1HIAA

Kallikrein complexed with hirustasin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
80
Chain Sequence
IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (protease/inhibitor)
molecule keywords KALLIKREIN
publication title A new structural class of serine protease inhibitors revealed by the structure of the hirustasin-kallikrein complex.
pubmed doi rcsb
source organism Sus scrofa
total genus 11
structure length 80
sequence length 80
chains with identical sequence X
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1996-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hiaA00
1O5CB 1TALA 1OP2A 2BLQA 2ZP0H 3KN2A 3A83A 3MU4A 3R0FA 1P9UA 1UTJA 1ZZZA 5T6DA 1MD8A 3D49H 3UOPA 4ZAEA 1EKBB 1C1PA 1TNKA 4A5TS 4B74A 5C5NA 3H5CB 4I7YH 1SGEE 2Y5GA 5EU8A 1PPGE 2PKAB 4D9QA 4U01A 5EXMA 3GY7A 1L2EA 3SZNA 3TGJE 1TB6H 3GYLB 1PPCE 1S84A 1GG6B 3MTYA 1Y5BT 1XUGA 2CJIA 2NU3E 4I8LA 2P93A 3ENSB 2A2XH 2YOLA 4AB9A 3F1SB 2FYQA 3PYHA 3PMAB 1WUNH 2P3TB 4O3UA 3EE0B 1GGDB 4DVAU 2C93B 1OWDA 2VWNA 5FX5A 2AGEX 1P01A 5HGGA 1GMDF 3PMJA 2VVUA 1KLTA 4X2VA 1SHHB 3VB7A 1SFQB 2SNVA 2QF3A 1GVKB 2G81E 1T8LA 3N7OA 1GG6C 1EXFA 3A8DA 2R0LA 2C90B 3ZVGA 1UHBB 1IQEA 2ZFQH 3V13A 1W10U 3GDVA 4IN2A 2OC0A 1QNJA 2OCVB 2VIQA 3F9HA 4K8YA 3LKWA 2PTCE 1AZ8A 1CHGA 4ASHA 1B0EA 3B23B 1GGDC 2AMPA 1GBDA 2O8UA 1SGQE 3U1IB 3OTJE 1SGPE 1GCTB 3PMHB 1M9UA 1MKWK 2PGBB 3TH2H 2Z6BD 1V2OT 4YOIA 1DLKB 4E7RG 1Q31A 5ESTE 1G32B 1CGIE 1QQ4A 1UO6A 1CHOG 4Y8ZA 2UWOA 4XDEA 3SOSA 3QLPH 5HMAA 4CRDA 1SOTA 1MKXK 1TMUH 1A61H 1L4ZA 1TLDA 4KELA 2JH0D 3A7ZA 2Y7ZA 3ATIA 5A8ZA 1DPOA 2XRCA 3GYMA 1MZDA 1O3IA 1XX9A 3FZDA 3M7QA 1Z8RA 3LH3A 2GV6A 1XXDA 1CA0B 4ZH8A 1GJAB 2D8WA 3RC6A 1HAPH 3SJOA 3MU1A 1CGHA 2EC9H 5FCRA 5A2MH 3A7YA 4Q7ZA 1TABE 1C5UA 3ZZBA 3RXUA 1DVAH 1ZTLA 2QYIA 3HPTB 1S5SA 3ATKA 1ZTJA 1XUJA 3KQBA 3RU4D 3BTWE 5A09A 1W2KH 1Y3XA 1KXBA 1LQDB 2A4QA 5DP9A 1OKXA 2F91A 1DSTA 1SQOA 2XYAA 1C5LH 5J4SA 2C3SA 1AWFH 1Y3WA 4ESTE 2H1UA 1ACBE 1YPMH 5K7RA 1SHYA 4NA8A 1H8DH 2ZHFH 2FOMB 1A4WH 1XKAC 1SVPA 1AKSB 1A3BH 1YPHC 4OS2A 2QN5T 2B0FA 5FXLA 3GDUA 2QF0A 4BXWA 4YT6H 2OLGA 5EW2H 2ZHDA 1OWJA 1DUAA 1C9TA 3DUXH 2SGDE 5C2ZA 5JBCS 3BTHE 2ZIQH 1SLUB 2ODPA 5C20A 3KEEA 1C2DA 3RC5A 2ZQ1A 1O3CA 1TE0A 1YBWA 3ZZDA 2GGVB 2KAIB 4Y0ZE 3T62A 4E05H 4H6TA 2UUFB 1RIWB 3FFGA 2OC7A 3E0PB 4Q80A 2FZZA 5GCHG 1W7GH 1GI5A 5E8EH 1HAVB 3MNCA 1Y3YA 2R2MB 1UK3A 2FIRH 4ZUHA 1GJ7B 4AB8A 1BIOA 1EOJA 2ZFRH 3D62A 1ANDA 2BDAA 3P8GA 3KHVA 1DDJA 1AUTC 2CGAA 4X6OA 2VIOA 3K9XB 1LHGH 1ZRKA 5FBEA 2SFAA 1P2NA 1DS2E 1PFXC 1C2FA 1W3CA 4ZKNU 2P3FH 6GCHG 4Y8YA 4A1VA 1MKWH 5FPTA 3JZ1B 1VGCB 3A84A 1OWKA 4FU7A 1C2HA 1O2PA 3VGCC 1V2WT 1SG8B 5JYIA 1F7ZA 1BTHH 1ARCA 1ESAA 2J92A 3SQHE 1YM0A 3ZZ7A 8GCHG 3NKKA 3F68H 3UNSA 1MKXH 3A87A 1W13U 4AX9H 1GHZA 1ZMNA 5E0JA 3SU5A 1C1WH 4K1TA 2W5EA 4BTUB 3QUMP 4DOQA 1P3CA 3OYPA 1GJCB 5PTPA 4CR5A 1XXFA 3AW1A 4CHAB 2ZDAH 1O2MA 2VINA 4F49A 4UFEH 1EB1H 2K1QA 2A31A 1GI6A 1ELDE 2PKSB 1MAYA 3LGTA 2JETB 1F92A 1ZSJA 4H6SB 5J4QA 1O3JA 2Q6FA 4IW4E 1Y3VA 5L30H 4JZIA 4F4OC 2XBVA 3PLKA 3VEQB 3V7TA 5F8ZA 1TGTA 1J17T 1DICA 2WPLS 2GT7A 1AU8A 4UE7H 2R3YA 4JZFH 1C5XB 2BMGB 2THFB 1PPFE 3DT0H 3BEFB 1D3PB 2TPIZ 4IMZA 4LZ4B 3I77A 5EGMA 1H8IH 1CHOF 1K1OA 1S6HA 1P11E 2HOBA 4NGAH 1CGJE 4ISNA 5JDUB 1LO6A 1VCPA 4JCNA 4CBNA 2XW9A 3PO1B 3QTOH 3QGNB 1JRSA 1O3GA 1QGFA 3ZYEA 3RXOA 2A4RA 1ZGIA 2UUJB 3U9AH 4AOQA 1YLCA 2XNIA 1GDQA 3G01A 3ATMA 2AFQB 1P06A 2CHAB 4UONA 4RSPA 3T26A 2RDLA 2ZO3H 1O0DH 3LU9B 4LK4A 1FXYA 1KLJH 4AGKA 3UR9A 3HK6B 2FLRH 3UNQA 2UWLA 1WSSH 3BTTE 1JIMA 1RJXB 1HXEH 1DWDH 1GHBF 4D9RA 2BXUH 4UEHH 5GPIB 1O2HA 1PQAA 1BMMH 3RU4E 4E06H 5DKMA 5TJXA 1HAZB 2H9TH 1O33A 3R3GB 1O37A 5HM2A 1KTSB 2CHAC 3SV6A 5E2PA 2R0KA 3NPSA 1A0JA 1F0SA 2UUYA 3P17H 3KL6A 2XBWA 1EAWA 5T3HA 4AFZA 3IWMA 1C5OH 3SUGA 1TGBA 1DFPA 3O8CA 3UR6A 2Z9KA 1P10A 1PPZA 1WQSA 1O3PB 3NCLA 2BD9A 4ISHH 3A86A 3BF6H 2ZTXA 4YO9A 1WTHD 2PLXA 3L3TA 5GCHF 3M5LA 1NPMA 2Z3DA 4OS6A 2NU2E 4DJZB 1FLEE 2FI5E 2A2QH 3EA7A 1BZXE 3LC3A 2VWMA 1GI9B 1WU1A 4BAOB 2BLVA 4K1EA 4ZKOU 1ID5H 3MU0A 1ETTH 2HGTH 5IYTA 3TJUA 2Y6TA 4U32A 2F9OA 2GV7A 1RTKA 1ETSH 4LZ1H 4CH8B 1D9IA 3BG8A 1DWBH 3K6ZA 5EG4A 5JBAS 6GCHF 1P02A 3UNRA 2XBXA 4TPYA 4DIHH 1FUJA 1AQ7A 3SU1A 1FJSA 2FOGA 2FM2A 1QJ1B 2ZGBH 8GCHF 4FUJA 3RMNH 1OWHA 2FS9A 1F0UA 2FODA 1BRAA 1GBEA 3K65B 3PV4A 3M5NA 1MTSA 2VJ1A 4ABJA 1VJ9U 2M5TA 2YNBA 2VIDA 3MOCA 1UVTH 2AIPA 2BDYA 1F5RA 1UVOA 1C5TA 1Y8TA 1FQ3A 5FCKA 1YP9A 4AORA 3VXEH 3P6ZB 3MYWA 1G3CA 4ISLA 1ORFA 2J4IA 4XBCA 1AMHA 2Z9IA 3E0NB 3ZV8A 3VB4A 2ZU2A 1Z1IA 1E38B 1QTFA 3HGNA 1NTPA 2FI4E 3S9CA 1HLTH 5EXLA 3EQ0H 3TNSA 1HJAC 2CXVA 4GLYA 2G4TA 1Z8IB 3M35A 1P2QA 1JMOH 1KDQA 1DWEH 4B1TA 3C1KA 3S9AA 2A4OA 2ZDKA 4Y7AA 2BDCA 4UD9H 2EA3A 3NXPA 3MNSA 1O31A 1G2LA 3RUOA 1RXPA 1MTVA 3ODFA 1TBRH 3TIUA 2F9NA 3GCTG 2A7CA 3SV9A 4Q2KA 1ZJDA 1D6WA 1UCYK 1V2JT 4X8SH 1ANEA 4TWWA 1GJ8B 2W7UA 1SC8U 4Y79A 1AGJA 3RXGA 9ESTA 2J34A 1QBOA 2VIPA 1SLXB 1QB9A 2WYGA 1O2RA 2XXLA 4WY3A 1MCTA 2ZFSA 3LONA 1AB9B 4ZXYH 1O2VA 1GHXH 1WOFA 3URCA 1PQ8A 1O35A 1J9CH 3U1JB 3NZIA 4MTBA 4UFFH 1DUEA 1UTMA 3TH4H 1FIZA 2FX6A 1C5YB 5JB9S 3ELAH 1YPHE 1Z8GA 5T6GA 1UVPA 2FOFA 1ELFA 3MU8A 3RLYH 2VB0A 3ZYDA 4NIXA 1O36A 4FVDA 2Y7XA 3SU2A 1YC0A 5DP3A 4ZHAA 3PTBA 3RXEA 1EZSC 1K1NA 4FUFA 4WWYA 1YCPK 1C9PA 5DP6A 1ZPCA 4IGDA 3ZVEA 2BQ7B 4FUIA 1GWAA 1NU7B 4B2CA 5EW1H 2Z3CA 4THNH 1OX1A 1YPEH 4NZQA 1V2LT 3VPKA 1N8OC 1QHRB 1C1TA 1NU9A 1ABIH 4HFPB 3SI4H 1QBVH 3B9FH 3RXVA 3MH5A 1H4WA 1G3EA 4JK6A 4FUCA 3NK8A 2G52A 3LJJA 4Y0YE 2V35A 2GMTC 3LT3A 2QGRA 2ZDVH 3IG6B 5F6MA 1AZZA 2A0QB 3SV2H 1V2KT 4DY7B 3SV8A 2P8OB 3GCHC 3OU0A 1D6RA 5HYOA 3MO3A 2FS8A 1W14U 1FPCH 1Z71A 3LGWA 1HAGE 1YGCH 3LGIA 2SNWA 2C8XB 2AYWA 2C8YB 5C1XA 2BY6X 2C8ZB 4WF8A 1G2MA 1L1GA 2OQUA 2ZGXH 2ZQ2A 1ZHPA 3LGVA 1VITG 5FHTA 2FOHA 2GZ8A 1XVMA 4FUHA 1TX8A 2ZHQH 1FN6A 2P8OC 1LVYA 3E3TA 1ARBA 3A82A 1J14A 1SLWB 2V0BA 3FP6E 1BQYA 4U2WA 1L4DA 4TWYA 3T29A 3VFEA 2XCFA 2HRVA 4JYTA 4KTSA 1SGTA 1P2OA 2VVCA 2J95A 4B75A 2ZCKP 3M61U 1IQHA 1UCYH 4JZ1A 5FPYA 1C1NA 2OUAA 1AN1E 3T2NA 4ZKSU 4AYVB 2QAAA 2ZHEH 1A0HB 2GCTC 1T4VH 5HXFA 1G37A 2PW8H 1ZR0A 1UTKA 2BVSH 3SU3A 2WUCA 3UOUA 3V3MA 4IN1A 5C1UA 3RXQA 1IQNA 1BBRK 1NY22 1BBRE 3RXJA 1FZZA 2Z9JA 1NFWA 4OGXA 2IN2A 1QB1A 2EI7A 4ABAA 1C4Y2 4DW2U 1SGNE 2CV3A 2BLWA 4ABBA 1LKAA 4D76A 3SU4A 3SNBA 2FOAA 1SGIB 1DXWA 1GPZA 1B7XB 4X2WA 1YCPH 5CE1A 1S6FA 1T8OA 1MH0A 2BX4A 3SORA 1XKBC 1O3EA 5TCAA 1FAXA 1FAKH 2JH5D 3S7KB 3ZVDA 1GI3A 1GI0A 1TGSZ 1K1MA 4CR9A 1HYLA 2TGTA 3RXLA 2C4FH 1BUIA 3M3SA 3GCTF 3PLPA 2C8WB 1QBNA 2Q1JA 2ULLA 3ZZ8A 3CS0A 1ANCA 2ZA5A 3P92A 1H9LB 2H5CA 5I25A 3HGPA 3SU0A 4ABIA 1K1IA 1OWEA 2VIWA 4BAHB 3KF2A 1CBWB 1O3HA 1O2IA 3UY9A 3MNBA 3PLBA 1VCWA 3C27B 4X1NU 2LNCA 2AGGX 3UWJH 5GDSH 1HAOH 1O3OA 1W8BH 2VH6A 4OGYA 3IITA 3RXTA 5EQSA 3AW0A 1JXPA 5JBBS 1A7SA 1ESTA 1P12E 1MAXA 3RM0H 2F3CE 1GHBG 1O39A 1O2NA 3MO6A 1QB6A 1CQQA 1KSNA 4O97A 1W12U 1V2ST 2EI8A 1GVLA 3U8TH 4Y10E 3V12A 1SQTA 4UFDH 1LHFH 1LPZB 2BY7X 1UTPA 1P09A 1CBWC 1BRUP 1HIAB 3OX7U 1SOZA 1WTGH 3DFLA 4K8BA 3KQCA 1O32A 3RXSA 1RRKA 2XBYA 2ZCHP 1V2TT 1CE5A 1PPBH 2SGFE 1V3XA 1VITH 1YCPM 3A7WA 5DP7A 1K28D 5FX6A 3ESTA 2BB4A 4JYUH 3KCGH 1A5GH 1LDTT 4DG4A 3GY5A 1BT7A 3ZVCA 4XBDA 3QK1A 1ESBA 1QURH 3BTKE 2TIOA 3BTDE 3VB3A 2HNTE 1GBAA 3O8RA 4BXSA 3A8CA 3VGCB 1BTYA 5C5OA 3LGUA 1L0ZA 1D3QB 1BBRH 1SR5C 2PWXA 1OOKB 1UVUH 4MNWA 4VGCC 1NFUA 4Q7XA 2TGPZ 1AWHB 1G3BA 3BSQA 5G4BA 2ANYA 1EATA 3BEUA 1LHCH 1PPHE 1SMFE 2OBQA 5T6FA 4YTAA 2OTVA 3LJOA 1C2KA 1VITF 2NU4E 1UTNA 2VGCC 1P9SA 4YM9A 3A8BA 1MUEB 4O3TA 2FTLE 2D26C 1MU6B 4K1SA 1HJ8A 7ESTE 2FLBH 3EAJA 3PWBA 4MNYA 5EQRA 4X1SU 1E36B 2OINA 2A4GA 1NRQH 2F83A 3CS7A 3TGKE 2QV1A 4AZ2B 4I8GA 1A46H 3Q3KA 2FYRA 3KNXA 1AVWA 2Y82A 3GY3A 2ANWA 1TOMH 2G51A 1DM4B 4X8UH 3TK6A 4ZHLU 1O3MA 1GBIA 4BAMB 4GHQA 8LPRA 3A81A 1O5FH 4Y11E 4BAKB 2B8OH 2ZHWH 1WCZA 2ZCLP 1YPGH 4AGJA 1C2MA 1W7XH 1NM6A 2V3HH 3BTGE 1IHSH 1GCDA 3NUMA 2ZU1A 4K69A 1O2SA 3PMBB 2ZTZA 3KIDU 1PJPA 1ZJKA 3ZZ4A 1TX6A 2FOBA 1DSUA 5L2YH 3RXIA 4RKOB 1QFKH 2QXJA 5DJ7A 1TNGA 1LVBA 5A0BA 4DIIH 2WPMS 1AHTH 3FANA 2BVRH 4ZROA 3M7TA 1O5BB 1B0FA 1TA6A 4CRGA 1CT2E 1C2LA 1Z6JH 1HIAA 1THSH 1OP8A 1OWIA 1GI1A 1N6YA 1ELCA 1GJDB 2HPPH 5F8TA 2ZF0H 4Y76A 5JBTA 1C5NH 1K1JA 2BD2A 1C5PA 3RXRA 2ASUB 3TLOA 1WV7H 4MDSA 1H9HE 4HTCH 4MLFB 3A85A 2AMQA 2Q6GA 2Z94A 3U98H 1ZLRA 2VWLA 1T32A 1GBJA 4AG2A 5LPRA 3RXDA 1C2IA 1IOEA 3RXAA 4ABEA 1ZTKA 1AE8H 1NESE 2Z9LA 3RXPA 3BV9B 2AEIH 4KTUA 2GTBA 1MD7A 1TRNA 1GDNA 5EOKA 2STAE 3W95A 3RMLH 1EP5A 2R3UA 1PQ7A 3A88A 2DUCA 3SQEE 2SGAA 2STBE 3AAUA 3KQDA 2BVXH 2UWPA 2O8LA 3SW2B 2AH4X 7KMEH 3QO6A 1KDQB 3GY4A 1ZHMA 3RP2A 1HJ9A 1OXGA 1D3TB 3SN8A 2D2DA 5CHAC 2GP9B 1CT4E 2FP7B 1TGCA 1GHWH 1HAYB 2P94A 1YPKH 3TJVA 1TA2A 3LOXA 1THPB 3MH4A 4X2XA 2D1JA 5DP8A 1IQFA 2ZKSA 3BTQE 7GCHG 2A5KA 3DA9B 4K5ZA 3T25A 4BOHA 1E0FD 1HFDA 3SJKA 3TK9A 2HNTF 3TNTA 2ZU5A 8KME2 4XBBA 1PPEE 4ISIH 3ATLA 1TMBH 1RD3B 1O38A 1XUHA 3P8FA 1KXDA 4D7FA 3QN7A 1G3DA 2BY8X 1DX5M 3FP8E 1TOCB 1BJVA 1O2GH 1HPGA 2FOCA 1IHTH 1IQMA 2R9PA 4B2BA 1E35B 1HXFH 1C1MA 2H9EH 3HATH 1TBZH 5FBIA 1GVZA 1AFEH 2G55A 3QX5H 1GJ5H 4JYVH 1WQVH 2WPHS 2BD3A 2PFEA 2HNTC 3BIUH 1K22H 1TRMA 1O3AA 5GWZA 1S82A 5BRRE 1AIXH 1E34B 3FAOA 3SHAH 1THRH 3T28A 4GVUA 1EQ9A 1AD8H 3AVZA 3SI3H 3TVJB 3LPRA 4FXGH 1MCVA 2RG3A 1ABJH 1MQ6A 1ZYOA 2FX4A 2HWLB 3MMGA 1T8MA 2F9UA 2O8MA 3PB1E 5C1YA 3SJ8A 4WH6A 2FXRA 2HPQH 4WXIA 1QL7A 1F0RA 1GJ4H 1LCYA 3HKJB 4XSKU 4I8JA 3STIA 1MQ5A 1SB1H 1N1LA 4Y6DA 1HJAB 1JRTA 4WJG2 1SBWA 2ZDNA 1AFQC 3RXKA 1EB2A 4H4FA 2G5VA 2FOEA 3LIWA 2ANMH 4ABGA 3GOVB 1HGTH 4DGJA 1C5QA 6ESTA 1KTTB 1LKBA 1S85A 3E91A 1EJNA 1TNIA 1BCUH 4ZXXH 1UK4A 1QR3E 2A5AA 3E90B 3GISB 4GHTA 3E16B 1J8AA 1V2VT 1F0TA 1O2QA 2BOHB 5LPEA 5AHGH 1ZMJA 2FI3E 3FZZA 4LXBH 1P05A 4YLUA 3Q77A 3RXFA 2RCEA 2FWWA 1BTWA 3S69A 1VCQA 3H7OA 5JB8S 1RTFB 3LC5A 4X1RU 1QL9A 5ETXA 1EPTC 1NROH 4INKA 3I78A 3BG4C 3BN9A 1O2UA 1O5EH 1BTXA 1Y59T 4OS1A 2ZPQA 1TQ0B 3ITIA 1BOQA 1LTOA 1FDPA 1XM1A 3W94A 3TGIE 1IAUA 1P04A 4GAWA 1UCYE 4HZHA 1OP0A 1V2UT 3B8JA 2TGAA 3AASA 4D8NA 2IJOB 1O2JA 3K6YA 3O8DA 1NRNH 4NCYA 4ISOA 2XC5A 1FI8A 3RU4T 1NT1A 4R0IA 1NS3A 3QTVH 1KYNA 3JZ2B 3ZVBA 2A5IA 3P95A 1O2WA 4TPIZ 3QZRA 1N8OB 1XUIA 1TNHA 1CSOE 4MPVA 1IQIA 2PSXA 2OBOA 1QRZA 4X6NA 2GZ7A 2VVVA 2XC4A 2QY0B 1Y5AT 5EPYA 4YOJA 1O34A 1TPSA 1EJMA 1O2LA 2JH6D 3LGYA 3RM2H 1ZMLA 2I6SA 4Y71A 1HBTH 2GMTB 3MHWU 4Y7BA 1EAIA 2AGIX 4JK5A 3S0NA 3V0XA 1TFXA 1F2SE 1FY1A 4BAQB 1O3NA 3MU5A 3GCHB 3ZZ5A 5E2OA 4TY6A 1FIWA 4ZKRU 2ILNA 2BDBA 4RN6A 2BDIA 5DK1A 5A8YA 2BZ6H 3A7VA 4K3JA 4NIYA 1C5WB 1EASA 3ZZCA 5A8XA 2BDHA 3U8RH 1TMTH 2XWBI 5DGJA 2BD5A 7GCHF 2ALVA 4B71A 1T8NA 1SLVB 2O8TA 5DP5A 1TRYA 2SGPE 1Q3XA 1TX7A 3RDZA 1CVWH 1LQEA 2BY5X 4NSVA 3SU6A 1LPGB 3U8OH 2TRMA 1O5AB 3SV7A 3MH6A 2Z9GA 3ODDA 4BANB 4MNVA 3TU7H 2CF8H 5IDKA 1QIXB 1P57B 4NZLA 3I29A 4OS5A 2WV5A 2ZU4A 3SGAE 3SGQE 1ZRBA 4A92A 4KP0A 2BD7A 1YLDA 5ESBA 1VZQH 1QRXA 2CMYA 4MNXA 4I33A 1BHXF 5LH8A 1BHXB 1HB0B 3QWCH 1V2QT 1K9OE 2AMDA 1P3EA 1AI8H 1TPAE 2GCTB 1HAXB 4ZHMU 3A8AA 5JPMH 1Z6EA 1TPOA 3NWUA 1AE5A 4TY7A 2ESTE 2ODYB 1OSSA 2PGQB 2B9LA 1GI2A 2JKHA 3EDXB 2YNAA 4IS5A 4ABFA 1SL3A 4E7NA 2BTCE 1QL8A 1BDAA 5BPEA 4CH2B 1X7AC 4I32A 2QIQA 4NA9H 3SNEA 4M7GA 2PR3A 6CHAC 2OXSA 3VXFH 1V6DA 2TGDA 1MTUA 3OY5U 3SHCH 4GSOA 3UQVA 1O3LA 1GMHF 2FPZA 4YLQH 1OYTH 2ANKH 2G5NA 1INCA 2ZDLA 2W3KA 4AYYB 5GJ4B 1O2YA 4K2YA 2VU8E 1L1JA 3PROA 3F9EA 1O3BA 2PUQH 3RXCA 3TJOA 2W26A 1CA8B 4AG1A 4X1QU 2PUXB 1TONA 6LPRA 8ESTE 3FVFB 1UVSH 5AFZH 1SPJA 1FN8A 1C4U2 5EODA 1NRPH 1D3DB 2Y5HA 4B2AA 1ANBA 3CENA 5E0HA 1O2TA 2XCNA 2AERH 3PWCA 2P16A 4ABHA 4AFUA 3GCNA 3ATWA 3GDSA 1UTLM 4R8TB 5AFYH 1K1LA 3T5FH 3MFJA 4UFGH 1XMNB 2WINI 2O9QA 1HCGA 3QGJA 2QA9E 1BITA 4X6PA 4NIVA 1LVOA 1SSXA 1YYY1 2ZGHA 2BY9X 1Q2WA 3OY6U 1GBBA 1SGDE 1TYNA 4MPXA 2F9PA 1JBUH 1ZPZA 1EZQA 3BTFE 3K2UA 2HVXA 2BM2A 2FO9A 4I31A 1MZAA 3O8BA 1O3KA 3EGKH 1GL0E 1KXEA 3MH7A 5I46H 4OS4A 1GCTC 1NC6A 1HNEE 1O3FA 4NA7A 4WMEA 1OS8A 4IBLH 2GDDA 2WPJS 1C2JA 3M3TA 4FUDA 1FMGA 1FNIA 1TQ7B 4XE4A 4J1YA 1SI5H 3SJIA 1C1VH 4NFFA 2GX4A 1TBQH 3UTUH 1K1PA 1AY6H 2BX3A 1GBFA 4MVNA 1F5LA 4D7GA 1C1QA 1SGFG 4VGCB 1G9IE 1NRRH 3TPIZ 1SFIA 3MWIU 1CA0C 1KXCA 1DOJA 1O2XA 1S81A 1C2EA 1P03A 2PKAA 4NSYA 3RLWH 1NN6A 3UIRA 1EAUA 1ELBA 1IQKA 4TYDA 1G36A 4NG9H 2GCHF 2VGCB 1TIOA 1HAIH 3PTNA 3Q00A 1AO5A 3MI4A 1BA8B 5DPAA 4AN7A 1H9IE 5H4IB 7LPRA 3D23A 2NWNA 3A7TA 1V2NT 2OC1A 4CBOA 3KQEA 2FESH 1ELAA 3A7XA 2H6MA 1J16A 2VWOA 2H9HA 3BTME 1C1UH 1VJAU 1W0YH 5GIBA 2AS9A 2B7DH 4GCHG 3F6UH 1HV7A 1TGNA 1GHVH 4JZDH 1GL1A 3H7TA 4MPUA 3M37A 1G30B 4LOYH 1YPJH 3ZZAA 1GMCG 1UHBA 2QCYA 3SGBE 1P2JA 3RC4A 4INHA 1FONA 4U30A 1F5KU 2J94A 3UFAA 3DFJA 3ZV9A 2NU1E 5B6OA 2R2WU 3SNCA 1NZQH 1CO7E 1FY5A 1N6XA 3RXMA 1MBQA 3ZVFA 1V2PT 1RIWC 1DT2A 2BLOA 3S7HB 3P70B 1V2RT 2ZU3A 3FP7E 1B5GH 2ZC9H 1L1NA 1QJ6B 1E37B 3SBKA 1RGQA 5F8XA 1HRTH 2GKVE 2J2UA 1BJUA 4WMDA 1VR1H 3DHKH 1EJAA 2EI6A 1SGRE 1TWXB 3T27A 2GD4B 4CRAA 3S9BA 2LPRA 4WH8A 5LPFA 5EPNA 3KGPA 1O2ZA 1KXFA 3M7UA 4JMYA 2DE8A 2F9VA 4WMFA 1LPKB 5EQQA 9LPRA 2QXHA 4YOGA 4Y8XA 4A1TA 2WYJA 1U6QA 1JOUB 2O8WA 4IMQA 3MO9A 3D65E 1LHDH 3SNAA 1EZUC 1VGCC 1A5IA 2Q6DA 5HM9A 2EEKA 2PHBA 1GI4A 5DO4H 4HI3A 3F9GA 1GBCA 2ALPA 2NU0E 1FY8E 5DG6A 1OYQA 4IC5A 3E1XB 1BRCE 3U69H 2ZI2H 1KY9A 3UPEA 1DXPA 4DCDA 3EA8A 1UK2A 1NO9H 2WPIS 1BTPA 1BMLA 4YESB 3HK3B 4Q7YA 5L2ZH 4JZEH 4CHAC 3GY6A 1S83A 1WBGB 1AKSA 2PTNA 1RFNA 2FMJA 5CHAB 3A80A 1AVXA 3GY8A 4NFEA 2PKSC 1C4V2 1O5DH 4X0WU 2JETC 1RS0A 1CU1A 2GVFA 1YF4A 4GPGA 4XOJA 1QA0A 2OQ5A 4IC6A 3P8NA 1KXAA 1PYTC 4A1XA 1MMJN 1O2KA 3P8OA 2HALA 1BMAA 4BTIB 1SGCA 3SUEA 2OD3B 5A0CA 1C5ZB 1MTNB 2KAIA 3STJA 1DE7H 1MTWA 2XWAA 5TCCA 3A89A 3L6PA 3RXHA 3UQOA 1DANH 1TNJA 1NRSH 1HAVA 1DY8A 1JIRA 1UTQA 1FY3A 1W0ZU 1P8VC 2RA3A 1EAXA 4FUEA 4X1PU 4A6LA 4DURA 4I8KA 3OSYA 3DD2H 3PO1C 1HUTH 1GHAG 1FY4A 5ABWA 1GJ9B 3Q76A 2ZPSA 5CMXH 2TBSA 4HGCA 4X6MA 3LH1A 1EX3A 2SGEE 2G00A 2P3UB 1MBMA 1T4UH 1MTNC 5L6NH 3GCOA 2FTMA 5GXPA 1ZSKA 2GT8A 4FUBA 4INLA 1KIGH 4X8TH 1DWCH 5FPSA 2ZFFH 4H42U 4MQAA 4CRFA 2BD4A 1IQLA 2W7SA 1K21H 3MNXA 2BQ6B 4KKDA 1T31A 1P2KA 1EZXC 2DE9A 5K0HA 1A3EH 2A1DB 3SUDA 4SGAE 1YPLH 1ZGVA 1V2MT 4Z6AH 1C1SA 1ELGA 1UJ1A 1GDUA 2Y81A 1BMNH 4PROA 4BNRA 1EOLA 1HAHH 1QQUA 2PSYA 1BRBE 2ZPRA 1GHYH 2J9NA 4GCHF 3M36A 1FV9A 1UTOA 3TK5A 1NFXA 2CF9H 1AFQB 4CRBA 5FAHA 1A5HA 1ELEE 4DT7B 4X2YA 1GMCF 5C67A 1ZHRA 1OPHB 2ZWLH 1NFYA 1GJ6A 4UDWH 3WY8A 1GI8B 1DITH 3BEIB 1QCPA 5C3NA 1Z7KA 1IQGA 2ZECA 3EYDA 2IPHA 1CT0E 3ZZ3A 4RKJB 1JWTA 4YT7H 2BHGA 4WXVA 2AIQA 3URDA 1GBHA 3TJNA 4O03A 4X8VH 5EXNA 1O2OA 2ZDMA 4NIWA 4FU9A 3AAVA 4O9VA 4CRCA 2WUBA 1UMAH 1GI7B 2ZNKH 2QC2A 2A45B 4CREA 1DLEA 1WYKA 1GMHG 1GBTA 1EPTB 1GBMA 1ZOMA 1Y3UA 3RMMH 3BG4B 4SGBE 2BYAX 2Z7FE 1XUKA 5DP4A 1W11U 2GZ9A 1GBLA 1HDTH 1BTUA 2QXIA 4WVPE 1QY6A 1EUFA 4KTCA 1C2GA 1GMDG 4B76A 2F9BH 1ETRH 1O30A 1S0QA 1TNLA 2RA0A 3CP7A 1IQJA 3TH3H 3VB6A 2XC0A 4A7IB 2ODQA 3M5MA 1D4PB 2H2ZA 2OC8A 1PYTD 5LGOA 5AF9H 1LMWB 2UUKB 1BB0B 2IOTA 3BTEE 1WAYB 4AFQA 1FPHH 1J15A 2A7HA 2XTTB 2BXTH 1MU8B 2BD8A 3QDZB 3E8LA 5AVDA 1XUFA 2CN0H 3GY2A 1TPPA 2J38A 4Z0KA 1C5RA 3UUZA 4K60A 2G8TA 1RTLA 1TAWA 2P95A 1AVGH 4YZUA 5F03A 2BZAA 1SGFA 3ZZ6A 4BTTB 3RXBA 2VIVA 2ZGJA 4XFQA 2ZTYA 3UREA 1ELTA 2G4UA 2ZG0H 4ZMAH 3Q3XA 1S0RA 3SNDA 1ZSLA 1LVMA 2W3IA 2Y5FA 2B5TB 1SQAA 1XVOA 1YKTA 2ZGCA 4MG3A 1O5GH 4ABDA 1AUJA 1PQ5A 2Y80A 3M5OA 1GJBB 4NWKA 4OS7A 2WPKS 1C1RA 3Q3YA 1LHEH 1KLIH 2Z3EA 1C5SA 2A7JA 2H5DA 1Z8JB 3E6PH 1C1OA 4J2YB 4KGAA 1QRWA 3EA9A 3M3VA 3SO3A 3TITA 1ZPBA 2A32A 3HKIB 2ZFTA 1H1BA 1A1RA 2HLCA 3F9FA 4FVBA 5A0AE 3QZQA 4FU8A 1EP6A 2SGQE 1Z1JA 3LDXH 4MPWA 4NWLA 1QJ7B 3ZVAA 1GHAF 2ZEBA 4I8HA 3UWIA 1P0SH 1P2MA 3SUFA 1Y5UT 1AB9C 3BIVH 3GICB 2PV9B 2GCHG 4GUXA 4QT8C 2FEQH 2BDGA 2P59A 1A2CH 2BOKA 1P2IA 1DY9A 1GBKA 1K2I1 5SGAE 1QA7A 2I6QA 2ZFPH 1BTZA 1SGYE 3ZZ9A 1ELVA 1EPTA 1O3DA 2V3OH 2VH0A 2ZZUH 3L33A 2QXGA 2OP9A 2BQWB 4AFSA 3RMOH 2FDAA 2VNTA 2V6NA 2WV4A 1C5MD 1A0LA 2GDEH 3SJ9A 1T7CA 5E0GA 3PM3A 3VB5A 4B73A 6CHAB 1C5VA 4FUGA
chains in the Genus database with same CATH superfamily
1O5CB 1TALA 1OP2A 2BLQA 2ZP0H 3KN2A 3A83A 3MU4A 3R0FA 1P9UA 1UTJA 1ZZZA 5T6DA 1MD8A 3D49H 3UOPA 4ZAEA 1EKBB 1C1PA 1TNKA 4A5TS 4B74A 5C5NA 2M2AA 3H5CB 4I7YH 1SGEE 2Y5GA 5EU8A 1PPGE 2PKAB 4D9QA 4U01A 5EXMA 3GY7A 1L2EA 2VBCA 3SZNA 3TGJE 3MQKC 1TB6H 4ACBA 3GYLB 3NRLA 1PPCE 1S84A 1GG6B 3MTYA 1Y5BT 1XUGA 2CJIA 2NU3E 4I8LA 2P93A 3ENSB 2A2XH 2YOLA 4AB9A 3F1SB 2FYQA 3PYHA 3PMAB 1WUNH 2P3TB 4O3UA 3EE0B 1GGDB 4DVAU 2C93B 1OWDA 2VWNA 5FX5A 2AGEX 1P01A 5HGGA 1GMDF 3PMJA 2VVUA 1KLTA 4X2VA 3KQ5A 1SHHB 3VB7A 1SFQB 2SNVA 2QF3A 1GVKB 2G81E 1T8LA 3N7OA 1GG6C 1EXFA 3A8DA 2R0LA 2C90B 3ZVGA 1UHBB 1IQEA 2ZFQH 3V13A 1W10U 3GDVA 4IN2A 2OC0A 4ASUD 1QNJA 2OCVB 2VIQA 3F9HA 4K8YA 3LKWA 2PTCE 1AZ8A 1CHGA 4ASHA 1B0EA 3B23B 1GGDC 2AMPA 1GBDA 2O8UA 1SGQE 3U1IB 3OTJE 1SGPE 1WXRA 1GCTB 3PMHB 1M9UA 1MKWK 2PGBB 3TH2H 2Z6BD 1V2OT 3KYFA 4YOIA 1DLKB 4E7RG 1Q31A 5ESTE 1G32B 1CGIE 1QQ4A 1UO6A 1CHOG 4Y8ZA 2UWOA 4XDEA 3SOSA 3QLPH 2YMSB 5HMAA 4CRDA 1SOTA 1MKXK 1TMUH 1A61H 1L4ZA 1TLDA 4KELA 2JH0D 2WPDD 2Y7ZA 3A7ZA 5CDFE 3ATIA 5A8ZA 1DPOA 2XRCA 3F0OA 3GYMA 1MZDA 2IPQX 1O3IA 1XX9A 3FZDA 3M7QA 1Z8RA 3LH3A 2GV6A 1XXDA 1CA0B 4ZH8A 1GJAB 2D8WA 3RC6A 1HAPH 3SJOA 3MU1A 1CGHA 2EC9H 5FCRA 5A2MH 3A7YA 4Q7ZA 1TABE 1C5UA 3ZZBA 3RXUA 1DVAH 1ZTLA 2QYIA 3HPTB 1S5SA 3ATKA 1ZTJA 1XUJA 3KQBA 3RU4D 3BTWE 5A09A 1W2KH 1Y3XA 1KXBA 1LQDB 2A4QA 5DP9A 1OKXA 2F91A 1DSTA 1SQOA 2XYAA 1C5LH 5J4SA 2K8IA 2C3SA 1AWFH 1Y3WA 4ESTE 2H1UA 1ACBE 1E1RD 1YPMH 5K7RA 1SHYA 4NA8A 1H8DH 2ZHFH 2FOMB 1A4WH 1XKAC 1SVPA 1AKSB 1A3BH 1YPHC 4OS2A 2QN5T 2B0FA 3H09A 3F2HA 5FXLA 3GDUA 2QF0A 4BXWA 4YT6H 2OLGA 5EW2H 2ZHDA 1OWJA 1DUAA 1C9TA 3DUXH 4F48B 2SGDE 5C2ZA 5JBCS 3BTHE 2ZIQH 1SLUB 2ODPA 5C20A 3KEEA 1C2DA 3RC5A 2ZQ1A 1O3CA 1TE0A 1YBWA 3ZZDA 2GGVB 2KAIB 4Y0ZE 3T62A 4E05H 4H6TA 2UUFB 1RIWB 3FFGA 2OC7A 3E0PB 4Q80A 2FZZA 5GCHG 1W7GH 1GI5A 5E8EH 1HAVB 3MNCA 1Y3YA 2R2MB 1UK3A 2FIRH 4ZUHA 1GJ7B 5KEDA 2W6JD 4AB8A 1BIOA 1EOJA 2ZFRH 3D62A 1ANDA 2BDAA 3P8GA 3PV2A 1MABB 3KHVA 1DDJA 1AUTC 2CGAA 4X6OA 2VIOA 3K9XB 1LHGH 1ZRKA 5FBEA 2SFAA 1P2NA 1DS2E 1PFXC 1C2FA 1W3CA 4ZKNU 2P3FH 6GCHG 4Y8YA 4A1VA 1MKWH 5FPTA 3JZ1B 1VGCB 3A84A 1OWKA 4FU7A 1C2HA 1O2PA 3VGCC 1V2WT 1SG8B 5JYIA 1F7ZA 1BTHH 1ARCA 1ESAA 2J92A 3SQHE 1YM0A 3ZZ7A 8GCHG 3NKKA 3F68H 3UNSA 1MKXH 3A87A 1W13U 4AX9H 1GHZA 1ZMNA 5E0JA 4XD7D 3SU5A 5T1VA 1C1WH 4K1TA 2W5EA 4BTUB 3QUMP 4DOQA 1P3CA 2V3MA 3OYPA 1GJCB 5PTPA 4CR5A 1XXFA 3AW1A 4CHAB 2ZDAH 1O2MA 2VINA 4F49A 2KFWA 4UFEH 1EB1H 2K1QA 2A31A 1GI6A 1ELDE 2PKSB 1MAYA 3LGTA 2JETB 1SKYE 1F92A 1ZSJA 4H6SB 5J4QA 1O3JA 2Q6FA 4B6FA 4IW4E 5KECA 1Y3VA 3VG8A 5L30H 4JZIA 4F4OC 3AK5A 2XBVA 3PLKA 3VEQB 3V7TA 5F8ZA 1TGTA 1J17T 1DICA 2WPLS 2GT7A 2KCOA 1AU8A 4ACAA 4UE7H 2R3YA 4JZFH 1C5XB 2BMGB 2THFB 1PPFE 3DT0H 3BEFB 1D3PB 2TPIZ 4IMZA 4LZ4B 3I77A 5EGMA 1H8IH 1CHOF 1K1OA 1S6HA 1P11E 2HOBA 4NGAH 1CGJE 4ISNA 5JDUB 1LO6A 1VCPA 4JCNA 4CBNA 2XW9A 3PO1B 3QTOH 3QGNB 1JRSA 1O3GA 1QGFA 3ZIAD 3ZYEA 3RXOA 3DSGA 2A4RA 1ZGIA 2UUJB 2V7QD 3U9AH 3DSOA 4AOQA 1YLCA 2XNIA 1GDQA 3G01A 3ATMA 2AFQB 3OE7D 1P06A 2CHAB 4UONA 1K0HA 4RSPA 3T26A 2RDLA 2ZO3H 1O0DH 3LU9B 4LK4A 1FXYA 1KLJH 4AGKA 3UR9A 3HK6B 2FLRH 3UNQA 2UWLA 1WSSH 2KX4A 3BTTE 1JIMA 1RJXB 1HXEH 1DWDH 1GHBF 2QE7D 4D9RA 2BXUH 4UEHH 1YLNA 5GPIB 1O2HA 1PQAA 1BMMH 3RU4E 4E06H 5DKMA 5TJXA 1HAZB 2H9TH 1O33A 3R3GB 1NBME 1O37A 5HM2A 1KTSB 2CHAC 3OFND 3SV6A 5E2PA 2R0KA 3NPSA 1A0JA 1F0SA 2UUYA 3P17H 3KL6A 2XBWA 1EAWA 5T3HA 4AFZA 3IWMA 1C5OH 3SUGA 1TGBA 1DFPA 3O8CA 3UR6A 2Z9KA 1P10A 1PPZA 1WQSA 1O3PB 3NCLA 2BD9A 4ISHH 3A86A 3BF6H 4RI0A 2ZTXA 4YO9A 5HIYA 1WTHD 2PLXA 3L3TA 5GCHF 3M5LA 1NPMA 2Z3DA 4OS6A 2NU2E 4DJZB 1FLEE 2FI5E 2A2QH 3EA7A 1BZXE 3LC3A 2VWMA 1GI9B 1WU1A 5GNDA 4BAOB 2BLVA 4K1EA 4ZKOU 3PV5A 1ID5H 3MU0A 1ETTH 2HGTH 5IYTA 3TJUA 2Y6TA 4U32A 2F9OA 2GV7A 4FOUC 1RTKA 1ETSH 4LZ1H 4CH8B 1D9IA 3BG8A 1DWBH 3K6ZA 5EG4A 5JBAS 6GCHF 1P02A 3UNRA 2XBXA 4TPYA 4DIHH 1FUJA 1AQ7A 3SU1A 1FJSA 2FOGA 2FM2A 1QJ1B 2ZGBH 8GCHF 4FUJA 3RMNH 1OWHA 2FS9A 1F0UA 2FODA 1BRAA 1GBEA 3K65B 3PV4A 3KYGA 3M5NA 1MTSA 2VJ1A 3WWBA 4ABJA 1VJ9U 2M5TA 2YNBA 2VIDA 3MOCA 1UVTH 2AIPA 2BDYA 1F5RA 1UVOA 1C5TA 1Y8TA 1FQ3A 5FCKA 1YP9A 4AORA 3VXEH 3P6ZB 3MYWA 1G3CA 4ISLA 1ORFA 2J4IA 4XBCA 1AMHA 2Z9IA 3E0NB 3ZV8A 3VB4A 2ZU2A 1Z1IA 1E38B 1QTFA 3HGNA 1NTPA 2FI4E 3S9CA 2WV9A 1HLTH 5EXLA 3EQ0H 3TNSA 1HJAC 2CXVA 4GLYA 2G4TA 1Z8IB 3M35A 1P2QA 1JMOH 1KDQA 1DWEH 4B1TA 3C1KA 3S9AA 2A4OA 2ZDKA 4Y7AA 2BDCA 4UD9H 2EA3A 3NXPA 3MNSA 1O31A 1G2LA 3RUOA 1RXPA 1MTVA 3ODFA 1TBRH 3TIUA 2F9NA 3GCTG 2A7CA 3SV9A 4Q2KA 1ZJDA 1D6WA 1UCYK 1V2JT 4X8SH 2LP6A 2OK5A 1ANEA 4TWWA 1GJ8B 2W7UA 1SC8U 4Y79A 1AGJA 3RXGA 9ESTA 2J34A 1QBOA 2VIPA 1SLXB 1QB9A 2WYGA 1O2RA 3FO8D 2XXLA 4WY3A 1MCTA 2ZFSA 3LONA 1AB9B 4ZXYH 1O2VA 1GHXH 1WOFA 3URCA 1PQ8A 1O35A 1J9CH 3U1JB 3NZIA 4MTBA 4UFFH 1DUEA 5C0TA 1UTMA 3TH4H 1FIZA 2FX6A 1C5YB 5JB9S 3ELAH 1YPHE 1Z8GA 5T6GA 1UVPA 2FOFA 1ELFA 3MU8A 3RLYH 2VB0A 3ZYDA 4NIXA 1O36A 4FVDA 2Y7XA 1E79D 1YC0A 3SU2A 5DP3A 4ZHAA 3PTBA 3RXEA 1H8HD 1EZSC 1K1NA 4FUFA 4WWYA 1YCPK 1C9PA 5DP6A 1ZPCA 4IGDA 3ZVEA 2BQ7B 4FUIA 1GWAA 1NU7B 4B2CA 5EW1H 2Z3CA 4THNH 2J5UA 1OX1A 1YPEH 4NZQA 1V2LT 3VPKA 1N8OC 1QHRB 2RFKC 1SQRA 1C1TA 1NU9A 1ABIH 4HFPB 3SI4H 1QBVH 3B9FH 3RXVA 2K0QA 3MH5A 1H4WA 1G3EA 4JK6A 4FUCA 1BMFD 3NK8A 2G52A 3LJJA 4Y0YE 2V35A 2GMTC 3LT3A 5C0UA 2QGRA 2ZDVH 3IG6B 5F6MA 1AZZA 2A0QB 4RT1A 3SV2H 1V2KT 4DY7B 3SV8A 2P8OB 3GCHC 3OU0A 1D6RA 5HYOA 3MO3A 2FS8A 1W14U 1FPCH 1Z71A 3LGWA 1HAGE 1YGCH 3LGIA 2SNWA 2C8XB 2AYWA 2C8YB 2HLDD 5C1XA 4ZCNA 2BY6X 2C8ZB 4WF8A 1G2MA 1L1GA 2OQUA 1E1QD 2ZGXH 2ZQ2A 1ZHPA 3LGVA 1VITG 5FHTA 2FOHA 2L6OA 2GZ8A 1XVMA 4FUHA 1TX8A 2ZHQH 1FN6A 2P8OC 1LVYA 3E3TA 1ARBA 5FL7D 3A82A 5B6LA 1J14A 1SLWB 2V0BA 3FP6E 1BQYA 4U2WA 1L4DA 4TWYA 3T29A 3VFEA 2XCFA 2HRVA 4JYTA 4KTSA 1SGTA 1P2OA 2VVCA 2J95A 4B75A 2ZCKP 3M61U 1IQHA 1UCYH 4JZ1A 5FPYA 1C1NA 2OUAA 1AN1E 3T2NA 4ZKSU 4AYVB 2QAAA 2ZHEH 1A0HB 2GCTC 1T4VH 5HXFA 1G37A 1WDIA 2PW8H 1ZR0A 1UTKA 2BVSH 3SU3A 1QZ8A 2WUCA 3UOUA 3V3MA 4IN1A 5C1UA 3RXQA 1IQNA 1BBRK 1NY22 1BBRE 3RXJA 1FZZA 2Z9JA 1NFWA 4OGXA 2IN2A 1QB1A 2EI7A 4ABAA 1C4Y2 4DW2U 1SGNE 2CV3A 2BLWA 4ABBA 1LKAA 4D76A 3SU4A 3SNBA 2FOAA 1SGIB 1DXWA 1GPZA 3N7DA 1B7XB 4X2WA 1YCPH 5CE1A 1S6FA 1T8OA 1MH0A 2BX4A 3SORA 1XKBC 5IK2D 1O3EA 5TCAA 1FAXA 1FAKH 2JH5D 3S7KB 3ZVDA 1GI3A 1GI0A 1TGSZ 1K1MA 4CR9A 1HYLA 2TGTA 3RXLA 2C4FH 1BUIA 3M3SA 3GCTF 3PLPA 2C8WB 1QBNA 2Q1JA 2ULLA 3ZZ8A 3CS0A 1ANCA 2ZA5A 3P92A 1H9LB 2H5CA 5I25A 3HGPA 3SU0A 4ABIA 3OTPA 1K1IA 1OWEA 2VIWA 4BAHB 3KF2A 1CBWB 1O3HA 1O2IA 3UY9A 3MNBA 3PLBA 1VCWA 3C27B 4X1NU 2LNCA 2AGGX 3UWJH 5GDSH 1HAOH 1O3OA 1W8BH 2VH6A 4OGYA 3IITA 3RXTA 5EQSA 3AW0A 1NBMD 1JXPA 5JBBS 1A7SA 1ESTA 1P12E 1MAXA 3RM0H 2F3CE 1GHBG 1O39A 1O2NA 3MO6A 1QB6A 1CQQA 1KSNA 2GJGA 3F3BA 4O97A 1W12U 1V2ST 5EJLA 2EI8A 1GVLA 3U8TH 4Y10E 3V12A 1SQTA 4UFDH 1LHFH 1LPZB 2BY7X 1UTPA 1P09A 1CBWC 1BRUP 1HIAB 3OX7U 1SOZA 1WTGH 3DFLA 4K8BA 3KQCA 1O32A 3RXSA 1RRKA 2XBYA 3FKSD 2ZCHP 1V2TT 1CE5A 1PPBH 2SGFE 1V3XA 1VITH 1YCPM 3A7WA 5DP7A 1K28D 5FX6A 3ESTA 2BB4A 4JYUH 3KCGH 1A5GH 1LDTT 4DG4A 3GY5A 2WHXA 1BT7A 4XRNA 4XBDA 3ZVCA 3QK1A 1ESBA 1QURH 3BTKE 5EIYA 2TIOA 3BTDE 3VB3A 2HNTE 1GBAA 3O8RA 4BXSA 3A8CA 3VGCB 1BTYA 5C5OA 3LGUA 1L0ZA 1D3QB 1BBRH 1SR5C 2PWXA 2JDID 1OOKB 1UVUH 4MNWA 4VGCC 1NFUA 4Q7XA 2TGPZ 1AWHB 1G3BA 3BSQA 5G4BA 2ANYA 1EATA 3BEUA 1LHCH 1PPHE 1SMFE 2OBQA 5T6FA 4YTAA 2OTVA 3LJOA 1C2KA 4P02A 1VITF 2NU4E 1UTNA 2VGCC 1P9SA 4YM9A 3A8BA 1MUEB 4O3TA 2FTLE 2D26C 1MU6B 4K1SA 1HJ8A 7ESTE 2FLBH 3EAJA 3PWBA 4MNYA 5EQRA 4X1SU 1E36B 2OINA 2A4GA 1NRQH 2F83A 3CS7A 3TGKE 2QV1A 4AZ2B 4I8GA 1A46H 3Q3KA 2FYRA 3KNXA 1AVWA 2Y82A 3GY3A 2ANWA 1TOMH 2G51A 1DM4B 4X8UH 3TK6A 4ZHLU 1O3MA 1GBIA 4BAMB 4GHQA 3F2GA 8LPRA 3A81A 1O5FH 4Y11E 4FETA 4BAKB 2B8OH 2ZHWH 1WCZA 2ZCLP 1YPGH 4AGJA 1C2MA 1W7XH 1NM6A 2V3HH 3BTGE 1IHSH 1GCDA 3NUMA 2ZU1A 4F55A 4K69A 1O2SA 3PMBB 2KR7A 2ZTZA 3KIDU 1PJPA 1ZJKA 3ZZ4A 1TX6A 2FOBA 1DSUA 5L2YH 3RXIA 3U28C 4RKOB 1QFKH 2QXJA 5DJ7A 1TNGA 1LVBA 5A0BA 4DIIH 2WPMS 1AHTH 3FANA 2BVRH 4ZROA 3M7TA 1O5BB 1B0FA 1TA6A 4CRGA 1CT2E 1C2LA 1Z6JH 1HIAA 1THSH 1OP8A 1OWIA 1GI1A 1N6YA 1ELCA 3OEED 1GJDB 2HPPH 5F8TA 2ZF0H 4Y76A 5JBTA 1C5NH 1FX0B 1K1JA 2BD2A 1C5PA 3RXRA 2ASUB 3TLOA 1WV7H 4MDSA 1H9HE 4HTCH 4MLFB 3A85A 2AMQA 2Q6GA 2Z94A 5DSFA 3U98H 1ZLRA 2VWLA 1T32A 1GBJA 4AG2A 5LPRA 3RXDA 1C2IA 1IOEA 3RXAA 4ABEA 1ZTKA 1AE8H 1NESE 2Z9LA 3RXPA 3BV9B 2AEIH 4KTUA 1S6LA 2GTBA 1MD7A 1TRNA 1GDNA 5EOKA 2STAE 3W95A 3RMLH 1EP5A 2R3UA 1PQ7A 3A88A 1W0KD 2DUCA 3SQEE 2W6ID 2SGAA 2STBE 3AAUA 3KQDA 2BVXH 2UWPA 2O8LA 3SW2B 2AH4X 7KMEH 3QO6A 1KDQB 3GY4A 1ZHMA 3RP2A 1HJ9A 1OXGA 1D3TB 3SN8A 2D2DA 5CHAC 2GP9B 1CT4E 2FP7B 1TGCA 1GHWH 1HAYB 2P94A 1YPKH 3TJVA 1TA2A 3LOXA 1THPB 3MH4A 3N99A 4X2XA 2L74A 2D1JA 5DP8A 1IQFA 2ZKSA 3BTQE 7GCHG 2A5KA 3DA9B 4K5ZA 3T25A 4BOHA 1E0FD 1HFDA 3SJKA 3TK9A 2HNTF 3TNTA 2ZU5A 8KME2 4XBBA 1PPEE 4ISIH 3ATLA 2PP6A 2J98A 1TMBH 1RD3B 1O38A 4I86A 1XUHA 3P8FA 1KXDA 4D7FA 3QN7A 1G3DA 2BY8X 1DX5M 3FP8E 1TOCB 1BJVA 1O2GH 1HPGA 2FOCA 1IHTH 1IQMA 2R9PA 4B2BA 1E35B 3DCLA 1HXFH 1C1MA 2H9EH 3HATH 1TBZH 5FBIA 1GVZA 1AFEH 2G55A 3QX5H 1GJ5H 4JYVH 1WQVH 2WPHS 2BD3A 2PFEA 2HNTC 3BIUH 1K22H 2RDEA 1TRMA 1O3AA 5GWZA 1S82A 5BRRE 1AIXH 1E34B 3FAOA 3SHAH 1THRH 3T28A 4GVUA 1EQ9A 2KM0A 1AD8H 3AVZA 3SI3H 3TVJB 3LPRA 4FXGH 1MCVA 2RG3A 1ABJH 1MQ6A 1ZYOA 2FX4A 2HWLB 3MMGA 1T8MA 2F9UA 2O8MA 3PB1E 5C1YA 3SJ8A 4WH6A 2FXRA 4HG6A 2HPQH 4WXIA 1QL7A 1F0RA 1GJ4H 1LCYA 3HKJB 4XSKU 4I8JA 3STIA 1MQ5A 1SB1H 1N1LA 4Y6DA 1HJAB 1JRTA 4WJG2 1SBWA 2ZDNA 1AFQC 3RXKA 1EB2A 4H4FA 2G5VA 2FOEA 3LIWA 2ANMH 4ABGA 3GOVB 1HGTH 4DGJA 1C5QA 6ESTA 1KTTB 1LKBA 1S85A 3E91A 1EJNA 1TNIA 1BCUH 4ZXXH 1UK4A 1QR3E 2A5AA 3E90B 3GISB 4GHTA 3E16B 1J8AA 1V2VT 1F0TA 1O2QA 2BOHB 5LPEA 5AHGH 1ZMJA 2FI3E 3FZZA 4LXBH 1P05A 4YLUA 3Q77A 3RXFA 2RCEA 2FWWA 1BTWA 1UW7A 3S69A 1VCQA 3H7OA 5JB8S 1RTFB 3LC5A 4X1RU 1QL9A 5ETXA 1EPTC 1NROH 4INKA 3I78A 3BG4C 3BN9A 1O2UA 1O5EH 1BTXA 1Y59T 4TT3D 3OAAD 4OS1A 2ZPQA 1TQ0B 3ITIA 1BOQA 1LTOA 1FDPA 1XM1A 3W94A 3TGIE 1IAUA 1P04A 4GAWA 1UCYE 4HZHA 4OM9A 1OP0A 1V2UT 2LELA 2TGAA 3AASA 3B8JA 4D8NA 2IJOB 1O2JA 3K6YA 3O8DA 1NRNH 4NCYA 4ISOA 2XC5A 1FI8A 3RU4T 1NT1A 4R0IA 1NS3A 3QTVH 1KYNA 3JZ2B 3ZVBA 2A5IA 3P95A 1O2WA 4TPIZ 3QZRA 1N8OB 1XUIA 1TNHA 1CSOE 4MPVA 2HVYB 1IQIA 2PSXA 2OBOA 1QRZA 4X6NA 2GZ7A 2VVVA 2XC4A 2QY0B 1Y5AT 5EPYA 4YOJA 1O34A 1TPSA 1EJMA 1O2LA 2JH6D 3LGYA 3RM2H 1ZMLA 2I6SA 4Y71A 3EE7A 1HBTH 2GMTB 3MHWU 4Y7BA 1EAIA 2AGIX 4JK5A 3S0NA 3V0XA 1TFXA 1F2SE 1FY1A 4BAQB 1O3NA 3MU5A 3GCHB 3ZZ5A 5E2OA 4TY6A 1FIWA 4ZKRU 2ILNA 2BDBA 4RN6A 2BDIA 5DK1A 5A8YA 2CK3D 2BZ6H 3A7VA 4K3JA 4NIYA 1C5WB 1EASA 3ZZCA 5A8XA 2BDHA 3U8RH 1TMTH 2XWBI 5DGJA 2BD5A 7GCHF 2ALVA 2EY4C 4B71A 1T8NA 1SLVB 2O8TA 5DP5A 1TRYA 1KMHB 2SGPE 1Q3XA 1TX7A 3RDZA 1CVWH 1LQEA 2BY5X 4NSVA 3SU6A 1LPGB 3U8OH 2TRMA 1O5AB 3SV7A 3MH6A 2Z9GA 3ODDA 4BANB 4MNVA 3TU7H 2CF8H 5IDKA 3SYJA 1QIXB 1P57B 4NZLA 3I29A 4OS5A 2JIZD 2WV5A 2ZU4A 3SGAE 3OEHD 3SGQE 1ZRBA 4A92A 4KP0A 2BD7A 1YLDA 5ESBA 1VZQH 1QRXA 2CMYA 4MNXA 4I33A 1BHXF 5LH8A 2AHME 1BHXB 1HB0B 3QWCH 1V2QT 3UB0A 1K9OE 2AMDA 2XNDD 1P3EA 1AI8H 1TPAE 2GCTB 1HAXB 4ZHMU 5DN6D 3A8AA 5JPMH 1Z6EA 1TPOA 3NWUA 4DT4A 1AE5A 4TY7A 2ESTE 2ODYB 1OSSA 2PGQB 2B9LA 1GI2A 5F53A 2JKHA 3EDXB 2YNAA 4IS5A 2KCAA 4ABFA 1SL3A 4E7NA 2BTCE 1QL8A 1BDAA 5BPEA 4CH2B 1X7AC 4I32A 2QIQA 4NA9H 3SNEA 4M7GA 2PR3A 6CHAC 2OXSA 3VXFH 1V6DA 2TGDA 1MTUA 4AC9A 2JJ2D 3OY5U 3SHCH 4GSOA 3UQVA 1O3LA 1GMHF 2FPZA 4YLQH 1YWUA 1OYTH 2ANKH 3SZEA 2G5NA 1INCA 2ZDLA 2W3KA 4AYYB 5GJ4B 1O2YA 4K2YA 2VU8E 1L1JA 3PROA 3F9EA 1O3BA 2PUQH 3RXCA 3TJOA 2W26A 1CA8B 4AG1A 4X1QU 2PUXB 1TONA 6LPRA 8ESTE 3FVFB 1UVSH 1H8ED 5AFZH 1SPJA 1FN8A 1C4U2 5EODA 1NRPH 1D3DB 2Y5HA 4B2AA 1ANBA 3CENA 5E0HA 3WWFA 1O2TA 2XCNA 2AERH 3PWCA 2P16A 4ABHA 4AFUA 1EFRD 3GCNA 3ATWA 3GDSA 1UTLM 4R8TB 5AFYH 1K1LA 3T5FH 3MFJA 4UFGH 1XMNB 2WINI 2O9QA 1HCGA 3QGJA 2EQNA 1BITA 2QA9E 4NIVA 1LVOA 1SSXA 4X6PA 1YYY1 2ZGHA 2BY9X 1Q2WA 3OY6U 1GBBA 1SGDE 1TYNA 4MPXA 2F9PA 1JBUH 3F0PA 1ZPZA 1EZQA 3BTFE 3K2UA 2HVXA 2BM2A 2FO9A 2F43B 4I31A 1MZAA 3O8BA 1O3KA 3EGKH 1GL0E 1KXEA 3MH7A 3GS9A 5I46H 4OS4A 1GCTC 1NC6A 1HNEE 1O3FA 4NA7A 4WMEA 1OS8A 4IBLH 2GDDA 2WPJS 1C2JA 3M3TA 4FUDA 1FMGA 1FNIA 1TQ7B 4XE4A 4J1YA 1SI5H 3SJIA 2YMSC 1C1VH 4NFFA 2GX4A 1TBQH 3UTUH 1K1PA 1AY6H 2BX3A 1GBFA 4MVNA 1F5LA 4D7GA 1C1QA 1SGFG 4VGCB 1G9IE 1NRRH 3TPIZ 1SFIA 3MWIU 1CA0C 1KXCA 1DOJA 1O2XA 1S81A 1C2EA 1P03A 2PKAA 4NSYA 3RLWH 1NN6A 3UIRA 1EAUA 1ELBA 1IQKA 4TYDA 1G36A 4NG9H 2GCHF 2VGCB 1TIOA 1HAIH 3PTNA 3Q00A 1AO5A 3MI4A 1BA8B 5DPAA 4AN7A 1H9IE 5H4IB 7LPRA 3D23A 2NWNA 3A7TA 1V2NT 2OC1A 4CBOA 3KQEA 2FESH 1ELAA 3A7XA 2H6MA 1J16A 2VWOA 2H9HA 3BTME 3FN8A 1C1UH 1VJAU 1W0YH 5GIBA 2AS9A 3PRDA 2B7DH 4GCHG 3F6UH 1HV7A 1TGNA 5CHBA 1GHVH 4JZDH 1GL1A 2QF5A 3H7TA 4MPUA 3M37A 1G30B 2KCPA 4LOYH 1YPJH 3ZZAA 1GMCG 1UHBA 2QCYA 3SGBE 1P2JA 3RC4A 4INHA 1FONA 4U30A 1F5KU 2J94A 3UFAA 3DFJA 3ZV9A 2NU1E 3PRBA 5B6OA 2R2WU 3SNCA 1NZQH 1CO7E 1FY5A 1N6XA 3RXMA 1MBQA 3ZVFA 1V2PT 1YY3A 1RIWC 1DT2A 2J98B 2BLOA 3S7HB 3P70B 1V2RT 2ZU3A 3FP7E 5C17A 1B5GH 2ZC9H 1L1NA 1QJ6B 1E37B 3SBKA 1RGQA 5F8XA 1HRTH 2GKVE 2J2UA 1BJUA 4WMDA 1VR1H 3DHKH 1EJAA 2EI6A 1SGRE 1TWXB 3T27A 2GD4B 3DSPA 4CRAA 3S9BA 2LPRA 4WH8A 5LPFA 5EPNA 3KGPA 1O2ZA 1KXFA 3M7UA 4JMYA 2DE8A 2F9VA 4WMFA 1LPKB 5EQQA 9LPRA 2QXHA 4YOGA 4Y8XA 4A1TA 2WYJA 1U6QA 1JOUB 2O8WA 3N7EA 4IMQA 3MO9A 3D65E 1LHDH 3SNAA 1EZUC 1VGCC 1A5IA 2Q6DA 5HM9A 2EEKA 2PHBA 1GI4A 5DO4H 4HI3A 3F9GA 1GBCA 2ALPA 5EJ1A 2NU0E 1FY8E 5DG6A 1OYQA 3UAIC 4IC5A 3E1XB 1BRCE 3U69H 2ZI2H 1KY9A 2KCYA 1DXPA 3UPEA 4DCDA 3EA8A 1UK2A 1NO9H 2WPIS 1BTPA 1BMLA 4YESB 3HK3B 4Q7YA 4YXWD 5L2ZH 2YMSD 4JZEH 4CHAC 3GY6A 1S83A 1WBGB 1AKSA 2PTNA 1RFNA 2FMJA 5CHAB 2QF4A 3A80A 1AVXA 3GY8A 4NFEA 2PKSC 1C4V2 1O5DH 4X0WU 2JETC 1RS0A 1CU1A 1OHHD 2GVFA 1YF4A 4GPGA 4XOJA 1QA0A 2OQ5A 4IC6A 3P8NA 1KXAA 1PYTC 4A1XA 1MMJN 1O2KA 3P8OA 2HALA 1BMAA 4BTIB 1SGCA 3SUEA 2OD3B 5A0CA 1C5ZB 1MTNB 2KAIA 3STJA 1VKYA 1DE7H 1MTWA 2XWAA 5TCCA 3A89A 3L6PA 3RXHA 3UQOA 1DANH 1TNJA 1NRSH 1HAVA 1DY8A 1JIRA 1UTQA 1FY3A 1W0ZU 1P8VC 2RA3A 2KZ4A 1EAXA 4FUEA 4X1PU 4A6LA 4DURA 4I8KA 3OSYA 3DD2H 3PO1C 1HUTH 1GHAG 2XOKD 1FY4A 5ABWA 1GJ9B 3Q76A 2ZPSA 5CMXH 2TBSA 4HGCA 4X6MA 3LH1A 1EX3A 2SGEE 2G00A 2P3UB 1MBMA 1T4UH 1MTNC 4B6EA 5L6NH 3GCOA 2FTMA 5GXPA 1ZSKA 2GT8A 4FUBA 4INLA 1KIGH 4Q4LA 4X8TH 1DWCH 5FPSA 2ZFFH 4TSFD 4H42U 4MQAA 4CRFA 2BD4A 1IQLA 2W7SA 1K21H 3MNXA 2BQ6B 4KKDA 1T31A 1P2KA 1EZXC 2DE9A 5K0HA 1A3EH 2A1DB 3SUDA 4SGAE 1YPLH 1ZGVA 1V2MT 4Z6AH 1C1SA 1ELGA 1UJ1A 1GDUA 2Y81A 1BMNH 4PROA 4BNRA 1EOLA 1HAHH 1QQUA 2PSYA 1BRBE 2ZPRA 1GHYH 2J9NA 4GCHF 5EJZA 3M36A 1FV9A 1UTOA 3TK5A 1NFXA 2CF9H 1AFQB 4CRBA 5FAHA 1A5HA 1ELEE 4DT7B 4X2YA 1GMCF 5C67A 1ZHRA 1OPHB 2ZWLH 1NFYA 1GJ6A 4UDWH 3WY8A 1GI8B 1DITH 3BEIB 1QCPA 5C3NA 1Z7KA 1IQGA 2ZECA 3EYDA 2IPHA 1CT0E 3ZZ3A 1W0JD 4RKJB 1JWTA 4YT7H 2BHGA 4WXVA 2AIQA 3URDA 1GBHA 3TJNA 4O03A 4X8VH 3FOAA 5EXNA 1O2OA 2ZDMA 4NIWA 4FU9A 3AAVA 4O9VA 4CRCA 2WUBA 1UMAH 1GI7B 2ZNKH 2QC2A 2A45B 4CREA 1DLEA 1WYKA 1GMHG 1GBTA 1EPTB 1GBMA 1ZOMA 1Y3UA 3RMMH 3CNRA 3BG4B 4SGBE 2BYAX 2Z7FE 1XUKA 5DP4A 1W11U 2GZ9A 1GBLA 1HDTH 1BTUA 2QXIA 4WVPE 1QY6A 1EUFA 4KTCA 1C2GA 1GMDG 4B76A 2F9BH 5HIZA 1ETRH 1O30A 1S0QA 1TNLA 2RA0A 3CP7A 3WW7A 1IQJA 3W1EA 4Q63A 3TH3H 3VB6A 2XC0A 4A7IB 2ODQA 3M5MA 1D4PB 5C94A 2H2ZA 2OC8A 1PYTD 5LGOA 5AF9H 1LMWB 2UUKB 1BB0B 2IOTA 2F4LA 3BTEE 1WAYB 4AFQA 1FPHH 1J15A 2A7HA 2XTTB 2BXTH 1MU8B 2BD8A 3QDZB 2JJ1D 3E8LA 5AVDA 1XUFA 2CN0H 3GY2A 1TPPA 2J38A 4Z0KA 1C5RA 3UUZA 4K60A 2G8TA 1RTLA 1TAWA 2P95A 1AVGH 4YZUA 5F03A 2BZAA 1SGFA 3ZZ6A 4BTTB 3RXBA 2VIVA 2ZGJA 4XFQA 2ZTYA 3UREA 1ELTA 2G4UA 2ZG0H 4ZMAH 3Q3XA 1S0RA 2IJD1 3SNDA 5HKKD 1ZSLA 1LVMA 2W3IA 2Y5FA 2B5TB 1SQAA 1XVOA 1YKTA 2ZGCA 2J97A 4MG3A 1O5GH 4ABDA 1COWD 1AUJA 2WSSD 1PQ5A 2Y80A 3M5OA 1GJBB 4NWKA 4OS7A 2WPKS 1C1RA 3Q3YA 1LHEH 1KLIH 2Z3EA 1C5SA 2A7JA 2H5DA 1Z8JB 3E6PH 1C1OA 4J2YB 4KGAA 1QRWA 3EA9A 3M3VA 3SO3A 3TITA 1ZPBA 2A32A 3HKIB 2ZFTA 1H1BA 1A1RA 2HLCA 3F9FA 4FVBA 5A0AE 3QZQA 4FU8A 1EP6A 4M9FA 2SGQE 1Z1JA 3LDXH 4MPWA 4NWLA 1QJ7B 3ZVAA 1GHAF 2ZEBA 4I8HA 4P00A 3UWIA 1P0SH 4Z1MD 1P2MA 3SUFA 1Y5UT 1AB9C 3BIVH 3GICB 2PV9B 2GCHG 4GUXA 4QT8C 2FEQH 2BDGA 2P59A 1A2CH 2BOKA 1P2IA 1DY9A 3F2FA 1GBKA 1K2I1 5SGAE 1QA7A 2WZQA 2I6QA 2ZFPH 1BTZA 1SGYE 3ZZ9A 1ELVA 1EPTA 1O3DA 2V3OH 2VH0A 2ZZUH 3L33A 4RT0A 2QXGA 2OP9A 2BQWB 4AFSA 3RMOH 2FDAA 2VNTA 2V6NA 2WV4A 1C5MD 1A0LA 2GDEH 3SJ9A 1T7CA 5E0GA 3PM3A 5KGOA 3VB5A 4B73A 6CHAB 1C5VA 4FUGA
chains in the Genus database with same CATH topology
1O5CB 1TALA 1OP2A 2BLQA 2ZP0H 3KN2A 3A83A 3MU4A 3R0FA 1P9UA 1UTJA 1ZZZA 5T6DA 1MD8A 3D49H 3UOPA 4ZAEA 1EKBB 1C1PA 1TNKA 4A5TS 4B74A 5C5NA 3H5CB 4I7YH 1SGEE 2Y5GA 5EU8A 1PPGE 2PKAB 4D9QA 4U01A 5EXMA 3GY7A 1L2EA 3SZNA 3TGJE 1TB6H 3GYLB 1PPCE 1S84A 1GG6B 3MTYA 1Y5BT 1XUGA 2CJIA 2NU3E 4I8LA 2P93A 3ENSB 2A2XH 2YOLA 4AB9A 3F1SB 2FYQA 3PYHA 3PMAB 1WUNH 2P3TB 4O3UA 3EE0B 1GGDB 4DVAU 2C93B 1OWDA 2VWNA 5FX5A 2AGEX 1P01A 5HGGA 1GMDF 3PMJA 2VVUA 1KLTA 4X2VA 1SHHB 3VB7A 1SFQB 2SNVA 2QF3A 1GVKB 2G81E 1T8LA 3N7OA 1GG6C 1EXFA 3A8DA 2R0LA 2C90B 3ZVGA 1UHBB 1IQEA 2ZFQH 3V13A 1W10U 3GDVA 4IN2A 2OC0A 1QNJA 2OCVB 2VIQA 3F9HA 4K8YA 3LKWA 2PTCE 1AZ8A 1CHGA 4ASHA 1B0EA 3B23B 1GGDC 2AMPA 1GBDA 2O8UA 1SGQE 3U1IB 3OTJE 1SGPE 1GCTB 3PMHB 1M9UA 1MKWK 2PGBB 3TH2H 2Z6BD 1V2OT 4YOIA 1DLKB 4E7RG 1Q31A 5ESTE 1G32B 1CGIE 1QQ4A 1UO6A 1CHOG 4Y8ZA 2UWOA 4XDEA 3SOSA 3QLPH 5HMAA 4CRDA 1SOTA 1MKXK 1TMUH 1A61H 1L4ZA 1TLDA 4KELA 2JH0D 3A7ZA 2Y7ZA 3ATIA 5A8ZA 1DPOA 2XRCA 3GYMA 1MZDA 1O3IA 1XX9A 3FZDA 3M7QA 1Z8RA 3LH3A 2GV6A 1XXDA 1CA0B 4ZH8A 1GJAB 2D8WA 3RC6A 1HAPH 3SJOA 3MU1A 1CGHA 2EC9H 5FCRA 5A2MH 3A7YA 4Q7ZA 1TABE 1C5UA 3ZZBA 3RXUA 1DVAH 1ZTLA 2QYIA 3HPTB 1S5SA 3ATKA 1ZTJA 1XUJA 3KQBA 3RU4D 3BTWE 5A09A 1W2KH 1Y3XA 1KXBA 1LQDB 2A4QA 5DP9A 1OKXA 2F91A 1DSTA 1SQOA 2XYAA 1C5LH 5J4SA 2C3SA 1AWFH 1Y3WA 4ESTE 2H1UA 1ACBE 1YPMH 5K7RA 1SHYA 4NA8A 1H8DH 2ZHFH 2FOMB 1A4WH 1XKAC 1SVPA 1AKSB 1A3BH 1YPHC 4OS2A 2QN5T 2B0FA 5FXLA 3GDUA 2QF0A 4BXWA 4YT6H 2OLGA 5EW2H 2ZHDA 1OWJA 1DUAA 1C9TA 3DUXH 2SGDE 5C2ZA 5JBCS 3BTHE 2ZIQH 1SLUB 2ODPA 5C20A 3KEEA 1C2DA 3RC5A 2ZQ1A 1O3CA 1TE0A 1YBWA 3ZZDA 2GGVB 2KAIB 4Y0ZE 3T62A 4E05H 4H6TA 2UUFB 1RIWB 3FFGA 2OC7A 3E0PB 4Q80A 2FZZA 5GCHG 1W7GH 1GI5A 5E8EH 1HAVB 3MNCA 1Y3YA 2R2MB 1UK3A 2FIRH 4ZUHA 1GJ7B 4AB8A 1BIOA 1EOJA 2ZFRH 3D62A 1ANDA 2BDAA 3P8GA 3KHVA 1DDJA 1AUTC 2CGAA 4X6OA 2VIOA 3K9XB 1LHGH 1ZRKA 5FBEA 2SFAA 1P2NA 1DS2E 1PFXC 1C2FA 1W3CA 4ZKNU 2P3FH 6GCHG 4Y8YA 4A1VA 1MKWH 5FPTA 3JZ1B 1VGCB 3A84A 1OWKA 4FU7A 1C2HA 1O2PA 3VGCC 1V2WT 1SG8B 5JYIA 1F7ZA 1BTHH 1ARCA 1ESAA 2J92A 3SQHE 1YM0A 3ZZ7A 8GCHG 3NKKA 3F68H 3UNSA 1MKXH 3A87A 1W13U 4AX9H 1GHZA 1ZMNA 5E0JA 3SU5A 1C1WH 4K1TA 2W5EA 4BTUB 3QUMP 4DOQA 1P3CA 3OYPA 1GJCB 5PTPA 4CR5A 1XXFA 3AW1A 4CHAB 2ZDAH 1O2MA 2VINA 4F49A 4UFEH 1EB1H 2K1QA 2A31A 1GI6A 1ELDE 2PKSB 1MAYA 3LGTA 2JETB 1F92A 1ZSJA 4H6SB 5J4QA 1O3JA 2Q6FA 4IW4E 1Y3VA 5L30H 4JZIA 4F4OC 2XBVA 3PLKA 3VEQB 3V7TA 5F8ZA 1TGTA 1J17T 1DICA 2WPLS 2GT7A 1AU8A 4UE7H 2R3YA 4JZFH 1C5XB 2BMGB 2THFB 1PPFE 3DT0H 3BEFB 1D3PB 2TPIZ 4IMZA 4LZ4B 3I77A 5EGMA 1H8IH 1CHOF 1K1OA 1S6HA 1P11E 2HOBA 4NGAH 1CGJE 4ISNA 5JDUB 1LO6A 1VCPA 4JCNA 4CBNA 2XW9A 3PO1B 3QTOH 3QGNB 1JRSA 1O3GA 1QGFA 3ZYEA 3RXOA 2A4RA 1ZGIA 2UUJB 3U9AH 4AOQA 1YLCA 2XNIA 1GDQA 3G01A 3ATMA 2AFQB 1P06A 2CHAB 4UONA 4RSPA 3T26A 2RDLA 2ZO3H 1O0DH 3LU9B 4LK4A 1FXYA 1KLJH 4AGKA 3UR9A 3HK6B 2FLRH 3UNQA 2UWLA 1WSSH 3BTTE 1JIMA 1RJXB 1HXEH 1DWDH 1GHBF 4D9RA 2BXUH 4UEHH 5GPIB 1O2HA 1PQAA 1BMMH 3RU4E 4E06H 5DKMA 5TJXA 1HAZB 2H9TH 1O33A 3R3GB 1O37A 5HM2A 1KTSB 2CHAC 3SV6A 5E2PA 2R0KA 3NPSA 1A0JA 1F0SA 2UUYA 3P17H 3KL6A 2XBWA 1EAWA 5T3HA 4AFZA 3IWMA 1C5OH 3SUGA 1TGBA 1DFPA 3O8CA 3UR6A 2Z9KA 1P10A 1PPZA 1WQSA 1O3PB 3NCLA 2BD9A 4ISHH 3A86A 3BF6H 2ZTXA 4YO9A 1WTHD 2PLXA 3L3TA 5GCHF 3M5LA 1NPMA 2Z3DA 4OS6A 2NU2E 4DJZB 1FLEE 2FI5E 2A2QH 3EA7A 1BZXE 3LC3A 2VWMA 1GI9B 1WU1A 4BAOB 2BLVA 4K1EA 4ZKOU 1ID5H 3MU0A 1ETTH 2HGTH 5IYTA 3TJUA 2Y6TA 4U32A 2F9OA 2GV7A 1RTKA 1ETSH 4LZ1H 4CH8B 1D9IA 3BG8A 1DWBH 3K6ZA 5EG4A 5JBAS 6GCHF 1P02A 3UNRA 2XBXA 4TPYA 4DIHH 1FUJA 1AQ7A 3SU1A 1FJSA 2FOGA 2FM2A 1QJ1B 2ZGBH 8GCHF 4FUJA 3RMNH 1OWHA 2FS9A 1F0UA 2FODA 1BRAA 1GBEA 3K65B 3PV4A 3M5NA 1MTSA 2VJ1A 4ABJA 1VJ9U 2M5TA 2YNBA 2VIDA 3MOCA 1UVTH 2AIPA 2BDYA 1F5RA 1UVOA 1C5TA 1Y8TA 1FQ3A 5FCKA 1YP9A 4AORA 3VXEH 3P6ZB 3MYWA 1G3CA 4ISLA 1ORFA 2J4IA 4XBCA 1AMHA 2Z9IA 3E0NB 3ZV8A 3VB4A 2ZU2A 1Z1IA 1E38B 1QTFA 3HGNA 1NTPA 2FI4E 3S9CA 1HLTH 5EXLA 3EQ0H 3TNSA 1HJAC 2CXVA 4GLYA 2G4TA 1Z8IB 3M35A 1P2QA 1JMOH 1KDQA 1DWEH 4B1TA 3C1KA 3S9AA 2A4OA 2ZDKA 4Y7AA 2BDCA 4UD9H 2EA3A 3NXPA 3MNSA 1O31A 1G2LA 3RUOA 1RXPA 1MTVA 3ODFA 1TBRH 3TIUA 2F9NA 3GCTG 2A7CA 3SV9A 4Q2KA 1ZJDA 1D6WA 1UCYK 1V2JT 4X8SH 1ANEA 4TWWA 1GJ8B 2W7UA 1SC8U 4Y79A 1AGJA 3RXGA 9ESTA 2J34A 1QBOA 2VIPA 1SLXB 1QB9A 2WYGA 1O2RA 2XXLA 4WY3A 1MCTA 2ZFSA 3LONA 1AB9B 4ZXYH 1O2VA 1GHXH 1WOFA 3URCA 1PQ8A 1O35A 1J9CH 3U1JB 3NZIA 4MTBA 4UFFH 1DUEA 1UTMA 3TH4H 1FIZA 2FX6A 1C5YB 5JB9S 3ELAH 1YPHE 1Z8GA 5T6GA 1UVPA 2FOFA 1ELFA 3MU8A 3RLYH 2VB0A 3ZYDA 4NIXA 1O36A 4FVDA 2Y7XA 3SU2A 1YC0A 5DP3A 4ZHAA 3PTBA 3RXEA 1EZSC 1K1NA 4FUFA 4WWYA 1YCPK 1C9PA 5DP6A 1ZPCA 4IGDA 3ZVEA 2BQ7B 4FUIA 1GWAA 1NU7B 4B2CA 5EW1H 2Z3CA 4THNH 1OX1A 1YPEH 4NZQA 1V2LT 3VPKA 1N8OC 1QHRB 1C1TA 1NU9A 1ABIH 4HFPB 3SI4H 1QBVH 3B9FH 3RXVA 3MH5A 1H4WA 1G3EA 4JK6A 4FUCA 3NK8A 2G52A 3LJJA 4Y0YE 2V35A 2GMTC 3LT3A 2QGRA 2ZDVH 3IG6B 5F6MA 1AZZA 2A0QB 3SV2H 1V2KT 4DY7B 3SV8A 2P8OB 3GCHC 3OU0A 1D6RA 5HYOA 3MO3A 2FS8A 1W14U 1FPCH 1Z71A 3LGWA 1HAGE 1YGCH 3LGIA 2SNWA 2C8XB 2AYWA 2C8YB 5C1XA 2BY6X 2C8ZB 4WF8A 1G2MA 1L1GA 2OQUA 2ZGXH 2ZQ2A 1ZHPA 3LGVA 1VITG 5FHTA 2FOHA 2GZ8A 1XVMA 4FUHA 1TX8A 2ZHQH 1FN6A 2P8OC 1LVYA 3E3TA 1ARBA 3A82A 1J14A 1SLWB 2V0BA 3FP6E 1BQYA 4U2WA 1L4DA 4TWYA 3T29A 3VFEA 2XCFA 2HRVA 4JYTA 4KTSA 1SGTA 1P2OA 2VVCA 2J95A 4B75A 2ZCKP 3M61U 1IQHA 1UCYH 4JZ1A 5FPYA 1C1NA 2OUAA 1AN1E 3T2NA 4ZKSU 4AYVB 2QAAA 2ZHEH 1A0HB 2GCTC 1T4VH 5HXFA 1G37A 2PW8H 1ZR0A 1UTKA 2BVSH 3SU3A 2WUCA 3UOUA 3V3MA 4IN1A 5C1UA 3RXQA 1IQNA 1BBRK 1NY22 1BBRE 3RXJA 1FZZA 2Z9JA 1NFWA 4OGXA 2IN2A 1QB1A 2EI7A 4ABAA 1C4Y2 4DW2U 1SGNE 2CV3A 2BLWA 4ABBA 1LKAA 4D76A 3SU4A 3SNBA 2FOAA 1SGIB 1DXWA 1GPZA 1B7XB 4X2WA 1YCPH 5CE1A 1S6FA 1T8OA 1MH0A 2BX4A 3SORA 1XKBC 1O3EA 5TCAA 1FAXA 1FAKH 2JH5D 3S7KB 3ZVDA 1GI3A 1GI0A 1TGSZ 1K1MA 4CR9A 1HYLA 2TGTA 3RXLA 2C4FH 1BUIA 3M3SA 3GCTF 3PLPA 2C8WB 1QBNA 2Q1JA 2ULLA 3ZZ8A 3CS0A 1ANCA 2ZA5A 3P92A 1H9LB 2H5CA 5I25A 3HGPA 3SU0A 4ABIA 1K1IA 1OWEA 2VIWA 4BAHB 3KF2A 1CBWB 1O3HA 1O2IA 3UY9A 3MNBA 3PLBA 1VCWA 3C27B 4X1NU 2LNCA 2AGGX 3UWJH 5GDSH 1HAOH 1O3OA 1W8BH 2VH6A 4OGYA 3IITA 3RXTA 5EQSA 3AW0A 1JXPA 5JBBS 1A7SA 1ESTA 1P12E 1MAXA 3RM0H 2F3CE 1GHBG 1O39A 1O2NA 3MO6A 1QB6A 1CQQA 1KSNA 4O97A 1W12U 1V2ST 2EI8A 1GVLA 3U8TH 4Y10E 3V12A 1SQTA 4UFDH 1LHFH 1LPZB 2BY7X 1UTPA 1P09A 1CBWC 1BRUP 1HIAB 3OX7U 1SOZA 1WTGH 3DFLA 4K8BA 3KQCA 1O32A 3RXSA 1RRKA 2XBYA 2ZCHP 1V2TT 1CE5A 1PPBH 2SGFE 1V3XA 1VITH 1YCPM 3A7WA 5DP7A 1K28D 5FX6A 3ESTA 2BB4A 4JYUH 3KCGH 1A5GH 1LDTT 4DG4A 3GY5A 1BT7A 3ZVCA 4XBDA 3QK1A 1ESBA 1QURH 3BTKE 2TIOA 3BTDE 3VB3A 2HNTE 1GBAA 3O8RA 4BXSA 3A8CA 3VGCB 1BTYA 5C5OA 3LGUA 1L0ZA 1D3QB 1BBRH 1SR5C 2PWXA 1OOKB 1UVUH 4MNWA 4VGCC 1NFUA 4Q7XA 2TGPZ 1AWHB 1G3BA 3BSQA 5G4BA 2ANYA 1EATA 3BEUA 1LHCH 1PPHE 1SMFE 2OBQA 5T6FA 4YTAA 2OTVA 3LJOA 1C2KA 1VITF 2NU4E 1UTNA 2VGCC 1P9SA 4YM9A 3A8BA 1MUEB 4O3TA 2FTLE 2D26C 1MU6B 4K1SA 1HJ8A 7ESTE 2FLBH 3EAJA 3PWBA 4MNYA 5EQRA 4X1SU 1E36B 2OINA 2A4GA 1NRQH 2F83A 3CS7A 3TGKE 2QV1A 4AZ2B 4I8GA 1A46H 3Q3KA 2FYRA 3KNXA 1AVWA 2Y82A 3GY3A 2ANWA 1TOMH 2G51A 1DM4B 4X8UH 3TK6A 4ZHLU 1O3MA 1GBIA 4BAMB 4GHQA 8LPRA 3A81A 1O5FH 4Y11E 4BAKB 2B8OH 2ZHWH 1WCZA 2ZCLP 1YPGH 4AGJA 1C2MA 1W7XH 1NM6A 2V3HH 3BTGE 1IHSH 1GCDA 3NUMA 2ZU1A 4K69A 1O2SA 3PMBB 2ZTZA 3KIDU 1PJPA 1ZJKA 3ZZ4A 1TX6A 2FOBA 1DSUA 5L2YH 3RXIA 4RKOB 1QFKH 2QXJA 5DJ7A 1TNGA 1LVBA 5A0BA 4DIIH 2WPMS 1AHTH 3FANA 2BVRH 4ZROA 3M7TA 1O5BB 1B0FA 1TA6A 4CRGA 1CT2E 1C2LA 1Z6JH 1HIAA 1THSH 1OP8A 1OWIA 1GI1A 1N6YA 1ELCA 1GJDB 2HPPH 5F8TA 2ZF0H 4Y76A 5JBTA 1C5NH 1K1JA 2BD2A 1C5PA 3RXRA 2ASUB 3TLOA 1WV7H 4MDSA 1H9HE 4HTCH 4MLFB 3A85A 2AMQA 2Q6GA 2Z94A 3U98H 1ZLRA 2VWLA 1T32A 1GBJA 4AG2A 5LPRA 3RXDA 1C2IA 1IOEA 3RXAA 4ABEA 1ZTKA 1AE8H 1NESE 2Z9LA 3RXPA 3BV9B 2AEIH 4KTUA 2GTBA 1MD7A 1TRNA 1GDNA 5EOKA 2STAE 3W95A 3RMLH 1EP5A 2R3UA 1PQ7A