2YNAA

Crystal structure of the main protease of coronavirus hku4
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-LIKE PROTEINASE
publication title Inhibitor for the Main Protease of Coronavirus Hku4
rcsb
source organism Tylonycteris bat coronavirus hku4
total genus 84
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2ynaA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ynaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ynaA02
3F9HA 2AFQB 1SI5H 1GJ5H 2J92A 3RU4E 2ZGBH 2O8TA 2FS9A 1O5BB 2VVVA 1FN8A 2TGDA 1GJ4H 3ZZBA 1ZMJA 1Q3XA 3ATWA 5DPAA 3KIDU 3ATLA 1DWCH 3BG4B 1YPGH 4OS6A 5A8ZA 4NIVA 1YM0A 2Z3CA 3M5MA 4ABEA 5E8EH 4MPXA 2ASUB 2EEKA 3SJKA 2BOKA 1CSOE 3W94A 4WMEA 1NC6A 1DFPA 2HVXA 2FESH 1C4U2 1Q2WA 1EPTB 3RMOH 2Z9IA 4CHAB 4DG4A 1EJMA 2ZP0H 1J17T 2OTVA 1QL9A 1QRZA 3PWCA 1C2KA 1P04A 1AHTH 1QURH 4BXSA 3S7HB 2FOEA 2UUFB 1MAYA 1G3DA 1OP8A 1RTLA 4I8HA 3BTHE 1MCTA 3MH6A 1YPHC 1HYLA 4AN7A 1LMWB 3M3TA 2VWMA 1LHCH 1LTOA 3URCA 1TOCB 1Z1IA 3RXSA 2PFEA 1MAXA 1O31A 1ELBA 3FP6E 2BX3A 2WPMS 1A61H 3IITA 4ABBA 3LGTA 3UWIA 2GX4A 5EPNA 2GCTC 1AWHB 1LVYA 1H8IH 1HB0B 9LPRA 1VGCC 2FXRA 1QGFA 3RXCA 1GVKB 1MU8B 3SJ8A 5EXMA 2GZ8A 4XOJA 1O33A 1Y59T 3HGPA 3M35A 3UNRA 2H1UA 2KAIB 5ABWA 2BDCA 3EYDA 1NFUA 4Y79A 1QBOA 3ATMA 2AERH 4JZDH 2GD4B 1TA2A 1O2GH 5A8YA 1W13U 1SGFA 4TWWA 2XTTB 1D9IA 1CA0C 1O3PB 4Y0YE 2HNTF 2QXJA 3BV9B 1GL1A 2ZDAH 5ETXA 1P05A 3CP7A 2ZU3A 4Q7ZA 1BRBE 1GI8B 1BBRH 3TH4H 3TJVA 1XUIA 2VIWA 2FLBH 1Q31A 2R2MB 1F2SE 3FANA 5L6NH 1A4WH 3C1KA 1ETTH 2ZCKP 3TGIE 1C4V2 5IYTA 1TMUH 3UOUA 2G52A 4DY7B 1CE5A 3I77A 2G8TA 3VEQB 1FPHH 3RMMH 1BJUA 1SHHB 5EW1H 1YPJH 1J16A 3BTQE 4XDEA 1WU1A 3RXQA 1SFQB 1IQIA 1INCA 1A5IA 1TGBA 2FLRH 2VGCC 4X6MA 2PHBA 4QT8C 5K0HA 2BLWA 4TY6A 4NCYA 1O2PA 3DT0H 1BITA 1S5SA 3STIA 1GHAG 3BTTE 1NFWA 1CQQA 2BX4A 2A5IA 1MD7A 1NM6A 2C93B 3T62A 4DURA 4OS5A 1O5FH 1C1VH 5FBIA 3RLWH 5EPYA 1HAPH 1PPHE 1T8MA 2ZFSA 4FUBA 4UFFH 2A5KA 1P3CA 3LC5A 3V0XA 4GSOA 2SGEE 2BD8A 2G51A 1TIOA 3PLKA 3PTNA 1TMBH 3DUXH 3RXPA 4JCNA 2VH6A 4ABAA 4B2AA 5BRRE 5AFZH 4BTUB 2AMPA 1XUJA 3NCLA 3L33A 1AO5A 1XVMA 1ZMNA 4U30A 1CGJE 3AW1A 2VJ1A 1GVLA 2ODPA 3T26A 3E1XB 1XUKA 4MNVA 4FVDA 1GBMA 1EAXA 2Z94A 3HK6B 2ZDKA 4R8TB 3UWJH 3UUZA 5ESBA 4H42U 1K1LA 5EXNA 3ZZCA 3A7ZA 1O2JA 4A1TA 1LVBA 1D3PB 4NWLA 2ODQA 1NS3A 3CENA 3ZZ9A 3BTGE 2Y5GA 2BQ6B 3PM3A 2FIRH 3LGYA 1DY9A 5HYOA 3O8CA 2BVSH 1LQEA 2A7JA 2A4RA 1UK2A 1A5HA 1AVXA 3QGJA 2ZFFH 4R0IA 3ZZ6A 3LIWA 4CRCA 1QTFA 2AMQA 1LDTT 4X2YA 2AGIX 2A5AA 3RMNH 4WF8A 1XM1A 3LJOA 3M3VA 4K2YA 4DOQA 1E36B 4U32A 1KLIH 4H6SB 1LHEH 5FX5A 3TU7H 1NPMA 4GCHF 7LPRA 4XSKU 5GIBA 1GJ6A 3BTFE 1C1TA 4IGDA 3FAOA 2W7SA 2FZZA 2V3OH 2OQUA 3K6ZA 1TX8A 4ZKSU 3V3MA 1GJ8B 1D3QB 1G36A 3TVJB 3ZVGA 3VXFH 2NU0E 2VGCB 1PPZA 1UTPA 1AD8H 4ZHLU 2B7DH 1GBDA 2JETB 4I33A 1C2DA 2ZF0H 5E0GA 1ELVA 1OX1A 5DP6A 1VCPA 1B0FA 1LQDB 2BZAA 4KKDA 1LKAA 1L4ZA 2O8LA 1HJ8A 2XBVA 3SU0A 6GCHF 4BNRA 2ZG0H 1E35B 1SBWA 2P3FH 3GICB 2QCYA 1AFQB 1YLCA 4GPGA 1TB6H 2XNIA 2QC2A 4INHA 2F9OA 1Z8IB 4PROA 3QLPH 2PW8H 1THPB 1GVZA 4NIWA 2GMTC 1C5OH 2OXSA 1EKBB 1QRWA 4CH8B 5EQQA 1K22H 3MU8A 2EI8A 1ELTA 3KQDA 1JBUH 2BM2A 5EGMA 3Q3KA 1GHZA 1XKAC 1RGQA 4INLA 3U9AH 1UCYH 1HAOH 2RA3A 1HAGE 2H5DA 1VZQH 2J94A 1P10A 4FVBA 2VIOA 3MO6A 5HMAA 3U8RH 1XUHA 2FM2A 3E0PB 1FY3A 2A2XH 3PWBA 1A0HB 3MH4A 5HM2A 2BD4A 1HIAB 5L2YH 3H7OA 1DLKB 1FNIA 2F9VA 3RM2H 3UPEA 1O2QA 2XCFA 1L1NA 2B5TB 2V6NA 3BN9A 1S6HA 2G00A 2VVCA 3TK9A 1TMTH 3RXJA 1OKXA 2ANMH 2QYIA 4XBDA 5LH8A 4X6PA 1G30B 5CMXH 4B1TA 3BIUH 1BTHH 1SGPE 1MQ5A 8GCHG 3LDXH 3FZDA 1MD8A 1C5TA 5CHAC 1AUJA 2ZGJA 1ZJDA 1ZSKA 2NU2E 4NWKA 3VFEA 1G2LA 1DWDH 1DWBH 4AFZA 2OC0A 3WY8A 1EJAA 2P94A 5EQRA 1P9SA 2TRMA 4DVAU 5FAHA 5GXPA 1SGRE 2V0BA 2R2WU 4ISLA 2ZTXA 2F9NA 4RKOB 2SGPE 3S9BA 2ZA5A 1A5GH 1C1PA 3SUEA 1FY1A 2ZTYA 2G5VA 2QV1A 3H7TA 2GDDA 1C5NH 3NXPA 3A83A 2ZU5A 3RXBA 2C4FH 3AAVA 5C20A 2JH6D 1T4VH 1P11E 2BDHA 3GCHB 1DSUA 2RCEA 2ZEBA 3ZZAA 1AVGH 4NIYA 1BHXF 1GBIA 1XX9A 1FUJA 5HXFA 4NSYA 3K65B 1Z6JH 5F8XA 3RUOA 4AFSA 2AEIH 2ZU2A 1ZHMA 3EBNA 4CR5A 3GOVB 2QN5T 2SGFE 3UOPA 3SV9A 1PFXC 1QR3E 3L3TA 4I7YH 2W3KA 3C27B 1ANDA 3KQEA 2XBWA 5TCAA 3LGWA 2BTCE 5G4BA 2IJOB 1SPJA 1Y3VA 3PMAB 1FPCH 1O5AB 1EXFA 1AQ7A 3F68H 1LKBA 2BY9X 2VWOA 1EB2A 1HAYB 1WV7H 3LOXA 1NFYA 6CHAC 2BDBA 1GCDA 1LHDH 3ZZ3A 4MPWA 1ANEA 2G55A 1Z6EA 3F6UH 1BA8B 1C1QA 4F49A 2ZFPH 3BTEE 4BTIB 1OYTH 1G3CA 1OWJA 5C1YA 1PPGE 4ISIH 5T6DA 2QAAA 3QWCH 1Y5UT 4IMQA 1IQKA 3HPTB 1GI4A 2TPIZ 5PTPA 1O30A 3SU1A 1RIWC 4I31A 4FUDA 2A31A 1F0UA 1E0FD 3NZIA 5EOKA 5T3HA 2ZQ2A 3E8LA 2UUJB 4H4FA 1O35A 1OP0A 4ZMAH 1IQGA 2GVFA 3UNQA 2G4UA 3UREA 1G3BA 1N6YA 1ESAA 3BTKE 2BD2A 1V2OT 5T6GA 1O3HA 2ZWLH 3T5FH 2ESTE 1ELCA 1G9IE 2A7CA 3KQBA 2ZGHA 3DFLA 4YZUA 3ZZ5A 3S9CA 2BZ6H 1Z8JB 3RXDA 3VPKA 1NROH 4DJZB 1KY9A 2RA0A 4TY7A 1EOLA 5HGGA 2A32A 1WCZA 3GISB 1GI9B 2ZPSA 4ZKNU 2F9BH 1PPFE 4UFEH 2FYQA 1C5QA 3SI4H 5F6MA 5LPEA 1WUNH 1ZYOA 2VVUA 3MWIU 1O2RA 2FMJA 3FZZA 4OGYA 1ZPZA 4YTAA 2Z9LA 1W8BH 4UDWH 2WPLS 1HCGA 3B8JA 1F5KU 3E16B 1TQ0B 1IHSH 1TNIA 1YPHE 2YOLA 4CBOA 4INKA 1VITG 1S0RA 2XWBI 1ZHPA 4JYVH 2GGVB 3O8DA 3SNBA 3PMBB 1HAVA 3P95A 3QUMP 1UVSH 2W26A 5LPRA 4FUJA 2Q6GA 1W11U 3BEIB 1EB1H 4MQAA 1OYQA 4IN2A 1AI8H 4DT7B 1BT7A 2H9TH 1H1BA 1CHOF 2XBXA 1P9UA 1MKWH 4AGKA 1P2QA 1CT4E 1XXFA 3GCOA 4AYVB 1K1PA 1C2FA 1GBLA 1SGTA 2OC7A 1O3DA 2BY8X 1ARCA 1C5ZB 1Y3YA 1GI6A 4WXIA 2VB0A 2XXLA 1GI3A 1BMLA 3MO9A 3UIRA 2BHGA 1BMMH 1TX7A 1UTKA 1GJBB 2AS9A 2PUQH 2Y80A 1DANH 3SBKA 2C90B 1C5XB 1IQHA 1C1WH 1MU6B 4Y6DA 4AFQA 4E06H 1FLEE 1SB1H 1EP5A 3RC5A 1NU7B 4X1QU 2ZDNA 1TNLA 2PTCE 2FWWA 1NTPA 7GCHG 1T4UH 1P12E 2GZ9A 3O8RA 1ZSJA 3BF6H 1IQMA 2IPHA 4X2VA 4X6OA 2C8YB 3Q77A 2ZHWH 4D9QA 3A81A 1L1GA 1RD3B 4NSVA 1OWHA 1GMCG 2F9PA 3LJJA 1O2OA 2ZGCA 4SGBE 1UK3A 2A2QH 2O9QA 4ABGA 3ZZDA 4YLQH 1QL8A 1YC0A 1SLVB 4OGXA 2P8OC 1HUTH 3A7WA 1GBCA 1P0SH 1UCYK 4BOHA 3QTVH 2BOHB 3F1SB 2GCHF 3U1IB 2ZPRA 3SU3A 2FOFA 2HNTC 4E05H 1BB0B 4BAHB 4TYDA 3MU0A 1NY22 4JYUH 3VB7A 3KEEA 2HPPH 1RTFB 4FUEA 6LPRA 3RXEA 1WAYB 1C1SA 3R0FA 1J9CH 2ZFRH 1Z8RA 1ARBA 1H4WA 1SGQE 1O5DH 1PQ5A 3M5LA 1NESE 4X1SU 3D62A 3I78A 1T31A 3PV4A 5F03A 4ZH8A 4WH8A 4XBBA 2ZDLA 4ZXYH 3UTUH 1O3FA 1JIRA 5A0AE 8LPRA 1LHFH 1O3OA 2VIPA 4NFEA 1GBKA 2QXHA 4U2WA 3QTOH 2V3HH 1C4Y2 3NK8A 3RXVA 1ACBE 3MI4A 1TRNA 3EAJA 1BTWA 1TX6A 1C5LH 1JRSA 3MU1A 4JK6A 2Z6BD 2XC5A 2F9UA 3SU6A 2PR3A 5DK1A 2H9HA 1XMNB 1TQ7B 1RRKA 4ZHAA 2FOAA 1GBBA 2CN0H 2DUCA 1V3XA 1SGFG 1XVOA 2LNCA 3NUMA 1EAUA 1W7XH 1NRNH 1B0EA 4J2YB 2P59A 1XXDA 4I32A 3EA8A 1FIWA 1LCYA 3GDSA 4K8BA 4IC6A 3NWUA 3MH7A 1ANBA 3SUDA 1DT2A 3KNXA 4B75A 3P92A 3VGCC 1EJNA 1MTWA 2DE8A 3OY5U 3MU4A 5C1XA 2FOGA 3SV6A 1SGIB 5C5NA 2BYAX 1O3MA 3RC6A 4X2WA 1BUIA 3EQ0H 1O36A 5HM9A 1C2EA 1O34A 1UK4A 3FVFB 3TNSA 3QN7A 3QO6A 4AB9A 3UQVA 1TGSZ 2BMGB 2PKSC 3P6ZB 5DP9A 1PQAA 1QNJA 2P8OB 1J15A 2WPKS 3LH3A 3A8AA 3CS7A 4H6TA 4NA8A 1C1OA 1IOEA 4FU7A 1TOMH 3RLYH 1ABIH 2F91A 1ZTJA 1YCPK 3ZYDA 2ZECA 2Q6DA 3SV8A 2A45B 2JETC 1DSTA 4D9RA 3PMJA 1TBRH 2CF9H 4A92A 1BQYA 3SNCA 5GJ4B 4TPYA 2Q1JA 4DGJA 2O8WA 3A8BA 1GHBF 3AVZA 1B7XB 2RG3A 1PYTD 1ZRKA 1TFXA 1AFQC 3ATKA 3G01A 1VCWA 3ENSB 1SG8B 1JIMA 2BB4A 4MTBA 5JYIA 1YPMH 2R0KA 3EA7A 5AFYH 1KDQA 2FP7B 2YNAA 5AVDA 1C5RA 3GY4A 1ELEE 2CXVA 2OC1A 1FMGA 1PQ8A 3RXKA 1OPHB 1L4DA 4J1YA 1TRYA 5TJXA 4AG1A 5FPTA 2WPIS 2NWNA 2A4OA 5E2OA 1HBTH 1LO6A 3RXTA 2ZCLP 1DXWA 4K5ZA 1T8NA 1K9OE 3ZYEA 4O03A 2BD5A 1C2LA 1PPCE 1K28D 4AORA 2QF0A 4K69A 2BDIA 2CJIA 4GAWA 1DX5M 1DVAH 3F9FA 1GBAA 2GZ7A 1VJAU 4O97A 3RMLH 1EZSC 3E6PH 1V2QT 1K1OA 4OS7A 1P2IA 1O2XA 1ABJH 3TITA 3SJOA 1YPEH 4Y7AA 1FI8A 1OSSA 4WH6A 7KMEH 1DWEH 2JKHA 2EA3A 3E3TA 3MMGA 2GCHG 2XWAA 4Y11E 1ELDE 1AB9B 3E90B 2QF3A 3SORA 4CH2B 3SOSA 1ESBA 1HV7A 3VGCB 3QZQA 1SMFE 3TGKE 2P93A 4ZHMU 2ZIQH 3EGKH 3ODDA 4Q7XA 3M61U 4K1EA 1JRTA 5FX6A 3VB5A 3K2UA 2PKSB 2M5TA 3SZNA 2BQWB 1CO7E 1N6XA 2D8WA 1QBNA 1ELFA 2WUBA 1SGDE 1VCQA 1KXEA 4GHQA 5DP8A 2A4QA 3BIVH 4CRDA 1HAZB 3LGVA 1RTKA 4A5TS 1KXDA 4NA9H 2ZGXH 1DPOA 1O3KA 3PMHB 3BTME 3GCHC 1MBMA 3MU5A 1O3IA 3A8CA 3PROA 3TPIZ 4ZKOU 3M37A 3MOCA 1DICA 1CA8B 5F8TA 4FXGH 3SI3H 1AFEH 3A82A 5GDSH 4NG9H 2W7UA 1HAXB 1UTMA 3TGJE 1S6FA 5JDUB 1C9PA 1RJXB 1BOQA 2GTBA 2VWLA 1T32A 2HWLB 1WSSH 1H9HE 1TGCA 3GY7A 1W3CA 2Y81A 2ZHQH 2ZPQA 1FDPA 1WBGB 4FU9A 3ZVFA 1GMDF 2Y7XA 1VR1H 2ZQ1A 3M7UA 1G37A 1QA0A 3BG8A 2FTLE 1RXPA 1W0ZU 2HRVA 4B2BA 2XBYA 1DY8A 1O3AA 5JBBS 1E38B 1ELGA 1C2IA 1SGNE 4RSPA 1GDNA 5GCHF 3A7XA 3P70B 2Z3EA 1KXBA 2QXGA 1A2CH 1MUEB 1A3BH 1O3GA 4ISHH 1C1RA 1V2NT 3A84A 3LU9B 1V2LT 1Z7KA 1W14U 1GI2A 2SGDE 4MDSA 4AB8A 1ZRBA 1V2VT 1TABE 1V2JT 4ZROA 2XYAA 2LPRA 3SHCH 4IC5A 1TRMA 4FUHA 1GJDB 3D65E 1K21H 1HAVB 5LGOA 3A7VA 3QZRA 3P17H 1E34B 4Y8YA 3ZVDA 1A0LA 4WWYA 4K1TA 1ZHRA 1D6WA 1ESTA 3URDA 3BTDE 2G81E 3SHAH 3CS0A 3SUFA 2TBSA 4UE7H 1AZZA 3SU2A 5IDKA 3GCTF 1IHTH 3HGNA 1J14A 1UVPA 3ZZ7A 1Y3XA 2P3TB 4E7RG 2FI4E 1W10U 4B76A 1ZJKA 4D7GA 1SOTA 1V2ST 1FQ3A 1SGYE 2FI5E 1Y5AT 1JXPA 1QJ1B 1BRUP 2EI7A 3LONA 3EDXB 1ZMLA 2GP9B 3GYMA 3EA9A 3S0NA 1OS8A 1T8OA 1T8LA 4FU8A 4I8GA 1EAIA 1A46H 1C5UA 5C1UA 1FZZA 1FAXA 1K1IA 1BBRK 1HLTH 3T2NA 1C9TA 1ZGVA 1CT0E 4X1NU 1H8DH 3KGPA 1O2TA 2LIZA 1F7ZA 1N1LA 2R9PA 4BAMB 3M5NA 3OX7U 1P2NA 1WTGH 5T6FA 1JMOH 3STJA 2ZU4A 1DE7H 2BD7A 2DE9A 1TWXB 3SNAA 1SC8U 1GL0E 1GBFA 2WINI 1OWIA 3LT3A 4OS4A 1S0QA 1BHXB 1ZR0A 2ANKH 1C1UH 3SV2H 3OYPA 3QDZB 1QQ4A 2H2ZA 4MNWA 1QRXA 1P2OA 5JBTA 2B9LA 4GCHG 1TBQH 3TNTA 1MTSA 3SW2B 1KLTA 5I25A 4KTUA 1NRQH 2PKAA 2VINA 5FHTA 2XW9A 1RS0A 1O2HA 1UO6A 1TAWA 1QBVH 1MTVA 1SLUB 3K9XB 4I8JA 4WXVA 1AY6H 1O2IA 1FJSA 1KYNA 2GT7A 5L30H 3ZVAA 3DHKH 1FAKH 4NZLA 1TONA 1BTZA 2BXUH 1P03A 4SGAE 1KXAA 1KLJH 1Y3UA 1YP9A 5E0JA 1K1NA 3LC3A 3Q3YA 5GWZA 1SLWB 2A7HA 4BANB 4Y7BA 2HNTE 1NZQH 4NA7A 3LKWA 6GCHG 4X1PU 3MH5A 4AGJA 1DUEA 2ZO3H 3U69H 4DIIH 1BRAA 1GHWH 4X6NA 4UFDH 2OBQA 3VB6A 3VB4A 5A0BA 1OWKA 1VJ9U 1DLEA 5FXLA 4B71A 1D6RA 3S9AA 4VGCC 2UUYA 4Z0KA 5JPMH 3I29A 1O2LA 1P01A 2H6MA 2WV4A 2PGQB 4JZEH 3PO1B 1SGCA 2ANYA 1UJ1A 1QCPA 1TA6A 3A8DA 2CHAC 2WPHS 5GCHG 1AWFH 1NRPH 3TLOA 1ORFA 3VXEH 1A0JA 1OP2A 1THSH 1QA7A 3IWMA 1EUFA 4I8KA 5A2MH 2BDAA 3JZ1B 1GCTC 2FEQH 3A89A 1F0SA 3SGAE 3OSYA 3RXRA 1L2EA 5GPIB 1GHYH 4HGCA 8KME2 1XUGA 4YM9A 4Y10E 1BRCE 4JK5A 3GCNA 5A0CA 1NT1A 5J4QA 3SU4A 1MBQA 1G3EA 3GY8A 4BAOB 3EE0B 2BLVA 2OLGA 2R0LA 1EZXC 4ESTE 2HGTH 3RC4A 2C8ZB 2W3IA 4YLUA 3U1JB 4KTSA 1IQEA 1O2MA 1YLDA 3KF2A 4A6LA 4YOGA 1PJPA 2C8WB 1AVWA 1YGCH 3HK3B 2O8MA 5F8ZA 1QFKH 2JH0D 2J9NA 3FP8E 5FPSA 2BY7X 1GHAF 3GYLB 3U8TH 1QB9A 2QIQA 1UHBA 3PB1E 4CRAA 2OQ5A 3T29A 1P2JA 2IOTA 1BMAA 1GJCB 1O5GH 3GCTG 2UUKB 1Z8GA 2J4IA 3RXOA 1SVPA 1QJ7B 2OP9A 2B8OH 2IN2A 1C5SA 1V2KT 5DGJA 4DIHH 5E2PA 3KL6A 4Q2KA 2O8UA 2Z9GA 4XFQA 3RXUA 1Y5BT 1OOKB 4RKJB 1SL3A 1BZXE 2XRCA 1C2JA 3VB3A 3QX5H 4AZ2B 1AU8A 1BTUA 4MNXA 1LPZB 3U8OH 1QL7A 1D3TB 1O3JA 4X0WU 3Q3XA 2NU1E 6ESTA 1KDQB 1IQJA 1BIOA 2K1QA 4ABHA 2QGRA 1E37B 3RXAA 2BD9A 4UD9H 3SUGA 1AKSA 4XE4A 5FCKA 4OS1A 5DKMA 2BDYA 4ABJA 4VGCB 1UVUH 1O5CB 5EODA 1GWAA 2WUCA 4UEHH 1C5WB 1HAHH 1SHYA 5DP4A 3PYHA 4CBNA 4MPVA 4ABDA 1P8VC 2R3YA 1GBHA 2CHAB 1EATA 2P3UB 1QY6A 3TK6A 2ODYB 1UTQA 2WPJS 4K1SA 1GCTB 4KELA 1C1NA 2CF8H 3TJNA 1EX3A 1MKXH 3SGQE 1THRH 5SGAE 3ZV9A 1TPOA 4Z6AH 3A87A 3PTBA 2FDAA 3ZVCA 1S81A 5LPFA 3Q76A 3OY6U 2VNTA 1ZTKA 3MNSA 4UONA 1CGHA 4YESB 4BXWA 1SGEE 1GMHF 1HPGA 4HI3A 1WYKA 1P3EA 3RXFA 1FV9A 1YPKH 4LZ1H 1IAUA 1AE5A 1SR5C 1B5GH 1VITH 1O3NA 3ZV8A 5BPEA 5JB9S 7ESTE 4JZFH 2ULLA 1EOJA 3RXIA 1ZOMA 1HJAB 1BDAA 1OWEA 2FPZA 2AMDA 3OU0A 2FOCA 1SOZA 2FOHA 1PYTC 3A7TA 2PTNA 3BTWE 2ZDMA 2V35A 4MLFB 1P2KA 3NPSA 1AUTC 1F92A 1GI1A 3L6PA 1C2HA 3GY5A 1AB9C 2VIQA 1WQSA 5K7RA 3ZVEA 2Z3DA 2BY6X 1N8OB 4CREA 2EC9H 9ESTA 2BY5X 4KGAA 4X2XA 3K6YA 3SGBE 3ZVBA 1BTPA 4XBCA 1BMNH 1O3LA 4D8NA 1GG6B 1QHRB 2STBE 2Y7ZA 2ZHEH 2Z9KA 5C5OA 3BSQA 1TYNA 1S82A 4O3UA 1O3BA 4IN1A 1HRTH 3RXGA 1O32A 4X8TH 5C67A 1WOFA 1TGNA 2VH0A 1CHOG 1UTOA 3MFJA 1RFNA 2FOBA 1H9LB 1O2VA 1BBRE 3KQCA 1V2UT 4NGAH 1J8AA 5EXLA 2BVXH 4NFFA 1TPSA 2OBOA 4GVUA 2STAE 1KIGH 4ZXXH 2RDLA 2TGTA 3GY6A 1FXYA 1M9UA 1PPEE 4KP0A 2VWNA 8GCHF 1CT2E 2UWOA 2Z9JA 3QGNB 2A4GA 2EI6A 3RXLA 1GDUA 1P06A 5EQSA 1TPAE 2VIVA 4K60A 4BAKB 1DOJA 4KTCA 1O39A 1AGJA 2PUXB 3M36A 4F4OC 3W95A 2WV5A 1SSXA 4Y71A 1OWDA 1PQ7A 5C2ZA 4D76A 1Z71A 2FODA 4Q7YA 1MQ6A 1S85A 2D1JA 1TE0A 1TPPA 2OCVB 2FX4A 1O2NA 4I8LA 3UQOA 2GT8A 4JZ1A 3RXMA 1ZPBA 3S69A 1YYY1 4HFPB 1W12U 1YPLH 4ISNA 2GCTB 1O2ZA 1EPTA 4AYYB 1OXGA 1XKBC 1VGCB 4M7GA 2C8XB 1NO9H 4LXBH 1QB6A 5EG4A 3FFGA 1CU1A 2ZI2H 1TGTA 5DJ7A 3RU4D 3U98H 1L1JA 4DCDA 1AE8H 1GBEA 4LOYH 4CRGA 3A80A 1LHGH 3MO3A 1W0YH 4U01A 3AAUA 3SO3A 1K1MA 4YOIA 3MTYA 2PSYA 3OTJE 1MCVA 1MKWK 1AZ8A 3P8FA 1GI5A 1KXFA 1WTHD 1G32B 1TLDA 1EAWA 2ZFTA 3R3GB 5EW2H 5DP3A 1DM4B 2ZNKH 2ZDVH 1CA0B 5DP7A 2BD3A 4JMYA 5H4IB 3GY2A 2QXIA 2GV7A 2PSXA 1L0ZA 1TNJA 2J2UA 4Y0ZE 3SNDA 5DO4H 2FTMA 3ELAH 1HDTH 1W2KH 3SV7A 3DD2H 1K1JA 4FUIA 3BEFB 1ID5H 1YBWA 2Y5FA 1BCUH 3B9FH 4YT7H 2KAIA 5ESTE 1GHVH 3GY3A 1GMHG 2NU4E 1GPZA 1A3EH 1GGDC 1O2UA 1TALA 2HLCA 2C3SA 1O2WA 2PKAB 2QY0B 5JB8S 1IQLA 1A1RA 2AYWA 3TJUA 2ZC9H 5JBAS 1NU9A 3PLBA 3A85A 1DS2E 2NU3E 2F3CE 1ZGIA 2P95A 3ZZ4A 4X8UH 5AHGH 2BVRH 1P09A 3KCGH 2SFAA 1GJ7B 1Y8TA 3F9GA 4WVPE 3UR9A 1ZZZA 3MNXA 1HXEH 1TBZH 3KHVA 3TH3H 1QQUA 2AH4X 2HOBA 1JOUB 1V2TT 4Y8ZA 2Z7FE 5DG6A 4LK4A 2B0FA 1FY4A 4DW2U 1NN6A 2ZHDA 2AGEX 4K3JA 3MYWA 3HKIB 4HZHA 1LPKB 2ANWA 2H5CA 4B73A 4BAQB 2OC8A 3UFAA 1VITF 3SQHE 1G2MA 3ZZ8A 3P8GA 1KTSB 3RDZA 1A7SA 1F0TA 1JWTA 3MHWU 4UFGH 1V2RT 4THNH 4Y8XA 4YOJA 1BTXA 2GDEH 1UVOA 1BTYA 3KN2A 4O3TA 5FBEA 3NKKA 1UCYE 2FS8A 1PPBH 2JH5D 4FUFA 4WMDA 3RM0H 1MKXK 4NIXA 3T25A 1C5PA 5B6OA 3O8BA 1MTNC 1TNKA 3A88A 1HGTH 1NFXA 1MMJN 4ZUHA 1GHBG 3B23B 1CBWC 1HJ9A 2OD3B 5DP5A 1U6QA 2J34A 1GI7B 2AIPA 2ILNA 1CVWH 3ATIA 2FX6A 3Q00A 2J95A 3DFJA 2TGAA 3HATH 2BQ7B 5FCRA 3V12A 2K7XA 1GJAB 3GDVA 4MPUA 2TIOA 2G5NA 1V2MT 3SU5A 4A7IB 4X8VH 4MNYA 3T28A 3PO1C 5FPYA 1C2MA 1F5RA 7GCHF 1UVTH 1D3DB 3UR6A 4A1VA 1C5MD 1GGDB 3A86A 2UWPA 1D4PB 3SJIA 1FY8E 5CE1A 3S7KB 4A1XA 4B74A 1UHBB 4E7NA 2Q6FA 1UMAH 1S83A 3ESTA 3LH1A 1GBJA 4ASHA 1GMCF 3DA9B 4IS5A 3SNEA 1AN1E 2GKVE 4O9VA 3D49H 1V6DA 1Y3WA 2XCNA 1V2PT 2SNWA 4LZ4B 2AGGX 2R3UA 1EZUC 4OS2A 1CHGA 4GHTA 3V7TA 3M3SA 1DITH 1NRSH 1O0DH 2FOMB 4K8YA 1ELAA 1K2I1 2YNBA 1GJ9B 2CV3A 3A7YA 2ZHFH 2GV6A 1MTUA 2TGPZ 1BJVA 3M7QA 1MZDA 2GMTB 2XC0A 4NZQA 1GDQA 3E0NB 3F9EA 2PWXA 1F0RA 2CGAA 3IG6B 1YCPM 3SQEE 3T27A 1C2GA 3LPRA 4CRFA 2HPQH 3QK1A 1AMHA 3FP7E 4WY3A 1P2MA 3M5OA 1AKSB 3M7TA 1W7GH 4ZAEA 1CGIE 4IMZA 2ZFQH 1IQNA 2F83A 1H9IE 4MVNA 1C5YB 2ALPA 2AIQA 3RXHA 1YCPH 4ISOA 3TH2H 1AIXH 4IBLH 1O2SA 2FI3E 1ETRH 4X1RU 3TJOA 1Z1JA 2ZU1A 1UTJA 4AG2A 3LGUA 5AF9H 3GDUA 4MG3A 3RU4T 1NRRH 1MTNB 2D26C 3AASA 1ANCA 4TPIZ 1O3CA 1EASA 1LPGB 2HALA 2VIDA 1X7AC 3TK5A 4B2CA 2Y82A 1MH0A 5L2ZH 1CBWB 1EQ9A 2ZTZA 1DDJA 5CHAB 2BLQA 1QJ6B 1SQOA 2ALVA 3N7OA 3ODFA 2XC4A 3AW0A 2UWLA 1GMDG 5TCCA 1FIZA 1P57B 2WYGA 1O3EA 3BG4C 1O38A 3UY9A 5EU8A 2I6SA 2FO9A 4CRBA 1DUAA 3E91A 1SQTA 1TNHA 1FONA 1KSNA 4Y76A 1MZAA 2D2DA 4GLYA 1HIAA 1HFDA 1SFIA 2QA9E 5E0HA 4AX9H 4CR9A 1FY5A 2FYRA 2W5EA 4YO9A 1ZLRA 3MNBA 4JYTA 5A09A 3HKJB 2BDGA 2SGQE 2PLXA 1GHXH 1GI0A 1EPTC 1O37A 4CHAC 1WQVH 2SNVA 1P02A 2G4TA 1QIXB 4FUCA 1DXPA 3PLPA 2Y5HA 3P8NA 2ZCHP 3ITIA 1HNEE 2VU8E 3D23A 2BLOA 1YKTA 1ZTLA 2I6QA 4AFUA 1O5EH 4WJG2 3RP2A 1EZQA 1UTNA 2SGAA 2Y6TA 1LVMA 3LGIA 1LVOA 1O2KA 1SLXB 1YF4A 2P16A 5JBCS 1TNGA 5C3NA 1EP6A 1QB1A 1C1MA 3TIUA 2BXTH 3SN8A 1S84A 1O2YA 1UTLM 1HJAC 1ZPCA 3SJ9A 1ETSH 3H5CB 3MNCA 6CHAB 2A0QB 4JZIA 5A8XA 2CMYA 3BEUA 5J4SA 4RN6A 1T7CA 2WYJA 4FUGA 4YT6H 4WMFA 2OUAA 1F5LA 2ZZUH 1GBTA 3P8OA 4HTCH 2OINA 1KXCA 4ABFA 2PV9B 1V2WT 1IQFA 1N8OC 4GUXA 3V13A 1XUFA 2PGBB 1RIWB 2H9EH 4ZKRU 1HAIH 1ZSLA 4D7FA 3UNSA 4ABIA 8ESTE 4X8SH 5I46H 2A1DB 2J38A 4AOQA 1HXFH 1C5VA 1GG6C 2THFB 1FN6A 1SQAA 4IW4E 4Q80A 3JZ2B 2ZKSA 4BTTB 4TWYA 1KTTB
chains in the Genus database with same CATH superfamily
3F9HA 2AFQB 1SI5H 1GJ5H 2J92A 3RU4E 2ZGBH 2O8TA 2FS9A 1O5BB 2VVVA 1FN8A 2TGDA 1GJ4H 3ZZBA 1ZMJA 1Q3XA 3ATWA 5DPAA 3KIDU 3ATLA 1DWCH 3BG4B 3ZIAD 1YPGH 4OS6A 5A8ZA 3FN8A 4NIVA 4DT4A 1YM0A 2Z3CA 3M5MA 4ABEA 5E8EH 4MPXA 2ASUB 2EEKA 3SJKA 2BOKA 1CSOE 3W94A 4WMEA 1NC6A 1DFPA 2HVXA 2FESH 1C4U2 1Q2WA 1EPTB 3RMOH 2Z9IA 4CHAB 4DG4A 1EJMA 2ZP0H 1J17T 2OTVA 1QL9A 1QRZA 3PWCA 1C2KA 1P04A 1AHTH 1QURH 4BXSA 3S7HB 2FOEA 2UUFB 1MAYA 1G3DA 1OP8A 1RTLA 4I8HA 3BTHE 1MCTA 3MH6A 1YPHC 1HYLA 4AN7A 1LMWB 3M3TA 2VWMA 1LHCH 1LTOA 3URCA 1TOCB 1Z1IA 3RXSA 2GJGA 2PFEA 1MAXA 1O31A 1ELBA 3FP6E 2BX3A 2WPMS 1A61H 3IITA 4ABBA 3LGTA 3UWIA 2GX4A 5EPNA 2GCTC 1AWHB 1LVYA 1H8IH 3F2FA 1HB0B 9LPRA 4OM9A 1VGCC 2FXRA 1QGFA 3RXCA 1GVKB 1MU8B 3SJ8A 5EXMA 2GZ8A 2HLDD 4XOJA 1O33A 1Y59T 3HGPA 3M35A 3UNRA 2H1UA 2KAIB 5ABWA 2BDCA 3EYDA 1NFUA 4Y79A 1QBOA 3ATMA 2AERH 4JZDH 2GD4B 1TA2A 1O2GH 5A8YA 1W13U 1SGFA 4TWWA 2XTTB 1D9IA 1CA0C 1O3PB 4Y0YE 2HNTF 2QXJA 3BV9B 1GL1A 2ZDAH 5ETXA 1P05A 2J98A 3CP7A 2ZU3A 4Q7ZA 1BRBE 1GI8B 1BBRH 3TH4H 3TJVA 1XUIA 2VIWA 2FLBH 1Q31A 2R2MB 4XD7D 1F2SE 3FANA 5L6NH 1A4WH 3C1KA 1ETTH 2ZCKP 3TGIE 3W1EA 1C4V2 5IYTA 1TMUH 3UOUA 2G52A 4DY7B 1CE5A 2KCPA 3I77A 2G8TA 3VEQB 1FPHH 3RMMH 1BJUA 1SHHB 4I86A 5EW1H 1YPJH 5FL7D 1SKYE 1J16A 3BTQE 4XDEA 1WU1A 3RXQA 1SFQB 1IQIA 1INCA 1A5IA 1TGBA 2FLRH 2VGCC 2K8IA 4X6MA 2PHBA 4QT8C 5K0HA 2BLWA 4TY6A 4NCYA 1O2PA 3DT0H 1BITA 1S5SA 3STIA 1GHAG 3BTTE 1NFWA 1CQQA 2BX4A 2A5IA 1MD7A 1NM6A 2C93B 3T62A 4DURA 4OS5A 1O5FH 1C1VH 5FBIA 3RLWH 3KYFA 5EPYA 1HAPH 1PPHE 1T8MA 2ZFSA 4FUBA 4UFFH 2A5KA 1P3CA 3LC5A 3V0XA 4GSOA 2SGEE 2BD8A 2G51A 1TIOA 3PLKA 3PTNA 1TMBH 3DUXH 3RXPA 4JCNA 2VH6A 4ABAA 4B2AA 5BRRE 5AFZH 4BTUB 3F0OA 5HIZA 2AMPA 1XUJA 2RDEA 3NCLA 3L33A 1AO5A 1XVMA 1ZMNA 4U30A 1CGJE 3AW1A 2VJ1A 1GVLA 2ODPA 3T26A 3E1XB 1XUKA 4MNVA 4FVDA 1GBMA 1EAXA 2Z94A 3HK6B 2ZDKA 4R8TB 3UWJH 3UUZA 5ESBA 4H42U 1K1LA 5EXNA 3ZZCA 3A7ZA 1O2JA 4A1TA 1LVBA 1NBME 1D3PB 2EQNA 4NWLA 2ODQA 1NS3A 3CENA 3ZZ9A 3BTGE 2Y5GA 2BQ6B 3PM3A 2FIRH 3LGYA 1DY9A 5HYOA 3O8CA 2BVSH 1LQEA 2A7JA 2A4RA 1UK2A 1A5HA 1AVXA 3QGJA 2ZFFH 4R0IA 3ZZ6A 3LIWA 5C17A 4CRCA 1QTFA 2AMQA 1LDTT 4X2YA 2AGIX 1YWUA 2A5AA 3RMNH 4WF8A 1XM1A 3LJOA 3M3VA 4K2YA 4DOQA 1E36B 4U32A 1KLIH 4H6SB 1LHEH 2V7QD 2OK5A 5FX5A 3TU7H 1NPMA 4GCHF 7LPRA 4XSKU 5GIBA 1GJ6A 3BTFE 1C1TA 4IGDA 3FAOA 2W7SA 2FZZA 2V3OH 2OQUA 3K6ZA 1TX8A 4ZKSU 3V3MA 1GJ8B 1D3QB 3AK5A 1G36A 3TVJB 3ZVGA 3VXFH 2NU0E 2VGCB 1PPZA 1UTPA 1AD8H 4ZHLU 2B7DH 1GBDA 2JETB 4I33A 1C2DA 2ZF0H 3N99A 5E0GA 1ELVA 1OX1A 5DP6A 1VCPA 1B0FA 1LQDB 2BZAA 2F43B 4KKDA 1LKAA 1L4ZA 2O8LA 1HJ8A 2XBVA 3SU0A 6GCHF 4BNRA 2ZG0H 1E35B 3GS9A 1SBWA 2P3FH 1W0KD 3GICB 2QCYA 1AFQB 1YLCA 4GPGA 1TB6H 2XNIA 2QC2A 4INHA 2F9OA 1Z8IB 4PROA 3QLPH 2PW8H 1THPB 1GVZA 1S6LA 4NIWA 2GMTC 1C5OH 5C94A 2OXSA 1EKBB 1QRWA 4CH8B 5EQQA 1K22H 3MU8A 2EI8A 1ELTA 3KQDA 2YMSC 1JBUH 2BM2A 5EGMA 3Q3KA 1GHZA 1XKAC 2K0QA 1RGQA 4INLA 3U9AH 1UCYH 1HAOH 2RA3A 1HAGE 2H5DA 1VZQH 2J94A 1P10A 4FVBA 2VIOA 3MO6A 5HMAA 3U8RH 1XUHA 2FM2A 3E0PB 1FY3A 2A2XH 3PWBA 1A0HB 3MH4A 5HM2A 2BD4A 1HIAB 5L2YH 3H7OA 1DLKB 1FNIA 2F9VA 4HG6A 3RM2H 3UPEA 1O2QA 2XCFA 1L1NA 2B5TB 2V6NA 3BN9A 1S6HA 2G00A 2VVCA 3TK9A 1TMTH 3RXJA 1OKXA 2ANMH 2QYIA 4XBDA 5LH8A 4X6PA 1G30B 5CMXH 4B1TA 3BIUH 1BTHH 1SGPE 1MQ5A 8GCHG 2F4LA 3LDXH 3FZDA 3PRBA 1MD8A 1C5TA 5CHAC 1AUJA 2ZGJA 1OHHD 1ZJDA 1ZSKA 2NU2E 4NWKA 3VFEA 1G2LA 1WDIA 1DWDH 1DWBH 4AFZA 2OC0A 3WY8A 1EJAA 2P94A 5EQRA 5CHBA 1P9SA 1FX0B 2TRMA 4DVAU 5FAHA 5GXPA 1SGRE 2V0BA 2R2WU 4ISLA 2ZTXA 2F9NA 4RKOB 2SGPE 3S9BA 2ZA5A 1A5GH 1C1PA 3SUEA 1FY1A 2ZTYA 2G5VA 2QV1A 3H7TA 2GDDA 1C5NH 3NXPA 2RFKC 5EIYA 3A83A 2ZU5A 3RXBA 2C4FH 3AAVA 5C20A 2JH6D 1T4VH 1P11E 2BDHA 3GCHB 1DSUA 2KZ4A 2RCEA 2ZEBA 4Q63A 3ZZAA 1AVGH 3FO8D 1BHXF 1GBIA 1XX9A 4NIYA 1FUJA 5HXFA 4NSYA 3K65B 1Z6JH 5F8XA 3RUOA 4AFSA 2AEIH 2ZU2A 1ZHMA 3EBNA 4CR5A 3GOVB 2QN5T 2SGFE 3UOPA 3SV9A 1PFXC 1QR3E 3L3TA 4I7YH 2W3KA 3C27B 1ANDA 3KQEA 2XBWA 5TCAA 3LGWA 2BTCE 5G4BA 2IJOB 1SPJA 1Y3VA 3PMAB 1FPCH 1O5AB 1EXFA 1AQ7A 3F68H 3KYGA 1LKBA 2BY9X 2VWOA 1EB2A 1HAYB 1WV7H 3LOXA 1NFYA 6CHAC 2BDBA 1GCDA 1LHDH 3ZZ3A 4MPWA 1ANEA 2G55A 1Z6EA 3F6UH 1BA8B 1C1QA 4F49A 2ZFPH 3BTEE 5C0UA 4BTIB 1OYTH 1G3CA 1OWJA 5C1YA 1PPGE 4ISIH 5T6DA 2QAAA 3QWCH 1Y5UT 4IMQA 1IQKA 3HPTB 1GI4A 2TPIZ 5PTPA 1O30A 3SU1A 1RIWC 4I31A 4FUDA 3N7DA 2A31A 1F0UA 1E0FD 3NZIA 5EOKA 5T3HA 2ZQ2A 3E8LA 2UUJB 4H4FA 1O35A 1OP0A 4ZMAH 1IQGA 2GVFA 3UNQA 2G4UA 3UREA 1G3BA 1N6YA 1EFRD 1ESAA 3BTKE 2BD2A 1V2OT 5T6GA 1O3HA 2ZWLH 3T5FH 2ESTE 1ELCA 1G9IE 2A7CA 3KQBA 2ZGHA 3DFLA 4YZUA 3ZZ5A 3S9CA 2BZ6H 1Z8JB 3RXDA 3VPKA 1NROH 4DJZB 1KY9A 2RA0A 4TY7A 1EOLA 5HGGA 2A32A 1WCZA 3GISB 1GI9B 2ZPSA 4ZKNU 2F9BH 1PPFE 4UFEH 2FYQA 1C5QA 3SI4H 5F6MA 5LPEA 1WUNH 1ZYOA 2VVUA 3MWIU 1O2RA 2FMJA 3FZZA 4OGYA 1ZPZA 4YTAA 2Z9LA 4TT3D 1W8BH 4UDWH 2WPLS 1HCGA 3B8JA 1F5KU 3E16B 1TQ0B 1IHSH 1TNIA 1YPHE 2YOLA 4CBOA 4INKA 1VITG 1S0RA 2XWBI 1ZHPA 4JYVH 2GGVB 3O8DA 1H8HD 3SNBA 3PMBB 1HAVA 3P95A 3QUMP 1UVSH 2W26A 5LPRA 4FUJA 2Q6GA 1W11U 3BEIB 1EB1H 4MQAA 1OYQA 4IN2A 1AI8H 4DT7B 1BT7A 2H9TH 1H1BA 1CHOF 3WW7A 2XBXA 1P9UA 4RI0A 1MKWH 1SQRA 4AGKA 1P2QA 1CT4E 1XXFA 3GCOA 4AYVB 1K1PA 1C2FA 1GBLA 2J98B 1SGTA 2OC7A 1O3DA 2KCOA 2BY8X 5F53A 1ARCA 1C5ZB 1Y3YA 1GI6A 4WXIA 2VB0A 2XXLA 1GI3A 1BMLA 3MO9A 3UIRA 2BHGA 1BMMH 1TX7A 1UTKA 1GJBB 2AS9A 2PUQH 2Y80A 1DANH 3SBKA 3DSGA 2C90B 1C5XB 1IQHA 1C1WH 1MU6B 4Y6DA 4AFQA 4E06H 1FLEE 1SB1H 1E1RD 1EP5A 3RC5A 1NU7B 4X1QU 2ZDNA 1TNLA 2PTCE 2FWWA 1NTPA 1QZ8A 7GCHG 1T4UH 1P12E 2GZ9A 3O8RA 1ZSJA 3BF6H 1IQMA 2IPHA 4X2VA 1W0JD 4X6OA 4ZCNA 4F55A 2C8YB 3Q77A 2ZHWH 4D9QA 3A81A 1L1GA 1RD3B 4NSVA 3PV5A 1OWHA 1GMCG 2F9PA 3LJJA 1O2OA 2ZGCA 4SGBE 1UK3A 2A2QH 2O9QA 4ABGA 3ZZDA 4YLQH 1QL8A 1YC0A 1SLVB 4OGXA 2P8OC 1HUTH 3A7WA 1GBCA 1P0SH 1UCYK 2LELA 4BOHA 3QTVH 2BOHB 2JIZD 3F1SB 2GCHF 3U1IB 2ZPRA 3SU3A 2FOFA 2HNTC 4E05H 1BB0B 4BAHB 4TYDA 3MU0A 1NY22 3UB0A 4JYUH 3VB7A 3KEEA 2WPDD 2HPPH 1RTFB 4FUEA 6LPRA 3RXEA 2L74A 1WAYB 1C1SA 3R0FA 1J9CH 2ZFRH 1Z8RA 1ARBA 1H4WA 1SGQE 1O5DH 1PQ5A 3M5LA 1NESE 4X1SU 3D62A 3I78A 1T31A 3PV4A 5F03A 4ZH8A 4WH8A 4XBBA 2ZDLA 4ZXYH 3UTUH 1O3FA 1JIRA 5A0AE 8LPRA 1LHFH 1O3OA 2VIPA 3H09A 4NFEA 1GBKA 2QXHA 4U2WA 3QTOH 2V3HH 1C4Y2 3NK8A 3RXVA 1ACBE 3MI4A 1TRNA 3EAJA 1BTWA 1TX6A 1C5LH 1JRSA 3MU1A 4JK6A 2Z6BD 2XC5A 2F9UA 3SU6A 2PR3A 5DK1A 2H9HA 1XMNB 1TQ7B 1RRKA 4ZHAA 2FOAA 1GBBA 2CN0H 2DUCA 1V3XA 1SGFG 1XVOA 2LNCA 3NUMA 1EAUA 1W7XH 1NRNH 1B0EA 2L6OA 4J2YB 2P59A 1XXDA 4I32A 3EA8A 1FIWA 1LCYA 3GDSA 4K8BA 4IC6A 3NWUA 1H8ED 3MH7A 1ANBA 3SUDA 1DT2A 3KNXA 4B75A 3P92A 3VGCC 1EJNA 1MTWA 2DE8A 2KM0A 3MU4A 3OY5U 5C1XA 2FOGA 3SV6A 1SGIB 5C5NA 2BYAX 3WWBA 1O3MA 3RC6A 2QF5A 4X2WA 1BUIA 3EQ0H 1O36A 5HM9A 1C2EA 1O34A 1UK4A 3FVFB 3TNSA 3QN7A 3QO6A 4AB9A 3UQVA 1TGSZ 2BMGB 2PKSC 3P6ZB 5DP9A 1PQAA 1QNJA 2P8OB 1J15A 2WPKS 3LH3A 3A8AA 3CS7A 4H6TA 4NA8A 1C1OA 1IOEA 4FU7A 2LP6A 2CK3D 1TOMH 3FKSD 3RLYH 1ABIH 2F91A 1ZTJA 1YCPK 3ZYDA 2ZECA 2Q6DA 3SV8A 2A45B 2JETC 1DSTA 4D9RA 3PMJA 1TBRH 2CF9H 4A92A 1BQYA 3SNCA 5GJ4B 5B6LA 4TPYA 2Q1JA 4DGJA 2O8WA 3A8BA 1GHBF 3AVZA 1B7XB 2RG3A 1PYTD 1ZRKA 1TFXA 1AFQC 3ATKA 3G01A 1VCWA 3ENSB 1SG8B 1JIMA 2BB4A 4MTBA 5JYIA 1YPMH 2R0KA 3EA7A 2WZQA 5AFYH 1KDQA 2FP7B 2YNAA 5AVDA 1C5RA 3GY4A 1ELEE 2CXVA 2OC1A 1FMGA 4RT0A 1PQ8A 3RXKA 1OPHB 1L4DA 4J1YA 1TRYA 5TJXA 4AG1A 5FPTA 2WPIS 2NWNA 2A4OA 5E2OA 1HBTH 1LO6A 3RXTA 2ZCLP 1DXWA 4K5ZA 1T8NA 1K9OE 3ZYEA 4O03A 2BD5A 1C2LA 1PPCE 1K28D 2JJ1D 4AORA 2QF0A 4K69A 2BDIA 2CJIA 4GAWA 1DX5M 1DVAH 3F9FA 1GBAA 2GZ7A 1VJAU 4O97A 3RMLH 1EZSC 3E6PH 1V2QT 1K1OA 4OS7A 1P2IA 1O2XA 1ABJH 3TITA 3SJOA 1YPEH 4Y7AA 1FI8A 1OSSA 4WH6A 7KMEH 3OEHD 1DWEH 2JKHA 3U28C 2EA3A 3E3TA 3MMGA 2GCHG 2XWAA 4Y11E 1ELDE 1AB9B 3E90B 2QF3A 3SORA 4CH2B 3SOSA 1ESBA 1HV7A 3VGCB 3QZQA 1SMFE 3TGKE 2P93A 4ZHMU 3MQKC 2ZIQH 3EGKH 3ODDA 4Q7XA 3M61U 4K1EA 1JRTA 5FX6A 3VB5A 3K2UA 2PKSB 1VKYA 2M5TA 3SZNA 2BQWB 1CO7E 1N6XA 2D8WA 1QBNA 1ELFA 2WUBA 1SGDE 1VCQA 1KXEA 4GHQA 5DP8A 2A4QA 3BIVH 4CRDA 1HAZB 3LGVA 1RTKA 4A5TS 1KXDA 4NA9H 2ZGXH 1DPOA 1O3KA 3PMHB 3BTME 3GCHC 1MBMA 3MU5A 1O3IA 4ACBA 3A8CA 3PROA 3TPIZ 4ZKOU 3M37A 3MOCA 1DICA 1CA8B 5F8TA 4FXGH 3SI3H 1AFEH 3A82A 5GDSH 4NG9H 4XRNA 2W7UA 1HAXB 1UTMA 3TGJE 1S6FA 5JDUB 1C9PA 4ACAA 1RJXB 1BOQA 2GTBA 2VWLA 1T32A 2HWLB 1WSSH 1H9HE 1TGCA 3GY7A 1W3CA 2Y81A 2ZHQH 2ZPQA 1FDPA 1WBGB 4FU9A 3ZVFA 1GMDF 2Y7XA 1VR1H 2ZQ1A 3M7UA 1G37A 1QA0A 3BG8A 2FTLE 1RXPA 1W0ZU 2HRVA 4B2BA 2XBYA 1DY8A 1O3AA 5JBBS 1E38B 1ELGA 2W6ID 1C2IA 1SGNE 4RSPA 1GDNA 5GCHF 3A7XA 3P70B 2Z3EA 2HVYB 1KXBA 2QXGA 3OE7D 1A2CH 1MUEB 1A3BH 1O3GA 4ISHH 1C1RA 5KEDA 1V2NT 3A84A 3LU9B 1V2LT 2IPQX 1Z7KA 1W14U 1GI2A 2SGDE 4MDSA 4AB8A 3DSPA 1ZRBA 1V2VT 1TABE 1V2JT 4ZROA 2XYAA 2LPRA 3SHCH 4IC5A 1TRMA 4FUHA 1GJDB 3D65E 1K21H 1HAVB 5DN6D 3A7VA 3QZRA 3P17H 5LGOA 1E34B 4Y8YA 3ZVDA 1A0LA 4WWYA 4K1TA 1ZHRA 1D6WA 1ESTA 3URDA 3BTDE 2G81E 3SHAH 3CS0A 3SUFA 1KMHB 1YY3A 2TBSA 4UE7H 1AZZA 3SU2A 5IDKA 3GCTF 1IHTH 3HGNA 1J14A 1UVPA 3ZZ7A 1Y3XA 2P3TB 4E7RG 2FI4E 1W10U 4B76A 1ZJKA 4D7GA 1SOTA 1V2ST 1FQ3A 1SGYE 2FI5E 1Y5AT 3N7EA 1JXPA 1QJ1B 1BRUP 2EI7A 3LONA 3EDXB 1ZMLA 2GP9B 3GYMA 2JDID 3EA9A 3S0NA 1OS8A 1T8OA 1T8LA 4FU8A 4I8GA 1EAIA 2KR7A 1A46H 1C5UA 5C1UA 3OTPA 1FZZA 1FAXA 1K1IA 1BBRK 1HLTH 3T2NA 1C9TA 1ZGVA 1CT0E 2QF4A 4X1NU 1H8DH 1UW7A 3KGPA 1O2TA 2LIZA 1F7ZA 1N1LA 2R9PA 4BAMB 3M5NA 3OX7U 1P2NA 1WTGH 3DCLA 5T6FA 1JMOH 3STJA 2ZU4A 1DE7H 2BD7A 2DE9A 1TWXB 3SNAA 1SC8U 1GL0E 1GBFA 2WINI 1OWIA 3LT3A 4OS4A 1S0QA 1BHXB 1ZR0A 2ANKH 1C1UH 3SV2H 1YLNA 3OYPA 3QDZB 1QQ4A 2H2ZA 4MNWA 1QRXA 1P2OA 5JBTA 2B9LA 2KX4A 1TBQH 4GCHG 3TNTA 1MTSA 3SW2B 1KLTA 5I25A 4KTUA 1NRQH 2PKAA 2VINA 5FHTA 2XW9A 1RS0A 1O2HA 1UO6A 1TAWA 1QBVH 1MTVA 1SLUB 3K9XB 4I8JA 4WXVA 1AY6H 1O2IA 1FJSA 1KYNA 2GT7A 5L30H 3ZVAA 3DHKH 3PV2A 1FAKH 2KCYA 4NZLA 1TONA 1BTZA 2BXUH 1P03A 4SGAE 1KXAA 1KLJH 1Y3UA 1YP9A 5E0JA 1K1NA 3LC3A 3Q3YA 5GWZA 1SLWB 2A7HA 4BANB 4Y7BA 2HNTE 1NZQH 4NA7A 3LKWA 6GCHG 4X1PU 3MH5A 4AGJA 1DUEA 2ZO3H 3U69H 4DIIH 1WXRA 3OAAD 1BRAA 1GHWH 4X6NA 4UFDH 2OBQA 3VB6A 3VB4A 5A0BA 1OWKA 1VJ9U 1DLEA 5FXLA 4B71A 1D6RA 3S9AA 4VGCC 2UUYA 4Z0KA 4FOUC 5HKKD 5JPMH 3I29A 1O2LA 4M9FA 1P01A 2H6MA 2WV4A 2PGQB 4JZEH 3PO1B 1SGCA 2ANYA 1UJ1A 1QCPA 2KCAA 1TA6A 3A8DA 2CHAC 2WPHS 5GCHG 1AWFH 1NRPH 3TLOA 1ORFA 3VXEH 1A0JA 1OP2A 1THSH 1QA7A 3IWMA 1EUFA 4I8KA 5A2MH 2BDAA 3JZ1B 1GCTC 2FEQH 3A89A 1F0SA 3SGAE 3OSYA 3RXRA 1L2EA 5GPIB 1GHYH 4HGCA 8KME2 1XUGA 4YM9A 4Y10E 1BRCE 4JK5A 3GCNA 5A0CA 1NT1A 5J4QA 3SU4A 1MBQA 1G3EA 5T1VA 3GY8A 4BAOB 3EE0B 2BLVA 2OLGA 2R0LA 1EZXC 4ESTE 2HGTH 3RC4A 2C8ZB 2W3IA 4YXWD 4YLUA 3U1JB 4KTSA 1IQEA 1O2MA 1YLDA 3KF2A 4A6LA 4YOGA 1PJPA 2C8WB 1AVWA 1YGCH 3HK3B 2O8MA 5F8ZA 1QFKH 2JH0D 3F2HA 4Q4LA 2J9NA 3FP8E 5FPSA 2BY7X 1GHAF 3GYLB 3U8TH 2WSSD 1QB9A 2QIQA 1UHBA 4RT1A 3PB1E 4CRAA 2OQ5A 3T29A 1P2JA 2IOTA 1BMAA 1GJCB 1O5GH 3GCTG 2UUKB 1Z8GA 2J4IA 2WV9A 1SVPA 3RXOA 1QJ7B 3OFND 2OP9A 2B8OH 2IN2A 1C5SA 4FETA 1V2KT 3CNRA 5DGJA 4DIHH 5E2PA 3KL6A 4Q2KA 2O8UA 2Z9GA 4XFQA 3RXUA 1Y5BT 1OOKB 4RKJB 1SL3A 1BZXE 2XRCA 1C2JA 3VB3A 3QX5H 3EE7A 4AZ2B 1AU8A 1BTUA 4MNXA 1LPZB 3U8OH 1QL7A 1D3TB 1O3JA 4X0WU 3Q3XA 2IJD1 2NU1E 6ESTA 1KDQB 1IQJA 1BIOA 2K1QA 4ABHA 2QGRA 3SYJA 1E37B 3RXAA 2BD9A 4UD9H 3SUGA 1AKSA 4XE4A 5FCKA 4OS1A 5DKMA 2BDYA 4ABJA 4VGCB 1UVUH 1O5CB 5EODA 1GWAA 2WUCA 4UEHH 1C5WB 1HAHH 1SHYA 5DP4A 3PYHA 4CBNA 4MPVA 5HIYA 4ABDA 1P8VC 2R3YA 4ASUD 1GBHA 2CHAB 1EATA 2P3UB 1QY6A 3TK6A 2ODYB 1UTQA 2WPJS 4K1SA 1GCTB 4KELA 3KQ5A 1C1NA 2CF8H 4B6EA 3TJNA 1EX3A 1MKXH 3SGQE 1THRH 5SGAE 3ZV9A 1TPOA 4Z6AH 3A87A 3PTBA 2FDAA 3ZVCA 1S81A 5LPFA 3Q76A 3OY6U 2VNTA 1ZTKA 3MNSA 4UONA 1CGHA 4YESB 4BXWA 1SGEE 1GMHF 1HPGA 4HI3A 1WYKA 1P3EA 3RXFA 1FV9A 1YPKH 4LZ1H 1IAUA 1AE5A 1SR5C 1B5GH 1VITH 2XNDD 1O3NA 3ZV8A 5BPEA 5JB9S 7ESTE 4JZFH 2ULLA 1EOJA 3RXIA 1ZOMA 1HJAB 1BDAA 1OWEA 2FPZA 2AMDA 3OU0A 2FOCA 1SOZA 2FOHA 1PYTC 3A7TA 2PTNA 3BTWE 2ZDMA 2V35A 4MLFB 1P2KA 3NPSA 1AUTC 1F92A 1GI1A 3L6PA 1C2HA 3GY5A 1AB9C 2VIQA 1WQSA 3WWFA 5K7RA 3ZVEA 4TSFD 2Z3DA 2BY6X 1N8OB 4CREA 2EC9H 9ESTA 2BY5X 4KGAA 4X2XA 3K6YA 5C0TA 3SGBE 3ZVBA 1BTPA 4XBCA 1BMNH 1O3LA 5DSFA 4D8NA 1GG6B 1QHRB 2STBE 2Y7ZA 2ZHEH 2Z9KA 5C5OA 3BSQA 1TYNA 1S82A 3F2GA 4O3UA 1O3BA 4IN1A 1HRTH 3RXGA 1O32A 4X8TH 5C67A 1WOFA 1TGNA 2VH0A 1CHOG 1UTOA 3MFJA 1RFNA 2FOBA 1BMFD 1H9LB 1O2VA 1BBRE 3KQCA 1V2UT 4NGAH 1J8AA 5EXLA 1MABB 2BVXH 4NFFA 1TPSA 2OBOA 4GVUA 2STAE 1KIGH 4ZXXH 2M2AA 2RDLA 2TGTA 3GY6A 1FXYA 1M9UA 1PPEE 4KP0A 2VWNA 8GCHF 1CT2E 2UWOA 2Z9JA 3QGNB 2A4GA 2EI6A 1E79D 3RXLA 1GDUA 1P06A 5EQSA 1TPAE 2VIVA 4K60A 4BAKB 1DOJA 4KTCA 1O39A 1AGJA 2PUXB 3M36A 4F4OC 3W95A 2WV5A 1SSXA 4Y71A 1OWDA 1PQ7A 5C2ZA 4D76A 1Z71A 2FODA 4Q7YA 1MQ6A 2J97A 1S85A 5EJLA 2D1JA 1TE0A 1TPPA 2OCVB 2FX4A 1O2NA 4I8LA 3UQOA 2GT8A 4JZ1A 3RXMA 1ZPBA 3S69A 1YYY1 4HFPB 1W12U 1YPLH 4ISNA 2GCTB 1O2ZA 1EPTA 4AYYB 1OXGA 1XKBC 1VGCB 4M7GA 2C8XB 1NO9H 4LXBH 1QB6A 5EG4A 3FFGA 2QE7D 1CU1A 2ZI2H 1TGTA 5DJ7A 3RU4D 3U98H 1L1JA 4DCDA 1AE8H 1GBEA 4LOYH 4CRGA 3A80A 1LHGH 3MO3A 1W0YH 4U01A 3AAUA 3SO3A 1K1MA 4YOIA 3MTYA 2PSYA 3OTJE 1MCVA 1MKWK 1AZ8A 3P8FA 1GI5A 1KXFA 1WTHD 1G32B 1TLDA 1EAWA 2ZFTA 3R3GB 5EW2H 5DP3A 1DM4B 2ZNKH 3F3BA 2ZDVH 1CA0B 5DP7A 2BD3A 4JMYA 5H4IB 3GY2A 2QXIA 2GV7A 1K0HA 2PSXA 1L0ZA 1TNJA 2J2UA 4Y0ZE 3SNDA 5DO4H 2FTMA 3ELAH 1HDTH 1W2KH 2KFWA 3SV7A 3DD2H 1K1JA 4FUIA 3BEFB 1ID5H 1YBWA 2Y5FA 1BCUH 3B9FH 3F0PA 4YT7H 2KAIA 5ESTE 1GHVH 4F48B 3GY3A 1GMHG 2NU4E 1GPZA 1A3EH 1GGDC 1O2UA 1TALA 2HLCA 4P02A 2C3SA 1O2WA 2PKAB 2QY0B 5JB8S 1IQLA 1A1RA 2AYWA 3FOAA 3TJUA 2ZC9H 5JBAS 1NU9A 3PLBA 3A85A 1DS2E 2NU3E 2F3CE 1ZGIA 2P95A 3ZZ4A 4X8UH 5AHGH 2BVRH 1P09A 3KCGH 2SFAA 1GJ7B 2VBCA 1Y8TA 3OEED 3F9GA 4WVPE 3UR9A 1ZZZA 3MNXA 1HXEH 1TBZH 3KHVA 3TH3H 1QQUA 2AH4X 2HOBA 1JOUB 1V2TT 4Y8ZA 2Z7FE 5DG6A 4LK4A 2B0FA 1FY4A 4DW2U 1NN6A 2ZHDA 2AGEX 4P00A 4K3JA 3DSOA 3MYWA 3HKIB 4HZHA 1LPKB 2ANWA 2H5CA 4B73A 4BAQB 2OC8A 3UFAA 1VITF 3SQHE 1G2MA 3ZZ8A 3P8GA 1KTSB 3RDZA 1A7SA 1F0TA 1JWTA 3MHWU 4UFGH 1V2RT 4THNH 4Y8XA 4YOJA 1BTXA 2GDEH 1UVOA 1BTYA 3KN2A 4O3TA 5FBEA 3NKKA 1UCYE 2FS8A 1PPBH 2JH5D 4FUFA 4WMDA 3RM0H 1MKXK 4NIXA 3T25A 1C5PA 5B6OA 3O8BA 1MTNC 1TNKA 3A88A 1HGTH 1NFXA 1MMJN 4ZUHA 1GHBG 3B23B 1CBWC 1HJ9A 2OD3B 4B6FA 5DP5A 1U6QA 2J34A 1GI7B 2AIPA 5CDFE 2ILNA 1CVWH 3ATIA 2FX6A 3Q00A 2J95A 3DFJA 2TGAA 2JJ2D 3HATH 2BQ7B 5FCRA 3V12A 2K7XA 1GJAB 3GDVA 4MPUA 2TIOA 5EJ1A 2XOKD 2G5NA 1V2MT 3SU5A 4A7IB 4X8VH 4MNYA 2V3MA 3PO1C 3T28A 5FPYA 1C2MA 1F5RA 7GCHF 1UVTH 1D3DB 3UR6A 4A1VA 1C5MD 1GGDB 5GNDA 2YMSD 3A86A 2UWPA 1D4PB 2J5UA 1FY8E 3SJIA 5CE1A 3S7KB 4A1XA 4B74A 1UHBB 4E7NA 2Q6FA 1UMAH 1S83A 3ESTA 3LH1A 3SZEA 1GBJA 4ASHA 1GMCF 3DA9B 4IS5A 3SNEA 1AN1E 2GKVE 4O9VA 3D49H 1V6DA 1Y3WA 2XCNA 1V2PT 2SNWA 4LZ4B 2AGGX 2R3UA 1EZUC 4OS2A 1CHGA 4GHTA 3V7TA 3M3SA 1DITH 1NRSH 1O0DH 1NBMD 2FOMB 4K8YA 1ELAA 1K2I1 2YNBA 1GJ9B 2CV3A 3A7YA 2ZHFH 2GV6A 1MTUA 2TGPZ 1BJVA 3M7QA 1MZDA 2GMTB 2XC0A 4NZQA 1GDQA 3E0NB 3F9EA 5KGOA 2PWXA 1F0RA 2CGAA 3IG6B 1YCPM 3SQEE 3T27A 1C2GA 3LPRA 4CRFA 2HPQH 3QK1A 1AMHA 2YMSB 3FP7E 4WY3A 1P2MA 3M5OA 1AKSB 3M7TA 1W7GH 4ZAEA 1CGIE 4IMZA 2ZFQH 1IQNA 2F83A 5EJZA 1H9IE 4MVNA 1C5YB 2ALPA 2AIQA 3RXHA 1YCPH 4ISOA 3TH2H 1AIXH 4IBLH 1O2SA 2FI3E 1ETRH 4X1RU 3TJOA 1Z1JA 2ZU1A 1UTJA 4AG2A 3LGUA 5AF9H 3GDUA 4MG3A 3RU4T 1NRRH 1MTNB 2D26C 3AASA 1ANCA 4TPIZ 1O3CA 1EASA 1LPGB 2HALA 4AC9A 2VIDA 1X7AC 3TK5A 4B2CA 2Y82A 1MH0A 3VG8A 1E1QD 5L2ZH 1CBWB 1EQ9A 2ZTZA 1DDJA 5CHAB 2BLQA 1QJ6B 1SQOA 2ALVA 3N7OA 3ODFA 2XC4A 3AW0A 2EY4C 2UWLA 1GMDG 5TCCA 1FIZA 1P57B 2WYGA 1O3EA 3BG4C 1O38A 3UY9A 5EU8A 2I6SA 2FO9A 4CRBA 1DUAA 3E91A 5KECA 1SQTA 1TNHA 1FONA 1KSNA 4Y76A 1MZAA 2D2DA 4GLYA 1HIAA 1HFDA 1SFIA 2QA9E 5E0HA 4AX9H 4CR9A 1FY5A 2FYRA 2W5EA 4YO9A 1ZLRA 1COWD 3MNBA 4JYTA 5A09A 3HKJB 2BDGA 2SGQE 2PLXA 1GHXH 1GI0A 1EPTC 1O37A 4CHAC 1WQVH 2SNVA 1P02A 2G4TA 1QIXB 4FUCA 1DXPA 3PLPA 2Y5HA 3P8NA 2ZCHP 3ITIA 1HNEE 2VU8E 3D23A 2BLOA 1YKTA 1ZTLA 2I6QA 4AFUA 3NRLA 1O5EH 4WJG2 3RP2A 1EZQA 1UTNA 2AHME 2SGAA 2Y6TA 1LVMA 3LGIA 1LVOA 1O2KA 1SLXB 1YF4A 2P16A 5JBCS 1TNGA 5C3NA 1EP6A 1QB1A 1C1MA 2BXTH 3TIUA 3SN8A 1S84A 1O2YA 1UTLM 1HJAC 1ZPCA 3SJ9A 5IK2D 1ETSH 3H5CB 3MNCA 6CHAB 2WHXA 2A0QB 4JZIA 2PP6A 5A8XA 2CMYA 3BEUA 5J4SA 2W6JD 4RN6A 1T7CA 2WYJA 4FUGA 4YT6H 4WMFA 2OUAA 1F5LA 2ZZUH 1GBTA 3UAIC 3P8OA 4HTCH 2OINA 1KXCA 4ABFA 2PV9B 1V2WT 1IQFA 1N8OC 4GUXA 3V13A 1XUFA 2PGBB 1RIWB 2H9EH 4ZKRU 1HAIH 1ZSLA 4D7FA 3UNSA 4ABIA 8ESTE 4X8SH 5I46H 2A1DB 2J38A 4AOQA 1HXFH 1C5VA 1GG6C 2THFB 1FN6A 1SQAA 3PRDA 4IW4E 4Z1MD 4Q80A 3JZ2B 2ZKSA 4BTTB 4TWYA 1KTTB
chains in the Genus database with same CATH topology
3F9HA 2AFQB 1SI5H 1GJ5H 2J92A 3RU4E 2ZGBH 2O8TA 2FS9A 1O5BB 2VVVA 1FN8A 2TGDA 1GJ4H 3ZZBA 1ZMJA 1Q3XA 3ATWA 5DPAA 3KIDU 3ATLA 1DWCH 3BG4B 1YPGH 4OS6A 5A8ZA 4NIVA 1YM0A 2Z3CA 3M5MA 4ABEA 5E8EH 4MPXA 2ASUB 2EEKA 3SJKA 2BOKA 1CSOE 3W94A 4WMEA 1NC6A 1DFPA 2HVXA 2FESH 1C4U2 1Q2WA 1EPTB 3RMOH 2Z9IA 4CHAB 4DG4A 1EJMA 2ZP0H 1J17T 2OTVA 1QL9A 1QRZA 3PWCA 1C2KA 1P04A 1AHTH 1QURH 4BXSA 3S7HB 2FOEA 2UUFB 1MAYA 1G3DA 1OP8A 1RTLA 4I8HA 3BTHE 1MCTA 3MH6A 1YPHC 1HYLA 4AN7A 1LMWB 3M3TA 2VWMA 1LHCH 1LTOA 3URCA 1TOCB 1Z1IA 3RXSA 2PFEA 1MAXA 1O31A 1ELBA 3FP6E 2BX3A 2WPMS 1A61H 3IITA 4ABBA 3LGTA 3UWIA 2GX4A 5EPNA 2GCTC 1AWHB 1LVYA 1H8IH 1HB0B 9LPRA 1VGCC 2FXRA 1QGFA 3RXCA 1GVKB 1MU8B 3SJ8A 5EXMA 2GZ8A 4XOJA 1O33A 1Y59T 3HGPA 3M35A 3UNRA 2H1UA 2KAIB 5ABWA 2BDCA 3EYDA 1NFUA 4Y79A 1QBOA 3ATMA 2AERH 4JZDH 2GD4B 1TA2A 1O2GH 5A8YA 1W13U 1SGFA 4TWWA 2XTTB 1D9IA 1CA0C 1O3PB 4Y0YE 2HNTF 2QXJA 3BV9B 1GL1A 2ZDAH 5ETXA 1P05A 3CP7A 2ZU3A 4Q7ZA 1BRBE 1GI8B 1BBRH 3TH4H 3TJVA 1XUIA 2VIWA 2FLBH 1Q31A 2R2MB 1F2SE 3FANA 5L6NH 1A4WH 3C1KA 1ETTH 2ZCKP 3TGIE 1C4V2 5IYTA 1TMUH 3UOUA 2G52A 4DY7B 1CE5A 3I77A 2G8TA 3VEQB 1FPHH 3RMMH 1BJUA 1SHHB 5EW1H 1YPJH 1J16A 3BTQE 4XDEA 1WU1A 3RXQA 1SFQB 1IQIA 1INCA 1A5IA 1TGBA 2FLRH 2VGCC 4X6MA 2PHBA 4QT8C 5K0HA 2BLWA 4TY6A 4NCYA 1O2PA 3DT0H 1BITA 1S5SA 3STIA 1GHAG 3BTTE 1NFWA 1CQQA 2BX4A 2A5IA 1MD7A 1NM6A 2C93B 3T62A 4DURA 4OS5A 1O5FH 1C1VH 5FBIA 3RLWH 5EPYA 1HAPH 1PPHE 1T8MA 2ZFSA 4FUBA 4UFFH 2A5KA 1P3CA 3LC5A 3V0XA 4GSOA 2SGEE 2BD8A 2G51A 1TIOA 3PLKA 3PTNA 1TMBH 3DUXH 3RXPA 4JCNA 2VH6A 4ABAA 4B2AA 5BRRE 5AFZH 4BTUB 2AMPA 1XUJA 3NCLA 3L33A 1AO5A 1XVMA 1ZMNA 4U30A 1CGJE 3AW1A 2VJ1A 1GVLA 2ODPA 3T26A 3E1XB 1XUKA 4MNVA 4FVDA 1GBMA 1EAXA 2Z94A 3HK6B 2ZDKA 4R8TB 3UWJH 3UUZA 5ESBA 4H42U 1K1LA 5EXNA 3ZZCA 3A7ZA 1O2JA 4A1TA 1LVBA 1D3PB 4NWLA 2ODQA 1NS3A 3CENA 3ZZ9A 3BTGE 2Y5GA 2BQ6B 3PM3A 2FIRH 3LGYA 1DY9A 5HYOA 3O8CA 2BVSH 1LQEA 2A7JA 2A4RA 1UK2A 1A5HA 1AVXA 3QGJA 2ZFFH 4R0IA 3ZZ6A 3LIWA 4CRCA 1QTFA 2AMQA 1LDTT 4X2YA 2AGIX 2A5AA 3RMNH 4WF8A 1XM1A 3LJOA 3M3VA 4K2YA 4DOQA 1E36B 4U32A 1KLIH 4H6SB 1LHEH 5FX5A 3TU7H 1NPMA 4GCHF 7LPRA 4XSKU 5GIBA 1GJ6A 3BTFE 1C1TA 4IGDA 3FAOA 2W7SA 2FZZA 2V3OH 2OQUA 3K6ZA 1TX8A 4ZKSU 3V3MA 1GJ8B 1D3QB 1G36A 3TVJB 3ZVGA 3VXFH 2NU0E 2VGCB 1PPZA 1UTPA 1AD8H 4ZHLU 2B7DH 1GBDA 2JETB 4I33A 1C2DA 2ZF0H 5E0GA 1ELVA 1OX1A 5DP6A 1VCPA 1B0FA 1LQDB 2BZAA 4KKDA 1LKAA 1L4ZA 2O8LA 1HJ8A 2XBVA 3SU0A 6GCHF 4BNRA 2ZG0H 1E35B 1SBWA 2P3FH 3GICB 2QCYA 1AFQB 1YLCA 4GPGA 1TB6H 2XNIA 2QC2A 4INHA 2F9OA 1Z8IB 4PROA 3QLPH 2PW8H 1THPB 1GVZA 4NIWA 2GMTC 1C5OH 2OXSA 1EKBB 1QRWA 4CH8B 5EQQA 1K22H 3MU8A 2EI8A 1ELTA 3KQDA 1JBUH 2BM2A 5EGMA 3Q3KA 1GHZA 1XKAC 1RGQA 4INLA 3U9AH 1UCYH 1HAOH 2RA3A 1HAGE 2H5DA 1VZQH 2J94A 1P10A 4FVBA 2VIOA 3MO6A 5HMAA 3U8RH 1XUHA 2FM2A 3E0PB 1FY3A 2A2XH 3PWBA 1A0HB 3MH4A 5HM2A 2BD4A 1HIAB 5L2YH 3H7OA 1DLKB 1FNIA 2F9VA 3RM2H 3UPEA 1O2QA 2XCFA 1L1NA 2B5TB 2V6NA 3BN9A 1S6HA 2G00A 2VVCA 3TK9A 1TMTH 3RXJA 1OKXA 2ANMH 2QYIA 4XBDA 5LH8A 4X6PA 1G30B 5CMXH 4B1TA 3BIUH 1BTHH 1SGPE 1MQ5A 8GCHG 3LDXH 3FZDA 1MD8A 1C5TA 5CHAC 1AUJA 2ZGJA 1ZJDA 1ZSKA 2NU2E 4NWKA 3VFEA 1G2LA 1DWDH 1DWBH 4AFZA 2OC0A 3WY8A 1EJAA 2P94A 5EQRA 1P9SA 2TRMA 4DVAU 5FAHA 5GXPA 1SGRE 2V0BA 2R2WU 4ISLA 2ZTXA 2F9NA 4RKOB 2SGPE 3S9BA 2ZA5A 1A5GH 1C1PA 3SUEA 1FY1A 2ZTYA 2G5VA 2QV1A 3H7TA 2GDDA 1C5NH 3NXPA 3A83A 2ZU5A 3RXBA 2C4FH 3AAVA 5C20A 2JH6D 1T4VH 1P11E 2BDHA 3GCHB 1DSUA 2RCEA 2ZEBA 3ZZAA 1AVGH 4NIYA 1BHXF 1GBIA 1XX9A 1FUJA 5HXFA 4NSYA 3K65B 1Z6JH 5F8XA 3RUOA 4AFSA 2AEIH 2ZU2A 1ZHMA 3EBNA 4CR5A 3GOVB 2QN5T 2SGFE 3UOPA 3SV9A 1PFXC 1QR3E 3L3TA 4I7YH 2W3KA 3C27B 1ANDA 3KQEA 2XBWA 5TCAA 3LGWA 2BTCE 5G4BA 2IJOB 1SPJA 1Y3VA 3PMAB 1FPCH 1O5AB 1EXFA 1AQ7A 3F68H 1LKBA 2BY9X 2VWOA 1EB2A 1HAYB 1WV7H 3LOXA 1NFYA 6CHAC 2BDBA 1GCDA 1LHDH 3ZZ3A 4MPWA 1ANEA 2G55A 1Z6EA 3F6UH 1BA8B 1C1QA 4F49A 2ZFPH 3BTEE 4BTIB 1OYTH 1G3CA 1OWJA 5C1YA 1PPGE 4ISIH 5T6DA 2QAAA 3QWCH 1Y5UT 4IMQA 1IQKA 3HPTB 1GI4A 2TPIZ 5PTPA 1O30A 3SU1A 1RIWC 4I31A 4FUDA 2A31A 1F0UA 1E0FD 3NZIA 5EOKA 5T3HA 2ZQ2A 3E8LA 2UUJB 4H4FA 1O35A 1OP0A 4ZMAH 1IQGA 2GVFA 3UNQA 2G4UA 3UREA 1G3BA 1N6YA 1ESAA 3BTKE 2BD2A 1V2OT 5T6GA 1O3HA 2ZWLH 3T5FH 2ESTE 1ELCA 1G9IE 2A7CA 3KQBA 2ZGHA 3DFLA 4YZUA 3ZZ5A 3S9CA 2BZ6H 1Z8JB 3RXDA 3VPKA 1NROH 4DJZB 1KY9A 2RA0A 4TY7A 1EOLA 5HGGA 2A32A 1WCZA 3GISB 1GI9B 2ZPSA 4ZKNU 2F9BH 1PPFE 4UFEH 2FYQA 1C5QA 3SI4H 5F6MA 5LPEA 1WUNH 1ZYOA 2VVUA 3MWIU 1O2RA 2FMJA 3FZZA 4OGYA 1ZPZA 4YTAA 2Z9LA 1W8BH 4UDWH 2WPLS 1HCGA 3B8JA 1F5KU 3E16B 1TQ0B 1IHSH 1TNIA 1YPHE 2YOLA 4CBOA 4INKA 1VITG 1S0RA 2XWBI 1ZHPA 4JYVH 2GGVB 3O8DA 3SNBA 3PMBB 1HAVA 3P95A 3QUMP 1UVSH 2W26A 5LPRA 4FUJA 2Q6GA 1W11U 3BEIB 1EB1H 4MQAA 1OYQA 4IN2A 1AI8H 4DT7B 1BT7A 2H9TH 1H1BA 1CHOF 2XBXA 1P9UA 1MKWH 4AGKA 1P2QA 1CT4E 1XXFA 3GCOA 4AYVB 1K1PA 1C2FA 1GBLA 1SGTA 2OC7A 1O3DA 2BY8X 1ARCA 1C5ZB 1Y3YA 1GI6A 4WXIA 2VB0A 2XXLA 1GI3A 1BMLA 3MO9A 3UIRA 2BHGA 1BMMH 1TX7A 1UTKA 1GJBB 2AS9A 2PUQH 2Y80A 1DANH 3SBKA 2C90B 1C5XB 1IQHA 1C1WH 1MU6B 4Y6DA 4AFQA 4E06H 1FLEE 1SB1H 1EP5A 3RC5A 1NU7B 4X1QU 2ZDNA 1TNLA 2PTCE 2FWWA 1NTPA 7GCHG 1T4UH 1P12E 2GZ9A 3O8RA 1ZSJA 3BF6H 1IQMA 2IPHA 4X2VA 4X6OA 2C8YB 3Q77A 2ZHWH 4D9QA 3A81A 1L1GA 1RD3B 4NSVA 1OWHA 1GMCG 2F9PA 3LJJA 1O2OA 2ZGCA 4SGBE 1UK3A 2A2QH 2O9QA 4ABGA 3ZZDA 4YLQH 1QL8A 1YC0A 1SLVB 4OGXA 2P8OC 1HUTH 3A7WA 1GBCA 1P0SH 1UCYK 4BOHA 3QTVH 2BOHB 3F1SB 2GCHF 3U1IB 2ZPRA 3SU3A 2FOFA 2HNTC 4E05H 1BB0B 4BAHB 4TYDA 3MU0A 1NY22 4JYUH 3VB7A 3KEEA 2HPPH 1RTFB 4FUEA 6LPRA 3RXEA 1WAYB 1C1SA 3R0FA 1J9CH 2ZFRH 1Z8RA 1ARBA 1H4WA 1SGQE 1O5DH 1PQ5A 3M5LA 1NESE 4X1SU 3D62A 3I78A 1T31A 3PV4A 5F03A 4ZH8A 4WH8A 4XBBA 2ZDLA 4ZXYH 3UTUH 1O3FA 1JIRA 5A0AE 8LPRA 1LHFH 1O3OA 2VIPA 4NFEA 1GBKA 2QXHA 4U2WA 3QTOH 2V3HH 1C4Y2 3NK8A 3RXVA 1ACBE 3MI4A 1TRNA 3EAJA 1BTWA 1TX6A 1C5LH 1JRSA 3MU1A 4JK6A 2Z6BD 2XC5A 2F9UA 3SU6A 2PR3A 5DK1A 2H9HA 1XMNB 1TQ7B 1RRKA 4ZHAA 2FOAA 1GBBA 2CN0H 2DUCA 1V3XA 1SGFG 1XVOA 2LNCA 3NUMA 1EAUA 1W7XH 1NRNH 1B0EA 4J2YB 2P59A 1XXDA 4I32A 3EA8A 1FIWA 1LCYA 3GDSA 4K8BA 4IC6A 3NWUA 3MH7A 1ANBA 3SUDA 1DT2A 3KNXA 4B75A 3P92A 3VGCC 1EJNA 1MTWA 2DE8A 3OY5U 3MU4A 5C1XA 2FOGA 3SV6A 1SGIB 5C5NA 2BYAX 1O3MA 3RC6A 4X2WA 1BUIA 3EQ0H 1O36A 5HM9A 1C2EA 1O34A 1UK4A 3FVFB 3TNSA 3QN7A 3QO6A 4AB9A 3UQVA 1TGSZ 2BMGB 2PKSC 3P6ZB 5DP9A 1PQAA 1QNJA 2P8OB 1J15A 2WPKS 3LH3A 3A8AA 3CS7A 4H6TA 4NA8A 1C1OA 1IOEA 4FU7A 1TOMH 3RLYH 1ABIH 2F91A 1ZTJA 1YCPK 3ZYDA 2ZECA 2Q6DA 3SV8A 2A45B 2JETC 1DSTA 4D9RA 3PMJA 1TBRH 2CF9H 4A92A 1BQYA 3SNCA 5GJ4B 4TPYA 2Q1JA 4DGJA 2O8WA 3A8BA 1GHBF 3AVZA 1B7XB 2RG3A 1PYTD 1ZRKA 1TFXA 1AFQC 3ATKA 3G01A 1VCWA 3ENSB 1SG8B 1JIMA 2BB4A 4MTBA 5JYIA 1YPMH 2R0KA 3EA7A 5AFYH 1KDQA 2FP7B 2YNAA 5AVDA 1C5RA 3GY4A 1ELEE 2CXVA 2OC1A 1FMGA 1PQ8A 3RXKA 1OPHB 1L4DA 4J1YA 1TRYA 5TJXA 4AG1A 5FPTA 2WPIS 2NWNA 2A4OA 5E2OA 1HBTH 1LO6A 3RXTA 2ZCLP 1DXWA 4K5ZA 1T8NA 1K9OE 3ZYEA 4O03A 2BD5A 1C2LA 1PPCE 1K28D 4AORA 2QF0A 4K69A 2BDIA 2CJIA 4GAWA 1DX5M 1DVAH 3F9FA 1GBAA 2GZ7A 1VJAU 4O97A 3RMLH 1EZSC 3E6PH 1V2QT 1K1OA 4OS7A 1P2IA 1O2XA 1ABJH 3TITA 3SJOA 1YPEH 4Y7AA 1FI8A 1OSSA 4WH6A 7KMEH 1DWEH 2JKHA 2EA3A 3E3TA 3MMGA 2GCHG 2XWAA 4Y11E 1ELDE 1AB9B 3E90B 2QF3A 3SORA 4CH2B 3SOSA 1ESBA 1HV7A 3VGCB 3QZQA 1SMFE 3TGKE 2P93A 4ZHMU 2ZIQH 3EGKH 3ODDA 4Q7XA 3M61U 4K1EA 1JRTA 5FX6A 3VB5A 3K2UA 2PKSB 2M5TA 3SZNA 2BQWB 1CO7E 1N6XA 2D8WA 1QBNA 1ELFA 2WUBA 1SGDE 1VCQA 1KXEA 4GHQA 5DP8A 2A4QA 3BIVH 4CRDA 1HAZB 3LGVA 1RTKA 4A5TS 1KXDA 4NA9H 2ZGXH 1DPOA 1O3KA 3PMHB 3BTME 3GCHC 1MBMA 3MU5A 1O3IA 3A8CA 3PROA 3TPIZ 4ZKOU 3M37A 3MOCA 1DICA 1CA8B 5F8TA 4FXGH 3SI3H 1AFEH 3A82A 5GDSH 4NG9H 2W7UA 1HAXB 1UTMA 3TGJE 1S6FA 5JDUB 1C9PA 1RJXB 1BOQA 2GTBA 2VWLA 1T32A 2HWLB 1WSSH 1H9HE 1TGCA 3GY7A 1W3CA 2Y81A 2ZHQH 2ZPQA 1FDPA 1WBGB 4FU9A 3ZVFA 1GMDF 2Y7XA