA8B 3IG6B 2ODQA 4DG4A 1FIWA 1YPEH 1SGNE 1AQ7A 3L3TA 1MAXA 2NU4E 3SUEA 1RTLA 2VBCA 1SLUB 1GCDA 2JETB 4AORA 1RTKA 3M3VA 3UQVA 2ILNA 2FO9A 1HAIH 2VIVA 4ABHA 2P8OC 4E06H 1W12U 3GCOA 1LHEH 4K5ZA 1S83A 1O2RA 3LKWA 2IPHA 1TPSA 2QCYA 2J9NA 1C1OA 2YMSD 3NKKA 1IQIA 3U69H 3ODDA 3SV9A 5CDFE 1ZSLA 3F0PA 2B7DH 3UNRA 2GCHF 1YLCA 4OS1A 1DUAA 4YZUA 1SGTA 2R2WU 1BTZA 2BB4A 2UWLA 2ESTE 2KCYA 3UTUH 1BBRK 4I33A 1UVPA 1G9IE 4ZKRU 1HAOH 1WAYB 1C2GA 2BLWA 1Q2WA 1BUIA 2ANYA 1C1WH 1ORFA 2VB0A 3PO1C 1MCVA 1P0SH 1GCTB 3KNXA 1BOQA 3W94A 1C9TA 3EE7A 4YTAA 3W95A 3NPSA 4Q63A 1LHGH 4ZHMU 1SI5H 4AYYB 2C8WB 5DP9A 1BT7A 3QWCH 1LVOA 1SHHB 1L1JA 2IJD1 2J94A 2AERH 1OOKB 2HVXA 4BAOB 3EA8A 1T7CA 4NIWA 3RXDA 1P04A 1TMTH 2XTTB 1IQLA 2BDGA 4A6LA 4K69A 3ZYEA 1KXBA 1F2SE 5C5NA 1MTNC 1HJ9A 1A3BH 3LH1A 3SORA 4YXWD 1A4WH 5J4QA 1SGEE 3TLOA 2GCTC 1NTPA 1EFRD 2CK3D 1MKXH 3RXMA 8KME2 4A7IB 1WQVH 1O5AB 3C1KA 1QJ1B 1ZMJA 1GI0A 1S6FA 5EG4A 1S6LA 2Y5GA 2CGAA 3RP2A 1QBVH 4Q2KA 1C2FA 2O9QA 3LGTA 2GZ8A 2A32A 2KCAA 2Z94A 4YESB 3UWJH 4INHA 3KQ5A 4UFFH 1B5GH 1UK4A 2C90B 3A8CA 2WPKS 2A5IA 1MU6B 4NG9H 1YM0A 5SGAE 1EPTA 3H7OA 5DP4A 3T28A 2V3OH 2AMQA 4Z1MD 4U2WA 5E2PA 1C5QA 1AHTH 4Y7AA 1OKXA 1AVXA 2ANMH 3OX7U 3MHWU 5F6MA 2Q6DA 2HPQH 4FUHA 3LGVA 4Y0YE 5GPIB 1HNEE 2RA3A 4NWLA 3ATWA 5AFYH 1CSOE 3OE7D 3QLPH 2VNTA 3UIRA 1P9SA 1O2YA 1PPBH 2XW9A 3A84A 4O97A 3ZVBA 1AFEH 1ETTH 2HLDD 5E0HA 1C2HA 2CF9H 3VPKA 3E6PH 4A1TA 4YLUA 1P2MA 2A4OA 2WHXA 1UTPA 4TWWA 4CREA 1AE5A 4MNWA 4X8TH 1VCPA 4ABJA 8ESTE 4GHQA 1OYTH 5AFZH 3ZZ9A 1QIXB 2VGCC 5FX5A 4XDEA 3UNSA 1BRUP 1HJAB 2WV9A 4WF8A 2ZHWH 1K1LA 1GHVH 2O8WA 1GG6B 1TPOA 1L0ZA 1QFKH 2O8MA 2QGRA 3DHKH 1QQUA 3F2FA 1O2ZA 5TJXA 3SNAA 2BQ7B 2A31A 4RSPA 1DITH 1QL9A 4XBCA 2AEIH 2AMDA 4DOQA 1GHAG 1VZQH 2P59A 4Y7BA 2YOLA 4A5TS 2A5AA 3LGUA 2IOTA 1KIGH 3NUMA 2EI7A 4I8LA 2BQ6B 1BIOA 2EY4C 4HGCA 1C5LH 4UONA 2RFKC 4DGJA 5EW1H 2BVSH 2ASUB 1ELCA 1GBJA 1GMCG 1WOFA 2B0FA 5KGOA 1AB9B 3TK9A 2KX4A 4BAKB 3FAOA 1WU1A 3E8LA 3KEEA 1DPOA 1LHCH 1MTWA 1UTQA 3HGNA 2WPMS 1KXFA 4ZROA 3RXEA 1J17T 3LGIA 2XCNA 1EASA 2PUQH 4UFGH 3M36A 4FU7A 1SLWB 4B73A 4BOHA 3A7WA 3SGQE 3RXKA 3SI3H 1C1MA 2QN5T 1IQEA 1ARBA 3LONA 2A7CA 1D3TB 2ZCLP 1YPMH 4YT7H 1OP2A 1TGNA 4P02A 2Z9JA 1FY1A 4RT1A 3SI4H 3OEHD 5L6NH 1HAYB 2VIOA 1GBKA 1WUNH 4FVDA 1NRNH 2P8OB 1W8BH 1UVSH 3DT0H 1FUJA 2BXTH 2FPZA 1E36B 1J8AA 3A83A 1Y59T 2R2MB 3KQEA 4JK6A 2A4QA 1IQGA 2ZHDA 1C5ZB 4JZ1A 5ESBA 5C94A 2WPDD 1KXCA 4X1PU 2NU1E 1GJ7B 1Y3WA 1D3PB 1TX8A 4OGXA 3P95A 2JDID 2V7QD 1VITF 2OUAA 3BTEE 3FO8D 4B74A 1VR1H 1B0EA 1TA6A 5AHGH 3SU1A 3PMBB 4WY3A 1EKBB 3PTBA 3PO1B 3K9XB 3KYGA 3CENA 1A2CH 4YOGA 3S69A 2ZG0H 1C2JA 2M2AA 1PPZA 2H9TH 3RMNH 1KY9A 1UTNA 3BTWE 2DE8A 1QBNA 3QGNB 1HAXB 3U8RH 4RKOB 3VXFH 3M7QA 2ZHFH 3E90B 3F9EA 3RXRA 5E2OA 1H8ED 1K1IA 2JH0D 4BAMB 1FDPA 3R3GB 2BYAX 4YLQH 1J15A 1RS0A 1OWEA 3S7KB 1O2MA 2FOMB 2O8UA 3P70B 3T62A 1Z1JA 1P3CA 1MTNB 3UOUA 3ZVAA 1GJ9B 2AMPA 2CF8H 2W26A 1GJDB 2GP9B 2XBYA 2GCTB 1ZMNA 1C5PA 3V13A 4OGYA 1MABB 1THSH 2HWLB 2YNBA 1EAIA 3IWMA 1KTSB 3RC6A 1QA0A 3GY3A 1BITA 2PKAB 1OWJA 3DFLA 2L74A 5K0HA 1ID5H 1YGCH 2EI8A 1CT0E 1SBWA 3GY7A 1KXEA 1XUKA 1C5WB 1UK3A 2SNVA 5E8EH 5DP8A 1IQKA 3BIVH 3MH4A 4MVNA 2BD7A 4JCNA 1ZLRA 1ZHMA 1O35A 1MD7A 2ZTYA 5EQSA 4ASUD 3S9BA 3RXJA 4OS2A 1GJ6A 1Z6JH 1ANCA 1YPKH 2SNWA 1RTFB 2L6OA 3RMLH 3GYLB 3B23B 3KL6A 5E0JA 4X1QU 1L4DA 2KCOA 3P17H 1PPFE 3A7VA 3NZIA 4GCHG 3JZ1B 4YOIA 3ATIA 3SQEE 3G01A 1O5GH 4GSOA 4TT3D 2BDHA 3BTTE 1EAWA 1C5UA 2DUCA 1FJSA 1AZZA 2ZKSA 5JBBS 3MNCA 1G3BA 1AIXH 1O33A 3SUDA 1J9CH 1HRTH 4A1VA 2PTCE 1AZ8A 1BMLA 4FUGA 1TBQH 2F9OA 2VGCB 3LDXH 2XC0A 1BBRH 1HGTH 1V2QT 3RXOA 1YBWA 1THPB 3VB5A 2UUFB 2Z9KA 5C2ZA 4ZH8A 1S0RA 3SJKA 1GJBB 3SNBA 1QRZA 1OWIA 3AVZA 1P10A 3UPEA 1UTOA 2OC8A 1FXYA 1DXPA 2ZPRA 1BMNH 2XOKD 3HK6B 3ZVGA 2A5KA 2W3KA 3V3MA 1NROH 1SGQE 1DM4B 1GJ4H 1BJUA 3PLKA 1DXWA 1SVPA 2F9UA 1GDNA 1C5SA 3UR6A 3RDZA 1GL0E 1O2GH 5ESTE 4DT7B 1ELEE 3JZ2B 3AAVA 4ZHAA 4HTCH 1PPEE 4GPGA 1UW7A 5HXFA 1DWCH 2FS8A 3SUFA 1UTLM 2C4FH 3VXEH 1TABE 5FX6A 5JBCS 1OPHB 1TA2A 1C2IA 1Y5UT 4KTUA 2Y7XA 1PQAA 2ZFTA 8GCHG 4K1SA 4O3UA 1NBME 5JBTA 1G3DA 4X6MA 3TIUA 4CH8B 4CRDA 4E7NA 1V2RT 2FESH 1WTHD 5A09A 1MQ5A 3F2HA 2M5TA 1HAVB 2LPRA 2G52A 4HZHA 4ZAEA 1E0FD 3DUXH 1L1GA 2SGPE 2R3YA 2XWAA 1K0HA 1HXFH 2Z3CA 1MKWK 2OBQA 4NSVA 1SGYE 3SW2B 1A0LA 1LVBA 1XMNB 2P94A 1C5TA 2J97A 2ZP0H 3RXSA 1Y8TA 3U1IB 3OAAD 1P02A 1C2DA 4DURA 4X6OA 3F9FA 1BRBE 1H9LB 4JMYA 1ACBE 5AVDA 3ATKA 3MO9A 3TVJB 1JBUH 2AIPA 4F4OC 9LPRA 1GI1A 1JMOH 3ZZAA 3K6ZA 4B2CA 2ZC9H 4J2YB 2G5VA 1MU8B 5DK1A 3M5LA 4KTSA 2ZGBH 3TJUA 4TPYA 3V12A 1FY3A 4NSYA 2PSYA 4WXVA 2BD4A 2WV5A 3GDUA 2C3SA 1C1RA 3PV4A 2WPHS 1T32A 2IJOB 3T2NA 3Q3KA 2BOKA 3A89A 3A7TA 1AVGH 3MO6A 2Z3EA 4AFUA 1A1RA 2VH0A 4ISNA 5DP3A 3TJVA 2VWMA 1OP8A 1G3EA 1NS3A 2H9EH 5C0TA 2QXHA 4NIYA 2G8TA 2AHME 1GHAF 2WUBA 1LKAA 3HPTB 1ZTLA 1ZGVA 3LIWA 3FP6E 4FETA 3DA9B 4Y6DA 5LPRA 1XX9A 2THFB 1O2XA 1D9IA 1MCTA 2R9PA 4VGCC 5PTPA 4UEHH 2STAE 4OS4A 4Q4LA 3BTHE 1GMCF 4ZCNA 2CJIA 3M5OA 3NWUA 1H9IE 5EQQA 2HPPH 3E16B 1W14U 2ZFSA 1WYKA 3HKJB 2HGTH 4OS5A 1BDAA 1FAXA 3BTGE 3TK5A 1ANDA 1H1BA 1QTFA 3URDA 1ZGIA 2UWPA 1P06A 2Y81A 1UCYE 4ABGA 2GV6A 4CRBA 5T6FA 2FP7B 1MTSA 1V2JT 3RXLA 3Q00A 1ZJKA 2FTLE 3QTOH 3UUZA 1O5CB 4NZQA 4AX9H 1UK2A 3TH3H 4Y11E 7ESTE 1QCPA 1QB9A 1O5EH 1C1TA 2P3UB 4IMZA 1S0QA 1TGTA 2BDCA 1NO9H 4TWYA 4E7RG 2EA3A 2CN0H 4WJG2 1P09A 4Y79A 3ZZ7A 1OP0A 2GDEH 3UNQA 3MQKC 2C93B 2J2UA 3SJ8A 1NT1A 1EOJA 1NRSH 1QQ4A 4BTIB 1O37A 2EC9H 3UB0A 1IOEA 1KDQB 4NFFA 2A7JA 2GX4A 2RCEA 5EIYA 1CGJE 4Y71A 1OWDA 2Z7FE 1KLIH 3N7EA 2YMSC 4ASHA 3LPRA 1SPJA 4FUCA 2TGDA 1GMHG 2XRCA 1XUIA 1GI9B 1MBMA 1SKYE 2G4TA 2G5NA 2CV3A 1UMAH 3K6YA 1V2ST 1VKYA 1A7SA 5L2YH 3CS0A 2SGDE 3LC5A 1C2EA 1DUEA 2GT8A 4J1YA 3WW7A 2SGQE 1YWUA 1N8OC 1P01A 1HXEH 3GDVA 2BTCE 1TNJA 2BVXH 1FIZA 1GDUA 1TX7A 3FP7E 5EXMA 1V2KT 1G36A 1W7XH 1E34B 1C5YB 5DG6A 2KAIB 2FOGA 3EAJA 2FLRH 1N1LA 1OXGA 1PJPA 4F48B 2A4RA 4RN6A 3O8DA 1K22H 2PGBB 2TGPZ 5FBEA 2Y5FA 5HKKD 4XSKU 3EDXB 3C27B 1GI2A 5C20A 5JB8S 1D6WA 3PWBA 1IQNA 3LGWA 2AGEX 1AMHA 1V2MT 2FOFA 5DP6A 1NFXA 5A0CA 3MMGA 1AU8A 1COWD 4INLA 6CHAC 3A86A 3U8OH 7GCHG 2QF0A 1C2KA 2H6MA 5CHAC 1BMFD 1DFPA 1W0ZU 3LH3A 1L1NA 1Y3YA 2ZPQA 1G32B 3UWIA 1P8VC 4LXBH 1GHXH 4DVAU 4NA9H 3VEQB 2J95A 5F8ZA 1ELFA 3QTVH 5HM2A 3F9HA 2QYIA 2XC4A 3T26A 3BSQA 2WYGA 3D65E 4NFEA 3T5FH 4FU8A 3ZZ3A 4WH6A 1EQ9A 1O3OA 2ZF0H 1W13U 3M5MA 1GDQA 3F2GA 1A5HA 1P2JA 1HIAB 1N6XA 3F68H 4AFQA 3SV6A 2PFEA 2ZCKP 4B2BA 1DY9A 1A5IA 5LH8A 1GVLA 1ZPCA 1P2NA 2FI3E 2OC7A 2P3TB 1X7AC 1YP9A 1GI7B 5C5OA 4KGAA 3LJJA 5GWZA 1FX0B 1WV7H 2ZCHP 4CRGA 2ZEBA 4GCHF 1SQAA 3SV2H 3DD2H 4X1RU 3A7YA 4CRAA 1P2IA 1BB0B 2VIPA 2ZDNA 3S9AA 5DP7A 4BAHB 1LCYA 1YCPM 1YKTA 1F0TA 3U28C 1K21H 2ZZUH 1H9HE 3GOVB 3TGJE 1YPGH 1VCQA 3SU3A 2PP6A 1EATA 1NN6A 1WTGH 2FLBH 2HALA 1GJ8B 1IHTH 2W5EA 1XUFA 2Z9GA 3SHCH 5G4BA 4Y8ZA 3W1EA 1ESTA 1W0KD 1DS2E 2VU8E 2FOCA 4B71A 2WSSD 3A82A 3ZIAD 1TMBH 3ZVEA 1EX3A 4D7FA 1Y3XA 2BD2A 2W6JD 3DSGA 5EJ1A 1CT4E 3FP8E 5FCKA 3MFJA 3PMHB 1S81A 3T29A 1O5FH 2ZNKH 1QB1A 3KGPA 1JWTA 2BDYA 2QF4A 4RKJB 2Y7ZA 2KZ4A 1YCPH 1QHRB 2PKAA 2QF3A 4CHAC 1TNIA 4VGCB 1HBTH 1ZTKA 1J14A 4MPVA 5FL7D 2TBSA 1ELAA 2GTBA 4LZ1H 2ALPA 4UD9H 1SC8U 1O2UA 4B76A 2F9NA 3BV9B 5DGJA 2SGEE 4IC6A 3PM3A 2ANKH 5EU8A 4AGJA 4I31A 1AE8H 1NC6A 1SFIA 3I29A 8GCHF 1F0UA 1QGFA 4FUFA 1RJXB 4ZXYH 3MU8A 2J98B 4ABIA 1O2NA 4FOUC 3QGJA 1DVAH 3QO6A 1LQEA 2FX6A 2P95A 5FCRA 2ODPA 1C5RA 1O2IA 2BDAA 4GHTA 3M35A 1SGPE 4ACBA 3KCGH 1DE7H 4MQAA 4CR9A 4R8TB 1AKSB 2HRVA 1ZSKA 3O8RA 4MPWA 1Z8IB 4X2VA 4JK5A 5TCAA 1SGDE 1XKAC 3RLWH 1SGRE 3FANA 2NU0E 5L2ZH 4WXIA 3NCLA 4I7YH 4Y8YA 1SLXB 5CHBA 3STJA 5A8YA 4CRFA 2A4GA 1GWAA 3UR9A 5B6LA 1Z8RA 3FZZA 1NFYA 1GBCA 3ZVDA 2FZZA 3SQHE 1MZDA 3E0PB 3BG8A 2BLVA 2QE7D 2XWBI 5C1XA 2YMSB 4DT4A 2OD3B 4MG3A 1DSUA 1JIRA 2ALVA 1VGCC 2G00A 4DJZB 3F0OA 1RGQA 1P57B 3RXUA 2QV1A 2BZ6H 4XRNA 5A8XA 3EE0B 1ZRKA 3MYWA 1GBIA 7LPRA 1N8OB 4CBNA 2WPIS 1LDTT 2SFAA 4X6NA 1GBBA 3GY4A 4CH2B 3LOXA 2ULLA 3HATH 1KMHB 5JDUB 1RXPA 1YY3A 2ZGHA 2XBXA 4JYTA 4XE4A 5GDSH 1KYNA 1HAZB 1CHGA 6GCHG 1O2VA 2FODA 4MDSA 3KYFA 2J4IA 2UUKB 1TFXA 1O2PA 3QN7A 1ZMLA 1NZQH 4IC5A 3UOPA 5F8XA 2G4UA 5A0AE 1YPLH 6CHAB 1NY22 1J16A 1EUFA 2OXSA 5CHAB 1GBEA 3RXTA 2AFQB 1HAVA 1VJ9U 1UCYK 5GNDA 3BTDE 3O8CA 1W3CA 1Z8JB 3H09A 4THNH 1IQMA 2BHGA 3OYPA 3RU4E 3SZEA 1G2LA 4ZKOU 2J5UA 3KQCA 3F1SB 1SGCA 4D9RA 3A8AA 1AO5A 1KXDA 3ENSB 1UTKA 4CBOA 1SFQB 1CVWH 4ISHH 2BD3A 2BLQA 4AB9A 2QF5A 1BTHH 1KTTB 3AW1A 2VIWA 4IN1A 2R0KA 1NRQH 2F9VA 2FM2A 3URCA 2LELA 1W11U 5EXLA 3KF2A 1W0JD 5DPAA 2Y6TA 3RXFA 1GHBG 2KR7A 1DDJA 1O2JA 1SSXA 2H2ZA 2Z3DA 3HK3B 2VVCA 4P00A 1C1VH 2RDLA 2OC1A 3RC4A 3CS7A 4AYVB 1FY4A 1FI8A 3TNTA 3PV5A 1DANH 1Z1IA 1TAWA 2D1JA 1SGFA 1C2LA 1QL7A 3OSYA 1SR5C 4OS7A 1G30B 4WH8A 2FOEA 5EGMA 1O3NA 2AS9A 2XXLA 1F5KU 2AIQA 3PRDA 3VGCC 2PR3A 3EA7A 1TNHA 4GAWA 3SZNA 1ZSJA 4XBBA 1GMHF 2GT7A 2ZI2H 3STIA 3RM2H 1QL8A 1AUJA 1ZHPA 1EZSC 1UVUH 1SQTA 1MTVA 1WQSA 2GZ7A 4DCDA 4K1TA 1E37B 2AH4X 5DSFA 1YC0A 1HB0B 1K1MA 4I32A 2H5DA 5GCHG 3UREA 4Z0KA 2FI4E 3E1XB 3ZZ5A 1BMAA 1LHFH 1EJNA 1C4V2 3MU4A 3KIDU 3OTPA 4O3TA 1TPPA 3PV2A 4TYDA 2WPJS 1O3AA 5DO4H 2V35A 1Z7KA 4K3JA 1EB2A 1DICA 1T4VH 1VITH 3BG4C 3P6ZB 4B75A 1V6DA 1FONA 2V6NA 2SGAA 4HFPB 4ZHLU 1QRXA 2FI5E 1HAPH 4CHAB 2ZFRH 3M5NA 1MMJN 1NRPH 4UE7H 4BNRA 1IQHA 3T25A 3D49H 3QDZB 5ABWA 7GCHF 3DCLA 4H42U 2NU3E 5IK2D 1FAKH 1CU1A 4I8GA 3RXBA 3A7ZA 2JH6D 3SU5A 1SLVB 2ZPSA 4B6EA 1TOMH 4D7GA 3A88A 1LMWB 3N7OA 4A92A 2C8YB 3GCTG 1BTXA 1H8DH 4ABBA 1THRH 1PPCE 4BXSA 4ACAA 3MH7A 4FU9A 1V2LT 4Y76A 1F0RA 1K1JA 1KLJH 1S85A 2AGGX 1EJMA 3QK1A 3TITA 1O3GA 1C1SA 1DT2A 3S0NA 1Z8GA 2GV7A 2BVRH 1K2I1 1KDQA 1IAUA 3MU5A 3HGPA 2PLXA 1CE5A 2XCFA 2PW8H 1HFDA 4SGBE 1NESE 1TRMA 3QZRA 4M9FA 1EZXC 1SL3A 5EQRA 1N6YA 1GVKB 3SU6A 4YT6H 2OC0A 3P8NA 3A81A 4MLFB 3WWBA 1BHXB 1PPGE 4LOYH 1VGCB 2BY7X 3T27A 1FN8A 3LT3A 3BEIB 1V3XA 2EI6A 4RI0A 2GGVB 2OTVA 4Y10E 2WZQA 8LPRA 1SGIB 3ZYDA 5BRRE 1AI8H 3E91A 1AFQC 2KAIA 5JBAS 4NIXA 3SU4A 2UUYA 1ZYOA 3TJNA 1SOZA 3GY8A 1O2HA 1BTWA 1OX1A 3FFGA 2BX3A 3TJOA 3GY2A 1B7XB 1FQ3A 2FTMA 1C5OH 2V3HH 3MTYA 2QY0B 3SHAH 3PLPA 1O36A 2ZECA 1TPAE 1ARCA 2PTNA 3ZZCA 1KLTA 2LNCA 2JH5D 2UWOA 2BD8A 2J34A 1O2TA 1MZAA 3K2UA 1IQJA 1TGSZ 1ZZZA 4KKDA 4D8NA 4K60A 3ZV9A 2VVUA 1O3LA 1GJAB 1HAHH 1FN6A 1A61H 1GHWH 1FNIA 1RD3B 1D3DB 1GPZA 2VIDA 1OYQA 2BY8X 1B0FA 3RU4D 5GJ4B 1NU9A 2BXUH 3BIUH 6ESTA 3BTQE 1HIAA 1ANBA 5EODA 4M7GA 1UHBB 2PKSC 1YLDA 2EQNA 1Y3VA 4X2XA 4IS5A 1ELVA 3ZZ8A 2I6SA 3RXCA 3LU9B 3WWFA 1T8LA 1GBDA 2VIQA 1QR3E 1CHOG 1IQFA 1MUEB 5HIZA 4FUDA 5CMXH 4NGAH 1EXFA 1O3MA 3QZQA 3IITA 3LGYA 1LHDH 4INKA 2XNDD 1FY8E 3RMOH 4ABFA 1W0YH 2C8XB 2JJ2D 2KFWA 4X1SU 5K7RA 1GBTA 2ZU1A 3PWCA 1PPHE 2ZDVH 4I8HA 1HUTH 4UDWH 1P12E 1QURH 3RXVA 1BRCE 1K28D 1NM6A 1O3BA 5FBIA 1A46H 1EP6A 4X1NU 4BAQB 4DIHH 1GJCB 2ODYB 1GI5A 3PB1E 1AGJA 3SGAE 2FEQH 4X0WU 2AYWA 1SHYA 4SGAE 2F83A 3VGCB 1PQ5A 1TRNA 3VB7A 2QIQA 4Y0ZE 4KELA 2OINA 4LK4A 1P2OA 1F5LA 5HMAA 3NRLA 3U9AH 3PYHA 1JRTA 2CXVA 3P8GA 1NFUA 3QUMP 1KSNA 2D2DA 1C1UH 1XM1A 1UVOA 4FUBA 2VWOA 2VWNA 1P2KA 2P93A 3I78A 4MPXA 2CHAC 4ABDA 2P3FH 4MNXA 4X8SH 2ZGXH 4YOJA 1DWBH 1DWEH 1ZPZA 1CGIE 2BD9A 4WWYA 1DX5M 1G2MA 5C3NA 1O0DH 3AAUA 4FUEA 1TB6H 2FXRA 2BDIA 3RM0H 1HDTH 1P05A 1A5GH 2P16A 4IN2A 1EPTC 1C4Y2 3BG4B 4Z6AH 6GCHF 5F8TA 1Y3UA 5L30H 3VB6A 1XKBC 3A85A 1YPJH 2OQ5A 3OEED 4BXWA 3M3TA 2Q6FA 2ZU5A 5LPFA 1CT2E 1UO6A 1PQ8A 2QXIA 2VH6A 1EAUA 3KQBA 1ESBA 1V2UT 3N99A 2W7SA 3TNSA 3ZVFA 2J98A 1KXAA 2QC2A 1GBHA 4AN7A 1YLNA 1LPZB 4ESTE 3ZZ4A 3ZZDA 2XBVA 1HLTH 1UCYH 1IHSH 4F55A 2GDDA 3DSPA 1GHYH 1GBAA 2BY6X 5JB9S 1GI6A 1AKSA 1PYTC 4FUIA 2A0QB 4ZKSU 1DLKB 1GBFA 1O3FA 2OBOA 3GCHC 1NBMD 1Y5AT 2ZHEH 1C5VA 1PYTD 1O34A 1EOLA 2ZGJA 1O3CA 1H8IH 5B6OA 2NWNA 1FLEE 1EAXA 3MH6A 1W7GH 1JXPA 1TX6A 5KEDA 1TQ7B 4AOQA 4JYVH 5TCCA 1F7ZA 2QXJA 3TH4H 2RA0A 1WDIA 5HIYA 2NU2E 1C5XB 2CMYA 3PLBA 1BJVA 5CE1A 3SV8A 4XOJA 4RT0A 2BD5A 5EJZA 4YO9A 1TNKA 2XBWA 4ISOA 3TPIZ 5HM9A 1NPMA 1GHBF 1OS8A 2PHBA 2K0QA 2FMJA 1TGBA 2A2QH 3GDSA 4NA7A 3FKSD 2GMTC 4FXGH 2EEKA 1QNJA 3U98H 2QA9E 1JRSA 3O8BA 1SG8B 5C1UA 1EZQA 4H6TA 3EQ0H 1ABIH 3S9CA 1SMFE 5C0UA 1O38A 1MAYA 1LO6A 3SV7A 2ZO3H 1K1OA 1AFQB 1GGDC 1PQ7A 4WMFA 3KN2A 3SJIA 2ZFFH 3SNDA 2Y80A 1V2OT 1FPCH 3UQOA 1ANEA 3VG8A 2J38A 1K1NA 1O3PB 2A45B 3D62A 2BX4A 1DWDH 2BM2A 1BTPA 3PROA 5H4IB 1PFXC 2A2XH 2ZQ1A 2FIRH 5GCHF 1BRAA 2I6QA 3L33A 2V0BA 1MQ6A 1S6HA 2F9PA 2F4LA 4MPUA 1O2KA 2O8TA 4X2WA 1S84A 2WUCA 2OK5A 1BTYA 3SYJA 1LVMA 1JIMA 2ZU3A 3AK5A 2B8OH 4TY6A 4KTCA 4ZKNU 1ETSH 1WCZA 3AW0A 1O3DA 1GMDG 1SQOA 1GL1A 1E38B 2SGFE 4MNVA 1XVOA 3K65B 2VJ1A 3EGKH 1ABJH 1TOCB 3SJ9A 1O30A 1RRKA 4X6PA 4R0IA 1V2TT 1BTUA 1GI4A 3OU0A 1HYLA 2FOBA 4DW2U 1ELGA 2OLGA 3BEFB 4GVUA 1LTOA 1Z6EA 1OSSA 2BY5X 5C1YA 5LPEA 4GLYA 3GY6A 4H6SB 4NZLA 2ZTZA 2PKSB 2ANWA 3TH2H 1TBRH 3E0NB 2ZHQH 3ZZBA 1O2WA 1MD8A 3GCTF 2K8IA 1O5DH 2VVVA 4A1XA 2LP6A 5LGOA 1CA0C 2ZIQH 5I25A 1C4U2 2A1DB 5T1VA 4AGKA 1QJ7B 1UTJA 3SU2A 1O2LA 3SNEA 2FYQA 3ATMA 1CQQA 3EA9A 2FOHA 5FXLA 3M61U 1O3IA 1OHHD 1XXFA 3MNBA 2WPLS 4BTTB 1VCWA 5DP5A 1HPGA 1MKWH 4I8KA 1DY8A 2HLCA 3F3BA 4HG6A 2TRMA 2QAAA 5J4SA 1D4PB 2TGAA 1YYY1 1FV9A 2TPIZ 1E1QD 1ZRBA 4K8BA 4IBLH 4UFDH 1EB1H 2FOAA 5EJLA 1CBWC 1E35B 3OTJE 3TGIE 3PMJA 5T3HA 2B5TB 2G55A 2WYJA 2TGTA 2W6ID 3MI4A 1U6QA 3FOAA 3OY6U 3RXQA 1C1PA 3F9GA 1GBMA 2O8LA 1OWHA 5I46H 2CHAB 3M3SA 4U30A 2F43B 3FN8A 1AN1E 1AY6H 4U32A 2J92A 1TQ0B 1LVYA 3V0XA 6LPRA 3BTKE 2YNAA 4FVBA 1SGFG 3GYMA 5E0GA 4PROA 1V2PT 1VJAU 3NK8A 4Q7YA 1WBGB 1S82A 1YPHE 3OFND 2BZAA 1NFWA 3M7UA 1EPTB 2R0LA 3R0FA 3GICB 3CNRA 1E1RD 3H7TA 1NU7B 1QB6A 1K1PA 1W2KH 2OP9A 1O2QA 2BDBA 4HI3A 1TONA 3H5CB 1TGCA 5HGGA 2R3UA 1C9PA 1DLEA 2GCHG 3NXPA 5EXNA 1LPGB 1HCGA 1AUTC 1LPKB 4ISLA 4FUJA 3SNCA 2Y82A 3DFJA 5FPYA 1UJ1A 1ZPBA 3D23A 2JIZD 4GUXA 3BEUA 3GCHB 1RIWC 4JZIA 1C1QA 3SU0A 1H4WA 5DKMA 4JYUH 2IN2A 3LC3A 1ZR0A 2G51A 3L6PA 1P2QA 2A7HA 3VFEA 1CHOF 1G3CA 2G81E 3B8JA 3I77A 1BBRE 1O3JA 3MH5A 3A7XA 5C17A 3BN9A 5IYTA 1F0SA 4TSFD 4O03A 3GY5A 2FS9A 2ZDKA 1S5SA 3RXPA 2HNTF 1BQYA 1GI8B 2ZDAH 4WMEA 2VWLA 1M9UA 1AVWA 4ZMAH 1ZJDA 4F49A 4MNYA 2QXGA 1WSSH 2C8ZB 2GMTB 5BPEA 1TMUH 3SN8A 5EOKA 3ATLA 1CA8B 1TYNA 3ZV8A 1MKXK 2JKHA 3A80A 1DSTA 1QRWA 4TPIZ 1Q31A 1TWXB 2BMGB 4OM9A 3VB4A 3BF6H 4JZEH 4BTUB 4B6FA 1QZ8A 4CR5A 5AF9H 1GGDB 3RUOA 2F3CE 3MU1A 1V2NT 2FDAA 3P8OA 1C1NA 1CGHA 2ZFPH 4U01A 3RC5A 5A0BA 1O5BB 3MNSA 3UFAA 4ZUHA 4XBDA 2GZ9A 1DOJA 1EJAA 1L2EA 3M7TA 2V3MA 1K9OE 1JOUB 2HNTE 5F53A 3CP7A 2RG3A 3A8BA 3Q3YA 1T8OA 2JETC 3V7TA 1UVTH 1TBZH 3U8TH 1WXRA 3B9FH 5ETXA 5DN6D 1TE0A 3GISB 1T31A 3SGBE 5FHTA 1SQRA 3SOSA 2ZA5A 5FAHA 4AZ2B 1A0JA 4B1TA 1P03A 1UHBA 4OS6A 3ESTA 3Q3XA 4MTBA 4NA8A 1BCUH 2BOHB 1P11E 2PUXB 4D9QA 3RMMH 1O3HA 2FWWA 3ZVCA 1A0HB 1MBQA 1ZTJA 1GVZA 1FMGA 2OCVB 2Q6GA 2AGIX 1O39A 3BTFE 5A2MH 1W10U 4YM9A 3QX5H 1G37A 4K8YA 3N7DA 1LQDB 1GCTC 2JJ1D 1ELDE 1CA0B 3GCNA 3ITIA 3RLYH 5EW2H 1H8HD 3KHVA 5JYIA 2Q1JA 2BQWB 3EYDA 3PRBA 1NRRH 1YCPK 2XNIA 1CO7E 3UY9A 2RDEA 2Y5HA 2GJGA 1HJ8A 3BTME 2K1QA 2B9LA 3E3TA 1F5RA 1O2SA 3VB3A 5T6DA 1ETRH 2PSXA 2Z9IA 4AB8A 4XD7D 4I86A 4ABAA 3P8FA 1HV7A 5DJ7A 1ZHRA 5HYOA 4JZFH 2GKVE 4K1EA 3TGKE 2HOBA 1SB1H 2XYAA 3SBKA 4DY7B 4ZXXH 2HVYB 3MO3A 1F92A 1CBWB 4Y8XA 1BZXE 1ELTA 2OQUA 3S7HB 3KQDA 4K2YA 3ELAH 4AG2A 4XFQA 4QT8C 4I8JA 1P9UA 1V2VT 1MH0A 4X2YA 4ISIH 1AD8H 4NCYA 1QY6A 3Q77A 1O31A 1QJ6B 1D3QB 1ELBA 1MTUA 4O9VA 4JZDH 1D6RA 3A8DA 3SO3A 1RFNA 4UFEH 4WVPE 5C67A 1YPHC 2STBE 3OY5U 1TLDA 4H4FA 4IMQA 3WY8A 2KCPA 3RXIA 2H5CA 2WV4A 2D26C 4X8VH 4B2AA 5GIBA 1YF4A 4BANB 4KP0A 5EPNA 1LKBA 2FX4A 1GI3A 4LZ4B 1SOTA 2GVFA 4WMDA 1TNLA 4CRCA 4NWKA 1QA7A 1E79D 3PMAB 2BY9X 1XXDA 3MWIU 4X8UH 1ZOMA 5F03A 3LJOA 3ODFA 3A87A 1GMDF 2ZTXA 7KMEH 5A8ZA 2F91A 1TRYA 1C2MA 1P3EA 1HAGE 2PV9B 1A3EH 1VITG 4E05H 4Q7ZA 5JPMH 3MNXA 1V2WT 1XUJA 2W7UA 1T8NA 5T6GA 2ZFQH 3RU4T 1XUGA 1Z71A 1BMMH 2FYRA 4AFZA 1RIWB 2D8WA 1C5MD 2ZU4A 1HJAC 1TALA 2ZDMA 1Q3XA 2W3IA 3TK6A 3GS9A 2BLOA 1L4ZA 1UTMA 1GG6C 2UUJB 2DE9A 1TIOA 1T8MA 1O3KA 4AFSA 1FY5A 3MU0A 1FPHH 2GD4B 4AG1A 1GJ5H 3RXHA 5KECA 1FZZA 3MOCA 2F9BH 2ZGCA 2ZU2A 3HKIB 2PGQB 1AWHB 3SUGA 9ESTA 3FVFB 1TNGA 1EZUC 4IGDA 5IDKA 1O2OA 2IPQX 3ZZ6A 5FPSA 3DSOA 5FPTA 4TY7A
chains in the Genus database with same CATH topology
1O32A 3M37A 5GXPA 4Q80A 4DIIH 5EPYA 1AB9C 4IW4E 3SJOA 1T4UH 1INCA 1ESAA 2PWXA 3AASA 2ZQ2A 1QBOA 2WINI 1BHXF 2TIOA 3PTNA 3FZDA 2XC5A 3P92A 2Z6BD 4D76A 2Z9LA 1EP5A 3RXGA 2HNTC 2ZWLH 4NIVA 3F6UH 1C5NH 3TU7H 1AWFH 1XUHA 4ABEA 2ZDLA 2VINA 1GHZA 1O3EA 4Q7XA 3Q76A 3RXAA 3U1JB 1GBLA 2H1UA 1OWKA 2H9HA 1XVMA 1Y5BT 1BA8B 3IG6B 2ODQA 4DG4A 1FIWA 1YPEH 1SGNE 1AQ7A 3L3TA 1MAXA 2NU4E 3SUEA 1RTLA 1SLUB 1GCDA 2JETB 4AORA 1RTKA 3M3VA 3UQVA 2ILNA 2FO9A 1HAIH 2VIVA 4ABHA 2P8OC 4E06H 1W12U 3GCOA 1LHEH 4K5ZA 1S83A 1O2RA 3LKWA 2IPHA 1TPSA 2QCYA 2J9NA 1C1OA 3NKKA 1IQIA 3U69H 3ODDA 3SV9A 1ZSLA 2B7DH 3UNRA 2GCHF 1YLCA 4OS1A 1DUAA 4YZUA 1SGTA 2R2WU 1BTZA 2BB4A 2UWLA 2ESTE 3UTUH 1BBRK 4I33A 1UVPA 1G9IE 4ZKRU 1HAOH 1WAYB 1C2GA 2BLWA 1Q2WA 1BUIA 2ANYA 1C1WH 1ORFA 2VB0A 3PO1C 1MCVA 1P0SH 1GCTB 3KNXA 1BOQA 3W94A 1C9TA 4YTAA 3W95A 3NPSA 1LHGH 4ZHMU 1SI5H 4AYYB 2C8WB 5DP9A 1BT7A 3QWCH 1LVOA 1SHHB 1L1JA 2J94A 2AERH 1OOKB 2HVXA 4BAOB 3EA8A 1T7CA 4NIWA 3RXDA 1P04A 1TMTH 2XTTB 1IQLA 2BDGA 4A6LA 4K69A 3ZYEA 1KXBA 1F2SE 5C5NA 1MTNC 1HJ9A 1A3BH 3LH1A 3SORA 1A4WH 5J4QA 1SGEE 3TLOA 2GCTC 1NTPA 1MKXH 3RXMA 8KME2 4A7IB 1WQVH 1O5AB 3C1KA 1QJ1B 1ZMJA 1GI0A 1S6FA 5EG4A 2Y5GA 2CGAA 3RP2A 1QBVH 4Q2KA 1C2FA 2O9QA 3LGTA 2GZ8A 2A32A 2Z94A 4YESB 3UWJH 4INHA 4UFFH 1B5GH 1UK4A 2C90B 3A8CA 2WPKS 2A5IA 1MU6B 4NG9H 1YM0A 5SGAE 1EPTA 3H7OA 5DP4A 3T28A 2V3OH 2AMQA 4U2WA 5E2PA 1C5QA 1AHTH 4Y7AA 1OKXA 1AVXA 2ANMH 3OX7U 3MHWU 5F6MA 2Q6DA 2HPQH 4FUHA 3LGVA 4Y0YE 5GPIB 1HNEE 2RA3A 4NWLA 3ATWA 5AFYH 1CSOE 3QLPH 2VNTA 3UIRA 1P9SA 1O2YA 1PPBH 2XW9A 3A84A 4O97A 3ZVBA 1AFEH 1ETTH 5E0HA 1C2HA 2CF9H 3VPKA 3E6PH 4A1TA 4YLUA 1P2MA 2A4OA 1UTPA 4TWWA 4CREA 1AE5A 4MNWA 4X8TH 1VCPA 4ABJA 8ESTE 4GHQA 1OYTH 5AFZH 3ZZ9A 1QIXB 2VGCC 5FX5A 4XDEA 3UNSA 1BRUP 1HJAB 4WF8A 2ZHWH 1K1LA 1GHVH 2O8WA 1GG6B 1TPOA 1L0ZA 1QFKH 2O8MA 2QGRA 3DHKH 1QQUA 1O2ZA 5TJXA 3SNAA 2BQ7B 2A31A 4RSPA 1DITH 1QL9A 4XBCA 2AEIH 2AMDA 4DOQA 1GHAG 1VZQH 2P59A 4Y7BA 2YOLA 4A5TS 2A5AA 3LGUA 2IOTA 1KIGH 3NUMA 2EI7A 4I8LA 2BQ6B 1BIOA 4HGCA 1C5LH 4UONA 4DGJA 5EW1H 2BVSH 2ASUB 1ELCA 1GBJA 1GMCG 1WOFA 2B0FA 3TK9A 1AB9B 4BAKB 3FAOA 1WU1A 3E8LA 3KEEA 1DPOA 1LHCH 1MTWA 1UTQA 3HGNA 2WPMS 1KXFA 4ZROA 3RXEA 1J17T 3LGIA 2XCNA 1EASA 2PUQH 4UFGH 3M36A 4FU7A 1SLWB 4B73A 4BOHA 3A7WA 3SGQE 3RXKA 3SI3H 1C1MA 2QN5T 1IQEA 1ARBA 3LONA 2A7CA 1D3TB 2ZCLP 1YPMH 4YT7H 1OP2A 1TGNA 2Z9JA 1FY1A 3SI4H 5L6NH 1HAYB 2VIOA 1GBKA 1WUNH 4FVDA 1NRNH 2P8OB 1W8BH 1UVSH 3DT0H 1FUJA 2BXTH 2FPZA 1E36B 1J8AA 3A83A 1Y59T 2R2MB 3KQEA 4JK6A 2A4QA 1IQGA 2ZHDA 1C5ZB 4JZ1A 5ESBA 1KXCA 4X1PU 2NU1E 1GJ7B 1Y3WA 1D3PB 1TX8A 4OGXA 3P95A 1VITF 2OUAA 3BTEE 4B74A 1VR1H 1B0EA 1TA6A 5AHGH 3SU1A 3PMBB 4WY3A 1EKBB 3PTBA 3PO1B 3K9XB 3CENA 1A2CH 4YOGA 3S69A 2ZG0H 1C2JA 1PPZA 2H9TH 3RMNH 1KY9A 1UTNA 3BTWE 2DE8A 1QBNA 3QGNB 1HAXB 3U8RH 4RKOB 3VXFH 3M7QA 2ZHFH 3E90B 3F9EA 3RXRA 5E2OA 1K1IA 2JH0D 4BAMB 1FDPA 3R3GB 2BYAX 4YLQH 1J15A 1RS0A 1OWEA 3S7KB 1O2MA 2FOMB 2O8UA 3P70B 3T62A 1Z1JA 1P3CA 1MTNB 3UOUA 3ZVAA 1GJ9B 2AMPA 2CF8H 2W26A 1GJDB 2GP9B 2XBYA 2GCTB 1ZMNA 1C5PA 3V13A 4OGYA 1THSH 2HWLB 2YNBA 1EAIA 3IWMA 1KTSB 3RC6A 1QA0A 3GY3A 1BITA 2PKAB 1OWJA 3DFLA 5K0HA 1ID5H 1YGCH 2EI8A 1CT0E 1SBWA 3GY7A 1KXEA 1XUKA 1C5WB 1UK3A 2SNVA 5E8EH 5DP8A 1IQKA 3BIVH 3MH4A 4MVNA 2BD7A 4JCNA 1ZLRA 1ZHMA 1O35A 1MD7A 2ZTYA 5EQSA 3S9BA 3RXJA 4OS2A 1GJ6A 1Z6JH 1ANCA 1YPKH 2SNWA 1RTFB 3RMLH 3GYLB 3B23B 3KL6A 5E0JA 4X1QU 1L4DA 3P17H 1PPFE 3A7VA 3NZIA 4GCHG 3JZ1B 4YOIA 3ATIA 3SQEE 3G01A 1O5GH 4GSOA 2BDHA 3BTTE 1EAWA 1C5UA 2DUCA 1FJSA 1AZZA 2ZKSA 5JBBS 3MNCA 1G3BA 1AIXH 1O33A 3SUDA 1J9CH 1HRTH 4A1VA 2PTCE 1AZ8A 1BMLA 4FUGA 1TBQH 2F9OA 2VGCB 3LDXH 2XC0A 1BBRH 1HGTH 1V2QT 3RXOA 1YBWA 1THPB 3VB5A 2UUFB 2Z9KA 5C2ZA 4ZH8A 1S0RA 3SJKA 1GJBB 3SNBA 1QRZA 1OWIA 3AVZA 1P10A 3UPEA 1UTOA 2OC8A 1FXYA 1DXPA 2ZPRA 1BMNH 3HK6B 3ZVGA 2A5KA 2W3KA 3V3MA 1NROH 1SGQE 1DM4B 1GJ4H 1BJUA 3PLKA 1DXWA 1SVPA 2F9UA 1GDNA 1C5SA 3UR6A 3RDZA 1GL0E 1O2GH 5ESTE 4DT7B 1ELEE 3JZ2B 3AAVA 4ZHAA 4HTCH 1PPEE 4GPGA 5HXFA 1DWCH 2FS8A 3SUFA 1UTLM 2C4FH 3VXEH 1TABE 5FX6A 5JBCS 1OPHB 1TA2A 1C2IA 1Y5UT 4KTUA 2Y7XA 1PQAA 2ZFTA 8GCHG 4K1SA 4O3UA 5JBTA 1G3DA 4X6MA 3TIUA 4CH8B 4CRDA 4E7NA 1V2RT 2FESH 1WTHD 5A09A 1MQ5A 2M5TA 1HAVB 2LPRA 2G52A 4HZHA 4ZAEA 1E0FD 3DUXH 1L1GA 2SGPE 2R3YA 2XWAA 1HXFH 2Z3CA 1MKWK 2OBQA 4NSVA 1SGYE 3SW2B 1A0LA 1LVBA 1XMNB 2P94A 1C5TA 2ZP0H 3RXSA 1Y8TA 3U1IB 1P02A 1C2DA 4DURA 4X6OA 3F9FA 1BRBE 1H9LB 4JMYA 1ACBE 5AVDA 3ATKA 3MO9A 3TVJB 1JBUH 2AIPA 4F4OC 9LPRA 1GI1A 1JMOH 3ZZAA 3K6ZA 4B2CA 2ZC9H 4J2YB 2G5VA 1MU8B 5DK1A 3M5LA 4KTSA 2ZGBH 3TJUA 4TPYA 3V12A 1FY3A 4NSYA 2PSYA 4WXVA 2BD4A 2WV5A 3GDUA 2C3SA 1C1RA 3PV4A 2WPHS 1T32A 2IJOB 3T2NA 3Q3KA 2BOKA 3A89A 3A7TA 1AVGH 3MO6A 2Z3EA 4AFUA 1A1RA 2VH0A 4ISNA 5DP3A 3TJVA 2VWMA 1OP8A 1G3EA 1NS3A 2H9EH 2QXHA 4NIYA 2G8TA 1GHAF 2WUBA 1LKAA 3HPTB 1ZTLA 1ZGVA 3LIWA 3FP6E 3DA9B 4Y6DA 5LPRA 1XX9A 2THFB 1O2XA 1D9IA 1MCTA 2R9PA 4VGCC 5PTPA 4UEHH 2STAE 4OS4A 3BTHE 1GMCF 2CJIA 3M5OA 3NWUA 1H9IE 5EQQA 2HPPH 3E16B 1W14U 2ZFSA 1WYKA 3HKJB 2HGTH 4OS5A 1BDAA 1FAXA 3BTGE 3TK5A 1ANDA 1H1BA 1QTFA 3URDA 1ZGIA 2UWPA 1P06A 2Y81A 1UCYE 4ABGA 2GV6A 4CRBA 5T6FA 2FP7B 1MTSA 1V2JT 3RXLA 3Q00A 1ZJKA 2FTLE 3QTOH 3UUZA 1O5CB 4NZQA 4AX9H 1UK2A 3TH3H 4Y11E 7ESTE 1QCPA 1QB9A 1O5EH 1C1TA 2P3UB 4IMZA 1S0QA 1TGTA 2BDCA 1NO9H 4TWYA 4E7RG 2EA3A 2CN0H 4WJG2 1P09A 4Y79A 3ZZ7A 1OP0A 2GDEH 3UNQA 2C93B 2J2UA 3SJ8A 1NT1A 1EOJA 1NRSH 1QQ4A 4BTIB 1O37A 2EC9H 1IOEA 1KDQB 4NFFA 2A7JA 2GX4A 2RCEA 1CGJE 4Y71A 1OWDA 2Z7FE 1KLIH 4ASHA 3LPRA 1SPJA 4FUCA 2TGDA 1GMHG 2XRCA 1XUIA 1GI9B 1MBMA 2G4TA 2G5NA 2CV3A 1UMAH 3K6YA 1V2ST 1A7SA 5L2YH 3CS0A 2SGDE 3LC5A 1C2EA 1DUEA 2GT8A 4J1YA 2SGQE 1N8OC 1P01A 1HXEH 3GDVA 2BTCE 1TNJA 2BVXH 1FIZA 1GDUA 1TX7A 3FP7E 5EXMA 1V2KT 1G36A 1W7XH 1E34B 1C5YB 5DG6A 2KAIB 2FOGA 3EAJA 2FLRH 1N1LA 1OXGA 1PJPA 2A4RA 4RN6A 3O8DA 1K22H 2PGBB 2TGPZ 5FBEA 2Y5FA 4XSKU 3EDXB 3C27B 1GI2A 5C20A 5JB8S 1D6WA 3PWBA 1IQNA 3LGWA 2AGEX 1AMHA 1V2MT 2FOFA 5DP6A 1NFXA 5A0CA 3MMGA 1AU8A 4INLA 6CHAC 3A86A 3U8OH 7GCHG 2QF0A 1C2KA 2H6MA 5CHAC 1DFPA 1W0ZU 3LH3A 1L1NA 1Y3YA 2ZPQA 1G32B 3UWIA 1P8VC 4LXBH 1GHXH 4DVAU 4NA9H 3VEQB 2J95A 5F8ZA 1ELFA 3QTVH 5HM2A 3F9HA 2QYIA 2XC4A 3T26A 3BSQA 2WYGA 3D65E 4NFEA 3T5FH 4FU8A 3ZZ3A 4WH6A 1EQ9A 1O3OA 2ZF0H 1W13U 3M5MA 1GDQA 1A5HA 1P2JA 1HIAB 1N6XA 3F68H 4AFQA 3SV6A 2PFEA 2ZCKP 4B2BA 1DY9A 1A5IA 5LH8A 1GVLA 2P3TB 1ZPCA 1P2NA 2FI3E 2OC7A 1X7AC 1YP9A 1GI7B 5C5OA 4KGAA 3LJJA 5GWZA 1WV7H 2ZCHP 4CRGA 2ZEBA 4GCHF 1SQAA 3SV2H 3DD2H 4X1RU 3A7YA 4CRAA 1P2IA 1BB0B 2VIPA 2ZDNA 3S9AA 5DP7A 4BAHB 1LCYA 1YCPM 1YKTA 1F0TA 1K21H 2ZZUH 1H9HE 3GOVB 3TGJE 1YPGH 1VCQA 3SU3A 1EATA 1NN6A 1WTGH 2FLBH 2HALA 1GJ8B 1IHTH 2W5EA 1XUFA 2Z9GA 3SHCH 5G4BA 4Y8ZA 1ESTA 1DS2E 2VU8E 2FOCA 4B71A 3A82A 1TMBH 3ZVEA 1EX3A 4D7FA 1Y3XA 2BD2A 1CT4E 3FP8E 5FCKA 3MFJA 3PMHB 1S81A 3T29A 1O5FH 2ZNKH 1QB1A 3KGPA 1JWTA 2BDYA 4RKJB 2Y7ZA 1YCPH 1QHRB 2PKAA 2QF3A 4CHAC 1TNIA 4VGCB 1HBTH 1ZTKA 1J14A 4MPVA 2TBSA 1ELAA 2GTBA 4LZ1H 2ALPA 4UD9H 1SC8U 1O2UA 4B76A 2F9NA 3BV9B 5DGJA 2SGEE 4IC6A 3PM3A 2ANKH 5EU8A 4AGJA 4I31A 1AE8H 1NC6A 1SFIA 3I29A 8GCHF 1F0UA 1QGFA 4FUFA 1RJXB 4ZXYH 3MU8A 4ABIA 1O2NA 3QGJA 1DVAH 3QO6A 1LQEA 2FX6A 2P95A 5FCRA 2ODPA 1C5RA 1O2IA 2BDAA 4GHTA 3M35A 1SGPE 3KCGH 1DE7H 4MQAA 4CR9A 4R8TB 1AKSB 2HRVA 1ZSKA 3O8RA 4MPWA 1Z8IB 4X2VA 4JK5A 5TCAA 1SGDE 1XKAC 3RLWH 1SGRE 3FANA 2NU0E 5L2ZH 4WXIA 3NCLA 4I7YH 4Y8YA 1SLXB 3STJA 5A8YA 4CRFA 2A4GA 1GWAA 3UR9A 1Z8RA 3FZZA 1NFYA 1GBCA 3ZVDA 2FZZA 3SQHE 1MZDA 3E0PB 3BG8A 2BLVA 2XWBI 5C1XA 2OD3B 4MG3A 1DSUA 1JIRA 2ALVA 1VGCC 2G00A 4DJZB 1RGQA 1P57B 3RXUA 2QV1A 2BZ6H 5A8XA 3EE0B 1ZRKA 3MYWA 1GBIA 7LPRA 1N8OB 4CBNA 2WPIS 1LDTT 2SFAA 4X6NA 1GBBA 3GY4A 4CH2B 3LOXA 2ULLA 3HATH 5JDUB 1RXPA 2ZGHA 2XBXA 4JYTA 4XE4A 5GDSH 1KYNA 1HAZB 1CHGA 6GCHG 1O2VA 2FODA 4MDSA 2J4IA 2UUKB 1TFXA 1O2PA