2HVXA

Discovery of potent, orally active, nonpeptide inhibitors of human mast cell chymase by using structure-based drug design
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of potent, selective, orally active, nonpeptide inhibitors of human mast cell chymase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chymase
total genus 52
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hvxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hvxA02
1IHSH 4R0IA 5C3NA 3GOVB 1C2GA 2FOHA 2STBE 1O2SA 1O3CA 1HIAB 3JZ2B 1OYQA 1QJ7B 3R0FA 4WY3A 9LPRA 4RKJB 4FUEA 3FP8E 3PWCA 1NU7B 4FUDA 2H6MA 3U8OH 3SV6A 3TJOA 1NPMA 3FP7E 1KTSB 1DXWA 3GISB 1FN8A 1DXPA 4K3JA 3SI3H 1LVYA 1F7ZA 1HAHH 2VWMA 4FUJA 1ACBE 2STAE 2ZTYA 1GI1A 2ZDVH 5AF9H 5EGMA 1MTWA 3T5FH 1B0EA 2FDAA 2GCTB 1EPTB 5J4QA 2UUFB 2ZCKP 4X6OA 3RLYH 1J14A 1TAWA 3ZZ5A 1EKBB 2QV1A 1MBMA 3E0PB 1BJVA 5EU8A 1H9IE 3EA7A 4IS5A 1WTGH 2FS8A 1RTKA 1GCTB 1H8DH 4D76A 2VINA 1GBFA 2FWWA 1GI5A 1FI8A 2ZFRH 2PSXA 4YT7H 5JB9S 1PFXC 2V3OH 3UR6A 1HXEH 2Q6FA 2R2WU 1QJ6B 2WUBA 1GBTA 1O5EH 3SNEA 1GJ7B 1BMAA 2F3CE 1PYTC 5DP6A 3M35A 1IQGA 3SI4H 4ABGA 1ZOMA 1PQ7A 1PPZA 3IWMA 2YNBA 1O3NA 3ZVFA 3D49H 7GCHF 2JKHA 4JMYA 1FAKH 1XUIA 1K1MA 2HNTF 3RXIA 2PHBA 1EP6A 1SQOA 4OGXA 3PROA 4D7FA 2PFEA 3S9AA 1XUFA 3SUFA 1MKWK 2ZGXH 1XXFA 4X0WU 5AVDA 1ZSKA 1Y3YA 4AORA 2J95A 2ZU5A 5GWZA 4CBNA 2SGQE 3M3TA 2A4GA 1OP2A 5AFZH 1TNGA 1TGNA 1TYNA 3SJIA 1TBRH 2FESH 4NIWA 1C9TA 1K1NA 2SNWA 1P9UA 4BANB 5FAHA 2QXGA 2NU1E 1RTLA 2Y5GA 1AB9C 1ESBA 2W7UA 5DO4H 1O5FH 1T8NA 1EQ9A 4IN2A 3M7UA 2OC1A 1IHTH 5LH8A 2R9PA 3BG4B 2J94A 1ZGIA 4HZHA 1DPOA 1FMGA 1Z6JH 2Y5FA 1VITH 2UUYA 1ZTLA 4CRDA 1HFDA 1QIXB 5JBCS 2WPKS 1GDQA 1LMWB 1SGNE 1WCZA 1DT2A 1TA2A 1HJ8A 1YBWA 1SGCA 4MPUA 4ZHMU 3A85A 3SV2H 3GCTF 4XBCA 1EOLA 4LK4A 1HAGE 2WUCA 2G5VA 2R0KA 4M7GA 1KSNA 2GV6A 2VH0A 2UWLA 2BD9A 1THRH 3E1XB 4TPIZ 4CHAC 1AI8H 3P8GA 2AMQA 4XSKU 1ESAA 1GI0A 3VPKA 3WY8A 2HPPH 1L0ZA 1MAYA 1NM6A 1SGFG 1W10U 1FONA 1GI6A 1TGTA 1YCPH 2GP9B 1CHOF 1S0QA 2OLGA 1ID5H 4DURA 4F49A 4MNXA 1UJ1A 4CH8B 2GD4B 1B7XB 1EASA 3PMAB 4Q80A 3LGWA 1PPCE 3LGVA 3I78A 1A1RA 1GBBA 2ZDLA 1GVLA 1FZZA 8GCHF 1SL3A 4TWYA 5HYOA 5C5NA 2FOAA 3OSYA 1HAIH 1LDTT 3BEUA 2FOEA 1T8LA 4H42U 3MH5A 1MTSA 5C5OA 3E3TA 1ZHRA 4WMFA 1AFEH 2QYIA 1GVKB 1W0ZU 4H6SB 1BMNH 2BDIA 2XWAA 1CGIE 2ZF0H 1MH0A 7KMEH 4X2VA 1VGCC 3RXOA 3I77A 3UY9A 1TB6H 4ABIA 3QGNB 1EJNA 1Z1IA 4NIXA 5JPMH 1KY9A 1PQ5A 1QBNA 3GY8A 4BTTB 5F8ZA 1C4Y2 3LU9B 1TNKA 4Y6DA 2HLCA 2BLOA 3BIVH 3MOCA 1HGTH 2V6NA 3GY3A 4Y7BA 4UEHH 2BTCE 3RM2H 2ANYA 1FUJA 4O3UA 3VB3A 2PKSC 4BOHA 3STIA 1GHVH 1EAXA 5GXPA 2P59A 1DUAA 1C5WB 3RXKA 1GBEA 1O33A 1DANH 1EPTA 2FI3E 1P2MA 5FHTA 1BRBE 1FV9A 1HXFH 1BMMH 3CS7A 3MU8A 1IQNA 5EPYA 4FUIA 4UONA 3MU1A 1A3EH 3RMLH 1ETTH 1O2UA 2A5KA 4INHA 1O2ZA 1O2TA 3D62A 3E91A 4OS7A 1TNJA 3RXLA 5LPFA 1GG6B 1C5PA 1HDTH 3PTNA 3P17H 4ZKSU 2VIDA 1ELEE 2BY8X 3OU0A 3GDSA 3OYPA 4FUGA 1RD3B 2JETB 4MG3A 3RMMH 1GBAA 3SW2B 3SJOA 1Y3UA 3FFGA 4J1YA 1E34B 1GHAG 1P04A 1C5VA 2PGBB 1JXPA 1AIXH 1V2UT 1GHZA 1GJDB 3FVFB 1O3IA 3K6ZA 2VIOA 2CMYA 1UTJA 2F9NA 2AMPA 4A1TA 1CT0E 3LC5A 4LXBH 5JBAS 2ZHDA 3BSQA 1OSSA 2ODYB 2Z9GA 1BUIA 1TNLA 2H1UA 3TVJB 2EI7A 1ZZZA 3V0XA 1YGCH 1DWEH 2ZDKA 1F5KU 3TGIE 1GJ8B 2ZGHA 4JK6A 2VH6A 5ESBA 5GDSH 3HKIB 1FJSA 1O3JA 4X6PA 3SN8A 5ESTE 1N6YA 2H5CA 3QWCH 3PMHB 2OC8A 1O34A 1TE0A 1KDQA 1VCQA 4I32A 1G3EA 2OINA 4IW4E 3E90B 1GGDB 3KQEA 2ZHFH 4FU9A 3TK5A 1U6QA 3C1KA 2ZFPH 1F92A 3SBKA 3ODFA 1SVPA 1XUGA 1SGEE 2FMJA 2GDEH 1RJXB 1BHXB 1HJAC 3SU3A 3ZZ4A 1AB9B 2BOKA 3M5MA 2FZZA 2Z3DA 2OTVA 1F5LA 1GHXH 2R0LA 3BN9A 3CS0A 1BBRE 4FU8A 2VVCA 1P01A 3BTHE 2O8LA 1YCPK 2PWXA 2V0BA 5K0HA 1IOEA 1MZDA 1UK3A 7GCHG 1F2SE 3GICB 1AN1E 3A82A 3F9FA 3KQCA 2PSYA 2FS9A 3KCGH 1T8MA 5TCAA 2FX4A 1KDQB 1K1IA 3KQDA 3LC3A 1GBHA 2A4RA 3UNSA 3H5CB 3SORA 1F0TA 1EAIA 2A4OA 2ZGJA 5FBIA 1J9CH 1GMHG 2ZU3A 4AGKA 1ZSJA 1TPPA 4MPXA 1ZRKA 2GV7A 4NWLA 1AD8H 3GDVA 3UUZA 2A1DB 1ZYOA 2A7CA 2XBYA 5T6DA 1RIWB 3PLKA 2ZNKH 4CH2B 4XE4A 3RXMA 2ZKSA 1UMAH 5ETXA 2VU8E 3EE0B 1CT4E 4YO9A 2F83A 3RXSA 4DJZB 3A89A 2G00A 1SB1H 1OX1A 2BVRH 1C5QA 1UVUH 3VXEH 2Z3CA 1NZQH 2CN0H 3TNTA 3A80A 1QCPA 1K1LA 8ESTE 3MU4A 5L2YH 5LGOA 1GDNA 1D4PB 1D9IA 5F6MA 4E7NA 1LHCH 2TPIZ 1MCTA 1EB1H 1W11U 3V3MA 1P2IA 1TMTH 3V12A 4RSPA 2P3FH 1KXAA 2W3KA 2GCTC 1DM4B 4CREA 1O2JA 2BX3A 4YTAA 3LGUA 1AHTH 1AMHA 4YLUA 1GI2A 2ZECA 1E37B 1UTKA 1O2PA 3R3GB 2ALVA 1NY22 3RXGA 5L2ZH 1OP8A 4Q7ZA 3P92A 3M7QA 5DGJA 1ETRH 1BJUA 4Y8XA 1P2OA 1P2KA 1H9LB 4DT7B 1O3MA 2P95A 8KME2 3AW0A 1JIMA 2VIQA 1C4V2 3SNDA 1BIOA 1Z6EA 1GBJA 4ISNA 2ILNA 4MPVA 5JDUB 1P2NA 5L30H 2ZPQA 1DS2E 1O2YA 5CE1A 1A4WH 1GCTC 1TMUH 3GCOA 2G8TA 2P94A 4CRCA 1K28D 1O35A 3A84A 3TITA 4THNH 2EI8A 5DP8A 2XC4A 2YNAA 1HCGA 1Y5UT 2BYAX 3NUMA 3RMNH 3EDXB 1MZAA 4YT6H 1KXEA 1CO7E 2SGFE 1XVMA 3F9HA 3RC5A 1LHFH 5EW2H 1O5GH 2TRMA 4K1SA 1T4UH 1E0FD 4AFUA 2EA3A 2O8UA 3SGBE 1WBGB 1HAOH 1T32A 1TGSZ 1ESTA 1WTHD 1Z8JB 3BTKE 1V6DA 4X1NU 2AERH 1K1OA 1V2KT 1DDJA 2BOHB 1UTMA 1BMLA 2LNCA 4X8VH 3QUMP 1VJ9U 1ZMJA 1LO6A 4JCNA 1BRAA 1FY8E 3A7YA 1FXYA 3MO6A 1BB0B 4JZDH 4Y71A 1TLDA 1C5MD 3MH6A 2ZA5A 3TNSA 2FEQH 1MQ5A 5E0GA 2QN5T 2QA9E 3EQ0H 4DVAU 2QIQA 1C1UH 2ZU2A 3HKJB 2WPLS 2QF0A 3CENA 5FXLA 1TONA 2TIOA 1BA8B 1GMDG 1P2QA 1GVZA 1GCDA 1O3PB 3SNAA 3ZZ9A 1CQQA 5GJ4B 2ZPSA 1TWXB 1LQEA 2BD8A 3M5NA 1WU1A 1BDAA 1YYY1 1O5CB 1B5GH 2CHAB 3E6PH 1FY5A 3GY4A 4X8TH 1P12E 4MQAA 3HPTB 1GL0E 3EGKH 3E8LA 2QAAA 1AE8H 2A7HA 2PR3A 1FIWA 2FOCA 4U32A 3SV7A 3KQBA 1TALA 5DP7A 1SFQB 3A83A 1MTVA 1P9SA 5A8YA 4NCYA 1INCA 3GY5A 1KTTB 2F9VA 1O39A 1TPOA 3M36A 4NIYA 1L1JA 5GPIB 6GCHF 3GYLB 3M5LA 3D65E 1ZLRA 1K21H 2XBXA 3JZ1B 1WV7H 4ESTE 3A7XA 2SGDE 2R2MB 2R3UA 1THPB 3OY5U 4Y11E 3W94A 4GUXA 4NFEA 4JZ1A 1G37A 3BEFB 3LIWA 1PQAA 1SGDE 2C3SA 1FIZA 3TIUA 1UCYK 2XTTB 1DVAH 3LGYA 1MAXA 4FUFA 1E36B 2AIPA 1C1QA 2AFQB 5IDKA 1C2MA 2VWNA 1G32B 2AH4X 4DCDA 1NFYA 2XYAA 3RXCA 2FTLE 4RN6A 2D26C 4NZLA 2ZFFH 3RC4A 1Z1JA 3F9GA 2C8WB 2A31A 2BY5X 2GGVB 2OC7A 4FU7A 1KYNA 4WH8A 2THFB 4GVUA 3MTYA 1MMJN 1Y3XA 1C5OH 4Y7AA 1UCYH 2QCYA 1AKSB 4X1SU 1L2EA 4KKDA 5LPEA 2C90B 3TH3H 1J17T 3VB7A 2P8OB 4ABEA 1UVTH 1V2WT 3PWBA 2PUXB 4LOYH 3M3VA 4O97A 2CGAA 5DP4A 5F8XA 3FANA 4NGAH 1C2HA 3IITA 3SUEA 3BTTE 3ZZBA 4Y8ZA 4WMEA 3RM0H 3SZNA 3GYMA 3SNCA 3ZZAA 5C1UA 1IAUA 2PLXA 2OQ5A 1RIWC 4ABDA 1YLCA 2K1QA 4INKA 3QN7A 1SSXA 1BBRK 1C5XB 4YOGA 1GI8B 1GMDF 1UTPA 1N8OB 2P3TB 2XCNA 3OX7U 3PB1E 1DY8A 1NROH 2Y5HA 1NFXA 1ZR0A 1HPGA 2B7DH 1O2IA 2GZ8A 1W13U 1VJAU 1UO6A 2A0QB 2G4TA 5BPEA 1AO5A 2BQ7B 2ZC9H 2ULLA 5HM9A 3T25A 1YPHE 5G4BA 2SGAA 3ZZ3A 1UK4A 2WPHS 4INLA 1RFNA 4BAOB 2ZTXA 2XBVA 3A8BA 2A2QH 2G51A 4B75A 4DGJA 1LCYA 5E0JA 1V2OT 3A7WA 1O3DA 2ANWA 3RXBA 2A5AA 2FLRH 4LZ4B 1YPLH 1SLUB 1YC0A 4JZIA 3W95A 3KEEA 3MO3A 1SR5C 2BY6X 1NO9H 3BIUH 1OS8A 3A88A 1GG6C 3H7OA 2HRVA 1P03A 3PYHA 1MBQA 2ZPRA 5C1XA 3FP6E 2JETC 1C2KA 1UCYE 1D6RA 5A09A 5JB8S 4ZHAA 5HMAA 3VXFH 1Q2WA 2HNTE 2HOBA 4KGAA 1T7CA 3RP2A 1MKXH 2BY9X 4HI3A 5HM2A 1XUHA 2Y7ZA 4TY6A 1SGIB 3ZZ7A 1OXGA 4H4FA 1ELAA 2WPJS 2V35A 2GCHG 4IMQA 1A5IA 2DE8A 2H5DA 1CGJE 4JK5A 1S5SA 1OKXA 3BTFE 2ZFTA 5BRRE 1P02A 2NWNA 3RXAA 1HAZB 1EZSC 3ZVCA 2W26A 2P3UB 3MNSA 4GCHG 1C5SA 1MKXK 3MNXA 1XX9A 1G3DA 2VB0A 3T62A 4ABFA 2FOMB 4B73A 2WV5A 2VWLA 1IQIA 5C20A 5EODA 3AAUA 2HALA 1HYLA 5E2PA 2OXSA 1HIAA 1LHEH 1C2EA 3MH4A 3P8NA 2Q6DA 1SFIA 1HB0B 2JH0D 3KGPA 2AMDA 1ZTKA 1XM1A 2ZDNA 2F9BH 2RA0A 4Z6AH 2O9QA 1W12U 4TYDA 3SO3A 1MTUA 3S0NA 1BCUH 2G55A 3SJKA 4DIIH 1FNIA 1JWTA 4K60A 3LH3A 4ZKRU 2XWBI 2WPIS 3F6UH 5AFYH 4D9RA 1UHBA 2FTMA 3O8CA 1Y8TA 1FY4A 7ESTE 1GJ5H 3TH4H 1PPGE 1C1MA 1S82A 1EB2A 4FXGH 2ZHWH 4IMZA 4YLQH 1JBUH 1QB1A 1S84A 1K22H 4XBBA 2A7JA 4HFPB 2ZFQH 4HTCH 1UTOA 1HAXB 1Y5BT 1GJBB 4BTUB 1KXCA 3UIRA 4WXIA 4Q7XA 5F03A 2PKAB 4Y10E 2PUQH 2WPMS 1S85A 2FO9A 3QGJA 1GHAF 2FYRA 1LKAA 3LGTA 5TJXA 3Q76A 1BOQA 1JRSA 1EZXC 5HGGA 1KLTA 3A81A 4ISLA 3U98H 1KXFA 4BXSA 4NA9H 3MO9A 1P06A 3A7TA 4NSVA 3ATLA 3MYWA 2BD5A 5DP3A 2B5TB 1SGTA 5C67A 1A5GH 3TJNA 1Z8IB 2CJIA 1ANCA 3O8DA 2ZIQH 3SU0A 3P8OA 1VZQH 3Q3XA 4ZH8A 2ZCHP 2BM2A 2VIPA 1GPZA 3RXTA 2RA3A 4FUBA 1HBTH 1K1JA 1BTYA 2BDHA 1ZMLA 1QRXA 1O5AB 1T31A 4SGAE 3NK8A 1GBCA 1ELDE 1GMCF 1RXPA 1W7GH 3A7VA 3GDUA 3M61U 4NIVA 2VNTA 3UPEA 1AFQB 1FLEE 4ZUHA 4K8YA 2GZ9A 1TX8A 1TFXA 1DICA 1B0FA 1AVGH 1DWDH 1L4DA 2ZDAH 1VITG 2FXRA 2ZZUH 3Q00A 6LPRA 4RKOB 1NS3A 5PTPA 1TRNA 4B2CA 4K2YA 3RXHA 3K6YA 4X8UH 5DP5A 4UD9H 5H4IB 1C5TA 1A5HA 1IQJA 1BRCE 3VB6A 1S0RA 4A92A 3PO1C 1EX3A 4ABAA 3TH2H 1BZXE 1Y3WA 3MHWU 1O3KA 2DUCA 1FN6A 1ZHPA 5C2ZA 1GI9B 2PTCE 2A45B 4GHTA 4MTBA 5A0BA 1M9UA 5I25A 1SOZA 1QRWA 4I8JA 1MQ6A 2ZGCA 5A8XA 2TGTA 1H9HE 4TPYA 2BD3A 1A0HB 1QL9A 1WAYB 2ASUB 4GAWA 1DUEA 3GY6A 3U1IB 3S7HB 1UTNA 1XKBC 1A46H 1HAVA 1QJ1B 4GCHF 2EI6A 1NRQH 6ESTA 3VEQB 3UOUA 1CU1A 4TY7A 2ZHEH 1EOJA 1IQKA 3SU2A 2OP9A 2VWOA 3K65B 1A0LA 1QL8A 1IQLA 1VITF 2Y82A 2ZHQH 3EAJA 3I29A 3UR9A 1DLEA 1O2WA 2BDAA 1UVSH 2HPQH 1P0SH 4BAHB 1SQAA 3UWJH 4ZHLU 1AUJA 1SGPE 2Y80A 3SNBA 1ELBA 2D8WA 2ODPA 2Y7XA 1H8IH 4ZROA 1O3BA 3QTOH 1O5BB 4Y8YA 1AWFH 1K9OE 1PPHE 2J34A 1TGBA 1V2ST 1BHXF 1TNIA 3SUDA 1N1LA 2DE9A 1ZPCA 3DD2H 1NT1A 2GTBA 3KHVA 3D23A 3E16B 5JBBS 2J9NA 1C1PA 2Z3EA 5HXFA 2BMGB 4NWKA 2Z94A 3P70B 3C27B 2G52A 1GGDC 1P11E 1YM0A 2O8MA 1GHBF 3PLBA 3ZVGA 2UUKB 3RXQA 2BVSH 3ATKA 3MNCA 4NA7A 4PROA 3CP7A 1ANEA 5FPSA 2OUAA 4I7YH 4O3TA 1KIGH 1TNHA 2QY0B 4WF8A 1EUFA 3ZZ6A 3VGCC 1ZSLA 4ISHH 4A1XA 1CA0C 2SGEE 4AYYB 2ZQ2A 1BBRH 1S6HA 4H6TA 4BNRA 1V2JT 3T26A 1P3EA 1ABIH 1AWHB 3M37A 1TBZH 1ETSH 3AVZA 1C2IA 1QTFA 3UNRA 4J2YB 1CBWC 6CHAB 1MCVA 4X6NA 5EW1H 3UWIA 1GWAA 3G01A 3QO6A 1G36A 3ZVBA 4DG4A 1E35B 2HGTH 1SHHB 4D7GA 2XRCA 1TABE 2YOLA 5TCCA 1GHYH 1RS0A 4XOJA 2XXLA 1GJ6A 2BVXH 1ZPBA 2GT8A 2EEKA 2VJ1A 2KAIA 2OD3B 3A87A 1HNEE 2A4QA 1P2JA 1EP5A 3S9CA 3SU4A 4IC6A 1ORFA 1EJMA 4Z0KA 5FCRA 1C1WH 1F5RA 1TMBH 5FPYA 3HK3B 2BDYA 1XXDA 4X1PU 1H4WA 1QGFA 3DFJA 1TOCB 3Q3KA 4MPWA 2UWOA 4XDEA 1K1PA 1HAVB 3ZVDA 5IYTA 3TPIZ 1ANBA 1AY6H 1FY1A 2WYGA 3PMBB 3EA9A 1GI7B 1OWEA 5GCHG 1SG8B 2ODQA 1C5YB 1YPMH 2XCFA 3A8DA 3RXUA 5E0HA 1DSTA 1YPKH 1DITH 1AKSA 2BXUH 1TA6A 4MVNA 3BTWE 2PKSB 2B8OH 2Z9IA 4KP0A 3RDZA 4MNWA 4WMDA 1TGCA 3MH7A 1TOMH 1UHBB 3ZZ8A 4ZAEA 1LPGB 5EXLA 2QC2A 4UE7H 1P8VC 1FDPA 1N8OC 2H9HA 3NPSA 2ZTZA 1UVOA 1ZMNA 1C2DA 1LHDH 9ESTA 1XUJA 1TRMA 2BZ6H 3FZZA 4X2WA 4YM9A 2H9TH 2AGEX 3LGIA 1FPCH 1ELCA 1GBDA 1O2KA 3ATMA 1YPEH 1D6WA 4E06H 5EQRA 5JYIA 4NFFA 2WV4A 2ZWLH 1GI3A 4DIHH 1O37A 1SLWB 1A61H 1QB6A 2VVVA 2ZDMA 1QHRB 1GJ9B 2ANKH 1NU9A 4I8KA 3A8CA 5T6GA 5EPNA 2G4UA 2B9LA 4ISIH 1N6XA 2XW9A 1TPAE 4OS2A 3QLPH 2Y81A 3PLPA 3SHAH 2QF3A 3K2UA 3ODDA 1C1RA 1GHWH 2BD4A 2HVXA 3L6PA 1EPTC 2NU4E 1CGHA 1EZQA 1J15A 3BV9B 3Q77A 5EOKA 2BLVA 3A86A 1NRNH 1DLKB 1GHBG 1QFKH 1Y3VA 5A0AE 2FIRH 1MD7A 4B2BA 4ABHA 5CMXH 2I6SA 4B1TA 3KNXA 2ZU4A 3UFAA 3MWIU 3B23B 3OY6U 2Q1JA 1PYTD 2FI5E 2VVUA 3BTME 1Z7KA 3PO1B 1O3LA 1XMNB 1JOUB 4K1EA 1QL7A 3P6ZB 2A2XH 4X1RU 5J4SA 2ZEBA 3FAOA 3LPRA 3RMOH 3NKKA 5CHAC 3U8TH 2TBSA 3AW1A 1O3GA 3KIDU 1O0DH 4UFGH 4I8GA 3O8RA 2UWPA 1CSOE 2NU2E 4A1VA 1L1NA 4X2XA 1CE5A 2GVFA 2P93A 2I6QA 8GCHG 2ZU1A 2Z7FE 2ZFSA 1S83A 3LT3A 1V2NT 1A7SA 3F68H 3GCHC 1DOJA 1O2NA 4CBOA 1O2RA 5EXNA 3SU6A 3SV8A 2Z9JA 1MD8A 2ALPA 3U8RH 4JYTA 2CHAC 2NU0E 2SNVA 3ITIA 5DJ7A 4XBDA 1ZHMA 2PGQB 1BITA 1C9PA 2NU3E 3GCTG 4OS5A 2GMTB 1UTQA 2AS9A 2FP7B 1XVOA 3PMJA 2M5TA 2SFAA 1KXDA 2CV3A 1Z8RA 3HATH 2CXVA 2GX4A 2XNIA 3SQEE 1XKAC 3DFLA 1C1TA 3UNQA 1NN6A 5E2OA 1XUKA 1ZGVA 5DPAA 1LPZB 2ZI2H 1HRTH 1W8BH 3UQVA 1VCWA 1P09A 5C1YA 4Y0ZE 1P05A 3LH1A 2Z9KA 4CRFA 4B2AA 1TRYA 3MU5A 3ESTA 1O3OA 1DWBH 2FI4E 1MTNC 2FX6A 1O3EA 5DP9A 6CHAC 3QTVH 4NA8A 4E7RG 3NZIA 2Q6GA 1BTWA 4YZUA 5GCHF 5FPTA 4OS1A 1DFPA 1ZJDA 2P16A 2F9UA 2FOGA 4JZFH 1C1VH 5T3HA 4UDWH 1WQVH 3K9XB 1ZTJA 1LVOA 1NFWA 4A6LA 3RXEA 5DG6A 3NCLA 1O2OA 2FM2A 4K1TA 1OWDA 2GDDA 2W5EA 2IJOB 3DUXH 3B8JA 1V2RT 1G2LA 1TQ0B 1OWIA 1OYTH 4X1QU 3OTJE 3MMGA 4TWWA 1O2MA 3A7ZA 2OQUA 3LOXA 1V2QT 4I31A 3TJUA 4U30A 6GCHG 1OWJA 2BXTH 4KELA 4CHAB 1O5DH 1Y59T 5ABWA 1HV7A 4MLFB 5EQSA 2EC9H 1SC8U 1JIRA 2BDBA 2ZO3H 2F91A 3SHCH 2TGAA 3MU0A 3HGPA 3T29A 1LQDB 1UTLM 1SI5H 4A5TS 4BAKB 3S7KB 1AUTC 2O8WA 1J8AA 3GY2A 1O3HA 3SU5A 1HAYB 1O2GH 3A8AA 4NZQA 4AG2A 4YOIA 3RU4D 4Q7YA 1O32A 2Z6BD 3ENSB 5A0CA 1EXFA 3QK1A 1V2VT 1G2MA 1L4ZA 3V13A 3MI4A 3P8FA 2OBQA 4IBLH 2B0FA 1DX5M 3RUOA 1ANDA 3Q3YA 5DKMA 3ZZCA 4B74A 3H7TA 1LVMA 1BQYA 1SLXB 4VGCC 3U9AH 2GZ7A 2Z9LA 3BF6H 1LHGH 2QXHA 4IC5A 1AQ7A 3UQOA 1EAWA 5A8ZA 4Y79A 1SOTA 3M3SA 1ABJH 1G9IE 3VB5A 2C8ZB 1C4U2 1MU8B 3HGNA 4AYVB 1TPSA 3URDA 1S6FA 2ZCLP 1W14U 1QQ4A 1CA8B 4AN7A 3RXVA 1DSUA 4FUHA 3ZV9A 2FPZA 4MNVA 1GL1A 4JZEH 2FODA 2HNTC 1O38A 1T8OA 1T4VH 1YP9A 2BLQA 3RXDA 1LKBA 3SJ9A 2BZAA 4MNYA 3RXRA 4X2YA 4CRBA 1D3QB 4BXWA 1V3XA 3BTQE 3UREA 4XFQA 1TX7A 1Z71A 1SLVB 1AZZA 1C5LH 1G3BA 1O2VA 1JMOH 1SGQE 2RG3A 3LKWA 3NXPA 3E0NB 4KTUA 4QT8C 3DA9B 1K2I1 4FVDA 2RCEA 1EJAA 1C2FA 5CHAB 1O3FA 1W2KH 1FY3A 2GKVE 1ELFA 1AVWA 1L1GA 3ZV8A 4JYUH 3T28A 4ZKNU 4AFQA 4X6MA 1QY6A 1SMFE 1O2QA 1ELTA 3ELAH 1TIOA 2F9PA 3MFJA 3KN2A 4U2WA 3L3TA 1ZRBA 1EATA 1BTHH 4UFDH 1LTOA 5F8TA 1MKWH 3BG4C 1MU6B 3KF2A 1PQ8A 1DY9A 1QA0A 3ATWA 4DW2U 1GBLA 2WYJA 1H1BA 4ASHA 1BTUA 1VCPA 5T6FA 1BTXA 1CA0B 1C1SA 4SGBE 4I33A 4ISOA 4UFEH 2GCHF 4NSYA 7LPRA 4KTCA 1F0SA 4MDSA 4IN1A 2QXJA 3GCHB 1CBWB 4AZ2B 1G30B 2J2UA 1AZ8A 1AE5A 4ZMAH 1NRSH 1IQHA 3SOSA 1ELGA 1JRTA 2IN2A 1FPHH 3URCA 1SHYA 1NRPH 3TU7H 3UTUH 1C1OA 1C5RA 2JH6D 3RU4T 1C5UA 1A2CH 1WQSA 2GMTC 1NTPA 3TK9A 2PKAA 1GJAB 3QX5H 3QDZB 1MTNB 1C2LA 2BX4A 3IG6B 2VGCC 1QBOA 4AFZA 1LVBA 3T2NA 1KLJH 2P8OC 1UVPA 1YLDA 2O8TA 1HJAB 1BTZA 2D2DA 1QNJA 1PJPA 1SPJA 1RGQA 1THSH 1GMHF 1QURH 1F0RA 1E38B 1Y5AT 3PM3A 4OGYA 3F9EA 1PPEE 1OOKB 4BAQB 1KXBA 1O30A 3LJOA 5JBTA 5L6NH 1QRZA 1AU8A 3BTEE 2W3IA 1V2LT 1QB9A 3ZYEA 1TX6A 4FVBA 3U69H 1W7XH 1C2JA 3F1SB 2SGPE 3MNBA 4KTSA 2OC0A 4LZ1H 4GSOA 2AYWA 5E8EH 1OP0A 4Y76A 2PV9B 4CRGA 2FOBA 4AFSA 1QR3E 3M5OA 3RLWH 1C1NA 2BQ6B 1W3CA 4K8BA 3U1JB 4U01A 3NWUA 2XC0A 1IQEA 1P3CA 4BAMB 2FLBH 3RXFA 1GBIA 2XBWA 4I8HA 4WVPE 2ZQ1A 3UOPA 1O31A 5K7RA 1GJ4H 4F4OC 3AAVA 1EAUA 2VIWA 2J4IA 1MUEB 3BG8A 4K5ZA 1AFQC 2V3HH 1FAXA 1EZUC 4FUCA 1V2PT 2ZP0H 3N7OA 5SGAE 3PTBA 2G81E 2ZG0H 1CHGA 4A7IB 2VIVA 2J38A 1S81A 4BTIB 1PPFE 3RXPA 1ZPZA 5EG4A 1C5ZB 1SQTA 2Y6TA 5AHGH 3HK6B 3BTDE 2BD7A 2CF8H 2OCVB 3SJ8A 4DOQA 4CR9A 4VGCB 2BHGA 2PTNA 2BB4A 1RRKA 4GHQA 4B71A 4AOQA 1TQ7B 1NC6A 5DK1A 1X7AC 1QBVH 1NFUA 3SUGA 1YKTA 1FQ3A 2BY7X 4WXVA 1O2HA 1HUTH 1W0YH 4ZXXH 1YF4A 4E05H 1YCPM 2C8XB 1GDUA 1GMCG 2G5NA 4YESB 8LPRA 1WSSH 4Y0YE 1BTPA 1YPGH 3ATIA 2BLWA 1A0JA 1O36A 2C8YB 5LPRA 4CR5A 3TGJE 2H9EH 3QZRA 1DWCH 3T27A 1ARBA 4D8NA 2QXIA 4OS4A 1AVXA 4UFFH 2C4FH 1P10A 3LJJA 1CVWH 2A32A 3GCNA 1Q31A 5I46H 4HGCA 3S9BA 1F0UA 3EA8A 4O03A 3VB4A 2ANMH 1WUNH 1UK2A 3V7TA 1ELVA 3M7TA 4K69A 2C93B 3QZQA 1SGRE 1HLTH 2A5IA 1CHOG 1SGYE 3ZVEA 3GY7A 2D1JA 1AGJA 2PW8H 4AB8A 1O3AA 3STJA 3P95A 2IOTA 1DE7H 1G3CA 4ABBA 3VFEA 2FOFA 1KLIH 1WYKA 2FYQA 2ESTE 3VGCB 2WINI 3LONA 5FCKA 1D3TB 1A3BH 1V2MT 1CT2E 1D3PB 3KL6A 2AGGX 3DT0H 3RXJA 1Z8GA 4CRAA 1VR1H 3TJVA 1RTFB 3S69A 3ZZDA 2ZGBH 1NESE 2BQWB 1P57B 4AB9A 2BDCA 1GBKA 1O2XA 1ARCA 2AEIH 3AASA 4Q2KA 2R3YA 4I8LA 5A2MH 4GPGA 1ZJKA 2LPRA 3EYDA 1QQUA 3RU4E 1BRUP 1O2LA 1IQMA 1TBQH 2KAIB 3L33A 3SGQE 4IGDA 1GBMA 2CF9H 3SU1A 2J92A 4ZKOU 4O9VA 1HAPH 2OBOA 3TLOA 3RC6A 2H2ZA 2HWLB 4X8SH 3LDXH 1D3DB 2UUJB 3SGAE 4R8TB 4OS6A 1YPJH 5FX6A 2TGPZ 3ZYDA 4AG1A 3DHKH 4ZXYH 2QGRA 2AGIX 1WOFA 3SV9A 4DY7B 1GI4A 1QA7A 1HJ9A 2TGDA 1OWKA 5EXMA 5FX5A 4JYVH 2F9OA 1IQFA 4NG9H 4WH6A 2AIQA 1PPBH 2RDLA 4YOJA 4B76A 5EQQA 4GLYA 4ABJA 4WWYA 2VGCB 1BT7A 1SBWA 1VGCB 1Q3XA 2IPHA 2W7SA 3BEIB 3FZDA 1OWHA 3ZVAA 1V2TT 3TK6A 2XC5A 2BD2A 4AGJA 2GT7A 2JH5D 1J16A 3SQHE 5GIBA 3PV4A 5FBEA 3O8BA 3B9FH 4D9QA 5B6OA 1OPHB 4WJG2 2BDGA 1GJCB 1LPKB 3TGKE 1YPHC 1NRRH 1SGFA 1C5NH 4AX9H 3BTGE
chains in the Genus database with same CATH superfamily
1IHSH 4R0IA 5C3NA 3GOVB 1C2GA 2FOHA 2STBE 1O2SA 1O3CA 3WW7A 1HIAB 3JZ2B 1OYQA 1QJ7B 2GJGA 3R0FA 4WY3A 9LPRA 1WXRA 2JIZD 4RKJB 4FUEA 3FP8E 3PWCA 1NU7B 4FUDA 2H6MA 3U8OH 3SV6A 3TJOA 1NPMA 3FP7E 1KTSB 1DXWA 3GISB 1FN8A 1DXPA 4K3JA 3SI3H 1LVYA 1F7ZA 1HAHH 2VWMA 4FUJA 1ACBE 2STAE 2ZTYA 1GI1A 2ZDVH 5AF9H 5EGMA 1MTWA 3T5FH 1B0EA 2FDAA 2GCTB 1EPTB 5J4QA 2UUFB 2ZCKP 4X6OA 3RLYH 4OM9A 1J14A 1TAWA 3ZZ5A 1EKBB 2QV1A 1MBMA 3E0PB 1BJVA 5EU8A 1H9IE 3EA7A 4XD7D 4IS5A 1WTGH 2FS8A 1RTKA 1GCTB 1H8DH 4D76A 2VINA 1GBFA 2FWWA 1GI5A 1FI8A 2ZFRH 2PSXA 4YT7H 5B6LA 5JB9S 1PFXC 2V3OH 3UR6A 1HXEH 2Q6FA 3OEED 2R2WU 1QJ6B 2WUBA 1GBTA 1O5EH 3SNEA 1GJ7B 1BMAA 2F3CE 1PYTC 5DP6A 3VG8A 3M35A 1IQGA 3SI4H 4ABGA 1ZOMA 1PQ7A 1PPZA 3IWMA 2YNBA 4YXWD 1O3NA 3ZVFA 3D49H 7GCHF 2JKHA 4JMYA 1FAKH 1XUIA 1K1MA 2HNTF 3RXIA 2PHBA 1EP6A 1SQOA 4OGXA 3PROA 5C94A 4D7FA 2PFEA 3S9AA 1XUFA 3SUFA 1YLNA 1MKWK 2ZGXH 1XXFA 4X0WU 5AVDA 1ZSKA 1Y3YA 4AORA 2J95A 2ZU5A 5GWZA 4CBNA 2SGQE 3M3TA 2A4GA 2YMSD 1OP2A 5AFZH 1TNGA 1TGNA 1TYNA 3SJIA 1TBRH 2FESH 4NIWA 1C9TA 1K1NA 2SNWA 1P9UA 4BANB 5FAHA 2QXGA 2NU1E 1RTLA 2Y5GA 1AB9C 1ESBA 2W7UA 5DO4H 1O5FH 1T8NA 3OE7D 1EQ9A 4IN2A 4Z1MD 3M7UA 2OC1A 1IHTH 5LH8A 2R9PA 3BG4B 2J94A 1ZGIA 4HZHA 5DSFA 1DPOA 1FMGA 1Z6JH 1VITH 2UUYA 1YWUA 1ZTLA 2Y5FA 2OK5A 4CRDA 1HFDA 1QIXB 5JBCS 2WPKS 1GDQA 1LMWB 1SGNE 4ACAA 1WCZA 2YMSC 1DT2A 1TA2A 1HJ8A 1YBWA 1SGCA 4MPUA 4ZHMU 3A85A 3SV2H 3GCTF 4XBCA 1EOLA 4LK4A 1HAGE 2WUCA 1MABB 2G5VA 2R0KA 4M7GA 1KSNA 2EY4C 2GV6A 2VH0A 2UWLA 2BD9A 1THRH 3E1XB 2V3MA 4ZCNA 4TPIZ 4CHAC 1AI8H 3P8GA 2AMQA 4XSKU 1ESAA 1GI0A 3VPKA 3WY8A 2HPPH 1L0ZA 1MAYA 1NM6A 1SGFG 1W10U 1FONA 1GI6A 1TGTA 1YCPH 2GP9B 1CHOF 1S0QA 2OLGA 1ID5H 1NBMD 2RFKC 4DURA 4F49A 4MNXA 1UJ1A 4CH8B 2GD4B 1B7XB 1EASA 3PMAB 4Q80A 3LGWA 1PPCE 3LGVA 3I78A 1A1RA 1GBBA 2ZDLA 1GVLA 2XNDD 1FZZA 8GCHF 1SL3A 4TWYA 3OAAD 5HYOA 5C5NA 2FOAA 3OSYA 1HAIH 1LDTT 3BEUA 2FOEA 1T8LA 4H42U 3MH5A 1MTSA 5C5OA 3E3TA 1ZHRA 4WMFA 1AFEH 2QYIA 1GVKB 1W0ZU 4H6SB 1BMNH 2BDIA 2XWAA 1CGIE 2ZF0H 1MH0A 7KMEH 4X2VA 1VGCC 3RXOA 3I77A 3UY9A 1TB6H 4ABIA 3QGNB 1EJNA 1Z1IA 4NIXA 5JPMH 1KY9A 1PQ5A 1QBNA 3GY8A 4BTTB 5F8ZA 1C4Y2 3LU9B 1TNKA 4Y6DA 2HLCA 2BLOA 3BIVH 3MOCA 1HGTH 4M9FA 4I86A 2V6NA 3GY3A 4Y7BA 4UEHH 2BTCE 3RM2H 2ANYA 1FUJA 4O3UA 3VB3A 2PKSC 4BOHA 3STIA 1GHVH 1EAXA 5GXPA 2P59A 1DUAA 1C5WB 3RXKA 1GBEA 1W0KD 1O33A 1DANH 1EPTA 2FI3E 1P2MA 5FHTA 1BRBE 1FV9A 1HXFH 1BMMH 3CS7A 3MU8A 1IQNA 5EPYA 4FUIA 4UONA 3MU1A 1A3EH 3RMLH 1ETTH 3F0PA 1O2UA 2A5KA 4INHA 1O2ZA 1O2TA 3D62A 3E91A 4OS7A 5CHBA 1TNJA 3RXLA 5LPFA 1GG6B 1C5PA 1HDTH 3PTNA 3P17H 4ZKSU 2VIDA 1ELEE 2BY8X 3OU0A 2V7QD 3GDSA 3OYPA 4FUGA 1RD3B 2JETB 4MG3A 3RMMH 1GBAA 3SW2B 3SJOA 1Y3UA 3FFGA 4J1YA 1E34B 1GHAG 1P04A 1C5VA 2PGBB 1JXPA 1AIXH 1V2UT 1GHZA 1GJDB 3FVFB 1O3IA 3K6ZA 2VIOA 2CMYA 1H8HD 1UTJA 2F9NA 2AMPA 4A1TA 1CT0E 3LC5A 4LXBH 5JBAS 2ZHDA 3BSQA 2KX4A 1OSSA 2ODYB 2Z9GA 1BUIA 1TNLA 2H1UA 3TVJB 5EIYA 2EI7A 1ZZZA 3CNRA 3V0XA 1YGCH 1DWEH 2ZDKA 1F5KU 3TGIE 1GJ8B 2ZGHA 4JK6A 2VH6A 5ESBA 5GDSH 3HKIB 1FJSA 1O3JA 4X6PA 3SN8A 5ESTE 1N6YA 2H5CA 3QWCH 3PMHB 2OC8A 1O34A 1TE0A 1KDQA 1VCQA 4I32A 1G3EA 2OINA 4IW4E 3U28C 3E90B 1GGDB 3KQEA 2ZHFH 4FU9A 3TK5A 1U6QA 3C1KA 2ZFPH 1F92A 3SBKA 3ODFA 1SVPA 1XUGA 1SGEE 2FMJA 2GDEH 1RJXB 1BHXB 1HJAC 3SU3A 3ZZ4A 1AB9B 2BOKA 3PV5A 3M5MA 2FZZA 2Z3DA 2OTVA 1F5LA 1GHXH 2R0LA 3BN9A 3CS0A 1BBRE 4FU8A 2VVCA 1P01A 3BTHE 2O8LA 1YCPK 2PWXA 2V0BA 5K0HA 1IOEA 1MZDA 1UK3A 7GCHG 1F2SE 3GICB 1AN1E 3A82A 3F9FA 3KQCA 2PSYA 2FS9A 3KCGH 1T8MA 2K0QA 5TCAA 2FX4A 1KDQB 1K1IA 3KQDA 3LC3A 1GBHA 2A4RA 3UNSA 3H5CB 3SORA 1F0TA 1EAIA 2A4OA 2ZGJA 5FBIA 1J9CH 1GMHG 1SQRA 5EJLA 2ZU3A 4AGKA 1ZSJA 1TPPA 2HVYB 4MPXA 1ZRKA 2GV7A 4NWLA 1AD8H 1E79D 3GDVA 3UUZA 2A1DB 1ZYOA 2A7CA 2XBYA 5T6DA 1RIWB 3PLKA 2ZNKH 4CH2B 4XE4A 3RXMA 2ZKSA 1UMAH 5ETXA 2VU8E 3EE0B 1CT4E 4YO9A 2F83A 3RXSA 4DJZB 3A89A 2G00A 1SB1H 1OX1A 2BVRH 1C5QA 1UVUH 3VXEH 2Z3CA 1NZQH 2CN0H 3TNTA 3A80A 1QCPA 1K1LA 8ESTE 3MU4A 5L2YH 5LGOA 1GDNA 1D4PB 1D9IA 5F6MA 4E7NA 1LHCH 2TPIZ 1MCTA 1EB1H 1W11U 3V3MA 1P2IA 1TMTH 3V12A 3OTPA 2P3FH 1KXAA 4RSPA 2W3KA 2GCTC 1DM4B 4CREA 1O2JA 2BX3A 4YTAA 3LGUA 1AHTH 1AMHA 4YLUA 1GI2A 2ZECA 1E37B 1UTKA 1O2PA 3R3GB 2ALVA 1NY22 3RXGA 5L2ZH 1OP8A 4Q7ZA 3P92A 3FN8A 3M7QA 5DGJA 1ETRH 1BJUA 4Y8XA 1P2OA 1P2KA 1H9LB 4DT7B 1O3MA 2P95A 8KME2 3AW0A 1JIMA 2VIQA 1C4V2 3SNDA 1BIOA 1Z6EA 1GBJA 4ISNA 2ILNA 4MPVA 5JDUB 1P2NA 5L30H 2ZPQA 1DS2E 1O2YA 5CE1A 1A4WH 1GCTC 1TMUH 3GCOA 2G8TA 2P94A 4CRCA 1K28D 1O35A 3A84A 3TITA 4THNH 2EI8A 5DP8A 4TT3D 2XC4A 2YNAA 1HCGA 1Y5UT 2BYAX 3NUMA 3RMNH 3EDXB 1MZAA 4YT6H 1KXEA 1CO7E 2SGFE 1XVMA 3F9HA 3RC5A 1LHFH 5EW2H 2J98A 1O5GH 2TRMA 4K1SA 1T4UH 1E0FD 4AFUA 2EA3A 2O8UA 3SGBE 1WBGB 1HAOH 1T32A 1TGSZ 1ESTA 1WTHD 1Z8JB 3BTKE 3PV2A 1V6DA 4X1NU 2AERH 1K1OA 1V2KT 1DDJA 2BOHB 1UTMA 1BMLA 2LNCA 4X8VH 3QUMP 1VJ9U 1ZMJA 1LO6A 4JCNA 1BRAA 1FY8E 3A7YA 1FXYA 3MO6A 1BB0B 4JZDH 4Y71A 2KCOA 1TLDA 1C5MD 3MH6A 2ZA5A 3TNSA 2FEQH 1MQ5A 5E0GA 2QN5T 3UAIC 3GS9A 2QA9E 3EQ0H 4DVAU 2QIQA 1C1UH 2ZU2A 3HKJB 2WPLS 2QF0A 3CENA 5FXLA 1TONA 2TIOA 1BA8B 1GMDG 1P2QA 1GVZA 3ZIAD 1GCDA 1O3PB 3DSGA 3SNAA 3ZZ9A 1CQQA 5GJ4B 2ZPSA 1TWXB 1LQEA 2BD8A 3M5NA 1WU1A 1BDAA 1YYY1 1O5CB 1B5GH 2CHAB 3E6PH 1FY5A 3GY4A 4X8TH 2QE7D 1P12E 4MQAA 3HPTB 1GL0E 3EGKH 3E8LA 2QAAA 1AE8H 2A7HA 2PR3A 1FIWA 2FOCA 5CDFE 4U32A 3SV7A 3KQBA 1TALA 5DP7A 1SFQB 3A83A 1MTVA 1P9SA 5A8YA 4NCYA 1K0HA 1INCA 3GY5A 1KTTB 2F9VA 1O39A 1TPOA 3M36A 4NIYA 1L1JA 5GPIB 6GCHF 3GYLB 3M5LA 3D65E 1ZLRA 1K21H 2XBXA 3JZ1B 1OHHD 1WV7H 4DT4A 4ESTE 3A7XA 2SGDE 3KQ5A 2R2MB 2R3UA 5KGOA 1THPB 3OY5U 4Y11E 3W94A 4GUXA 4NFEA 4JZ1A 1G37A 3BEFB 3LIWA 1PQAA 1SGDE 2C3SA 1FIZA 3TIUA 1UCYK 2XTTB 1DVAH 3LGYA 1MAXA 4FUFA 1E36B 2AIPA 1C1QA 2AFQB 5IDKA 1C2MA 2VWNA 1G32B 2AH4X 4DCDA 1NFYA 3FO8D 2XYAA 3RXCA 4FOUC 2FTLE 4RN6A 2D26C 4NZLA 2ZFFH 3RC4A 1Z1JA 3F9GA 2C8WB 2A31A 2BY5X 2GGVB 2LP6A 2OC7A 4FU7A 1KYNA 4WH8A 2THFB 4GVUA 3MTYA 1MMJN 1Y3XA 1C5OH 4Y7AA 1UCYH 2QCYA 1AKSB 4X1SU 1L2EA 4KKDA 3H09A 5LPEA 2C90B 3TH3H 1J17T 3VB7A 4FETA 2P8OB 4ABEA 1UVTH 1V2WT 3PWBA 2PUXB 4LOYH 3M3VA 4O97A 2CGAA 5DP4A 5F8XA 3FANA 4NGAH 3KYGA 1C2HA 3IITA 3SUEA 3BTTE 3ZZBA 4Y8ZA 4WMEA 3RM0H 3SZNA 1KMHB 3GYMA 3SNCA 3ZZAA 5C1UA 1IAUA 2PLXA 2OQ5A 1RIWC 4ABDA 1YLCA 2K1QA 4INKA 3QN7A 5HKKD 1SSXA 1BBRK 1C5XB 4YOGA 1GI8B 1GMDF 1UTPA 1N8OB 2P3TB 2XCNA 3OX7U 3PB1E 1DY8A 1NROH 2Y5HA 1NFXA 1NBME 1ZR0A 3FKSD 1HPGA 2B7DH 1O2IA 2GZ8A 1W13U 3OFND 1VJAU 1UO6A 2A0QB 2G4TA 5BPEA 1AO5A 2BQ7B 2ZC9H 2ULLA 2CK3D 5HM9A 3T25A 1YPHE 5G4BA 2SGAA 2IJD1 3ZZ3A 1UK4A 2WPHS 4INLA 1RFNA 4BAOB 2ZTXA 2XBVA 3A8BA 1H8ED 2A2QH 2G51A 4B75A 4DGJA 1LCYA 2J5UA 5E0JA 1V2OT 3A7WA 1O3DA 2ANWA 3RXBA 2A5AA 2FLRH 4LZ4B 1YPLH 1SLUB 1YC0A 4JZIA 3W95A 3KEEA 3MO3A 1SR5C 2BY6X 1NO9H 3BIUH 1OS8A 3A88A 1GG6C 3H7OA 2HRVA 1P03A 3PYHA 1MBQA 2ZPRA 5C1XA 3FP6E 2JETC 1C2KA 1UCYE 1D6RA 5A09A 5JB8S 4ZHAA 5HMAA 3VXFH 1Q2WA 2HNTE 2K8IA 5C0TA 2HOBA 4KGAA 1T7CA 3RP2A 1MKXH 2BY9X 4HI3A 5HM2A 1XUHA 2Y7ZA 4TY6A 1SGIB 3ZZ7A 2KR7A 1OXGA 4H4FA 1ELAA 2KZ4A 2WPJS 3F0OA 2V35A 2GCHG 4IMQA 1A5IA 2DE8A 2H5DA 1CGJE 3F3BA 1S5SA 4JK5A 5DN6D 1OKXA 3BTFE 2ZFTA 5BRRE 1P02A 2NWNA 3RXAA 1HAZB 1EZSC 3ZVCA 2W26A 2P3UB 3MNSA 4GCHG 1C5SA 1MKXK 3MNXA 1XX9A 1G3DA 2VB0A 3T62A 4ABFA 2FOMB 4B73A 2JDID 5HIZA 2WV5A 2VWLA 3N7EA 1IQIA 1COWD 5C20A 5EODA 3AAUA 2HALA 1HYLA 5E2PA 1SKYE 2OXSA 1HIAA 1LHEH 1C2EA 3MH4A 3P8NA 2Q6DA 1SFIA 1HB0B 2JH0D 3KGPA 2AMDA 1ZTKA 1XM1A 2ZDNA 2F9BH 2RA0A 4Z6AH 2VBCA 2O9QA 1W12U 4TYDA 3SO3A 1MTUA 3S0NA 1BCUH 2G55A 3SJKA 3N7DA 4DIIH 1FNIA 1JWTA 4K60A 3LH3A 4ZKRU 2XWBI 2WPIS 3F6UH 5AFYH 4D9RA 1UHBA 2FTMA 3O8CA 1Y8TA 1FY4A 7ESTE 3F2FA 1GJ5H 3TH4H 1PPGE 1C1MA 1S82A 1EB2A 2W6JD 4FXGH 2ZHWH 4IMZA 4YLQH 3WWBA 1JBUH 1QB1A 1S84A 1K22H 5FL7D 4XBBA 2A7JA 4HFPB 4F55A 2ZFQH 4HTCH 1UTOA 1HAXB 1Y5BT 2KCAA 1GJBB 4BTUB 1KXCA 3UIRA 4WXIA 4Q7XA 5F03A 2PKAB 4Y10E 2PUQH 2WPMS 4P00A 1S85A 2FO9A 3QGJA 1GHAF 2FYRA 3DSPA 1LKAA 3LGTA 5TJXA 3Q76A 1BOQA 1JRSA 1EZXC 5HGGA 1KLTA 3A81A 4ISLA 3U98H 1KXFA 4BXSA 4NA9H 3MO9A 1P06A 3A7TA 4NSVA 3ATLA 3MYWA 2BD5A 5DP3A 2B5TB 3NRLA 1SGTA 5C67A 1A5GH 3TJNA 1Z8IB 2CJIA 1ANCA 3O8DA 5GNDA 2ZIQH 3SU0A 3P8OA 1VZQH 3Q3XA 4ZH8A 2ZCHP 2BM2A 2VIPA 1GPZA 3RXTA 2RA3A 4FUBA 1HBTH 1K1JA 1BTYA 2BDHA 1ZMLA 1QRXA 3SZEA 1O5AB 1T31A 4SGAE 3NK8A 1GBCA 1ELDE 1GMCF 1RXPA 1W7GH 3A7VA 3GDUA 3M61U 4NIVA 2VNTA 3UPEA 1AFQB 1FLEE 3UB0A 4ZUHA 4K8YA 2GZ9A 1TX8A 1TFXA 1DICA 1B0FA 1AVGH 1DWDH 1L4DA 2ZDAH 1VITG 2FXRA 2ZZUH 2L74A 3Q00A 6LPRA 4RKOB 1NS3A 5PTPA 1TRNA 4B2CA 4K2YA 3RXHA 3K6YA 4X8UH 5F53A 5DP5A 4UD9H 5H4IB 5C17A 1C5TA 1A5HA 1IQJA 1BRCE 3VB6A 1S0RA 4A92A 3PO1C 1EX3A 4ABAA 3TH2H 1BZXE 1Y3WA 3MHWU 1O3KA 2DUCA 1FN6A 1ZHPA 5C2ZA 1GI9B 2PTCE 2A45B 4GHTA 4MTBA 5A0BA 1M9UA 5I25A 1SOZA 1QRWA 4I8JA 1MQ6A 2ZGCA 5A8XA 2TGTA 1H9HE 4TPYA 2BD3A 1A0HB 1QL9A 1WAYB 2ASUB 4GAWA 1DUEA 3GY6A 3U1IB 2IPQX 3S7HB 1UTNA 1XKBC 1A46H 1HAVA 1QJ1B 4GCHF 2EI6A 1NRQH 6ESTA 3VEQB 3UOUA 1CU1A 4TY7A 2ZHEH 1EOJA 1IQKA 3SU2A 2OP9A 2VWOA 3K65B 1A0LA 1QL8A 1IQLA 1VITF 2Y82A 2ZHQH 3EAJA 3I29A 3UR9A 1DLEA 1O2WA 2BDAA 1UVSH 2HPQH 1P0SH 4BAHB 1SQAA 3UWJH 4ZHLU 1AUJA 1SGPE 2Y80A 3SNBA 1ELBA 2D8WA 2ODPA 2Y7XA 1H8IH 4ZROA 1O3BA 3QTOH 1O5BB 4Y8YA 1AWFH 1K9OE 1PPHE 2WHXA 2J34A 1TGBA 1V2ST 1BHXF 1TNIA 3SUDA 1N1LA 2DE9A 1ZPCA 3DD2H 1NT1A 2GTBA 3KHVA 3D23A 3E16B 5JBBS 2J9NA 1C1PA 2Z3EA 5HXFA 2BMGB 4NWKA 2Z94A 3P70B 3C27B 2G52A 1GGDC 1P11E 1YM0A 2O8MA 1E1QD 1GHBF 3PLBA 3ZVGA 2UUKB 3RXQA 2BVSH 3ATKA 3MNCA 4NA7A 4PROA 3CP7A 1ANEA 5FPSA 2OUAA 4I7YH 4O3TA 1KIGH 1TNHA 2QY0B 4WF8A 1BMFD 1EUFA 3ZZ6A 3VGCC 1ZSLA 4ISHH 4A1XA 1CA0C 2SGEE 4AYYB 2ZQ2A 1BBRH 1S6HA 4H6TA 4BNRA 1V2JT 3T26A 1P3EA 1ABIH 1AWHB 1S6LA 3M37A 1TBZH 1ETSH 3AVZA 1C2IA 1QTFA 3UNRA 4J2YB 1CBWC 6CHAB 1MCVA 4X6NA 5EW1H 4RI0A 3UWIA 1GWAA 3G01A 3QO6A 1G36A 3ZVBA 4DG4A 1E35B 2HGTH 1SHHB 4D7GA 2XRCA 1TABE 2YOLA 5TCCA 2WZQA 1GHYH 1RS0A 4XOJA 2XXLA 1GJ6A 2BVXH 2WSSD 1ZPBA 2GT8A 2EEKA 2VJ1A 2KAIA 2OD3B 3A87A 1HNEE 2A4QA 1P2JA 1EP5A 3S9CA 3SU4A 4IC6A 1ORFA 1EJMA 4Z0KA 5FCRA 1C1WH 1F5RA 1TMBH 5FPYA 3HK3B 2BDYA 1XXDA 4X1PU 1H4WA 1QGFA 3DFJA 1TOCB 3Q3KA 4MPWA 2UWOA 2KFWA 4XDEA 1K1PA 1HAVB 3ZVDA 2J98B 5IYTA 3TPIZ 1ANBA 1AY6H 1FY1A 2WYGA 3PMBB 3EA9A 1GI7B 1OWEA 5GCHG 1SG8B 2ODQA 1C5YB 1YPMH 2XCFA 3A8DA 3RXUA 5E0HA 1DSTA 1YPKH 1DITH 1AKSA 2BXUH 1TA6A 4MVNA 3BTWE 2PKSB 2B8OH 1EFRD 2Z9IA 4KP0A 3RDZA 4MNWA 4Q4LA 4WMDA 1TGCA 3MH7A 1TOMH 1UHBB 3ZZ8A 4ZAEA 1LPGB 5EXLA 2QC2A 4UE7H 1P8VC 1FDPA 1N8OC 2H9HA 3NPSA 2ZTZA 1E1RD 1UVOA 1ZMNA 1C2DA 1LHDH 9ESTA 1XUJA 1TRMA 2BZ6H 3FZZA 4X2WA 4YM9A 2H9TH 2AGEX 3LGIA 1FPCH 1ELCA 1GBDA 1O2KA 3ATMA 1YPEH 1D6WA 4E06H 5EQRA 5JYIA 4NFFA 2WV4A 2ZWLH 1GI3A 4DIHH 2AHME 2WV9A 1O37A 1SLWB 4B6FA 1A61H 1QB6A 2VVVA 2ZDMA 1QHRB 1GJ9B 2ANKH 1NU9A 2KCYA 4I8KA 3A8CA 5T6GA 5EPNA 2G4UA 2B9LA 4ISIH 1N6XA 2XW9A 1TPAE 4OS2A 3QLPH 5T1VA 5EJZA 2Y81A 3PLPA 3SHAH 2QF3A 3K2UA 3ODDA 1C1RA 1GHWH 3DSOA 2BD4A 2HVXA 3L6PA 1EPTC 2NU4E 1CGHA 1EZQA 1J15A 3BV9B 3Q77A 5EOKA 2BLVA 3A86A 1NRNH 1DLKB 1GHBG 1QFKH 1Y3VA 5A0AE 2FIRH 1MD7A 3FOAA 2KCPA 4B2BA 4ABHA 5CMXH 2I6SA 4B1TA 3KNXA 2ZU4A 3UFAA 3MWIU 3B23B 3OY6U 1W0JD 2Q1JA 1PYTD 2FI5E 2VVUA 3BTME 1Z7KA 3PO1B 1O3LA 1XMNB 1JOUB 4K1EA 1QL7A 3P6ZB 2A2XH 4X1RU 5J4SA 2ZEBA 3FAOA 3LPRA 3RMOH 3NKKA 5CHAC 3U8TH 2TBSA 3AW1A 1O3GA 3KIDU 3WWFA 1O0DH 4UFGH 4I8GA 3O8RA 4B6EA 2UWPA 1CSOE 2NU2E 4A1VA 1L1NA 2PP6A 4X2XA 1CE5A 2GVFA 2P93A 2I6QA 8GCHG 2ZU1A 2Z7FE 2ZFSA 1S83A 3LT3A 1V2NT 1A7SA 3F68H 3GCHC 1DOJA 1O2NA 4CBOA 1O2RA 5EXNA 3SU6A 3SV8A 2Z9JA 1MD8A 2ALPA 3U8RH 4JYTA 2LELA 2CHAC 2NU0E 2SNVA 3ITIA 5DJ7A 4XBDA 1ZHMA 2PGQB 1BITA 1C9PA 2NU3E 3GCTG 4OS5A 2GMTB 1UTQA 2QF4A 2AS9A 2FP7B 1XVOA 3PMJA 2M5TA 2SFAA 1KXDA 2CV3A 5HIYA 1Z8RA 3HATH 2CXVA 2GX4A 2XNIA 3SQEE 1XKAC 3DFLA 1C1TA 3UNQA 1NN6A 5E2OA 1XUKA 1ZGVA 5DPAA 1LPZB 2ZI2H 1HRTH 1W8BH 3UQVA 1VCWA 1P09A 5C1YA 4Y0ZE 1P05A 3LH1A 2Z9KA 4CRFA 4B2AA 1TRYA 3MU5A 3ESTA 1O3OA 1DWBH 2FI4E 1MTNC 2FX6A 1O3EA 5DP9A 6CHAC 3QTVH 4NA8A 4E7RG 3NZIA 2Q6GA 3F2HA 1BTWA 4YZUA 5GCHF 5FPTA 4OS1A 1DFPA 1ZJDA 2P16A 2F9UA 2FOGA 4JZFH 1C1VH 5T3HA 4UDWH 1WQVH 3K9XB 1ZTJA 1LVOA 1NFWA 4A6LA 3RXEA 5DG6A 3NCLA 1O2OA 2FM2A 4K1TA 1OWDA 2GDDA 2W5EA 2IJOB 3DUXH 3B8JA 1V2RT 1G2LA 1TQ0B 1OWIA 1OYTH 4X1QU 3OTJE 3MMGA 2QF5A 4TWWA 1YY3A 1O2MA 3A7ZA 2OQUA 3LOXA 4RT0A 1V2QT 4I31A 3TJUA 4U30A 6GCHG 1OWJA 2BXTH 4KELA 4CHAB 1O5DH 1Y59T 5ABWA 1HV7A 4MLFB 3PRBA 5EQSA 2EC9H 1SC8U 1JIRA 2BDBA 2XOKD 2ZO3H 2F91A 3SHCH 2JJ2D 2TGAA 3MU0A 3HGPA 3T29A 1LQDB 1UTLM 1SI5H 4A5TS 4BAKB 3S7KB 1AUTC 2O8WA 1J8AA 3GY2A 1O3HA 3SU5A 1HAYB 1O2GH 3A8AA 4NZQA 4AG2A 4YOIA 3RU4D 4Q7YA 1O32A 2Z6BD 3ENSB 5A0CA 1EXFA 3QK1A 1V2VT 1G2MA 1L4ZA 3V13A 3MI4A 3DCLA 3P8FA 2OBQA 1FX0B 4IBLH 2B0FA 1DX5M 3RUOA 1ANDA 3Q3YA 5DKMA 3ZZCA 4B74A 3H7TA 1LVMA 1BQYA 4RT1A 1SLXB 4VGCC 3U9AH 2GZ7A 2Z9LA 3BF6H 1LHGH 2QXHA 4IC5A 1AQ7A 3UQOA 1EAWA 5A8ZA 4Y79A 1SOTA 3M3SA 1ABJH 1G9IE 3VB5A 2C8ZB 1C4U2 1MU8B 3HGNA 2M2AA 4AYVB 1TPSA 3URDA 1S6FA 2ZCLP 4TSFD 1W14U 1QQ4A 1CA8B 4AN7A 3RXVA 1DSUA 4FUHA 3ZV9A 1UW7A 2FPZA 4MNVA 1GL1A 4JZEH 2FODA 2HNTC 1O38A 4HG6A 1T8OA 1T4VH 1YP9A 2BLQA 3RXDA 1LKBA 3SJ9A 2BZAA 4MNYA 3RXRA 4X2YA 4CRBA 1D3QB 4BXWA 1V3XA 3BTQE 2W6ID 3UREA 4XFQA 1TX7A 1Z71A 1SLVB 1AZZA 1C5LH 1G3BA 1O2VA 1JMOH 1SGQE 2RG3A 3LKWA 3NXPA 3E0NB 4KTUA 4QT8C 1WDIA 1K2I1 3DA9B 4FVDA 2RCEA 1EJAA 1C2FA 5CHAB 1O3FA 1W2KH 2J97A 1FY3A 2GKVE 1ELFA 1AVWA 1L1GA 3ZV8A 4JYUH 3T28A 4ZKNU 4AFQA 4X6MA 1QY6A 1SMFE 1O2QA 1ELTA 3ELAH 1TIOA 2F9PA 3MFJA 3KN2A 4U2WA 3L3TA 1ZRBA 1EATA 1BTHH 4UFDH 1LTOA 5F8TA 1MKWH 3BG4C 1MU6B 3KF2A 1PQ8A 1DY9A 1QA0A 3ATWA 4DW2U 1GBLA 2WYJA 1H1BA 4ASHA 3MQKC 1VKYA 1BTUA 1VCPA 5T6FA 1BTXA 1CA0B 1C1SA 1QZ8A 4SGBE 4I33A 4ISOA 4UFEH 2GCHF 4NSYA 7LPRA 4KTCA 1F0SA 4MDSA 4IN1A 2QXJA 3GCHB 1CBWB 4AZ2B 1G30B 2J2UA 1AZ8A 1AE5A 4ZMAH 1NRSH 1IQHA 3SOSA 1ELGA 1JRTA 2IN2A 1FPHH 3URCA 1SHYA 1NRPH 3TU7H 3UTUH 2YMSB 1C1OA 1C5RA 2JH6D 3RU4T 1C5UA 1A2CH 1WQSA 2GMTC 1NTPA 3TK9A 2PKAA 1GJAB 3QX5H 3QDZB 1MTNB 1C2LA 2BX4A 3IG6B 2VGCC 1QBOA 4AFZA 1LVBA 3T2NA 1KLJH 2P8OC 1UVPA 1YLDA 2O8TA 1HJAB 1BTZA 4ACBA 2D2DA 1QNJA 1PJPA 1SPJA 1RGQA 1THSH 1GMHF 1QURH 1F0RA 1E38B 1Y5AT 3PM3A 4OGYA 3F9EA 1PPEE 1OOKB 4BAQB 1KXBA 1O30A 3LJOA 5JBTA 5L6NH 1QRZA 1AU8A 3BTEE 2W3IA 1V2LT 1QB9A 3ZYEA 1TX6A 4FVBA 3U69H 1W7XH 1C2JA 3F1SB 3AK5A 2SGPE 3MNBA 4KTSA 2OC0A 4LZ1H 5KEDA 4GSOA 2AYWA 5E8EH 4AC9A 1OP0A 3N99A 4Y76A 2PV9B 2F43B 4CRGA 2FOBA 4AFSA 1QR3E 3M5OA 3RLWH 1C1NA 2BQ6B 1W3CA 4K8BA 3U1JB 4U01A 3NWUA 2XC0A 1IQEA 1P3CA 4BAMB 2FLBH 3RXFA 1GBIA 2XBWA 4I8HA 4WVPE 2ZQ1A 3UOPA 1O31A 5K7RA 1GJ4H 4F4OC 3AAVA 2L6OA 1EAUA 2VIWA 2J4IA 1MUEB 3BG8A 5KECA 4K5ZA 1AFQC 2V3HH 1FAXA 2JJ1D 1EZUC 4FUCA 1V2PT 2ZP0H 3N7OA 5SGAE 3PTBA 2G81E 2ZG0H 3PRDA 1CHGA 4A7IB 2VIVA 2J38A 1S81A 4BTIB 1PPFE 3RXPA 1ZPZA 5EG4A 1C5ZB 1SQTA 2Y6TA 5AHGH 3HK6B 3BTDE 2BD7A 2CF8H 2OCVB 3SJ8A 4DOQA 4CR9A 4VGCB 2BHGA 2PTNA 2BB4A 4XRNA 1RRKA 4GHQA 4B71A 4AOQA 1TQ7B 1NC6A 5DK1A 4Q63A 1X7AC 1QBVH 1NFUA 3SUGA 1YKTA 1FQ3A 2BY7X 4WXVA 1O2HA 1HUTH 1W0YH 4ZXXH 1YF4A 4E05H 1YCPM 2C8XB 1GDUA 1GMCG 2G5NA 3W1EA 4YESB 8LPRA 1WSSH 4Y0YE 1BTPA 1YPGH 3ATIA 2BLWA 1A0JA 1O36A 2C8YB 5LPRA 4CR5A 3TGJE 2H9EH 3QZRA 1DWCH 3T27A 1ARBA 4D8NA 2QXIA 4OS4A 1AVXA 4UFFH 2C4FH 1P10A 3LJJA 1CVWH 2A32A 3GCNA 1Q31A 5I46H 4HGCA 3S9BA 1F0UA 3EA8A 4O03A 3VB4A 2ANMH 1WUNH 1UK2A 4F48B 5C0UA 3V7TA 1ELVA 3M7TA 4K69A 2C93B 3QZQA 1SGRE 1HLTH 2A5IA 1CHOG 1SGYE 3ZVEA 3GY7A 2D1JA 1AGJA 2PW8H 4AB8A 1O3AA 3STJA 3P95A 2IOTA 1DE7H 1G3CA 4ABBA 3VFEA 2FOFA 1KLIH 1WYKA 2FYQA 2ESTE 3VGCB 2WINI 3LONA 5FCKA 4ASUD 1D3TB 1A3BH 1V2MT 1CT2E 1D3PB 3KL6A 2AGGX 3DT0H 3RXJA 1Z8GA 4CRAA 1VR1H 3TJVA 1RTFB 3S69A 3OEHD 3ZZDA 2ZGBH 3EE7A 1NESE 2BQWB 1P57B 4AB9A 2BDCA 1GBKA 1O2XA 2EQNA 1ARCA 2AEIH 3AASA 4Q2KA 2R3YA 4I8LA 5A2MH 3F2GA 4GPGA 1ZJKA 2LPRA 3EYDA 1QQUA 3RU4E 1BRUP 1O2LA 1IQMA 1TBQH 2KAIB 3L33A 3SGQE 4IGDA 1GBMA 2F4LA 2CF9H 3SU1A 2J92A 4ZKOU 4O9VA 1HAPH 2OBOA 3SYJA 3TLOA 3RC6A 2H2ZA 2HWLB 4X8SH 3LDXH 1D3DB 2UUJB 3SGAE 4R8TB 4OS6A 5EJ1A 1YPJH 5FX6A 2TGPZ 3ZYDA 5IK2D 4AG1A 3DHKH 4ZXYH 2QGRA 2AGIX 1WOFA 3SV9A 4DY7B 1GI4A 1QA7A 1HJ9A 2TGDA 1OWKA 5EXMA 5FX5A 4JYVH 2F9OA 1IQFA 3KYFA 4NG9H 4P02A 4WH6A 2AIQA 1PPBH 2RDLA 4YOJA 4B76A 5EQQA 4GLYA 4ABJA 4WWYA 2VGCB 1BT7A 1SBWA 1VGCB 1Q3XA 2IPHA 2W7SA 3BEIB 2HLDD 3FZDA 1OWHA 3ZVAA 1V2TT 3TK6A 2XC5A 2BD2A 4AGJA 2GT7A 2JH5D 1J16A 3SQHE 5GIBA 3PV4A 2RDEA 5FBEA 3O8BA 3B9FH 4D9QA 2KM0A 1OPHB 4WJG2 5B6OA 2BDGA 1GJCB 1LPKB 3TGKE 1YPHC 1NRRH 1SGFA 1C5NH 4AX9H 2WPDD 3BTGE
chains in the Genus database with same CATH topology
1IHSH 4R0IA 5C3NA 3GOVB 1C2GA 2FOHA 2STBE 1O2SA 1O3CA 1HIAB 3JZ2B 1OYQA 1QJ7B 3R0FA 4WY3A 9LPRA 4RKJB 4FUEA 3FP8E 3PWCA 1NU7B 4FUDA 2H6MA 3U8OH 3SV6A 3TJOA 1NPMA 3FP7E 1KTSB 1DXWA 3GISB 1FN8A 1DXPA 4K3JA 3SI3H 1LVYA 1F7ZA 1HAHH 2VWMA 4FUJA 1ACBE 2STAE 2ZTYA 1GI1A 2ZDVH 5AF9H 5EGMA 1MTWA 3T5FH 1B0EA 2FDAA 2GCTB 1EPTB 5J4QA 2UUFB 2ZCKP 4X6OA 3RLYH 1J14A 1TAWA 3ZZ5A 1EKBB 2QV1A 1MBMA 3E0PB 1BJVA 5EU8A 1H9IE 3EA7A 4IS5A 1WTGH 2FS8A 1RTKA 1GCTB 1H8DH 4D76A 2VINA 1GBFA 2FWWA 1GI5A 1FI8A 2ZFRH 2PSXA 4YT7H 5JB9S 1PFXC 2V3OH 3UR6A 1HXEH 2Q6FA 2R2WU 1QJ6B 2WUBA 1GBTA 1O5EH 3SNEA 1GJ7B 1BMAA 2F3CE 1PYTC 5DP6A 3M35A 1IQGA 3SI4H 4ABGA 1ZOMA 1PQ7A 1PPZA 3IWMA 2YNBA 1O3NA 3ZVFA 3D49H 7GCHF 2JKHA 4JMYA 1FAKH 1XUIA 1K1MA 2HNTF 3RXIA 2PHBA 1EP6A 1SQOA 4OGXA 3PROA 4D7FA 2PFEA 3S9AA 1XUFA 3SUFA 1MKWK 2ZGXH 1XXFA 4X0WU 5AVDA 1ZSKA 1Y3YA 4AORA 2J95A 2ZU5A 5GWZA 4CBNA 2SGQE 3M3TA 2A4GA 1OP2A 5AFZH 1TNGA 1TGNA 1TYNA 3SJIA 1TBRH 2FESH 4NIWA 1C9TA 1K1NA 2SNWA 1P9UA 4BANB 5FAHA 2QXGA 2NU1E 1RTLA 2Y5GA 1AB9C 1ESBA 2W7UA 5DO4H 1O5FH 1T8NA 1EQ9A 4IN2A 3M7UA 2OC1A 1IHTH 5LH8A 2R9PA 3BG4B 2J94A 1ZGIA 4HZHA 1DPOA 1FMGA 1Z6JH 2Y5FA 1VITH 2UUYA 1ZTLA 4CRDA 1HFDA 1QIXB 5JBCS 2WPKS 1GDQA 1LMWB 1SGNE 1WCZA 1DT2A 1TA2A 1HJ8A 1YBWA 1SGCA 4MPUA 4ZHMU 3A85A 3SV2H 3GCTF 4XBCA 1EOLA 4LK4A 1HAGE 2WUCA 2G5VA 2R0KA 4M7GA 1KSNA 2GV6A 2VH0A 2UWLA 2BD9A 1THRH 3E1XB 4TPIZ 4CHAC 1AI8H 3P8GA 2AMQA 4XSKU 1ESAA 1GI0A 3VPKA 3WY8A 2HPPH 1L0ZA 1MAYA 1NM6A 1SGFG 1W10U 1FONA 1GI6A 1TGTA 1YCPH 2GP9B 1CHOF 1S0QA 2OLGA 1ID5H 4DURA 4F49A 4MNXA 1UJ1A 4CH8B 2GD4B 1B7XB 1EASA 3PMAB 4Q80A 3LGWA 1PPCE 3LGVA 3I78A 1A1RA 1GBBA 2ZDLA 1GVLA 1FZZA 8GCHF 1SL3A 4TWYA 5HYOA 5C5NA 2FOAA 3OSYA 1HAIH 1LDTT 3BEUA 2FOEA 1T8LA 4H42U 3MH5A 1MTSA 5C5OA 3E3TA 1ZHRA 4WMFA 1AFEH 2QYIA 1GVKB 1W0ZU 4H6SB 1BMNH 2BDIA 2XWAA 1CGIE 2ZF0H 1MH0A 7KMEH 4X2VA 1VGCC 3RXOA 3I77A 3UY9A 1TB6H 4ABIA 3QGNB 1EJNA 1Z1IA 4NIXA 5JPMH 1KY9A 1PQ5A 1QBNA 3GY8A 4BTTB 5F8ZA 1C4Y2 3LU9B 1TNKA 4Y6DA 2HLCA 2BLOA 3BIVH 3MOCA 1HGTH 2V6NA 3GY3A 4Y7BA 4UEHH 2BTCE 3RM2H 2ANYA 1FUJA 4O3UA 3VB3A 2PKSC 4BOHA 3STIA 1GHVH 1EAXA 5GXPA 2P59A 1DUAA 1C5WB 3RXKA 1GBEA 1O33A 1DANH 1EPTA 2FI3E 1P2MA 5FHTA 1BRBE 1FV9A 1HXFH 1BMMH 3CS7A 3MU8A 1IQNA 5EPYA 4FUIA 4UONA 3MU1A 1A3EH 3RMLH 1ETTH 1O2UA 2A5KA 4INHA 1O2ZA 1O2TA 3D62A 3E91A 4OS7A 1TNJA 3RXLA 5LPFA 1GG6B 1C5PA 1HDTH 3PTNA 3P17H 4ZKSU 2VIDA 1ELEE 2BY8X 3OU0A 3GDSA 3OYPA 4FUGA 1RD3B 2JETB 4MG3A 3RMMH 1GBAA 3SW2B 3SJOA 1Y3UA 3FFGA 4J1YA 1E34B 1GHAG 1P04A 1C5VA 2PGBB 1JXPA 1AIXH 1V2UT 1GHZA 1GJDB 3FVFB 1O3IA 3K6ZA 2VIOA 2CMYA 1UTJA 2F9NA 2AMPA 4A1TA 1CT0E 3LC5A 4LXBH 5JBAS 2ZHDA 3BSQA 1OSSA 2ODYB 2Z9GA 1BUIA 1TNLA 2H1UA 3TVJB 2EI7A 1ZZZA 3V0XA 1YGCH 1DWEH 2ZDKA 1F5KU 3TGIE 1GJ8B 2ZGHA 4JK6A 2VH6A 5ESBA 5GDSH 3HKIB 1FJSA 1O3JA 4X6PA 3SN8A 5ESTE 1N6YA 2H5CA 3QWCH 3PMHB 2OC8A 1O34A 1TE0A 1KDQA 1VCQA 4I32A 1G3EA 2OINA 4IW4E 3E90B 1GGDB 3KQEA 2ZHFH 4FU9A 3TK5A 1U6QA 3C1KA 2ZFPH 1F92A 3SBKA 3ODFA 1SVPA 1XUGA 1SGEE 2FMJA 2GDEH 1RJXB 1BHXB 1HJAC 3SU3A 3ZZ4A 1AB9B 2BOKA 3M5MA 2FZZA 2Z3DA 2OTVA 1F5LA 1GHXH 2R0LA 3BN9A 3CS0A 1BBRE 4FU8A 2VVCA 1P01A 3BTHE 2O8LA 1YCPK 2PWXA 2V0BA 5K0HA 1IOEA 1MZDA 1UK3A 7GCHG 1F2SE 3GICB 1AN1E 3A82A 3F9FA 3KQCA 2PSYA 2FS9A 3KCGH 1T8MA 5TCAA 2FX4A 1KDQB 1K1IA 3KQDA 3LC3A 1GBHA 2A4RA 3UNSA 3H5CB 3SORA 1F0TA 1EAIA 2A4OA 2ZGJA 5FBIA 1J9CH 1GMHG 2ZU3A 4AGKA 1ZSJA 1TPPA 4MPXA 1ZRKA 2GV7A 4NWLA 1AD8H 3GDVA 3UUZA 2A1DB 1ZYOA 2A7CA 2XBYA 5T6DA 1RIWB 3PLKA 2ZNKH 4CH2B 4XE4A 3RXMA 2ZKSA 1UMAH 5ETXA 2VU8E 3EE0B 1CT4E 4YO9A 2F83A 3RXSA 4DJZB 3A89A 2G00A 1SB1H 1OX1A 2BVRH 1C5QA 1UVUH 3VXEH 2Z3CA 1NZQH 2CN0H 3TNTA 3A80A 1QCPA 1K1LA 8ESTE 3MU4A 5L2YH 5LGOA 1GDNA 1D4PB 1D9IA 5F6MA 4E7NA 1LHCH 2TPIZ 1MCTA 1EB1H 1W11U 3V3MA 1P2IA 1TMTH 3V12A 4RSPA 2P3FH 1KXAA 2W3KA 2GCTC 1DM4B 4CREA 1O2JA 2BX3A 4YTAA 3LGUA 1AHTH 1AMHA 4YLUA 1GI2A 2ZECA 1E37B 1UTKA 1O2PA 3R3GB 2ALVA 1NY22 3RXGA 5L2ZH 1OP8A 4Q7ZA 3P92A 3M7QA 5DGJA 1ETRH 1BJUA 4Y8XA 1P2OA 1P2KA 1H9LB 4DT7B 1O3MA 2P95A 8KME2 3AW0A 1JIMA 2VIQA 1C4V2 3SNDA 1BIOA 1Z6EA 1GBJA 4ISNA 2ILNA 4MPVA 5JDUB 1P2NA 5L30H 2ZPQA 1DS2E 1O2YA 5CE1A 1A4WH 1GCTC 1TMUH 3GCOA 2G8TA 2P94A 4CRCA 1K28D 1O35A 3A84A 3TITA 4THNH 2EI8A 5DP8A 2XC4A 2YNAA 1HCGA 1Y5UT 2BYAX 3NUMA 3RMNH 3EDXB 1MZAA 4YT6H 1KXEA 1CO7E 2SGFE 1XVMA 3F9HA 3RC5A 1LHFH 5EW2H 1O5GH 2TRMA 4K1SA 1T4UH 1E0FD 4AFUA 2EA3A 2O8UA 3SGBE 1WBGB 1HAOH 1T32A 1TGSZ 1ESTA 1WTHD 1Z8JB 3BTKE 1V6DA 4X1NU 2AERH 1K1OA 1V2KT 1DDJA 2BOHB 1UTMA 1BMLA 2LNCA 4X8VH 3QUMP 1VJ9U 1ZMJA 1LO6A 4JCNA 1BRAA 1FY8E 3A7YA 1FXYA 3MO6A 1BB0B 4JZDH 4Y71A 1TLDA 1C5MD 3MH6A 2ZA5A 3TNSA 2FEQH 1MQ5A 5E0GA 2QN5T 2QA9E 3EQ0H 4DVAU 2QIQA 1C1UH 2ZU2A 3HKJB 2WPLS 2QF0A 3CENA 5FXLA 1TONA 2TIOA 1BA8B 1GMDG 1P2QA 1GVZA 1GCDA 1O3PB 3SNAA 3ZZ9A 1CQQA 5GJ4B 2ZPSA 1TWXB 1LQEA 2BD8A 3M5NA 1WU1A 1BDAA 1YYY1 1O5CB 1B5GH 2CHAB 3E6PH 1FY5A 3GY4A 4X8TH 1P12E 4MQAA 3HPTB 1GL0E 3EGKH 3E8LA 2QAAA 1AE8H 2A7HA 2PR3A 1FIWA 2FOCA 4U32A 3SV7A 3KQBA 1TALA 5DP7A 1SFQB 3A83A 1MTVA 1P9SA 5A8YA 4NCYA 1INCA 3GY5A 1KTTB 2F9VA 1O39A 1TPOA 3M36A 4NIYA 1L1JA 5GPIB 6GCHF 3GYLB 3M5LA 3D65E 1ZLRA 1K21H 2XBXA 3JZ1B 1WV7H 4ESTE 3A7XA 2SGDE 2R2MB 2R3UA 1THPB 3OY5U 4Y11E 3W94A 4GUXA 4NFEA 4JZ1A 1G37A 3BEFB 3LIWA 1PQAA 1SGDE 2C3SA 1FIZA 3TIUA 1UCYK 2XTTB 1DVAH 3LGYA 1MAXA 4FUFA 1E36B 2AIPA 1C1QA 2AFQB 5IDKA 1C2MA 2VWNA 1G32B 2AH4X 4DCDA 1NFYA 2XYAA 3RXCA 2FTLE 4RN6A 2D26C 4NZLA 2ZFFH 3RC4A 1Z1JA 3F9GA 2C8WB 2A31A 2BY5X 2GGVB 2OC7A 4FU7A 1KYNA 4WH8A 2THFB 4GVUA 3MTYA 1MMJN 1Y3XA 1C5OH 4Y7AA 1UCYH 2QCYA 1AKSB 4X1SU 1L2EA 4KKDA 5LPEA 2C90B 3TH3H 1J17T 3VB7A 2P8OB 4ABEA 1UVTH 1V2WT 3PWBA 2PUXB 4LOYH 3M3VA 4O97A 2CGAA 5DP4A 5F8XA 3FANA 4NGAH 1C2HA 3IITA 3SUEA 3BTTE 3ZZBA 4Y8ZA 4WMEA 3RM0H 3SZNA 3GYMA 3SNCA 3ZZAA 5C1UA 1IAUA 2PLXA 2OQ5A 1RIWC 4ABDA 1YLCA 2K1QA 4INKA 3QN7A 1SSXA 1BBRK 1C5XB 4YOGA 1GI8B 1GMDF 1UTPA 1N8OB 2P3TB 2XCNA 3OX7U 3PB1E 1DY8A 1NROH 2Y5HA 1NFXA 1ZR0A 1HPGA 2B7DH 1O2IA 2GZ8A 1W13U 1VJAU 1UO6A 2A0QB 2G4TA 5BPEA 1AO5A 2BQ7B 2ZC9H 2ULLA 5HM9A 3T25A 1YPHE 5G4BA 2SGAA 3ZZ3A 1UK4A 2WPHS 4INLA 1RFNA 4BAOB 2ZTXA 2XBVA 3A8BA 2A2QH 2G51A 4B75A 4DGJA 1LCYA 5E0JA 1V2OT 3A7WA 1O3DA 2ANWA 3RXBA 2A5AA 2FLRH 4LZ4B 1YPLH 1SLUB 1YC0A 4JZIA 3W95A 3KEEA 3MO3A 1SR5C 2BY6X 1NO9H 3BIUH 1OS8A 3A88A 1GG6C 3H7OA 2HRVA 1P03A 3PYHA 1MBQA 2ZPRA 5C1XA 3FP6E 2JETC 1C2KA 1UCYE 1D6RA 5A09A 5JB8S 4ZHAA 5HMAA 3VXFH 1Q2WA 2HNTE 2HOBA 4KGAA 1T7CA 3RP2A 1MKXH 2BY9X 4HI3A 5HM2A 1XUHA 2Y7ZA 4TY6A 1SGIB 3ZZ7A 1OXGA 4H4FA 1ELAA 2WPJS 2V35A 2GCHG 4IMQA 1A5IA 2DE8A 2H5DA 1CGJE 4JK5A 1S5SA 1OKXA 3BTFE 2ZFTA 5BRRE 1P02A 2NWNA 3RXAA 1HAZB 1EZSC 3ZVCA 2W26A 2P3UB 3MNSA 4GCHG 1C5SA 1MKXK 3MNXA 1XX9A 1G3DA 2VB0A 3T62A 4ABFA 2FOMB 4B73A 2WV5A 2VWLA 1IQIA 5C20A 5EODA 3AAUA 2HALA 1HYLA 5E2PA 2OXSA 1HIAA 1LHEH 1C2EA 3MH4A 3P8NA 2Q6DA 1SFIA 1HB0B 2JH0D 3KGPA 2AMDA 1ZTKA 1XM1A 2ZDNA 2F9BH 2RA0A 4Z6AH 2O9QA 1W12U 4TYDA 3SO3A 1MTUA 3S0NA 1BCUH 2G55A 3SJKA 4DIIH 1FNIA 1JWTA 4K60A 3LH3A 4ZKRU 2XWBI 2WPIS 3F6UH 5AFYH 4D9RA 1UHBA 2FTMA 3O8CA 1Y8TA 1FY4A 7ESTE 1GJ5H 3TH4H 1PPGE 1C1MA 1S82A 1EB2A 4FXGH 2ZHWH 4IMZA 4YLQH 1JBUH 1QB1A 1S84A 1K22H 4XBBA 2A7JA 4HFPB 2ZFQH 4HTCH 1UTOA 1HAXB 1Y5BT 1GJBB 4BTUB 1KXCA 3UIRA 4WXIA 4Q7XA 5F03A 2PKAB 4Y10E 2PUQH 2WPMS 1S85A 2FO9A 3QGJA 1GHAF 2FYRA 1LKAA 3LGTA 5TJXA 3Q76A 1BOQA 1JRSA 1EZXC 5HGGA 1KLTA 3A81A 4ISLA 3U98H 1KXFA 4BXSA 4NA9H 3MO9A 1P06A 3A7TA 4NSVA 3ATLA 3MYWA 2BD5A 5DP3A 2B5TB 1SGTA 5C67A 1A5GH 3TJNA 1Z8IB 2CJIA 1ANCA 3O8DA 2ZIQH 3SU0A 3P8OA 1VZQH 3Q3XA 4ZH8A 2ZCHP 2BM2A 2VIPA 1GPZA 3RXTA 2RA3A 4FUBA 1HBTH 1K1JA 1BTYA 2BDHA 1ZMLA 1QRXA 1O5AB 1T31A 4SGAE 3NK8A 1GBCA 1ELDE 1GMCF 1RXPA 1W7GH 3A7VA 3GDUA 3M61U 4NIVA 2VNTA 3UPEA 1AFQB 1FLEE 4ZUHA 4K8YA 2GZ9A 1TX8A 1TFXA 1DICA 1B0FA 1AVGH 1DWDH 1L4DA 2ZDAH 1VITG 2FXRA 2ZZUH 3Q00<