2HVXA

Discovery of potent, orally active, nonpeptide inhibitors of human mast cell chymase by using structure-based drug design
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymase
publication title Discovery of potent, selective, orally active, nonpeptide inhibitors of human mast cell chymase.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hvxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hvxA02
2A7JA 4I8LA 5A8ZA 4KTCA 3UUZA 2DUCA 1O3MA 2W3KA 1Y3WA 4U30A 4JK6A 4A7IB 1SI5H 4MVNA 2VVVA 1YKTA 1XKBC 2LNCA 1OP2A 1GDNA 2ZNKH 1GWAA 2AGGX 3FZDA 3PTNA 1A5GH 5DP6A 2W5EA 1SGEE 1MU8B 3U8RH 2UUYA 1Z6EA 2TRMA 3QZQA 2FS8A 1ANEA 1DX5M 1NM6A 2H2ZA 3E0PB 4UDWH 3S7HB 2BD4A 5FAHA 1EOJA 1ELEE 1IHSH 2B0FA 1H9LB 1C1OA 4ISNA 4XDEA 1DSTA 1GDQA 3LGVA 3T25A 5A09A 1IHTH 1G30B 4OS7A 1QBOA 2UUFB 2FI3E 5CE1A 4Y0ZE 4MNWA 2K1QA 2VWNA 2A4QA 2Z3EA 3O8CA 3SOSA 2P94A 1FY1A 2VGCB 1L4ZA 3TU7H 5EQQA 1SR5C 2OQ5A 5PTPA 1GBDA 2FODA 3ZZ6A 3RXCA 4BANB 2Y5GA 3SJ8A 5C67A 2BDYA 4Y8YA 1BTUA 1GG6B 1TFXA 2GCHF 1TNGA 1YPMH 1C1MA 1AZZA 1A3EH 3OTJE 2W7SA 3A8AA 1C5MD 3FANA 2VJ1A 1T8LA 3ATWA 9ESTA 3VGCC 1YPHE 4WH6A 3PLBA 5DP4A 3MO9A 4A92A 5GCHF 6LPRA 3MU8A 2G51A 2UWPA 1OYQA 1W0YH 1C5OH 3ZVCA 3BSQA 1C2LA 1BQYA 3HPTB 3V3MA 1HXFH 2GT8A 4BOHA 2SGAA 3H7OA 1QCPA 1EP5A 2TGDA 1GBEA 1WCZA 1DOJA 2O8LA 2QXJA 1YCPK 2WINI 1GBIA 1MUEB 2O8TA 1CO7E 3RDZA 2JETC 1LHCH 5E0HA 4HGCA 4DURA 5T6FA 5HYOA 2A7HA 2WPIS 3UREA 4DIHH 2ODQA 2BYAX 1EPTA 1IQIA 5DGJA 1O5CB 1X7AC 1GJBB 1FY4A 2W26A 2PKAA 5LPRA 3SV9A 1AD8H 5AFZH 3A8DA 1N6XA 3SORA 1DSUA 1RIWB 3N7OA 4X6MA 4H6SB 4O3UA 2BY8X 3ZVGA 5BRRE 1J16A 4IC6A 3SHCH 1GVKB 4DW2U 3A7YA 2HRVA 1ELVA 1O3EA 3UQVA 2CN0H 3SGAE 4K1SA 1LQEA 5C3NA 4MPVA 3UWJH 3MNSA 2ZGBH 2OBOA 3NKKA 4AB9A 4MPXA 3K65B 1O5FH 2VIQA 4B73A 1DLEA 1BZXE 1MAYA 2P95A 1QB1A 5AVDA 1CHOG 1FUJA 3RXDA 3T5FH 3ZVBA 1C4U2 1CT2E 1HAZB 1K1LA 1XUKA 2R9PA 2ZDVH 1O0DH 3PLKA 3SN8A 5EU8A 4D76A 3RC6A 4DOQA 3GYLB 2BTCE 2V6NA 2ANKH 4MNYA 3L6PA 2R2MB 1GBFA 2A31A 3MH4A 3MU5A 1DWDH 1O38A 1BA8B 3BTME 2GP9B 5BPEA 1NZQH 4AFQA 1EJMA 4AFZA 1CGHA 2GVFA 3O8BA 4TWYA 4OS6A 1PYTC 5F03A 1PQ7A 5A8YA 2WV4A 1BJVA 5AHGH 4YT7H 2BD7A 5SGAE 3M5LA 1ZR0A 4ABBA 2RA0A 4XSKU 4CRGA 4DJZB 3BEFB 4Z6AH 3M7QA 2PTCE 1MTNC 2AS9A 1AIXH 2Y7ZA 5GJ4B 1SGRE 1BRBE 2A5KA 2VNTA 4KTSA 2FO9A 2FOHA 5EODA 1P9SA 1E38B 3MO6A 5FX6A 1NTPA 3ZZCA 1Z7KA 2V3OH 3SU3A 5CMXH 1C2MA 1YPHC 1NRSH 3MH6A 1C2FA 3QGJA 1FIZA 1UTLM 1O5AB 1VCPA 1Z8GA 1AQ7A 4WWYA 2FZZA 4X6PA 3GYMA 2BLVA 2B5TB 5L30H 3RXEA 3D23A 4ISOA 3TJUA 1J9CH 2FESH 4YO9A 4JK5A 4FUIA 1HJ8A 2ZFSA 3TH4H 2DE8A 1SGFG 7LPRA 3UY9A 3T29A 1YYY1 1C1TA 4I33A 3MTYA 1UTJA 5A8XA 1IQMA 2VIPA 1P04A 3DHKH 1BHXB 3M3TA 3RXKA 1O2PA 3C1KA 1P3CA 3P17H 1SGFA 1A4WH 2ZPQA 2J9NA 4JMYA 1XKAC 4LOYH 3G01A 3UQOA 1P8VC 1XX9A 1IOEA 3RXPA 3RXGA 4FUCA 1NC6A 5JDUB 3GISB 2PTNA 1EQ9A 4OGXA 1BMLA 2R3UA 1BRUP 1MAXA 1QA7A 1S6HA 5TCAA 2H9HA 2A32A 2P8OC 2TGAA 2BDIA 1LDTT 2J2UA 2SGQE 3MWIU 1RTLA 1RS0A 1SFIA 1VCWA 3A8BA 1HBTH 1DUEA 4CH2B 1LHFH 1QL8A 1W12U 4X2XA 2FOCA 1KLIH 1WTHD 1ZSKA 4CR5A 1F7ZA 3TGJE 1J17T 1WTGH 2A4OA 2AGEX 1Y3XA 3URCA 1PYTD 1IQLA 5LGOA 2A1DB 4ZMAH 2Q6GA 3SJOA 1ELDE 3SW2B 5ETXA 5L6NH 1O5DH 4XBBA 3UTUH 2QA9E 4ZKSU 1P2QA 5JBBS 5FHTA 2G8TA 3GCHC 3SNBA 1XM1A 3LONA 2OC1A 3IG6B 1UJ1A 2A2QH 4FUDA 2B9LA 3ZZ9A 1FAKH 2BD2A 1MTVA 1A7SA 5FBEA 4ZUHA 1GMDG 2QXHA 2V3HH 3MU0A 3MHWU 2OQUA 3F9GA 3GY8A 3MYWA 1SMFE 1O36A 2C8WB 3TVJB 1O3NA 2CGAA 1C2HA 3UNRA 3LH1A 1BITA 3HK6B 1S81A 2GZ7A 2QGRA 3D62A 3JZ1B 4PROA 1DT2A 1B0EA 2DE9A 3VXFH 3MH7A 5HXFA 3E16B 2ZI2H 1LHDH 1O2GH 1T31A 3SI3H 3ZVAA 1ZHRA 2SNVA 1P2JA 3TNSA 3SGQE 1GVZA 2FOMB 3OX7U 1HAIH 1VCQA 4RN6A 1EZUC 1GL0E 3EGKH 2FOFA 3Q3YA 4FUBA 1XXFA 1UHBB 4GPGA 3DD2H 1MTNB 3TH3H 1YLDA 2ZHDA 4CHAC 3H5CB 5C1XA 2TGPZ 2Z9KA 1FONA 2D1JA 3QN7A 4B2AA 5L2ZH 2W3IA 1Y5BT 3KN2A 2GX4A 1PPEE 1JBUH 1Y3UA 4IBLH 2G52A 1QHRB 5CHAC 3UIRA 4R0IA 1RGQA 4CR9A 1MQ5A 2GCHG 2PR3A 2KAIB 2PSXA 4NA7A 2BQ7B 3NXPA 1PPGE 3SJIA 2STAE 1SGDE 2BY6X 5GPIB 4ABFA 1KTTB 3RLWH 1GBJA 1DITH 2OC7A 4U2WA 3NZIA 1TA2A 3UNSA 1GJDB 2NU2E 3MNCA 3E1XB 4X8TH 3ATIA 3RXHA 2LPRA 8ESTE 3MU1A 3FP6E 1GI3A 4Y8XA 1C1QA 1BRCE 3OU0A 3RXIA 4XOJA 4MLFB 3TLOA 2NWNA 2VVUA 1W14U 1HIAB 4A1VA 3Q3KA 1CHOF 1TYNA 1EB2A 3D49H 1H9IE 1YCPM 1W0ZU 5IDKA 1N1LA 3SU2A 1RRKA 1ZRBA 3F9HA 3A87A 2V35A 2FOEA 4NIXA 2P8OB 2PW8H 5EW1H 2ZQ2A 4X6OA 5DP3A 3DA9B 3S7KB 1PQ5A 1SGNE 3ZZAA 5DG6A 4YOJA 1ZJDA 3RXUA 5E0GA 2OCVB 1F5LA 4BTUB 2Y7XA 1W2KH 1JRSA 1YC0A 2ZGJA 4ZKNU 1FY8E 4X2VA 1MZDA 1S6FA 1PPFE 3M3VA 3URDA 2WYGA 4ABHA 1ESBA 1YPJH 1HB0B 1O3CA 1XUJA 1P2IA 1F0UA 1ESAA 2PHBA 1F0RA 2J38A 4TY7A 2J92A 4JZIA 3GY3A 4AX9H 4H4FA 3AASA 1O2WA 3O8RA 3U9AH 3PYHA 1TBZH 3HGPA 4NZLA 3JZ2B 5DPAA 3PM3A 5HM2A 3L3TA 3P8OA 1N8OC 4LZ4B 4JZFH 2XBYA 1P12E 1GG6C 1W10U 1MTWA 2FLRH 1FQ3A 2ZFQH 5EXLA 2Q1JA 1P10A 1F5RA 1VITF 3T26A 3ZZBA 1C9PA 4D9RA 1ZPCA 4TYDA 2BLOA 1RD3B 1SOZA 1GBCA 2YNAA 2BD5A 2EA3A 2XXLA 3QX5H 1YLCA 3S9AA 2FWWA 1WYKA 1V2LT 3RXRA 4YM9A 4B2CA 2QXGA 2FOAA 1S83A 5ESTE 2FXRA 4D9QA 1DS2E 5DO4H 3NPSA 1PPHE 1UCYH 3W94A 1TQ7B 1W3CA 3STJA 1K21H 3F68H 2XCNA 1E36B 3DFJA 1YPGH 2Z9JA 1GI1A 1LQDB 1NT1A 1UTQA 3MOCA 4F4OC 3VB5A 1QJ6B 3P8FA 4ZXYH 4WMDA 4ABGA 1BB0B 1GJ9B 1K28D 2ZDKA 2ZDLA 5CHAB 3BN9A 2BXUH 3GICB 1A3BH 1THSH 1ZRKA 2AEIH 1UMAH 3BTWE 3QTOH 1MQ6A 1RIWC 1ZSJA 4K5ZA 1O5EH 4GCHG 3AAUA 2Z94A 2FYRA 5FCRA 1FI8A 1CHGA 4SGAE 2OC8A 3C27B 4X1QU 4K1EA 1GI9B 3S9CA 2IPHA 1QL9A 4YTAA 1T7CA 5LPEA 1TGCA 4ABIA 1LVBA 1WV7H 1SQTA 3RXSA 3LGUA 1EXFA 5DKMA 1LVMA 1QRZA 1ZHPA 3QTVH 3SU6A 1UTOA 4FVDA 4Y0YE 1ELTA 1HAVA 4ISHH 2WPJS 3SV8A 1GMDF 3RUOA 1QQ4A 1J15A 1EP6A 2ZCKP 1E0FD 1TGNA 3A7TA 1O3KA 5EXMA 1MTSA 1EJAA 3A7VA 2YOLA 1IQHA 1GI0A 3GOVB 3RP2A 2XBVA 1SSXA 1TNJA 1GBTA 3STIA 1BTWA 1WQVH 2OUAA 4Y79A 5TJXA 1ESTA 2BLWA 4UFFH 1OWJA 5JBTA 2Z3DA 3UOUA 5HGGA 3P95A 1WAYB 1MZAA 1TMTH 6GCHF 1O2SA 5FXLA 3ATLA 2PV9B 4GHQA 3KQCA 3B23B 4BAQB 1AUTC 2FIRH 2GDEH 2Z9IA 3SQHE 2EC9H 2VIOA 4I31A 2CMYA 1OYTH 3A7XA 3RU4D 2F9OA 1C5XB 2EI7A 3IWMA 1E35B 3T28A 1D3DB 1SHHB 1SB1H 1KLJH 4JZDH 2C8XB 2PKAB 1J8AA 3QO6A 3LIWA 2F9UA 1N8OB 4IN2A 1Q31A 4ZH8A 2Q6DA 1C5YB 1MD7A 2XW9A 1C1RA 1GHAG 4Z0KA 2NU4E 4CBOA 1C5WB 3MU4A 1FAXA 1C1VH 1KSNA 1GMHG 3RXLA 2ILNA 3E6PH 1WU1A 1YCPH 4XE4A 1XUGA 1BCUH 2EEKA 3HKIB 3MI4A 1P2MA 1Z71A 5EW2H 1RFNA 2FP7B 2J94A 5E2OA 1L1NA 4F49A 4H42U 3ZVFA 2P3UB 4AYVB 3MNXA 1FV9A 2HNTC 2PLXA 4RKJB 1SLWB 1TX8A 2R2WU 3ZZDA 1PPBH 4KELA 2F91A 1JMOH 2IN2A 3F6UH 1JIMA 1BUIA 3UNQA 2CJIA 8GCHG 5LH8A 2AH4X 1F92A 3OY5U 1XUFA 1V2RT 3SGBE 4ESTE 1AKSA 2JH0D 1NFYA 4NGAH 1QIXB 3S9BA 2H5CA 4BXWA 3PMHB 1GJ8B 1TBRH 1WBGB 1SBWA 1Y8TA 3ODFA 5I25A 1NRRH 2WV5A 3A83A 3KEEA 4NFFA 3BEUA 1VR1H 3TJOA 3A8CA 2BB4A 3SQEE 1ELFA 1V2JT 3RC5A 1FNIA 3AW1A 2FX6A 2O8UA 3A85A 3BF6H 3P70B 3U98H 1UTMA 3KF2A 1O3DA 1ABJH 1C1NA 1W11U 2GZ9A 3NCLA 2ANWA 1V2WT 4MPUA 2HPPH 2J34A 1GJCB 1Y5UT 5C5OA 1GVLA 2CF8H 2Y80A 1BBRH 1Z8IB 4HI3A 1E34B 4GLYA 1RTFB 3E90B 4O97A 2G4TA 3RLYH 3NUMA 2Z7FE 1HLTH 2WPLS 4Q7YA 3GY7A 1BBRK 1ZTLA 2ZTXA 3QLPH 2BDAA 1O2RA 2XYAA 3M37A 1QB9A 4B1TA 4B74A 1Z8JB 1C2IA 5C5NA 3VXEH 3HKJB 4AFUA 1QY6A 1TMUH 4D7GA 1PJPA 2FS9A 4FUEA 1TB6H 3RXMA 3E91A 4YOIA 3FFGA 2ZWLH 4DCDA 2BXTH 1V2NT 4NCYA 5G4BA 1O3OA 1ZMLA 3I78A 2Y82A 1TPOA 5JPMH 3RM0H 2XRCA 1LHGH 3A81A 1ETTH 2P3TB 1Q3XA 1O3FA 4UEHH 3D65E 1NRPH 3KNXA 2Q6FA 5DP8A 1TPPA 5C1YA 1TONA 2Z9LA 3AVZA 3W95A 4WY3A 2BY7X 2BY5X 3SO3A 1BOQA 3PLPA 4AYYB 3LGTA 4WMFA 4ZROA 3KQDA 3VB4A 4OGYA 1V2QT 1IQFA 3EA9A 1WSSH 1VITG 1BTYA 1NY22 4GCHF 1ELBA 1LHEH 1KTSB 1Z1IA 1ARBA 1C4V2 2ZG0H 4X8VH 4K3JA 1GI5A 1F5KU 2O8MA 3FP8E 4NG9H 4U01A 1HRTH 1GBBA 3FVFB 1CGIE 2VIDA 2OTVA 2BD3A 1C1SA 4Q7XA 3SV7A 1O2YA 1O37A 1OWEA 1SLXB 2TBSA 4INHA 1QTFA 3RXAA 2BY9X 3V0XA 3ZZ4A 1SVPA 1K1OA 2P16A 1NS3A 1DWCH 1OP8A 4ZHAA 1BT7A 1NN6A 2GZ8A 1XMNB 4IW4E 1SGPE 1VGCC 1C1PA 2HGTH 4GVUA 5A0BA 4B71A 1A5HA 1J14A 3VPKA 3SV2H 1Y3VA 1KDQB 2BZ6H 2SGPE 2I6SA 2OP9A 2QIQA 3LGYA 1O3HA 1P0SH 2Z3CA 1G3CA 4Y76A 1HV7A 1V2VT 1T4VH 2WPKS 3CS0A 3OSYA 4K8BA 1LKBA 8LPRA 3BTQE 1RTKA 1AY6H 2GKVE 2WYJA 1O5BB 1Q2WA 4TY6A 4DY7B 1P11E 3TK6A 1GHVH 2QXIA 3LGWA 2ZFRH 2RDLA 3VB3A 2HLCA 4K2YA 3SJKA 4AGJA 2ZU3A 3UR9A 1TQ0B 3SV6A 1O3LA 1EB1H 2AMQA 1JXPA 1DANH 1TLDA 2I6QA 2VIWA 1B0FA 5DP7A 3GY5A 3SU4A 3ZV9A 2BVRH 5EQSA 1ZGIA 1CSOE 1K1MA 4BAHB 4A1TA 4KKDA 2VB0A 4MNVA 2ANYA 2HOBA 2A4RA 1Z1JA 1ANDA 4O3TA 4AG1A 1GJ4H 1IAUA 3SU0A 5J4SA 2J4IA 1OKXA 1C5RA 2UUJB 1QRWA 3DT0H 2XC4A 3TNTA 3EE0B 4NIVA 4I8JA 2Y5HA 1AB9C 4CRAA 1K22H 1GHAF 1CGJE 4CH8B 2FDAA 1ZYOA 2SNWA 1GMHF 1AO5A 4Y11E 1AVXA 1SGYE 1HFDA 6GCHG 2PWXA 1KXAA 3T27A 5JBCS 5T6GA 1GL1A 3SU5A 3KCGH 1EZQA 1AWFH 1MH0A 7KMEH 5J4QA 4K8YA 1KXBA 1K1PA 1NFUA 1YF4A 4NIWA 2ZFTA 4OS5A 1OX1A 2ZA5A 4TWWA 3VFEA 1TA6A 1IQNA 2EI8A 8GCHF 4B75A 2UUKB 3TIUA 4NSYA 4OS2A 1XXDA 1V2UT 3VB6A 1PFXC 1O3PB 4AZ2B 4UFGH 1MBMA 1NESE 3TK9A 1O3AA 3RU4E 3SJ9A 4MPWA 1IQKA 1PQ8A 2F9VA 1GHBG 4JYVH 5DP5A 2BQ6B 2SGDE 2BQWB 2ANMH 3T2NA 5EXNA 2VIVA 1INCA 1BIOA 1W8BH 3KGPA 1CA8B 2AIQA 1T8NA 3K9XB 4DIIH 2FPZA 1FPCH 2P3FH 2ZQ1A 1YPLH 1FLEE 3OY6U 1SOTA 1SGCA 2XC5A 4ABDA 4I32A 2A45B 1S85A 4SGBE 2BX4A 3LC3A 1TNIA 1BTXA 1FXYA 2BDCA 3Q3XA 1ELCA 3P8NA 5K0HA 1BRAA 1NPMA 2CXVA 4NWLA 1VGCB 1D3PB 1EJNA 1VITH 4FUJA 3TK5A 3KL6A 1TPSA 1MD8A 3BTKE 3DUXH 1DE7H 3U1IB 1GI4A 1YPEH 2QCYA 3ZVEA 4ABJA 1UHBA 4HFPB 4I7YH 2F3CE 1FDPA 3PB1E 1DICA 1HCGA 3QGNB 4CRCA 1O2XA 2XCFA 1YPKH 4INKA 4LK4A 3KQEA 3CENA 1TABE 1LO6A 1EAWA 2ZPSA 3U1JB 2BOKA 2FI5E 2ZFPH 1UVOA 3ATMA 1LPGB 4DGJA 3CS7A 1EZXC 1B5GH 1C2EA 1YBWA 4RSPA 3S69A 1ELGA 1DWBH 4BNRA 4BTTB 1A0HB 1O2ZA 2THFB 1OSSA 2FOGA 2OLGA 1QRXA 1FPHH 1NFWA 1EPTC 2FLBH 4M7GA 2M5TA 2ZCHP 1XVOA 1ZHMA 5A2MH 1GJ5H 3RMNH 1ZPBA 4A6LA 1F0SA 1O3BA 3I77A 3OYPA 1BTHH 2JH6D 9LPRA 1O2TA 1LMWB 5EGMA 4NWKA 1ZTJA 1AB9B 1Z6JH 1BTZA 2PFEA 3PMBB 4IMZA 2V0BA 1TAWA 1KXCA 3R3GB 3TPIZ 1O2JA 1G36A 1GDUA 3ELAH 4JYUH 2GV7A 3ZZ5A 1IQJA 4E7RG 5A0CA 3ITIA 3BG4C 2F9PA 1P05A 1H1BA 2ZC9H 5F8XA 2XWAA 1ZJKA 2H6MA 1SC8U 3SZNA 1D3QB 1P09A 2QV1A 1O30A 2UWLA 3NWUA 1MKWH 1DUAA 4FUFA 1HAVB 1TRMA 4J2YB 3ODDA 4JCNA 1BMMH 5GDSH 1ARCA 2GTBA 1C5ZB 4FUGA 5T3HA 1ACBE 1EZSC 1KXEA 1EKBB 3U8TH 2HNTE 3E0NB 4VGCC 4KTUA 1MKWK 3BTGE 4O9VA 2FEQH 1QA0A 2C4FH 1RJXB 1AGJA 1U6QA 4CRDA 1HAOH 1UVTH 1W7GH 4Y71A 3UFAA 4A5TS 3K2UA 1YGCH 3RMMH 4X1RU 1OWHA 1AFQC 1C5QA 1UVSH 3PMAB 4NA8A 6ESTA 1HJ9A 1V2OT 3GCTG 1Z8RA 3LT3A 4WJG2 3RXBA 2BM2A 3IITA 5C20A 3M61U 1T8MA 1CA0C 3AAVA 3ZV8A 4DT7B 1UCYE 1GMCG 1O34A 3GY6A 1QFKH 1O2KA 2XWBI 3LJJA 3VB7A 2G5NA 2UWOA 3M3SA 1O31A 1HYLA 3QK1A 1ELAA 1K1IA 2BD9A 4UE7H 1CE5A 1SLVB 2OD3B 3EA7A 5JB8S 5FBIA 1TALA 3HGNA 3BTEE 4IGDA 5EPNA 3M36A 1THRH 4ZHMU 1ZMNA 4K1TA 2ZCLP 4YZUA 3A86A 1V3XA 2FOBA 2ZGHA 1QGFA 2ODYB 1NFXA 4WF8A 1D4PB 3SUDA 3TJNA 4OS4A 3A80A 5FPTA 3RXFA 2JKHA 1V2ST 1CBWC 1P2OA 2D2DA 4ISIH 2ZTZA 1GBKA 1OWIA 2B7DH 1HJAC 4FU9A 4X8UH 1C1WH 1CT4E 4O03A 4I8GA 1AVGH 1XUIA 3SUEA 1OWDA 1P57B 1FN8A 2BZAA 2BD8A 5JYIA 2H9EH 2F83A 5EQRA 2A0QB 4BXSA 1SQAA 1GCTC 2BDHA 1V6DA 1HGTH 5HM9A 1K1NA 1EPTB 1TMBH 1CU1A 3ZYEA 1C2JA 1AI8H 3FZZA 1KYNA 1GI2A 2H1UA 1AKSB 4WH8A 1H8IH 3ESTA 1NU7B 1ZSLA 3QUMP 1OS8A 2FI4E 3KQBA 1GHZA 1O5GH 2ZHFH 3GY2A 1MKXH 1OP0A 1GHBF 2FTMA 2PUQH 4K69A 3H7TA 1OXGA 3B8JA 4I8KA 1AWHB 1HDTH 1GJ6A 1L0ZA 2BMGB 1DWEH 2AMDA 1W7XH 3LPRA 5F8TA 3K6ZA 3BG4B 2G4UA 1CQQA 1MKXK 1IQGA 2OINA 1PPZA 1A5IA 1L2EA 1OOKB 3TH2H 1JOUB 1SFQB 1BJUA 1P9UA 2ZECA 1ID5H 2WUCA 3MFJA 1D9IA 1P2NA 1S0RA 3Q00A 4MQAA 4ZKRU 5FX5A 3SHAH 2SFAA 5FPSA 1L1GA 4AB8A 3BV9B 4WXVA 1O3GA 4YOGA 3PMJA 2GT7A 1TGSZ 4A1XA 2QC2A 1Y5AT 1FJSA 1EOLA 2ZDAH 4WXIA 2C90B 2D8WA 2R0LA 4U32A 4VGCB 1ZOMA 1TX6A 4X1PU 2G5VA 2VWOA 1SQOA 2A2XH 1K2I1 2ALVA 1S0QA 2RA3A 4BAMB 1THPB 4THNH 1GBHA 1G2LA 1A2CH 5A0AE 5F8ZA 1TRNA 1AFQB 5I46H 2PUXB 2FTLE 3UWIA 5B6OA 3S0NA 2AYWA 3MNBA 4CBNA 3LU9B 4XFQA 4YESB 2H9TH 2Z6BD 1AMHA 5H4IB 1C5VA 5TCCA 3QZRA 1O2NA 3GDUA 4D7FA 3RXTA 1P06A 2ZPRA 1CA0B 1AUJA 3FAOA 5FCKA 4FU7A 1RXPA 2BDBA 2F9NA 1AZ8A 1EX3A 4KP0A 1UK4A 2FX4A 2IOTA 3A84A 3GDVA 3TGIE 1KIGH 4FU8A 4GSOA 2NU0E 2W7UA 4Q7ZA 3L33A 4Y7AA 2ZO3H 5LPFA 5HMAA 2ZGXH 1ZZZA 3NK8A 4Y10E 4CREA 1NU9A 2AGIX 2O9QA 1C5LH 2ZHEH 4UFDH 6CHAC 1JIRA 2AMPA 1C2GA 2J95A 2ZTYA 2SGEE 4CRFA 1BDAA 2SGFE 1GCDA 3SBKA 2IJOB 1MU6B 2F9BH 3GDSA 1C5TA 2OBQA 2GV6A 3HATH 1G2MA 4X6NA 1MCVA 1CBWB 1D6WA 4IC5A 3EA8A 1HJAB 4D8NA 4AOQA 1PQAA 2HVXA 5L2YH 3SI4H 2G55A 3K6YA 1LTOA 1V2PT 2XC0A 2QY0B 3UPEA 3F9FA 3A7WA 3BTHE 1O2IA 1K1JA 5JBAS 2A4GA 1JWTA 2FYQA 1GCTB 2B8OH 1BBRE 1TGTA 2ZU1A 3BIVH 3O8DA 3RU4T 2CV3A 3SUGA 4LXBH 4DVAU 1A0JA 1QJ7B 4HTCH 1B7XB 7ESTE 3HK3B 1AFEH 4XBDA 1ETRH 3PV4A 1ETSH 1O2MA 4HZHA 1GGDC 1M9UA 5EOKA 1KLTA 5GIBA 1TPAE 2ZU2A 3PWBA 2QAAA 5DP9A 2VH6A 2GCTC 1OWKA 1NROH 2XBWA 3SNEA 1G3BA 4FVBA 1ANCA 1UO6A 3ZZ3A 3GCTF 3P8GA 4JYTA 1MMJN 3U8OH 1C2KA 2RG3A 1O33A 1GHXH 3VGCB 1CT0E 4I8HA 4QT8C 1UTPA 1GMCF 2C8YB 1O3JA 1GHYH 1DY8A 1YP9A 2ZGCA 2A7CA 4ZKOU 1P01A 1G3DA 4J1YA 1KXDA 1MTUA 1QURH 3ZZ7A 1GBAA 3EDXB 2AIPA 5T6DA 2ZU5A 3T62A 2WPMS 1L1JA 4BAOB 1ANBA 4OS1A 2C3SA 1S82A 3GCNA 1AE5A 1A46H 2PKSC 4UD9H 1UK3A 2C93B 2ZZUH 3AW0A 1WOFA 4BTIB 2JH5D 3ZZ8A 2CF9H 2JETB 3GCOA 4Y6DA 1QJ1B 2TIOA 1LVYA 2PGQB 3V13A 2STBE 2VH0A 3BTDE 4FUHA 4R8TB 7GCHG 1UVPA 3ENSB 5DK1A 2R0KA 1QQUA 1SGIB 2ZP0H 2TGTA 3MMGA 3F9EA 1IQEA 1G3EA 3M5MA 2VVCA 1DXWA 1DPOA 5C1UA 2QN5T 3RC4A 1C4Y2 3BEIB 1MBQA 1SGTA 2VWLA 2CHAC 1ZMJA 1UK2A 1DVAH 1BMNH 5E2PA 2HALA 1C5NH 1FY3A 2AFQB 1C2DA 4NZQA 3U69H 4GUXA 1P2KA 1TX7A 6CHAB 1DM4B 2QYIA 2VWMA 3A89A 5EPYA 1GJAB 1S84A 1O35A 4ABAA 1O2QA 1G9IE 2ZEBA 1UTKA 3PWCA 3E8LA 1KDQA 1DDJA 1TE0A 1MCTA 1NRQH 1GBLA 4WMEA 3RXQA 2D26C 4ZXXH 1K9OE 5JB9S 1C5UA 3VEQB 8KME2 1LCYA 1GBMA 2P93A 3M35A 1ZTKA 4MNXA 1ABIH 1PPCE 2RCEA 3PO1C 2AERH 3SNCA 2ALPA 4Q2KA 1ZPZA 1TRYA 4DG4A 1O32A 4AORA 4LZ1H 1HXEH 4GAWA 2R3YA 1ZGVA 4INLA 4KGAA 1S5SA 3E3TA 4E7NA 4NSVA 5IYTA 1VJ9U 4YT6H 1Y3YA 1O2LA 1FN6A 1TNHA 2GGVB 3PTBA 2BX3A 3DFLA 4NA9H 1GGDB 4YLUA 1LKAA 2EI6A 1VJAU 2HWLB 1GI7B 1P3EA 5GWZA 4MTBA 3LOXA 2GCTB 3CP7A 2PSYA 2TPIZ 4CRBA 1AE8H 1DXPA 3RXVA 3EYDA 4E05H 1HAHH 4NIYA 2GD4B 4E06H 1NO9H 1QBVH 4Y8ZA 1QL7A 1KXFA 5GCHG 1BMAA 1V2TT 1L4DA 1NRNH 2Y81A 2ZHWH 3WY8A 1HAYB 1HPGA 1FY5A 5AFYH 4MG3A 1HAGE 2GMTC 1QNJA 3SNDA 1H8DH 3V12A 2QF3A 1GI8B 1HAXB 1SL3A 2ZFFH 3GY4A 1TNKA 3TJVA 1V2MT 1DFPA 4NFEA 2FM2A 2BVSH 3UR6A 1TOCB 2PKSB 4YLQH 1O2HA 2ZDMA 2XNIA 5F6MA 2VINA 2ULLA 1LPKB 2BLQA 4X2YA 2BOHB 1D3TB 4GHTA 1O3IA 3I29A 3ZYDA 1GI6A 1EAUA 4JZEH 1LPZB 1EATA 1EAXA 1EUFA 2HPQH 3A88A 1TGBA 4B2BA 2ZIQH 1QBNA 5DJ7A 1AHTH 4AN7A 2KAIA 4X2WA 3KIDU 3UOPA 1LVOA 3FP7E 4FXGH 4UFEH 4WVPE 1SPJA 1TOMH 5C2ZA 1EASA 1QR3E 1UTNA 2G00A 1OPHB 2ZKSA 5E8EH 1V2KT 2C8ZB 3LH3A 5FPYA 2YNBA 3KHVA 2G81E 2CHAB 4XBCA 4ISLA 1O2OA 1KY9A 1JRTA 1W13U 4Y7BA 3MH5A 4B76A 2GDDA 3TGKE 4X0WU 2BDGA 1O2VA 3RMLH 1HUTH 1T8OA 3GCHB 2BVXH 1SGQE 1H9HE 1HIAA 4ZHLU 2OXSA 4K60A 3LDXH 4H6TA 2H5DA 2VGCC 3M5OA 4X8SH 1AN1E 4UONA 3R0FA 2A5IA 2FMJA 2A5AA 1QB6A 2WUBA 3EQ0H 2BHGA 3PROA 1C9TA 2PGBB 4IMQA 2QF0A 3QDZB 2ESTE 1A61H 1FZZA 4ABEA 3A82A 1SG8B 4MDSA 1TBQH 1Y59T 1C5SA 2VU8E 1FIWA 3LKWA 4ASHA 1T4UH 1H4WA 1VZQH 4IN1A 4JZ1A 2ZF0H 4TPIZ 1AVWA 1A0LA 1E37B 3F1SB 1DLKB 5ESBA 2O8WA 2ASUB 3SNAA 1F0TA 3PO1B 1C1UH 3P92A 3LJOA 3V7TA 3ZVDA 1XUHA 2XBXA 2WPHS 3QWCH 2ZU4A 1P03A 1AU8A 1G37A 3Q76A 3A7ZA 3SU1A 1CVWH 5ABWA 1UVUH 3B9FH 1GJ7B 1BTPA 4IS5A 4RKOB 3LC5A 1GPZA 4CHAB 1ZLRA 5EG4A 3Q77A 5E0JA 5AF9H 1HAPH 1TNLA 1WUNH 4BAKB 1SLUB 2ZHQH 1SHYA 2ODPA 1TIOA 7GCHF 4Q80A 4AG2A 2P59A 1UCYK 1O2UA 2NU3E 3MO3A 1A1RA 1TWXB 3M5NA 2Y6TA 1BHXF 3P6ZB 3M7TA 1EAIA 3BTFE 1WQSA 3SUFA 4X1SU 1DY9A 2ZDNA 2Y5FA 3ATKA 1FMGA 2XTTB 3BG8A 1F2SE 1G32B 1P02A 2HNTF 2NU1E 5GXPA 1D6RA 4TPYA 2GMTB 4ZAEA 3RM2H 2OC0A 4AGKA 3LGIA 3RXJA 3BIUH 1ORFA 2Z9GA 1GHWH 3M7UA 1N6YA 3EAJA 1HNEE 3BTTE 1C5PA 5K7RA 4AFSA 1O39A 3RXOA 1XVMA 3RMOH 1T32A 1YM0A 4X1NU 3TITA
chains in the Genus database with same CATH superfamily
2A7JA 4I8LA 5A8ZA 4KTCA 3UUZA 3PV5A 2DUCA 1O3MA 2W3KA 1Y3WA 4U30A 4JK6A 4A7IB 1SI5H 4MVNA 2VVVA 1YKTA 1XKBC 2LNCA 1OP2A 1GDNA 2ZNKH 1GWAA 2AGGX 3FZDA 3PTNA 1A5GH 5DP6A 2W5EA 1SGEE 1MU8B 3U8RH 2UUYA 1Z6EA 2TRMA 3QZQA 2FS8A 1ANEA 1DX5M 1NM6A 2H2ZA 3E0PB 4UDWH 3S7HB 2BD4A 5FAHA 1EOJA 1ELEE 1IHSH 3N99A 2B0FA 1H9LB 1C1OA 4ISNA 4XDEA 1DSTA 1GDQA 3LGVA 3T25A 5A09A 1IHTH 1G30B 4OS7A 1QBOA 2UUFB 2FI3E 5CE1A 4Y0ZE 4MNWA 2K1QA 4ACBA 2VWNA 2A4QA 2Z3EA 3O8CA 3SOSA 2P94A 1FY1A 2VGCB 3N7DA 1L4ZA 3TU7H 5EQQA 1SR5C 2OQ5A 5PTPA 1GBDA 2FODA 3ZZ6A 3RXCA 4BANB 2Y5GA 3SJ8A 5C67A 2BDYA 4Y8YA 1BTUA 1GG6B 1TFXA 2GCHF 1TNGA 1YPMH 1C1MA 1AZZA 1A3EH 1KMHB 2WSSD 3A8AA 3OTJE 1C5MD 3FANA 2W7SA 2VJ1A 1T8LA 3ATWA 9ESTA 3VGCC 1YPHE 4WH6A 3PLBA 5DP4A 3MO9A 4A92A 5GCHF 6LPRA 3MU8A 2G51A 2UWPA 1OYQA 1W0YH 1C5OH 3ZVCA 3BSQA 5C17A 1C2LA 1BQYA 3HPTB 4DT4A 3V3MA 1HXFH 2GT8A 4BOHA 2SGAA 3H7OA 1QCPA 1EP5A 2TGDA 1GBEA 1WCZA 1DOJA 2O8LA 2QXJA 1YCPK 2WINI 1GBIA 1MUEB 2O8TA 1CO7E 3RDZA 2KFWA 2JETC 1LHCH 5E0HA 4HGCA 4DURA 5T6FA 5HYOA 2A7HA 2WPIS 3UREA 4DIHH 2ODQA 2BYAX 1EPTA 1IQIA 5EJ1A 5DGJA 1O5CB 1X7AC 1GJBB 1FY4A 2W26A 2PKAA 5LPRA 3SV9A 1AD8H 5AFZH 3A8DA 1N6XA 3SORA 1DSUA 1RIWB 3N7OA 4X6MA 4H6SB 4O3UA 2BY8X 3ZVGA 5BRRE 1J16A 4TSFD 4IC6A 2WZQA 3SHCH 1GVKB 4DW2U 3A7YA 2HRVA 1ELVA 1O3EA 3UQVA 2CN0H 3SGAE 4K1SA 1LQEA 5C3NA 4MPVA 3UWJH 3MNSA 2ZGBH 2OBOA 3NKKA 4AB9A 4MPXA 3K65B 1O5FH 2VIQA 4B73A 1DLEA 1BZXE 1MAYA 2P95A 1QB1A 5AVDA 1CHOG 1FUJA 3RXDA 3T5FH 3ZVBA 1C4U2 1CT2E 1HAZB 1K1LA 1XUKA 2R9PA 2ZDVH 1O0DH 3PLKA 3SN8A 5EU8A 4D76A 3RC6A 4DOQA 3GYLB 2BTCE 2V6NA 2ANKH 4MNYA 3L6PA 2R2MB 1GBFA 2A31A 3MH4A 5IK2D 3MU5A 1DWDH 1O38A 1BA8B 3BTME 2GP9B 5BPEA 1NZQH 4AFQA 1EJMA 4AFZA 1CGHA 2GVFA 3O8BA 4TWYA 4OS6A 1PYTC 5F03A 1PQ7A 5A8YA 2WV4A 1BJVA 5AHGH 4YT7H 2BD7A 5SGAE 3M5LA 1ZR0A 4ABBA 2RA0A 4XSKU 4CRGA 4DJZB 3BEFB 4Z6AH 3M7QA 2PTCE 1MTNC 2AS9A 1AIXH 2Y7ZA 5GJ4B 1SGRE 1BRBE 2A5KA 2VNTA 4KTSA 2FO9A 2FOHA 5EODA 1P9SA 1E38B 3MO6A 2J98A 5FX6A 1NTPA 3ZZCA 1Z7KA 2V3OH 3SU3A 5CMXH 3FKSD 1C2MA 1YPHC 1NRSH 3MH6A 1C2FA 3QGJA 1FIZA 1UTLM 1O5AB 1VCPA 1Z8GA 1AQ7A 1E79D 2FZZA 4WWYA 4X6PA 3GYMA 2BLVA 2B5TB 2LELA 5L30H 3RXEA 3D23A 1FX0B 4ISOA 1J9CH 3TJUA 2FESH 4YO9A 4JK5A 4FUIA 1HJ8A 2ZFSA 3TH4H 2DE8A 1SGFG 7LPRA 3UY9A 3T29A 1YYY1 1C1TA 4I33A 3MTYA 1UTJA 5A8XA 1IQMA 2VIPA 1P04A 3DHKH 1BHXB 3M3TA 3RXKA 1O2PA 3C1KA 1P3CA 3P17H 1SGFA 1A4WH 2ZPQA 3EE7A 2J9NA 4JMYA 1XKAC 4LOYH 3G01A 4XD7D 3UQOA 1P8VC 1XX9A 1IOEA 3RXPA 2WV9A 3RXGA 4FUCA 1NC6A 5JDUB 3GISB 2PTNA 1EQ9A 4OGXA 4ASUD 1BMLA 2R3UA 1BRUP 1MAXA 1QA7A 1S6HA 5TCAA 2H9HA 2A32A 1WDIA 2P8OC 2TGAA 2BDIA 1LDTT 2J2UA 2SGQE 3MWIU 1RTLA 1RS0A 1SFIA 1VCWA 3A8BA 1HBTH 1DUEA 4CH2B 1LHFH 1QL8A 1W12U 2L74A 4X2XA 5CHBA 2FOCA 1KLIH 1WTHD 1ZSKA 4CR5A 1F7ZA 3TGJE 1J17T 1WTGH 3VG8A 2A4OA 2AGEX 1Y3XA 3URCA 1PYTD 1IQLA 5LGOA 2A1DB 4ZMAH 2Q6GA 3SJOA 1ELDE 3OEED 3SW2B 5ETXA 5L6NH 1O5DH 4XBBA 3UTUH 2QA9E 4ZKSU 1P2QA 2XNDD 5JBBS 5FHTA 2G8TA 3GCHC 3SNBA 1XM1A 3F0OA 3LONA 2OC1A 3IG6B 1UJ1A 2A2QH 4FUDA 2B9LA 3ZZ9A 1FAKH 2BD2A 1MTVA 1A7SA 5FBEA 4ZUHA 1GMDG 2QXHA 2V3HH 3MU0A 3MHWU 2OQUA 3F9GA 3GY8A 3MYWA 1SMFE 1O36A 2C8WB 3TVJB 1O3NA 2CGAA 1C2HA 3UNRA 3LH1A 1BITA 3HK6B 1S81A 2GZ7A 2QGRA 3D62A 3JZ1B 4PROA 1DT2A 1B0EA 2DE9A 3VXFH 3OE7D 3MH7A 5HXFA 3E16B 2ZI2H 1LHDH 1O2GH 1T31A 2KR7A 2CK3D 3SI3H 3ZVAA 1ZHRA 2SNVA 1P2JA 3TNSA 3SGQE 1GVZA 2FOMB 3OX7U 1HAIH 1VCQA 4RN6A 1EZUC 1GL0E 3EGKH 2FOFA 3Q3YA 4FUBA 1XXFA 1UHBB 4GPGA 3DD2H 1MTNB 3TH3H 1YLDA 2ZHDA 4CHAC 3H5CB 5C1XA 2TGPZ 2Z9KA 1FONA 2D1JA 3QN7A 4B2AA 5L2ZH 2W3IA 1Y5BT 2KCYA 3KN2A 2GX4A 2IJD1 1PPEE 1JBUH 1Y3UA 4IBLH 2G52A 1QHRB 5CHAC 3UIRA 4R0IA 1RGQA 4CR9A 1MQ5A 2GCHG 2PR3A 2KAIB 2PSXA 4NA7A 2BQ7B 3NXPA 1PPGE 3SJIA 2STAE 1SGDE 2BY6X 5GPIB 4ABFA 1KTTB 3RLWH 1GBJA 1DITH 2OC7A 4U2WA 3NZIA 1TA2A 3UNSA 1GJDB 2NU2E 3MNCA 3E1XB 4X8TH 3ATIA 3RXHA 2LPRA 8ESTE 3MU1A 3FP6E 1GI3A 4Y8XA 1C1QA 1BRCE 3OU0A 3RXIA 4XOJA 4MLFB 3TLOA 2NWNA 2VVUA 1W14U 1HIAB 4A1VA 3Q3KA 1CHOF 1TYNA 1EB2A 3D49H 1H9IE 1YCPM 5EJZA 1W0ZU 5IDKA 1N1LA 3SU2A 1RRKA 1ZRBA 3F9HA 3A87A 2V35A 2FOEA 3GS9A 4NIXA 2P8OB 2PW8H 5EW1H 2ZQ2A 4X6OA 5DP3A 3DA9B 3S7KB 2XOKD 1PQ5A 1SGNE 3ZZAA 2PP6A 5DG6A 4YOJA 1ZJDA 1W0KD 3RXUA 5E0GA 2OCVB 1F5LA 4BTUB 2Y7XA 1W2KH 1JRSA 1YC0A 2ZGJA 4ZKNU 1FY8E 4X2VA 1MZDA 1S6FA 1PPFE 3M3VA 3URDA 2WYGA 4ABHA 1ESBA 1YPJH 1HB0B 1O3CA 1XUJA 1P2IA 1F0UA 1ESAA 2PHBA 1F0RA 2J38A 4TY7A 2J92A 4JZIA 3GY3A 4AX9H 4H4FA 3AASA 1O2WA 3O8RA 3U9AH 5EIYA 1MABB 1TBZH 3PYHA 3HGPA 4NZLA 1YWUA 3JZ2B 5DPAA 3PM3A 5HM2A 3L3TA 3P8OA 1N8OC 4LZ4B 4JZFH 2XBYA 1P12E 1GG6C 1W10U 4F48B 1MTWA 2FLRH 1FQ3A 2ZFQH 3WW7A 5EXLA 2Q1JA 1P10A 1F5RA 1VITF 3T26A 3ZZBA 1C9PA 4D9RA 3PRDA 1ZPCA 4TYDA 2BLOA 1RD3B 1SOZA 1GBCA 2YNAA 2BD5A 2EA3A 2XXLA 3QX5H 1YLCA 3S9AA 2FWWA 2KZ4A 1WYKA 1V2LT 3RXRA 4YM9A 4B2CA 2QXGA 2FOAA 1S83A 5ESTE 2FXRA 4D9QA 1DS2E 5DO4H 3NPSA 1PPHE 1UCYH 3W94A 1TQ7B 1W3CA 3STJA 1K21H 3F68H 2XCNA 1E36B 3DFJA 1YPGH 2Z9JA 1GI1A 1LQDB 1NT1A 1UTQA 1NBMD 3MOCA 4F4OC 3VB5A 1QJ6B 3P8FA 4ZXYH 4WMDA 4ABGA 1BB0B 1GJ9B 1K28D 2ZDKA 2ZDLA 5CHAB 3BN9A 2BXUH 3GICB 1A3BH 1THSH 1ZRKA 2AEIH 1UMAH 3BTWE 3QTOH 1MQ6A 1RIWC 1ZSJA 2M2AA 4K5ZA 4RT1A 1O5EH 4GCHG 3N7EA 3AAUA 2Z94A 2FYRA 5FCRA 1FI8A 2F4LA 2W6JD 1CHGA 4SGAE 2OC8A 3C27B 4X1QU 4K1EA 1GI9B 3S9CA 2IPHA 1QL9A 4YTAA 1T7CA 5LPEA 1TGCA 4ABIA 1LVBA 1WV7H 1SQTA 3RXSA 3LGUA 1EXFA 2QE7D 5DKMA 1LVMA 1QRZA 1ZHPA 3QTVH 3SU6A 1UTOA 4FVDA 3FOAA 4Y0YE 1ELTA 1HAVA 4ISHH 2WPJS 3SV8A 1GMDF 3RUOA 1OHHD 1QQ4A 1J15A 1EP6A 2ZCKP 1E0FD 1TGNA 2KX4A 3A7TA 1O3KA 5EXMA 1MTSA 1EJAA 3A7VA 2YOLA 1IQHA 1GI0A 3GOVB 3RP2A 2WHXA 2XBVA 1SSXA 1TNJA 1GBTA 3STIA 1BTWA 1WQVH 2OUAA 4Y79A 5TJXA 1ESTA 2BLWA 4UFFH 1OWJA 5JBTA 2Z3DA 3UOUA 5HGGA 3P95A 1WAYB 1MZAA 1TMTH 6GCHF 1O2SA 3UAIC 5FXLA 3ATLA 2PV9B 4GHQA 3KQCA 1E1QD 3B23B 4BAQB 1AUTC 2FIRH 2GDEH 2Z9IA 3SQHE 2EC9H 2VIOA 4I31A 2CMYA 1OYTH 3A7XA 3RU4D 2F9OA 1C5XB 2EI7A 3IWMA 1E35B 1SKYE 3T28A 1D3DB 3DSOA 1SHHB 1SB1H 1KLJH 4JZDH 2C8XB 2PKAB 1W0JD 1J8AA 3QO6A 3LIWA 2F9UA 1N8OB 4IN2A 1Q31A 4ZH8A 4ACAA 2Q6DA 1C5YB 1MD7A 2XW9A 4P00A 1C1RA 1GHAG 4Z0KA 2NU4E 4CBOA 1C5WB 3MU4A 1FAXA 1C1VH 1KSNA 1GMHG 3RXLA 2ILNA 3E6PH 1WU1A 1YCPH 3PV2A 4XE4A 1XUGA 1BCUH 2EEKA 3HKIB 3MI4A 1P2MA 1Z71A 5EW2H 1RFNA 2FP7B 2J94A 5E2OA 1L1NA 4F49A 4H42U 3ZVFA 2KCPA 4Q4LA 2P3UB 4AYVB 3MNXA 1FV9A 2HNTC 2PLXA 4RKJB 1SLWB 1TX8A 2R2WU 3ZZDA 1PPBH 4KELA 2F91A 1JMOH 2IN2A 3F6UH 1JIMA 1BUIA 3UNQA 2CJIA 8GCHG 5LH8A 2AH4X 1F92A 3OY5U 1XUFA 1V2RT 3SGBE 4ESTE 1AKSA 2JH0D 5HIYA 1NFYA 4NGAH 1QIXB 3S9BA 2H5CA 3F2HA 4BXWA 3PMHB 1GJ8B 1TBRH 1WBGB 1SBWA 1Y8TA 3ODFA 5I25A 1NRRH 2WV5A 3A83A 3F0PA 3KEEA 3BEUA 1VR1H 4NFFA 3TJOA 3A8CA 2BB4A 3SQEE 1ELFA 1V2JT 3RC5A 1FNIA 3AW1A 2FX6A 3SYJA 2O8UA 3A85A 3BF6H 3P70B 3U98H 1UTMA 3KF2A 1O3DA 1ABJH 1C1NA 1W11U 2GZ9A 3NCLA 2ANWA 1V2WT 4MPUA 1QZ8A 2HPPH 2J34A 1GJCB 2J98B 1Y5UT 5C5OA 1GVLA 2CF8H 2Y80A 1BBRH 1Z8IB 4HI3A 3KQ5A 1E34B 4GLYA 1RTFB 3E90B 2K0QA 4O97A 2G4TA 3RLYH 3OAAD 3NUMA 2Z7FE 1HLTH 2WPLS 4HG6A 4Q7YA 3GY7A 1BBRK 2LP6A 1ZTLA 2ZTXA 3QLPH 2BDAA 1O2RA 2XYAA 3M37A 1QB9A 4B1TA 4B74A 1Z8JB 1C2IA 5C5NA 3VXEH 3HKJB 4AFUA 1QY6A 1TMUH 4D7GA 1PJPA 2FS9A 2V7QD 4FUEA 1TB6H 3RXMA 3E91A 4YOIA 3FFGA 2ZWLH 4DCDA 2BXTH 1V2NT 4NCYA 5G4BA 1O3OA 1ZMLA 3I78A 2Y82A 1TPOA 5JPMH 3RM0H 2XRCA 1LHGH 3A81A 1ETTH 2P3TB 1Q3XA 1O3FA 4TT3D 3D65E 4UEHH 1NRPH 3KNXA 2RFKC 2Q6FA 5DP8A 1TPPA 5C1YA 2F43B 1TONA 2Z9LA 3AVZA 5C94A 3W95A 4WY3A 2BY7X 2BY5X 3SO3A 1BOQA 3PLPA 3FO8D 4AYYB 3LGTA 4WMFA 4ZROA 3KQDA 3VB4A 4OGYA 1V2QT 1IQFA 3EA9A 1WSSH 1VITG 1BTYA 1NY22 4GCHF 1ELBA 1LHEH 1KTSB 1Z1IA 1ARBA 1C4V2 2ZG0H 4X8VH 4K3JA 1GI5A 1F5KU 2O8MA 3FP8E 4NG9H 4U01A 1HRTH 1GBBA 3FVFB 1CGIE 2VIDA 2OTVA 3OTPA 2BD3A 1C1SA 4Q7XA 3SV7A 1O2YA 1O37A 1OWEA 1SLXB 2TBSA 4INHA 1QTFA 3RXAA 2BY9X 3V0XA 3ZZ4A 1SVPA 1K1OA 2P16A 1NS3A 1DWCH 1OP8A 1EFRD 4ZHAA 1BT7A 1NN6A 2GZ8A 1XMNB 4IW4E 1SGPE 1VGCC 2JJ1D 1C1PA 2HGTH 4GVUA 5A0BA 4B71A 1A5HA 1J14A 3VPKA 3SV2H 1Y3VA 1KDQB 2BZ6H 4XRNA 2SGPE 2I6SA 2OP9A 2QIQA 3LGYA 1O3HA 2GJGA 1P0SH 2Z3CA 1G3CA 4Y76A 1HV7A 1V2VT 1NBME 1T4VH 1H8ED 2WPKS 3CS0A 3OSYA 4K8BA 1LKBA 8LPRA 3BTQE 1RTKA 1AY6H 2GKVE 2WYJA 1O5BB 1Q2WA 4TY6A 4DY7B 1P11E 3TK6A 1GHVH 2QXIA 3LGWA 2ZFRH 2RDLA 3VB3A 2HLCA 4K2YA 3SJKA 4AGJA 2ZU3A 3UR9A 1TQ0B 3SV6A 1O3LA 1EB1H 2AMQA 1JXPA 1DANH 1TLDA 2I6QA 2VIWA 1B0FA 5DP7A 3GY5A 3SU4A 3ZV9A 2BVRH 5EQSA 1ZGIA 1CSOE 1K1MA 4BAHB 5T1VA 4A1TA 4KKDA 2VB0A 4MNVA 2ANYA 2HOBA 2A4RA 1Z1JA 1ANDA 4O3TA 4AG1A 1GJ4H 1IAUA 3SU0A 5J4SA 2J4IA 4B6FA 1OKXA 1C5RA 2QF4A 1QRWA 2UUJB 3DT0H 2XC4A 3NRLA 3TNTA 3EE0B 4NIVA 4I8JA 2Y5HA 1AB9C 4CRAA 1K22H 1GHAF 1CGJE 4CH8B 2FDAA 1ZYOA 2SNWA 1GMHF 1AO5A 4Y11E 1AVXA 1SGYE 1HFDA 6GCHG 2PWXA 1KXAA 3T27A 5JBCS 5T6GA 1GL1A 3SU5A 3KCGH 1EZQA 1AWFH 1MH0A 2IPQX 7KMEH 5J4QA 4K8YA 1KXBA 1K1PA 1NFUA 1YF4A 4NIWA 2ZFTA 4OS5A 1OX1A 2ZA5A 4TWWA 3VFEA 1TA6A 1IQNA 2EI8A 8GCHF 4B75A 2UUKB 3UB0A 3TIUA 4NSYA 4OS2A 1XXDA 1V2UT 3VB6A 1PFXC 1O3PB 2EQNA 4AZ2B 4UFGH 1MBMA 1NESE 3TK9A 1O3AA 3RU4E 3SJ9A 4MPWA 1IQKA 1PQ8A 2F9VA 1GHBG 4JYVH 5DP5A 2BQ6B 2SGDE 2BQWB 2ANMH 3T2NA 5EXNA 2VIVA 1INCA 1BIOA 1W8BH 3KGPA 1CA8B 2AIQA 1T8NA 3K9XB 4DIIH 2FPZA 1FPCH 2P3FH 2ZQ1A 1YPLH 1FLEE 3OY6U 1SOTA 1SGCA 4ZCNA 2XC5A 4ABDA 4I32A 2A45B 1S85A 4SGBE 2BX4A 3LC3A 1TNIA 1BTXA 1FXYA 2BDCA 3Q3XA 1ELCA 2WPDD 3P8NA 5K0HA 1BRAA 1NPMA 2CXVA 4NWLA 1VGCB 1D3PB 1EJNA 1VITH 4FUJA 3TK5A 3KL6A 1TPSA 1MD8A 3BTKE 3DUXH 1BMFD 1DE7H 3U1IB 1GI4A 1YPEH 2QCYA 3ZVEA 4ABJA 2RDEA 1UHBA 4HFPB 4I7YH 2F3CE 1FDPA 3PB1E 1DICA 1HCGA 5HKKD 3QGNB 4CRCA 1O2XA 2XCFA 1YPKH 3CNRA 4INKA 4LK4A 3KQEA 3CENA 1TABE 1LO6A 1EAWA 2ZPSA 3U1JB 3PRBA 2BOKA 2FI5E 2ZFPH 1UVOA 3ATMA 1LPGB 4DGJA 3CS7A 1EZXC 1B5GH 3DCLA 1C2EA 1YBWA 4RSPA 3S69A 1ELGA 1DWBH 4BNRA 2JIZD 1A0HB 1O2ZA 4BTTB 2THFB 1OSSA 2FOGA 2OLGA 1QRXA 1FPHH 1NFWA 1EPTC 2FLBH 4M7GA 5GNDA 2M5TA 2ZCHP 1XVOA 1ZHMA 5A2MH 1GJ5H 3RMNH 1ZPBA 4A6LA 1F0SA 1O3BA 3I77A 3OYPA 1BTHH 2JH6D 9LPRA 1O2TA 1LMWB 5EGMA 4NWKA 1ZTJA 1AB9B 1Z6JH 1BTZA 2PFEA 3PMBB 4IMZA 2V0BA 1TAWA 1KXCA 3R3GB 3TPIZ 1O2JA 1G36A 1GDUA 3ELAH 4JYUH 2GV7A 3ZZ5A 1IQJA 4E7RG 5A0CA 3ITIA 3BG4C 2F9PA 1P05A 1H1BA 2ZC9H 5F8XA 2XWAA 1ZJKA 2H6MA 1SC8U 2KCOA 3SZNA 3FN8A 1D3QB 1P09A 2QV1A 1O30A 2UWLA 3NWUA 1MKWH 1DUAA 4FUFA 4B6EA 1HAVB 1TRMA 4J2YB 3ODDA 4JCNA 1BMMH 5GDSH 1ARCA 2GTBA 1C5ZB 4FUGA 5T3HA 1ACBE 1EZSC 1KXEA 1EKBB 3U8TH 2HNTE 3E0NB 4VGCC 4KTUA 1MKWK 3BTGE 4O9VA 2FEQH 1QA0A 4YXWD 2C4FH 1RJXB 1AGJA 1U6QA 4CRDA 1HAOH 1UVTH 1W7GH 4Y71A 3UFAA 4A5TS 3K2UA 1YGCH 3RMMH 4X1RU 1OWHA 1AFQC 1C5QA 1UVSH 3PMAB 4NA8A 6ESTA 1HJ9A 1V2OT 3GCTG 1Z8RA 3LT3A 4WJG2 3RXBA 2BM2A 3IITA 5C20A 3M61U 1T8MA 1CA0C 3AAVA 3ZV8A 4DT7B 1UCYE 1GMCG 3SZEA 1O34A 3GY6A 1QFKH 1O2KA 2XWBI 3LJJA 3VB7A 2G5NA 2UWOA 3M3SA 1O31A 1HYLA 3QK1A 1ELAA 1K1IA 2BD9A 4UE7H 1CE5A 1SLVB 2OD3B 3EA7A 5JB8S 5FBIA 1TALA 3HGNA 3DSPA 3U28C 3BTEE 4IGDA 5EPNA 3M36A 1THRH 4ZHMU 1ZMNA 4K1TA 2ZCLP 4YZUA 3A86A 1V3XA 2FOBA 2ZGHA 1QGFA 2ODYB 1NFXA 4WF8A 1D4PB 3SUDA 3TJNA 4OS4A 3A80A 5FPTA 3RXFA 2JKHA 1V2ST 1CBWC 1P2OA 2D2DA 4ISIH 3MQKC 2ZTZA 1GBKA 1OWIA 2B7DH 1HJAC 4FU9A 4X8UH 1C1WH 1CT4E 4O03A 4I8GA 1AVGH 1XUIA 3SUEA 1OWDA 1P57B 1FN8A 1YLNA 2BZAA 2KCAA 2BD8A 2H9EH 5JYIA 2F83A 5EQRA 2A0QB 4BXSA 1H8HD 1SQAA 1GCTC 2BDHA 1V6DA 1HGTH 5HM9A 1K1NA 1EPTB 1TMBH 1CU1A 3ZYEA 1C2JA 1AI8H 3FZZA 1KYNA 1GI2A 2H1UA 1AKSB 4WH8A 2L6OA 2OK5A 1H8IH 3ESTA 2KM0A 1NU7B 1ZSLA 3QUMP 1OS8A 2FI4E 3KQBA 1GHZA 1O5GH 2ZHFH 3GY2A 1MKXH 5HIZA 4OM9A 1OP0A 3OEHD 1GHBF 2FTMA 2PUQH 4K69A 3H7TA 1OXGA 1E1RD 3B8JA 4I8KA 1AWHB 1HDTH 1GJ6A 1L0ZA 2BMGB 1DWEH 2AMDA 1W7XH 3LPRA 5F8TA 3K6ZA 3BG4B 2G4UA 1CQQA 1MKXK 1IQGA 2OINA 1PPZA 1A5IA 1L2EA 1OOKB 3TH2H 2J97A 1JOUB 1SFQB 1BJUA 1P9UA 2YMSC 2ZECA 1ID5H 2WUCA 3MFJA 1D9IA 1P2NA 1S0RA 3Q00A 4MQAA 4ZKRU 5FX5A 3SHAH 2SFAA 5FPSA 1L1GA 4AB8A 3BV9B 4WXVA 1O3GA 4YOGA 3PMJA 2GT7A 1TGSZ 4A1XA 2QC2A 1Y5AT 1FJSA 1EOLA 2ZDAH 4WXIA 2C90B 2D8WA 2R0LA 4U32A 4VGCB 1ZOMA 1TX6A 4X1PU 2G5VA 2VWOA 1SQOA 2A2XH 1K2I1 2ALVA 1S0QA 2RA3A 4BAMB 1THPB 4THNH 1GBHA 1G2LA 1A2CH 5A0AE 5F8ZA 1TRNA 1AFQB 5I46H 2PUXB 2FTLE 3UWIA 5B6OA 3S0NA 2AYWA 3MNBA 4RI0A 3LU9B 4CBNA 4XFQA 4YESB 2H9TH 2Z6BD 1AMHA 5H4IB 1C5VA 5TCCA 3QZRA 1O2NA 3GDUA 4D7FA 3F2FA 1P06A 2ZPRA 1CA0B 3RXTA 1AUJA 2JDID 3FAOA 5FCKA 4FU7A 1RXPA 2BDBA 2F9NA 1AZ8A 1EX3A 4KP0A 1UK4A 2FX4A 2IOTA 1UW7A 3A84A 3GDVA 3TGIE 1KIGH 4FU8A 4GSOA 2NU0E 2W7UA 4Q7ZA 3L33A 4Q63A 4Y7AA 2ZO3H 5LPFA 5HMAA 2ZGXH 1ZZZA 3NK8A 4Y10E 4CREA 1NU9A 2AGIX 2O9QA 1C5LH 2ZHEH 4UFDH 6CHAC 1JIRA 2AMPA 1C2GA 2J95A 3AK5A 4I86A 2ZTYA 2HVYB 2SGEE 4CRFA 2AHME 1BDAA 3KYFA 2SGFE 1GCDA 3SBKA 2IJOB 1MU6B 2F9BH 3KYGA 3GDSA 1C5TA 2OBQA 2GV6A 3HATH 1G2MA 4X6NA 1MCVA 1CBWB 1D6WA 4IC5A 3EA8A 1HJAB 4D8NA 4AOQA 1PQAA 2HVXA 5L2YH 3SI4H 2G55A 3K6YA 1LTOA 1V2PT 2XC0A 2QY0B 3UPEA 2YMSD 3F9FA 3A7WA 3BTHE 1O2IA 1K1JA 5JBAS 2A4GA 1JWTA 2FYQA 1GCTB 2B8OH 1BBRE 1TGTA 2ZU1A 3BIVH 3O8DA 3RU4T 2CV3A 3SUGA 4LXBH 4DVAU 1A0JA 1QJ7B 2J5UA 4HTCH 1B7XB 7ESTE 3H09A 3HK3B 1AFEH 4XBDA 5CDFE 1ETRH 3PV4A 1ETSH 1O2MA 4HZHA 5DSFA 1GGDC 1M9UA 5EOKA 1KLTA 5GIBA 1TPAE 2ZU2A 3PWBA 2QAAA 5DP9A 2VH6A 2GCTC 1OWKA 1NROH 2XBWA 3SNEA 1G3BA 4FVBA 1ANCA 1UO6A 3ZZ3A 3GCTF 3P8GA 4JYTA 3W1EA 1MMJN 3U8OH 1C2KA 2RG3A 1O33A 1GHXH 2YMSB 3VGCB 1CT0E 4I8HA 4QT8C 1UTPA 1GMCF 2C8YB 1O3JA 1GHYH 1DY8A 1YP9A 2ZGCA 2A7CA 4ZKOU 1P01A 1G3DA 4J1YA 1KXDA 1MTUA 1QURH 3ZZ7A 1GBAA 3EDXB 2AIPA 5T6DA 2ZU5A 3T62A 2WPMS 1L1JA 4BAOB 1ANBA 4OS1A 2C3SA 1S82A 3GCNA 1AE5A 1A46H 2PKSC 4UD9H 1UK3A 2C93B 2ZZUH 3AW0A 1WOFA 4BTIB 2JH5D 3ZZ8A 2CF9H 2JETB 3GCOA 4Y6DA 1QJ1B 2TIOA 1LVYA 2PGQB 3V13A 2STBE 2VH0A 3BTDE 4FUHA 4R8TB 7GCHG 1WXRA 5C0TA 1UVPA 3ENSB 5DK1A 2VBCA 2R0KA 1QQUA 1SGIB 2ZP0H 4FOUC 2TGTA 3MMGA 1K0HA 3F9EA 1IQEA 1G3EA 3M5MA 2VVCA 1DXWA 1DPOA 4Z1MD 5C1UA 2QN5T 3RC4A 1C4Y2 3BEIB 1MBQA 1SGTA 2VWLA 2CHAC 1ZMJA 1UK2A 1DVAH 1S6LA 1BMNH 5E2PA 3OFND 2HALA 1C5NH 3ZIAD 1FY3A 2AFQB 1C2DA 4NZQA 3U69H 4GUXA 1P2KA 1TX7A 6CHAB 1DM4B 2QYIA 2VWMA 3A89A 4RT0A 5EPYA 1GJAB 1S84A 1O35A 4ABAA 1O2QA 1G9IE 2ZEBA 1UTKA 3PWCA 3E8LA 1KDQA 1DDJA 1TE0A 1MCTA 1NRQH 1GBLA 4WMEA 3RXQA 2D26C 4ZXXH 1K9OE 5JB9S 1C5UA 3VEQB 8KME2 1LCYA 1GBMA 2P93A 3M35A 5B6LA 1ZTKA 4MNXA 1ABIH 1PPCE 2RCEA 3PO1C 2AERH 3SNCA 2ALPA 4Q2KA 5EJLA 1ZPZA 3F2GA 1TRYA 4DG4A 1O32A 4AORA 4LZ1H 1HXEH 4GAWA 2R3YA 1ZGVA 4INLA 4KGAA 1S5SA 3E3TA 4E7NA 4NSVA 5IYTA 1VJ9U 4YT6H 1Y3YA 1O2LA 1FN6A 1TNHA 2GGVB 3PTBA 2BX3A 3DFLA 4NA9H 1GGDB 4YLUA 1LKAA 2EI6A 1VJAU 2HWLB 1GI7B 1P3EA 5GWZA 4MTBA 3LOXA 2GCTB 3CP7A 4FETA 2PSYA 2TPIZ 4CRBA 3WWFA 1AE8H 1DXPA 4M9FA 3RXVA 3EYDA 4E05H 1HAHH 4NIYA 2GD4B 4E06H 1NO9H 1QBVH 4Y8ZA 1QL7A 1KXFA 5GCHG 1BMAA 1V2TT 4F55A 1L4DA 1NRNH 2Y81A 2ZHWH 3WY8A 1HAYB 1HPGA 1FY5A 5AFYH 4MG3A 1HAGE 2GMTC 1QNJA 3SNDA 1H8DH 3V12A 2QF3A 1GI8B 3WWBA 1HAXB 1SL3A 2ZFFH 3GY4A 1TNKA 3TJVA 1V2MT 1DFPA 4NFEA 2FM2A 5DN6D 2BVSH 3UR6A 1TOCB 2PKSB 4YLQH 1O2HA 2ZDMA 2XNIA 5F6MA 2VINA 2ULLA 1LPKB 2BLQA 4X2YA 2BOHB 1D3TB 4GHTA 1O3IA 3I29A 3ZYDA 1GI6A 1EAUA 4JZEH 1LPZB 2K8IA 2HLDD 1EATA 4AC9A 1EAXA 1EUFA 2HPQH 3A88A 1TGBA 4B2BA 2ZIQH 1QBNA 5DJ7A 1AHTH 4AN7A 2KAIA 4X2WA 3KIDU 3UOPA 1LVOA 3FP7E 4FXGH 4UFEH 4WVPE 1SPJA 1TOMH 5C2ZA 1EASA 1QR3E 3DSGA 1UTNA 2G00A 1OPHB 2ZKSA 5E8EH 1V2KT 2C8ZB 3LH3A 5FPYA 2YNBA 3KHVA 2G81E 2CHAB 4XBCA 4ISLA 1O2OA 1KY9A 1JRTA 1W13U 4Y7BA 3F3BA 3MH5A 4B76A 2GDDA 3TGKE 4X0WU 2BDGA 1O2VA 3RMLH 1HUTH 1T8OA 2V3MA 3GCHB 2BVXH 1SGQE 1H9HE 1HIAA 5KGOA 2OXSA 4K60A 4ZHLU 3LDXH 5KECA 4H6TA 2H5DA 2VGCC 3M5OA 5KEDA 4X8SH 1AN1E 4UONA 3R0FA 2A5IA 2FMJA 2A5AA 1QB6A 2WUBA 3EQ0H 2BHGA 3PROA 1C9TA 2PGBB 4IMQA 2QF0A 3QDZB 2ESTE 1A61H 1FZZA 4ABEA 3A82A 4P02A 1SG8B 4MDSA 1TBQH 1Y59T 1C5SA 2VU8E 1FIWA 3LKWA 4ASHA 2EY4C 1T4UH 1H4WA 1VZQH 4IN1A 4JZ1A 2ZF0H 4TPIZ 1AVWA 1A0LA 1E37B 3F1SB 1DLKB 5ESBA 2O8WA 2ASUB 3SNAA 2W6ID 1F0TA 3PO1B 1C1UH 3P92A 3LJOA 1VKYA 3V7TA 3ZVDA 1XUHA 2XBXA 2WPHS 3QWCH 2ZU4A 1P03A 1AU8A 1G37A 3Q76A 3A7ZA 5C0UA 3SU1A 1CVWH 5ABWA 1UVUH 3B9FH 1GJ7B 1BTPA 4IS5A 4RKOB 3LC5A 1GPZA 4CHAB 1ZLRA 5EG4A 3Q77A 1SQRA 1YY3A 2QF5A 5E0JA 5AF9H 1HAPH 1TNLA 1WUNH 4BAKB 1SLUB 2ZHQH 1SHYA 2ODPA 1TIOA 7GCHF 4Q80A 4AG2A 2P59A 1UCYK 1O2UA 2NU3E 3MO3A 1A1RA 5F53A 1TWXB 3M5NA 2Y6TA 5FL7D 1BHXF 3P6ZB 3M7TA 1EAIA 3BTFE 1WQSA 3SUFA 4X1SU 1DY9A 2ZDNA 2Y5FA 3ATKA 1FMGA 2XTTB 3BG8A 1F2SE 1G32B 1P02A 2HNTF 2NU1E 5GXPA 1D6RA 4TPYA 2GMTB 4ZAEA 3RM2H 2OC0A 4AGKA 3LGIA 3RXJA 3BIUH 1ORFA 2Z9GA 1GHWH 3M7UA 1COWD 1N6YA 3EAJA 1HNEE 3BTTE 2JJ2D 1C5PA 5K7RA 4AFSA 1O39A 3RXOA 1XVMA 3RMOH 1T32A 1YM0A 4X1NU 3TITA
chains in the Genus database with same CATH topology
2A7JA 4I8LA 5A8ZA 4KTCA 3UUZA 2DUCA 1O3MA 2W3KA 1Y3WA 4U30A 4JK6A 4A7IB 1SI5H 4MVNA 2VVVA 1YKTA 1XKBC 2LNCA 1OP2A 1GDNA 2ZNKH 1GWAA 2AGGX 3FZDA 3PTNA 1A5GH 5DP6A 2W5EA 1SGEE 1MU8B 3U8RH 2UUYA 1Z6EA 2TRMA 3QZQA 2FS8A 1ANEA 1DX5M 1NM6A 2H2ZA 3E0PB 4UDWH 3S7HB 2BD4A 5FAHA 1EOJA 1ELEE 1IHSH 2B0FA 1H9LB 1C1OA 4ISNA 4XDEA 1DSTA 1GDQA 3LGVA 3T25A 5A09A 1IHTH 1G30B 4OS7A 1QBOA 2UUFB 2FI3E 5CE1A 4Y0ZE 4MNWA 2K1QA 2VWNA 2A4QA 2Z3EA 3O8CA 3SOSA 2P94A 1FY1A 2VGCB 1L4ZA 3TU7H 5EQQA 1SR5C 2OQ5A 5PTPA 1GBDA 2FODA 3ZZ6A 3RXCA 4BANB 2Y5GA 3SJ8A 5C67A 2BDYA 4Y8YA 1BTUA 1GG6B 1TFXA 2GCHF 1TNGA 1YPMH 1C1MA 1AZZA 1A3EH 3OTJE 2W7SA 3A8AA 1C5MD 3FANA 2VJ1A 1T8LA 3ATWA 9ESTA 3VGCC 1YPHE 4WH6A 3PLBA 5DP4A 3MO9A 4A92A 5GCHF 6LPRA 3MU8A 2G51A 2UWPA 1OYQA 1W0YH 1C5OH 3ZVCA 3BSQA 1C2LA 1BQYA 3HPTB 3V3MA 1HXFH 2GT8A 4BOHA 2SGAA 3H7OA 1QCPA 1EP5A 2TGDA 1GBEA 1WCZA 1DOJA 2O8LA 2QXJA 1YCPK 2WINI 1GBIA 1MUEB 2O8TA 1CO7E 3RDZA 2JETC 1LHCH 5E0HA 4HGCA 4DURA 5T6FA 5HYOA 2A7HA 2WPIS 3UREA 4DIHH 2ODQA 2BYAX 1EPTA 1IQIA 5DGJA 1O5CB 1X7AC 1GJBB 1FY4A 2W26A 2PKAA 5LPRA 3SV9A 1AD8H 5AFZH 3A8DA 1N6XA 3SORA 1DSUA 1RIWB 3N7OA 4X6MA 4H6SB 4O3UA 2BY8X 3ZVGA 5BRRE 1J16A 4IC6A 3SHCH 1GVKB 4DW2U 3A7YA 2HRVA 1ELVA 1O3EA 3UQVA 2CN0H 3SGAE 4K1SA 1LQEA 5C3NA 4MPVA 3UWJH 3MNSA 2ZGBH 2OBOA 3NKKA 4AB9A 4MPXA 3K65B 1O5FH 2VIQA 4B73A 1DLEA 1BZXE 1MAYA 2P95A 1QB1A 5AVDA 1CHOG 1FUJA 3RXDA 3T5FH 3ZVBA 1C4U2 1CT2E 1HAZB 1K1LA 1XUKA 2R9PA 2ZDVH 1O0DH 3PLKA 3SN8A 5EU8A 4D76A 3RC6A 4DOQA 3GYLB 2BTCE 2V6NA 2ANKH 4MNYA 3L6PA 2R2MB 1GBFA 2A31A 3MH4A 3MU5A 1DWDH 1O38A 1BA8B 3BTME 2GP9B 5BPEA 1NZQH 4AFQA 1EJMA 4AFZA 1CGHA 2GVFA 3O8BA 4TWYA 4OS6A 1PYTC 5F03A 1PQ7A 5A8YA 2WV4A 1BJVA 5AHGH 4YT7H 2BD7A 5SGAE 3M5LA 1ZR0A 4ABBA 2RA0A 4XSKU 4CRGA 4DJZB 3BEFB 4Z6AH 3M7QA 2PTCE 1MTNC 2AS9A 1AIXH 2Y7ZA 5GJ4B 1SGRE 1BRBE 2A5KA 2VNTA 4KTSA 2FO9A 2FOHA 5EODA 1P9SA 1E38B 3MO6A 5FX6A 1NTPA 3ZZCA 1Z7KA 2V3OH 3SU3A 5CMXH 1C2MA 1YPHC 1NRSH 3MH6A 1C2FA 3QGJA 1FIZA 1UTLM 1O5AB 1VCPA 1Z8GA 1AQ7A 4WWYA 2FZZA 4X6PA 3GYMA 2BLVA 2B5TB 5L30H 3RXEA 3D23A 4ISOA 3TJUA 1J9CH 2FESH 4YO9A 4JK5A 4FUIA 1HJ8A 2ZFSA 3TH4H 2DE8A 1SGFG 7LPRA 3UY9A 3T29A 1YYY1 1C1TA 4I33A 3MTYA 1UTJA 5A8XA 1IQMA 2VIPA 1P04A 3DHKH 1BHXB 3M3TA 3RXKA 1O2PA 3C1KA 1P3CA 3P17H 1SGFA 1A4WH 2ZPQA 2J9NA 4JMYA 1XKAC 4LOYH 3G01A 3UQOA 1P8VC 1XX9A 1IOEA 3RXPA 3RXGA 4FUCA 1NC6A 5JDUB 3GISB 2PTNA 1EQ9A 4OGXA 1BMLA 2R3UA 1BRUP 1MAXA 1QA7A 1S6HA 5TCAA 2H9HA 2A32A 2P8OC 2TGAA 2BDIA 1LDTT 2J2UA 2SGQE 3MWIU 1RTLA 1RS0A 1SFIA 1VCWA 3A8BA 1HBTH 1DUEA 4CH2B 1LHFH 1QL8A 1W12U 4X2XA 2FOCA 1KLIH 1WTHD 1ZSKA 4CR5A 1F7ZA 3TGJE 1J17T 1WTGH 2A4OA 2AGEX 1Y3XA 3URCA 1PYTD 1IQLA 5LGOA 2A1DB 4ZMAH 2Q6GA 3SJOA 1ELDE 3SW2B 5ETXA 5L6NH 1O5DH 4XBBA 3UTUH 2QA9E 4ZKSU 1P2QA 5JBBS 5FHTA 2G8TA 3GCHC 3SNBA 1XM1A 3LONA 2OC1A 3IG6B 1UJ1A 2A2QH 4FUDA 2B9LA 3ZZ9A 1FAKH 2BD2A 1MTVA 1A7SA 5FBEA 4ZUHA 1GMDG 2QXHA 2V3HH 3MU0A 3MHWU 2OQUA 3F9GA 3GY8A 3MYWA 1SMFE 1O36A 2C8WB 3TVJB 1O3NA 2CGAA 1C2HA 3UNRA 3LH1A 1BITA 3HK6B 1S81A 2GZ7A 2QGRA 3D62A 3JZ1B 4PROA 1DT2A 1B0EA 2DE9A 3VXFH 3MH7A 5HXFA 3E16B 2ZI2H 1LHDH 1O2GH 1T31A 3SI3H 3ZVAA 1ZHRA 2SNVA 1P2JA 3TNSA 3SGQE 1GVZA 2FOMB 3OX7U 1HAIH 1VCQA 4RN6A 1EZUC 1GL0E 3EGKH 2FOFA 3Q3YA 4FUBA 1XXFA 1UHBB 4GPGA 3DD2H 1MTNB 3TH3H 1YLDA 2ZHDA 4CHAC 3H5CB 5C1XA 2TGPZ 2Z9KA 1FONA 2D1JA 3QN7A 4B2AA 5L2ZH 2W3IA 1Y5BT 3KN2A 2GX4A 1PPEE 1JBUH 1Y3UA 4IBLH 2G52A 1QHRB 5CHAC 3UIRA 4R0IA 1RGQA 4CR9A 1MQ5A 2GCHG 2PR3A 2KAIB 2PSXA 4NA7A 2BQ7B 3NXPA 1PPGE 3SJIA 2STAE 1SGDE 2BY6X 5GPIB 4ABFA 1KTTB 3RLWH 1GBJA 1DITH 2OC7A 4U2WA 3NZIA 1TA2A 3UNSA 1GJDB 2NU2E 3MNCA 3E1XB 4X8TH 3ATIA 3RXHA 2LPRA 8ESTE 3MU1A 3FP6E 1GI3A 4Y8XA 1C1QA 1BRCE 3OU0A 3RXIA 4XOJA 4MLFB 3TLOA 2NWNA 2VVUA 1W14U 1HIAB 4A1VA 3Q3KA 1CHOF 1TYNA 1EB2A 3D49H 1H9IE 1YCPM 1W0ZU 5IDKA 1N1LA 3SU2A 1RRKA 1ZRBA 3F9HA 3A87A 2V35A 2FOEA 4NIXA 2P8OB 2PW8H 5EW1H 2ZQ2A 4X6OA 5DP3A 3DA9B 3S7KB 1PQ5A 1SGNE 3ZZAA 5DG6A 4YOJA 1ZJDA 3RXUA 5E0GA 2OCVB 1F5LA 4BTUB 2Y7XA 1W2KH 1JRSA 1YC0A 2ZGJA 4ZKNU 1FY8E 4X2VA 1MZDA 1S6FA 1PPFE 3M3VA 3URDA 2WYGA 4ABHA 1ESBA 1YPJH 1HB0B 1O3CA 1XUJA 1P2IA 1F0UA 1ESAA 2PHBA 1F0RA 2J38A 4TY7A 2J92A 4JZIA 3GY3A 4AX9H 4H4FA 3AASA 1O2WA 3O8RA 3U9AH 3PYHA 1TBZH 3HGPA 4NZLA 3JZ2B 5DPAA 3PM3A 5HM2A 3L3TA 3P8OA 1N8OC 4LZ4B 4JZFH 2XBYA 1P12E 1GG6C 1W10U 1MTWA 2FLRH 1FQ3A 2ZFQH 5EXLA 2Q1JA 1P10A 1F5RA 1VITF 3T26A 3ZZBA 1C9PA 4D9RA 1ZPCA 4TYDA 2BLOA 1RD3B 1SOZA 1GBCA 2YNAA 2BD5A 2EA3A 2XXLA 3QX5H 1YLCA 3S9AA 2FWWA 1WYKA 1V2LT 3RXRA 4YM9A 4B2CA 2QXGA 2FOAA 1S83A 5ESTE 2FXRA 4D9QA 1DS2E 5DO4H 3NPSA 1PPHE 1UCYH 3W94A 1TQ7B 1W3CA 3STJA 1K21H 3F68H 2XCNA 1E36B 3DFJA 1YPGH 2Z9JA 1GI1A 1LQDB 1NT1A 1UTQA 3MOCA 4F4OC 3VB5A 1QJ6B 3P8FA 4ZXYH 4WMDA 4ABGA 1BB0B 1GJ9B 1K28D 2ZDKA 2ZDLA 5CHAB 3BN9A 2BXUH 3GICB 1A3BH 1THSH 1ZRKA 2AEIH 1UMAH 3BTWE 3QTOH 1MQ6A 1RIWC 1ZSJA 4K5ZA 1O5EH 4GCHG 3AAUA 2Z94A 2FYRA 5FCRA 1FI8A 1CHGA 4SGAE 2OC8A 3C27B 4X1QU 4K1EA 1GI9B 3S9CA 2IPHA 1QL9A 4YTAA 1T7CA 5LPEA 1TGCA 4ABIA 1LVBA 1WV7H 1SQTA 3RXSA 3LGUA 1EXFA 5DKMA 1LVMA 1QRZA 1ZHPA 3QTVH 3SU6A 1UTOA 4FVDA 4Y0YE 1ELTA 1HAVA 4ISHH 2WPJS 3SV8A 1GMDF 3RUOA 1QQ4A 1J15A 1EP6A 2ZCKP 1E0FD 1TGNA 3A7TA 1O3KA 5EXMA 1MTSA 1EJAA 3A7VA 2YOLA 1IQHA 1GI0A 3GOVB 3RP2A 2XBVA 1SSXA 1TNJA 1GBTA 3STIA 1BTWA 1WQVH 2OUAA 4Y79A 5TJXA 1ESTA 2BLWA 4UFFH 1OWJA 5JBTA 2Z3DA 3UOUA 5HGGA 3P95A 1WAYB 1MZAA 1TMTH 6GCHF 1O2SA 5FXLA 3ATLA 2PV9B 4GHQA 3KQCA 3B23B 4BAQB 1AUTC 2FIRH 2GDEH 2Z9IA 3SQHE 2EC9H 2VIOA 4I31A 2CMYA 1OYTH 3A7XA 3RU4D 2F9OA 1C5XB 2EI7A 3IWMA 1E35B 3T28A 1D3DB 1SHHB 1SB1H 1KLJH 4JZDH 2C8XB 2PKAB 1J8AA 3QO6A 3LIWA 2F9UA 1N8OB 4IN2A 1Q31A 4ZH8A 2Q6DA 1C5YB 1MD7A 2XW9A 1C1RA 1GHAG 4Z0KA 2NU4E 4CBOA 1C5WB 3MU4A 1FAXA 1C1VH 1KSNA 1GMHG 3RXLA 2ILNA 3E6PH 1WU1A 1YCPH 4XE4A 1XUGA 1BCUH 2EEKA 3HKIB 3MI4A 1P2MA 1Z71A 5EW2H 1RFNA 2FP7B 2J94A 5E2OA 1L1NA 4F49A 4H42U 3ZVFA 2P3UB 4AYVB 3MNXA 1FV9A 2HNTC 2PLXA 4RKJB 1SLWB 1TX8A 2R2WU 3ZZDA 1PPBH 4KELA 2F91A 1JMOH 2IN2A 3F6UH 1JIMA 1BUIA 3UNQA 2CJIA 8GCHG 5LH8A 2AH4X 1F92A 3OY5U 1XUFA 1V2RT 3SGBE 4ESTE 1AKSA 2JH0D 1NFYA 4NGAH 1QIXB 3S9BA 2H5CA 4BXWA 3PMHB 1GJ8B 1TBRH 1WBGB 1SBWA 1Y8TA 3ODFA 5I25A 1NRRH 2WV5A 3A83A 3KEEA 4NFFA 3BEUA 1VR1H 3TJOA 3A8CA 2BB4A 3SQEE 1ELFA 1V2JT 3RC5A 1FNIA 3AW1A 2FX6A 2O8UA 3A85A 3BF6H 3P70B 3U98H 1UTMA 3KF2A 1O3DA 1ABJH 1C1NA 1W11U 2GZ9A 3NCLA 2ANWA 1V2WT 4MPUA 2HPPH 2J34A 1GJCB 1Y5UT 5C5OA 1GVLA 2CF8H 2Y80A 1BBRH 1Z8IB 4HI3A 1E34B 4GLYA 1RTFB 3E90B 4O97A 2G4TA 3RLYH 3NUMA 2Z7FE 1HLTH 2WPLS 4Q7YA 3GY7A 1BBRK 1ZTLA 2ZTXA 3QLPH 2BDAA 1O2RA 2XYAA 3M37A 1QB9A 4B1TA 4B74A 1Z8JB 1C2IA 5C5NA 3VXEH 3HKJB 4AFUA 1QY6A 1TMUH 4D7GA 1PJPA 2FS9A 4FUEA 1TB6H 3RXMA 3E91A 4YOIA 3FFGA 2ZWLH 4DCDA 2BXTH 1V2NT 4NCYA 5G4BA 1O3OA 1ZMLA 3I78A 2Y82A 1TPOA 5JPMH 3RM0H 2XRCA 1LHGH 3A81A 1ETTH 2P3TB 1Q3XA 1O3FA 4UEHH 3D65E 1NRPH 3KNXA 2Q6FA 5DP8A 1TPPA 5C1YA 1TONA 2Z9LA 3AVZA 3W95A 4WY3A 2BY7X 2BY5X 3SO3A 1BOQA 3PLPA 4AYYB 3LGTA 4WMFA 4ZROA 3KQDA 3VB4A 4OGYA 1V2QT 1IQFA 3EA9A 1WSSH 1VITG 1BTYA 1NY22 4GCHF 1ELBA 1LHEH 1KTSB 1Z1IA 1ARBA 1C4V2 2ZG0H 4X8VH 4K3JA 1GI5A 1F5KU 2O8MA 3FP8E 4NG9H 4U01A 1HRTH 1GBBA 3FVFB 1CGIE 2VIDA 2OTVA 2BD3A 1C1SA 4Q7XA 3SV7A 1O2YA 1O37A 1OWEA 1SLXB 2TBSA 4INHA 1QTFA 3RXAA 2BY9X 3V0XA 3ZZ4A 1SVPA 1K1OA 2P16A 1NS3A 1DWCH 1OP8A 4ZHAA 1BT7A 1NN6A 2GZ8A 1XMNB 4IW4E 1SGPE 1VGCC 1C1PA 2HGTH 4GVUA 5A0BA 4B71A 1A5HA 1J14A 3VPKA 3SV2H 1Y3VA 1KDQB 2BZ6H 2SGPE 2I6SA 2OP9A 2QIQA 3LGYA 1O3HA 1P0SH 2Z3CA 1G3CA 4Y76A 1HV7A 1V2VT 1T4VH 2WPKS 3CS0A 3OSYA 4K8BA 1LKBA 8LPRA 3BTQE 1RTKA 1AY6H 2GKVE 2WYJA 1O5BB 1Q2WA 4TY6A 4DY7B 1P11E 3TK6A 1GHVH 2QXIA 3LGWA 2ZFRH 2RDLA 3VB3A 2HLCA 4K2YA 3SJKA 4AGJA 2ZU3A 3UR9A 1TQ0B 3SV6A 1O3LA 1EB1H 2AMQA 1JXPA 1DANH 1TLDA 2I6QA 2VIWA 1B0FA 5DP7A 3GY5A 3SU4A 3ZV9A 2BVRH 5EQSA 1ZGIA 1CSOE 1K1MA 4BAHB