2HVXA

Discovery of potent, orally active, nonpeptide inhibitors of human mast cell chymase by using structure-based drug design
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymase
publication title Discovery of potent, selective, orally active, nonpeptide inhibitors of human mast cell chymase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hvxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hvxA02
1SB1H 4ABGA 3FANA 1O3LA 2OUAA 3GYMA 1SGQE 2OINA 2ZFQH 4DT7B 1FLEE 2XCNA 2GGVB 2SGEE 3UIRA 2H6MA 2P93A 2QIQA 2V3OH 4RN6A 3V0XA 2ZQ1A 2ZDKA 3UOPA 4GUXA 1ABIH 1NROH 4A6LA 2J2UA 1IQHA 1HDTH 4X0WU 1W7GH 3CP7A 1C5NH 2ZFFH 4IMZA 2ODQA 3MWIU 3MO9A 3BN9A 1O3OA 2PR3A 5F6MA 1GBFA 1AIXH 1YPGH 3T29A 5CMXH 2FYQA 1ELVA 3LU9B 1B7XB 1O2SA 3P8FA 1Y3UA 4U01A 1W11U 1ZOMA 4ZHMU 5LGOA 1P12E 3P8OA 3LJJA 1GHXH 2EI6A 1UTQA 1GHBG 1B0FA 2BTCE 3RMOH 3G01A 1QJ6B 1TALA 3LH1A 1G2MA 1TGBA 3TITA 1BTXA 5CHAC 4Y8YA 2G55A 1C5UA 5HXFA 1HAIH 1YPMH 4Y0YE 1GMDF 3SGAE 2VVUA 3M7UA 1RRKA 3FZDA 3BG8A 1V6DA 4B2CA 1SQAA 2OP9A 3A8BA 1PPEE 5DP4A 3MI4A 4UDWH 2DUCA 1GG6C 1RD3B 1O2YA 4JYVH 4THNH 3RP2A 1C5YB 1BTYA 1E37B 1HAVB 4UONA 1TIOA 4I8LA 1CQQA 1S81A 1Q31A 2A5AA 5EXNA 4JMYA 2BVXH 1XXDA 2WYJA 4OS7A 2QXHA 1GI3A 3GY2A 1XKBC 1GBTA 1BTUA 1BBRE 1BA8B 3MH7A 1UTNA 2ODPA 1JRSA 1QL8A 4ABFA 3UNRA 1BTZA 2R2WU 1CT2E 3UPEA 3S9CA 1W2KH 3RC4A 1C5VA 4FUCA 3QDZB 3VGCB 1L4DA 1EP5A 1PQ7A 1GHWH 1O31A 1GJ5H 1IAUA 4ABBA 1EP6A 2ZIQH 1UVPA 2B8OH 2VINA 3GY7A 2VJ1A 1ELTA 2EC9H 3MNCA 1TWXB 2HWLB 2RA0A 4DG4A 3PLPA 5AFYH 1IQFA 5A0BA 2QCYA 1W0ZU 1CBWC 5T6GA 4DIIH 1EB2A 1E34B 1KY9A 3GCNA 1QR3E 3M3SA 4ABJA 3UUZA 1AFQC 1ZPZA 1F0RA 1ZJKA 2AS9A 3E0PB 1BB0B 3FZZA 1O35A 1YC0A 3LIWA 1F5KU 1O2MA 3KCGH 2PW8H 3GDVA 4ASHA 2VGCC 2ZFSA 1C2IA 2GVFA 3SU0A 2ZFRH 3ZZDA 2ZDMA 2FOBA 1SMFE 2ZG0H 2BD5A 1HAOH 1CA0B 1DSUA 1QURH 2OTVA 4KELA 5DGJA 5FPSA 3E6PH 3OU0A 4I32A 4JK5A 1FV9A 2STBE 4DVAU 1SI5H 1XXFA 2BY9X 4YT7H 3ZVAA 2OD3B 1RJXB 3KHVA 4ZMAH 3BSQA 1F5LA 4I7YH 1GL1A 2FLRH 5FCKA 3Q76A 3RXIA 3A87A 1V2VT 5EPYA 2I6SA 3OY5U 3PLKA 1KXDA 3SQHE 3UR9A 2FLBH 2QGRA 2R0KA 1ARCA 4JZIA 2XWBI 3SJIA 3RM2H 3SUEA 1O5FH 1VGCC 1QJ1B 3LH3A 1TA6A 2CXVA 2PSYA 3UREA 1P2NA 4NIWA 1GCDA 1QA7A 1A7SA 1BQYA 1K1PA 3K2UA 1TFXA 1QGFA 1S82A 2VIDA 1DS2E 1ACBE 1DOJA 1J15A 1OWIA 1MCTA 3MH6A 4TPIZ 1GVKB 4NA7A 4KTUA 3SJ8A 4ISLA 1LO6A 3A8AA 1BTPA 3RMNH 1EJAA 4I8KA 3JZ2B 1ETSH 3MHWU 1P04A 5JBBS 1NRNH 1LKAA 6ESTA 2ZHWH 4CR9A 1QY6A 2XTTB 2ZHFH 4GPGA 1GGDB 4DW2U 5EW1H 2ANMH 1WCZA 2GT8A 5EU8A 1WAYB 2Z9GA 1K1MA 5ESBA 1FONA 1HNEE 1SLVB 3KQEA 3BTEE 1QL7A 1GVZA 1RIWB 1O2GH 2V6NA 3U8OH 8KME2 3SU2A 3QX5H 3U8RH 3UY9A 2ZDAH 4TWWA 1K2I1 1UVTH 4X2YA 1BHXB 3S7KB 3IITA 3BTTE 3FP8E 3TVJB 3T2NA 1K1JA 2DE8A 2Y6TA 3EDXB 5EW2H 1ANCA 1Y8TA 1ZMLA 3M5NA 4FUHA 1C5LH 1TRYA 4HGCA 3LGYA 1SGPE 2CF9H 1TONA 4LZ4B 1H9IE 1V2QT 4U2WA 1A5IA 3DFLA 2W26A 5FCRA 4CRDA 1J8AA 2C8XB 3SQEE 4FUBA 2P3FH 5PTPA 1TLDA 5HGGA 1GBAA 4KGAA 4A1VA 1JIRA 2BX4A 3GCHC 1A0HB 2AGEX 1BJUA 3RM0H 2ZP0H 1YLCA 3D49H 4KKDA 1ZHMA 5C1UA 1TQ0B 1ZMJA 2PUQH 3T26A 5IYTA 2STAE 2TPIZ 3A8CA 4X8VH 4U32A 1TPAE 1WBGB 3SU4A 2XC4A 3T27A 3SOSA 2ZTXA 4JZ1A 4Q7ZA 3FAOA 3M5OA 1TMBH 2GTBA 4ZH8A 1L1NA 1GI0A 1AO5A 1GCTB 1UTPA 1YPHC 1OS8A 4AFUA 5DPAA 2AH4X 2ZCKP 4DURA 1XM1A 2ZC9H 1N1LA 1D3DB 1O2ZA 3A88A 4ISNA 1YF4A 1FY8E 2OQ5A 1BOQA 2GCTC 1V2ST 4MLFB 4YLUA 3U98H 5A8YA 1VZQH 1IQGA 2BX3A 1BRUP 3ATIA 1SOZA 1SGIB 1P2QA 2JETC 3SORA 1ESBA 1GI2A 2Y5FA 3AAVA 1SGCA 3VB6A 4SGAE 1QB9A 3LGVA 5SGAE 2GDDA 3MYWA 1HAZB 3H7OA 4NFFA 1SGYE 3AW1A 3SGBE 1EPTC 1K9OE 1NRQH 3K6YA 3MNBA 4CHAC 2AMDA 5AFZH 3PMJA 1PJPA 4NIXA 1QTFA 2FDAA 1F0UA 1NRSH 2BM2A 1KTSB 2BD2A 3MU5A 1LHEH 3V13A 1YCPH 3PV4A 1E35B 2ASUB 1O3KA 1EAWA 1D4PB 2NWNA 2Z94A 7GCHF 1V2KT 1HRTH 2ZEBA 3F9HA 1ZTLA 1LHFH 2IN2A 4GHQA 1PPHE 1DITH 1Y3WA 5HM9A 1GMDG 1AKSB 2W3IA 3QUMP 1O5DH 4BAOB 2FX6A 3R0FA 1GBLA 1GVLA 3UNQA 3MFJA 4CH2B 5FBEA 4LOYH 4UE7H 1FI8A 2BQWB 1T8OA 2XW9A 1O2XA 1EATA 5EQSA 1A46H 1LVYA 4IC6A 1AHTH 1ORFA 3RU4T 1SGDE 1O2LA 5ABWA 2A4GA 3K9XB 4K1SA 3BTQE 2BQ7B 2CHAC 4D9RA 1FUJA 1C5QA 3SO3A 3AVZA 2FYRA 4Y10E 2A7HA 1AZ8A 1KXCA 5BPEA 1EB1H 2J9NA 2ZECA 3OX7U 4JYUH 1BTHH 1GBCA 2FXRA 1DUEA 3MOCA 2XNIA 4NZLA 2TGAA 1F7ZA 5GXPA 4ISOA 2ALVA 4MQAA 3QTVH 1O2JA 4TY7A 4XBBA 3SN8A 1DLKB 1GI9B 3QZQA 1TRMA 2Q6FA 3N7OA 2FMJA 2ZDLA 1AKSA 5C5NA 1HAPH 1UVOA 3TJOA 1WUNH 2HPQH 1P3EA 2ANWA 5EPNA 4BAKB 1HXFH 2QN5T 3A7ZA 3QK1A 2XRCA 1ZGIA 2UWLA 2W7SA 3LC5A 3CENA 3UTUH 4ABIA 2D2DA 4D76A 1P03A 3FP6E 1C9PA 4MDSA 4YOIA 1DICA 1XMNB 1H1BA 5LPFA 4NCYA 1Z1JA 4X1SU 4X8TH 1GJ6A 1T8MA 2V0BA 3BTKE 2UWOA 4D7FA 1C5XB 5C5OA 4WY3A 2WV4A 4AGKA 4IMQA 1IQJA 3RXDA 1AD8H 1C5RA 1C4V2 1BDAA 1ELBA 4H42U 1MTSA 1QBNA 1TPSA 3TGIE 2GMTB 2RA3A 1ZRKA 2BQ6B 3UNSA 1YPKH 1MU6B 4X6MA 2HRVA 3P8NA 3GY5A 2ZWLH 1Z8IB 3P70B 2BMGB 4B76A 2GZ9A 1O2KA 1PQ8A 3KQDA 1B0EA 2Q1JA 1LPKB 1TGSZ 2H1UA 2O8UA 5C1XA 5FX5A 4K8YA 1ETRH 5GDSH 4BAHB 1EZUC 2HOBA 2THFB 1HUTH 1HJAB 5DP8A 3TK5A 1GBBA 1QBVH 2BDYA 4Y7BA 2Z9KA 3NKKA 1FY1A 4RKOB 3PO1B 1IQEA 6GCHF 1V2PT 1EASA 3E1XB 5ETXA 1UK2A 1TNKA 1YCPK 1GBDA 2A2XH 2ILNA 1P09A 1TBRH 1W3CA 3KQBA 3PTBA 4FUJA 5CHAB 3W94A 2VB0A 2ZI2H 1GI5A 1ZHRA 4DJZB 2ZTZA 1KLIH 2OBOA 4A1TA 1A2CH 3E90B 1W14U 1U6QA 3SNCA 1S0QA 3D23A 2A5IA 1ANBA 3ITIA 3CS7A 1GBJA 1O33A 2YNBA 1GHVH 3GY8A 1V2RT 2J95A 2D1JA 2B0FA 2FOEA 4Y6DA 3L6PA 3HKIB 2BLOA 1MBQA 4YO9A 1BT7A 4K5ZA 4K8BA 6CHAC 2CGAA 1NM6A 2XXLA 3T62A 4DCDA 1P06A 4MPUA 1DSTA 3E3TA 3P95A 1T7CA 3LGTA 4E7RG 1RS0A 3ZYEA 4YT6H 2BD4A 4O03A 1NY22 4FUIA 2SGPE 3M7QA 1MTNB 3VB3A 2UUYA 1GHYH 5L6NH 3RXOA 3SBKA 3VB7A 1QL9A 1D6WA 1O3EA 3F1SB 3D62A 5C20A 2P59A 2O8LA 1P2IA 1HIAB 1RTKA 1BUIA 2FI4E 1ELEE 3DFJA 4VGCB 1NT1A 2PUXB 3E0NB 3RXQA 4DIHH 3PMAB 4GSOA 2ZO3H 1C2LA 4ZXYH 2ZTYA 1O30A 3A80A 2GT7A 3PLBA 2ZFTA 4AFZA 4KP0A 5DP5A 1T31A 4Q7XA 1EAIA 3LGIA 1EAXA 3RMMH 1TNGA 4JZDH 2F9OA 3RU4D 2HALA 1VJ9U 1IQNA 1O2RA 1MQ5A 2VGCB 1UCYH 1BRCE 1C4Y2 1D3PB 1Z8RA 5I25A 4ESTE 2VIWA 5FAHA 2UUJB 3E91A 4IC5A 1SSXA 1GI4A 2P8OB 3TH2H 1GBIA 3ATWA 2BLVA 1W12U 3MNXA 3KQCA 1P8VC 4I8JA 1P2JA 4OS2A 4KTSA 3TGJE 4YZUA 1G30B 3BTGE 1P02A 3V3MA 2F9VA 2A32A 1GBEA 2XBVA 3RXUA 2TRMA 1TX8A 4AZ2B 4ZXXH 1TGNA 1TE0A 3SU6A 1VITF 3BTHE 1ELFA 2GD4B 3F9EA 1AVXA 1QB1A 3EGKH 3TH4H 4BOHA 2QYIA 2HNTF 3SJOA 1C1QA 2A4OA 3FP7E 1NESE 2PWXA 2YOLA 2R3YA 3BIVH 1THSH 4X1QU 1G3BA 4AGJA 2GDEH 4BXWA 1ZPBA 2FOAA 1C2JA 2LPRA 2SFAA 3VB4A 2OC0A 1CO7E 3VB5A 1DANH 1KLJH 3TJVA 3KN2A 1O2OA 1GHAF 1C9TA 3SUGA 5L2ZH 4AYYB 3GY6A 4NA8A 1NS3A 1Z1IA 1O34A 4ZKNU 4ZKSU 1K22H 1THRH 1G3EA 1MTUA 1S85A 2F9PA 1KIGH 1AFEH 3KEEA 1HAVA 2PFEA 1K1OA 2JH0D 3F6UH 2BOHB 4WF8A 2WYGA 2VNTA 3BG4C 3GDSA 1Z8JB 1O38A 4M7GA 2BD9A 1WQSA 7GCHG 1O5CB 3T5FH 1A5HA 2R3UA 1AZZA 1HV7A 4IS5A 1LCYA 4X6NA 4Q80A 4FUDA 1AWFH 4K69A 1TNHA 1X7AC 3B23B 3OSYA 2C93B 2ZQ2A 2P16A 1ANEA 3U1JB 5FBIA 3D65E 1IQLA 2PKSB 1TPPA 5EOKA 1NFWA 5C3NA 3ZYDA 1QQ4A 2J34A 3NPSA 1BIOA 4O3TA 1AQ7A 2F9BH 3PYHA 5DK1A 1Y59T 1S6FA 3NUMA 4K2YA 2ZU5A 1MKXH 2BY6X 3STIA 3ZZCA 4D7GA 2BB4A 2EEKA 2ZKSA 4ISHH 3ZVBA 4FUEA 1LVBA 2HLCA 1BRAA 1Q3XA 1C1RA 3KF2A 1EOJA 1GHZA 2EI7A 3BV9B 3DHKH 2ZGBH 1ANDA 1MMJN 3ZZ6A 3TK9A 1CGIE 1AU8A 2FOCA 1JWTA 1O3CA 1FIZA 3S69A 2GZ7A 4JCNA 3VGCC 4Y7AA 3BTWE 4MPXA 2J92A 2AERH 8LPRA 5FHTA 2Y5GA 1V2JT 1O3NA 1NO9H 1SGTA 1W10U 1UVUH 1Q2WA 3SHAH 3ELAH 1DVAH 1UCYK 1UTOA 2QY0B 2XWAA 4X1NU 2AMPA 1KXFA 5E2PA 2ODYB 1TGCA 1IQIA 2BVSH 2XBXA 1ELGA 3RLYH 4ABHA 2HNTC 4INKA 2SGFE 1Y3VA 2F3CE 5DKMA 1QIXB 5JPMH 4X2VA 5AHGH 4WJG2 2Z6BD 4CH8B 4GVUA 3TGKE 2OC7A 4Y76A 2NU1E 2JH5D 3IG6B 4GCHF 1HAXB 1CHGA 3RLWH 1C2HA 5CE1A 1O3MA 3SW2B 2FO9A 3S9BA 2CF8H 3TNSA 1FN6A 1ZRBA 4Y11E 1HGTH 4Z0KA 4AFSA 1G36A 3P6ZB 4WH8A 5EQQA 1SPJA 2A1DB 1FY5A 4YTAA 1H4WA 2BVRH 1FQ3A 1UO6A 1FIWA 5K7RA 3L33A 3KIDU 3LONA 1GWAA 2WPJS 1CA0C 1Z6EA 4JK6A 5JBTA 4RKJB 2PSXA 3ZVFA 1V2UT 1DY9A 2OCVB 1MTVA 1HBTH 1QHRB 3SU3A 2G4UA 2H9EH 1C5OH 8ESTE 4X6PA 2Y7ZA 2SNVA 2PV9B 6GCHG 1DFPA 1SVPA 3P8GA 4AB9A 1MAXA 3NZIA 2Y81A 3MO6A 1JMOH 4FU9A 2SNWA 1TMUH 1P01A 1GJ7B 3ZZ9A 1BITA 2IPHA 2H2ZA 3CS0A 1MCVA 1QRXA 1MU8B 1A4WH 1AY6H 1C5ZB 7ESTE 2AEIH 1VITH 1PQAA 1EZSC 5DP7A 3E8LA 4ZAEA 2LNCA 3EE0B 1INCA 4O97A 1MBMA 2OLGA 5FPTA 4A92A 2FS9A 1ELCA 2R2MB 3QWCH 1HJ8A 1LVOA 2Q6GA 1N8OC 3KGPA 2Z3DA 3U1IB 3UWIA 5HMAA 2WV5A 1O2IA 2CV3A 3GYLB 1CVWH 2FOMB 1T4UH 1XUKA 2CHAB 1LMWB 1KXEA 2BZAA 5K0HA 1QA0A 2FOFA 3RXRA 3SU5A 2XC5A 3V7TA 1TPOA 2C8YB 1Y5UT 3RXTA 1MKXK 4MPWA 4MG3A 1AB9C 3HPTB 4E06H 1O5AB 1XKAC 3F68H 1HAYB 1TBQH 1T8NA 3GY4A 1Z6JH 1AUTC 1O5GH 2ZA5A 1GGDC 1TOMH 1NFUA 1G37A 4TYDA 5BRRE 1SQTA 4YLQH 1SFQB 2XBYA 1FMGA 1SOTA 3ZV8A 1S5SA 3RXVA 5HM2A 4X6OA 1YGCH 1MH0A 4I8HA 2P3UB 4INHA 4WVPE 5GPIB 1O2PA 1A3BH 1F2SE 2VWLA 2CN0H 1QCPA 5JBCS 1KDQB 3ZZ8A 1CGHA 4ZHLU 1YPJH 1O2NA 1QNJA 4OGXA 1THPB 5DO4H 3LGWA 5JB8S 1Z71A 3MU1A 3GCOA 1XVMA 1DDJA 5E8EH 1JOUB 4IW4E 2FZZA 1TBZH 2SGDE 1SL3A 1BMNH 4XOJA 3DT0H 5J4SA 3S0NA 1ELDE 1GBHA 3SHCH 3A83A 1C1OA 1QFKH 2XC0A 4AOQA 1A0LA 2TGDA 1SBWA 1YP9A 2W7UA 4XBCA 2NU3E 1C5TA 3A81A 3M3VA 3SI4H 2BDHA 3PB1E 1Z7KA 2ZU1A 3GCTF 1D6RA 4DGJA 2NU4E 2Z9IA 1PYTD 3P92A 2GV6A 2P94A 1DPOA 3BTFE 3LPRA 4NZQA 1GL0E 1ZGVA 4NSYA 3RUOA 2BY5X 3T25A 1V2WT 3BEIB 1VITG 1AN1E 3F9FA 2FODA 4Q7YA 4YESB 3A7WA 2IJOB 1O3GA 1PPCE 2FPZA 4JZFH 4NG9H 2ZCHP 1S83A 3SJKA 2FESH 4J2YB 1DX5M 1GCTC 1NRRH 2IOTA 2QC2A 4CRFA 1EAUA 1GJBB 4I33A 1EX3A 4NWLA 3QLPH 1C1TA 1KXAA 4TWYA 4AG1A 1YBWA 1ZTKA 1P0SH 4B75A 1V2LT 1GHAG 3QO6A 4ZROA 1VCPA 1GJ4H 4IN1A 2ZHQH 1D3QB 4MTBA 3RXGA 2HVXA 1C2GA 1UTKA 2NU2E 2PKAB 1QBOA 2WUBA 2A0QB 4DY7B 5J4QA 1J17T 1PPFE 5DP9A 1SGFA 3RXHA 3GICB 2ZU2A 2OBQA 1G3DA 1ZSLA 2WINI 4MPVA 4ABDA 4NIYA 4ZHAA 2WPHS 3C27B 2F91A 1Y3XA 2VIVA 3UR6A 3ODDA 2XCFA 3A7VA 3RXLA 3UOUA 1OWHA 1W8BH 1OKXA 3I78A 2GP9B 2ZPQA 2WPLS 8GCHF 3NK8A 3MU0A 5JB9S 1P9UA 2I6QA 1AMHA 1P2MA 1K1IA 1GJAB 1CHOG 1FY3A 3F9GA 5E2OA 2A4QA 1FAXA 4YOJA 4E05H 1A0JA 5F03A 3SGQE 4XE4A 2M5TA 5EQRA 1T4VH 1H8IH 1OP2A 3A7YA 1P2KA 2J4IA 3WY8A 1VCQA 2B5TB 4CRBA 4MNVA 2EI8A 3PMHB 2QF3A 1O5BB 3URCA 4WXVA 1V3XA 1O36A 1EOLA 4Y8XA 3ZZ3A 3A82A 2BD7A 4GAWA 3UFAA 2PKAA 1O3HA 1RGQA 1A3EH 3NCLA 4B2BA 1IOEA 3TNTA 2VH6A 4FUGA 3PMBB 1GI6A 1ZR0A 3A86A 2VIPA 3QGJA 2J38A 2ZHEH 3BEFB 4Z6AH 2C4FH 1AI8H 2O9QA 2G52A 5F8ZA 2R9PA 1IQMA 1LVMA 4INLA 2HGTH 3GY3A 1N6XA 1ELAA 1YPHE 1V2TT 1GI8B 4A1XA 1K21H 3OY6U 1O5EH 1YCPM 2H5CA 3S9AA 2ZPRA 1GBMA 4X1PU 1C2FA 5H4IB 1V2OT 4D9QA 1GG6B 1O3IA 1VR1H 5LPRA 2VVVA 3DUXH 2PHBA 1M9UA 1BBRH 1YLDA 5A09A 9ESTA 1O2VA 1HYLA 4IBLH 2PLXA 2W5EA 4HTCH 4NA9H 3TJUA 7KMEH 1C5WB 1NC6A 2BY8X 6LPRA 5I46H 3EQ0H 4GCHG 1O3JA 2TGTA 2BZ6H 2J94A 3T28A 4TPYA 1DLEA 2BLQA 3SUFA 1PPZA 2RDLA 3MH5A 2B7DH 5TJXA 3GOVB 3MNSA 3QGNB 3HK3B 4A7IB 2BLWA 1DM4B 1MTWA 1OWEA 2GMTC 1G9IE 1WTHD 3LOXA 1KSNA 1S0RA 4X1RU 1LHDH 2W3KA 1GDQA 1S84A 2QF0A 3UQOA 1ZHPA 3SNDA 1EQ9A 1OYTH 5A8ZA 4CRAA 1CU1A 1JRTA 5GWZA 3OYPA 1NTPA 4D8NA 1DUAA 1C1NA 2BD3A 4H6SB 1CGJE 1CBWB 3ENSB 1MAYA 2FOHA 2A5KA 1TMTH 1TNIA 1GI1A 1HCGA 1AFQB 2P3TB 3HK6B 1EJMA 3M5LA 1DXWA 1RTLA 4BTTB 1L2EA 1XX9A 3BG4B 1ETTH 3B8JA 1IHTH 3SV9A 1H9LB 4LZ1H 1HJAC 2GCHG 2SGAA 3L3TA 4ZKRU 3PO1C 2BXTH 1KXBA 1W0YH 2F9NA 3NXPA 3PM3A 1MUEB 1FPCH 1XUFA 1A1RA 2H9TH 1AVGH 5AVDA 3RDZA 3ZZ5A 3ZVGA 1EZXC 4XBDA 2C8ZB 3RC5A 1TAWA 1CE5A 7LPRA 1JIMA 5F8XA 2AMQA 1ZTJA 3MH4A 4NIVA 5LH8A 1GBKA 1C2MA 1O37A 1P2OA 3KL6A 2ZGJA 5DJ7A 1ZJDA 1MD7A 4RSPA 2VIQA 5TCCA 2FTMA 2ALPA 1WYKA 2GV7A 3RXJA 9LPRA 1BJVA 4K60A 4BAQB 1HIAA 1SHHB 2C8WB 1UTMA 4UFDH 1OWKA 5A0AE 2XBWA 1GJCB 3SUDA 3TH3H 3PWCA 3KNXA 3ZV9A 2JKHA 4FXGH 3NWUA 3Q3XA 5ESTE 1SHYA 1OSSA 3Q3KA 3STJA 1NPMA 1OWJA 2BYAX 4YOGA 1NU7B 2Z3CA 1HFDA 1MD8A 1FJSA 3ZVCA 1HB0B 1QJ7B 2Z7FE 1OPHB 2VVCA 3VFEA 2Y82A 3OTJE 1K1NA 2O8TA 1NRPH 1VGCB 2K1QA 1MTNC 2G5VA 4GHTA 4B71A 1BRBE 3U9AH 3AW0A 1HLTH 4BTUB 1FY4A 1W13U 3TJNA 1CA8B 3AASA 3QTOH 3V12A 2VWNA 1S6HA 3ESTA 2A7CA 2PGBB 3RXCA 2V35A 4UEHH 4OGYA 1F92A 1FN8A 4VGCC 4H6TA 3PWBA 1BBRK 1XUJA 3BIUH 1SGFG 2G51A 2NU0E 3M61U 1VCWA 1WTGH 2G00A 4OS1A 1DT2A 3H5CB 1GDUA 1A61H 1YYY1 1GMCF 4UFFH 3RXEA 1BMAA 2H5DA 5C2ZA 3LKWA 2FTLE 1WSSH 3EA9A 4Y0ZE 1CHOF 2BDBA 4NFEA 1P3CA 3MMGA 3GCTG 4BANB 2P95A 1XUHA 4AG2A 1YM0A 4XSKU 3EA7A 1O0DH 5T6FA 3MU8A 3A8DA 1L4ZA 1C5SA 1LKBA 3ZZ4A 3TLOA 3E16B 3UQVA 2G8TA 2P8OC 3RU4E 1MZAA 1O2TA 1YPEH 4ABAA 5GCHG 1FXYA 2EA3A 1UCYE 2F9UA 2TBSA 4XFQA 2BD8A 1UHBB 3DD2H 2Z9LA 1PQ5A 5FPYA 4XDEA 1ZLRA 3M36A 1IQKA 4NGAH 1O2WA 1V2MT 1ZPCA 1D9IA 2O8WA 3FVFB 1SG8B 4IGDA 2VH0A 4NWKA 1GMHG 2GZ8A 1LPZB 2TGPZ 3SU1A 4HFPB 4FU8A 1OYQA 5JBAS 1C1MA 2FI3E 3C1KA 5F8TA 3SNEA 1LHCH 5A8XA 4JYTA 4K1EA 1QB6A 2FI5E 1RFNA 2BDIA 2YNAA 4H4FA 3GCHB 5FXLA 1WV7H 1OP0A 1O2HA 3AAUA 1EUFA 2PTNA 3PROA 1AWHB 4OS4A 1DWBH 2AIQA 3TK6A 3SNAA 3LC3A 4B74A 5LPEA 1WQVH 2HPPH 1J9CH 1L1JA 1P9SA 1XUGA 3BTME 3P17H 4KTCA 3VXEH 3A7XA 4B2AA 1N8OB 3RXAA 1SLWB 2WUCA 2WPKS 1BHXF 3A89A 4PROA 3W95A 4UD9H 1UHBA 3O8DA 1YPLH 4OS6A 4QT8C 1ESTA 5DP6A 2ESTE 3MU4A 3A84A 1N6YA 2ULLA 2ZGCA 8GCHG 1ZMNA 2GCTB 4WMFA 1P05A 5EODA 4CRGA 2VIOA 3K65B 2CJIA 2C90B 2RCEA 2O8MA 3GDUA 1AB9B 2JETB 4CREA 5GIBA 2G5NA 5FX6A 2GX4A 1TQ7B 1ZSJA 1LQEA 3H7TA 2A2QH 1WU1A 2WPMS 5L2YH 1PFXC 2PKSC 5A0CA 2AIPA 3A85A 1EPTB 4CHAB 4FUFA 4K3JA 1H9HE 2A31A 3HGPA 2A4RA 3BEUA 5EGMA 3R3GB 1L1GA 4CRCA 3QN7A 4I8GA 4GLYA 1L0ZA 1YKTA 3ZVEA 1ARBA 5L30H 1BCUH 5T6DA 4O3UA 1CT4E 1TOCB 3Q3YA 1TABE 4IN2A 3SI3H 1MQ6A 2GCHF 3TPIZ 2QA9E 1HXEH 1DWCH 4J1YA 2ANKH 1SGRE 1BZXE 4OS5A 1HAHH 4CBNA 2H9HA 3M5MA 1GHBF 4LXBH 2ANYA 4F4OC 1UVSH 4AB8A 2AGGX 4F49A 1UJ1A 5AF9H 4CR5A 1IHSH 3SJ9A 5E0GA 2AGIX 4BTIB 1AUJA 3HGNA 2Y80A 2PTCE 1P11E 2UUKB 4UFGH 4K1TA 1C5MD 2TIOA 1G32B 1SFIA 1G2LA 1EXFA 1NFYA 1GJ9B 2A45B 4R8TB 1PYTC 3ATMA 3LT3A 3RXFA 1TNJA 1EPTA 2ZZUH 1BMMH 1F0SA 4E7NA 3UWJH 1TYNA 4MNYA 2WPIS 1AE5A 1OX1A 1Y3YA 1C2EA 1AGJA 4FU7A 1F0TA 1QRWA 3RMLH 1O2QA 1XUIA 1C1SA 2UWPA 4FVDA 1SR5C 1GI7B 1KTTB 2ZNKH 1K1LA 1W7XH 1F5RA 1QRZA 4ISIH 2OC1A 4AX9H 3RXPA 1OWDA 1JBUH 3U69H 4Y8ZA 1T32A 3I29A 1FPHH 1MKWH 3ODFA 2D26C 4ZUHA 3U8TH 2BXUH 1RIWC 3QZRA 1J14A 4B73A 1TX7A 1H8DH 1MZDA 4YM9A 3Q00A 5HYOA 1QQUA 2VWMA 3VPKA 1O3FA 4X2WA 3HKJB 1RXPA 2GKVE 1V2NT 1HPGA 1O32A 1B5GH 1OP8A 1Y5AT 1TGTA 4X8UH 5DG6A 3SV6A 2SGQE 1AVWA 1DWDH 2ZU4A 2F83A 1SLUB 1NZQH 3LDXH 2BHGA 1GJDB 2KAIB 3EYDA 3URDA 1CT0E 3EAJA 2QXIA 3FFGA 4UFEH 1O3BA 4AYVB 3RC6A 1O2UA 4HI3A 2JH6D 4X2XA 2ZGHA 2FWWA 2RG3A 1WOFA 1TB6H 4FVBA 2C3SA 4CBOA 3DA9B 1DXPA 2D8WA 1TA2A 1O3DA 2ZU3A 4WXIA 1KLTA 5DP3A 1BMLA 2ZPSA 1C2KA 1EZQA 1NU9A 1E38B 2OQUA 1J16A 1EKBB 4R0IA 1D3TB 5GCHF 2B9LA 2AFQB 1KDQA 2BDAA 2OC8A 3JZ1B 3ATLA 2FOGA 1UTJA 1G3CA 1E36B 2DE9A 1K28D 3ZZBA 1A5GH 1UK3A 1LPGB 3ZVDA 2FEQH 1P10A 3VEQB 1GMHF 5TCAA 2HNTE 3GISB 2Y7XA 2FS8A 5IDKA 4TY6A 1ZSKA 2KAIA 4AFQA 1C4U2 4ZKOU 5C1YA 2BDGA 5C67A 1C1PA 4SGBE 4BXSA 1CSOE 4Y71A 1FNIA 3M3TA 2AYWA 4O9VA 2A7JA 4DOQA 3M35A 1OOKB 2FIRH 1C5PA 2QV1A 5JDUB 5EXMA 4AN7A 1BTWA 1XVOA 3MTYA 4WMEA 4MNWA 1ESAA 2XYAA 3TIUA 4I31A 2BOKA 2ZHDA 3O8RA 1SGEE 1O3AA 4Y79A 1DE7H 1HAGE 4WWYA 1DY8A 1JXPA 4A5TS 1UK4A 1SQOA 1LQDB 1TNLA 1Y5BT 1FZZA 1TX6A 3TU7H 3K6ZA 3RXMA 6CHAB 1GMCG 4WMDA 2PGQB 1SGNE 3EA8A 4X8SH 2R0LA 1LTOA 3RXBA 2QXJA 3LJOA 3B9FH 3SNBA 2BDCA 2QXGA 4MNXA 3RXSA 1UMAH 2Z9JA 4AORA 5A2MH 3O8CA 1FAKH 4BAMB 3RXKA 3Q77A 1RTFB 1Z8GA 3BF6H 5B6OA 1HJ9A 1NFXA 2OXSA 1AE8H 5G4BA 1TRNA 2ZGXH 1KYNA 1ZZZA 2CMYA 1MKWK 4BNRA 1OXGA 2QAAA 4NSVA 3HATH 1C2DA 1ID5H 1T8LA 1LDTT 2ZCLP 1O39A 5GJ4B 1C1UH 1E0FD 2ZF0H 4WH6A 1C1WH 3VXFH 3SV7A 3SV8A 1SC8U 3ATKA 4LK4A 3M7TA 2ZDVH 1VJAU 1C1VH 2ZFPH 2UUFB 1ZYOA 4B1TA 1ABJH 2Q6DA 1FDPA 4Q2KA 1NN6A 1P57B 2FM2A 2ZDNA 3IWMA 3O8BA 4JZEH 3BTDE 1PPGE 5EG4A 3M37A 5JYIA 4ABEA 3ZZAA 2G81E 1SLXB 5E0JA 5E0HA 1GJ8B 2FP7B 2FX4A 3A7TA 2VWOA 1LHGH 2BY7X 2VU8E 3LGUA 1GDNA 2G4TA 1PPBH 1UTLM 3S7HB 5T3HA 3SV2H 3I77A 1EJNA 4MVNA 1GPZA 2Y5HA 2Z3EA 5EXLA 4HZHA 3MO3A 1DWEH 1O3PB 3ZZ7A 2V3HH 3PTNA 3SZNA 4U30A
chains in the Genus database with same CATH superfamily
1SB1H 4ABGA 3FANA 1O3LA 2OUAA 2YMSD 3GYMA 1SGQE 2OINA 2ZFQH 4DT7B 1FLEE 2XCNA 2GGVB 2SGEE 3UIRA 2H6MA 2P93A 2QIQA 2V3MA 2V3OH 4RN6A 3V0XA 2ZQ1A 2ZDKA 3UOPA 4GUXA 1ABIH 1NROH 4A6LA 2J2UA 1IQHA 1HDTH 4X0WU 1W7GH 3CP7A 1C5NH 2ZFFH 4IMZA 2ODQA 3MWIU 3MO9A 3BN9A 3EE7A 1O3OA 2PR3A 5F6MA 1GBFA 1AIXH 1YPGH 3T29A 3N7DA 5CMXH 2FYQA 1ELVA 3LU9B 1B7XB 1O2SA 3P8FA 1Y3UA 4U01A 1W11U 1ZOMA 4ZHMU 5LGOA 1P12E 3P8OA 3LJJA 1GHXH 2EI6A 1UTQA 1GHBG 1B0FA 2BTCE 3RMOH 3G01A 1QJ6B 1TALA 3LH1A 1G2MA 1TGBA 3TITA 1BTXA 5CHAC 3DSGA 4Y8YA 2G55A 1C5UA 5HXFA 1HAIH 1YPMH 4Y0YE 1GMDF 3SGAE 2VVUA 3M7UA 1RRKA 3FZDA 3BG8A 1V6DA 4ACBA 4B2CA 1SQAA 2OP9A 3A8BA 4RT1A 1PPEE 5DP4A 2HLDD 3MI4A 4UDWH 2DUCA 1GG6C 1RD3B 1O2YA 4JYVH 4THNH 3RP2A 1C5YB 1BTYA 1E37B 1HAVB 4UONA 1TIOA 4I8LA 1CQQA 1S81A 2XOKD 1Q31A 2A5AA 5EXNA 4JMYA 2BVXH 1XXDA 2WYJA 4OS7A 2QXHA 1GI3A 3GY2A 1XKBC 1GBTA 1BTUA 1BBRE 1BA8B 3MH7A 1UTNA 2ODPA 1JRSA 1QL8A 4ABFA 3UNRA 2QF4A 1E1QD 1BTZA 2R2WU 1CT2E 3UPEA 3S9CA 1W2KH 3RC4A 1C5VA 4FUCA 3QDZB 3VGCB 1L4DA 1EP5A 1PQ7A 1GHWH 1O31A 1GJ5H 1IAUA 3OEED 4ABBA 1EP6A 2ZIQH 1UVPA 2B8OH 2VINA 3GY7A 2VJ1A 1ELTA 2EC9H 3MNCA 1TWXB 2HWLB 2RA0A 4DG4A 3PRDA 3PLPA 5AFYH 1IQFA 5A0BA 2QCYA 1W0ZU 1CBWC 5T6GA 4DIIH 1EB2A 1E34B 1KY9A 3GCNA 1QR3E 3M3SA 4ABJA 3UUZA 1AFQC 1ZPZA 1F0RA 1ZJKA 2AS9A 3E0PB 1BB0B 3FZZA 1O35A 1YC0A 3LIWA 1F5KU 1O2MA 3KCGH 2PW8H 3GDVA 3SZEA 4ASHA 2VGCC 2ZFSA 1C2IA 2GVFA 3SU0A 2ZFRH 3ZZDA 2ZDMA 2FOBA 1SMFE 2ZG0H 2BD5A 1HAOH 1CA0B 1DSUA 1QURH 2OTVA 4KELA 5DGJA 5FPSA 3E6PH 3OU0A 4I32A 4JK5A 1FV9A 2STBE 4DVAU 1SI5H 1XXFA 2BY9X 4YT7H 3ZVAA 2OD3B 1RJXB 3KHVA 4ASUD 4ZMAH 3BSQA 1F5LA 4I7YH 1GL1A 2FLRH 5FCKA 3Q76A 3RXIA 3A87A 1V2VT 5EPYA 2I6SA 3OY5U 3PLKA 1KXDA 3SQHE 3UR9A 2FLBH 2QGRA 4P00A 2R0KA 1NBMD 1ARCA 3ZIAD 4JZIA 2XWBI 3SJIA 3RM2H 3SUEA 1O5FH 1VGCC 1QJ1B 3LH3A 1TA6A 2CXVA 2PSYA 3UREA 1P2NA 4NIWA 1GCDA 1QA7A 1E1RD 1A7SA 1BQYA 3F2FA 1K1PA 3K2UA 1TFXA 2JJ1D 1QGFA 1S82A 2VIDA 1DS2E 1ACBE 1DOJA 3DSPA 1J15A 1OWIA 1MCTA 3MH6A 4TPIZ 1GVKB 4NA7A 4KTUA 3SJ8A 4ISLA 1LO6A 1YWUA 2IPQX 3A8AA 1BTPA 3RMNH 1EJAA 4I8KA 3JZ2B 1ETSH 3MHWU 1P04A 5JBBS 1NRNH 4TT3D 1LKAA 6ESTA 2ZHWH 3FOAA 4CR9A 1QY6A 2XTTB 2ZHFH 4GPGA 1GGDB 4DW2U 5EW1H 2ANMH 1WCZA 5CDFE 2GT8A 5EU8A 1WAYB 2Z9GA 1K1MA 5ESBA 1FONA 1HNEE 1SLVB 3KQEA 3BTEE 1QL7A 1GVZA 1RIWB 1O2GH 2V6NA 3U8OH 8KME2 3SU2A 3QX5H 1SKYE 2RFKC 3U8RH 3UY9A 2ZDAH 4TWWA 1K2I1 1UVTH 4X2YA 1BHXB 3S7KB 3IITA 3BTTE 3FP8E 3TVJB 3T2NA 1K1JA 2DE8A 2Y6TA 3EDXB 5EW2H 1ANCA 1Y8TA 1ZMLA 3M5NA 4FUHA 1C5LH 5KEDA 1TRYA 4HGCA 3LGYA 1SGPE 2CF9H 4TSFD 4B6FA 1TONA 4LZ4B 1H9IE 4Q4LA 1V2QT 4U2WA 1A5IA 3DFLA 4YXWD 2W26A 5FCRA 4CRDA 1J8AA 2C8XB 3SQEE 4FUBA 2P3FH 5PTPA 1TLDA 5HGGA 1GBAA 4KGAA 4A1VA 1JIRA 2BX4A 3GCHC 1A0HB 2AGEX 1BJUA 3RM0H 2ZP0H 1YLCA 3D49H 4KKDA 1ZHMA 5C1UA 1TQ0B 1ZMJA 2PUQH 3T26A 5IYTA 2STAE 2TPIZ 3A8CA 4X8VH 4U32A 1TPAE 1WBGB 3SU4A 3GS9A 2XC4A 3T27A 3SOSA 2ZTXA 4JZ1A 4Q7ZA 3FAOA 3M5OA 1TMBH 2GTBA 4ZH8A 1L1NA 1GI0A 1AO5A 1GCTB 1UTPA 1YPHC 1OS8A 4AFUA 5DPAA 2AH4X 2ZCKP 4DURA 1XM1A 2ZC9H 1N1LA 1D3DB 1O2ZA 3A88A 4ISNA 1YF4A 1FY8E 2OQ5A 1BOQA 2GCTC 1V2ST 4MLFB 4YLUA 3U98H 5A8YA 1VZQH 1IQGA 2BX3A 2W6ID 1BRUP 3ATIA 1SOZA 1SGIB 1P2QA 2JETC 3SORA 1W0JD 1ESBA 1GI2A 2Y5FA 3AAVA 1SGCA 3VB6A 4SGAE 1QB9A 2VBCA 3LGVA 2GDDA 3MYWA 1HAZB 5SGAE 3H7OA 4NFFA 1SGYE 3AW1A 3SGBE 1EPTC 1K9OE 1NRQH 3K6YA 3MNBA 3F0PA 4CHAC 2AMDA 5AFZH 3PMJA 1PJPA 4NIXA 1QTFA 2FDAA 1F0UA 1NRSH 2BM2A 1KTSB 2BD2A 3MU5A 1LHEH 3V13A 1YCPH 3PV4A 1E35B 2ASUB 1O3KA 1EAWA 1D4PB 2NWNA 2Z94A 7GCHF 1V2KT 5KECA 1HRTH 1UW7A 2ZEBA 3F9HA 1ZTLA 1LHFH 2IN2A 4GHQA 1PPHE 1DITH 1Y3WA 5HM9A 1GMDG 1AKSB 2W3IA 3QUMP 1O5DH 4BAOB 2FX6A 3R0FA 1GBLA 1GVLA 3UNQA 3MFJA 4CH2B 5FBEA 4LOYH 4UE7H 1FI8A 2BQWB 1T8OA 2XW9A 1O2XA 1EATA 5EQSA 1A46H 1LVYA 2IJD1 1AHTH 1ORFA 4IC6A 3RU4T 1SGDE 1O2LA 5ABWA 2A4GA 3K9XB 3W1EA 3N99A 4K1SA 3BTQE 2BQ7B 2CHAC 4D9RA 1FUJA 1C5QA 3SO3A 3AVZA 2FYRA 2KCOA 4Y10E 2A7HA 1AZ8A 1KXCA 5BPEA 1EB1H 2J9NA 2ZECA 3OX7U 4JYUH 1BTHH 1GBCA 2FXRA 4DT4A 1DUEA 3MOCA 2XNIA 4NZLA 2TGAA 1F7ZA 5GXPA 5C17A 4ISOA 2ALVA 4MQAA 3QTVH 1O2JA 4TY7A 4XBBA 3SN8A 1DLKB 1GI9B 3QZQA 1TRMA 4FOUC 2Q6FA 3N7OA 2FMJA 2ZDLA 1AKSA 5C5NA 1HAPH 1UVOA 3TJOA 1WUNH 2HPQH 1P3EA 2ANWA 5EPNA 4BAKB 1HXFH 2QN5T 3A7ZA 3QK1A 2XRCA 1ZGIA 2UWLA 2W7SA 3LC5A 3CENA 3UTUH 4ABIA 2D2DA 4D76A 1P03A 3FP6E 1C9PA 4MDSA 4YOIA 1DICA 1XMNB 1H1BA 5LPFA 4NCYA 1Z1JA 4X1SU 4X8TH 1GJ6A 1T8MA 2V0BA 3BTKE 2UWOA 4D7FA 1C5XB 5C5OA 4WY3A 2WV4A 4AGKA 4IMQA 1IQJA 3RXDA 1AD8H 1C5RA 3DCLA 2YMSC 1C4V2 1BDAA 1ELBA 4H42U 1MTSA 1QBNA 1TPSA 3TGIE 2GMTB 2RA3A 1ZRKA 2BQ6B 3UNSA 1YPKH 1MU6B 4X6MA 2HRVA 3P8NA 3GY5A 2ZWLH 1Z8IB 3P70B 2BMGB 4B76A 2GZ9A 1O2KA 1PQ8A 3KQDA 1B0EA 2Q1JA 1LPKB 1TGSZ 2H1UA 2O8UA 5C1XA 5FX5A 4K8YA 1ETRH 5GDSH 4BAHB 4F48B 1EZUC 2HOBA 2THFB 1HUTH 1HJAB 5DP8A 3TK5A 1GBBA 1QBVH 2BDYA 4Y7BA 2Z9KA 3NKKA 1FY1A 4RKOB 3PO1B 1IQEA 6GCHF 1V2PT 1EASA 3E1XB 5ETXA 1UK2A 1TNKA 1YCPK 1GBDA 2A2XH 2ILNA 1P09A 1TBRH 1W3CA 3KQBA 3PTBA 4FUJA 5CHAB 3W94A 2VB0A 2ZI2H 1GI5A 1ZHRA 3KYFA 2J98B 4DJZB 2ZTZA 1KLIH 2OBOA 4A1TA 1A2CH 3E90B 1W14U 1U6QA 3SNCA 1S0QA 3D23A 2A5IA 1ANBA 3ITIA 3CS7A 1GBJA 1O33A 2YNBA 1GHVH 3GY8A 1V2RT 2J95A 2D1JA 2B0FA 3F0OA 2FOEA 4Y6DA 3L6PA 3HKIB 2BLOA 1MBQA 4YO9A 1BT7A 4K5ZA 4K8BA 1KMHB 2CGAA 3U28C 6CHAC 1NM6A 2XXLA 3T62A 4DCDA 1P06A 4MPUA 4F55A 1DSTA 3E3TA 2KM0A 1WXRA 3P95A 1T7CA 3LGTA 4E7RG 1RS0A 3ZYEA 4YT6H 2BD4A 4O03A 1NY22 4FUIA 2SGPE 3M7QA 1MTNB 3VB3A 2JJ2D 1GHYH 2UUYA 5L6NH 3RXOA 3SBKA 3VB7A 1QL9A 1D6WA 1O3EA 3F1SB 3D62A 5C20A 2P59A 2O8LA 1P2IA 1HIAB 1RTKA 1BUIA 2FI4E 1ELEE 3DFJA 4VGCB 1NT1A 2PUXB 3E0NB 3RXQA 4DIHH 3PMAB 4GSOA 2ZO3H 1C2LA 4ZXYH 2ZTYA 1O30A 3A80A 2GT7A 3PLBA 2ZFTA 4AFZA 4KP0A 5DP5A 1T31A 4Q7XA 1EAIA 3LGIA 3PV2A 1EAXA 3RMMH 1TNGA 4JZDH 2F9OA 3RU4D 2HALA 1VJ9U 1IQNA 1O2RA 1MQ5A 2VGCB 1UCYH 1BRCE 1C4Y2 3OEHD 1D3PB 1Z8RA 5I25A 4ESTE 2VIWA 5FAHA 2UUJB 3E91A 4IC5A 1SSXA 1GI4A 2P8OB 3TH2H 1GBIA 1S6LA 3ATWA 2BLVA 1W12U 3MNXA 3KQCA 3CNRA 1P8VC 4I8JA 1P2JA 4OS2A 4KTSA 5HIZA 3TGJE 4YZUA 1G30B 3BTGE 1P02A 3V3MA 2F9VA 2WHXA 2A32A 1GBEA 2XBVA 3RXUA 2TRMA 1TX8A 4AZ2B 4ZXXH 1TGNA 1TE0A 3SU6A 1VITF 3BTHE 1ELFA 2GD4B 3F9EA 1AVXA 1QB1A 3EGKH 3TH4H 4BOHA 2QYIA 2HNTF 3SJOA 1C1QA 2A4OA 3FP7E 1NESE 2PWXA 2YOLA 2R3YA 3BIVH 1THSH 4X1QU 1G3BA 4AGJA 2GDEH 4BXWA 1ZPBA 2FOAA 1C2JA 2LPRA 2SFAA 3VB4A 2OC0A 1CO7E 3VB5A 1DANH 1KLJH 3TJVA 3KN2A 1O2OA 1GHAF 1C9TA 3SUGA 5L2ZH 4AYYB 3GY6A 4NA8A 1NS3A 1Z1IA 1O34A 4ZKNU 4ZKSU 1K22H 1THRH 1G3EA 1MTUA 1S85A 2F9PA 1KIGH 1AFEH 3KEEA 1HAVA 2PFEA 1K1OA 2JH0D 3F6UH 2BOHB 4WF8A 2WYGA 2VNTA 3BG4C 1OHHD 1Z8JB 3GDSA 1O38A 4M7GA 2BD9A 1WQSA 7GCHG 1O5CB 3T5FH 1A5HA 2R3UA 1AZZA 1HV7A 4IS5A 1LCYA 4X6NA 4Q80A 2OK5A 4FUDA 1AWFH 4K69A 1TNHA 1X7AC 3B23B 3OSYA 2C93B 2ZQ2A 2P16A 1ANEA 3U1JB 5FBIA 2K0QA 3D65E 1IQLA 2PKSB 1TPPA 5EOKA 1NFWA 5C3NA 3ZYDA 1QQ4A 2J34A 3NPSA 5T1VA 1BIOA 4RT0A 4O3TA 1AQ7A 2F9BH 3PYHA 5DK1A 1Y59T 1S6FA 3NUMA 4K2YA 2ZU5A 1MKXH 1YY3A 2BY6X 3OE7D 3STIA 3ZZCA 2BB4A 4D7GA 2EEKA 2ZKSA 4ISHH 3ZVBA 4FUEA 1LVBA 2HLCA 1BRAA 1Q3XA 1C1RA 3KF2A 1EOJA 3MQKC 1GHZA 2EI7A 3BV9B 3DHKH 2ZGBH 1ANDA 1MMJN 3ZZ6A 3TK9A 1CGIE 1AU8A 2FOCA 1JWTA 1O3CA 1FIZA 3S69A 2GZ7A 3FO8D 4JCNA 3VGCC 4B6EA 4Y7AA 3BTWE 4MPXA 1H8ED 2J92A 2AERH 8LPRA 5FHTA 2Y5GA 1V2JT 1O3NA 1NO9H 1SGTA 1W10U 1UVUH 1Q2WA 3SHAH 3ELAH 3OTPA 1DVAH 1UCYK 1UTOA 2QY0B 2XWAA 4X1NU 2AMPA 1KXFA 5E2PA 2ODYB 1TGCA 1IQIA 2BVSH 2XBXA 1ELGA 3RLYH 4ABHA 2HNTC 2KZ4A 4INKA 5FL7D 2SGFE 1Y3VA 2F3CE 5DKMA 1QIXB 5JPMH 4X2VA 5AHGH 4WJG2 2Z6BD 4CH8B 4GVUA 3TGKE 2OC7A 4Y76A 2NU1E 2JH5D 3IG6B 4GCHF 1HAXB 1CHGA 3RLWH 1C2HA 5CE1A 2KCYA 1O3MA 3SW2B 2FO9A 3S9BA 2CF8H 3TNSA 1FN6A 1ZRBA 4Y11E 1HGTH 4Z0KA 4AFSA 1G36A 3P6ZB 4WH8A 5EQQA 1SPJA 2A1DB 1FY5A 4YTAA 1H4WA 2BVRH 3UB0A 1FQ3A 4XRNA 1UO6A 1FIWA 5K7RA 3L33A 2GJGA 2WPDD 3KIDU 3LONA 1GWAA 2WPJS 1CA0C 1Z6EA 1SQRA 4JK6A 5JBTA 4RKJB 2PSXA 4OM9A 3ZVFA 1V2UT 1DY9A 2OCVB 1MTVA 1HBTH 1QHRB 3SU3A 2HVYB 2G4UA 2H9EH 1C5OH 8ESTE 4X6PA 2Y7ZA 2SNVA 2PV9B 2RDEA 3UAIC 6GCHG 1DFPA 1SVPA 3P8GA 4AB9A 1MAXA 3NZIA 2Y81A 3MO6A 3SYJA 1JMOH 4FU9A 2SNWA 1TMUH 1P01A 1GJ7B 3ZZ9A 1BITA 2IPHA 2H2ZA 3CS0A 1MCVA 1QRXA 1MU8B 1A4WH 1AY6H 1C5ZB 7ESTE 2AEIH 1VITH 1PQAA 1EZSC 5DP7A 3E8LA 4ZAEA 2LNCA 3EE0B 1INCA 4O97A 1MBMA 2OLGA 5FPTA 4A92A 2FS9A 1ELCA 2R2MB 3QWCH 1HJ8A 1LVOA 2Q6GA 1N8OC 3KGPA 1NBME 2Z3DA 3U1IB 3UWIA 5HMAA 2WV5A 1O2IA 2CV3A 3GYLB 1CVWH 2FOMB 1T4UH 1XUKA 2CHAB 1LMWB 1KXEA 2BZAA 5K0HA 1QA0A 2FOFA 3RXRA 3SU5A 2XC5A 3V7TA 1TPOA 2J97A 3F3BA 3NRLA 2C8YB 1Y5UT 3RXTA 1MKXK 4MPWA 4MG3A 1AB9C 3HPTB 4E06H 1O5AB 1XKAC 3F68H 1HAYB 5C0UA 1TBQH 4FETA 1T8NA 3GY4A 1Z6JH 1AUTC 1O5GH 2ZA5A 1GGDC 1TOMH 1NFUA 1G37A 2L74A 4TYDA 5BRRE 1MABB 1SQTA 4YLQH 1SFQB 2XBYA 1FX0B 1FMGA 1SOTA 3ZV8A 1S5SA 3RXVA 5HM2A 4X6OA 1YGCH 1MH0A 4I8HA 2P3UB 4INHA 4WVPE 5GPIB 1H8HD 2L6OA 1O2PA 1A3BH 1F2SE 2VWLA 2CN0H 1QCPA 5JBCS 1KDQB 3ZZ8A 1CGHA 4ZHLU 1YPJH 1O2NA 1QNJA 4OGXA 1THPB 5DO4H 3LGWA 5JB8S 1Z71A 3MU1A 3GCOA 1XVMA 1DDJA 5E8EH 4I86A 2LP6A 1JOUB 4IW4E 3FKSD 2FZZA 1TBZH 2SGDE 1SL3A 1BMNH 4XOJA 3DT0H 5J4SA 3S0NA 1ELDE 1GBHA 3SHCH 3A83A 1C1OA 1QFKH 2XC0A 4AOQA 1A0LA 2TGDA 1SBWA 1YP9A 2YMSB 2W7UA 4XBCA 2NU3E 1C5TA 3A81A 3M3VA 3SI4H 2BDHA 3PB1E 1Z7KA 2ZU1A 3GCTF 1D6RA 4DGJA 2NU4E 2Z9IA 1PYTD 3P92A 2GV6A 2P94A 1DPOA 3BTFE 3LPRA 4NZQA 1GL0E 1ZGVA 4NSYA 2KR7A 3RUOA 2BY5X 3T25A 1V2WT 3BEIB 1VITG 1AN1E 3F9FA 2FODA 4Q7YA 4YESB 3A7WA 2IJOB 1O3GA 1PPCE 2FPZA 4JZFH 4NG9H 2ZCHP 1S83A 3KYGA 3SJKA 2FESH 4J2YB 1DX5M 1GCTC 1NRRH 2IOTA 2QC2A 4CRFA 1EAUA 1GJBB 4I33A 1EX3A 4NWLA 3QLPH 1C1TA 1KXAA 4TWYA 4AG1A 1YBWA 5DSFA 1ZTKA 1P0SH 4B75A 1V2LT 1GHAG 3QO6A 4ZROA 2EQNA 1VCPA 1GJ4H 4IN1A 2ZHQH 1D3QB 4MTBA 3RXGA 2HVXA 1C2GA 1UTKA 2NU2E 2PKAB 1QBOA 2WUBA 2A0QB 4DY7B 5J4QA 1J17T 1PPFE 5DP9A 1SGFA 3RXHA 3GICB 2ZU2A 2OBQA 1G3DA 1ZSLA 2WINI 4MPVA 4ABDA 4NIYA 4ZHAA 2PP6A 2WPHS 3C27B 2F91A 1Y3XA 2VIVA 3UR6A 3ODDA 2XCFA 3A7VA 3RXLA 3UOUA 1OWHA 1W8BH 1OKXA 2EY4C 3I78A 2GP9B 2ZPQA 2WPLS 8GCHF 3NK8A 3MU0A 5JB9S 1P9UA 2I6QA 1AMHA 1P2MA 1K1IA 1GJAB 1CHOG 1FY3A 3F9GA 5E2OA 2A4QA 1FAXA 4YOJA 3F2GA 4E05H 1A0JA 5F03A 3SGQE 4XE4A 2M5TA 5EQRA 1T4VH 1H8IH 1OP2A 3A7YA 1P2KA 2J4IA 3WY8A 1VCQA 2B5TB 4CRBA 4MNVA 2EI8A 3PMHB 2QF3A 1O5BB 3URCA 4WXVA 1V3XA 1O36A 1EOLA 4Y8XA 3ZZ3A 3A82A 2BD7A 4GAWA 3UFAA 2PKAA 1O3HA 1RGQA 1A3EH 3NCLA 4B2BA 1IOEA 3TNTA 2VH6A 4FUGA 3PMBB 1GI6A 1ZR0A 3A86A 2VIPA 3QGJA 2J38A 2ZHEH 3BEFB 4Z6AH 2C4FH 1AI8H 2O9QA 2G52A 5F8ZA 2R9PA 1IQMA 1LVMA 4INLA 2HGTH 3GY3A 1N6XA 1ELAA 1YPHE 1V2TT 1GI8B 4A1XA 1K21H 4M9FA 1EFRD 3OY6U 1O5EH 1YCPM 2H5CA 3S9AA 2ZPRA 1GBMA 4X1PU 1C2FA 5H4IB 1V2OT 4D9QA 5HKKD 1GG6B 1O3IA 1VR1H 5LPRA 2VVVA 3DUXH 2PHBA 1M9UA 1BBRH 1YLDA 5A09A 9ESTA 1O2VA 1HYLA 4IBLH 2PLXA 2W5EA 4HTCH 4XD7D 4NA9H 1BMFD 3TJUA 7KMEH 1C5WB 4P02A 1NC6A 2BY8X 6LPRA 5I46H 3EQ0H 4GCHG 5CHBA 2LELA 1O3JA 2TGTA 2BZ6H 2J94A 3T28A 3H09A 4TPYA 5EIYA 1DLEA 2BLQA 3SUFA 1PPZA 2RDLA 3MH5A 2B7DH 5TJXA 3GOVB 3MNSA 3QGNB 3HK3B 5KGOA 4A7IB 2BLWA 1DM4B 1MTWA 1OWEA 2GMTC 1G9IE 1WTHD 3LOXA 1KSNA 1S0RA 4X1RU 1LHDH 2W3KA 2J98A 1GDQA 1S84A 2QF0A 3UQOA 1ZHPA 3SNDA 1EQ9A 1OYTH 2XNDD 5A8ZA 4CRAA 5EJ1A 1CU1A 1JRTA 5GWZA 3AK5A 3OYPA 1NTPA 4D8NA 1DUAA 1C1NA 2BD3A 4H6SB 1CGJE 1CBWB 3ENSB 1MAYA 2FOHA 2A5KA 1TMTH 1TNIA 1GI1A 1HCGA 1AFQB 2P3TB 3HK6B 1EJMA 3M5LA 1DXWA 1RTLA 4BTTB 1L2EA 1XX9A 3BG4B 1ETTH 3B8JA 1YLNA 1IHTH 3SV9A 4RI0A 1H9LB 4LZ1H 1HJAC 2GCHG 2SGAA 3L3TA 4ZKRU 3PO1C 2BXTH 1KXBA 1W0YH 2F9NA 3NXPA 3PM3A 1MUEB 1FPCH 1XUFA 1A1RA 2H9TH 1AVGH 5AVDA 3RDZA 3ZZ5A 3ZVGA 1EZXC 4XBDA 5F53A 2C8ZB 3RC5A 1TAWA 1CE5A 7LPRA 1JIMA 5F8XA 2AMQA 1ZTJA 3MH4A 4NIVA 5LH8A 1GBKA 1C2MA 1O37A 1P2OA 3KL6A 2ZGJA 5DJ7A 1W0KD 1ZJDA 1MD7A 4RSPA 2VIQA 5TCCA 2FTMA 2ALPA 2CK3D 1WYKA 2GV7A 3RXJA 9LPRA 1BJVA 4K60A 4BAQB 1HIAA 1SHHB 2C8WB 1UTMA 4UFDH 1OWKA 5A0AE 2XBWA 1GJCB 3SUDA 3TH3H 3PWCA 3KNXA 5GNDA 3ZV9A 2JKHA 4FXGH 3NWUA 3Q3XA 5ESTE 4ZCNA 1SHYA 1OSSA 3FN8A 3Q3KA 3STJA 1NPMA 1OWJA 2BYAX 4YOGA 1NU7B 2Z3CA 1HFDA 1QZ8A 1MD8A 1FJSA 3ZVCA 1HB0B 1QJ7B 2Z7FE 1OPHB 2VVCA 3VFEA 2Y82A 3OTJE 1K1NA 2O8TA 1NRPH 1VGCB 2K1QA 1MTNC 2G5VA 4GHTA 4B71A 1BRBE 3U9AH 3AW0A 1HLTH 4BTUB 1FY4A 1W13U 3TJNA 1CA8B 3AASA 3QTOH 3V12A 2VWNA 3PV5A 5IK2D 1S6HA 3ESTA 2A7CA 2PGBB 3RXCA 2V35A 4UEHH 3OFND 4OGYA 1F92A 1FN8A 4VGCC 4H6TA 3PWBA 1BBRK 1XUJA 3BIUH 1SGFG 2G51A 2NU0E 3M61U 1VCWA 1WTGH 2G00A 4OS1A 1DT2A 3H5CB 1GDUA 1A61H 1YYY1 1GMCF 4UFFH 3RXEA 1BMAA 2H5DA 5C2ZA 3LKWA 2FTLE 1WSSH 3EA9A 4Y0ZE 1CHOF 2BDBA 4NFEA 1P3CA 2AHME 3MMGA 3GCTG 4BANB 2P95A 1XUHA 4AG2A 1YM0A 4XSKU 3EA7A 1O0DH 5T6FA 3MU8A 3A8DA 1L4ZA 1C5SA 1LKBA 3ZZ4A 3TLOA 3E16B 3UQVA 5HIYA 2G8TA 2P8OC 3RU4E 1MZAA 1O2TA 1YPEH 4ABAA 5GCHG 1FXYA 2EA3A 1UCYE 2F9UA 1WDIA 2WZQA 2TBSA 4XFQA 2BD8A 1UHBB 3DD2H 2Z9LA 1PQ5A 2V7QD 4XDEA 1ZLRA 5FPYA 3M36A 1IQKA 4NGAH 1O2WA 1V2MT 1ZPCA 1D9IA 2O8WA 3FVFB 1SG8B 4IGDA 2VH0A 4NWKA 3WW7A 1GMHG 2GZ8A 1LPZB 2TGPZ 3SU1A 4HFPB 4FU8A 1OYQA 5JBAS 1C1MA 2FI3E 3C1KA 5F8TA 3SNEA 1LHCH 5A8XA 4JYTA 4Z1MD 4K1EA 1QB6A 2FI5E 1RFNA 2BDIA 2YNAA 4H4FA 3GCHB 2J5UA 5FXLA 1WV7H 1OP0A 1O2HA 3AAUA 1EUFA 2PTNA 3PROA 1AWHB 4OS4A 3F2HA 3DSOA 1DWBH 2AIQA 3TK6A 3SNAA 3LC3A 4B74A 5LPEA 1WQVH 2HPPH 1J9CH 1L1JA 1P9SA 1XUGA 3BTME 3P17H 4KTCA 1E79D 3VXEH 3A7XA 4B2AA 1N8OB 3RXAA 1SLWB 2WUCA 2WPKS 1BHXF 3A89A 4PROA 3W95A 4UD9H 1UHBA 3O8DA 1YPLH 4OS6A 4QT8C 1ESTA 5DP6A 2ESTE 3MU4A 3A84A 1N6YA 4Q63A 2ULLA 2ZGCA 8GCHG 1ZMNA 2GCTB 4WMFA 1P05A 5EODA 4CRGA 2VIOA 3K65B 2CJIA 2C90B 2RCEA 2O8MA 3GDUA 1AB9B 2JETB 4CREA 5GIBA 2G5NA 5FX6A 2GX4A 1TQ7B 1ZSJA 5EJZA 1LQEA 3H7TA 2A2QH 1WU1A 2WPMS 5L2YH 1PFXC 2PKSC 5A0CA 2AIPA 3A85A 1EPTB 4CHAB 4FUFA 4K3JA 1H9HE 2A31A 3HGPA 2A4RA 3BEUA 5EGMA 3R3GB 1L1GA 4CRCA 3QN7A 4I8GA 4GLYA 1L0ZA 1YKTA 3ZVEA 1ARBA 5L30H 1BCUH 5T6DA 4O3UA 1CT4E 1TOCB 3Q3YA 3KQ5A 1TABE 4IN2A 3SI3H 1MQ6A 2GCHF 3TPIZ 2QA9E 1HXEH 1DWCH 4J1YA 2ANKH 1SGRE 1BZXE 4OS5A 1HAHH 4CBNA 2H9HA 3M5MA 1GHBF 4LXBH 2ANYA 4HG6A 4F4OC 1UVSH 4AB8A 2AGGX 4F49A 1UJ1A 5AF9H 4CR5A 1IHSH 3SJ9A 5E0GA 2AGIX 4BTIB 1AUJA 3HGNA 2Y80A 2PTCE 1P11E 2UUKB 4UFGH 4K1TA 1C5MD 2TIOA 1G32B 1SFIA 1G2LA 2K8IA 2WV9A 1EXFA 1NFYA 1GJ9B 2A45B 4R8TB 1PYTC 3ATMA 3LT3A 3RXFA 1TNJA 1EPTA 2ZZUH 1BMMH 1F0SA 4E7NA 3UWJH 1TYNA 4MNYA 2WPIS 1AE5A 1OX1A 1Y3YA 1C2EA 1AGJA 4FU7A 1F0TA 1QRWA 3RMLH 1O2QA 1XUIA 1C1SA 2UWPA 4FVDA 2F4LA 1SR5C 1GI7B 1KTTB 2ZNKH 1K1LA 1W7XH 1F5RA 1QRZA 3WWBA 4ACAA 4ISIH 5C0TA 2OC1A 4AX9H 3RXPA 1OWDA 1COWD 1JBUH 3U69H 4Y8ZA 1T32A 3I29A 1FPHH 1MKWH 3ODFA 2D26C 4ZUHA 3U8TH 3OAAD 2BXUH 5EJLA 1RIWC 3QZRA 1J14A 4B73A 1TX7A 1H8DH 1MZDA 4YM9A 3Q00A 5HYOA 1QQUA 2VWMA 2WSSD 3VPKA 1O3FA 4X2WA 3HKJB 1RXPA 2GKVE 1V2NT 1HPGA 2QE7D 1O32A 1B5GH 1OP8A 1Y5AT 1TGTA 4X8UH 5DG6A 3SV6A 2SGQE 1AVWA 1DWDH 2ZU4A 2F83A 1SLUB 1NZQH 3LDXH 2BHGA 1GJDB 3VG8A 2KAIB 3EYDA 3URDA 1CT0E 5C94A 3EAJA 2QXIA 3FFGA 3PRBA 4UFEH 1O3BA 4AYVB 3RC6A 1O2UA 4HI3A 2JH6D 4X2XA 2ZGHA 2FWWA 2RG3A 1WOFA 1TB6H 4FVBA 2C3SA 4CBOA 3DA9B 1DXPA 2D8WA 1TA2A 1O3DA 2ZU3A 4WXIA 1KLTA 5DP3A 1BMLA 2ZPSA 1C2KA 1EZQA 1NU9A 1E38B 2OQUA 1J16A 1EKBB 4R0IA 1D3TB 5GCHF 2B9LA 2AFQB 4AC9A 1KDQA 2BDAA 2OC8A 3JZ1B 3ATLA 2FOGA 1UTJA 1G3CA 1E36B 2DE9A 2KCPA 1K28D 3ZZBA 1A5GH 1UK3A 1LPGB 3ZVDA 2FEQH 1P10A 3VEQB 1GMHF 5TCAA 2HNTE 3GISB 2Y7XA 2FS8A 5IDKA 4TY6A 1ZSKA 2KAIA 4AFQA 1C4U2 4ZKOU 5C1YA 2BDGA 5C67A 2KX4A 1C1PA 4SGBE 4BXSA 1CSOE 4Y71A 1FNIA 3M3TA 2AYWA 4O9VA 2A7JA 4DOQA 3M35A 1OOKB 2FIRH 1C5PA 2F43B 2QV1A 5JDUB 5EXMA 2KCAA 4AN7A 1BTWA 1XVOA 3MTYA 4WMEA 4MNWA 1ESAA 2XYAA 3TIUA 4I31A 2BOKA 2ZHDA 3O8RA 1SGEE 1O3AA 4Y79A 3N7EA 1DE7H 1HAGE 4WWYA 1DY8A 1JXPA 4A5TS 1UK4A 1SQOA 1LQDB 1TNLA 1Y5BT 1FZZA 1TX6A 3TU7H 3K6ZA 2KFWA 3RXMA 6CHAB 5DN6D 1GMCG 4WMDA 2PGQB 1SGNE 3EA8A 4X8SH 2R0LA 1LTOA 3RXBA 2QXJA 3LJOA 3B9FH 3SNBA 2JIZD 2BDCA 2QXGA 4MNXA 3RXSA 1UMAH 2Z9JA 4AORA 5A2MH 3O8CA 1FAKH 4BAMB 3RXKA 3Q77A 5B6LA 1RTFB 1Z8GA 3BF6H 5B6OA 1HJ9A 1NFXA 2OXSA 1AE8H 5G4BA 1TRNA 2ZGXH 1KYNA 1ZZZA 2CMYA 1MKWK 4BNRA 1OXGA 2QAAA 2JDID 3HATH 4NSVA 1C2DA 2M2AA 1ID5H 1T8LA 1LDTT 2ZCLP 1O39A 5GJ4B 1C1UH 1E0FD 2ZF0H 4WH6A 1C1WH 3VXFH 3SV7A 3SV8A 1SC8U 3ATKA 4LK4A 3M7TA 2ZDVH 1VJAU 1C1VH 2ZFPH 2UUFB 1ZYOA 4B1TA 1ABJH 2Q6DA 1FDPA 4Q2KA 1NN6A 1P57B 2FM2A 2ZDNA 3IWMA 3O8BA 4JZEH 3BTDE 1PPGE 5EG4A 3M37A 5JYIA 4ABEA 3ZZAA 3WWFA 2G81E 1SLXB 1VKYA 5E0JA 5E0HA 1GJ8B 2FP7B 2FX4A 3A7TA 2VWOA 1LHGH 2BY7X 2VU8E 3LGUA 1GDNA 2G4TA 1PPBH 1UTLM 3S7HB 5T3HA 3SV2H 1K0HA 3I77A 1EJNA 2W6JD 4MVNA 1GPZA 2Y5HA 2Z3EA 5EXLA 4HZHA 3MO3A 2QF5A 1DWEH 1O3PB 3ZZ7A 2V3HH 3PTNA 3SZNA 4U30A
chains in the Genus database with same CATH topology
1SB1H 4ABGA 3FANA 1O3LA 2OUAA 3GYMA 1SGQE 2OINA 2ZFQH 4DT7B 1FLEE 2XCNA 2GGVB 2SGEE 3UIRA 2H6MA 2P93A 2QIQA 2V3OH 4RN6A 3V0XA 2ZQ1A 2ZDKA 3UOPA 4GUXA 1ABIH 1NROH 4A6LA 2J2UA 1IQHA 1HDTH 4X0WU 1W7GH 3CP7A 1C5NH 2ZFFH 4IMZA 2ODQA 3MWIU 3MO9A 3BN9A 1O3OA 2PR3A 5F6MA 1GBFA 1AIXH 1YPGH 3T29A 5CMXH 2FYQA 1ELVA 3LU9B 1B7XB 1O2SA 3P8FA 1Y3UA 4U01A 1W11U 1ZOMA 4ZHMU 5LGOA 1P12E 3P8OA 3LJJA 1GHXH 2EI6A 1UTQA 1GHBG 1B0FA 2BTCE 3RMOH 3G01A 1QJ6B 1TALA 3LH1A 1G2MA 1TGBA 3TITA 1BTXA 5CHAC 4Y8YA 2G55A 1C5UA 5HXFA 1HAIH 1YPMH 4Y0YE 1GMDF 3SGAE 2VVUA 3M7UA 1RRKA 3FZDA 3BG8A 1V6DA 4B2CA 1SQAA 2OP9A 3A8BA 1PPEE 5DP4A 3MI4A 4UDWH 2DUCA 1GG6C 1RD3B 1O2YA 4JYVH 4THNH 3RP2A 1C5YB 1BTYA 1E37B 1HAVB 4UONA 1TIOA 4I8LA 1CQQA 1S81A 1Q31A 2A5AA 5EXNA 4JMYA 2BVXH 1XXDA 2WYJA 4OS7A 2QXHA 1GI3A 3GY2A 1XKBC 1GBTA 1BTUA 1BBRE 1BA8B 3MH7A 1UTNA 2ODPA 1JRSA 1QL8A 4ABFA 3UNRA 1BTZA 2R2WU 1CT2E 3UPEA 3S9CA 1W2KH 3RC4A 1C5VA 4FUCA 3QDZB 3VGCB 1L4DA 1EP5A 1PQ7A 1GHWH 1O31A 1GJ5H 1IAUA 4ABBA 1EP6A 2ZIQH 1UVPA 2B8OH 2VINA 3GY7A 2VJ1A 1ELTA 2EC9H 3MNCA 1TWXB 2HWLB 2RA0A 4DG4A 3PLPA 5AFYH 1IQFA 5A0BA 2QCYA 1W0ZU 1CBWC 5T6GA 4DIIH 1EB2A 1E34B 1KY9A 3GCNA 1QR3E 3M3SA 4ABJA 3UUZA 1AFQC 1ZPZA 1F0RA 1ZJKA 2AS9A 3E0PB 1BB0B 3FZZA 1O35A 1YC0A 3LIWA 1F5KU 1O2MA 3KCGH 2PW8H 3GDVA 4ASHA 2VGCC 2ZFSA 1C2IA 2GVFA 3SU0A 2ZFRH 3ZZDA 2ZDMA 2FOBA 1SMFE 2ZG0H 2BD5A 1HAOH 1CA0B 1DSUA 1QURH 2OTVA 4KELA 5DGJA 5FPSA 3E6PH 3OU0A 4I32A 4JK5A 1FV9A 2STBE 4DVAU 1SI5H 1XXFA 2BY9X 4YT7H 3ZVAA 2OD3B 1RJXB 3KHVA 4ZMAH 3BSQA 1F5LA 4I7YH 1GL1A 2FLRH 5FCKA 3Q76A 3RXIA 3A87A 1V2VT 5EPYA 2I6SA 3OY5U 3PLKA 1KXDA 3SQHE 3UR9A 2FLBH 2QGRA 2R0KA 1ARCA 4JZIA 2XWBI 3SJIA 3RM2H 3SUEA 1O5FH 1VGCC 1QJ1B 3LH3A 1TA6A 2CXVA 2PSYA 3UREA 1P2NA 4NIWA 1GCDA 1QA7A 1A7SA 1BQYA 1K1PA 3K2UA 1TFXA 1QGFA 1S82A 2VIDA 1DS2E 1ACBE 1DOJA 1J15A 1OWIA 1MCTA 3MH6A 4TPIZ 1GVKB 4NA7A 4KTUA 3SJ8A 4ISLA 1LO6A 3A8AA 1BTPA 3RMNH 1EJAA 4I8KA 3JZ2B 1ETSH 3MHWU 1P04A 5JBBS 1NRNH 1LKAA 6ESTA 2ZHWH 4CR9A 1QY6A 2XTTB 2ZHFH 4GPGA 1GGDB 4DW2U 5EW1H 2ANMH 1WCZA 2GT8A 5EU8A 1WAYB 2Z9GA 1K1MA 5ESBA 1FONA 1HNEE 1SLVB 3KQEA 3BTEE 1QL7A 1GVZA 1RIWB 1O2GH 2V6NA 3U8OH 8KME2 3SU2A 3QX5H 3U8RH 3UY9A 2ZDAH 4TWWA 1K2I1 1UVTH 4X2YA 1BHXB 3S7KB 3IITA 3BTTE 3FP8E 3TVJB 3T2NA 1K1JA 2DE8A 2Y6TA 3EDXB 5EW2H 1ANCA 1Y8TA 1ZMLA 3M5NA 4FUHA 1C5LH 1TRYA 4HGCA 3LGYA 1SGPE 2CF9H 1TONA 4LZ4B 1H9IE 1V2QT 4U2WA 1A5IA 3DFLA 2W26A 5FCRA 4CRDA 1J8AA 2C8XB 3SQEE 4FUBA 2P3FH 5PTPA 1TLDA 5HGGA 1GBAA 4KGAA 4A1VA 1JIRA 2BX4A 3GCHC 1A0HB 2AGEX 1BJUA 3RM0H 2ZP0H 1YLCA 3D49H 4KKDA 1ZHMA 5C1UA 1TQ0B 1ZMJA 2PUQH 3T26A 5IYTA 2STAE 2TPIZ 3A8CA 4X8VH 4U32A 1TPAE 1WBGB 3SU4A 2XC4A 3T27A 3SOSA 2ZTXA 4JZ1A 4Q7ZA 3FAOA 3M5OA 1TMBH 2GTBA 4ZH8A 1L1NA 1GI0A 1AO5A 1GCTB 1UTPA 1YPHC 1OS8A 4AFUA 5DPAA 2AH4X 2ZCKP 4DURA 1XM1A 2ZC9H 1N1LA 1D3DB 1O2ZA 3A88A 4ISNA 1YF4A 1FY8E 2OQ5A 1BOQA 2GCTC 1V2ST 4MLFB 4YLUA 3U98H 5A8YA 1VZQH 1IQGA 2BX3A 1BRUP 3ATIA 1SOZA 1SGIB 1P2QA 2JETC 3SORA 1ESBA 1GI2A 2Y5FA 3AAVA 1SGCA 3VB6A 4SGAE 1QB9A 3LGVA 5SGAE 2GDDA 3MYWA 1HAZB 3H7OA 4NFFA 1SGYE 3AW1A 3SGBE 1EPTC 1K9OE 1NRQH 3K6YA 3MNBA 4CHAC 2AMDA 5AFZH 3PMJA 1PJPA 4NIXA 1QTFA 2FDAA 1F0UA 1NRSH 2BM2A 1KTSB 2BD2A 3MU5A 1LHEH 3V13A 1YCPH 3PV4A 1E35B 2ASUB 1O3KA 1EAWA 1D4PB 2NWNA 2Z94A 7GCHF 1V2KT 1HRTH 2ZEBA 3F9HA 1ZTLA 1LHFH 2IN2A 4GHQA 1PPHE 1DITH 1Y3WA 5HM9A 1GMDG 1AKSB 2W3IA 3QUMP 1O5DH 4BAOB 2FX6A 3R0FA 1GBLA 1GVLA 3UNQA 3MFJA 4CH2B 5FBEA 4LOYH 4UE7H 1FI8A 2BQWB 1T8OA 2XW9A 1O2XA 1EATA 5EQSA 1A46H 1LVYA 4IC6A 1AHTH 1ORFA 3RU4T 1SGDE 1O2LA 5ABWA 2A4GA 3K9XB 4K1SA 3BTQE 2BQ7B 2CHAC 4D9RA 1FUJA 1C5QA 3SO3A 3AVZA 2FYRA 4Y10E 2A7HA 1AZ8A 1KXCA 5BPEA 1EB1H 2J9NA 2ZECA 3OX7U 4JYUH 1BTHH 1GBCA 2FXRA 1DUEA 3MOCA 2XNIA 4NZLA 2TGAA 1F7ZA 5GXPA 4ISOA 2ALVA 4MQAA 3QTVH 1O2JA 4TY7A 4XBBA 3SN8A 1DLKB 1GI9B 3QZQA 1TRMA 2Q6FA 3N7OA 2FMJA 2ZDLA 1AKSA 5C5NA 1HAPH 1UVOA 3TJOA 1WUNH 2HPQH 1P3EA 2ANWA 5EPNA 4BAKB 1HXFH 2QN5T 3A7ZA 3QK1A 2XRCA 1ZGIA 2UWLA 2W7SA 3LC5A 3CENA 3UTUH 4ABIA 2D2DA 4D76A 1P03A 3FP6E 1C9PA 4MDSA 4YOIA 1DICA 1XMNB 1H1BA 5LPFA 4NCYA 1Z1JA 4X1SU 4X8TH 1GJ6A 1T8MA 2V0BA 3BTKE 2UWOA 4D7FA 1C5XB 5C5OA 4WY3A 2WV4A 4AGKA 4IMQA 1IQJA 3RXDA 1AD8H 1C5RA 1C4V2 1BDAA 1ELBA 4H42U 1MTSA 1QBNA 1TPSA 3TGIE 2GMTB 2RA3A 1ZRKA 2BQ6B 3UNSA 1YPKH 1MU6B 4X6MA 2HRVA 3P8NA 3GY5A 2ZWLH 1Z8IB 3P70B 2BMGB 4B76A 2GZ9A 1O2KA 1PQ8A 3KQDA 1B0EA 2Q1JA 1LPKB 1TGSZ 2H1UA 2O8UA 5C1XA 5FX5A 4K8YA 1ETRH 5GDSH 4BAHB 1EZUC 2HOBA 2THFB 1HUTH 1HJAB 5DP8A 3TK5A 1GBBA 1QBVH 2BDYA 4Y7BA 2Z9KA 3NKKA 1FY1A 4RKOB 3PO1B 1IQEA 6GCHF 1V2PT 1EASA 3E1XB 5ETXA 1UK2A 1TNKA 1YCPK 1GBDA 2A2XH 2ILNA 1P09A 1TBRH 1W3CA 3KQBA 3PTBA 4FUJA 5CHAB 3W94A 2VB0A 2ZI2H 1GI5A 1ZHRA 4DJZB 2ZTZA 1KLIH 2OBOA 4A1TA 1A2CH 3E90B 1W14U 1U6QA 3SNCA 1S0QA 3D23A 2A5IA 1ANBA 3ITIA 3CS7A 1GBJA 1O33A 2YNBA 1GHVH 3GY8A 1V2RT 2J95A 2D1JA 2B0FA 2FOEA 4Y6DA 3L6PA 3HKIB 2BLOA 1MBQA 4YO9A 1BT7A 4K5ZA 4K8BA 6CHAC 2CGAA 1NM6A 2XXLA 3T62A 4DCDA 1P06A 4MPUA 1DSTA 3E3TA 3P95A 1T7CA 3LGTA 4E7RG 1RS0A 3ZYEA 4YT6H 2BD4A 4O03A 1NY22 4FUIA 2SGPE 3M7QA 1MTNB 3VB3A 2UUYA 1GHYH 5L6NH 3RXOA 3SBKA 3VB7A 1QL9A 1D6WA 1O3EA 3F1SB 3D62A 5C20A 2P59A 2O8LA 1P2IA 1HIAB 1RTKA 1BUIA 2FI4E 1ELEE 3DFJA 4VGCB 1NT1A 2PUXB 3E0NB 3RXQA 4DIHH 3PMAB 4GSOA 2ZO3H 1C2LA 4ZXYH 2ZTYA 1O30A 3A80A 2GT7A 3PLBA 2ZFTA 4AFZA 4KP0A 5DP5A 1T31A 4Q7XA 1EAIA 3LGIA 1EAXA 3RMMH 1TNGA 4JZDH 2F9OA 3RU4D 2HALA 1VJ9U 1IQNA 1O2RA 1MQ5A 2VGCB 1UCYH 1BRCE 1C4Y2 1D3PB 1Z8RA 5I25A 4ESTE 2VIWA 5FAHA 2UUJB 3E91A 4IC5A 1SSXA 1GI4A 2P8OB 3TH2H 1GBIA 3ATWA 2BLVA 1W12U 3MNXA 3KQCA 1P8VC 4I8JA 1P2JA 4OS2A 4KTSA 3TGJE 4YZUA 1G30B 3BTGE 1P02A 3V3MA 2F9VA 2A32A 1GBEA 2XBVA 3RXUA 2TRMA 1TX8A 4AZ2B 4ZXXH 1TGNA 1TE0A 3SU6A 1VITF 3BTHE 1ELFA 2GD4B 3F9EA 1AVXA 1QB1A 3EGKH 3TH4H 4BOHA 2QYIA 2HNTF 3SJOA 1C1QA 2A4OA 3FP7E 1NESE 2PWXA 2YOLA 2R3YA 3BIVH 1THSH 4X1QU 1G3BA 4AGJA 2GDEH 4BXWA 1ZPBA 2FOAA 1C2JA 2LPRA 2SFAA 3VB4A 2OC0A 1CO7E 3VB5A 1DANH 1KLJH 3TJVA 3KN2A 1O2OA 1GHAF 1C9TA 3SUGA 5L2ZH 4AYYB 3GY6A 4NA8A 1NS3A 1Z1IA 1O34A 4ZKNU 4ZKSU 1K22H 1THRH 1G3EA 1MTUA 1S85A 2F9PA 1KIGH 1AFEH 3KEEA 1HAVA 2PFEA 1K1OA 2JH0D 3F6UH 2BOHB 4WF8A 2WYGA 2VNTA 3BG4C 3GDSA 1Z8JB 1O38A 4M7GA 2BD9A 1WQSA 7GCHG 1O5CB 3T5FH 1A5HA 2R3UA 1AZZA 1HV7A 4IS5A 1LCYA 4X6NA 4Q80A 4FUDA 1AWFH 4K69A 1TNHA 1X7AC 3B23B 3OSYA 2C93B 2ZQ2A 2P16A 1ANEA 3U1JB 5FBIA 3D65E 1IQLA 2PKSB 1TPPA 5EOKA 1NFWA 5C3NA 3ZYDA 1QQ4A 2J34A 3NPSA 1BIOA 4O3TA 1AQ7A 2F9BH 3PYHA 5DK1A 1Y59T 1S6FA 3NUMA 4K2YA 2ZU5A 1MKXH 2BY6X 3STIA 3ZZCA 4D7GA 2BB4A 2EEKA 2ZKSA 4ISHH 3ZVBA 4FUEA 1LVBA 2HLCA 1BRAA 1Q3XA 1C1RA 3KF2A 1EOJA 1GHZA 2EI7A 3BV9B 3DHKH 2ZGBH 1ANDA 1MMJN 3ZZ6A 3TK9A 1CGIE 1AU8A 2FOCA 1JWTA 1O3CA 1FIZA 3S69A 2GZ7A 4JCNA 3VGCC 4Y7AA 3BTWE 4MPXA 2J92A 2AERH 8LPRA 5FHTA 2Y5GA 1V2JT 1O3NA 1NO9H 1SGTA 1W10U 1UVUH 1Q2WA 3SHAH 3ELAH 1DVAH 1UCYK 1UTOA 2QY0B 2XWAA 4X1NU 2AMPA 1KXFA 5E2PA 2ODYB 1TGCA 1IQIA 2BVSH 2XBXA 1ELGA 3RLYH 4ABHA 2HNTC 4INKA 2SGFE 1Y3VA 2F3CE 5DKMA 1QIXB 5JPMH 4X2VA 5AHGH 4WJG2 2Z6BD 4CH8B 4GVUA 3TGKE 2OC7A 4Y76A 2NU1E 2JH5D 3IG6B 4GCHF 1HAXB 1CHGA 3RLWH 1C2HA 5CE1A 1O3MA 3SW2B 2FO9A 3S9BA 2CF8H 3TNSA 1FN6A 1ZRBA 4Y11E 1HGTH 4Z0KA 4AFSA 1G36A 3P6ZB 4WH8A 5EQQA 1SPJA 2A1DB 1FY5A 4YTAA 1H4WA 2BVRH 1FQ3A 1UO6A 1FIWA 5K7RA 3L33A 3KIDU 3LONA 1GWAA 2WPJS 1CA0C 1Z6EA 4JK6A 5JBTA 4RKJB 2PSXA 3ZVFA 1V2UT 1DY9A 2OCVB 1MTVA 1HBTH 1QHRB 3SU3A 2G4UA 2H9EH 1C5OH 8ESTE 4X6PA 2Y7ZA 2SNVA 2PV9B 6GCHG 1DFPA 1SVPA 3P8GA 4AB9A 1MAXA 3NZIA 2Y81A 3MO6A 1JMOH 4FU9A 2SNWA 1TMUH 1P01A 1GJ7B 3ZZ9A 1BITA 2IPHA 2H2ZA 3CS0A 1MCVA 1QRXA 1MU8B 1A4WH 1AY6H 1C5ZB 7ESTE 2AEIH 1VITH 1PQAA 1EZSC 5DP7A 3E8LA 4ZAEA 2LNCA 3EE0B 1INCA 4O97A 1MBMA 2OLGA 5FPTA 4A92A 2FS9A 1ELCA 2R2MB 3QWCH 1HJ8A 1LVOA 2Q6GA 1N8OC 3KGPA 2Z3DA 3U1IB 3UWIA 5HMAA 2WV5A 1O2IA 2CV3A 3GYLB 1CVWH 2FOMB