2HVXA

Discovery of potent, orally active, nonpeptide inhibitors of human mast cell chymase by using structure-based drug design
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of potent, selective, orally active, nonpeptide inhibitors of human mast cell chymase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chymase
total genus 52
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hvxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hvxA02
5A8YA 4NSYA 3V3MA 1GJ7B 2HVXA 5DGJA 1TMTH 3SJOA 5C2ZA 3A85A 3KGPA 2B0FA 3LGTA 2BHGA 2ZEBA 3OY6U 1KDQB 1NT1A 1H9IE 1HJ9A 2PTNA 1TGNA 1DDJA 2BDIA 2PWXA 2W7SA 1W7GH 1QJ1B 1KLJH 1B5GH 1IQJA 3E3TA 3HGNA 4DG4A 1BBRH 3GY2A 3OX7U 1SG8B 1C5MD 3RC4A 3E16B 1NROH 1DXWA 2BDYA 2D2DA 2ZHWH 4Q7YA 2ZPSA 1J15A 1V6DA 1HYLA 1KLIH 1NZQH 1O2IA 1OS8A 3ZZ6A 4ZAEA 4LZ4B 1UTLM 1AUJA 4FUDA 1YPJH 4BTUB 1ZR0A 1BJVA 3LT3A 1C2JA 1DUEA 4A6LA 2A7JA 4O9VA 3ZZDA 1TNLA 1G37A 1O2PA 3NWUA 3F9FA 3SQHE 4Y11E 2G00A 3M3TA 1QTFA 2ZFFH 1MCVA 4A92A 3CP7A 4X1NU 1MCTA 4OS6A 2A31A 3SHAH 1Z1JA 1SI5H 5C1YA 3ZVAA 2ZFTA 3KQCA 2H1UA 3RXOA 4ZXYH 3EE0B 1Z6JH 1UK2A 1QBOA 4RKOB 2OD3B 1KXAA 1QY6A 1EPTA 4DCDA 3DA9B 1O3NA 1JIMA 3TVJB 4AORA 2H2ZA 1VITG 2QF3A 3KNXA 1W7XH 4MDSA 1SGYE 2W5EA 3S9AA 3SW2B 1SLUB 4ISLA 3SU0A 3VXEH 1LPZB 2FOGA 3QZRA 4Y7BA 1AFQB 3SV8A 3NPSA 4VGCC 1W0YH 1HFDA 3O8RA 3BTKE 5LGOA 3GICB 3D49H 2TGPZ 2ZGJA 3DFJA 1FY5A 1TWXB 4FU7A 2SGPE 2VIPA 1A7SA 5EQSA 3PMHB 2WPIS 3VEQB 2QYIA 1KXEA 4KTUA 1YPHE 1LHEH 1GBAA 2ALVA 2QIQA 2VVUA 3A7VA 2YNAA 5EW2H 1SBWA 1UTNA 1C2EA 1EB2A 2R9PA 1QQ4A 1BMNH 2AMDA 1D9IA 5DJ7A 4JZFH 2AGGX 2J92A 5E8EH 3O8CA 1ELAA 2FOEA 1UVOA 3A7TA 5CHAC 4BAQB 2VWMA 1FV9A 1DOJA 5FBEA 4CRAA 1MTSA 3DFLA 4GUXA 1L4DA 4HFPB 1CT4E 3P95A 1O5DH 1GVLA 3SJ8A 3M5MA 2CMYA 1EJAA 1WOFA 1AFQC 5JBAS 3MH6A 3BG4B 2Y6TA 4HI3A 1SSXA 5FBIA 3MHWU 1ZHPA 2NU2E 3A82A 3BTME 5DP3A 1JBUH 1PPFE 1YM0A 4M7GA 1F7ZA 1BITA 1O5GH 1AZZA 2SGFE 1O3EA 2ZGXH 1CA0C 1O2XA 1MQ6A 3RXAA 1V2KT 1K1LA 1P01A 2RDLA 2HALA 4BTTB 2BD3A 8ESTE 1CHOG 2WINI 2ZPQA 2GDEH 3NXPA 1N6XA 3S7KB 4FVDA 4NA9H 4R0IA 1GHVH 4DURA 3ZZ3A 4Y7AA 5CE1A 4B2AA 2PSXA 3T5FH 3SGAE 4OS7A 2BY9X 4O03A 2QCYA 4CRDA 4XDEA 1PPGE 2JKHA 4IW4E 1K28D 1CBWB 4IC5A 3GDUA 2HNTE 4MQAA 4VGCB 1NFYA 1ELTA 2WPMS 3PLKA 2GX4A 1CQQA 2A7CA 1C1RA 4GPGA 1WTGH 3SUEA 1GI7B 1WUNH 1C1SA 1O3IA 4AB8A 1BTWA 1O2JA 1ARBA 3UTUH 5EU8A 1BIOA 1HJ8A 2BX4A 1RFNA 1BTPA 2FZZA 1QFKH 2RCEA 1P09A 1CHGA 3LGUA 2ZO3H 1GI5A 1LDTT 3TGJE 2VIDA 1BTZA 1P3EA 1LKAA 4IMZA 4H4FA 1ESTA 5A0AE 2FPZA 4JZ1A 2WPKS 1C5VA 4ABAA 4X1SU 4BAMB 2BVXH 3TK6A 5GXPA 3U1JB 3A7YA 5FX5A 1D6RA 5J4SA 1P9SA 1V3XA 1TYNA 2J9NA 1LVMA 1GGDB 4MNVA 1BRBE 3UQVA 1RJXB 3UQOA 1BJUA 1LVBA 4YESB 3RC5A 2G81E 3TNTA 1S0QA 2C90B 3LIWA 1U6QA 4TY7A 1VITF 4X6NA 1MMJN 3O8BA 5JPMH 1TONA 2CHAC 1AWFH 1GGDC 1L1GA 4D8NA 5IDKA 5DP4A 3SI4H 1NY22 1TGSZ 2TBSA 4JMYA 1SLVB 3P6ZB 3SUFA 3ZVFA 1G3DA 4UFGH 1WAYB 1DX5M 1KXBA 1KLTA 1GI2A 4FUCA 1GG6C 3ODFA 2VH6A 1V2VT 3SV7A 2XC0A 2PR3A 2EI6A 2G4UA 2UWLA 2B8OH 1O3OA 2P3TB 1BMAA 2H9HA 1IQIA 4NA7A 1ZPBA 4NSVA 5DP8A 1C1PA 4TY6A 1EZSC 1DANH 1UVPA 3BTEE 3SU4A 1P12E 1TPOA 1NPMA 2SNVA 1C2HA 4Y71A 1UTPA 2A5AA 3STJA 2Y5FA 3CENA 5AF9H 1O5FH 1GBLA 2QF0A 2BMGB 9ESTA 4KTSA 4RKJB 3ZVGA 1P11E 1F5LA 1FI8A 1KTSB 4B1TA 3UR6A 1GI0A 3M36A 2C4FH 1Z8JB 1DLKB 1O2MA 1GMHG 2C3SA 4A1TA 3U8TH 4X2WA 1HPGA 3GCTF 4WH8A 1FMGA 1BZXE 2VIWA 1C5LH 2SNWA 4YM9A 4OGXA 2FYQA 1Y59T 2V3HH 1ETRH 2H9EH 1PPCE 2ESTE 3LGYA 1BHXB 2ZGHA 1O2VA 4AB9A 1TOMH 1G30B 2LNCA 1SOZA 2V6NA 5AFYH 5JDUB 2OINA 4K1EA 4U30A 3RU4E 3SQEE 3BTWE 2A32A 3NK8A 1AI8H 1SMFE 2FO9A 3ATKA 4WXVA 2Y5GA 1HGTH 3JZ2B 5BRRE 2R0KA 1WBGB 3MI4A 4YTAA 1A5HA 1QJ7B 3M7UA 1NO9H 1EAUA 1GCTB 4KP0A 3M7TA 3EYDA 1F2SE 1ACBE 4FXGH 1GCTC 3FP8E 2K1QA 4JZIA 3PWBA 3S0NA 3GISB 3SUGA 1PQ5A 1CA0B 5DK1A 5K7RA 1O2YA 3ZV8A 1H9LB 2BLWA 1CHOF 1EQ9A 1QL8A 1T8MA 1SFIA 2IN2A 2F91A 2Q6FA 3HATH 4ABDA 1GHBG 4GHTA 1INCA 2VNTA 1G3BA 3F6UH 4AG1A 2BXUH 2ZZUH 3GDSA 1EB1H 4GCHF 5C5OA 1GJDB 3RXIA 1C5OH 3SGBE 1OWEA 1ZRBA 1S84A 7LPRA 2CXVA 1SQTA 3KQEA 3T25A 2G52A 1GJBB 1O3PB 3Q77A 4INHA 4NCYA 2FP7B 4ZUHA 1E38B 4X8TH 3A88A 4WY3A 1O3BA 3RXMA 3V7TA 3D62A 2GCHG 2F9VA 2O8TA 3MO9A 1OOKB 3SU2A 2F9OA 1PPEE 1TMBH 2XCFA 1SHYA 4MG3A 1LPGB 2J4IA 4WMEA 1CU1A 1RIWB 1KYNA 4Q2KA 1O2OA 2JH0D 4X2VA 4ZKRU 4JK6A 1P06A 1FDPA 5A0CA 1FONA 2BOHB 4QT8C 2VGCB 2ZHFH 3LJOA 2A4GA 4IN2A 3GY4A 1A1RA 1P2QA 1TBZH 1AUTC 1GBEA 3SGQE 5A09A 1Y3XA 3KEEA 2VB0A 1ZGVA 1YYY1 1AE8H 2GP9B 3SJ9A 1IOEA 4MNXA 3LGVA 1TNKA 5C1UA 1EAWA 2BY6X 1Z6EA 1ZYOA 1XKBC 2AFQB 2FS9A 1TBRH 3TH3H 1C1MA 1JMOH 1SGQE 4ZHLU 1P2OA 4YLUA 5A8XA 1XVOA 2GZ9A 1EUFA 1DM4B 3D65E 2EA3A 3OTJE 3BTFE 1ZTJA 1GHWH 1V2NT 3RM0H 1BA8B 1H8IH 2BVRH 3VB7A 1D3TB 1W10U 4LXBH 1NFUA 1DLEA 5FAHA 1TIOA 3Q00A 3GCOA 1LKBA 1LVOA 3TPIZ 3UOPA 3T29A 2GTBA 3O8DA 1K1JA 5PTPA 3LKWA 1ZPZA 1L0ZA 3ATMA 3FP7E 1V2OT 3I29A 1C2GA 5A2MH 3MU5A 3SORA 1O36A 2THFB 2FOCA 2Y7XA 1EATA 1XMNB 1TOCB 3GY7A 3MU0A 1OWHA 2VJ1A 4AFZA 4UONA 4FUJA 1DY9A 1THRH 3SV2H 3OY5U 1AB9C 1RIWC 3GYLB 5IYTA 4WVPE 2A5KA 2B9LA 3PLBA 4NIVA 2JETB 1CT2E 3VB3A 2AMPA 1Y3WA 1GL1A 1HAYB 1EOLA 2PGBB 4FUIA 1BQYA 4ABBA 5GPIB 3P8FA 2ZDNA 1PQ7A 1OXGA 1FIWA 4XE4A 4ABHA 2VIOA 1AWHB 2BYAX 4CR9A 1E0FD 1NRNH 3RU4D 3ZZBA 4B76A 2BZAA 1SGRE 4OS1A 4X2XA 1RTLA 4K2YA 3UY9A 1B7XB 2J38A 3RXBA 1C5SA 1S82A 1SPJA 2GVFA 3AW0A 3S9BA 1AVWA 1H1BA 3A8AA 3SNBA 1ELBA 4E7NA 4FUEA 1TX6A 3QZQA 1FPCH 1SC8U 4FUFA 4AYVB 1GI3A 5FPTA 1B0EA 1BTHH 2Z7FE 3HKJB 1J9CH 1QQUA 1QBNA 3LONA 2XC4A 3F9EA 4ISHH 2EC9H 4UD9H 5EGMA 1Y8TA 1HLTH 4DT7B 2BM2A 5EW1H 2GZ7A 1F5RA 2O8MA 1C2KA 1SL3A 1F0TA 4XBBA 4E7RG 5L6NH 2QXIA 2Z3CA 1C2IA 1SGDE 3TJNA 1P3CA 2D26C 5H4IB 3TK5A 1Y3UA 5C5NA 1V2LT 2ZG0H 2P3UB 1XUJA 4Q7XA 1O3JA 1MD8A 5DP7A 1OWDA 1QA0A 1TRNA 3RXRA 1EP5A 4ESTE 5T6FA 1QJ6B 3SN8A 3W94A 3A84A 2XTTB 3K6YA 1GJ5H 1Z1IA 1LO6A 2GCTB 1Q31A 1GHXH 2A4OA 3FZZA 2AGIX 1Y5UT 1P2JA 1P9UA 4B2CA 5T6GA 1MKXH 4TYDA 1T8OA 2CN0H 5J4QA 3FANA 2XYAA 5EPYA 1GI9B 3Q3KA 1YPHC 1G2MA 3A87A 2A2QH 2G55A 1PQ8A 4FUBA 2C8ZB 1FAXA 4RN6A 1P10A 1JIRA 3A7XA 1O33A 3ZVDA 2SGDE 1C4Y2 2Z9JA 4AGJA 2G5VA 4B71A 4XBDA 4JZDH 4Q7ZA 4I7YH 2ZP0H 1YF4A 3TJUA 1C1UH 1ZGIA 1ZTKA 1ZJDA 3LGIA 1EZXC 1T8NA 2ZCKP 2AH4X 4UEHH 1GDUA 1DUAA 3KQBA 1L4ZA 3SOSA 2UUYA 3A8CA 1OPHB 3UOUA 1H8DH 3E0PB 1OP0A 1YCPK 5JBTA 4O3TA 3SV9A 1AE5A 2QY0B 4D9QA 2OC7A 1SGIB 2PFEA 2B5TB 1TA6A 2ZDKA 4U2WA 1TQ0B 2AIQA 1MTNC 1UO6A 1MKXK 1FQ3A 5EXNA 1QRZA 1FIZA 2PKSC 2O8WA 2BD9A 3RM2H 3MOCA 3PWCA 1A46H 3VB5A 2C8XB 1D3QB 2ZCHP 1THSH 3E90B 1UVSH 1UK4A 3BTTE 4JCNA 3VPKA 1SGCA 2OLGA 1ORFA 4ZHMU 5HM9A 3MH4A 1SGFA 4OS4A 1HUTH 2J94A 1O5AB 3IG6B 4ZXXH 4K8BA 3BTHE 1XVMA 1NRRH 1UTMA 2G4TA 1JRTA 3T27A 1CSOE 2O8LA 4B75A 5HMAA 1A0LA 2BLVA 2Z6BD 3EAJA 5CHAB 8KME2 1G3CA 2O9QA 2XWAA 4AGKA 3OU0A 4CH8B 2W7UA 3STIA 3RXKA 4B2BA 1BT7A 4I33A 1ABJH 2ZU2A 3SZNA 5LH8A 1K1OA 1SGPE 2HOBA 1O35A 2GCHF 2ZF0H 1O5CB 3AVZA 3LPRA 2NU4E 3EA9A 3LU9B 4UFEH 5CMXH 1CT0E 1VR1H 2M5TA 4UE7H 4Y8ZA 1ELDE 1QB1A 2ODQA 3MNCA 2GZ8A 1G32B 1GHAF 2PW8H 1ANCA 1T7CA 2C8WB 1A0HB 4E06H 2BQ6B 6GCHF 3ZZ7A 3G01A 1FXYA 4NFEA 1GBIA 4Z6AH 1F0UA 1GHBF 1BRAA 1WV7H 5EXLA 2VWOA 1SGFG 3MTYA 1KXFA 2AGEX 4YOGA 2Q1JA 2XCNA 3SJIA 5T3HA 1Q2WA 1ZPCA 1QCPA 1QB6A 3NZIA 1DFPA 2BDHA 4XFQA 1Z8IB 3FFGA 2F9UA 4J1YA 1P03A 2ZA5A 1EJNA 4YOIA 2PLXA 1AN1E 4CBOA 1TNIA 1BTXA 1Z7KA 2XNIA 1KY9A 1Z8GA 1C1TA 1S6FA 5F8XA 2G5NA 3OSYA 1C5YB 1QBVH 5FX6A 1VZQH 2Z9IA 4DIHH 4XBCA 1GBFA 1MKWH 2G51A 2GV6A 4X1RU 2VIQA 4KELA 1S85A 4Y8XA 1TLDA 2P8OC 4Y79A 2FX6A 2P8OB 4HGCA 1GWAA 3UREA 1AVXA 1LVYA 4AFQA 2CGAA 2BOKA 3M37A 1MQ5A 1OWJA 2YOLA 1VJAU 3QUMP 1BCUH 2SGAA 4WH6A 1QGFA 1N6YA 3F68H 3GOVB 5GJ4B 2NWNA 5B6OA 2BQWB 1P8VC 4ZMAH 2EI7A 3SI3H 5FHTA 3A7ZA 1ZTLA 2FX4A 3SBKA 2Y80A 1IQLA 1XUIA 3ZVEA 2EEKA 3ZZ4A 7ESTE 2AIPA 1SGNE 1FY1A 1MKWK 4X2YA 4ABJA 3TNSA 2RA0A 4MVNA 1HNEE 2QXGA 1QRXA 5LPRA 3TITA 3PB1E 1HJAB 1YLCA 2GCTC 3U1IB 1N1LA 4AX9H 2ZU1A 3QO6A 4BAHB 1VCWA 2Q6DA 2HNTF 3IITA 2YNBA 1O38A 1DXPA 1BRUP 1P2NA 3S69A 3UWIA 3ZZ5A 1SFQB 2BDGA 2BD8A 3RXJA 4BANB 3B8JA 4GCHG 3P8GA 3RXDA 2VVVA 2C8YB 5JYIA 1NU9A 1W3CA 1K22H 4IMQA 2QXHA 2ZCLP 2OUAA 1HAHH 1L1JA 3Q3YA 4U32A 3UNRA 5TCAA 1ANEA 2KAIB 4JYTA 1O3HA 1V2ST 1ELCA 2ZECA 3F9GA 1ANBA 1OP2A 1YBWA 2A1DB 2WUBA 5E0GA 5HYOA 1HAOH 1PPHE 6CHAB 2Z3EA 3EA7A 2TGTA 1O2SA 1E34B 3DUXH 2XC5A 3RMOH 1UTOA 4HZHA 1O2QA 2Z3DA 4JK5A 1OYQA 3T2NA 1D3DB 1QL7A 2Z94A 1P05A 5BPEA 1V2TT 5L2YH 3QDZB 1GVKB 3Q3XA 3K6ZA 1W14U 1V2RT 4I8LA 2FOBA 3JZ1B 2OC0A 1UCYK 3DD2H 1KIGH 4WMFA 1FN6A 5EQQA 1MZDA 5DP9A 1GI8B 1UHBA 3E6PH 3LGWA 5FPSA 1AZ8A 4O3UA 3T26A 1ID5H 1K2I1 4UFFH 5DP5A 3VB6A 1IQKA 3DHKH 5AHGH 2XWBI 2OXSA 4TWYA 1C5NH 1QL9A 1M9UA 1BBRE 2FESH 3TGIE 1MZAA 1AQ7A 1RTFB 1O2TA 2XXLA 3TK9A 4CRGA 5E0HA 3AAVA 3M61U 4Y0YE 5LPFA 1P02A 1GI4A 1A4WH 4NFFA 2CF8H 4X6MA 2A45B 2ZQ1A 1NESE 1DT2A 2P95A 1TAWA 3RXFA 1N8OC 3SNDA 1UVUH 4NIXA 5EXMA 2BDBA 1MAXA 1RS0A 1PYTD 2FLBH 1C1OA 1O2KA 2BTCE 4D76A 3GCTG 5L2ZH 4B73A 1PPBH 2W3KA 1GG6B 2Y81A 4B74A 3PROA 2JETC 4OS5A 2AYWA 2FOFA 2ANMH 4MPVA 6LPRA 4AYYB 4BTIB 4MPXA 1H4WA 1E36B 2ZWLH 2ZDMA 2V0BA 1CA8B 4GVUA 2B7DH 3RXTA 5C20A 3MYWA 1BTUA 4BXSA 1P0SH 3BG8A 1O5BB 5AFZH 2P59A 5T6DA 1IQEA 2FEQH 4BAOB 1GMDG 3SJKA 1YPEH 2ODPA 1P2KA 1ZSJA 5FXLA 4F4OC 1XKAC 2BXTH 2F9NA 4D7FA 1Y5AT 3MNXA 2EI8A 3H7TA 2XBWA 1W8BH 3P17H 3SO3A 1BMLA 2HRVA 1YPLH 4TPYA 1C5XB 3U8OH 1LHCH 2BZ6H 3SU5A 1W2KH 3BF6H 3SU1A 1XUFA 2QV1A 2ZGCA 2UUFB 1OYTH 2UUJB 3ODDA 1EASA 3MNBA 1C5UA 2HPPH 1OP8A 1HAXB 1BUIA 4MPWA 3B23B 4O97A 1MBQA 1N8OB 5F8TA 3TU7H 1E37B 4F49A 4NGAH 1DWBH 4X8VH 4D9RA 1O3DA 3U8RH 2DE8A 4Z0KA 1YLDA 1EAIA 4ZROA 3RXVA 1RXPA 3ZVCA 3GY5A 3U9AH 2VINA 1T8LA 2ZTZA 2ZDLA 1BHXF 1ZMLA 2XW9A 4ASHA 1C2FA 3VB4A 1C5PA 2BY7X 2XRCA 2F9PA 1OWIA 1ZJKA 3BV9B 2OCVB 1O32A 4ISNA 4SGBE 1DWDH 1HXFH 1GBCA 4OGYA 2QGRA 2ANYA 1ELVA 3RMLH 1C1QA 1BB0B 3HK3B 3GY6A 3S9CA 1C4V2 2FTMA 7GCHF 2A4QA 3P8OA 1IQHA 4Q80A 1GBMA 1NC6A 2QXJA 1LTOA 1A5GH 2ZKSA 3VFEA 1YC0A 1A2CH 2FI3E 3LH1A 2ZIQH 3TLOA 2OBOA 1LHFH 1FUJA 4AFSA 1C5WB 2AEIH 1GHZA 2PKAA 1VITH 1BTYA 1QRWA 4CRBA 1DICA 1K1NA 1TRMA 1AMHA 1V2WT 1PQAA 1JRSA 1GJ9B 4HTCH 2BDAA 1O2WA 4THNH 2CF9H 1ELEE 4I32A 4GSOA 3A83A 1G36A 3PYHA 2J34A 1TRYA 3RMNH 1NU7B 3NUMA 4KTCA 1P04A 1EPTC 1C5TA 1O34A 3BIUH 1KXDA 3H7OA 1BDAA 4I31A 2FI4E 1G2LA 1FY8E 3TJOA 1HXEH 1LQEA 3TH2H 2PGQB 5JB8S 2LPRA 3FAOA 1DSTA 1FY4A 4KKDA 8GCHG 1NRSH 4INLA 3GDVA 1K9OE 1FAKH 1AO5A 2A7HA 2BDCA 2XBXA 2GKVE 1EKBB 2WPLS 4YOJA 4LK4A 4UDWH 1T4VH 1EOJA 1UMAH 3PLPA 3PTBA 1A61H 3EQ0H 1GHAG 1LPKB 1EP6A 2I6SA 1VGCB 2ZNKH 4BNRA 3UUZA 1ZZZA 1FJSA 4MNWA 4YT6H 2A2XH 1UTJA 4YT7H 2BQ7B 1GI1A 1AFEH 2PUQH 4I8GA 1GBDA 1HIAA 1CGJE 1C1WH 1PJPA 3V13A 2OQ5A 2FI5E 1J16A 1NTPA 4X6PA 1GVZA 1RGQA 1T31A 2P93A 2RA3A 1C9TA 1LHGH 2PKAB 4I8KA 2WV4A 3KF2A 4ABGA 4LZ1H 1ELGA 1QR3E 2QAAA 1AKSB 1S83A 2H6MA 1UJ1A 4UFDH 3P70B 5I25A 4IN1A 4SGAE 1O2GH 2R2MB 3LC3A 3QWCH 4GAWA 3UFAA 2HNTC 1FLEE 1EZQA 2ZI2H 4CR5A 3PV4A 4CHAC 1V2QT 2SGQE 5F8ZA 3RC6A 1HBTH 5LPEA 5EQRA 1DITH 1ETSH 3L3TA 1HJAC 1TBQH 4WWYA 2GGVB 2DUCA 2FDAA 2FTLE 1SR5C 4FUHA 5GCHG 1HAPH 3SNEA 4GLYA 3ZZ9A 5AVDA 1YPGH 1IQFA 1DSUA 3F1SB 3GY3A 1XUHA 2SFAA 3AASA 3M7QA 4FUGA 4Y0ZE 3KQDA 4ISOA 3LOXA 1S6HA 1SLWB 2VWLA 1MD7A 4TPIZ 3A8BA 3RXCA 2ZU5A 4OS2A 1WCZA 1C1NA 3M5OA 4NA8A 1SHHB 3RXPA 1EXFA 5EG4A 2ZU3A 1QIXB 3PMBB 1AKSA 3TJVA 2Z9LA 1TGBA 1O5EH 1A0JA 3NCLA 1WU1A 4CRFA 1MTNB 5GDSH 4GHQA 1C2MA 1K1MA 1TA2A 5ABWA 2ZTXA 1QURH 2ZFSA 4IC6A 1MTVA 4ISIH 4H6SB 2GV7A 1HIAB 2A0QB 1FNIA 1V2UT 2AERH 3AW1A 1WQSA 1TFXA 1TQ7B 9LPRA 3N7OA 3SU6A 1WQVH 5I46H 2PV9B 3GYMA 2P16A 1TGCA 1AIXH 1HAIH 1V2MT 2C93B 1HAVB 4K1SA 3CS7A 2Y5HA 1W0ZU 2Y82A 4IGDA 2ZC9H 2ANWA 2OP9A 1TX8A 3MMGA 4CRCA 4IBLH 4CHAB 1HV7A 3U69H 3EA8A 5DP6A 1GHYH 3M3VA 2OTVA 3ZYEA 1TX7A 1FZZA 2BD5A 3RXQA 1ZLRA 2GDDA 3SU3A 4DGJA 2F3CE 5TCCA 3I77A 1O3KA 4AOQA 1ZSLA 3L6PA 3S7HB 1O3GA 5DO4H 1Z8RA 1AB9B 4U01A 2CV3A 3E1XB 2GT7A 1TE0A 3RUOA 6GCHG 2BX3A 3MO6A 1MH0A 4X0WU 1OSSA 2OBQA 3P8NA 3MNSA 2PKSB 1C5QA 1GBBA 2W26A 4DJZB 4RSPA 1O3FA 4Y6DA 4Y76A 1G9IE 1LCYA 5C67A 1MU6B 2PHBA 3PO1C 2A4RA 2ALPA 3C27B 5TJXA 1TPSA 1XM1A 3L33A 3H5CB 5FCRA 2ZFRH 1C4U2 1TNGA 6CHAC 1XUGA 3AAUA 3VGCC 3DT0H 1L1NA 3SNAA 1V2PT 1D6WA 3IWMA 1NRPH 3E8LA 1BMMH 1Z71A 1GJ6A 3P92A 4E05H 3WY8A 1JOUB 3LC5A 3M3SA 1ESBA 4ABFA 4DY7B 1ETTH 4Y10E 5GIBA 1AD8H 2WYGA 1O2RA 4AZ2B 1O0DH 1MBMA 1SQAA 2XBVA 1SVPA 2VU8E 4FVBA 1AY6H 3A81A 3RXHA 4ZKSU 3HGPA 4NIYA 3Q76A 4K1TA 3RDZA 3R0FA 3MU4A 1O30A 2IJOB 5FCKA 2PUXB 1O3LA 3ELAH 1QNJA 3QGNB 2H5DA 3MWIU 2OC8A 3HPTB 5G4BA 3ZZ8A 4CREA 1KSNA 1UTQA 3V12A 1DWEH 4BAKB 1O2LA 2R2WU 1UCYH 3SV6A 3SHCH 3E91A 1BRCE 3ATLA 3K9XB 1C9PA 1K1IA 2IPHA 2P94A 5EPNA 1A5IA 1SGEE 3RP2A 2R0LA 4DOQA 4R8TB 2F83A 3KIDU 3UPEA 4A1VA 5L30H 2TIOA 2VVCA 2ZFPH 4YO9A 1A3BH 1YPMH 2VH0A 2ZPRA 1J8AA 4DVAU 2A5IA 3RLWH 2J2UA 2P3FH 3QN7A 3LH3A 3MU8A 4NWKA 1BOQA 2QC2A 3UR9A 4I8HA 1S0RA 1O3MA 2STAE 1HAVA 3T62A 1CGHA 3QTOH 4JYVH 4LOYH 1T32A 1TGTA 1YGCH 3PMAB 2ULLA 3URDA 3ATIA 2FOMB 1HB0B 1TNJA 4TWWA 7GCHG 4H42U 1X7AC 1Q3XA 2WPJS 1RTKA 1YCPM 1W12U 3RXUA 5HXFA 1GDNA 2WUCA 1O37A 3QLPH 3D23A 2NU1E 1D4PB 1HAGE 1GPZA 4K3JA 1CBWC 3M5NA 3ZV9A 2V3OH 1O2NA 1HCGA 2AMQA 2FWWA 2PTCE 1UHBB 4K60A 2FLRH 3BSQA 1K1PA 5GCHF 1OWKA 1GCDA 1MAYA 1SB1H 3MH7A 3RXSA 1ESAA 3TH4H 1UK3A 2FXRA 1OX1A 1GJ8B 4FU9A 2H9TH 1AGJA 2J95A 4D7GA 1NFXA 1ZMJA 2VWNA 4A1XA 3A7WA 1J14A 3QTVH 3VGCB 1C2DA 5E2PA 2STBE 2ZHQH 2ZU4A 5HM2A 3QK1A 3UIRA 1AVGH 3URCA 2ZGBH 3GCHB 1EX3A 1UCYE 2FS8A 3PO1B 2OQUA 3ZYDA 1O3AA 4CBNA 3A86A 5E0JA 1KDQA 1GL0E 5K0HA 1O39A 1TPPA 1THPB 1DY8A 3ITIA 4ZKOU 3PM3A 4BXWA 2Z9KA 1GJCB 1WSSH 1ZSKA 2UUKB 1ZMNA 1S81A 4INKA 1UTKA 4MPUA 3MO3A 2NU3E 3RLYH 1DE7H 1CO7E 4WF8A 2GMTC 3RXEA 2BVSH 3PMJA 1P2IA 3RXGA 1F92A 1TALA 2GMTB 3GY8A 4X1PU 3GCNA 4NZLA 3PTNA 5ESTE 1ELFA 4NWLA 4H6TA 2GT8A 4NG9H 1DVAH 3KHVA 4X8UH 3K2UA 3MFJA 3LJJA 4ZHAA 1UVTH 2Z9GA 3TIUA 1B0FA 1QA7A 2AS9A 3UWJH 4X8SH 1PFXC 3QX5H 3FVFB 1HRTH 1MU8B 1JXPA 2D8WA 4MTBA 5F03A 4WXIA 8GCHF 4WMDA 4K69A 1K21H 1XXDA 1Y3YA 3RU4T 3FZDA 1IQMA 2KAIA 2R3YA 4NIWA 1J17T 1S5SA 2ZTYA 2NU0E 1IQNA 4A7IB 4CH2B 2Y7ZA 3EDXB 1TPAE 1LHDH 3B9FH 1O31A 4KGAA 2JH5D 2BD2A 1C2LA 2BB4A 2QN5T 2PSYA 1KXCA 1HDTH 1A3EH 4PROA 3HKIB 4JZEH 3MU1A 4IS5A 5C3NA 1Y3VA 1F0RA 3W95A 1D3PB 1HAZB 1GMCG 5E2OA 2QA9E 1OKXA 1V2JT 1YCPH 1AU8A 3C1KA 2FODA 1O2UA 1EAXA 2CHAB 2WV5A 1EJMA 1GBHA 1TNHA 1TB6H 1LQDB 4JYUH 2FM2A 2WPHS 6ESTA 3E0NB 1SLXB 3OYPA 3A8DA 1VCQA 1C5ZB 1DS2E 1GJ4H 1DWCH 2BLOA 2VGCC 1CE5A 1KTTB 1IAUA 3CS0A 3KCGH 1JWTA 8LPRA 1GMCF 1PYTC 1G3EA 1XXFA 1C1VH 1FPHH 2W3IA 4I8JA 2BD4A 4X1QU 1P2MA 1SOTA 1Y5BT 3TGKE 1VCPA 1IQGA 1ZOMA 2UWPA 3ZZCA 2TGDA 1NFWA 5ESBA 2R3UA 4YLQH 5FPYA 3A80A 3F9HA 1P57B 3BN9A 3ZVBA 4ZKNU 1ABIH 2CJIA 2O8UA 3RMMH 1T4UH 1SQOA 1ARCA 2TPIZ 1H9HE 4WJG2 1GDQA 4MLFB 3NKKA 2Q6GA 2JH6D 2HLCA 2TRMA 2BY5X 3BEFB 1W13U 3A89A 3ZZAA 2V35A 1YP9A 3V0XA 1NN6A 5A0BA 4J2YB 5DPAA 1VJ9U 1TMUH 5DKMA 4NZQA 1L2EA 1O2HA 3SNCA 1EPTB 1O2ZA 4A5TS 1XUKA 4AFUA 4ABEA 4Y8YA 5SGAE 3BEUA 1W11U 2FOAA 3FP6E 1FN8A 1NS3A 2FMJA 1VGCC 2ODYB 5EOKA 3EGKH 3U98H 5JB9S 4FU8A 5JBBS 1O3CA 2ZHEH 2ANKH 2IOTA 2ZQ2A 1IHTH 1ZHRA 1DPOA 1ANDA 1QB9A 3ATWA 3K65B 1LMWB 1ZRKA 3MH5A 1GBKA 2FYRA 4MNYA 1PPZA 3RXLA 4XOJA 4AN7A 4XSKU 1GMDF 1QHRB 5GWZA 2ASUB 2ILNA 2UWOA 3QGJA 2BD7A 2TGAA 3BTQE 1IHSH 2WYJA 1MTUA 1CVWH 1RRKA 5A8ZA 4K8YA 5DG6A 3BTGE 1WYKA 2HPQH 1NM6A 1EZUC 2F9BH 4K5ZA 1FY3A 3SUDA 5ETXA 2ZHDA 1RD3B 4BOHA 2BLQA 3LDXH 3I78A 2SGEE 1ZHMA 1GBJA 2FOHA 2G8TA 1AHTH 1YPKH 1E35B 1CGIE 1SGTA 1TABE 2H5CA 3KL6A 3UNQA 2D1JA 1WTHD 1GJAB 3UNSA 5JBCS 2ZDVH 2OC1A 4DW2U 2XBYA 3M5LA 5EODA 4ABIA 7KMEH 3BIVH 2ZFQH 3ESTA 3BEIB 3T28A 1NRQH 1GBTA 2I6QA 4YZUA 3VXFH 4DIIH 3ENSB 3GCHC 1XX9A 3M35A 3KN2A 2VIVA 2DE9A 4X6OA 1F5KU 2ZDAH 2HWLB 1MUEB 2FIRH 3BG4C 3R3GB 1C5RA 1F0SA 1YKTA 2BY8X 2GD4B 3HK6B 5HGGA 3BTDE 4ZH8A 1MTWA 1BBRK 1GMHF 2RG3A 4AG2A 1GI6A 5F6MA 5C1XA 2HGTH
chains in the Genus database with same CATH superfamily
5A8YA 3F0PA 4NSYA 3V3MA 1GJ7B 2HVXA 5DGJA 1TMTH 3SJOA 5C2ZA 3A85A 3KGPA 1MABB 2B0FA 3LGTA 2BHGA 2V3MA 2ZEBA 3OY6U 1KDQB 1NT1A 1H9IE 1HJ9A 2PTNA 4RT1A 1TGNA 1DDJA 4Q4LA 2BDIA 2PWXA 2W7SA 1W7GH 1QJ1B 1KLJH 1B5GH 1IQJA 3E3TA 3HGNA 4DG4A 1BBRH 3GY2A 3OX7U 1SG8B 1C5MD 3RC4A 4XRNA 3E16B 1NROH 1DXWA 2BDYA 2D2DA 2ZHWH 4Q7YA 2ZPSA 1J15A 5KEDA 1V6DA 1HYLA 1KLIH 1NZQH 1O2IA 1OS8A 3ZZ6A 4ZAEA 4LZ4B 1UTLM 1AUJA 4FUDA 1YPJH 4BTUB 1ZR0A 1BJVA 3LT3A 1C2JA 1DUEA 4A6LA 2A7JA 4O9VA 3ZZDA 1TNLA 1G37A 1O2PA 2HVYB 3NWUA 3F9FA 3SQHE 4Y11E 2G00A 3M3TA 1QTFA 2KZ4A 1MCVA 2ZFFH 4A92A 3CP7A 4X1NU 1MCTA 4OS6A 1S6LA 2A31A 3SHAH 1Z1JA 1SI5H 5C1YA 3ZVAA 2ZFTA 3KQCA 2H1UA 3RXOA 4ZXYH 3EE0B 1Z6JH 1UK2A 1QBOA 4RKOB 2OD3B 1KXAA 1QY6A 1EPTA 4DCDA 3DA9B 1O3NA 1JIMA 3TVJB 4AORA 2H2ZA 1VITG 2QF3A 3KNXA 1W7XH 4MDSA 5DSFA 1SGYE 2W5EA 2LP6A 3S9AA 3SW2B 1SLUB 4ISLA 3SU0A 3VXEH 1LPZB 2FOGA 3QZRA 4Y7BA 1AFQB 3SV8A 3NPSA 4VGCC 1W0YH 1HFDA 2CK3D 5FL7D 3O8RA 3BTKE 5LGOA 3GICB 3D49H 2TGPZ 2LELA 2ZGJA 3F2HA 3DFJA 1FY5A 1TWXB 4FU7A 2SGPE 2VIPA 1A7SA 5EQSA 3PMHB 2WPIS 3VEQB 2QYIA 1KXEA 4KTUA 1YPHE 1LHEH 1GBAA 2ALVA 2QIQA 2VVUA 3A7VA 2YNAA 5C0TA 5EW2H 1SBWA 1UTNA 1C2EA 2KCOA 1EB2A 2R9PA 1QQ4A 1BMNH 2AMDA 1D9IA 3NRLA 5DJ7A 4JZFH 2AGGX 2J92A 5E8EH 3O8CA 1ELAA 2FOEA 1UVOA 2EY4C 3A7TA 5CHAC 4BAQB 2VWMA 1FV9A 1DOJA 5FBEA 4CRAA 1MTSA 3DFLA 5EJLA 4GUXA 1L4DA 4HFPB 1CT4E 3P95A 1O5DH 1GVLA 3SJ8A 3M5MA 2KCAA 2CMYA 1EJAA 1WOFA 1AFQC 5JBAS 3MH6A 3BG4B 2Y6TA 4HI3A 1SSXA 5FBIA 3MHWU 1ZHPA 2NU2E 3A82A 3BTME 5DP3A 1JBUH 1PPFE 1YM0A 4M7GA 1F7ZA 1BITA 1O5GH 2YMSC 1AZZA 2SGFE 1O3EA 2ZGXH 1CA0C 1O2XA 1MQ6A 3RXAA 3VG8A 1V2KT 1K1LA 1NBMD 1P01A 2RDLA 2HALA 4BTTB 2BD3A 8ESTE 1CHOG 2WINI 2ZPQA 2GDEH 3NXPA 1N6XA 3S7KB 4FVDA 4NA9H 4R0IA 1GHVH 4DURA 3ZZ3A 4Y7AA 5CE1A 4B2AA 2PSXA 3T5FH 3SGAE 4OS7A 2BY9X 4O03A 2QCYA 4CRDA 4XDEA 1PPGE 2JKHA 4IW4E 1K28D 1CBWB 4IC5A 3GDUA 3MQKC 2HNTE 4MQAA 4VGCB 1NFYA 1ELTA 2WPMS 3PLKA 2GX4A 1CQQA 2A7CA 1C1RA 4GPGA 1WTGH 3SUEA 1GI7B 1WUNH 1C1SA 1O3IA 2J98B 4AB8A 1BTWA 4DT4A 1O2JA 1ARBA 3UTUH 5EU8A 1BIOA 1HJ8A 2BX4A 1RFNA 1BTPA 2FZZA 1QFKH 2RCEA 1P09A 1CHGA 3LGUA 2ZO3H 1GI5A 1LDTT 3TGJE 2VIDA 1BTZA 1P3EA 1LKAA 4IMZA 4H4FA 1ESTA 5A0AE 2FPZA 4JZ1A 2WPKS 1C5VA 4ABAA 4X1SU 4BAMB 2BVXH 3TK6A 5GXPA 3U1JB 3A7YA 5FX5A 1D6RA 5J4SA 1P9SA 1V3XA 1TYNA 2J9NA 1LVMA 1GGDB 4MNVA 1BRBE 3UQVA 1RJXB 3UQOA 1BJUA 1LVBA 4YESB 3RC5A 2G81E 3TNTA 1S0QA 2C90B 3LIWA 1U6QA 4TY7A 1VITF 4X6NA 1MMJN 3O8BA 5JPMH 1TONA 2CHAC 2EQNA 1AWFH 1GGDC 1L1GA 4D8NA 5IDKA 5DP4A 3SI4H 1NY22 1TGSZ 2TBSA 4JMYA 5CDFE 1SLVB 3P6ZB 3SUFA 3ZVFA 1G3DA 4UFGH 1WAYB 1DX5M 1KXBA 1KLTA 1GI2A 4FUCA 2KCYA 1GG6C 3ODFA 1KMHB 2VH6A 1V2VT 3SV7A 2XC0A 3DSOA 2PR3A 1YLNA 2EI6A 2G4UA 2UWLA 2B8OH 1O3OA 2P3TB 1BMAA 2H9HA 1IQIA 4NA7A 1ZPBA 4NSVA 5DP8A 1C1PA 4TY6A 1EZSC 1DANH 1UVPA 3BTEE 3SU4A 1P12E 1TPOA 1NPMA 2SNVA 2XOKD 1C2HA 4Y71A 1UTPA 2A5AA 3STJA 4XD7D 2Y5FA 3CENA 5AF9H 1O5FH 1GBLA 2QF0A 2BMGB 9ESTA 4KTSA 4RKJB 3ZVGA 1P11E 1F5LA 1FI8A 1KTSB 4B1TA 3UR6A 1GI0A 3M36A 2C4FH 1Z8JB 1DLKB 1O2MA 1GMHG 2C3SA 4A1TA 3U8TH 4X2WA 1HPGA 3GCTF 4WH8A 1FMGA 1BZXE 2VIWA 1C5LH 2SNWA 4YM9A 4OGXA 2FYQA 1Y59T 2V3HH 1ETRH 2H9EH 1COWD 1PPCE 2ESTE 3LGYA 5CHBA 1BHXB 2ZGHA 1O2VA 4AB9A 1TOMH 1G30B 2LNCA 1SOZA 2V6NA 5AFYH 5JDUB 2OINA 4K1EA 4U30A 3RU4E 3SQEE 3BTWE 2A32A 3NK8A 1AI8H 1SMFE 2FO9A 3ATKA 4WXVA 2Y5GA 1HGTH 3JZ2B 5BRRE 2R0KA 1WBGB 2OK5A 3MI4A 4YTAA 1A5HA 1QJ7B 3M7UA 1NO9H 1EAUA 1GCTB 4KP0A 3M7TA 3EYDA 1F2SE 1ACBE 4FXGH 1GCTC 3FP8E 2K1QA 4JZIA 3PWBA 3S0NA 3GISB 3SUGA 1PQ5A 1CA0B 5DK1A 5K7RA 1O2YA 3ZV8A 1H9LB 2BLWA 1CHOF 1EQ9A 1QL8A 1T8MA 1SFIA 2IN2A 2F91A 2Q6FA 3HATH 4ABDA 1GHBG 4GHTA 4ASUD 1INCA 2VNTA 1G3BA 3F6UH 4AG1A 2BXUH 2ZZUH 3GDSA 4OM9A 1EB1H 4GCHF 5C5OA 1GJDB 3RXIA 1C5OH 3SGBE 1OWEA 1ZRBA 1S84A 7LPRA 2CXVA 3PV2A 1SQTA 3KQEA 3T25A 2G52A 1GJBB 1O3PB 3Q77A 4INHA 4NCYA 2FP7B 4ZUHA 1E38B 4X8TH 3A88A 4WY3A 1O3BA 3RXMA 3V7TA 3D62A 2GCHG 2F9VA 2O8TA 3MO9A 1OOKB 3SU2A 2F9OA 1PPEE 1TMBH 5HIYA 2XCFA 1SHYA 4MG3A 1LPGB 2J4IA 4WMEA 1CU1A 1RIWB 1KYNA 4Q2KA 1O2OA 2JH0D 4X2VA 4ZKRU 4JK6A 1P06A 1FDPA 5A0CA 1FONA 2BOHB 4QT8C 2VGCB 2ZHFH 3LJOA 3PRDA 2A4GA 4IN2A 3GY4A 1A1RA 1P2QA 1TBZH 1AUTC 1GBEA 3SGQE 5A09A 1Y3XA 3KEEA 2VB0A 1ZGVA 1YYY1 1AE8H 2GP9B 3SJ9A 1IOEA 4MNXA 3LGVA 1TNKA 5C1UA 1EAWA 2BY6X 1Z6EA 1ZYOA 1XKBC 2AFQB 2FS9A 1TBRH 3TH3H 1C1MA 1JMOH 1SGQE 4ZHLU 1P2OA 4YLUA 5A8XA 1XVOA 2GZ9A 1EUFA 1DM4B 3D65E 2EA3A 3OTJE 3BTFE 1ZTJA 1GHWH 1V2NT 3RM0H 5B6LA 1BA8B 1H8IH 2BVRH 3VB7A 1D3TB 1W10U 4LXBH 1NFUA 1DLEA 5FAHA 1TIOA 3Q00A 3GCOA 1LKBA 1LVOA 3TPIZ 3UOPA 3T29A 2GTBA 3O8DA 1K1JA 5PTPA 3LKWA 1ZPZA 1L0ZA 3ATMA 3FP7E 1V2OT 3I29A 1C2GA 5A2MH 3MU5A 1SQRA 3SORA 1O36A 2THFB 2FOCA 2Y7XA 1EATA 1XMNB 1TOCB 3GY7A 3MU0A 1OWHA 2VJ1A 4AFZA 4UONA 4FUJA 1DY9A 1THRH 3SV2H 3UAIC 3OY5U 1AB9C 1RIWC 3GYLB 5IYTA 4WVPE 2A5KA 2B9LA 3PLBA 4NIVA 2JETB 1CT2E 3VB3A 2AMPA 3FOAA 1Y3WA 1GL1A 1HAYB 1EOLA 2PGBB 4FUIA 1BQYA 4ABBA 5GPIB 3P8FA 2ZDNA 1PQ7A 1OXGA 1FIWA 4XE4A 4ABHA 2VIOA 1AWHB 2BYAX 4CR9A 1E0FD 1NRNH 3RU4D 3ZZBA 4B76A 2BZAA 1SGRE 4RI0A 4OS1A 4X2XA 1RTLA 4K2YA 3UY9A 3U28C 1B7XB 2J38A 3RXBA 1C5SA 1S82A 1SPJA 2GVFA 3AW0A 3H09A 3S9BA 1AVWA 1H1BA 3A8AA 3SNBA 1ELBA 4E7NA 4FUEA 1TX6A 3QZQA 1FPCH 1SC8U 4FUFA 4AYVB 1GI3A 5FPTA 1B0EA 1BTHH 2Z7FE 3HKJB 1J9CH 1QQUA 1QBNA 3LONA 2XC4A 3F9EA 4ISHH 2EC9H 4UD9H 5EGMA 1Y8TA 1HLTH 4DT7B 2BM2A 5EW1H 1YY3A 2GZ7A 1F5RA 2O8MA 1C2KA 1SL3A 4P02A 1F0TA 4XBBA 4E7RG 5L6NH 2QXIA 2Z3CA 1C2IA 1SGDE 3TJNA 1P3CA 2D26C 5H4IB 3TK5A 1Y3UA 5C5NA 1V2LT 2ZG0H 2P3UB 1XUJA 4Q7XA 1O3JA 1MD8A 5DP7A 1OWDA 1QA0A 1TRNA 3RXRA 1EP5A 4ESTE 5T6FA 1QJ6B 3SN8A 3W94A 3A84A 2L74A 2XTTB 3K6YA 1GJ5H 1Z1IA 5T1VA 1LO6A 2GCTB 5EJ1A 1Q31A 1GHXH 2A4OA 3FZZA 2AGIX 1Y5UT 1P2JA 1P9UA 4B2CA 5T6GA 3KYFA 4FETA 1MKXH 4TYDA 1T8OA 2CN0H 3OE7D 5J4QA 3FANA 2XYAA 5EPYA 1GI9B 3Q3KA 1YPHC 1G2MA 3A87A 2A2QH 1W0JD 2G55A 1PQ8A 4FUBA 2C8ZB 1FAXA 1QZ8A 2WSSD 2YMSD 1P10A 1JIRA 4RN6A 3A7XA 1O33A 3ZVDA 2SGDE 1C4Y2 2Z9JA 4AGJA 2G5VA 4B71A 4XBDA 4JZDH 4Q7ZA 4I7YH 2ZP0H 1YF4A 3TJUA 1C1UH 1ZGIA 4B6FA 1ZTKA 1ZJDA 3LGIA 1EZXC 1T8NA 2ZCKP 2AH4X 4UEHH 1GDUA 1DUAA 3KQBA 1L4ZA 3SOSA 2UUYA 3A8CA 1OPHB 3UOUA 1H8DH 3E0PB 1OP0A 1YCPK 5JBTA 4O3TA 3SV9A 1AE5A 2QY0B 4D9QA 2OC7A 1SGIB 2PFEA 2B5TB 1TA6A 2ZDKA 4U2WA 1TQ0B 2AIQA 1MTNC 1UO6A 1MKXK 1FQ3A 5EXNA 1QRZA 1FIZA 2PKSC 2O8WA 2BD9A 3RM2H 3MOCA 3PWCA 1A46H 3DSPA 3VB5A 2C8XB 1D3QB 4YXWD 2ZCHP 1THSH 3E90B 1UVSH 1UK4A 3BTTE 4JCNA 3VPKA 1SGCA 2OLGA 1ORFA 4ZHMU 5HM9A 3MH4A 1SGFA 4OS4A 1HUTH 2J94A 1O5AB 3IG6B 4ZXXH 4K8BA 3BTHE 1XVMA 2M2AA 1NRRH 1UTMA 2G4TA 1JRTA 3T27A 1CSOE 1K0HA 2O8LA 4B75A 5HMAA 1A0LA 2BLVA 2Z6BD 3EAJA 5CHAB 8KME2 1G3CA 2O9QA 2XWAA 4AGKA 3OU0A 4CH8B 2W7UA 3STIA 3RXKA 4B2BA 1BT7A 4I33A 1ABJH 2ZU2A 3SZNA 5LH8A 1K1OA 1SGPE 2HOBA 1O35A 2GCHF 2ZF0H 1O5CB 3AVZA 3LPRA 2NU4E 4RT0A 3EA9A 3LU9B 4UFEH 5CMXH 1CT0E 1VR1H 2M5TA 4UE7H 4Y8ZA 1ELDE 1QB1A 2ODQA 3MNCA 2GZ8A 1G32B 1GHAF 2PW8H 1ANCA 1T7CA 2C8WB 1A0HB 4E06H 2BQ6B 2WV9A 6GCHF 3ZZ7A 3G01A 1FXYA 4NFEA 1GBIA 4Z6AH 1F0UA 1GHBF 1BRAA 1WV7H 5EXLA 2VWOA 1SGFG 2QF4A 3MTYA 1KXFA 2AGEX 4YOGA 2Q1JA 2XCNA 3SJIA 5T3HA 1Q2WA 1ZPCA 1QCPA 1QB6A 3NZIA 4F48B 1DFPA 2BDHA 3OTPA 4XFQA 5F53A 1Z8IB 3FFGA 2F9UA 4J1YA 1P03A 2ZA5A 1EJNA 4YOIA 2PLXA 1AN1E 4CBOA 1TNIA 2W6JD 1BTXA 1Z7KA 2XNIA 1KY9A 1Z8GA 1C1TA 1S6FA 3GS9A 5F8XA 2G5NA 3OSYA 1C5YB 1QBVH 5FX6A 1VZQH 2Z9IA 5EIYA 4DIHH 4XBCA 1GBFA 1MKWH 2G51A 2GV6A 4X1RU 2VIQA 4KELA 1S85A 4Y8XA 1TLDA 2P8OC 4Y79A 2FX6A 2P8OB 4HGCA 1GWAA 3UREA 1AVXA 1LVYA 4AFQA 2CGAA 2BOKA 5KECA 3M37A 1MQ5A 1OWJA 2YOLA 1VJAU 3QUMP 2IPQX 1BCUH 2SGAA 4WH6A 1QGFA 1N6YA 3F68H 3GOVB 5GJ4B 2NWNA 5B6OA 2BQWB 1P8VC 4ZMAH 2EI7A 3SI3H 5FHTA 3A7ZA 1ZTLA 2FX4A 3SBKA 2Y80A 1IQLA 1XUIA 3ZVEA 2EEKA 3ZZ4A 7ESTE 2AIPA 1SGNE 4M9FA 1FY1A 1MKWK 4X2YA 4ABJA 3TNSA 2RA0A 3SYJA 4MVNA 1HNEE 2QXGA 1QRXA 5LPRA 3TITA 3PB1E 1HJAB 1YLCA 2GCTC 3U1IB 1N1LA 4AX9H 2ZU1A 3QO6A 4BAHB 1VCWA 2Q6DA 2HNTF 3IITA 2KR7A 2YNBA 1O38A 1DXPA 1BRUP 1P2NA 3S69A 3UWIA 3ZZ5A 1SFQB 2BDGA 2BD8A 3RXJA 4BANB 3B8JA 4GCHG 3P8GA 3RXDA 2VVVA 1UW7A 2C8YB 5JYIA 1NU9A 1W3CA 1K22H 4IMQA 2QXHA 2ZCLP 2OUAA 1HAHH 1L1JA 3Q3YA 4U32A 3UNRA 5TCAA 1ANEA 2KAIB 4JYTA 1O3HA 1V2ST 1ELCA 2ZECA 3F9GA 1ANBA 1OP2A 1YBWA 2A1DB 2WUBA 5E0GA 5HYOA 1HAOH 1PPHE 6CHAB 3EE7A 2Z3EA 3EA7A 2TGTA 1O2SA 1E34B 3DUXH 2XC5A 3RMOH 3F0OA 1UTOA 4HZHA 1O2QA 2Z3DA 4JK5A 1OYQA 3T2NA 1D3DB 1QL7A 2Z94A 1P05A 5BPEA 1V2TT 2KX4A 3QDZB 1GVKB 5L2YH 3Q3XA 3K6ZA 1W14U 1V2RT 4I8LA 2FOBA 3JZ1B 2OC0A 1UCYK 3DD2H 1KIGH 4WMFA 1YWUA 1FN6A 5EQQA 1MZDA 5DP9A 1GI8B 1UHBA 3E6PH 3LGWA 5FPSA 1AZ8A 4O3UA 3T26A 1ID5H 1K2I1 4UFFH 5DP5A 3VB6A 1IQKA 3DHKH 5AHGH 3SZEA 2XWBI 2OXSA 4TWYA 1C5NH 1QL9A 1M9UA 1BBRE 2FESH 3TGIE 1MZAA 1AQ7A 1RTFB 1O2TA 2XXLA 3TK9A 4CRGA 5E0HA 3AAVA 3M61U 4Y0YE 5LPFA 1P02A 1GI4A 1A4WH 4NFFA 2CF8H 4X6MA 2A45B 2ZQ1A 1NESE 1DT2A 2P95A 1TAWA 1FX0B 3RXFA 1N8OC 3SNDA 1UVUH 4NIXA 5EXMA 2BDBA 1MAXA 1RS0A 1PYTD 1VKYA 2FLBH 1C1OA 1O2KA 2BTCE 4D76A 3GCTG 5L2ZH 3PRBA 3WW7A 4B73A 1PPBH 2W3KA 1GG6B 2Y81A 4B74A 3PROA 2JETC 4OS5A 2AYWA 2FOFA 2ANMH 4MPVA 1W0KD 6LPRA 4AYYB 4BTIB 4MPXA 1H4WA 1E36B 2ZWLH 2ZDMA 2V0BA 3OFND 1CA8B 4GVUA 2B7DH 3RXTA 5C20A 3MYWA 1BTUA 4BXSA 1P0SH 3BG8A 1O5BB 5AFZH 2J98A 2P59A 5T6DA 1IQEA 2FEQH 4BAOB 1GMDG 3SJKA 1YPEH 2ODPA 1P2KA 1ZSJA 5FXLA 4F4OC 1XKAC 2BXTH 2F9NA 4D7FA 1Y5AT 3MNXA 2EI8A 3H7TA 2XBWA 1W8BH 3P17H 3SO3A 4B6EA 1BMLA 2HRVA 1YPLH 4TPYA 1C5XB 3U8OH 1LHCH 2BZ6H 3SU5A 1W2KH 3BF6H 3SU1A 1XUFA 2QV1A 2ZGCA 2UUFB 1OYTH 2UUJB 3ODDA 1EASA 3MNBA 1C5UA 2HPPH 2KCPA 1OP8A 1HAXB 1BUIA 3OEED 4MPWA 3B23B 4O97A 1MBQA 1N8OB 5F8TA 5C0UA 3TU7H 1E37B 4F49A 4NGAH 1DWBH 4X8VH 4D9RA 1O3DA 3U8RH 2DE8A 4Z0KA 1YLDA 3FO8D 3N7DA 3F2GA 1EAIA 3DSGA 4ZROA 3RXVA 1RXPA 5C94A 3N99A 3ZVCA 3GY5A 3U9AH 2VINA 1T8LA 2ZTZA 2ZDLA 1BHXF 1ZMLA 2XW9A 4ASHA 1C2FA 3VB4A 1C5PA 2BY7X 2XRCA 2F9PA 1OWIA 1ZJKA 3BV9B 2OCVB 1O32A 4ISNA 4SGBE 1DWDH 1HXFH 1GBCA 4OGYA 2QGRA 2ANYA 1ELVA 3RMLH 1C1QA 1BB0B 3HK3B 3GY6A 3S9CA 2XNDD 2FTMA 1C4V2 7GCHF 2A4QA 3P8OA 1IQHA 4Q80A 1GBMA 1NC6A 2QXJA 1LTOA 1A5GH 2ZKSA 3DCLA 1YC0A 3VFEA 1A2CH 2FI3E 3LH1A 2KM0A 2ZIQH 3TLOA 2OBOA 3UB0A 1LHFH 1FUJA 3OEHD 4AFSA 1C5WB 2K8IA 2AEIH 1GHZA 2PKAA 1VITH 1BTYA 1QRWA 4CRBA 1DICA 1K1NA 1TRMA 1AMHA 1V2WT 1PQAA 1JRSA 1GJ9B 4HTCH 2BDAA 1O2WA 2WHXA 4THNH 2CF9H 1ELEE 4I32A 4GSOA 3A83A 1G36A 3CNRA 3PYHA 2J34A 1TRYA 3RMNH 1NU7B 4F55A 3NUMA 4KTCA 1P04A 1EPTC 1C5TA 1O34A 3BIUH 1KXDA 3H7OA 1BDAA 2JJ2D 4I31A 2FI4E 1G2LA 1FY8E 3TJOA 1HXEH 1LQEA 3TH2H 5GNDA 2PGQB 5JB8S 2LPRA 3FAOA 1DSTA 1FY4A 4KKDA 8GCHG 1NRSH 4INLA 3GDVA 1K9OE 1FAKH 2GJGA 1AO5A 2A7HA 2BDCA 2XBXA 2GKVE 1EKBB 2WPLS 4YOJA 4LK4A 4UDWH 1T4VH 1EOJA 1UMAH 3PLPA 3PTBA 1A61H 3EQ0H 1GHAG 1LPKB 1EP6A 2I6SA 1VGCB 2ZNKH 4BNRA 3UUZA 1ZZZA 1FJSA 4MNWA 4YT6H 1NBME 2A2XH 1UTJA 4YT7H 2BQ7B 1AFEH 1GI1A 5KGOA 2PUQH 4I8GA 1GBDA 4ACBA 1HIAA 1CGJE 1C1WH 1PJPA 3V13A 4Q63A 2OQ5A 3AK5A 2FI5E 1J16A 1NTPA 4X6PA 1GVZA 1RGQA 1T31A 2P93A 2RA3A 1C9TA 1LHGH 2PKAB 4I8KA 2WV4A 3KF2A 4ABGA 4LZ1H 1ELGA 1QR3E 2QAAA 1AKSB 1S83A 4I86A 2H6MA 1UJ1A 2IJD1 4UFDH 3F3BA 3P70B 5I25A 4IN1A 4SGAE 1O2GH 2R2MB 3LC3A 3QWCH 4GAWA 3UFAA 2HNTC 1FLEE 1EZQA 2ZI2H 4CR5A 3PV4A 4CHAC 1V2QT 2SGQE 5F8ZA 3RC6A 1HBTH 5LPEA 5EQRA 1DITH 1ETSH 3L3TA 3FN8A 1HJAC 1TBQH 4WWYA 2GGVB 2DUCA 2FDAA 2FTLE 1SR5C 4FUHA 5GCHG 1HAPH 3SNEA 4GLYA 3ZZ9A 5AVDA 1YPGH 1IQFA 1DSUA 3F1SB 3GY3A 1XUHA 2SFAA 3AASA 3M7QA 4FUGA 4Y0ZE 3KQDA 4ISOA 3LOXA 1S6HA 1SLWB 2VWLA 1MD7A 4TPIZ 3A8BA 3RXCA 2ZU5A 4OS2A 1WCZA 1C1NA 3M5OA 4NA8A 1SHHB 3RXPA 1EXFA 5EG4A 2ZU3A 1QIXB 3PMBB 1AKSA 3TJVA 2Z9LA 1TGBA 1O5EH 1A0JA 3NCLA 1WU1A 3KQ5A 1MTNB 4CRFA 5GDSH 4GHQA 1C2MA 1K1MA 1TA2A 5ABWA 2ZTXA 1QURH 2ZFSA 4IC6A 1MTVA 4ISIH 4H6SB 2GV7A 1HIAB 2A0QB 1FNIA 1V2UT 2AERH 3AW1A 1WQSA 1TFXA 1TQ7B 1BMFD 9LPRA 3N7OA 3SU6A 1WQVH 5I46H 2PV9B 3GYMA 2P16A 1TGCA 1AIXH 1HAIH 1V2MT 2C93B 1HAVB 4K1SA 3CS7A 2Y5HA 1W0ZU 5DN6D 2Y82A 4IGDA 2ZC9H 2ANWA 2OP9A 5EJZA 1TX8A 3MMGA 4CRCA 4IBLH 4CHAB 5HKKD 1HV7A 3U69H 3EA8A 5DP6A 1GHYH 3M3VA 2OTVA 3ZYEA 2RFKC 1TX7A 3KYGA 1FZZA 2BD5A 3RXQA 1ZLRA 2GDDA 3SU3A 4DGJA 5IK2D 2F3CE 5TCCA 3I77A 1O3KA 4AOQA 1ZSLA 3L6PA 3S7HB 1O3GA 5DO4H 1Z8RA 1AB9B 4U01A 2CV3A 3E1XB 2GT7A 1TE0A 3RUOA 6GCHG 2BX3A 3MO6A 1MH0A 4X0WU 1OSSA 2OBQA 3P8NA 3MNSA 2PKSB 1C5QA 1GBBA 1H8HD 2W26A 4DJZB 4RSPA 1O3FA 4Y6DA 4Y76A 1G9IE 1LCYA 5C67A 1MU6B 2PHBA 3PO1C 4TT3D 2A4RA 2ALPA 3C27B 5TJXA 1TPSA 1XM1A 3L33A 3H5CB 5FCRA 2ZFRH 1C4U2 1TNGA 6CHAC 1XUGA 1SKYE 3AAUA 3VGCC 3DT0H 1L1NA 2PP6A 3SNAA 1V2PT 1D6WA 3IWMA 1NRPH 3E8LA 4Z1MD 1BMMH 1Z71A 1GJ6A 3P92A 4E05H 3WY8A 1JOUB 3LC5A 3M3SA 1ESBA 4ABFA 4DY7B 1ETTH 4Y10E 5GIBA 1AD8H 2WYGA 1O2RA 4AZ2B 1O0DH 3WWBA 1MBMA 1SQAA 2XBVA 1SVPA 2VU8E 4FVBA 1AY6H 3A81A 3RXHA 4ZKSU 3HGPA 4NIYA 3Q76A 4K1TA 3RDZA 3R0FA 3MU4A 1O30A 2IJOB 5FCKA 2PUXB 1O3LA 3ELAH 1QNJA 3QGNB 2H5DA 3MWIU 2OC8A 3HPTB 5G4BA 3ZZ8A 4CREA 1KSNA 1UTQA 3V12A 1DWEH 4BAKB 1O2LA 2R2WU 1UCYH 3SV6A 3SHCH 3E91A 1BRCE 3ATLA 3K9XB 1C9PA 1K1IA 2IPHA 2P94A 5EPNA 1A5IA 1SGEE 3RP2A 2R0LA 4DOQA 4R8TB 2F83A 2L6OA 3KIDU 3UPEA 4A1VA 5L30H 2TIOA 2VVCA 2ZFPH 4YO9A 1A3BH 1YPMH 2VH0A 2ZPRA 1J8AA 4DVAU 2A5IA 3RLWH 2J2UA 2P3FH 3QN7A 3LH3A 3MU8A 4NWKA 1E1RD 1BOQA 4HG6A 2QC2A 3UR9A 4I8HA 1S0RA 1O3MA 2STAE 1HAVA 3T62A 1CGHA 3QTOH 4JYVH 4LOYH 1T32A 1TGTA 1YGCH 3PMAB 2ULLA 3URDA 3ATIA 2FOMB 1HB0B 1TNJA 4TWWA 7GCHG 4H42U 1X7AC 1Q3XA 2WPJS 1RTKA 1YCPM 1W12U 2HLDD 3RXUA 5HXFA 1GDNA 2WUCA 1O37A 3QLPH 3D23A 2NU1E 1D4PB 1HAGE 1GPZA 4K3JA 1CBWC 3M5NA 3ZV9A 2V3OH 1O2NA 1HCGA 2AMQA 2FWWA 2PTCE 1UHBB 4K60A 2FLRH 3BSQA 1K1PA 5GCHF 1OWKA 1GCDA 1MAYA 1SB1H 3MH7A 3RXSA 1ESAA 3TH4H 1UK3A 2FXRA 5C17A 1OX1A 1GJ8B 4FU9A 2H9TH 1AGJA 4FOUC 2J95A 4D7GA 1NFXA 1ZMJA 2VWNA 3PV5A 4A1XA 3A7WA 1EFRD 1J14A 3QTVH 3VGCB 1C2DA 5E2PA 2STBE 2ZHQH 2ZU4A 5HM2A 3QK1A 3UIRA 2J5UA 1AVGH 3URCA 2ZGBH 3GCHB 1EX3A 1UCYE 2FS8A 3PO1B 2OQUA 3ZYDA 1O3AA 4CBNA 3A86A 5E0JA 1KDQA 1GL0E 5K0HA 1O39A 2J97A 1TPPA 1THPB 1DY8A 3ITIA 4ZKOU 3PM3A 1WXRA 4BXWA 2Z9KA 1GJCB 3WWFA 1WSSH 1ZSKA 3N7EA 2UUKB 1ZMNA 1S81A 4INKA 1UTKA 4MPUA 3MO3A 2NU3E 2W6ID 3RLYH 1DE7H 1CO7E 4WF8A 2GMTC 3RXEA 2BVSH 3PMJA 1P2IA 2F4LA 1OHHD 3RXGA 1F92A 1TALA 2GMTB 4TSFD 3GY8A 3W1EA 4X1PU 3GCNA 1H8ED 4NZLA 3PTNA 5ESTE 1ELFA 4NWLA 2QE7D 4H6TA 2GT8A 4NG9H 2V7QD 1DVAH 3F2FA 3KHVA 3OAAD 4X8UH 3K2UA 3MFJA 3LJJA 4ZHAA 1UVTH 2Z9GA 3TIUA 1B0FA 1QA7A 2AS9A 3UWJH 4X8SH 1PFXC 3QX5H 3FVFB 1HRTH 1MU8B 1JXPA 2D8WA 2JJ1D 4MTBA 5F03A 4WXIA 8GCHF 4WMDA 4K69A 1K21H 1XXDA 1Y3YA 3RU4T 2YMSB 3FZDA 1IQMA 2KAIA 2R3YA 4NIWA 1J17T 1S5SA 2ZTYA 2NU0E 1IQNA 4A7IB 4CH2B 2Y7ZA 3EDXB 1TPAE 1LHDH 3B9FH 1O31A 4KGAA 2JH5D 2BD2A 1C2LA 2BB4A 4ACAA 2QN5T 2PSYA 1KXCA 1HDTH 1A3EH 4AC9A 4PROA 3HKIB 4JZEH 3MU1A 4IS5A 5C3NA 1Y3VA 1F0RA 3W95A 1D3PB 1HAZB 1E79D 3ZIAD 1GMCG 5E2OA 2QA9E 1OKXA 1V2JT 1YCPH 1AU8A 3C1KA 2FODA 1O2UA 1EAXA 2CHAB 2WV5A 1EJMA 1GBHA 2RDEA 1TNHA 1TB6H 1LQDB 4JYUH 2FM2A 2WPHS 6ESTA 3E0NB 1SLXB 3OYPA 3A8DA 1VCQA 1C5ZB 1DS2E 1GJ4H 1DWCH 2BLOA 2VGCC 1CE5A 1KTTB 1IAUA 3CS0A 3KCGH 1JWTA 8LPRA 1GMCF 1PYTC 1G3EA 1XXFA 1C1VH 1FPHH 2W3IA 4I8JA 2BD4A 4X1QU 1P2MA 1SOTA 1Y5BT 3TGKE 1VCPA 1IQGA 1ZOMA 2UWPA 3ZZCA 2TGDA 1NFWA 5ESBA 2R3UA 4YLQH 5FPYA 3A80A 3F9HA 1P57B 3BN9A 3ZVBA 4ZKNU 1ABIH 2CJIA 2O8UA 3RMMH 1T4UH 1SQOA 1ARCA 2TPIZ 1H9HE 4WJG2 1GDQA 2KFWA 2AHME 4MLFB 3NKKA 2Q6GA 2JH6D 2HLCA 2TRMA 2BY5X 3BEFB 1W13U 3A89A 2K0QA 2V35A 1YP9A 3V0XA 1NN6A 2QF5A 4J2YB 3ZZAA 5A0BA 5DPAA 1VJ9U 1TMUH 5DKMA 4NZQA 1L2EA 1O2HA 3SNCA 1EPTB 1O2ZA 4A5TS 5HIZA 1XUKA 4AFUA 4ABEA 4Y8YA 5SGAE 3BEUA 1W11U 2FOAA 3FP6E 2WPDD 1FN8A 1NS3A 2FMJA 1VGCC 2ODYB 5EOKA 3EGKH 3U98H 5JB9S 4FU8A 2F43B 5JBBS 1O3CA 2ZHEH 2ANKH 2IOTA 2ZQ2A 1IHTH 1ZHRA 1DPOA 1ANDA 1QB9A 3ATWA 3K65B 1LMWB 1ZRKA 3MH5A 1GBKA 2FYRA 4MNYA 1PPZA 3RXLA 4XOJA 4AN7A 4XSKU 1GMDF 1QHRB 5GWZA 2ASUB 1E1QD 2ILNA 2UWOA 3QGJA 2BD7A 2TGAA 3BTQE 1WDIA 2VBCA 1IHSH 2WYJA 1MTUA 1CVWH 1RRKA 2JDID 4K8YA 5DG6A 5A8ZA 3BTGE 1WYKA 2HPQH 1NM6A 4P00A 1EZUC 2F9BH 4K5ZA 1FY3A 3SUDA 5ETXA 2ZHDA 1RD3B 4BOHA 2BLQA 3LDXH 3I78A 2SGEE 1ZHMA 1GBJA 2FOHA 2G8TA 1AHTH 1YPKH 1E35B 1CGIE 1SGTA 1TABE 2H5CA 3KL6A 3UNQA 4ZCNA 2D1JA 1WTHD 1GJAB 3UNSA 5JBCS 2ZDVH 2OC1A 4DW2U 2XBYA 3M5LA 5EODA 4ABIA 7KMEH 3BIVH 2ZFQH 3ESTA 3BEIB 3T28A 1NRQH 1GBTA 2I6QA 4YZUA 3VXFH 4DIIH 3ENSB 3GCHC 1XX9A 3M35A 3KN2A 2VIVA 2DE9A 3FKSD 4X6OA 1F5KU 2ZDAH 2WZQA 2HWLB 1MUEB 2FIRH 3BG4C 3R3GB 1C5RA 1F0SA 1YKTA 2BY8X 2GD4B 3HK6B 5HGGA 3BTDE 4ZH8A 1MTWA 1BBRK 1GMHF 2RG3A 4AG2A 1GI6A 5F6MA 5C1XA 2HGTH 2JIZD
chains in the Genus database with same CATH topology
5A8YA 4NSYA 3V3MA 1GJ7B 2HVXA 5DGJA 1TMTH 3SJOA 5C2ZA 3A85A 3KGPA 2B0FA 3LGTA 2BHGA 2ZEBA 3OY6U 1KDQB 1NT1A 1H9IE 1HJ9A 2PTNA 1TGNA 1DDJA 2BDIA 2PWXA 2W7SA 1W7GH 1QJ1B 1KLJH 1B5GH 1IQJA 3E3TA 3HGNA 4DG4A 1BBRH 3GY2A 3OX7U 1SG8B 1C5MD 3RC4A 3E16B 1NROH 1DXWA 2BDYA 2D2DA 2ZHWH 4Q7YA 2ZPSA 1J15A 1V6DA 1HYLA 1KLIH 1NZQH 1O2IA 1OS8A 3ZZ6A 4ZAEA 4LZ4B 1UTLM 1AUJA 4FUDA 1YPJH 4BTUB 1ZR0A 1BJVA 3LT3A 1C2JA 1DUEA 4A6LA 2A7JA 4O9VA 3ZZDA 1TNLA 1G37A 1O2PA 3NWUA 3F9FA 3SQHE 4Y11E 2G00A 3M3TA 1QTFA 2ZFFH 1MCVA 4A92A 3CP7A 4X1NU 1MCTA 4OS6A 2A31A 3SHAH 1Z1JA 1SI5H 5C1YA 3ZVAA 2ZFTA 3KQCA 2H1UA 3RXOA 4ZXYH 3EE0B 1Z6JH 1UK2A 1QBOA 4RKOB 2OD3B 1KXAA 1QY6A 1EPTA 4DCDA 3DA9B 1O3NA 1JIMA 3TVJB 4AORA 2H2ZA 1VITG 2QF3A 3KNXA 1W7XH 4MDSA 1SGYE 2W5EA 3S9AA 3SW2B 1SLUB 4ISLA 3SU0A 3VXEH 1LPZB 2FOGA 3QZRA 4Y7BA 1AFQB 3SV8A 3NPSA 4VGCC 1W0YH 1HFDA 3O8RA 3BTKE 5LGOA 3GICB 3D49H 2TGPZ 2ZGJA 3DFJA 1FY5A 1TWXB 4FU7A 2SGPE 2VIPA 1A7SA 5EQSA 3PMHB 2WPIS 3VEQB 2QYIA 1KXEA 4KTUA 1YPHE 1LHEH 1GBAA 2ALVA 2QIQA 2VVUA 3A7VA 2YNAA 5EW2H 1SBWA 1UTNA 1C2EA 1EB2A 2R9PA 1QQ4A 1BMNH 2AMDA 1D9IA 5DJ7A 4JZFH 2AGGX 2J92A 5E8EH 3O8CA 1ELAA 2FOEA 1UVOA 3A7TA 5CHAC 4BAQB 2VWMA 1FV9A 1DOJA 5FBEA 4CRAA 1MTSA 3DFLA 4GUXA 1L4DA 4HFPB 1CT4E 3P95A 1O5DH 1GVLA 3SJ8A 3M5MA 2CMYA 1EJAA 1WOFA 1AFQC 5JBAS 3MH6A 3BG4B 2Y6TA 4HI3A 1SSXA 5FBIA 3MHWU 1ZHPA 2NU2E 3A82A 3BTME 5DP3A 1JBUH 1PPFE 1YM0A 4M7GA 1F7ZA 1BITA 1O5GH 1AZZA 2SGFE 1O3EA 2ZGXH 1CA0C 1O2XA 1MQ6A 3RXAA 1V2KT 1K1LA 1P01A 2RDLA 2HALA 4BTTB 2BD3A 8ESTE 1CHOG 2WINI 2ZPQA 2GDEH 3NXPA 1N6XA 3S7KB 4FVDA 4NA9H 4R0IA 1GHVH 4DURA 3ZZ3A 4Y7AA 5CE1A 4B2AA 2PSXA 3T5FH 3SGAE 4OS7A 2BY9X 4O03A 2QCYA 4CRDA 4XDEA 1PPGE 2JKHA 4IW4E 1K28D 1CBWB 4IC5A 3GDUA 2HNTE 4MQAA 4VGCB 1NFYA 1ELTA 2WPMS 3PLKA 2GX4A 1CQQA 2A7CA 1C1RA 4GPGA 1WTGH 3SUEA 1GI7B 1WUNH 1C1SA 1O3IA 4AB8A 1BTWA 1O2JA 1ARBA 3UTUH 5EU8A 1BIOA 1HJ8A 2BX4A 1RFNA 1BTPA 2FZZA 1QFKH 2RCEA 1P09A 1CHGA 3LGUA 2ZO3H 1GI5A 1LDTT 3TGJE 2VIDA 1BTZA 1P3EA 1LKAA 4IMZA 4H4FA 1ESTA 5A0AE 2FPZA 4JZ1A 2WPKS 1C5VA 4ABAA 4X1SU 4BAMB 2BVXH 3TK6A 5GXPA 3U1JB 3A7YA 5FX5A 1D6RA 5J4SA 1P9SA 1V3XA 1TYNA 2J9NA 1LVMA 1GGDB 4MNVA 1BRBE 3UQVA 1RJXB 3UQOA 1BJUA 1LVBA 4YESB 3RC5A 2G81E 3TNTA 1S0QA 2C90B 3LIWA 1U6QA 4TY7A 1VITF 4X6NA 1MMJN 3O8BA 5JPMH 1TONA 2CHAC 1AWFH 1GGDC 1L1GA 4D8NA 5IDKA 5DP4A 3SI4H 1NY22 1TGSZ 2TBSA 4JMYA 1SLVB 3P6ZB 3SUFA 3ZVFA 1G3DA 4UFGH 1WAYB 1DX5M 1KXBA 1KLTA 1GI2A 4FUCA 1GG6C 3ODFA 2VH6A 1V2VT 3SV7A 2XC0A 2PR3A 2EI6A 2G4UA 2UWLA 2B8OH 1O3OA 2P3TB 1BMAA 2H9HA 1IQIA 4NA7A 1ZPBA 4NSVA 5DP8A 1C1PA 4TY6A 1EZSC 1DANH 1UVPA 3BTEE 3SU4A 1P12E 1TPOA 1NPMA 2SNVA 1C2HA 4Y71A 1UTPA 2A5AA 3STJA 2Y5FA 3CENA 5AF9H 1O5FH 1GBLA 2QF0A 2BMGB 9ESTA 4KTSA 4RKJB 3ZVGA 1P11E 1F5LA 1FI8A 1KTSB 4B1TA 3UR6A 1GI0A 3M36A 2C4FH 1Z8JB 1DLKB 1O2MA 1GMHG 2C3SA 4A1TA 3U8TH 4X2WA 1HPGA 3GCTF 4WH8A 1FMGA 1BZXE 2VIWA 1C5LH 2SNWA 4YM9A 4OGXA 2FYQA 1Y59T 2V3HH 1ETRH 2H9EH 1PPCE 2ESTE 3LGYA 1BHXB 2ZGHA 1O2VA 4AB9A 1TOMH 1G30B 2LNCA 1SOZA 2V6NA 5AFYH 5JDUB 2OINA 4K1EA 4U30A 3RU4E 3SQEE 3BTWE 2A32A 3NK8A 1AI8H 1SMFE 2FO9A 3ATKA 4WXVA 2Y5GA 1HGTH 3JZ2B 5BRRE 2R0KA 1WBGB 3MI4A 4YTAA 1A5HA 1QJ7B 3M7UA 1NO9H 1EAUA 1GCTB 4KP0A 3M7TA 3EYDA 1F2SE 1ACBE 4FXGH 1GCTC 3FP8E 2K1QA 4JZIA 3PWBA 3S0NA 3GISB 3SUGA 1PQ5A 1CA0B 5DK1A 5K7RA 1O2YA 3ZV8A 1H9LB 2BLWA 1CHOF 1EQ9A 1QL8A 1T8MA 1SFIA 2IN2A 2F91A 2Q6FA 3HATH 4ABDA 1GHBG 4GHTA 1INCA 2VNTA 1G3BA 3F6UH 4AG1A 2BXUH 2ZZUH 3GDSA 1EB1H 4GCHF 5C5OA 1GJDB 3RXIA 1C5OH 3SGBE 1OWEA 1ZRBA 1S84A 7LPRA 2CXVA 1SQTA 3KQEA 3T25A 2G52A 1GJBB 1O3PB 3Q77A 4INHA 4NCYA 2FP7B 4ZUHA 1E38B 4X8TH 3A88A 4WY3A 1O3BA 3RXMA 3V7TA 3D62A 2GCHG 2F9VA 2O8TA 3MO9A 1OOKB 3SU2A 2F9OA 1PPEE 1TMBH 2XCFA 1SHYA 4MG3A 1LPGB 2J4IA 4WMEA 1CU1A 1RIWB 1KYNA 4Q2KA 1O2OA 2JH0D 4X2VA 4ZKRU 4JK6A 1P06A 1FDPA 5A0CA 1FONA 2BOHB 4QT8C 2VGCB 2ZHFH 3LJOA 2A4GA 4IN2A 3GY4A 1A1RA 1P2QA 1TBZH 1AUTC 1GBEA 3SGQE 5A09A 1Y3XA 3KEEA 2VB0A 1ZGVA 1YYY1 1AE8H 2GP9B 3SJ9A 1IOEA 4MNXA 3LGVA 1TNKA 5C1UA 1EAWA 2BY6X 1Z6EA 1ZYOA 1XKBC 2AFQB 2FS9A 1TBRH 3TH3H 1C1MA 1JMOH 1SGQE 4ZHLU 1P2OA 4YLUA 5A8XA 1XVOA 2GZ9A 1EUFA 1DM4B 3D65E 2EA3A 3OTJE 3BTFE 1ZTJA 1GHWH 1V2NT 3RM0H 1BA8B 1H8IH 2BVRH 3VB7A 1D3TB 1W10U 4LXBH 1NFUA 1DLEA 5FAHA 1TIOA 3Q00A 3GCOA 1LKBA 1LVOA 3TPIZ 3UOPA 3T29A 2GTBA 3O8DA 1K1JA 5PTPA 3LKWA 1ZPZA 1L0ZA 3ATMA 3FP7E 1V2OT 3I29A 1C2GA 5A2MH 3MU5A 3SORA 1O36A 2THFB 2FOCA 2Y7XA 1EATA 1XMNB 1TOCB 3GY7A 3MU0A 1OWHA 2VJ1A 4AFZA 4UONA 4FUJA 1DY9A 1THRH 3SV2H 3OY5U 1AB9C 1RIWC 3GYLB 5IYTA 4WVPE 2A5KA 2B9LA 3PLBA 4NIVA 2JETB 1CT2E 3VB3A 2AMPA 1Y3WA 1GL1A 1HAYB 1EOLA 2PGBB 4FUIA 1BQYA 4ABBA 5GPIB 3P8FA 2ZDNA 1PQ7A 1OXGA 1FIWA 4XE4A 4ABHA 2VIOA 1AWHB 2BYAX 4CR9A 1E0FD 1NRNH 3RU4D 3ZZBA 4B76A 2BZAA 1SGRE 4OS1A 4X2XA 1RTLA 4K2YA 3UY9A 1B7XB 2J38A 3RXBA 1C5SA 1S82A 1SPJA 2GVFA 3AW0A 3S9BA 1AVWA 1H1BA 3A8AA 3SNBA 1ELBA 4E7NA 4FUEA 1TX6A 3QZQA 1FPCH 1SC8U 4FUFA 4AYVB 1GI3A 5FPTA 1B0EA 1BTHH 2Z7FE 3HKJB 1J9CH 1QQUA 1QBNA 3LONA 2XC4A 3F9EA 4ISHH 2EC9H 4UD9H 5EGMA 1Y8TA 1HLTH 4DT7B 2BM2A 5EW1H 2GZ7A 1F5RA 2O8MA 1C2KA 1SL3A 1F0TA 4XBBA 4E7RG 5L6NH 2QXIA 2Z3CA 1C2IA 1SGDE 3TJNA 1P3CA 2D26C 5H4IB 3TK5A 1Y3UA 5C5NA 1V2LT 2ZG0H 2P3UB 1XUJA 4Q7XA 1O3JA 1MD8A 5DP7A 1OWDA 1QA0A 1TRNA 3RXRA 1EP5A 4ESTE 5T6FA 1QJ6B 3SN8A 3W94A 3A84A 2XTTB 3K6YA 1GJ5H 1Z1IA 1LO6A 2GCTB 1Q31A 1GHXH 2A4OA 3FZZA 2AGIX 1Y5UT 1P2JA 1P9UA 4B2CA 5T6GA 1MKXH 4TYDA 1T8OA 2CN0H 5J4QA 3FANA 2XYAA 5EPYA 1GI9B 3Q3KA 1YPHC 1G2MA 3A87A 2A2QH 2G55A 1PQ8A 4FUBA 2C8ZB 1FAXA 4RN6A 1P10A 1JIRA 3A7XA 1O33A 3ZVDA 2SGDE 1C4Y2 2Z9JA 4AGJA 2G5VA 4B71A 4XBDA 4JZDH 4Q7ZA 4I7YH 2ZP0H 1YF4A 3TJUA 1C1UH 1ZGIA 1ZTKA 1ZJDA 3LGIA 1EZXC 1T8NA 2ZCKP 2AH4X 4UEHH 1GDUA 1DUAA 3KQBA 1L4ZA 3SOSA 2UUYA 3A8CA 1OPHB 3UOUA 1H8DH 3E0PB 1OP0A 1YCPK 5JBTA 4O3TA 3SV9A 1AE5A 2QY0B 4D9QA 2OC7A 1SGIB 2PFEA 2B5TB 1TA6A 2ZDKA 4U2WA 1TQ0B 2AIQA 1MTNC 1UO6A 1MKXK 1FQ3A 5EXNA 1QRZA 1FIZA 2PKSC 2O8WA 2BD9A 3RM2H 3MOCA 3PWCA 1A46H 3VB5A 2C8XB 1D3QB 2ZCHP 1THSH 3E90B 1UVSH 1UK4A 3BTTE 4JCNA 3VPKA 1SGCA 2OLGA 1ORFA 4ZHMU 5HM9A 3MH4A 1SGFA 4OS4A 1HUTH 2J94A 1O5AB 3IG6B 4ZXXH 4K8BA 3BTHE 1XVMA 1NRRH 1UTMA 2G4TA 1JRTA 3T27A 1CSOE 2O8LA 4B75A 5HMAA 1A0LA 2BLVA 2Z6BD 3EAJA 5CHAB 8KME2 1G3CA 2O9QA 2XWAA 4AGKA 3OU0A 4CH8B 2W7UA 3STIA 3RXKA 4B2BA 1BT7A 4I33A 1ABJH 2ZU2A 3SZNA 5LH8A 1K1OA 1SGPE 2HOBA 1O35A 2GCHF 2ZF0H 1O5CB 3AVZA 3LPRA 2NU4E 3EA9A 3LU9B 4UFEH 5CMXH 1CT0E 1VR1H 2M5TA 4UE7H 4Y8ZA 1ELDE 1QB1A 2ODQA 3MNCA 2GZ8A 1G32B 1GHAF 2PW8H 1ANCA 1T7CA 2C8WB 1A0HB 4E06H 2BQ6B 6GCHF 3ZZ7A 3G01A 1FXYA 4NFEA 1GBIA 4Z6AH 1F0UA 1GHBF 1BRAA 1WV7H 5EXLA 2VWOA 1SGFG 3MTYA 1KXFA 2AGEX 4YOGA 2Q1JA 2XCNA 3SJIA 5T3HA 1Q2WA 1ZPCA 1QCPA 1QB6A 3NZIA 1DFPA 2BDHA 4XFQA 1Z8IB 3FFGA 2F9UA 4J1YA 1P03A 2ZA5A 1EJNA 4YOIA 2PLXA 1AN1E 4CBOA 1TNIA 1BTXA 1Z7KA 2XNIA 1KY9A 1Z8GA 1C1TA 1S6FA 5F8XA 2G5NA 3OSYA 1C5YB 1QBVH 5FX6A 1VZQH 2Z9IA 4DIHH 4XBCA 1GBFA 1MKWH 2G51A 2GV6A 4X1RU 2VIQA 4KELA 1S85A 4Y8XA 1TLDA 2P8OC 4Y79A 2FX6A 2P8OB 4HGCA 1GWAA 3UREA 1AVXA 1LVYA 4AFQA 2CGAA 2BOKA 3M37A 1MQ5A 1OWJA 2YOLA 1VJAU 3QUMP 1BCUH 2SGAA 4WH6A 1QGFA 1N6YA 3F68H 3GOVB 5GJ4B 2NWNA 5B6OA 2BQWB 1P8VC 4ZMAH 2EI7A 3SI3H 5FHTA 3A7ZA 1ZTLA 2FX4A 3SBKA 2Y80A 1IQLA 1XUIA 3ZVEA 2EEKA 3ZZ4A 7ESTE 2AIPA 1SGNE 1FY1A 1MKWK 4X2YA 4ABJA 3TNSA 2RA0A 4MVNA 1HNEE 2QXGA 1QRXA 5LPRA 3TITA 3PB1E 1HJAB 1YLCA 2GCTC 3U1IB 1N1LA 4AX9H 2ZU1A 3QO6A 4BAHB 1VCWA 2Q6DA 2HNTF 3IITA 2YNBA 1O38A 1DXPA 1BRUP 1P2NA 3S69A 3UWIA 3ZZ5A 1SFQB 2BDGA 2BD8A 3RXJA 4BANB 3B8JA 4GCHG 3P8GA 3RXDA 2VVVA 2C8YB 5JYIA 1NU9A 1W3CA 1K22H 4IMQA 2QXHA 2ZCLP 2OUAA 1HAHH 1L1JA 3Q3YA 4U32A 3UNRA 5TCAA 1ANEA 2KAIB 4JYTA 1O3HA 1V2ST 1ELCA 2ZECA 3F9GA 1ANBA 1OP2A 1YBWA 2A1DB 2WUBA 5E0GA 5HYOA 1HAOH 1PPHE 6CHAB 2Z3EA 3EA7A 2TGTA 1O2SA 1E34B 3DUXH 2XC5A 3RMOH 1UTOA 4HZHA 1O2QA 2Z3D<