1HIAA

Kallikrein complexed with hirustasin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
80
Chain Sequence
IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KALLIKREIN
publication title A new structural class of serine protease inhibitors revealed by the structure of the hirustasin-kallikrein complex.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Complex (protease/inhibitor)
total genus 11
structure length 80
sequence length 80
chains with identical sequence X
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1996-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hiaA00
1GI6A 1BTZA 1SQOA 2A7CA 5FX6A 1MAXA 3TGIE 1HIAA 1EZQA 1T4VH 2FYQA 2QXHA 3NZIA 1FPHH 4WJG2 2FOBA 3ZZ4A 3NWUA 1AY6H 1TX7A 1TX6A 2WPHS 4ISOA 4LOYH 2OTVA 4NWKA 2P3UB 5BPEA 5A8XA 4WMFA 3RXIA 1C5RA 1GMDG 2H9HA 1C1SA 1NFYA 5LPRA 1TBRH 4X1RU 4ISLA 2FOHA 1TMTH 3I78A 1G2LA 1O2HA 1V2NT 2V3OH 4GLYA 1F5RA 3RXVA 1A4WH 2HPQH 3ATKA 1HGTH 5E0HA 3N7OA 3UOUA 1PPBH 4WMEA 1O2RA 1QB9A 3CP7A 4K3JA 3AAVA 1BUIA 4CRDA 5A0AE 1EOLA 1GHWH 1GJ5H 5EXNA 2FO9A 3PO1B 1ZGIA 8KME2 2THFB 3ZV9A 2CV3A 3E6PH 2G51A 3P95A 1ELFA 2YNBA 3A80A 1AUTC 2OQ5A 3SV6A 5HMAA 1C1WH 1NTPA 2C8YB 1BTPA 1P01A 2SGAA 3RXHA 2PTCE 1FIWA 4JZIA 5TCCA 2XCFA 1H9HE 1LVYA 1XX9A 1IQNA 1IQIA 1GHXH 3UNQA 2OC7A 1GBDA 1XXFA 2F9BH 2ZDNA 4H4FA 8LPRA 4X2YA 1DM4B 3C1KA 2H9TH 4SGBE 3RM0H 3PO1C 1C2IA 1GJBB 3MH7A 4FXGH 8ESTE 3TNSA 3M3VA 3SQHE 1FDPA 1QURH 1GBHA 3IG6B 1D6RA 4AGJA 3URDA 3SNCA 1LO6A 1NFWA 2BLVA 1EAWA 1OSSA 4B74A 5EPYA 1LKAA 4UD9H 3PMHB 1HCGA 1GJ9B 2PFEA 5HM9A 1ACBE 4AZ2B 1G36A 1KXEA 1ZHRA 2BYAX 3S7KB 2FYRA 3MH5A 1AZ8A 4XDEA 1KIGH 5FPSA 1YPEH 2BOKA 3QZRA 2NU3E 2RDLA 4ESTE 2ALVA 1HV7A 3LU9B 4GSOA 1MZAA 2C90B 2ZHWH 3TLOA 2ZFQH 4U2WA 3VB3A 1ELEE 4U32A 1SG8B 1U6QA 2P8OC 5FPTA 4PROA 1TMBH 2ZNKH 1EASA 1WCZA 1VZQH 3VEQB 1DICA 1A5GH 4XSKU 3MHWU 1W3CA 1KYNA 1L1NA 5E0GA 5A0CA 3VGCB 3K65B 1A0LA 4NIXA 1KLTA 3ZZ7A 2QV1A 4BANB 3UQVA 3BG4B 4HI3A 2XCNA 3ZVBA 2FLBH 1MTSA 3LONA 2VIWA 3JZ2B 1C4U2 2FOGA 2J38A 1DX5M 2BX3A 4X8UH 1GI9B 3D62A 1YM0A 5CMXH 3PM3A 2H6MA 3BTKE 4CRFA 1ZMLA 2BLOA 2HNTE 1Z71A 4JMYA 1TNGA 1C5UA 3B9FH 3SZNA 3D49H 1BITA 2FODA 2I6QA 1ARBA 3VGCC 4Y7AA 2EI6A 3PMAB 5EXMA 1O3CA 5C20A 1QRXA 1SGEE 3BG4C 1H9LB 1UJ1A 2XC0A 3NPSA 4GPGA 1SGFG 4WY3A 4XBBA 2F9OA 2P59A 4KTCA 1HJAB 3Q76A 1CSOE 1NO9H 2XBVA 1C5QA 1QA7A 2Z3EA 3A86A 4X2WA 3SORA 2HVXA 1ZMJA 1IQFA 1SPJA 2F9UA 1J8AA 5C3NA 2BD9A 1EATA 1WTGH 2Z9KA 1EJNA 1ORFA 1GBJA 2KAIA 1LVOA 4IMQA 3M35A 3BV9B 1O3HA 1D9IA 3MNXA 4LZ4B 1PFXC 3EDXB 2R2MB 3A88A 3QWCH 4YESB 1ABIH 1GHBG 1EAIA 1GMHF 1HB0B 1RIWB 5DG6A 1TPAE 1LDTT 1O33A 3BTGE 5AF9H 4ZKSU 4Y0ZE 1QIXB 4O3TA 2J9NA 1ELGA 1GDUA 2Z3CA 2ZU3A 2Y81A 2ZFFH 2ZHFH 1O2VA 2BLQA 1LVBA 2ZDKA 3OU0A 3PMBB 4Y0YE 4GCHF 4K1TA 2BVRH 5ESBA 3GY6A 4RKOB 4HFPB 2GVFA 3ESTA 4YT6H 2Y5GA 4FUDA 4CRGA 2AIQA 1NN6A 1FONA 3RXGA 1OOKB 3E3TA 1RIWC 1ANCA 1RGQA 1T7CA 3BG8A 1ZPCA 1DFPA 2AH4X 3NCLA 2Z94A 3MU5A 4YO9A 1DANH 4Y8XA 1GWAA 1MTUA 1P2KA 1LQEA 3U98H 1CGHA 3GDUA 1ZOMA 3QUMP 1HRTH 1ZSLA 4KP0A 1MZDA 1FV9A 1TGSZ 1PPCE 5B6OA 4I7YH 3P8GA 4AN7A 1ZPZA 1P2QA 3MO3A 1CHOF 4BAOB 3LDXH 5I25A 2G00A 2VVUA 3QGJA 1Q31A 4UE7H 2ZU5A 1S82A 1P9UA 3M37A 3VXEH 1ZTJA 2VWMA 4TY6A 3URCA 1DSTA 1P12E 1CGIE 5H4IB 1RXPA 3MU4A 2SGEE 1BRUP 1IQMA 2FEQH 4CREA 1D3PB 3STIA 1YPJH 4BAMB 5EPNA 2P94A 2ZDLA 1TMUH 3M7TA 3TH3H 3UQOA 4BTTB 2Q1JA 2CF9H 2WUCA 2HGTH 4YOIA 2IPHA 5AFYH 2HWLB 1AIXH 1AFQB 1SLUB 2QYIA 1V2LT 3SHCH 3SOSA 1ELAA 1ZHMA 1WYKA 2VU8E 1YC0A 4WWYA 1C5NH 1P2MA 2BQ7B 3H5CB 4Y6DA 2F9NA 3Q3XA 5JDUB 1GI8B 2RG3A 3A82A 1XXDA 4ZXYH 3TU7H 1BTXA 2FESH 2SNWA 3SHAH 1KDQB 4DT7B 3KHVA 3T5FH 1ZHPA 1GJ8B 1S6FA 2SNVA 5E0JA 1W8BH 1UTKA 2AGEX 2CMYA 1C1VH 1GL0E 2ULLA 5T6GA 3SU4A 2ZWLH 4UFGH 1N1LA 1AFQC 6ESTA 4MPWA 4O03A 2ZFPH 2XC5A 2ZGXH 1NC6A 1PQ7A 3LKWA 2C93B 1HAOH 5F8XA 1QJ7B 2V6NA 4NWLA 3GY4A 3KQEA 1A5IA 1ZR0A 3GCTG 2BM2A 3TK6A 1SGIB 1SLWB 1GHVH 3IITA 3M5LA 3KEEA 2ZF0H 3GY8A 3VB4A 2GZ9A 1KXAA 2A5IA 3CENA 1EXFA 2PLXA 2HPPH 1GBIA 3PLBA 1T32A 3ZZCA 1YLDA 1CHGA 4AB8A 1F0RA 4X6MA 1O3JA 1UVTH 1O2IA 1W10U 1A61H 2A7JA 1P2IA 2GDDA 3T29A 1JWTA 3LOXA 3EAJA 4FUBA 1GI5A 1P3EA 2PSXA 4LK4A 1P09A 1QB1A 1HAGE 1QCPA 2AGGX 2P95A 2XWAA 3BTHE 5DP8A 1Y3VA 3A8DA 3LGWA 4I8HA 1BRCE 2BZ6H 1A0HB 3RXTA 4ISNA 2BD8A 2BDBA 1DWBH 2M5TA 1MTVA 1O3LA 1DUAA 1E37B 1SHHB 3PMJA 2ZFTA 3T27A 5EQSA 2ASUB 2O9QA 5EQRA 1S84A 1C9TA 1GJ6A 1DY9A 1D4PB 4ABJA 3HK6B 3E8LA 4AGKA 1YCPM 1FY4A 4ZH8A 2GT8A 2GZ7A 1WAYB 1KXBA 2QXIA 3P8OA 1TNHA 4KGAA 2XC4A 1GCTB 2A2QH 2ZU4A 4ZHAA 2ZHEH 1DITH 2VIPA 2RA3A 1CVWH 1SGPE 3MO6A 1ZZZA 1GG6B 4FUEA 1UTOA 1CA8B 1P10A 1TE0A 3L33A 4J2YB 1W7XH 1Y3XA 1P02A 1B0FA 1FY1A 4R8TB 2TGAA 4Q7XA 1DWEH 2PTNA 1QQ4A 4JK6A 3RXQA 3K6ZA 5A2MH 1BBRE 5LPFA 2TGDA 2DE8A 2F83A 4KTUA 2JETB 1TFXA 3MWIU 5FXLA 2QA9E 4XBDA 5ESTE 4AORA 1GCTC 2QC2A 4FVBA 1GG6C 5A8ZA 1BHXB 4AFZA 3QDZB 3EQ0H 3MOCA 3P17H 1F5KU 1C2EA 1FXYA 1SL3A 5J4SA 2J2UA 5CHAB 4ABBA 2ZDMA 1N8OB 3K2UA 1C5ZB 4KELA 1E38B 2SGQE 1C2GA 1SFQB 1YPHC 2J92A 3FP8E 4K2YA 1AKSA 3ODDA 1NRPH 4R0IA 2FWWA 3M3TA 1DS2E 4MNWA 4X2VA 1G3DA 1B7XB 1HFDA 1HAZB 1G9IE 1NM6A 1O2QA 2BTCE 2FS8A 1YPLH 2TGPZ 3TITA 3GOVB 1P04A 1G3BA 5DP4A 1S83A 1O3GA 1TGCA 1GGDB 5CHAC 2PUQH 4NGAH 1LHFH 2PKAB 2DUCA 1OWEA 3TH2H 5JBCS 1XUFA 1TNJA 4BNRA 3LC5A 3O8DA 1XMNB 1O2PA 1O3AA 5DJ7A 2P93A 3BSQA 4MQAA 1AZZA 2SGPE 1BCUH 7GCHG 1C5PA 3WY8A 1VITG 5JBTA 1EJMA 1O3OA 1EX3A 5DP5A 2XBXA 4E7RG 1E0FD 1CU1A 2ZKSA 5DK1A 4X1PU 1Y5BT 1ANDA 1ELBA 3PWBA 3S69A 5C67A 3C27B 1GI0A 3HGPA 1HAPH 4AOQA 2QCYA 4YZUA 1O2OA 2CF8H 1PPEE 3UWJH 1PPFE 1FIZA 1YYY1 4D8NA 3LGUA 1RJXB 4NSYA 2QF0A 1IOEA 3FAOA 1UVPA 2ZTZA 5GIBA 3MNSA 2FOCA 2ESTE 1GBEA 1YKTA 2ZPRA 4OS1A 3RUOA 2Y6TA 1GL1A 3ZZ5A 2VWNA 4K1SA 2CHAB 2V3HH 1IAUA 4CRCA 1C2KA 2FPZA 2IOTA 1EOJA 1C5MD 1O5BB 2R3YA 3IWMA 2ZHDA 1PPGE 4Y8YA 5GCHG 1V2QT 1ESBA 3VXFH 1XM1A 4BXSA 2STBE 1SSXA 1NRRH 1UK4A 4B2CA 3PTBA 3SU1A 1C2HA 5EQQA 1O31A 2H2ZA 1P0SH 1HJ8A 4UFDH 1BTWA 3RMLH 5L6NH 2CHAC 3EGKH 4MNVA 3P92A 4JZEH 2BDIA 1W14U 2GCHG 3BTTE 1GDQA 2V0BA 1P57B 1RFNA 1DUEA 1KTTB 1C1QA 1TGNA 1AI8H 2EI8A 3LC3A 5EU8A 2PGBB 2GMTB 3T62A 5J4QA 1C2DA 1X7AC 4BAHB 1FMGA 1O3MA 2GTBA 3Q77A 1H1BA 2D26C 3LJJA 1YP9A 1HXEH 1C4V2 1EUFA 3ZVAA 1ANBA 1OPHB 2HALA 3K9XB 3TJVA 3SBKA 4AB9A 4E06H 3I77A 2RA0A 4TYDA 1S0QA 1M9UA 1A1RA 3BTDE 2QAAA 1RD3B 1DVAH 1AE5A 4TWWA 2P8OB 2GMTC 1G30B 4KKDA 1BA8B 1HAVA 3ZYEA 1OS8A 4ZROA 3MU1A 5EXLA 1P3CA 2FTMA 1ETTH 2EA3A 1GI2A 4WVPE 1O3DA 2WYJA 2IJOB 1BJUA 1O3NA 4NCYA 4NFEA 2PR3A 1GJ4H 1G2MA 1PQAA 1TRYA 1UMAH 5DPAA 1EB1H 3SGAE 2OD3B 1L1GA 3QGNB 1V2JT 2BD4A 8GCHF 1K1NA 3NK8A 4I8GA 2BD2A 4YM9A 1IQLA 1DWCH 2H9EH 2VVVA 1K1PA 4DIHH 1DY8A 3I29A 4JYVH 3NKKA 1F92A 1C5OH 1F0TA 1GPZA 2BXTH 1TQ7B 4UFFH 2ZU1A 1G3CA 4ZKRU 1HBTH 1LTOA 4CRAA 3H7TA 3S9CA 1C1RA 1P11E 1UVUH 5T6DA 4ZXXH 2ZO3H 1AHTH 1O39A 2ZIQH 1VITH 3SUDA 1EB2A 2VNTA 2D1JA 1GBBA 1THPB 1LVMA 1D3QB 2GCTB 2V35A 1LPKB 2QY0B 3HATH 3ZZ9A 1OWKA 4JZDH 5JB8S 4E7NA 2BY6X 1SGDE 1BIOA 4OGXA 1Z1IA 2BY8X 3RXAA 4CH8B 4ABFA 1DXWA 2ZQ2A 2ODPA 1IHSH 4XOJA 5DO4H 3RMNH 6GCHG 1GMDF 1E34B 2ZEBA 4JYTA 3TIUA 4B2AA 1P03A 3GY7A 1TPSA 1EPTB 1ZLRA 3MU8A 4NIWA 1C1OA 1CE5A 2JH5D 1YPHE 2FM2A 4D9QA 2ZP0H 4AFQA 3MH6A 3SJ9A 2O8MA 3W95A 3T2NA 1DXPA 2EEKA 2GCTC 2C3SA 4A1XA 1BMMH 3S0NA 3BEUA 3OY5U 2NU2E 1NPMA 1UTPA 1FLEE 1HIAB 3SI4H 1SI5H 3RC4A 4MPUA 1OKXA 1VCQA 3A7VA 4TPYA 4CR9A 2FP7B 1ARCA 1EPTC 1AVWA 4X6PA 4BOHA 1O2ZA 1T8OA 1DLEA 1ID5H 2ODYB 1D6WA 1ZTKA 2FI5E 4XFQA 2OP9A 3QTOH 3GDVA 1SMFE 1TLDA 1MH0A 4GAWA 4NA8A 2G55A 2XTTB 3E0PB 2VINA 2W3KA 3SU5A 1T8NA 1O5DH 4Y8ZA 3T28A 4JCNA 1UCYE 4ISIH 1C5VA 5F8ZA 3D23A 3DA9B 1OYQA 3M5OA 3ZYDA 3M36A 5F03A 3SNEA 5L2YH 1UTJA 1BTYA 4HTCH 4SGAE 3GYLB 3W94A 3SV8A 1BB0B 1JRSA 1B5GH 2ZU2A 3OSYA 2UUFB 2DE9A 3FP6E 1BZXE 1ZSKA 1Y5UT 1A0JA 1GJCB 5A8YA 1O5GH 1SOTA 3GISB 4FUHA 1TNIA 2GV7A 4WXVA 2J34A 1H8IH 2A4RA 2QF3A 2CXVA 2OC8A 5EW1H 4ISHH 1YCPK 3UWIA 2H5DA 3QZQA 2BDAA 3BTFE 2PUXB 1LQDB 2TGTA 4X8SH 3BTQE 1SGCA 3FZDA 1W13U 4IMZA 1LPZB 3A7YA 5HXFA 1TNKA 3E91A 2WV5A 4AYVB 5LPEA 2Z7FE 2UUYA 3ATLA 1LCYA 1TIOA 1DT2A 3ZZBA 1J9CH 3BF6H 3VB5A 1Y3YA 3T25A 1GCDA 2OBOA 1Q3XA 1IQKA 4M7GA 1K28D 2PSYA 2ZFSA 5GXPA 3SNAA 1EAUA 3RMOH 2QN5T 1THSH 3AAUA 2A4OA 2A7HA 1HAHH 1O5CB 7ESTE 3RXKA 1ETRH 1AVXA 1MTNB 1L1JA 1ZMNA 4IW4E 4UONA 2OLGA 3PLPA 2BQ6B 4OS5A 4THNH 3A89A 4Q80A 1GMCG 2OC1A 1WU1A 1QB6A 1NT1A 1J14A 3RC5A 1TRMA 1PPHE 1JBUH 9LPRA 2FOEA 5IDKA 5BRRE 4AFSA 1OP8A 1MMJN 1OP0A 1IQEA 2A2XH 4AYYB 2GD4B 1GDNA 3PYHA 5GDSH 1NS3A 3M5MA 1MTNC 2XNIA 3BTME 2AS9A 5GJ4B 1D3TB 5PTPA 2BVXH 1QR3E 1KLJH 2FX6A 1V2KT 1VR1H 3KCGH 1E35B 4ZUHA 2A4GA 3RXFA 1A3EH 3M3SA 3SGQE 4ABIA 4INLA 5DGJA 2LNCA 1EKBB 1PQ8A 1MD7A 2R9PA 1Y5AT 4A1VA 3U8RH 3U69H 1SQAA 3ZZ6A 1O3FA 3LGVA 4WH6A 4Y10E 1O5AB 1QBOA 4K8BA 3DFJA 1S6HA 1ESAA 1BRBE 3O8RA 4YOGA 3F9FA 2BD5A 2A32A 2R0KA 2A1DB 1GHBF 1TGTA 1AN1E 1AU8A 4CH2B 1QHRB 1L0ZA 4MDSA 2I6SA 3MFJA 5IYTA 3UFAA 1C9PA 1V2ST 1UK2A 3LT3A 1BMAA 4MTBA 1GHAG 3M7UA 1GHZA 1EJAA 1WQSA 3B23B 1ETSH 1VJAU 1CGJE 2AMDA 2D8WA 3RXCA 1HAXB 4A6LA 1GBFA 2D2DA 1K1OA 3SU0A 2KAIB 3RM2H 3SJKA 4X1QU 2BZAA 2FI3E 1SVPA 3ZVFA 2G4UA 4A1TA 2FS9A 4IC5A 4D76A 1O30A 1P2NA 4E05H 3SJIA 1YCPH 2GDEH 1EQ9A 1ESTA 1DDJA 5C2ZA 5F8TA 1C4Y2 5K0HA 1P05A 1Z8GA 1F2SE 4AX9H 3MYWA 1ZRKA 2FTLE 1INCA 3E16B 5TCAA 3ZZAA 1FZZA 2VB0A 2AEIH 1O2UA 4F49A 4KTSA 3SUFA 2QXJA 2FIRH 2W26A 1DOJA 4Y71A 1MCTA 5FHTA 2ZGJA 3BIUH 1TABE 2F9PA 1SGNE 3UPEA 4DG4A 3LIWA 5HM2A 4TWYA 1LKBA 1O2XA 2WUBA 3VB6A 1AMHA 3ATMA 1O5EH 1MKXH 4IS5A 4Q2KA 1O36A 3E1XB 2AMPA 1YPGH 4WXIA 4X0WU 1MQ5A 1EP6A 1KY9A 1UO6A 1IQGA 3SNBA 3KQBA 3TK5A 1CT2E 1TBQH 2BLWA 4I32A 3RMMH 3DD2H 1WOFA 2XW9A 4H42U 5FX5A 5ETXA 4DCDA 2EI7A 4MLFB 2EC9H 1FAXA 4F4OC 2HOBA 3HK3B 3Q00A 3RXJA 4BAKB 3M61U 3ELAH 4IN2A 3ZZDA 1OXGA 1YLCA 3L6PA 4Z0KA 3V12A 1WV7H 1KXDA 1CBWB 1JIMA 4RSPA 2AIPA 3NUMA 1ZJKA 1QQUA 3RU4D 2VIDA 2SGFE 3RU4T 1TONA 4UEHH 1V2WT 4NSVA 3UOPA 2CGAA 4BAQB 1UTQA 3M5NA 3MH4A 3GY3A 3UNRA 3PWCA 1WBGB 1AD8H 1S81A 3RXLA 2BDCA 3A8AA 3T26A 3KN2A 1ELDE 2A5AA 1A5HA 1BBRH 4CHAB 1CBWC 1BT7A 1VGCB 3RLYH 1V2TT 2TBSA 2FDAA 3GCTF 3PV4A 2J4IA 4ABDA 1AB9C 1TALA 2OCVB 1B0EA 1NRSH 2G8TA 2BOHB 1ELTA 1FY3A 2BB4A 4NA9H 1OX1A 3KQCA 1MKWH 3SJ8A 1G32B 1TPPA 1GVZA 2JH0D 2AMQA 3BTWE 3GDSA 2FI4E 5AHGH 1MQ6A 2G4TA 1UVOA 1BTHH 1FUJA 1O32A 4YTAA 1K22H 4FUJA 2VWLA 4CHAC 2PKSB 2ZGCA 5JPMH 1VGCC 2TPIZ 4FU7A 1SB1H 3G01A 2GX4A 1UVSH 3FP7E 2ZTYA 3SI3H 3RXPA 4YLUA 4BTIB 2B0FA 3U8TH 1UK3A 1TA2A 3TJUA 2P3TB 2BHGA 4Q7ZA 1LHCH 5C5NA 3F9EA 2Q6GA 4TY7A 2ZI2H 1FNIA 1UTNA 2VWOA 1KXCA 1W12U 1C5LH 5K7RA 3FANA 1BRAA 3BTEE 3RXMA 3LGTA 5DP6A 5JYIA 1TYNA 1UTMA 2H5CA 1H8DH 2WPMS 2PKSC 1QGFA 3DUXH 3R0FA 4O9VA 2Z6BD 4K8YA 4MPVA 2BMGB 1JOUB 2GGVB 5ABWA 1HLTH 3GY2A 3A87A 2BY9X 1TOMH 6CHAB 3AASA 1V2VT 3EA8A 4U01A 3OYPA 1QNJA 1O0DH 2OINA 1P2OA 3FVFB 1XKBC 3HKJB 1MCVA 1J17T 5C1UA 2Q6FA 1JRTA 2VGCB 2WPLS 1BMNH 2G5NA 1LMWB 1GBLA 1FJSA 4AG2A 5FCKA 1C2JA 1OWIA 4JZFH 2Y7XA 1YBWA 2A45B 1QL8A 3SO3A 3BN9A 3U8OH 2AGIX 4WH8A 6CHAC 2OUAA 3SV9A 3RXEA 2ZHQH 1SGRE 4OS6A 2F3CE 1F0SA 4FU9A 3STJA 1SBWA 1HYLA 4Q7YA 1QFKH 1O2LA 2UUKB 4INHA 1K1LA 4DOQA 2VGCC 1NROH 1GMHG 1WUNH 1V3XA 3ZZ3A 3HKIB 4CR5A 1IQHA 1FI8A 1XVOA 1ABJH 1VCWA 1MD8A 1ZGVA 4X2XA 4CBOA 4Y7BA 1IHTH 4K60A 1O3EA 5HYOA 1C5WB 2Y5FA 3JZ1B 7LPRA 3RXRA 1UHBA 4GCHG 5A09A 3PTNA 1T8MA 3MNCA 5GPIB 1GVKB 4X8TH 1C2FA 4FUGA 1O34A 3ODFA 4FU8A 1ZSJA 1OP2A 2FMJA 3RU4E 2ZECA 4D7FA 5C1XA 3QTVH 5A0BA 1NU7B 2A31A 2BVSH 3SV2H 3P70B 4B71A 1TB6H 2G81E 5FBIA 3Q3YA 1TA6A 1NRQH 2UWLA 3F68H 3BIVH 1F7ZA 2PW8H 9ESTA 2ZFRH 3MO9A 3DFLA 3EA9A 1FAKH 4X1NU 1FN8A 2VIVA 1NFXA 1FY8E 4I8LA 1HJ9A 3OY6U 5JB9S 4MG3A 3F9GA 1UCYK 3VFEA 3ZVGA 2FZZA 4I31A 7GCHF 2XYAA 1EP5A 1MBQA 3SV7A 1CHOG 1VITF 3GICB 2UWOA 1AKSB 1XUKA 4MNXA 4YT7H 3RP2A 1YGCH 4OS7A 1AO5A 2C8ZB 3TJOA 2UUJB 1O3IA 2GP9B 2GKVE 3KL6A 3BEIB 1YF4A 1KDQA 1W0ZU 4Y11E 2C4FH 3RC6A 4HZHA 1EZSC 5FBEA 4DJZB 4O97A 3RLWH 2O8LA 1AQ7A 4H6TA 1C1UH 4TPIZ 4B73A 2BXUH 4J1YA 3V0XA 2ANYA 3HGNA 4FUIA 2W5EA 2Z9IA 1YPMH 2BD3A 4D9RA 1VJ9U 1TOCB 5EODA 3RDZA 3BEFB 2ZA5A 2Z3DA 1MUEB 4JYUH 4CBNA 1TQ0B 1P06A 1DPOA 1RS0A 2FXRA 1TX8A 2QXGA 5LH8A 1K1MA 2R0LA 2XRCA 1HPGA 4OS4A 3MI4A 4ZKOU 2LPRA 5EGMA 1L4DA 4Z6AH 2PHBA 2RCEA 1JMOH 5SGAE 5GCHF 1UTLM 2STAE 1T4UH 2HNTF 2XWBI 3MU0A 2P16A 3UUZA 2O8TA 1CQQA 1RTLA 1NY22 5CE1A 3V3MA 1TPOA 2ZDVH 2ZPQA 3SU3A 4X6NA 1MU8B 1O3PB 2OC0A 4OGYA 4ABGA 5AFZH 3QK1A 2G52A 3MTYA 1SGTA 3PB1E 2VH6A 3FZZA 3ZVEA 2BX4A 4GUXA 3RXUA 2GCHF 1EAXA 3LGIA 4QT8C 3GY5A 1BHXF 3TJNA 3KQDA 5FAHA 4MNYA 2FLRH 2AYWA 1O2SA 2VH0A 3TK9A 1SLXB 4B76A 3SNDA 1D3DB 2B8OH 3PLKA 4YLQH 1C2LA 1O2MA 2ZCHP 2XXLA 1FN6A 1FY5A 5L2ZH 3P6ZB 1HJAC 1O2YA 5DP3A 5FCRA 1C1PA 1K1IA 5JBBS 1NFUA 4RN6A 4B75A 5E8EH 1RRKA 1QJ6B 1TRNA 4XBCA 2ZCLP 4K5ZA 5T6FA 3F9HA 1W0YH 1QBVH 1QL7A 1GHYH 2B7DH 1GVLA 1QA0A 1SLVB 1OWHA 1GI3A 1AFEH 1ANEA 5EOKA 4K69A 1XVMA 4D7GA 1RTKA 4CRBA 3SUEA 2ALPA 1O2NA 3ATWA 4WMDA 4X6OA 2B5TB 1XUIA 1O2TA 2ZGHA 4X8VH 1CT0E 5E2OA 3GCOA 1Z8JB 1DSUA 1ELCA 3SGBE 2W3IA 1SFIA 2A0QB 1HUTH 1K2I1 1BJVA 4LXBH 2NU0E 1A3BH 1O5FH 4O3UA 1O37A 4H6SB 1TNLA 4FUFA 2Q6DA 1O38A 1SGQE 4MPXA 1UCYH 1YPKH 1SOZA 2TRMA 3UTUH 2OBQA 2ODQA 1Z8RA 3PROA 2HRVA 4LZ1H 1VCPA 3E90B 1SR5C 1MKXK 1UHBB 3AVZA 1W11U 2Z9JA 3UREA 1N6XA 1OWJA 4K1EA 1O2GH 5EG4A 5LGOA 1HAVB 3EYDA 1F0UA 1MAYA 3O8BA 4A7IB 3TGJE 1KSNA 4ABHA 5G4BA 4DY7B 6LPRA 3TVJB 1Y59T 1AUJA 1FPCH 1HAYB 2QGRA 2WPIS 4X1SU 1XKAC 1WQVH 1XUJA 3A7ZA 4ABEA 3M7QA 1GJAB 1L4ZA 5EW2H 1GI7B 3H7OA 2ZTXA 4I8JA 1GI4A 3DT0H 4UFEH 1W7GH 2ZPSA 2ZCKP 5I46H 3KF2A 2QIQA 1AE8H 1O2JA 6GCHF 3SUGA 3EE0B 1HDTH 3R3GB 3UNSA 2PWXA 2P3FH 4NFFA 3QN7A 3ENSB 4ZHMU 1QRZA 4DW2U 2BD7A 1V2OT 1P2JA 4MVNA 1W2KH 2BQWB 1LHEH 3B8JA 1PQ5A 4NZLA 1SQTA 4NG9H 2PKAA 4NA7A 3F1SB 2H1UA 4BXWA 4FUCA 1TBZH 4A92A 2GT7A 2Y7ZA 2J94A 3GCHB 1NZQH 2WYGA 2ZC9H 1H9IE 2SFAA 2VIOA 2WPJS 1BBRK 1THRH 3A85A 2FOAA 2AERH 4DIIH 2ZGBH 4AG1A 1PYTC 4IN1A 1K1JA 4JZ1A 2XBYA 4IC6A 4I8KA 2J95A 2BDGA 1CT4E 1BTUA 3KIDU 1GI1A 1GJ7B 1KXFA 2JH6D 4DVAU 1J15A 2Z9GA 3MNBA 2FX4A 3A84A 1TGBA 1MKWK 4WF8A 3SQEE 3S9BA 1AGJA 1N6YA 4XE4A 2IN2A 1LHDH 3GCHC 3Q3KA 2C8XB 1BDAA 3RXOA 4FVDA 2ZG0H 4IGDA 1ZPBA 3ITIA 1H4WA 3UIRA 1C5XB 3U9AH 1V2MT 3UY9A 1C1NA 1Z6JH 2HLCA 1MTWA 3LH3A 1DLKB 1Q2WA 1NRNH 2AFQB 2R2WU 1ZYOA 4DGJA 2VVCA 4YOJA 1EZXC 4AFUA 4NIVA 1A2CH 3E0NB 2W7SA 3TH4H 4IBLH 3CS7A 3QX5H 3LJOA 2ANKH 1RTFB 2NWNA 1KLIH 1A7SA 3K6YA 1SGFA 5L30H 5C5OA 1V2PT 2WINI 5F6MA 3OTJE 1QL9A 1Y3WA 3GCNA 1S85A 5DP7A 1F5LA 1CA0B 1PYTD 1QTFA 3CS0A 1O35A 3A7XA 3NXPA 1V2RT 3S9AA 1C5TA 4Y79A 1P9SA 3U1IB 3ZVDA 1P8VC 1C5YB 3RXDA 1C5SA 4GHQA 3TGKE 7KMEH 1BOQA 3SJOA 4I33A 5DP9A 1HAIH 5E2PA 2R3UA 2ZDAH 2C8WB 2ANWA 1WTHD 1G37A 1L2EA 4ZHLU 2CN0H 3ZVCA 1C1MA 1HNEE 1SC8U 1XUGA 2VIQA 1QRWA 1O3KA 3F6UH 1TWXB 2WV4A 2Z9LA 1G3EA 2YOLA 3A8BA 2Y5HA 3KNXA 3MMGA 2Y82A 3RXBA 1NESE 1AVGH 3TPIZ 3V7TA 3KGPA 1LHGH 3LPRA 4A5TS 4ZKNU 1CA0C 3FFGA 2A5KA 2VJ1A 2JKHA 3A7TA 3ZV8A 1O2WA 4INKA 2PV9B 1DE7H 1JIRA 4UDWH 1V6DA 1GMCF 1ZJDA 2CJIA 2PGQB 2BDHA 3HPTB 1GBTA 1Y3UA 1V2UT 4ZMAH 1S5SA 3A83A 2B9LA 1TAWA 1ZTLA 2G5VA 4OS2A 4ABAA 1AB9B 1Z8IB 2FOFA 1T8LA 1JXPA 2ZZUH 1T31A 3P8FA 1SHYA 2NU4E 2F91A 2BY7X 2NU1E 4ASHA 4U30A 5JBAS 1KTSB 1ZRBA 3L3TA 4HGCA 3AW0A 2ZQ1A 1MBMA 3SW2B 4NIYA 1A46H 1DWDH 2HNTC 3QLPH 1OYTH 5TJXA 3UR9A 1GJDB 3TNTA 1OWDA 1ELVA 1EZUC 1XUHA 5HGGA 1K21H 3OX7U 5AVDA 1FQ3A 2F9VA 3A8CA 4ZAEA 2JETC 5C1YA 3SU6A 3ZZ8A 4BTUB 5DKMA 2OXSA 2O8WA 1Y8TA 1AWHB 2O8UA 2FOMB 1SGYE 1NU9A 2BDYA 3SN8A 3RXSA 4Y76A 1GBAA 3GYMA 3V13A 4NZQA 4B1TA 1IQJA 2A4QA 1QY6A 3U1JB 1BQYA 5T3HA 1PPZA 3A81A 1C2MA 4GHTA 1WSSH 4VGCB 3S7HB 3UR6A 1GHAF 1LPGB 1QBNA 2OQUA 3LGYA 3EA7A 1N8OC 1K9OE 1QJ1B 1GBMA 2YNAA 8GCHG 1O2KA 1Z1JA 2K1QA 2ANMH 2TIOA 1HXFH 3ATIA 1C1TA 2GV6A 2UWPA 3AW1A 5FPYA 3SU2A 3O8CA 1GBKA 1MU6B 3DHKH 4JK5A 2SGDE 4DURA 1EPTA 5GWZA 3VPKA 2W7UA 2BY5X 2Y80A 1CO7E 3P8NA 1J16A 1PJPA 3VB7A 4GVUA 1GGDC 1Z6EA 2XBWA 1GBCA 4VGCC 1BMLA 2WPKS 4RKJB 1E36B 1AWFH 1O3BA 2ILNA 2GZ8A 4B2BA 1S0RA 3QO6A 3D65E 3LH1A 3A7WA 1Z7KA
chains in the Genus database with same CATH superfamily
1GI6A 1BTZA 1SQOA 2A7CA 5FX6A 1MAXA 3TGIE 1HIAA 1EZQA 1T4VH 2FYQA 2QXHA 3NZIA 1FPHH 4WJG2 2FOBA 3ZZ4A 3NWUA 1AY6H 1TX7A 1TX6A 2WPHS 4ISOA 4LOYH 2OTVA 4NWKA 2P3UB 5BPEA 5A8XA 4WMFA 2KFWA 3RXIA 1C5RA 1GMDG 2H9HA 1C1SA 1NFYA 2RFKC 5LPRA 1TBRH 4X1RU 4ISLA 2FOHA 1TMTH 3I78A 1G2LA 1O2HA 1V2NT 2V3OH 4GLYA 1F5RA 3RXVA 1A4WH 2HPQH 3ATKA 1HGTH 5E0HA 3N7OA 3UOUA 1PPBH 4WMEA 1O2RA 1QB9A 3CP7A 4K3JA 3AAVA 1BUIA 4CRDA 5A0AE 1EOLA 1GHWH 1GJ5H 5EXNA 2FO9A 3PO1B 1ZGIA 8KME2 2THFB 3FKSD 3ZV9A 2CV3A 3E6PH 2G51A 2GJGA 3P95A 1ELFA 2YNBA 3A80A 1AUTC 2OQ5A 3SV6A 5HMAA 1C1WH 1NTPA 2C8YB 1BTPA 1P01A 2SGAA 3RXHA 2PTCE 1FIWA 4JZIA 5TCCA 4DT4A 2XCFA 1H9HE 1LVYA 1XX9A 1IQNA 1IQIA 1GHXH 3UNQA 2OC7A 1GBDA 1XXFA 2F9BH 2ZDNA 4H4FA 8LPRA 4X2YA 1DM4B 2KX4A 3C1KA 2H9TH 4SGBE 3RM0H 3PO1C 1C2IA 1GJBB 3MH7A 4FXGH 8ESTE 3TNSA 2EQNA 3M3VA 3SQHE 1FDPA 1QURH 1GBHA 3IG6B 1D6RA 4AGJA 3URDA 3SNCA 1LO6A 1NFWA 2BLVA 1EAWA 1OSSA 2F4LA 4B74A 5EPYA 1LKAA 4UD9H 3PMHB 1HCGA 1GJ9B 2PFEA 5HM9A 1ACBE 4AZ2B 1G36A 1KXEA 1ZHRA 3H09A 2BYAX 3S7KB 2FYRA 5EJLA 2VBCA 3MH5A 1AZ8A 4XDEA 1KIGH 5FPSA 1YPEH 2BOKA 3QZRA 2NU3E 2RDLA 4ESTE 2ALVA 3FO8D 3PRDA 1HV7A 3LU9B 4GSOA 1MZAA 2C90B 2ZHWH 3TLOA 2ZFQH 4U2WA 3VB3A 1ELEE 4U32A 1SG8B 1U6QA 2P8OC 5FPTA 4PROA 1TMBH 2ZNKH 1EASA 1WCZA 1VZQH 3VEQB 1DICA 1A5GH 4XSKU 3MHWU 1W3CA 1KYNA 1L1NA 5E0GA 5A0CA 3VGCB 3K65B 1A0LA 4NIXA 1KLTA 3PRBA 2QV1A 3ZZ7A 4BANB 2J98B 3UQVA 3BG4B 4HI3A 2XCNA 3ZVBA 2FLBH 1MTSA 3LONA 2VIWA 3JZ2B 1C4U2 2FOGA 2J38A 1DX5M 2BX3A 4X8UH 1GI9B 3D62A 1YM0A 5CMXH 3PM3A 2H6MA 3BTKE 4CRFA 1ZMLA 2BLOA 2HNTE 1Z71A 4JMYA 1TNGA 1C5UA 3B9FH 3SZNA 3D49H 1BITA 2FODA 2I6QA 1ARBA 3VGCC 4Y7AA 3F3BA 2EI6A 3PMAB 5EXMA 1O3CA 5C20A 1QRXA 1SGEE 3BG4C 1H9LB 1UJ1A 2XC0A 3NPSA 4GPGA 1SGFG 4WY3A 4XBBA 2F9OA 2P59A 4KTCA 1HJAB 3DCLA 3Q76A 1CSOE 1NO9H 2XBVA 1C5QA 1QA7A 2Z3EA 3A86A 4X2WA 3SORA 2HVXA 1ZMJA 1IQFA 1SPJA 2F9UA 1J8AA 5C3NA 2BD9A 1EATA 1WTGH 2Z9KA 1EJNA 1ORFA 1GBJA 5DSFA 2KAIA 1S6LA 1LVOA 4IMQA 3M35A 3BV9B 1O3HA 1D9IA 3MNXA 4LZ4B 1PFXC 3EDXB 2R2MB 3A88A 3QWCH 4YESB 1ABIH 1GHBG 1EAIA 1GMHF 1HB0B 1RIWB 5DG6A 1TPAE 1LDTT 1O33A 3BTGE 5AF9H 4ZKSU 4Y0ZE 1QIXB 4O3TA 2J9NA 1ELGA 1GDUA 2Z3CA 2ZU3A 2Y81A 2ZFFH 2ZHFH 3OAAD 1O2VA 2BLQA 1LVBA 2ZDKA 3OU0A 3PMBB 4Y0YE 4GCHF 4K1TA 2BVRH 5ESBA 3GY6A 4RKOB 4HFPB 2GVFA 3ESTA 4YT6H 2Y5GA 4FUDA 4CRGA 2AIQA 1NN6A 1FONA 3RXGA 1OOKB 3E3TA 1OHHD 1RIWC 1ANCA 1RGQA 1T7CA 3BG8A 1ZPCA 1DFPA 2AH4X 2JIZD 3NCLA 2Z94A 3MU5A 4YO9A 1DANH 4Y8XA 1GWAA 1MTUA 1P2KA 1LQEA 3U98H 1CGHA 3GDUA 1ZOMA 3QUMP 1HRTH 1ZSLA 4KP0A 1MZDA 1FV9A 1TGSZ 1PPCE 1YLNA 5B6OA 4I7YH 3P8GA 4ASUD 4AN7A 1ZPZA 1P2QA 3MO3A 1CHOF 1H8ED 4BAOB 3LDXH 5I25A 2G00A 2VVUA 3QGJA 1Q31A 4UE7H 2ZU5A 1S82A 1P9UA 3M37A 3VXEH 1ZTJA 2VWMA 4TY6A 3URCA 1DSTA 1P12E 1CGIE 5H4IB 1RXPA 3MU4A 2SGEE 1BRUP 1IQMA 2FEQH 4CREA 1D3PB 3STIA 1YPJH 4BAMB 5EPNA 2P94A 2ZDLA 1TMUH 3M7TA 3TH3H 3UQOA 4BTTB 2Q1JA 2CF9H 2WUCA 2HGTH 4YOIA 2IPHA 5AFYH 2HWLB 1AIXH 1AFQB 1SLUB 2QYIA 1V2LT 3SHCH 3SOSA 1ELAA 1ZHMA 1WYKA 2VU8E 1YC0A 4WWYA 1C5NH 1P2MA 2BQ7B 4I86A 3H5CB 4Y6DA 2F9NA 3Q3XA 5JDUB 1GI8B 2RG3A 3A82A 1XXDA 4ZXYH 3TU7H 1BTXA 2FESH 2SNWA 3SHAH 1KDQB 4DT7B 5C0TA 3KHVA 3T5FH 1ZHPA 1GJ8B 1S6FA 2SNVA 5E0JA 1W8BH 1UTKA 2AGEX 2CMYA 1C1VH 1GL0E 2ULLA 5T6GA 3SU4A 2ZWLH 4UFGH 1N1LA 1AFQC 6ESTA 4MPWA 4O03A 2ZFPH 2XC5A 2ZGXH 1NC6A 1PQ7A 2HLDD 3LKWA 2C93B 1HAOH 5F8XA 1QJ7B 2V6NA 4NWLA 3GY4A 3KQEA 3WWBA 1A5IA 1ZR0A 3GCTG 2BM2A 3TK6A 1SGIB 1SLWB 1GHVH 3IITA 2J5UA 3M5LA 3KEEA 2ZF0H 3GY8A 3VB4A 2GZ9A 1KXAA 2A5IA 3CENA 1EXFA 2PLXA 2HPPH 2F43B 1GBIA 3PLBA 1T32A 3ZZCA 1YLDA 1CHGA 4AB8A 1F0RA 2XNDD 4X6MA 1O3JA 1UVTH 1O2IA 1W10U 1A61H 2A7JA 5HIZA 1P2IA 2GDDA 3T29A 1JWTA 3LOXA 3EAJA 4FUBA 1NBMD 1GI5A 1P3EA 2PSXA 4LK4A 1P09A 1QB1A 1HAGE 1QCPA 2AGGX 2P95A 2XWAA 3BTHE 5DP8A 1Y3VA 3A8DA 3LGWA 4I8HA 1BRCE 2BZ6H 1A0HB 2L74A 3RXTA 4ISNA 2BD8A 2BDBA 4P00A 1DWBH 2M5TA 1MTVA 1O3LA 1DUAA 1E37B 1SHHB 3PMJA 2ZFTA 1SQRA 3T27A 5EQSA 2ASUB 2O9QA 2W6JD 5EQRA 1S84A 1C9TA 1GJ6A 2CK3D 1DY9A 1D4PB 4ABJA 3HK6B 3E8LA 4AGKA 1YCPM 1FY4A 4ZH8A 2GT8A 2GZ7A 1WAYB 2RDEA 1KXBA 2QXIA 3P8OA 1TNHA 4KGAA 2XC4A 1GCTB 2A2QH 2ZU4A 4ZHAA 2ZHEH 1DITH 2VIPA 2RA3A 1CVWH 1SGPE 3MO6A 1ZZZA 1GG6B 4FUEA 1UTOA 1CA8B 1P10A 1TE0A 3L33A 4J2YB 1W7XH 1Y3XA 1P02A 1B0FA 1FY1A 4R8TB 2TGAA 4Q7XA 1DWEH 2PTNA 1QQ4A 4JK6A 3RXQA 3K6ZA 4RI0A 5A2MH 1BBRE 5EJ1A 5LPFA 2TGDA 2DE8A 4RT1A 2F83A 4KTUA 2JETB 1TFXA 3MWIU 5FXLA 2QA9E 4XBDA 5ESTE 4AORA 1GCTC 2QC2A 5DN6D 4FVBA 1GG6C 5A8ZA 1K0HA 1BHXB 4AFZA 3QDZB 3EQ0H 3MOCA 3P17H 1F5KU 1C2EA 1FXYA 1SL3A 5J4SA 2J2UA 5CHAB 4ABBA 2ZDMA 1N8OB 3K2UA 1C5ZB 4KELA 1E38B 2SGQE 1C2GA 1SFQB 1YPHC 2J92A 3FP8E 3KQ5A 4K2YA 1AKSA 3ODDA 1NRPH 4R0IA 3NRLA 2FWWA 3M3TA 1DS2E 4MNWA 4X2VA 1G3DA 1B7XB 1HFDA 1HAZB 1G9IE 1NM6A 1O2QA 2BTCE 2FS8A 1YPLH 2TGPZ 3TITA 3GOVB 1P04A 1G3BA 5DP4A 1S83A 1O3GA 1TGCA 1GGDB 5CHAC 2PUQH 4NGAH 1LHFH 5CHBA 2PKAB 2DUCA 1OWEA 3TH2H 5JBCS 1XUFA 1TNJA 4BNRA 3LC5A 3O8DA 1XMNB 1O2PA 1O3AA 5DJ7A 2P93A 3BSQA 4MQAA 1AZZA 2SGPE 2V3MA 1BCUH 7GCHG 1C5PA 3WY8A 1VITG 4B6FA 5JBTA 1EJMA 1O3OA 1EX3A 5DP5A 2XBXA 4E7RG 1E0FD 1CU1A 2ZKSA 5DK1A 4X1PU 1Y5BT 1ANDA 1ELBA 2JJ2D 4AC9A 3PWBA 3S69A 5C67A 3C27B 1GI0A 3HGPA 1HAPH 4AOQA 2QCYA 4YZUA 1O2OA 2CF8H 1PPEE 3UWJH 1PPFE 1FIZA 1YYY1 4D8NA 3LGUA 1RJXB 4NSYA 4ACBA 2QF0A 1IOEA 3FAOA 1UVPA 2ZTZA 5GIBA 3MNSA 4F48B 2FOCA 2ESTE 1GBEA 1YKTA 2KM0A 2ZPRA 4OS1A 3RUOA 1YWUA 2Y6TA 2W6ID 1GL1A 3ZZ5A 2VWNA 4K1SA 4F55A 2CHAB 3PV2A 2V3HH 1IAUA 4CRCA 1C2KA 2FPZA 2KCYA 2IOTA 1EOJA 1C5MD 1O5BB 2R3YA 3IWMA 2ZHDA 1PPGE 4Y8YA 5GCHG 1V2QT 1ESBA 3VXFH 1XM1A 4BXSA 2STBE 1SSXA 3OFND 1NRRH 1UK4A 4B2CA 3PTBA 3SU1A 3FN8A 1C2HA 5EQQA 1O31A 2WZQA 2H2ZA 1P0SH 1HJ8A 3W1EA 4UFDH 1BTWA 3RMLH 3ZIAD 5L6NH 2CHAC 3EGKH 3OE7D 4MNVA 3P92A 4JZEH 2BDIA 1W14U 2GCHG 3BTTE 1GDQA 2V0BA 1P57B 1RFNA 1DUEA 1KTTB 1C1QA 1TGNA 1AI8H 2EI8A 3LC3A 5EU8A 2PGBB 2GMTB 3T62A 5J4QA 1C2DA 1X7AC 4BAHB 1FMGA 1O3MA 2GTBA 3Q77A 1H1BA 2D26C 3LJJA 1YP9A 1HXEH 1C4V2 1EUFA 3ZVAA 1ANBA 1OPHB 4XRNA 2HALA 3K9XB 3TJVA 3SBKA 4AB9A 4E06H 3I77A 2RA0A 3KYFA 4TYDA 1S0QA 1M9UA 1A1RA 3N7DA 3BTDE 2QAAA 1RD3B 1DVAH 1AE5A 4TWWA 2P8OB 2GMTC 1KMHB 1G30B 4KKDA 1BA8B 1HAVA 3ZYEA 1OS8A 4ZROA 3MU1A 4TSFD 5EXLA 1P3CA 2FTMA 1ETTH 2EA3A 1GI2A 4WVPE 1O3DA 2WYJA 2IJOB 1BJUA 1O3NA 4NCYA 4NFEA 4B6EA 2PR3A 1GJ4H 2KCOA 1G2MA 1PQAA 1TRYA 1UMAH 5DPAA 1EB1H 3SGAE 2OD3B 1L1GA 3QGNB 1EFRD 1V2JT 2BD4A 8GCHF 1K1NA 3NK8A 4I8GA 2BD2A 4YM9A 1IQLA 1E79D 1DWCH 2H9EH 2VVVA 1K1PA 4DIHH 1DY8A 3I29A 4JYVH 2OK5A 3NKKA 1F92A 1C5OH 1F0TA 1GPZA 2BXTH 1TQ7B 5IK2D 4UFFH 2ZU1A 1G3CA 4ZKRU 1HBTH 1LTOA 4CRAA 3H7TA 3S9CA 1C1RA 1P11E 2K8IA 4Q63A 1UVUH 5T6DA 4ZXXH 2ZO3H 1AHTH 1O39A 2ZIQH 4Q4LA 1VITH 3SUDA 1EB2A 2VNTA 2D1JA 1GBBA 1MABB 1LVMA 1THPB 1D3QB 2GCTB 2V35A 1LPKB 2QY0B 3HATH 2IPQX 3ZZ9A 1OWKA 4JZDH 5JB8S 4E7NA 2BY6X 1SGDE 1BIOA 4OGXA 1W0JD 1Z1IA 2BY8X 3RXAA 4CH8B 4ABFA 1DXWA 2ZQ2A 2ODPA 1IHSH 4XOJA 5DO4H 3RMNH 6GCHG 1GMDF 1E34B 2ZEBA 4JYTA 3TIUA 4B2AA 1P03A 3GY7A 1TPSA 1EPTB 1ZLRA 3MU8A 4NIWA 1C1OA 1CE5A 2JH5D 1YPHE 2FM2A 4D9QA 2ZP0H 4AFQA 4YXWD 3MH6A 3SJ9A 2O8MA 3W95A 2KCAA 1DXPA 2EEKA 2GCTC 3T2NA 2C3SA 4A1XA 1BMMH 3S0NA 3BEUA 3OY5U 2NU2E 1NPMA 3CNRA 1UTPA 1FLEE 1HIAB 3SI4H 1SI5H 3RC4A 4MPUA 1OKXA 1VCQA 3A7VA 4TPYA 4CR9A 2FP7B 1ARCA 1EPTC 1AVWA 4X6PA 4BOHA 1O2ZA 1T8OA 1DLEA 1ID5H 2ODYB 1D6WA 1ZTKA 2FI5E 4XFQA 2OP9A 3QTOH 3GDVA 1SMFE 1TLDA 1MH0A 4GAWA 4NA8A 3F0OA 2G55A 2XTTB 3E0PB 2VINA 2W3KA 1WDIA 3SU5A 1T8NA 1O5DH 4Y8ZA 3T28A 4JCNA 1UCYE 4ISIH 1C5VA 5F8ZA 3D23A 3DA9B 3MQKC 1OYQA 3M5OA 3ZYDA 3M36A 5F03A 3SNEA 2WPDD 5L2YH 1UTJA 1BTYA 4HTCH 2LELA 3GYLB 4SGAE 3W94A 3SV8A 1BB0B 1JRSA 1B5GH 2ZU2A 3OSYA 2UUFB 2DE9A 1VKYA 1BZXE 1ZSKA 1Y5UT 1A0JA 1GJCB 3FP6E 5A8YA 1O5GH 1SOTA 3GISB 4FUHA 1TNIA 2GV7A 4WXVA 2J34A 1H8IH 2A4RA 2QF3A 2EY4C 2CXVA 2OC8A 5EW1H 2K0QA 4ISHH 1YCPK 3UWIA 2H5DA 4M9FA 3QZQA 2BDAA 3BTFE 2PUXB 1LQDB 2TGTA 4X8SH 3BTQE 1SGCA 3FZDA 1W13U 4IMZA 1LPZB 3DSOA 3A7YA 5HXFA 1TNKA 3E91A 5C0UA 2WV5A 4AYVB 5EJZA 5LPEA 2Z7FE 2UUYA 3ATLA 1LCYA 1TIOA 1DT2A 3ZZBA 1J9CH 3BF6H 3VB5A 1Y3YA 1WXRA 3T25A 1GCDA 2OBOA 3AK5A 1Q3XA 1IQKA 4M7GA 1K28D 2PSYA 2ZFSA 5GXPA 3SNAA 1EAUA 3RMOH 2QF4A 2QN5T 1THSH 3UAIC 3AAUA 2A4OA 2A7HA 1HAHH 1O5CB 7ESTE 3RXKA 1ETRH 1AVXA 1MTNB 2V7QD 1L1JA 1ZMNA 4IW4E 4UONA 2OLGA 3PLPA 2BQ6B 4OS5A 4THNH 3A89A 4Q80A 1GMCG 2OC1A 1WU1A 3N99A 1QB6A 1NT1A 1J14A 3RC5A 1TRMA 1PPHE 2WV9A 1JBUH 9LPRA 2FOEA 2KR7A 5IDKA 5BRRE 4AFSA 1OP8A 4XD7D 1MMJN 1OP0A 1IQEA 2A2XH 4AYYB 2GD4B 1GDNA 3PYHA 5GDSH 1NS3A 3M5MA 1MTNC 2XNIA 3BTME 2AS9A 5GJ4B 1D3TB 5PTPA 2BVXH 1QR3E 1KLJH 2FX6A 1V2KT 3GS9A 1VR1H 3KCGH 1E35B 4ZUHA 2A4GA 3RXFA 1A3EH 3M3SA 3SGQE 4ABIA 4INLA 5DGJA 2LNCA 1EKBB 1PQ8A 1MD7A 2R9PA 1Y5AT 4A1VA 3U8RH 3U69H 1SQAA 3ZZ6A 1O3FA 3LGVA 4WH6A 4Y10E 1O5AB 1QBOA 4K8BA 3DFJA 1S6HA 1ESAA 1BRBE 3O8RA 4YOGA 3F9FA 2BD5A 2A32A 2R0KA 2A1DB 1GHBF 1TGTA 1AN1E 1AU8A 4CH2B 1QHRB 3F0PA 1L0ZA 4MDSA 2I6SA 3MFJA 5IYTA 3UFAA 1C9PA 1V2ST 1UK2A 3LT3A 1BMAA 4MTBA 1GHAG 3M7UA 1GHZA 1EJAA 1WQSA 3B23B 1ETSH 1VJAU 1CGJE 2AMDA 2D8WA 3RXCA 1HAXB 4A6LA 5EIYA 1GBFA 2D2DA 1K1OA 3SU0A 2KAIB 3RM2H 3SJKA 4X1QU 2BZAA 2FI3E 1SVPA 3ZVFA 2G4UA 4A1TA 2FS9A 4IC5A 4D76A 1O30A 1P2NA 4E05H 3SJIA 1YCPH 2GDEH 1EQ9A 1ESTA 1DDJA 5C2ZA 5F8TA 1C4Y2 5K0HA 2QF5A 1P05A 1Z8GA 1F2SE 4AX9H 3MYWA 1ZRKA 2FTLE 1INCA 3E16B 5TCAA 3ZZAA 1FZZA 3EE7A 2VB0A 2AEIH 1O2UA 4F49A 4KTSA 3SUFA 5C17A 2QXJA 2FIRH 2W26A 1DOJA 4Y71A 1MCTA 5FHTA 2ZGJA 3BIUH 2QE7D 1TABE 2F9PA 1SGNE 3UPEA 4DG4A 3LIWA 5HM2A 4TWYA 1LKBA 1O2XA 2WUBA 3VB6A 1AMHA 3ATMA 1O5EH 1MKXH 4IS5A 1SKYE 4Q2KA 1O36A 3VG8A 3E1XB 2AMPA 1YPGH 4WXIA 4X0WU 1UW7A 1MQ5A 1EP6A 1KY9A 1UO6A 1IQGA 3SNBA 3KQBA 3TK5A 1CT2E 1TBQH 2BLWA 4I32A 3RMMH 3DD2H 1WOFA 2XW9A 4H42U 5FX5A 5ETXA 4DCDA 2EI7A 4MLFB 2EC9H 2JDID 1FAXA 4F4OC 2HOBA 3HK3B 3Q00A 3RXJA 4BAKB 3F2FA 3M61U 3ELAH 4IN2A 3ZZDA 1OXGA 1YLCA 3L6PA 4Z0KA 3V12A 1WV7H 1KXDA 3SYJA 1CBWB 1JIMA 4RSPA 2AIPA 3NUMA 1ZJKA 1QQUA 3RU4D 2VIDA 2SGFE 3RU4T 1TONA 4UEHH 1V2WT 4NSVA 3UOPA 2CGAA 4BAQB 1UTQA 3M5NA 3MH4A 3GY3A 3UNRA 3PWCA 1WBGB 1AD8H 1S81A 3RXLA 2BDCA 3A8AA 3T26A 3KN2A 1ELDE 2A5AA 1A5HA 1BBRH 4CHAB 1CBWC 2IJD1 3OTPA 1BT7A 1VGCB 3RLYH 1V2TT 2TBSA 2FDAA 3GCTF 3PV4A 2J4IA 4ABDA 1AB9C 1TALA 2OCVB 2AHME 1B0EA 1NRSH 2G8TA 2BOHB 3KYGA 4OM9A 1ELTA 1FY3A 2BB4A 2J98A 4NA9H 1OX1A 3KQCA 1MKWH 3SJ8A 1G32B 1TPPA 1GVZA 2JH0D 2AMQA 3BTWE 3GDSA 2FI4E 5AHGH 1MQ6A 2G4TA 1UVOA 1BTHH 1FUJA 1O32A 4YTAA 1K22H 4FUJA 2VWLA 4CHAC 2PKSB 2ZGCA 5JPMH 1VGCC 2TPIZ 4FU7A 1SB1H 3G01A 2GX4A 1UVSH 3FP7E 3U28C 2ZTYA 3SI3H 3RXPA 4YLUA 4BTIB 2B0FA 3U8TH 1UK3A 1TA2A 3TJUA 3F2HA 2P3TB 2BHGA 4Q7ZA 3PV5A 1LHCH 5C5NA 3F9EA 2Q6GA 4TY7A 2ZI2H 1FNIA 1UTNA 2VWOA 1KXCA 1W12U 1C5LH 5K7RA 3DSPA 1NBME 1BRAA 3FANA 3BTEE 3RXMA 3LGTA 5DP6A 5JYIA 1TYNA 1UTMA 2H5CA 1H8DH 2WPMS 2PKSC 1QGFA 3DUXH 3R0FA 4O9VA 2Z6BD 4K8YA 4MPVA 2BMGB 1JOUB 2GGVB 5ABWA 1HLTH 3GY2A 3A87A 2BY9X 1TOMH 6CHAB 3AASA 1V2VT 3EA8A 4U01A 5CDFE 3OYPA 1QNJA 1O0DH 2OINA 1P2OA 3FVFB 1XKBC 3HKJB 1MCVA 1J17T 5C1UA 2Q6FA 1JRTA 2VGCB 2WPLS 1BMNH 2G5NA 1LMWB 1GBLA 1FJSA 4AG2A 5FCKA 1C2JA 1OWIA 4JZFH 2HVYB 2Y7XA 1YBWA 2A45B 1QL8A 3SO3A 3BN9A 3DSGA 3U8OH 2AGIX 4WH8A 6CHAC 2OUAA 2WHXA 2YMSB 3SV9A 3RXEA 2ZHQH 1SGRE 4OS6A 2F3CE 1F0SA 4FU9A 3STJA 1SBWA 1HYLA 4Q7YA 1QFKH 1O2LA 2UUKB 4INHA 1K1LA 4DOQA 2VGCC 1NROH 1GMHG 1WUNH 1V3XA 1FX0B 3ZZ3A 3HKIB 4CR5A 1IQHA 1FI8A 1XVOA 1ABJH 1VCWA 1MD8A 1ZGVA 4X2XA 4CBOA 4Y7BA 1IHTH 4K60A 1O3EA 5HYOA 1C5WB 2Y5FA 3JZ1B 7LPRA 1BMFD 3RXRA 2YMSC 1UHBA 4GCHG 5A09A 3PTNA 1T8MA 3MNCA 5GPIB 1GVKB 4X8TH 1C2FA 4FUGA 1O34A 3ODFA 4FU8A 5T1VA 5KECA 1ZSJA 1OP2A 2FMJA 3RU4E 2ZECA 4D7FA 5C1XA 3QTVH 5A0BA 1NU7B 2A31A 2BVSH 3SV2H 3P70B 4B71A 1TB6H 2G81E 5FBIA 3Q3YA 1TA6A 1NRQH 5GNDA 2UWLA 3F68H 3BIVH 1F7ZA 2PW8H 9ESTA 2ZFRH 3MO9A 3DFLA 3EA9A 1FAKH 4X1NU 1FN8A 2VIVA 1NFXA 1FY8E 4I8LA 2M2AA 1HJ9A 3OY6U 5JB9S 4MG3A 3F9GA 1UCYK 3VFEA 3ZVGA 2FZZA 4I31A 7GCHF 2XYAA 1EP5A 1MBQA 3SV7A 1CHOG 1VITF 3GICB 2UWOA 1AKSB 1XUKA 1YY3A 4MNXA 4YT7H 3RP2A 1YGCH 4OS7A 1AO5A 2C8ZB 3TJOA 2UUJB 1W0KD 1O3IA 2GP9B 2GKVE 3KL6A 3BEIB 1YF4A 2J97A 1KDQA 1W0ZU 4Y11E 2C4FH 3RC6A 4HZHA 1EZSC 5FBEA 4DJZB 4O97A 3RLWH 1AQ7A 2O8LA 4H6TA 1C1UH 4TPIZ 4B73A 2YMSD 2BXUH 4J1YA 3V0XA 2ANYA 3HGNA 4FUIA 2W5EA 2Z9IA 1YPMH 2BD3A 4D9RA 1VJ9U 1TOCB 5EODA 3RDZA 3BEFB 2ZA5A 2Z3DA 1MUEB 4JYUH 4CBNA 1TQ0B 1P06A 1DPOA 1RS0A 2FXRA 1TX8A 2QXGA 5LH8A 1E1QD 1K1MA 2R0LA 2WSSD 2XRCA 1HPGA 4OS4A 3MI4A 4ZKOU 2LPRA 5EGMA 1L4DA 4Z6AH 2PHBA 2RCEA 1JMOH 5SGAE 5GCHF 1UTLM 2STAE 1T4UH 3OEED 2HNTF 2XWBI 3MU0A 2P16A 3UUZA 2O8TA 1CQQA 1RTLA 1NY22 5CE1A 3V3MA 1TPOA 2ZDVH 2ZPQA 3SU3A 2JJ1D 4X6NA 1MU8B 1O3PB 2OC0A 4OGYA 4ABGA 5AFZH 3QK1A 2G52A 3MTYA 1SGTA 3SZEA 3PB1E 2VH6A 3FZZA 3ZVEA 2BX4A 4GUXA 3RXUA 2PP6A 3WW7A 2GCHF 1EAXA 3LGIA 4QT8C 3GY5A 1BHXF 3TJNA 3KQDA 5FAHA 4MNYA 2FLRH 2AYWA 1O2SA 2VH0A 3TK9A 1SLXB 4B76A 3SNDA 1D3DB 2B8OH 3PLKA 4FETA 4YLQH 1C2LA 1O2MA 2ZCHP 2XXLA 1FN6A 1FY5A 5L2ZH 3P6ZB 1HJAC 1O2YA 5DP3A 5FCRA 1C1PA 1K1IA 5JBBS 1NFUA 4RN6A 4B75A 5E8EH 1RRKA 1QJ6B 1TRNA 4XBCA 2ZCLP 4K5ZA 2KCPA 5T6FA 3F9HA 1W0YH 1QBVH 5KGOA 1QL7A 1GHYH 2B7DH 1GVLA 1QA0A 1SLVB 1OWHA 1GI3A 5HIYA 4RT0A 1AFEH 1ANEA 5EOKA 4K69A 1XVMA 4D7GA 1RTKA 4CRBA 3SUEA 2ALPA 1O2NA 3ATWA 1COWD 4WMDA 4X6OA 2B5TB 1XUIA 1O2TA 2ZGHA 4X8VH 1CT0E 5E2OA 3GCOA 1Z8JB 1DSUA 1ELCA 3SGBE 2W3IA 1SFIA 2A0QB 1HUTH 1K2I1 1BJVA 5HKKD 4LXBH 2NU0E 1A3BH 1O5FH 4O3UA 1O37A 4H6SB 1TNLA 4FUFA 2Q6DA 1O38A 1SGQE 4MPXA 1UCYH 1YPKH 1SOZA 2TRMA 3UTUH 2OBQA 2ODQA 1Z8RA 3PROA 2HRVA 5B6LA 4LZ1H 1VCPA 3E90B 1SR5C 1MKXK 1UHBB 3AVZA 1W11U 2Z9JA 3UREA 1N6XA 1OWJA 4K1EA 1O2GH 5EG4A 5LGOA 1HAVB 3EYDA 1F0UA 1MAYA 3O8BA 4A7IB 3TGJE 1KSNA 4ABHA 5G4BA 4DY7B 1QZ8A 6LPRA 3TVJB 1Y59T 2LP6A 1AUJA 1FPCH 1HAYB 2QGRA 2WPIS 4X1SU 1XKAC 1WQVH 1XUJA 3A7ZA 4HG6A 3OEHD 4ABEA 3M7QA 1GJAB 1L4ZA 5EW2H 1GI7B 3H7OA 2ZTXA 4I8JA 1GI4A 3DT0H 4UFEH 1W7GH 2ZPSA 2ZCKP 5I46H 4P02A 3KF2A 2QIQA 1AE8H 1O2JA 6GCHF 3SUGA 3EE0B 1HDTH 3R3GB 3UNSA 2PWXA 2P3FH 4NFFA 3QN7A 3ENSB 4ZHMU 1QRZA 4DW2U 2BD7A 1V2OT 1P2JA 4MVNA 1W2KH 2BQWB 1LHEH 3B8JA 1PQ5A 4NZLA 1SQTA 4NG9H 2PKAA 4NA7A 3F1SB 2H1UA 4BXWA 4FUCA 1TBZH 4A92A 2GT7A 2Y7ZA 2J94A 3GCHB 1NZQH 2WYGA 2ZC9H 1H9IE 2SFAA 2VIOA 2WPJS 1BBRK 1THRH 3A85A 2FOAA 2AERH 4DIIH 2ZGBH 4AG1A 1PYTC 4IN1A 1K1JA 4JZ1A 2XBYA 4IC6A 4I8KA 2J95A 2BDGA 1CT4E 1BTUA 3KIDU 1GI1A 1GJ7B 1KXFA 4ZCNA 2JH6D 4DVAU 1J15A 2Z9GA 3MNBA 2FX4A 3A84A 1TGBA 1MKWK 4WF8A 3SQEE 3S9BA 1AGJA 1N6YA 4XE4A 2IN2A 1LHDH 3GCHC 3Q3KA 2C8XB 1BDAA 3RXOA 4FVDA 2ZG0H 4IGDA 1ZPBA 3ITIA 1H4WA 3WWFA 3UIRA 1C5XB 3U9AH 1V2MT 3UY9A 1C1NA 1Z6JH 2HLCA 1MTWA 3LH3A 1DLKB 1Q2WA 1NRNH 2AFQB 2R2WU 1ZYOA 4DGJA 2VVCA 4YOJA 1EZXC 4AFUA 4NIVA 4ACAA 1A2CH 3E0NB 2W7SA 3TH4H 4IBLH 3CS7A 3QX5H 3LJOA 3UB0A 2ANKH 1RTFB 2NWNA 1KLIH 1A7SA 3K6YA 5F53A 1SGFA 5L30H 5C5OA 1V2PT 2WINI 5F6MA 3F2GA 3OTJE 1QL9A 1Y3WA 3GCNA 1S85A 5DP7A 1F5LA 1CA0B 1PYTD 1QTFA 3CS0A 1O35A 3A7XA 3NXPA 1V2RT 3S9AA 1C5TA 4Y79A 1P9SA 3U1IB 4FOUC 3ZVDA 1P8VC 1C5YB 3RXDA 1C5SA 4GHQA 3TGKE 7KMEH 1BOQA 3SJOA 4I33A 5DP9A 1HAIH 5E2PA 2R3UA 2ZDAH 2C8WB 2ANWA 1WTHD 1G37A 1L2EA 4ZHLU 2CN0H 3ZVCA 1C1MA 1HNEE 1SC8U 1XUGA 2VIQA 1QRWA 1O3KA 3F6UH 1TWXB 2WV4A 2Z9LA 1G3EA 2YOLA 3A8BA 2Y5HA 3KNXA 3MMGA 2Y82A 3RXBA 1NESE 3N7EA 1AVGH 2KZ4A 3TPIZ 3V7TA 3KGPA 1LHGH 3LPRA 4A5TS 4ZKNU 1CA0C 3FFGA 2A5KA 2VJ1A 2JKHA 3A7TA 3ZV8A 1O2WA 4INKA 2PV9B 1DE7H 1JIRA 4UDWH 1V6DA 1GMCF 1ZJDA 2CJIA 2PGQB 2BDHA 3HPTB 1GBTA 1Y3UA 1V2UT 4ZMAH 1S5SA 3A83A 2B9LA 1H8HD 1TAWA 1ZTLA 5C94A 2G5VA 4OS2A 4ABAA 1AB9B 1Z8IB 2FOFA 1T8LA 1E1RD 1JXPA 2ZZUH 1T31A 3P8FA 1SHYA 2NU4E 2F91A 2BY7X 2NU1E 4ASHA 4U30A 5JBAS 1KTSB 1ZRBA 3L3TA 4HGCA 3AW0A 2ZQ1A 1MBMA 3SW2B 4NIYA 1A46H 1DWDH 2HNTC 3QLPH 1OYTH 5TJXA 3UR9A 5KEDA 1GJDB 3TNTA 1OWDA 1ELVA 1EZUC 1XUHA 5HGGA 1K21H 3OX7U 5AVDA 3FOAA 1FQ3A 2F9VA 3A8CA 4ZAEA 2JETC 5C1YA 3SU6A 3ZZ8A 4BTUB 5DKMA 2OXSA 2O8WA 1Y8TA 1AWHB 2O8UA 2FOMB 1SGYE 1NU9A 2BDYA 3SN8A 3RXSA 4Y76A 1GBAA 3GYMA 3V13A 4NZQA 4B1TA 1IQJA 2A4QA 1QY6A 3U1JB 1BQYA 5T3HA 1PPZA 3A81A 1C2MA 4GHTA 1WSSH 4VGCB 3S7HB 3UR6A 5FL7D 1GHAF 1LPGB 1QBNA 2OQUA 3LGYA 3EA7A 1N8OC 1K9OE 1QJ1B 1GBMA 2YNAA 8GCHG 1O2KA 1Z1JA 2K1QA 2ANMH 2TIOA 1HXFH 3ATIA 1C1TA 2GV6A 2UWPA 3AW1A 5FPYA 3SU2A 3O8CA 1GBKA 2XOKD 1MU6B 3DHKH 4JK5A 2SGDE 4DURA 1EPTA 5GWZA 3VPKA 2W7UA 2BY5X 2Y80A 1CO7E 4Z1MD 3P8NA 1J16A 1PJPA 3VB7A 4GVUA 1GGDC 1Z6EA 2XBWA 2L6OA 1GBCA 4VGCC 1BMLA 2WPKS 4RKJB 1E36B 1AWFH 1O3BA 2ILNA 2GZ8A 4B2BA 1S0RA 3QO6A 3D65E 3LH1A 3A7WA 1Z7KA 4TT3D
chains in the Genus database with same CATH topology
1GI6A 1BTZA 1SQOA 2A7CA 5FX6A 1MAXA 3TGIE 1HIAA 1EZQA 1T4VH 2FYQA 2QXHA 3NZIA 1FPHH 4WJG2 2FOBA 3ZZ4A 3NWUA 1AY6H 1TX7A 1TX6A 2WPHS 4ISOA 4LOYH 2OTVA 4NWKA 2P3UB 5BPEA 5A8XA 4WMFA 3RXIA 1C5RA 1GMDG 2H9HA 1C1SA 1NFYA 5LPRA 1TBRH 4X1RU 4ISLA 2FOHA 1TMTH 3I78A 1G2LA 1O2HA 1V2NT 2V3OH 4GLYA 1F5RA 3RXVA 1A4WH 2HPQH 3ATKA 1HGTH 5E0HA 3N7OA 3UOUA 1PPBH 4WMEA 1O2RA 1QB9A 3CP7A 4K3JA 3AAVA 1BUIA 4CRDA 5A0AE 1EOLA 1GHWH 1GJ5H 5EXNA 2FO9A 3PO1B 1ZGIA 8KME2 2THFB 3ZV9A 2CV3A 3E6PH 2G51A 3P95A 1ELFA 2YNBA 3A80A 1AUTC 2OQ5A 3SV6A 5HMAA 1C1WH 1NTPA 2C8YB 1BTPA 1P01A 2SGAA 3RXHA 2PTCE 1FIWA 4JZIA 5TCCA 2XCFA 1H9HE 1LVYA 1XX9A 1IQNA 1IQIA 1GHXH 3UNQA 2OC7A 1GBDA 1XXFA 2F9BH 2ZDNA 4H4FA 8LPRA 4X2YA 1DM4B 3C1KA 2H9TH 4SGBE 3RM0H 3PO1C 1C2IA 1GJBB 3MH7A 4FXGH 8ESTE 3TNSA 3M3VA 3SQHE 1FDPA 1QURH 1GBHA 3IG6B 1D6RA 4AGJA 3URDA 3SNCA 1LO6A 1NFWA 2BLVA 1EAWA 1OSSA 4B74A 5EPYA 1LKAA 4UD9H 3PMHB 1HCGA 1GJ9B 2PFEA 5HM9A 1ACBE 4AZ2B 1G36A 1KXEA 1ZHRA 2BYAX 3S7KB 2FYRA 3MH5A 1AZ8A 4XDEA 1KIGH 5FPSA 1YPEH 2BOKA 3QZRA 2NU3E 2RDLA 4ESTE 2ALVA 1HV7A 3LU9B 4GSOA 1MZAA 2C90B 2ZHWH 3TLOA 2ZFQH 4U2WA 3VB3A 1ELEE 4U32A 1SG8B 1U6QA 2P8OC 5FPTA 4PROA 1TMBH 2ZNKH 1EASA 1WCZA 1VZQH 3VEQB 1DICA 1A5GH 4XSKU 3MHWU 1W3CA 1KYNA 1L1NA 5E0GA 5A0CA 3VGCB 3K65B 1A0LA 4NIXA 1KLTA 3ZZ7A 2QV1A 4BANB 3UQVA 3BG4B 4HI3A 2XCNA 3ZVBA 2FLBH 1MTSA 3LONA 2VIWA 3JZ2B 1C4U2 2FOGA 2J38A 1DX5M 2BX3A 4X8UH 1GI9B 3D62A 1YM0A 5CMXH 3PM3A 2H6MA 3BTKE 4CRFA 1ZMLA 2BLOA 2HNTE 1Z71A 4JMYA 1TNGA 1C5UA 3B9FH 3SZNA 3D49H 1BITA 2FODA 2I6QA 1ARBA 3VGCC 4Y7AA 2EI6A 3PMAB 5EXMA 1O3CA 5C20A 1QRXA 1SGEE 3BG4C 1H9LB 1UJ1A 2XC0A 3NPSA 4GPGA 1SGFG 4WY3A 4XBBA 2F9OA 2P59A 4KTCA 1HJAB 3Q76A 1CSOE 1NO9H 2XBVA 1C5QA 1QA7A 2Z3EA 3A86A 4X2WA 3SORA 2HVXA 1ZMJA 1IQFA 1SPJA 2F9UA 1J8AA 5C3NA 2BD9A 1EATA 1WTGH 2Z9KA 1EJNA 1ORFA 1GBJA 2KAIA 1LVOA 4IMQA 3M35A 3BV9B 1O3HA 1D9IA 3MNXA 4LZ4B 1PFXC 3EDXB 2R2MB 3A88A 3QWCH 4YESB 1ABIH 1GHBG 1EAIA 1GMHF 1HB0B 1RIWB 5DG6A 1TPAE 1LDTT 1O33A 3BTGE 5AF9H 4ZKSU 4Y0ZE 1QIXB 4O3TA 2J9NA 1ELGA 1GDUA 2Z3CA 2ZU3A 2Y81A 2ZFFH 2ZHFH 1O2VA 2BLQA 1LVBA 2ZDKA 3OU0A 3PMBB 4Y0YE 4GCHF 4K1TA 2BVRH 5ESBA 3GY6A 4RKOB 4HFPB 2GVFA 3ESTA 4YT6H 2Y5GA 4FUDA 4CRGA 2AIQA 1NN6A 1FONA 3RXGA 1OOKB 3E3TA 1RIWC 1ANCA 1RGQA 1T7CA 3BG8A 1ZPCA 1DFPA 2AH4X 3NCLA 2Z94A 3MU5A 4YO9A 1DANH 4Y8XA 1GWAA 1MTUA 1P2KA 1LQEA 3U98H 1CGHA 3GDUA 1ZOMA 3QUMP 1HRTH 1ZSLA 4KP0A 1MZDA 1FV9A 1TGSZ 1PPCE 5B6OA 4I7YH 3P8GA 4AN7A 1ZPZA 1P2QA 3MO3A 1CHOF 4BAOB 3LDXH 5I25A 2G00A 2VVUA 3QGJA 1Q31A 4UE7H 2ZU5A 1S82A 1P9UA 3M37A 3VXEH 1ZTJA 2VWMA 4TY6A 3URCA 1DSTA 1P12E 1CGIE 5H4IB 1RXPA 3MU4A 2SGEE 1BRUP 1IQMA 2FEQH 4CREA 1D3PB 3STIA 1YPJH 4BAMB 5EPNA 2P94A 2ZDLA 1TMUH 3M7TA 3TH3H 3UQOA 4BTTB 2Q1JA 2CF9H 2WUCA 2HGTH 4YOIA 2IPHA 5AFYH 2HWLB 1AIXH 1AFQB 1SLUB 2QYIA 1V2LT 3SHCH 3SOSA 1ELAA 1ZHMA 1WYKA 2VU8E 1YC0A 4WWYA 1C5NH 1P2MA 2BQ7B 3H5CB 4Y6DA 2F9NA 3Q3XA 5JDUB 1GI8B 2RG3A 3A82A 1XXDA 4ZXYH 3TU7H 1BTXA 2FESH 2SNWA 3SHAH 1KDQB 4DT7B 3KHVA 3T5FH 1ZHPA 1GJ8B 1S6FA 2SNVA 5E0JA 1W8BH 1UTKA 2AGEX 2CMYA 1C1VH 1GL0E 2ULLA 5T6GA 3SU4A 2ZWLH 4UFGH 1N1LA 1AFQC 6ESTA 4MPWA 4O03A 2ZFPH 2XC5A 2ZGXH 1NC6A 1PQ7A 3LKWA 2C93B 1HAOH 5F8XA 1QJ7B 2V6NA 4NWLA 3GY4A 3KQEA 1A5IA 1ZR0A 3GCTG 2BM2A 3TK6A 1SGIB 1SLWB 1GHVH 3IITA 3M5LA 3KEEA 2ZF0H 3GY8A 3VB4A 2GZ9A 1KXAA 2A5IA 3CENA 1EXFA 2PLXA 2HPPH 1GBIA 3PLBA 1T32A 3ZZCA 1YLDA 1CHGA 4AB8A 1F0RA 4X6MA 1O3JA 1UVTH 1O2IA 1W10U 1A61H 2A7JA 1P2IA 2GDDA 3T29A 1JWTA 3LOXA 3EAJA 4FUBA 1GI5A 1P3EA 2PSXA 4LK4A 1P09A 1QB1A 1HAGE 1QCPA 2AGGX 2P95A 2XWAA 3BTHE 5DP8A 1Y3VA 3A8DA 3LGWA 4I8HA 1BRCE 2BZ6H 1A0HB 3RXTA 4ISNA 2BD8A 2BDBA 1DWBH 2M5TA 1MTVA 1O3LA 1DUAA 1E37B 1SHHB 3PMJA 2ZFTA 3T27A 5EQSA 2ASUB 2O9QA 5EQRA 1S84A 1C9TA 1GJ6A 1DY9A 1D4PB 4ABJA 3HK6B 3E8LA 4AGKA 1YCPM 1FY4A 4ZH8A 2GT8A 2GZ7A 1WAYB 1KXBA 2QXIA 3P8OA 1TNHA 4KGAA 2XC4A 1GCTB 2A2QH 2ZU4A 4ZHAA 2ZHEH 1DITH 2VIPA 2RA3A 1CVWH 1SGPE 3MO6A 1ZZZA 1GG6B 4FUEA 1UTOA 1CA8B 1P10A 1TE0A 3L33A 4J2YB 1W7XH 1Y3XA 1P02A 1B0FA 1FY1A 4R8TB 2TGAA 4Q7XA 1DWEH 2PTNA 1QQ4A 4JK6A 3RXQA 3K6ZA 5A2MH 1BBRE 5LPFA 2TGDA 2DE8A 2F83A 4KTUA 2JETB 1TFXA 3MWIU 5FXLA 2QA9E 4XBDA 5ESTE 4AORA 1GCTC 2QC2A 4FVBA 1GG6C 5A8ZA 1BHXB 4AFZA 3QDZB 3EQ0H 3MOCA 3P17H 1F5KU 1C2EA 1FXYA 1SL3A 5J4SA 2J2UA 5CHAB 4ABBA 2ZDMA 1N8OB 3K2UA 1C5ZB 4KELA 1E38B 2SGQE 1C2GA 1SFQB 1YPHC 2J92A 3FP8E 4K2YA 1AKSA 3ODDA 1NRPH 4R0IA 2FWWA 3M3TA 1DS2E 4MNWA 4X2VA 1G3DA 1B7XB 1HFDA 1HAZB 1G9IE 1NM6A 1O2QA 2BTCE 2FS8A 1YPLH 2TGPZ 3TITA 3GOVB 1P04A 1G3BA 5DP4A 1S83A 1O3GA 1TGCA 1GGDB 5CHAC 2PUQH 4NGAH 1LHFH 2PKAB 2DUCA 1OWEA 3TH2H 5JBCS 1XUFA 1TNJA 4BNRA 3LC5A 3O8DA 1XMNB 1O2PA 1O3AA 5DJ7A 2P93A 3BSQA 4MQAA 1AZZA 2SGPE 1BCUH 7GCHG 1C5PA 3WY8A 1VITG 5JBTA 1EJMA 1O3OA 1EX3A 5DP5A 2XBXA 4E7RG 1E0FD 1CU1A 2ZKSA 5DK1A 4X1PU 1Y5BT 1ANDA 1ELBA 3PWBA 3S69A 5C67A 3C27B 1GI0A 3HGPA 1HAPH 4AOQA 2QCYA 4YZUA 1O2OA 2CF8H 1PPEE 3UWJH 1PPFE 1FIZA 1YYY1 4D8NA 3LGUA 1RJXB 4NSYA 2QF0A 1IOEA 3FAOA 1UVPA 2ZTZA 5GIBA 3MNSA 2FOCA 2ESTE 1GBEA 1YKTA 2ZPRA 4OS1A 3RUOA 2Y6TA 1GL1A 3ZZ5A 2VWNA 4K1SA 2CHAB 2V3HH 1IAUA 4CRCA 1C2KA 2FPZA 2IOTA 1EOJA 1C5MD 1O5BB 2R3YA 3IWMA 2ZHDA 1PPGE 4Y8YA 5GCHG 1V2QT 1ESBA 3VXFH 1XM1A 4BXSA 2STBE 1SSXA 1NRRH 1UK4A 4B2CA 3PTBA 3SU1A 1C2HA 5EQQA 1O31A 2H2ZA 1P0SH 1HJ8A 4UFDH 1BTWA 3RMLH 5L6NH 2CHAC 3EGKH 4MNVA 3P92A 4JZEH 2BDIA 1W14U 2GCHG 3BTTE 1GDQA 2V0BA 1P57B 1RFNA 1DUEA 1KTTB 1C1QA 1TGNA 1AI8H 2EI8A 3LC3A 5EU8A 2PGBB 2GMTB 3T62A 5J4QA 1C2DA 1X7AC 4BAHB 1FMGA 1O3MA 2GTBA 3Q77A 1H1BA 2D26C 3LJJA 1YP9A 1HXEH 1C4V2 1EUFA 3ZVAA 1ANBA 1OPHB 2HALA 3K9XB 3TJVA 3SBKA 4AB9A 4E06H 3I77A 2RA0A 4TYDA 1S0QA 1M9UA 1A1RA 3BTDE 2QAAA 1RD3B 1DVAH 1AE5A 4TWWA 2P8OB 2GMTC 1G30B 4KKDA 1BA8B 1HAVA 3ZYEA 1OS8A 4ZROA 3MU1A 5EXLA 1P3CA 2FTMA 1ETTH 2EA3A 1GI2A 4WVPE 1O3DA 2WYJA 2IJOB 1BJUA 1O3NA 4NCYA 4NFEA 2PR3A 1GJ4H 1G2MA 1PQAA 1TRYA 1UMAH 5DPAA 1EB1H 3SGAE 2OD3B 1L1GA 3QGNB 1V2JT 2BD4A 8GCHF 1K1NA 3NK8A 4I8GA 2BD2A 4YM9A 1IQLA 1DWCH 2H9EH 2VVVA 1K1PA 4DIHH 1DY8A 3I29A 4JYVH 3NKKA 1F92A 1C5OH 1F0TA 1GPZA 2BXTH 1TQ7B 4UFFH 2ZU1A 1G3CA 4ZKRU 1HBTH 1LTOA 4CRAA 3H7TA 3S9CA 1C1RA 1P11E 1UVUH 5T6DA 4ZXXH 2ZO3H 1AHTH 1O39A 2ZIQH 1VITH 3SUDA 1EB2A 2VNTA 2D1JA 1GBBA 1THPB 1LVMA 1D3QB 2GCTB 2V35A 1LPKB 2QY0B 3HATH 3ZZ9A 1OWKA 4JZDH 5JB8S 4E7NA 2BY6X 1SGDE 1BIOA 4OGXA 1Z1IA 2BY8X 3RXAA 4CH8B 4ABFA 1DXWA 2ZQ2A 2ODPA 1IHSH 4XOJA 5DO4H 3RMNH 6GCHG 1GMDF 1E34B 2ZEBA 4JYTA 3TIUA 4B2AA 1P03A 3GY7A 1TPSA 1EPTB 1ZLRA 3MU8A 4NIWA 1C1OA 1CE5A 2JH5D 1YPHE 2FM2A 4D9QA 2ZP0H 4AFQA 3MH6A 3SJ9A 2O8MA 3W95A 3T2NA 1DXPA 2EEKA 2GCTC 2C3SA 4A1XA 1BMMH 3S0NA 3BEUA 3OY5U 2NU2E 1NPMA 1UTPA 1FLEE 1HIAB 3SI4H 1SI5H 3RC4A 4MPUA 1OKXA 1VCQA 3A7VA 4TPYA 4CR9A 2FP7B 1ARCA 1EPTC 1AVWA 4X6PA 4BOHA 1O2ZA 1T8OA 1DLEA 1ID5H 2ODYB 1D6WA 1ZTKA 2FI5E 4XFQA 2OP9A 3QTOH 3GDVA 1SMFE 1TLDA 1MH0A 4GAWA 4NA8A 2G55A 2XTTB 3E0PB 2VINA 2W3KA 3SU5A 1T8NA 1O5DH 4Y8ZA 3T28A 4JCNA 1UCYE 4ISIH 1C5VA 5F8ZA 3D23A 3DA9B 1OYQA 3M5OA 3ZYDA 3M36A 5F03A 3SNEA 5L2YH 1UTJA 1BTYA 4HTCH 4SGAE 3GYLB 3W94A 3SV8A 1BB0B 1JRSA 1B5GH 2ZU2A 3OSYA 2UUFB 2DE9A 3FP6E 1BZXE 1ZSKA 1Y5UT 1A0JA 1GJCB 5A8YA 1O5GH 1SOTA 3GISB 4FUHA 1TNIA 2GV7A 4WXVA 2J34A 1H8IH 2A4RA 2QF3A 2CXVA 2OC8A 5EW1H 4ISHH 1YCPK 3UWIA 2H5DA 3QZQA 2BDAA 3BTFE 2PUXB 1LQDB 2TGTA 4X8SH 3BTQE 1SGCA 3FZDA 1W13U 4IMZA 1LPZB 3A7YA 5HXFA 1TNKA 3E91A 2WV5A 4AYVB 5LPEA 2Z7FE 2UUYA 3ATLA 1LCYA 1TIOA 1DT2A 3ZZBA 1J9CH 3BF6H 3VB5A 1Y3YA 3T25A 1GCDA 2OBOA 1Q3XA 1IQKA 4M7GA 1K28D 2PSYA 2ZFSA 5GXPA 3SNAA 1EAUA 3RMOH 2QN5T 1THSH 3AAUA 2A4OA 2A7HA 1HAHH 1O5CB 7ESTE 3RXKA 1ETRH 1AVXA 1MTNB 1L1JA 1ZMNA 4IW4E 4UONA 2OLGA 3PLPA 2BQ6B 4OS5A 4THNH 3A89A 4Q80A 1GMCG 2OC1A 1WU1A 1QB6A 1NT1A 1J14A 3RC5A 1TRMA 1PPHE 1JBUH 9LPRA 2FOEA 5IDKA 5BRRE 4AFSA 1OP8A 1MMJN 1OP0A 1IQEA 2A2XH 4AYYB 2GD4B 1GDNA 3PYHA 5GDSH 1NS3A 3M5MA 1MTNC 2XNIA 3BTME <