2YNAA

Crystal structure of the main protease of coronavirus hku4
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-LIKE PROTEINASE
publication title Inhibitor for the Main Protease of Coronavirus Hku4
rcsb
source organism Tylonycteris bat coronavirus hku4
molecule tags Hydrolase
total genus 84
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2ynaA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ynaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ynaA02
1NU9A 2IN2A 1YF4A 8KME2 2PW8H 4NA9H 2W7SA 4RN6A 1NFWA 3RXQA 3DA9B 1P3CA 2B0FA 4WH8A 1V3XA 1HV7A 1TA2A 2GV7A 1EXFA 2AS9A 5HMAA 1MKXH 1TONA 3LU9B 1E0FD 6CHAC 1TPOA 5A09A 5JBCS 1TX6A 2OC7A 3SV9A 5A2MH 1OP0A 1ANBA 1WU1A 3LGVA 1TIOA 2C8XB 3V12A 1LDTT 2BZ6H 3IITA 1K9OE 3E0NB 2V6NA 1SGNE 4MNYA 5ESTE 5E8EH 3STIA 2M5TA 1H8DH 4ZXXH 2J95A 1OOKB 3MWIU 1ZHMA 1HAZB 1K1JA 3E90B 9LPRA 2CF9H 4AGKA 1L1JA 1CHGA 3BTQE 5EPYA 1NRNH 1C2IA 1ZPCA 1ANCA 4Z6AH 1EAXA 1TX7A 4UD9H 3OY5U 1FY4A 1ZR0A 3T25A 2PWXA 3A81A 4DGJA 4X6NA 1O2QA 3PLBA 1HBTH 3EA8A 1C5OH 1H1BA 4YOGA 3ZVDA 4O97A 4IGDA 5IDKA 3FZZA 1GI1A 2Q6DA 1GI2A 2Z3EA 2KAIB 3SU4A 2DE9A 2EI7A 3A80A 4Y6DA 1AGJA 5LH8A 4MQAA 1P57B 3LC5A 4UE7H 1ZMNA 1HNEE 3M35A 1NTPA 2ZHEH 1WOFA 3B23B 4A6LA 2Q6FA 1C2HA 3AAVA 2JETC 1P2NA 3RUOA 4NSVA 3W95A 2QF3A 2OBOA 1ARBA 1ESBA 1O33A 2AIPA 1SGCA 1SLXB 1IQIA 3EYDA 4DVAU 1TNKA 1BT7A 2Z3DA 1BJVA 2BHGA 3U8OH 5TCAA 4DY7B 1F2SE 5E2PA 5G4BA 3K6YA 4AFQA 3A7VA 1O3FA 3A82A 2R0LA 1N6YA 2ZGXH 2FOHA 3A84A 1XVOA 3PO1B 1Z6EA 2A5KA 5DP9A 2CGAA 3BEIB 3C27B 4NFFA 1RIWC 2FI3E 3A89A 3ELAH 2FDAA 4NZLA 2RDLA 1TRMA 3M3SA 2Y81A 3F9FA 1LO6A 1OWDA 1O5CB 2VB0A 1DANH 2BD8A 1AN1E 1C5NH 2XC5A 1O3JA 5E0GA 1HAGE 4FUDA 1LPKB 3T62A 2VVVA 3RP2A 3RXLA 3SU3A 3S9CA 2BD2A 3B9FH 3BEUA 2ZG0H 2FI4E 4CHAB 2BQ7B 2P8OC 2BLWA 3VB7A 1QB1A 1FONA 1A46H 1P2KA 1T7CA 2THFB 1GI3A 1SLWB 3TIUA 4XOJA 3UTUH 5F8TA 5FAHA 1JIMA 1ZPZA 1L1GA 2WPMS 1ANDA 1DLKB 5SGAE 4IN1A 3QO6A 1GJ8B 1WTGH 5E2OA 2FOAA 4Y11E 1UHBB 1FAKH 1CE5A 4XSKU 1G3CA 1THSH 1UHBA 2R2MB 1A7SA 3SU6A 2FTMA 4NSYA 2F83A 1J17T 4OGYA 6LPRA 2FXRA 3GCOA 3BN9A 1DSTA 1GHVH 1D4PB 1UK2A 5GCHF 4XFQA 5T6DA 2JH5D 1O2JA 3SNDA 4CRFA 4DIHH 1ZYOA 1YYY1 2B5TB 4WF8A 2ZF0H 3GYLB 3S9BA 4QT8C 3LGUA 4O9VA 3S0NA 2UUKB 3FP8E 2FOFA 3MU1A 2NU0E 3TLOA 1DE7H 1GMCF 1KY9A 3SNBA 3ZVEA 1O2KA 4K69A 3ATMA 4YLUA 3PTNA 2BD5A 1EB2A 3OYPA 2ZGHA 5JB8S 3WY8A 8GCHF 3TK6A 1ELAA 4ASHA 1P04A 1T8MA 1S84A 1O3CA 2UWLA 3RXFA 2VGCB 3DHKH 1MCTA 1NROH 4Y7AA 1W7XH 2J2UA 5LPRA 1TPSA 1ZSKA 1CHOG 2FESH 2Q1JA 1BMLA 4FVDA 4X6MA 1O38A 2VH6A 4THNH 1SFQB 1LQDB 1GPZA 3QN7A 5GXPA 3D23A 1KSNA 3EQ0H 4K8BA 3LKWA 5L2YH 1ETTH 4DT7B 1NT1A 2PSYA 5A0BA 4YTAA 3GCNA 3GDVA 3LPRA 5FBEA 5LGOA 4INLA 5BPEA 3KNXA 1RGQA 3M36A 1DWDH 4FU7A 1PPCE 3MNSA 2AFQB 4R8TB 1SGQE 3URCA 3SNAA 4U32A 1O3NA 4K2YA 1O2XA 2HGTH 4XDEA 4A1XA 1EZUC 1KYNA 2PKSC 1XUGA 3E1XB 2ILNA 1N8OC 4FUBA 3SUEA 2VJ1A 5EU8A 2SGAA 3Q76A 5GIBA 3A7WA 5DKMA 1W13U 1ZZZA 2G55A 2ZDNA 3QWCH 4CRAA 1FDPA 1RXPA 1PYTD 3UREA 1GMDF 1A5GH 3M37A 2PGQB 1JXPA 1O35A 4UFDH 3UNQA 1SL3A 5EQRA 1AUTC 4HTCH 1TGCA 2ZP0H 1MTSA 3SO3A 1YLCA 1FNIA 1D6WA 4BAMB 1TNGA 2P16A 3GY5A 1QA0A 4CRDA 2CF8H 3UOPA 2VIDA 2OC8A 4MG3A 1O2PA 1AQ7A 1OKXA 4CBOA 4NFEA 2BMGB 3C1KA 1O3HA 1TX8A 3RC4A 1C5ZB 1ID5H 2PHBA 3S7HB 2YOLA 2ZPSA 3SJ8A 1A3EH 1YKTA 4MNWA 3KQCA 1ORFA 2GZ9A 2ZKSA 1S5SA 5PTPA 2CXVA 2A32A 2P3TB 2BDYA 1S83A 4BAOB 1C1TA 2B8OH 3NZIA 1GJ9B 4WH6A 1AI8H 1H8IH 5A0AE 3M7UA 3O8BA 4MPUA 3VB5A 1W8BH 2O8UA 2Z7FE 1YPHE 3VB6A 3GCTF 5FX5A 2OUAA 3STJA 1ZPBA 3LC3A 1UTOA 1XUKA 2ASUB 1F7ZA 4YESB 2ZGCA 3S9AA 1MU8B 1S85A 1TNIA 2CHAB 2ZHDA 3T28A 2FM2A 3FP7E 1F0SA 2VU8E 2NWNA 2UWOA 3UNSA 1JRSA 5LPEA 3URDA 4BOHA 3RLWH 1NFYA 2Y6TA 3PMHB 1NU7B 1MBMA 1C2EA 1XVMA 1ELGA 4YOJA 2VWOA 4MPVA 4GLYA 1D6RA 3SV2H 2PFEA 1QQUA 1XUFA 1MTUA 4AB9A 3SJKA 1LKBA 1TQ0B 1WV7H 2Y80A 4J2YB 2D2DA 2OXSA 3UOUA 2F91A 1GI8B 1BB0B 2FYRA 1TE0A 2TIOA 3A88A 3TK5A 1K1IA 2AGEX 2W3KA 1MD8A 5J4SA 1IQFA 4Y79A 1Y3WA 1VZQH 2PSXA 1JBUH 4ZMAH 3P8NA 1C5RA 3T2NA 3ESTA 3L33A 3PO1C 2XBYA 3SJ9A 1A5HA 1NRRH 1SGTA 1MU6B 3TNTA 1OWJA 1RJXB 1C5TA 3BSQA 2VH0A 4JYTA 2CMYA 4INKA 4Q7XA 1BITA 2ZWLH 1THRH 1PFXC 1P12E 4A1TA 1TMUH 1AFEH 1E34B 2C3SA 3D65E 2AMDA 3T29A 3FFGA 2FOCA 4X2VA 1BIOA 1TQ7B 2PR3A 5C1XA 2ZHWH 1CGIE 5C5NA 1WAYB 2HRVA 1XKBC 1MZAA 2WPHS 1HAYB 4O3UA 4CHAC 3MH6A 1GBFA 1QL7A 1W7GH 3ZYDA 1O3PB 1LHDH 1ZTKA 3PB1E 1FN8A 1GBIA 1QHRB 1LPZB 4FUHA 3UWIA 1XKAC 3QK1A 2XC0A 4IN2A 1YLDA 3VXFH 5HXFA 1D3PB 1P2JA 2XBVA 4LZ4B 3NCLA 1EQ9A 1G37A 3AW1A 3MU8A 5HYOA 5BRRE 1O0DH 1QB9A 3NK8A 4K1EA 4RSPA 2GZ8A 4AZ2B 1AUJA 4CH8B 1BHXF 2UUFB 3GY2A 4B73A 5CE1A 3VFEA 3F1SB 3MO6A 1C1UH 4O3TA 1SI5H 3RXGA 1DXWA 4TPYA 7LPRA 2HALA 5DP5A 1G2LA 1QGFA 4I8LA 4NZQA 2SGPE 2FOBA 1WSSH 1NRSH 3EBNA 1BOQA 3CENA 1AVXA 1IQGA 2BD7A 2W5EA 3RXKA 3ITIA 1MZDA 1P11E 4KGAA 3RMMH 2FI5E 3AAUA 1QJ1B 4A7IB 1C2MA 1C5QA 1BTWA 1QRWA 4KTCA 5GJ4B 2HVXA 1PPZA 2FLRH 4BANB 2BDCA 3Q3YA 1GBEA 4NA7A 1W2KH 2LIZA 3ZZ7A 3EDXB 1HAIH 4CR9A 1TNHA 1GJ5H 5EW2H 1GHZA 3SI4H 5DP4A 1V2OT 1E37B 4HI3A 5T6FA 3VGCB 1MMJN 1AVGH 2FX4A 1K2I1 1C2KA 4JZDH 1BBRK 4CRGA 1HYLA 1F5RA 2VGCC 2BY8X 3KQEA 1F0RA 1IAUA 3TVJB 1CT4E 4D9RA 1NPMA 3BV9B 4K5ZA 4NIYA 1B0EA 1GMCG 8LPRA 4FVBA 1V2LT 1Z8RA 1QB6A 4Y0ZE 4D76A 4ZHMU 1C5MD 7GCHF 1UVTH 1EOJA 4X2XA 3RDZA 2VWNA 1DWEH 1F92A 8GCHG 4K3JA 1EP6A 4U30A 2D8WA 3O8CA 1HRTH 1V2VT 4ISOA 2A0QB 5L30H 3HGPA 3E6PH 1DPOA 2YNBA 1IQKA 4X0WU 3M5LA 4NG9H 1LHCH 3U69H 4JZEH 3SOSA 2WUBA 2WPLS 2VIQA 1YC0A 2AGGX 1ACBE 1GG6B 1GJCB 1XMNB 3D62A 1F5LA 2Y82A 1HJAB 1A61H 2GD4B 1OWKA 1V2WT 3LJOA 3RXPA 3M7QA 1TBRH 3SW2B 3SU5A 1O39A 1O2ZA 2A2QH 2H9HA 3RMLH 6ESTA 2BOKA 1L0ZA 1Y59T 2G81E 1O2IA 1NC6A 1FZZA 3RC5A 2ZEBA 5A8YA 3Q77A 4XBDA 4FUIA 2Z94A 5DP8A 1FY1A 2FODA 3ZVFA 3SJOA 4ISIH 1GBMA 1UTJA 4DIIH 5EXMA 1O2UA 5C67A 1QJ6B 5ESBA 5L6NH 4ZKRU 4TYDA 1O2YA 3RXEA 1P2MA 1L2EA 4AFZA 3HKIB 3NXPA 4BTUB 3I78A 3A8DA 2FOGA 5FPYA 1CVWH 1BTZA 4I8HA 1GMDG 3GY3A 3RXOA 1V2MT 1FPHH 1TWXB 2BTCE 1FY3A 4KTSA 1T4VH 4GHQA 4CBNA 1C5PA 1GDQA 4NGAH 2C8WB 2V35A 1O3OA 2ESTE 3QDZB 2OCVB 2BDIA 1O32A 2QXJA 1DFPA 1O2MA 1SLUB 1VGCB 4Y8XA 1P2IA 4ISNA 5E0HA 1ZTJA 2KAIA 1JOUB 1WTHD 2CHAC 1ELTA 2WINI 1IQJA 1UTKA 5C5OA 5EW1H 2ZIQH 1EAUA 4KKDA 2D26C 2HLCA 1LKAA 5DPAA 1SGEE 3LGWA 4D7FA 1GHXH 1YPEH 2BM2A 2H9EH 1BRCE 2GP9B 3A7XA 4Q80A 3GCTG 4BXWA 1CGJE 1J9CH 1E35B 3TJUA 1O2GH 3UWJH 1XM1A 3RM2H 4ESTE 4MPXA 3N7OA 2VINA 4AYVB 1CA8B 4NIXA 4H6TA 1ZSLA 3ATIA 3U1JB 1YGCH 1EZQA 1ELDE 1O2NA 5DP6A 1BRAA 3A7YA 2ZFSA 4Y76A 1XX9A 1C1VH 2GZ7A 1QQ4A 3BIVH 1Q2WA 3O8RA 1IOEA 2PUXB 2XW9A 3ZZ9A 3DT0H 3P8FA 1TMTH 2BX4A 1HAOH 1Y3YA 3Q3KA 1DVAH 1O2WA 5JB9S 2H9TH 3P8OA 5FPSA 1PQ7A 1V2UT 2XCNA 3CS7A 1K1MA 5E0JA 2GMTB 1TALA 4NIWA 3NUMA 1BMMH 3MNBA 2GDDA 1O3AA 1TGTA 1LCYA 1EOLA 1Y5BT 1FN6A 3ENSB 2GT8A 1FV9A 1AE5A 8ESTE 2BLQA 2QXIA 2A4QA 3QLPH 1ZLRA 2JKHA 4JK5A 1SQOA 2F9VA 1T8NA 2C8YB 2ANYA 1HXEH 1MUEB 1LVOA 5DO4H 1NZQH 3MH7A 1TGBA 3RU4T 5C3NA 1SGDE 2NU4E 1H9HE 2BXTH 2F9UA 3U9AH 1GJ6A 2TGPZ 1ANEA 2Y5GA 2A4GA 4BAQB 1EJMA 3KIDU 1SVPA 4X8VH 1RS0A 2BDBA 4TPIZ 1AWFH 1PYTC 2G5VA 4JYUH 4ABAA 1KXFA 3M61U 3R3GB 3M7TA 4BTTB 1EJNA 2QC2A 4IC5A 1PQ8A 1DM4B 1GBTA 1QBOA 4WXVA 3VB4A 1BUIA 3AVZA 1ELEE 3S7KB 1Z71A 1GI4A 2HOBA 1BHXB 2G52A 4MNXA 5DP3A 2OBQA 1L4DA 1K1LA 5AVDA 4WXIA 3RXTA 3RXHA 1BMNH 1J14A 3EA7A 1O2HA 1MQ6A 2VIPA 3RXJA 1V2PT 1BJUA 1NFUA 4AOQA 5C20A 1FUJA 2IPHA 2P59A 4K1SA 4B2BA 4NCYA 1FIWA 1V2ST 3VGCC 3MFJA 2AEIH 2QF0A 5FPTA 5J4QA 3TNSA 4WMFA 2BXUH 3MU4A 3BTME 1VJAU 3SV8A 2OC1A 3LT3A 1HJ8A 1NY22 4OS7A 1GHAF 2ULLA 2Z6BD 5FCKA 1SHYA 2BB4A 1TBQH 1ARCA 1Z8JB 3GCHC 3DUXH 4MLFB 1OPHB 1GI9B 1P01A 1SC8U 1W10U 3A83A 5TJXA 3ZZ5A 1ELFA 2GVFA 1QFKH 2G4UA 2ZTYA 5C2ZA 1HPGA 1UVUH 1N1LA 2A5AA 1YPKH 5AFYH 2XNIA 2PUQH 2V0BA 3P17H 2WYGA 1P9UA 3UQVA 1V6DA 1YP9A 2G4TA 3BTFE 3BF6H 2H1UA 3Q3XA 1AE8H 2SNWA 7GCHG 2F9BH 2ZHQH 3TH4H 1GG6C 2BVXH 2FZZA 3SU2A 1W14U 3UR9A 1IQLA 1J15A 3V3MA 1HJAC 2Z9LA 1TFXA 2ZQ1A 2BDGA 2ODYB 3BTGE 2VVCA 1MAYA 1YPGH 4FXGH 3SNCA 1UO6A 3KEEA 1RD3B 2JH6D 1EP5A 3VB3A 3ZVBA 3ATWA 4JZFH 4X1NU 1QIXB 4AORA 1DY8A 4X8UH 5CHAB 3U8RH 4R0IA 2Z9KA 1QY6A 3GDUA 1OWEA 1ZGVA 4Y10E 3KHVA 2Z9JA 2K7XA 1V2JT 1QBVH 3GISB 3GOVB 1ZHPA 1W12U 3PMJA 1O5GH 1KTTB 1P09A 2RA0A 1CQQA 3LGTA 3P8GA 4X1SU 2A4RA 1GVLA 1HUTH 4A1VA 1WQVH 4WMDA 1YBWA 4UEHH 1TB6H 1AWHB 3MNCA 5C1YA 2OP9A 1BZXE 1GBAA 2O9QA 1BA8B 2BYAX 5L2ZH 3P70B 4A92A 2OQ5A 1FJSA 4ZHLU 1OS8A 2XYAA 1C1QA 1KTSB 2F9PA 1TRNA 3IWMA 1NFXA 4MTBA 1VGCC 4NA8A 2OC0A 3LH1A 1CT0E 1LVMA 3GY6A 3SNEA 1L4ZA 1WYKA 1HFDA 2SGEE 1V2QT 3PV4A 4X6OA 1AZZA 5A8ZA 4FUJA 2NU2E 4LXBH 3GY7A 3RXBA 4AFSA 1GVKB 3OY6U 2J38A 3KCGH 2GT7A 2STAE 3TJNA 1ABJH 4ABJA 1GHWH 2FIRH 3RXSA 5H4IB 3PWCA 2ZFRH 4ZKOU 1EAWA 4FUCA 1AVWA 4Y71A 2SNVA 1C5YB 3F68H 4JZIA 2EEKA 3KF2A 4X1PU 1UMAH 1DS2E 5HM2A 1AIXH 2ZI2H 2RCEA 1Q3XA 3SGQE 2XWBI 3F9GA 2ZGJA 1K28D 1WCZA 2ZHFH 2PV9B 3SUGA 1GBLA 2D1JA 4YM9A 2FX6A 3EAJA 1GL0E 4OGXA 3RLYH 2AMQA 2A7HA 4FUFA 1QRZA 3LOXA 5F8ZA 2ALPA 4DG4A 2NU1E 1T4UH 2QXHA 1TLDA 3SGBE 1ZRKA 4ZUHA 1HJ9A 2GMTC 4GPGA 1XUIA 4Y0YE 4GCHF 1VJ9U 2XRCA 1IQHA 1AO5A 1AHTH 1G30B 4M7GA 1DITH 4D7GA 2ZFFH 2ODQA 1DWBH 1ETSH 4ZKSU 1GI6A 2R0KA 2QV1A 2WPJS 1E36B 3SN8A 4B2AA 3RU4E 3JZ1B 3H5CB 3RXIA 1QR3E 5EXLA 2VIOA 2Y5FA 2ZCHP 1IHTH 3PM3A 4DCDA 2AIQA 1O2RA 3MHWU 3GY8A 1C5SA 2ZCKP 3LGIA 1C1OA 1V2TT 1VCPA 1C1WH 1GI5A 4YO9A 1OXGA 4GAWA 1D3QB 2FS8A 3UIRA 2VWLA 1Y5UT 3I29A 4YLQH 5JBBS 2ANWA 3ZYEA 1YCPK 3K65B 1ELVA 3ZV9A 1RFNA 3ZZCA 1S0QA 2BDHA 4JYVH 1GJBB 2LPRA 1QTFA 1LVBA 1MQ5A 1C5WB 2ZGBH 3BTDE 2QA9E 4CRBA 3NWUA 1Y3UA 3D49H 1FLEE 1P03A 2J34A 3MO3A 9ESTA 3NPSA 3M5NA 3RXCA 1FIZA 5EOKA 3EGKH 1LQEA 3RXRA 2GCHF 2BVSH 2TRMA 4BNRA 4PROA 1JMOH 1O5FH 1TNLA 2Y7XA 3ATLA 4UFEH 1INCA 2HWLB 1UTPA 1VITH 3PWBA 2VVUA 1C1SA 5EODA 1C2GA 5ETXA 4XBCA 2QXGA 1TNJA 2VIVA 4AGJA 3FAOA 1BTUA 6GCHG 1G3EA 3QUMP 3KGPA 3ODFA 1SGYE 4I7YH 1C1NA 3RC6A 1HDTH 2BDAA 3SV6A 5GPIB 2W7UA 2WV4A 2ALVA 5HGGA 1P02A 4E06H 3FANA 3AW0A 3GCHB 1PQAA 5AF9H 4INHA 1WQSA 2I6SA 1KDQB 2ZZUH 2A5IA 4SGAE 4CRCA 4ISLA 1SB1H 4BTIB 1KDQA 1WBGB 3UY9A 1AU8A 2J92A 3FVFB 1KXCA 1LHGH 2H2ZA 2BQ6B 1SGIB 2FPZA 2ZPQA 3GICB 1LHFH 3M3TA 4B74A 1OWIA 2VWMA 1TPAE 3TJVA 4GSOA 7KMEH 1DLEA 1O31A 2SFAA 1Y5AT 1YPMH 4XBBA 1GHAG 1N6XA 1NS3A 1SLVB 1TGSZ 3MOCA 3ZZDA 2F3CE 2FOEA 1ESAA 4UFFH 1JWTA 1T8OA 3MYWA 1HAXB 1DUAA 4ZAEA 2OQUA 5JPMH 3LIWA 4OS4A 1ESTA 1L1NA 3SBKA 1QCPA 4U2WA 2BY6X 4GHTA 2OD3B 1QA7A 4WWYA 4KELA 2BX3A 3NKKA 2FO9A 3BTKE 2A7CA 1C9TA 4SGBE 2UUJB 4U01A 5EXNA 4TWWA 3DFLA 1K1NA 5CHAC 1SFIA 3VEQB 2ZFQH 2FWWA 4D8NA 3H7OA 2FEQH 2TPIZ 4RKJB 1UCYK 2ZDKA 4J1YA 3UNRA 2R3UA 2XBWA 2ZU2A 2BD3A 1BQYA 1MCVA 1OX1A 4TY6A 2NU3E 4YT6H 5JDUB 4Q7ZA 2Y7ZA 2VNTA 2GGVB 1EUFA 4Y8ZA 1UTMA 1IQNA 3UQOA 5DJ7A 1BRUP 2QGRA 2ZTXA 1PPBH 1XUHA 2C90B 4HGCA 4ABHA 1Q31A 1UTLM 1QJ7B 1SOTA 2BQWB 2XTTB 3SORA 4BXSA 1ZRBA 4LK4A 4I8GA 2AGIX 4ISHH 1O2SA 5K7RA 2XBXA 2XCFA 3HGNA 1RTKA 1FXYA 3HATH 2F9NA 4I32A 1C1RA 4BAKB 1VCWA 4WY3A 1BTHH 1MTVA 1YPHC 1TYNA 1ZMLA 3ZVAA 3ZVGA 1MKWK 5GWZA 1A2CH 3OU0A 2DUCA 4NWLA 1DICA 1KXBA 1PPEE 1G36A 1EAIA 1BBRH 1V2KT 1S0RA 1BBRE 1Y3VA 1C9PA 2HNTE 1CBWB 2AYWA 4IW4E 4MNVA 4DW2U 3IG6B 3HK3B 2BLOA 3E8LA 4F49A 1KIGH 1Z6JH 2QY0B 3K9XB 4F4OC 5JBAS 1ELCA 1B7XB 4HZHA 1BRBE 4OS6A 2JH0D 3SHAH 4D9QA 4OS2A 3SUFA 3UPEA 1CO7E 1YPLH 1ZOMA 2ZDLA 2ZQ2A 1SQTA 3CP7A 1HAHH 4UDWH 2Z9GA 1WUNH 3EE0B 1SR5C 2YNAA 3MNXA 3ZV8A 5FX6A 1FAXA 3BEFB 1O2OA 2FP7B 1O2TA 2UUYA 2BY7X 2FTLE 2C4FH 1S82A 1SQAA 1Y3XA 2BY5X 4I8KA 1SGRE 1HAPH 2G5NA 2SGDE 3OTJE 4OS5A 4CR5A 2B9LA 1O5BB 1D3DB 4IMZA 5JYIA 1GBJA 1GJAB 1DUEA 5K0HA 2A45B 3A7TA 3GYMA 2QAAA 3KQDA 3TU7H 1B0FA 1TBZH 2PKAB 1SGPE 4CH2B 1O2LA 1DXPA 1HLTH 1C5UA 1GHYH 2PKAA 3AASA 1DDJA 1ZMJA 1A0JA 3ZZ3A 2BD4A 2VIWA 1NESE 1A3BH 5JBTA 4E7NA 4YT7H 2DE8A 1RTFB 2ZO3H 1RTLA 1A1RA 3O8DA 1SBWA 4AN7A 3RXDA 1D3TB 2B7DH 2J9NA 2G00A 4ABIA 1UCYH 1EPTB 2OLGA 1HB0B 1UCYE 1ETRH 1EZXC 4JMYA 2OINA 1O30A 1KXAA 1C1PA 1EPTA 2ZFPH 1GCTB 5ABWA 1BMAA 1D9IA 1TMBH 5F03A 4O03A 4X2YA 2IJOB 2IOTA 5DGJA 1EB1H 4GCHG 4X8TH 4ZH8A 2ZDMA 3BTHE 1LPGB 4AYYB 3RMNH 1P0SH 1EX3A 4B75A 3BTEE 1OYQA 4GUXA 1NM6A 5TCCA 3A8BA 3G01A 2F9OA 4VGCB 1GL1A 1EJAA 1MTNB 1GHBG 3PMAB 2A7JA 2CN0H 3SZNA 1TA6A 4DURA 4FUGA 6GCHF 3QX5H 3U98H 1O3DA 1GGDB 2W26A 3SU1A 2A1DB 1JRTA 2SGQE 4Z0KA 1C4U2 1MAXA 1LTOA 1MKWH 1O3EA 2G8TA 1DY9A 1H9LB 1PPHE 3LGYA 1Z1JA 1VITF 2O8MA 4TY7A 1SGFA 1KXEA 2R2WU 5AHGH 4E05H 4IMQA 2K1QA 4LZ1H 1T32A 1DX5M 3T27A 1SGFG 3MI4A 2QIQA 5I25A 2ZTZA 3FZDA 2AERH 2XXLA 2BVRH 1OYTH 1A4WH 2FS9A 1AFQB 1M9UA 2P95A 2BZAA 1Y8TA 3A86A 3Q00A 4RKOB 3BG4B 4JCNA 2P3FH 2J94A 1LHEH 1G32B 3U1IB 2GCHG 4ABEA 1O5AB 1VCQA 2P93A 3T26A 1MTWA 5DG6A 3RMOH 3LJJA 4I33A 3PTBA 1O34A 2WPKS 2QYIA 1K1OA 3KQBA 1GMHG 5A0CA 1XXFA 2BD9A 4H4FA 3F9HA 1GDNA 7ESTE 5GDSH 1OSSA 3T5FH 4AFUA 5FCRA 4B2CA 1C4Y2 1GBCA 1NO9H 4WMEA 3BTTE 3MU5A 3ATKA 1C2DA 3V13A 2GTBA 1AB9B 3RU4D 1IQMA 3A85A 1CA0B 2PGBB 4FU8A 2GCTB 1GDUA 4MDSA 3OX7U 1OP8A 3M5OA 4JK6A 3GDSA 3RXUA 4X1QU 2GKVE 2HPPH 1PPFE 1AKSB 4K1TA 4ABFA 2QN5T 1O5DH 1AKSA 3P92A 3PYHA 1O5EH 3RM0H 1K1PA 3TGIE 2Z3CA 3ODDA 2ZU3A 2ZCLP 3TH2H 2AMPA 1A5IA 1KLIH 5LPFA 3V0XA 4ABGA 4NWKA 5T3HA 3SU0A 3HPTB 1BDAA 5HM9A 2UWPA 3KL6A 3M3VA 1TOCB 1XUJA 5DK1A 1GJDB 5EG4A 1KXDA 3PMBB 1QURH 1V2NT 5A8XA 3V7TA 6CHAB 3JZ2B 2BLVA 1HXFH 2AH4X 2CJIA 3W94A 4HFPB 2QCYA 1O3IA 2V3HH 1RRKA 4NIVA 1C1MA 2WPIS 3P95A 1YCPM 1GBHA 1CGHA 1T8LA 1QNJA 2WUCA 2ZC9H 4Q7YA 1G3DA 3MO9A 1ZJDA 2XC4A 4FUEA 2CV3A 3DFJA 1W0YH 1P10A 4A5TS 1A0LA 3QZQA 4I8JA 3UUZA 1W11U 1DSUA 3QTOH 1MH0A 1FY8E 3BTWE 4BAHB 3OSYA 3HKJB 3LH3A 5F8XA 4X1RU 1GCDA 1GI0A 1GJ7B 2ZA5A 1ZHRA 2HNTF 1F0TA 1TPPA 2RG3A 3ZZ4A 2EA3A 2G51A 1FPCH 3ZZAA 3SQHE 3ZZBA 4MPWA 1DOJA 1P05A 1J16A 1VR1H 1W0ZU 1DT2A 1QL9A 1CBWC 2ZPRA 3ZZ6A 5AFZH 3E91A 4IC6A 2WV5A 1H9IE 1O3MA 1S6HA 2JETB 3SHCH 1P8VC 3QGJA 2HNTC 4ZROA 1TOMH 1T31A 2R9PA 1NRQH 4DJZB 4X2WA 3DD2H 4X8SH 3MTYA 4X6PA 2Z9IA 2ZDAH 1UTNA 1LMWB 4IBLH 2V3OH 3P6ZB 5FBIA 1BCUH 1U6QA 2I6QA 1UJ1A 1P06A 1E38B 2O8WA 3MH5A 3CS0A 2P3UB 1UK4A 3TJOA 3A8CA 1TAWA 2SGFE 4OS1A 1TGNA 1P9SA 2WYJA 2A4OA 1UVSH 5CMXH 1GWAA 1A0HB 1IHSH 4FU9A 1G3BA 2H5CA 5EQQA 1FQ3A 1ZGIA 1EKBB 1NN6A 3RXAA 4WVPE 4AB8A 2HPQH 4Y8YA 4H6SB 3TH3H 5EQSA 3TPIZ 4TWYA 4ABDA 4YZUA 1C5XB 1QRXA 2TGDA 1RIWB 2RA3A 1PPGE 1Z1IA 1KLTA 3QZRA 1MD7A 4B1TA 1TABE 1P2QA 5EGMA 3MU0A 4ABBA 4E7RG 1W3CA 1ZJKA 2Q6GA 2O8TA 1QL8A 2R3YA 1SPJA 2ODPA 3EA9A 1C2JA 2GX4A 1UVPA 1GHBF 4Y7BA 1X7AC 3E16B 1Z8GA 1C2LA 4ZHAA 3FP6E 1F5KU 1FI8A 3VPKA 3K6ZA 1CSOE 4Q2KA 1PJPA 2FOMB 2P8OB 1B5GH 1C4V2 1EPTC 2GV6A 3UR6A 3UFAA 3SV7A 3I77A 2BOHB 3BIUH 1ABIH 1GCTC 2GDEH 3SGAE 3B8JA 3GY4A 1SHHB 3F6UH 1P2OA 2P94A 3TITA 1TRYA 2FYQA 2ANMH 1KLJH 1Z7KA 4YOIA 1THPB 2PLXA 1HCGA 1O37A 3RXMA 2ZDVH 2BY9X 3HK6B 4MVNA 5IYTA 3S69A 1BTXA 1C5LH 1K22H 1IQEA 1MKXK 5T6GA 1YM0A 1NRPH 1UK3A 4VGCC 1EASA 3F9EA 5C1UA 2EI6A 2A31A 1MTNC 1O2VA 4KP0A 5FXLA 3L3TA 4GVUA 1C5VA 1GGDC 3E0PB 5DP7A 3ZZ8A 4I31A 2PTNA 3L6PA 1G9IE 1SSXA 2ZNKH 1LVYA 3KN2A 3QGNB 3MH4A 2OTVA 3LDXH 1SMFE 1GI7B 3TGKE 4KTUA 3BG8A 1HIAB 4AG2A 5F6MA 3SJIA 1GMHF 1GBKA 2XWAA 1HIAA 1S81A 1QBNA 1AMHA 1O3GA 1CHOF 4WJG2 2LNCA 2TBSA 1O3LA 1GBDA 2C8ZB 4K8YA 4CREA 3A7ZA 1AFQC 2ANKH 2ZFTA 3RXVA 4ZXYH 5EPNA 2TGAA 3BG4C 3TK9A 2PTCE 1J8AA 3PLPA 1P3EA 1F0UA 1CU1A 4JZ1A 4ZKNU 1JIRA 2A2XH 4IS5A 4DOQA 2C93B 1VITG 3K2UA 3E3TA 5GCHG 1AD8H 1FY5A 3SUDA 1G2MA 1BTPA 3SI3H 1S6FA 2W3IA 2ZU5A 3PLKA 2EI8A 2O8LA 3U8TH 1UTQA 1AY6H 4H42U 4UONA 3M5MA 4LOYH 1SOZA 1ZTLA 1MBQA 2EC9H 4K60A 1UVOA 2Y5HA 1ZSJA 1GJ4H 3ZVCA 2H5DA 1OP2A 3PROA 5I46H 3SQEE 3QTVH 2FMJA 1ELBA 1K21H 1O3BA 1EZSC 1GVZA 3TGJE 4UFGH 2TGTA 5B6OA 3H7TA 3MMGA 1PQ5A 1DWCH 1O3KA 2STBE 4AG1A 1Z8IB 4B76A 1SG8B 1AB9C 1CA0C 2GCTC 1YPJH 2FLBH 1H4WA 2PKSB 1HAVB 3A8AA 1FMGA 1GBBA 3A87A 3LONA 1N8OB 1C2FA 1HAVA 2H6MA 4XE4A 4AX9H 1O36A 3VXEH 3R0FA 1AZ8A 2ZU1A 2ZU4A 1EATA 1V2RT 5FHTA 1OWHA 2ZECA 1CT2E 1XXDA 2J4IA 4B71A 1YCPH 1HGTH 1BTYA
chains in the Genus database with same CATH superfamily
1NU9A 2IN2A 1YF4A 8KME2 2PW8H 4NA9H 2W7SA 1K0HA 4RN6A 1NFWA 3RXQA 3DA9B 1P3CA 1VKYA 2B0FA 4WH8A 1V3XA 1HV7A 1TA2A 2GV7A 1EXFA 2AS9A 4FOUC 5HMAA 1MKXH 1TONA 3LU9B 1E0FD 6CHAC 1TPOA 5A09A 5JBCS 1TX6A 2OC7A 3SV9A 5A2MH 1OP0A 1ANBA 1WU1A 3LGVA 1TIOA 2C8XB 3V12A 1LDTT 2BZ6H 3IITA 1K9OE 3E0NB 2V6NA 1SGNE 3H09A 4MNYA 5ESTE 5E8EH 3STIA 2M5TA 1H8DH 4ZXXH 2J95A 1OOKB 3MWIU 1ZHMA 1HAZB 1K1JA 3E90B 9LPRA 2CF9H 4AGKA 1L1JA 1CHGA 3BTQE 5EPYA 1NRNH 1C2IA 1ZPCA 3DCLA 2YMSC 1ANCA 4Z6AH 1EAXA 1TX7A 4UD9H 3OY5U 1FY4A 1ZR0A 2W6ID 3T25A 2PWXA 3A81A 4DGJA 4X6NA 1O2QA 3PLBA 1HBTH 3EA8A 1C5OH 1H1BA 4YOGA 3ZVDA 4O97A 4IGDA 5IDKA 3FZZA 3DSGA 1GI1A 2Q6DA 1GI2A 5FL7D 5HKKD 2Z3EA 2KAIB 3SU4A 2DE9A 2EI7A 3A80A 4Y6DA 1AGJA 5LH8A 4MQAA 1P57B 3LC5A 4UE7H 1ZMNA 1HNEE 3M35A 1NTPA 2ZHEH 1WOFA 3B23B 4A6LA 2Q6FA 1C2HA 3AAVA 2JETC 1P2NA 3RUOA 4NSVA 3W95A 2QF3A 2OBOA 1ARBA 1ESBA 1O33A 2AIPA 1SGCA 1SLXB 1IQIA 3EYDA 4DVAU 2EQNA 1TNKA 1BT7A 1YLNA 2Z3DA 1BJVA 2BHGA 3U8OH 4XRNA 5TCAA 4DY7B 1F2SE 5E2PA 5G4BA 3K6YA 4AFQA 3A7VA 1O3FA 3A82A 2R0LA 1N6YA 2ZGXH 2FOHA 3A84A 1XVOA 3PO1B 1Z6EA 2A5KA 5DP9A 2CGAA 3BEIB 3C27B 4NFFA 1RIWC 2FI3E 3A89A 3ELAH 2FDAA 4NZLA 2RDLA 1TRMA 3M3SA 4Q63A 2Y81A 3F9FA 1LO6A 1OWDA 1O5CB 2VB0A 5EJLA 1DANH 2BD8A 1AN1E 1C5NH 2XC5A 1O3JA 5E0GA 1HAGE 4FUDA 1LPKB 3T62A 2VVVA 3RP2A 3RXLA 3SU3A 3S9CA 2BD2A 3B9FH 3BEUA 2ZG0H 2FI4E 4CHAB 2BQ7B 2P8OC 2BLWA 3VB7A 1QB1A 2YMSD 1FONA 1A46H 1P2KA 1T7CA 2THFB 1GI3A 1SLWB 3TIUA 4XOJA 3UTUH 5F8TA 5FAHA 1JIMA 1ZPZA 2KX4A 1L1GA 2WPMS 1ANDA 1DLKB 5SGAE 4IN1A 3QO6A 1GJ8B 1WTGH 5E2OA 2FOAA 4Y11E 1UHBB 1FAKH 1CE5A 4XSKU 1G3CA 1THSH 1UHBA 2R2MB 1A7SA 3SU6A 2FTMA 3WW7A 4NSYA 2F83A 1J17T 4OGYA 6LPRA 2FXRA 3GCOA 3BN9A 1DSTA 1GHVH 1D4PB 1UK2A 5GCHF 4XFQA 1SKYE 5T6DA 2JH5D 1O2JA 3SNDA 4CRFA 4DIHH 1ZYOA 1YYY1 2B5TB 4WF8A 2ZF0H 3GYLB 3S9BA 4QT8C 3LGUA 3F0PA 4O9VA 3S0NA 2UUKB 3FP8E 2FOFA 3MU1A 2NU0E 3TLOA 1DE7H 1GMCF 1KY9A 3SNBA 3ZVEA 1O2KA 4K69A 3ATMA 4YLUA 3PTNA 2BD5A 1EB2A 3OYPA 2ZGHA 5JB8S 3WY8A 8GCHF 1COWD 3TK6A 1ELAA 4ASHA 1P04A 1T8MA 1S84A 1UW7A 1O3CA 2UWLA 3RXFA 2VGCB 3DHKH 1MCTA 1NROH 4Y7AA 1W7XH 2J2UA 5LPRA 1TPSA 1ZSKA 1CHOG 2FESH 3DSOA 2Q1JA 1BMLA 4FVDA 4X6MA 1O38A 2VH6A 4THNH 1SFQB 1LQDB 1GPZA 3QN7A 5GXPA 3D23A 1KSNA 3EQ0H 4K8BA 3LKWA 5L2YH 1ETTH 4DT7B 1NT1A 2PSYA 5A0BA 4YTAA 3GCNA 3GDVA 3LPRA 5FBEA 5LGOA 4INLA 5BPEA 3KNXA 1RGQA 3M36A 1DWDH 4FU7A 1PPCE 3MNSA 2AFQB 4R8TB 1SGQE 5B6LA 3URCA 3SNAA 4U32A 1O3NA 4K2YA 1O2XA 2HGTH 4XDEA 4A1XA 1EZUC 1KYNA 2PKSC 1XUGA 3E1XB 2ILNA 1N8OC 4FUBA 3SUEA 2VJ1A 5EU8A 2SGAA 3Q76A 2LP6A 5GIBA 3A7WA 5DKMA 1W0JD 1W13U 1ZZZA 2KCAA 2G55A 2ZDNA 3QWCH 4CRAA 1FDPA 1RXPA 1PYTD 3UREA 2QF4A 1GMDF 1A5GH 3M37A 2PGQB 1JXPA 1O35A 4UFDH 3UNQA 1SL3A 5EQRA 1AUTC 4HTCH 1TGCA 2ZP0H 5C0TA 1MTSA 2J5UA 3SO3A 1YLCA 1FNIA 1D6WA 1W0KD 4BAMB 1TNGA 2P16A 3GY5A 1QA0A 4CRDA 2CF8H 3UOPA 2VIDA 2OC8A 4MG3A 1O2PA 1AQ7A 1OKXA 4CBOA 4NFEA 2BMGB 3C1KA 1O3HA 1TX8A 3RC4A 1C5ZB 1ID5H 2PHBA 3S7HB 2YOLA 2ZPSA 3SJ8A 1A3EH 1YKTA 4MNWA 3KQCA 1ORFA 2GZ9A 2ZKSA 1S5SA 5PTPA 2CXVA 2A32A 2CK3D 2P3TB 2BDYA 3CNRA 1S83A 4BAOB 1C1TA 2B8OH 3NZIA 1GJ9B 4WH6A 3WWBA 1AI8H 1H8IH 5A0AE 3M7UA 3O8BA 4MPUA 3FN8A 3VB5A 1W8BH 2O8UA 2Z7FE 1YPHE 3VB6A 1NBME 3GCTF 5FX5A 2KCYA 2OUAA 3STJA 1ZPBA 3LC3A 1UTOA 1XUKA 2ASUB 1F7ZA 4YESB 2ZGCA 3S9AA 1MU8B 1S85A 1TNIA 2CHAB 2ZHDA 3T28A 2FM2A 3FP7E 1F0SA 4ZCNA 2VU8E 2NWNA 2UWOA 3UNSA 1JRSA 5LPEA 3URDA 4BOHA 3RLWH 1NFYA 2Y6TA 3PMHB 4ASUD 1NU7B 1MBMA 1C2EA 1XVMA 1ELGA 4YOJA 2VWOA 4MPVA 4GLYA 1D6RA 3SV2H 2IJD1 2PFEA 1QQUA 1XUFA 1MTUA 4AB9A 3SJKA 4F55A 1LKBA 1TQ0B 1WV7H 2Y80A 4J2YB 2D2DA 2OXSA 3UOUA 2F91A 3SYJA 1GI8B 1BB0B 2FYRA 1TE0A 2TIOA 3A88A 3TK5A 1K1IA 2AGEX 2W3KA 1MD8A 5J4SA 1QZ8A 1IQFA 4Y79A 1Y3WA 1VZQH 2PSXA 1JBUH 4ZMAH 4OM9A 3P8NA 1C5RA 3T2NA 4P00A 3ESTA 3L33A 3PO1C 2XBYA 3SJ9A 1A5HA 1NRRH 1SGTA 1MU6B 3TNTA 1OWJA 1RJXB 1C5TA 3BSQA 2VH0A 4JYTA 2CMYA 4INKA 4Q7XA 1BITA 2ZWLH 1THRH 3SZEA 2KR7A 1PFXC 1P12E 4A1TA 1TMUH 1AFEH 1E34B 2C3SA 3D65E 2AMDA 3T29A 3FFGA 2FOCA 4X2VA 1BIOA 1TQ7B 2PR3A 5C1XA 2ZHWH 1CGIE 5C5NA 1WAYB 2HRVA 1XKBC 1MZAA 2WPHS 1HAYB 4O3UA 4CHAC 3MH6A 1GBFA 1QL7A 1W7GH 3ZYDA 1O3PB 1LHDH 1ZTKA 3PB1E 1FN8A 1GBIA 1QHRB 1LPZB 4FUHA 3UWIA 1XKAC 3QK1A 2XC0A 4IN2A 1YLDA 3VXFH 5HXFA 1D3PB 1P2JA 2XBVA 4LZ4B 3NCLA 1EQ9A 1G37A 3AW1A 3MU8A 5HYOA 5BRRE 1O0DH 1QB9A 3NK8A 4K1EA 4RSPA 3F0OA 2GZ8A 4AZ2B 1AUJA 4CH8B 1BHXF 2UUFB 3GY2A 4B73A 5CE1A 3VFEA 3F1SB 2JJ2D 3MO6A 1C1UH 4O3TA 1SI5H 3RXGA 1DXWA 4TPYA 7LPRA 2HALA 5DP5A 1G2LA 1QGFA 4I8LA 4NZQA 2SGPE 2FOBA 1WSSH 1NRSH 3EBNA 1BOQA 3CENA 1AVXA 1IQGA 2BD7A 2W5EA 3RXKA 3ITIA 1MZDA 1E1RD 1P11E 5HIZA 4KGAA 3RMMH 2FI5E 3AAUA 1QJ1B 4A7IB 1C2MA 1C5QA 1BTWA 1QRWA 4KTCA 5GJ4B 2HVXA 1PPZA 2FLRH 2K8IA 4BANB 2BDCA 3Q3YA 1GBEA 4NA7A 1W2KH 2LIZA 3ZZ7A 5C94A 3EDXB 1HAIH 4CR9A 1TNHA 1GJ5H 5EW2H 1GHZA 3SI4H 5DP4A 1V2OT 1E37B 4HI3A 5T6FA 3VGCB 1MMJN 1AVGH 2FX4A 1K2I1 1C2KA 4JZDH 1BBRK 4CRGA 3F2FA 1HYLA 1F5RA 2VGCC 2BY8X 3KQEA 1F0RA 1IAUA 3TVJB 1CT4E 4D9RA 1NPMA 3BV9B 4K5ZA 3FKSD 4NIYA 1B0EA 1GMCG 8LPRA 4FVBA 1V2LT 1Z8RA 1QB6A 4Y0ZE 4D76A 4ZHMU 1C5MD 4RT0A 7GCHF 1UVTH 1EOJA 3PV2A 4X2XA 3RDZA 2VWNA 1DWEH 1F92A 1KMHB 8GCHG 4K3JA 1EP6A 4U30A 2D8WA 3O8CA 1HRTH 1V2VT 4ISOA 2A0QB 5L30H 3HGPA 3E6PH 1DPOA 2W6JD 2YNBA 1IQKA 3DSPA 4X0WU 3M5LA 4NG9H 1LHCH 3U69H 4JZEH 3SOSA 2WUBA 2WPLS 2AHME 2VIQA 1YC0A 2AGGX 1ACBE 1GG6B 1GJCB 1XMNB 2GJGA 3D62A 1F5LA 2Y82A 1HJAB 1A61H 2GD4B 1OWKA 1V2WT 3LJOA 3RXPA 2WPDD 3M7QA 1TBRH 3SW2B 2J98B 3SU5A 1O39A 1O2ZA 2A2QH 2H9HA 3RMLH 6ESTA 2BOKA 1L0ZA 2PP6A 1Y59T 2G81E 4Z1MD 1O2IA 1NC6A 1FZZA 3RC5A 2ZEBA 5A8YA 3Q77A 4XBDA 4FUIA 2Z94A 5DP8A 1FY1A 2FODA 3ZVFA 3SJOA 2KM0A 4ISIH 1GBMA 1UTJA 4DIIH 5EXMA 1O2UA 5C67A 1QJ6B 5ESBA 5L6NH 4ZKRU 4TYDA 1O2YA 3RXEA 1P2MA 1L2EA 4AFZA 3HKIB 3NXPA 4BTUB 3I78A 3A8DA 2FOGA 5FPYA 1CVWH 1BTZA 4Q4LA 4I8HA 1GMDG 3GY3A 3RXOA 3N7EA 1V2MT 1FPHH 1TWXB 2K0QA 2BTCE 1FY3A 4KTSA 1T4VH 4GHQA 4CBNA 1C5PA 1GDQA 4NGAH 2C8WB 2V35A 1O3OA 2ESTE 3PV5A 3QDZB 2OCVB 2BDIA 1O32A 2QXJA 1DFPA 1O2MA 1SLUB 1VGCB 4Y8XA 1P2IA 4ISNA 5E0HA 1ZTJA 2KAIA 1EFRD 1JOUB 1WTHD 2CHAC 1ELTA 2WINI 1IQJA 1UTKA 5C5OA 5EW1H 2ZIQH 1EAUA 3F2GA 3OFND 4KKDA 2D26C 2HLCA 1LKAA 5DPAA 1SGEE 3LGWA 4D7FA 1GHXH 2L74A 1YPEH 2BM2A 2H9EH 1BRCE 2GP9B 3A7XA 2M2AA 3GCTG 4Q80A 4BXWA 1CGJE 1J9CH 4FETA 1E35B 3TJUA 1O2GH 3UWJH 1XM1A 3RM2H 4ESTE 4MPXA 3N7OA 2VINA 4AYVB 1CA8B 4NIXA 4H6TA 1ZSLA 3ATIA 3U1JB 1YGCH 1EZQA 1ELDE 1O2NA 5DP6A 1BRAA 3A7YA 2ZFSA 3OTPA 4Y76A 1XX9A 1C1VH 2GZ7A 1QQ4A 3BIVH 1Q2WA 3O8RA 1IOEA 2PUXB 2XW9A 3ZZ9A 3DT0H 3P8FA 1TMTH 2BX4A 1HAOH 1Y3YA 3Q3KA 5IK2D 1DVAH 1O2WA 5JB9S 2H9TH 2F43B 3P8OA 5FPSA 1PQ7A 1V2UT 2XCNA 3CS7A 1K1MA 5E0JA 2GMTB 1TALA 4NIWA 3NUMA 1BMMH 3MNBA 2GDDA 1O3AA 1TGTA 1LCYA 1EOLA 1Y5BT 1FN6A 3ENSB 2GT8A 1FV9A 1AE5A 8ESTE 5KECA 2BLQA 2QXIA 2A4QA 3QLPH 1ZLRA 2JKHA 4JK5A 1SQOA 2F9VA 1T8NA 2C8YB 2ANYA 1HXEH 1MUEB 1LVOA 5DO4H 1NZQH 3MH7A 1TGBA 3RU4T 5C3NA 1SGDE 2NU4E 1H9HE 2BXTH 2F9UA 3U9AH 2J97A 1GJ6A 2TGPZ 1ANEA 2Y5GA 2A4GA 4BAQB 1EJMA 3KIDU 1SVPA 4X8VH 1RS0A 2BDBA 4TPIZ 1AWFH 1PYTC 2G5VA 4JYUH 4ABAA 1NBMD 1KXFA 3M61U 3R3GB 3M7TA 4BTTB 1EJNA 2QC2A 4IC5A 1PQ8A 1DM4B 1GBTA 1QBOA 4WXVA 3VB4A 1BUIA 3AVZA 5EJZA 1ELEE 2JDID 3S7KB 1Z71A 1GI4A 2HOBA 1BHXB 2G52A 4MNXA 5DP3A 2OBQA 1L4DA 1K1LA 5AVDA 1S6LA 4WXIA 3RXTA 3RXHA 1BMNH 4XD7D 1J14A 3EA7A 1O2HA 1MQ6A 2VIPA 3RXJA 1V2PT 1BJUA 1NFUA 4AOQA 5C20A 1FUJA 2IPHA 2P59A 4K1SA 4B2BA 4NCYA 1FIWA 1V2ST 3VGCC 3MFJA 2AEIH 2EY4C 2QF0A 5FPTA 5J4QA 3TNSA 4WMFA 2BXUH 3MU4A 3BTME 1VJAU 3SV8A 2OC1A 3LT3A 1HJ8A 1NY22 4OS7A 1GHAF 2ULLA 2Z6BD 5FCKA 1SHYA 2BB4A 1TBQH 1ARCA 1Z8JB 3GCHC 3DUXH 4MLFB 1OPHB 1GI9B 1P01A 2RFKC 1SC8U 1W10U 3A83A 5TJXA 3ZZ5A 1ELFA 2GVFA 5DSFA 1QFKH 2G4UA 2ZTYA 2QF5A 5C2ZA 1HPGA 1UVUH 1N1LA 2A5AA 1YPKH 5AFYH 2XNIA 1H8HD 2PUQH 2V0BA 3P17H 2WYGA 1P9UA 3UQVA 1V6DA 1YP9A 2G4TA 3BTFE 3BF6H 2H1UA 3Q3XA 1AE8H 2SNWA 7GCHG 2F9BH 2ZHQH 3TH4H 1GG6C 2BVXH 2FZZA 3SU2A 1W14U 3UR9A 1IQLA 1J15A 3V3MA 1HJAC 2Z9LA 1TFXA 2ZQ1A 4ACAA 2BDGA 2ODYB 3BTGE 2VVCA 1MAYA 1YPGH 4FXGH 3SNCA 1UO6A 3KEEA 1RD3B 2JH6D 1EP5A 3VB3A 3ZVBA 3ATWA 4JZFH 4X1NU 1QIXB 4AORA 1DY8A 4X8UH 5CHAB 3U8RH 4R0IA 2Z9KA 1QY6A 3GDUA 1E1QD 1OWEA 1ZGVA 4Y10E 3KHVA 2Z9JA 2K7XA 1V2JT 1QBVH 3GISB 3GOVB 1ZHPA 1W12U 3PMJA 1O5GH 1KTTB 3EE7A 1P09A 2RA0A 1CQQA 3LGTA 3P8GA 4X1SU 2A4RA 1GVLA 3KYGA 1HUTH 4A1VA 1WQVH 4WMDA 1YBWA 4UEHH 1TB6H 1AWHB 3MNCA 4YXWD 5C1YA 2OP9A 1BZXE 1GBAA 2O9QA 1BA8B 3AK5A 2BYAX 5L2ZH 3P70B 4A92A 2OQ5A 1YWUA 1FJSA 4ZHLU 1OS8A 2XYAA 1C1QA 1KTSB 2F9PA 1TRNA 3IWMA 1NFXA 4MTBA 1VGCC 4NA8A 2OC0A 3LH1A 1CT0E 1LVMA 3GY6A 3SNEA 1L4ZA 1WYKA 1HFDA 2SGEE 1V2QT 3PV4A 4X6OA 1AZZA 5A8ZA 4FUJA 2NU2E 4LXBH 3GY7A 3RXBA 4AFSA 1GVKB 3OY6U 2J38A 3KCGH 2WV9A 2GT7A 2STAE 3TJNA 1ABJH 4ABJA 1GHWH 2FIRH 3RXSA 5H4IB 3PWCA 2ZFRH 4ZKOU 1EAWA 4FUCA 1AVWA 4Y71A 2SNVA 1C5YB 3F68H 4JZIA 2EEKA 3KF2A 4X1PU 1UMAH 1DS2E 5HM2A 1AIXH 2ZI2H 2RCEA 1MABB 1Q3XA 3SGQE 1SQRA 2XWBI 3F9GA 2ZGJA 1K28D 1OHHD 1WCZA 3FOAA 2ZHFH 2PV9B 3SUGA 1GBLA 2D1JA 4YM9A 2FX6A 3EAJA 1GL0E 4OGXA 3RLYH 2AMQA 2A7HA 4FUFA 5F53A 1QRZA 3LOXA 2VBCA 5F8ZA 2ALPA 2KZ4A 4DG4A 2NU1E 1T4UH 2QXHA 1TLDA 3OAAD 3SGBE 1ZRKA 4ZUHA 1HJ9A 4RT1A 2GMTC 4GPGA 1XUIA 5KEDA 4Y0YE 4GCHF 1VJ9U 2XRCA 1IQHA 1AO5A 1AHTH 1G30B 4M7GA 1DITH 4D7GA 2ZFFH 2JJ1D 2ODQA 1DWBH 1ETSH 4B6FA 4ZKSU 1GI6A 2R0KA 2QV1A 2WPJS 1E36B 3SN8A 4B2AA 3RU4E 3W1EA 3JZ1B 3H5CB 3RXIA 1QR3E 5EXLA 2VIOA 2Y5FA 2ZCHP 1IHTH 3PM3A 4DCDA 2AIQA 1O2RA 3MHWU 3GY8A 1C5SA 2ZCKP 3LGIA 1C1OA 2HVYB 1V2TT 1VCPA 1C1WH 1GI5A 4YO9A 1OXGA 4GAWA 1D3QB 2FS8A 3UIRA 2VWLA 2QE7D 1Y5UT 3I29A 4YLQH 2RDEA 2ANWA 5JBBS 3ZYEA 1YCPK 3K65B 1ELVA 3ZV9A 1RFNA 3ZZCA 1S0QA 2BDHA 3KYFA 5CDFE 4JYVH 1GJBB 2LPRA 1QTFA 1LVBA 1MQ5A 1C5WB 2ZGBH 3BTDE 2QA9E 1H8ED 4CRBA 3NWUA 1Y3UA 3D49H 1FLEE 5C17A 1P03A 2J34A 3MO3A 9ESTA 3NPSA 3M5NA 3RXCA 1FIZA 5EOKA 3EGKH 1LQEA 3RXRA 2GCHF 2JIZD 2KFWA 2BVSH 2TRMA 4BNRA 4PROA 1JMOH 1O5FH 1YY3A 1TNLA 2Y7XA 3ATLA 4UFEH 1INCA 2HWLB 1UTPA 1VITH 3PWBA 2VVUA 1C1SA 5EODA 1C2GA 5ETXA 4XBCA 2QXGA 1TNJA 2VIVA 2V7QD 4AGJA 3FAOA 1BTUA 6GCHG 1G3EA 2XNDD 3QUMP 3KGPA 3ODFA 1SGYE 4I7YH 1C1NA 3RC6A 1HDTH 2BDAA 3SV6A 5GPIB 2W7UA 2WV4A 2ALVA 5HGGA 1P02A 4E06H 3NRLA 3FANA 3AW0A 3GCHB 1PQAA 5AF9H 4INHA 1WQSA 2I6SA 1KDQB 2ZZUH 2A5IA 4SGAE 4CRCA 4ISLA 1SB1H 4BTIB 1KDQA 1WBGB 3UY9A 1AU8A 2J92A 3FVFB 1KXCA 1LHGH 2H2ZA 2BQ6B 1SGIB 2FPZA 2ZPQA 3GICB 1LHFH 3M3TA 4B74A 1OWIA 2VWMA 1TPAE 3TJVA 4GSOA 7KMEH 3ZIAD 1DLEA 1O31A 2SFAA 1Y5AT 1YPMH 4XBBA 1GHAG 1BMFD 1N6XA 1NS3A 1SLVB 1TGSZ 3MOCA 3ZZDA 2F3CE 2FOEA 1ESAA 4UFFH 1JWTA 1T8OA 3MYWA 1HAXB 1DUAA 1WDIA 4ZAEA 2OQUA 5JPMH 3LIWA 4OS4A 1ESTA 1L1NA 3SBKA 1QCPA 4U2WA 2BY6X 4GHTA 2J98A 2OD3B 1E79D 1QA7A 5DN6D 4WWYA 4KELA 2BX3A 3NKKA 2FO9A 3BTKE 2A7CA 1C9TA 4SGBE 2UUJB 4U01A 5EXNA 4TWWA 3DFLA 1K1NA 5CHAC 1SFIA 2XOKD 3VEQB 2ZFQH 2FWWA 4D8NA 3H7OA 2FEQH 2TPIZ 4RKJB 1UCYK 2ZDKA 4J1YA 3UNRA 2R3UA 2XBWA 2ZU2A 2BD3A 1BQYA 1MCVA 1OX1A 4TY6A 2NU3E 4YT6H 4F48B 4Q7ZA 5JDUB 2Y7ZA 2VNTA 2GGVB 1EUFA 4Y8ZA 4DT4A 1UTMA 1IQNA 3UQOA 5DJ7A 1BRUP 2QGRA 2ZTXA 1PPBH 1XUHA 2C90B 4HGCA 4ABHA 1Q31A 1UTLM 1QJ7B 1SOTA 2BQWB 2XTTB 3SORA 4BXSA 1ZRBA 4LK4A 4I8GA 2AGIX 4ISHH 1O2SA 4I86A 2XBXA 5K7RA 2XCFA 3HGNA 1RTKA 1FXYA 3HATH 2F9NA 4I32A 1C1RA 4BAKB 1VCWA 4WY3A 1BTHH 1MTVA 1YPHC 1TYNA 1ZMLA 3ZVAA 5HIYA 3ZVGA 1MKWK 5GWZA 1A2CH 3OU0A 2DUCA 4NWLA 1DICA 1KXBA 1PPEE 1G36A 1EAIA 1BBRH 1V2KT 1S0RA 1BBRE 1Y3VA 1C9PA 2HNTE 1CBWB 2AYWA 4IW4E 4MNVA 4DW2U 3IG6B 3HK3B 2BLOA 4M9FA 3E8LA 4F49A 1KIGH 1Z6JH 2QY0B 3K9XB 4F4OC 5JBAS 1ELCA 1B7XB 4HZHA 1BRBE 4OS6A 2JH0D 3SHAH 4D9QA 4OS2A 3SUFA 3UPEA 1CO7E 1YPLH 1ZOMA 2ZDLA 2ZQ2A 1SQTA 3CP7A 1HAHH 4UDWH 2Z9GA 1WUNH 3EE0B 1SR5C 2YNAA 4B6EA 3MNXA 3ZV8A 5FX6A 1FAXA 3BEFB 1O2OA 4P02A 2FP7B 3F3BA 1O2TA 4ACBA 2UUYA 2BY7X 1WXRA 2FTLE 2C4FH 1S82A 1SQAA 1Y3XA 2BY5X 4I8KA 1SGRE 1HAPH 2G5NA 2SGDE 3OTJE 4OS5A 4CR5A 2B9LA 1O5BB 1D3DB 3FO8D 4IMZA 5JYIA 1GBJA 1GJAB 1DUEA 5K0HA 2A45B 3A7TA 3GYMA 2QAAA 3KQDA 3TU7H 1B0FA 1TBZH 2PKAB 1SGPE 4CH2B 2WHXA 1O2LA 1DXPA 1HLTH 1C5UA 1GHYH 2PKAA 3AASA 1DDJA 1ZMJA 1A0JA 3ZZ3A 2BD4A 2VIWA 1NESE 1A3BH 5JBTA 4E7NA 4YT7H 2DE8A 1RTFB 2ZO3H 1RTLA 1A1RA 3O8DA 1SBWA 4AN7A 3RXDA 1D3TB 2B7DH 2J9NA 2G00A 4ABIA 1UCYH 5EJ1A 1EPTB 2OLGA 1HB0B 1UCYE 1ETRH 1EZXC 4JMYA 2OINA 1O30A 1KXAA 1C1PA 1EPTA 3UAIC 2ZFPH 1GCTB 5ABWA 1BMAA 1D9IA 1TMBH 5F03A 4O03A 4X2YA 2IJOB 2IOTA 5DGJA 1EB1H 4GCHG 4X8TH 4ZH8A 2ZDMA 3BTHE 1LPGB 4AYYB 3RMNH 1P0SH 1EX3A 4B75A 3BTEE 1OYQA 4GUXA 1NM6A 5TCCA 3A8BA 3G01A 2F9OA 4VGCB 1GL1A 1EJAA 1MTNB 1GHBG 3PMAB 2A7JA 2CN0H 3SZNA 1TA6A 4DURA 4FUGA 6GCHF 3QX5H 3U98H 1O3DA 4TT3D 1GGDB 2IPQX 2W26A 3SU1A 2A1DB 1JRTA 2SGQE 4Z0KA 1C4U2 1MAXA 1LTOA 1MKWH 1O3EA 2G8TA 1DY9A 1H9LB 3OEED 1PPHE 3LGYA 1Z1JA 1VITF 2O8MA 4TY7A 3OE7D 1SGFA 1KXEA 2R2WU 5AHGH 4E05H 4IMQA 2K1QA 4LZ1H 1T32A 1DX5M 3T27A 1SGFG 3MI4A 2QIQA 5I25A 2ZTZA 3FZDA 2AERH 2XXLA 2BVRH 1OYTH 1A4WH 2FS9A 1AFQB 1M9UA 2P95A 2BZAA 1Y8TA 3A86A 3Q00A 4RKOB 3BG4B 4JCNA 2P3FH 2J94A 1LHEH 1G32B 2V3MA 3U1IB 2GCHG 4ABEA 1O5AB 1VCQA 2P93A 3T26A 1MTWA 5DG6A 3RMOH 3LJJA 4I33A 3PTBA 1O34A 2WPKS 2QYIA 1K1OA 3KQBA 1GMHG 5A0CA 1XXFA 2BD9A 4H4FA 3F9HA 1GDNA 7ESTE 5GDSH 1OSSA 3T5FH 3VG8A 4AFUA 5FCRA 4B2CA 1C4Y2 1GBCA 1NO9H 3PRDA 4WMEA 3BTTE 3MU5A 3ATKA 1C2DA 3V13A 2GTBA 1AB9B 3RU4D 1IQMA 3A85A 1CA0B 2PGBB 4FU8A 2GCTB 1GDUA 4MDSA 3OX7U 1OP8A 3M5OA 4JK6A 3GDSA 3RXUA 4X1QU 2GKVE 2WZQA 2HPPH 1PPFE 1AKSB 4K1TA 4ABFA 2QN5T 1O5DH 1AKSA 3P92A 3PYHA 1O5EH 3RM0H 1K1PA 3TGIE 2Z3CA 3ODDA 2ZU3A 2ZCLP 3TH2H 2AMPA 1A5IA 1KLIH 5LPFA 3V0XA 4ABGA 4NWKA 5T3HA 3SU0A 2KCOA 3HPTB 1BDAA 5HM9A 2UWPA 3KL6A 3M3VA 1TOCB 1XUJA 5DK1A 1GJDB 5EG4A 1KXDA 3PMBB 1QURH 1V2NT 5A8XA 3V7TA 6CHAB 3JZ2B 2BLVA 1HXFH 2AH4X 2CJIA 5GNDA 3W94A 4HFPB 2QCYA 1O3IA 2V3HH 1RRKA 4NIVA 1C1MA 2KCPA 2WPIS 3P95A 1YCPM 1GBHA 1CGHA 1T8LA 1QNJA 2WUCA 2ZC9H 4Q7YA 1G3DA 3MO9A 1ZJDA 2XC4A 4FUEA 2CV3A 3DFJA 1W0YH 1P10A 4A5TS 1A0LA 3QZQA 4I8JA 3UUZA 1W11U 1DSUA 3QTOH 1MH0A 2YMSB 3PRBA 1FY8E 3BTWE 4BAHB 2HLDD 3OSYA 3HKJB 3LH3A 5F8XA 3U28C 4X1RU 1GCDA 1GI0A 1GJ7B 2ZA5A 1ZHRA 2HNTF 1F0TA 1TPPA 2RG3A 3ZZ4A 2EA3A 2G51A 1FPCH 3ZZAA 3SQHE 3ZZBA 4MPWA 2WSSD 1DOJA 1P05A 5EIYA 1J16A 1VR1H 1W0ZU 1DT2A 1QL9A 1CBWC 2ZPRA 3ZZ6A 5AFZH 3E91A 4IC6A 2WV5A 1H9IE 1O3MA 1S6HA 2JETB 3SHCH 1P8VC 4RI0A 3QGJA 2HNTC 4ZROA 1TOMH 1T31A 2R9PA 1NRQH 4DJZB 4X2WA 3DD2H 4X8SH 3MTYA 4X6PA 5CHBA 2Z9IA 2ZDAH 1UTNA 1LMWB 4IBLH 2V3OH 3P6ZB 5FBIA 1BCUH 1U6QA 2I6QA 1UJ1A 1P06A 1E38B 2O8WA 3MH5A 3CS0A 4HG6A 2P3UB 1UK4A 3TJOA 3A8CA 1TAWA 2SGFE 3F2HA 4OS1A 1TGNA 1P9SA 2WYJA 2A4OA 1UVSH 5CMXH 1GWAA 1A0HB 1IHSH 4FU9A 1G3BA 2H5CA 5EQQA 1FQ3A 3WWFA 1ZGIA 1EKBB 1NN6A 3RXAA 4WVPE 4AB8A 2HPQH 4Y8YA 4H6SB 3TH3H 5EQSA 3N99A 3TPIZ 4TWYA 4ABDA 4YZUA 1C5XB 1QRXA 2TGDA 1RIWB 2RA3A 5KGOA 1PPGE 1Z1IA 1KLTA 3QZRA 1MD7A 4B1TA 1TABE 1P2QA 5EGMA 3MU0A 4ABBA 4E7RG 1W3CA 1ZJKA 2Q6GA 2O8TA 1QL8A 2R3YA 1SPJA 2ODPA 3EA9A 1C2JA 2GX4A 1UVPA 1GHBF 4Y7BA 1X7AC 3E16B 1Z8GA 1C2LA 4ZHAA 3FP6E 1F5KU 1FI8A 3VPKA 3K6ZA 1CSOE 4Q2KA 1PJPA 2FOMB 2P8OB 1B5GH 1C4V2 1EPTC 2GV6A 3UR6A 3UFAA 3SV7A 3I77A 2BOHB 3BIUH 1ABIH 1GCTC 2GDEH 3SGAE 3B8JA 3GY4A 1SHHB 3F6UH 1P2OA 2P94A 3TITA 1TRYA 2FYQA 2ANMH 1KLJH 1Z7KA 4YOIA 1FX0B 1THPB 2PLXA 1HCGA 1O37A 3RXMA 2ZDVH 2BY9X 3HK6B 4MVNA 5IYTA 3S69A 1BTXA 1C5LH 1K22H 5T1VA 1IQEA 1MKXK 5T6GA 1YM0A 1NRPH 1UK3A 4VGCC 3OEHD 1EASA 3F9EA 5C0UA 2EI6A 2A31A 5C1UA 1MTNC 1O2VA 4KP0A 5FXLA 3L3TA 4GVUA 1C5VA 1GGDC 3E0PB 2F4LA 5DP7A 3ZZ8A 4I31A 2PTNA 3L6PA 1G9IE 1SSXA 2ZNKH 1LVYA 3KN2A 3QGNB 3MH4A 2OTVA 3LDXH 1SMFE 1GI7B 3TGKE 4KTUA 3BG8A 1HIAB 4AG2A 5F6MA 3SJIA 1GMHF 1GBKA 2XWAA 1HIAA 1S81A 1QBNA 1AMHA 1O3GA 1CHOF 4WJG2 2LNCA 2TBSA 1O3LA 1GBDA 2C8ZB 4K8YA 4CREA 3A7ZA 1AFQC 2ANKH 2ZFTA 3RXVA 4ZXYH 5EPNA 2TGAA 2LELA 3BG4C 3TK9A 2PTCE 1J8AA 3PLPA 1P3EA 1F0UA 1CU1A 4JZ1A 4ZKNU 1JIRA 2A2XH 3GS9A 3N7DA 4IS5A 4DOQA 2C93B 1VITG 3K2UA 3E3TA 5GCHG 1AD8H 1FY5A 3SUDA 1G2MA 1BTPA 3SI3H 1S6FA 2W3IA 2ZU5A 3PLKA 2EI8A 4AC9A 2O8LA 3U8TH 1UTQA 1AY6H 4H42U 4UONA 3M5MA 4LOYH 1SOZA 1ZTLA 1MBQA 2EC9H 2L6OA 4K60A 1UVOA 2Y5HA 1ZSJA 1GJ4H 3ZVCA 2H5DA 1OP2A 3PROA 5I46H 3MQKC 3SQEE 3QTVH 2FMJA 1ELBA 1K21H 1O3BA 1EZSC 1GVZA 3TGJE 4UFGH 2TGTA 5B6OA 2OK5A 3H7TA 3MMGA 1PQ5A 1DWCH 1O3KA 2STBE 4AG1A 1Z8IB 4B76A 1SG8B 3KQ5A 1AB9C 1CA0C 2GCTC 1YPJH 2FLBH 1H4WA 2PKSB 1HAVB 3A8AA 1FMGA 1GBBA 3A87A 3LONA 1N8OB 1C2FA 1HAVA 2H6MA 3UB0A 4XE4A 4AX9H 1O36A 3VXEH 3R0FA 1AZ8A 2ZU1A 2ZU4A 1EATA 1V2RT 5FHTA 1OWHA 2ZECA 1CT2E 1XXDA 2J4IA 4TSFD 4B71A 1YCPH 1HGTH 1BTYA
chains in the Genus database with same CATH topology
1NU9A 2IN2A 1YF4A 8KME2 2PW8H 4NA9H 2W7SA 4RN6A 1NFWA 3RXQA 3DA9B 1P3CA 2B0FA 4WH8A 1V3XA 1HV7A 1TA2A 2GV7A 1EXFA 2AS9A 5HMAA 1MKXH 1TONA 3LU9B 1E0FD 6CHAC 1TPOA 5A09A 5JBCS 1TX6A 2OC7A 3SV9A 5A2MH 1OP0A 1ANBA 1WU1A 3LGVA 1TIOA 2C8XB 3V12A 1LDTT 2BZ6H 3IITA 1K9OE 3E0NB 2V6NA 1SGNE 4MNYA 5ESTE 5E8EH 3STIA 2M5TA 1H8DH 4ZXXH 2J95A 1OOKB 3MWIU 1ZHMA 1HAZB 1K1JA 3E90B 9LPRA 2CF9H 4AGKA 1L1JA 1CHGA 3BTQE 5EPYA 1NRNH 1C2IA 1ZPCA 1ANCA 4Z6AH 1EAXA 1TX7A 4UD9H 3OY5U 1FY4A 1ZR0A 3T25A 2PWXA 3A81A 4DGJA 4X6NA 1O2QA 3PLBA 1HBTH 3EA8A 1C5OH 1H1BA 4YOGA 3ZVDA 4O97A 4IGDA 5IDKA 3FZZA 1GI1A 2Q6DA 1GI2A 2Z3EA 2KAIB 3SU4A 2DE9A 2EI7A 3A80A 4Y6DA 1AGJA 5LH8A 4MQAA 1P57B 3LC5A 4UE7H 1ZMNA 1HNEE 3M35A 1NTPA 2ZHEH 1WOFA 3B23B 4A6LA 2Q6FA 1C2HA 3AAVA 2JETC 1P2NA 3RUOA 4NSVA 3W95A 2QF3A 2OBOA 1ARBA 1ESBA 1O33A 2AIPA 1SGCA 1SLXB 1IQIA 3EYDA 4DVAU 1TNKA 1BT7A 2Z3DA 1BJVA 2BHGA 3U8OH 5TCAA 4DY7B 1F2SE 5E2PA 5G4BA 3K6YA 4AFQA 3A7VA 1O3FA 3A82A 2R0LA 1N6YA 2ZGXH 2FOHA 3A84A 1XVOA 3PO1B 1Z6EA 2A5KA 5DP9A 2CGAA 3BEIB 3C27B 4NFFA 1RIWC 2FI3E 3A89A 3ELAH 2FDAA 4NZLA 2RDLA 1TRMA 3M3SA 2Y81A 3F9FA 1LO6A 1OWDA 1O5CB 2VB0A 1DANH 2BD8A 1AN1E 1C5NH 2XC5A 1O3JA 5E0GA 1HAGE 4FUDA 1LPKB 3T62A 2VVVA 3RP2A 3RXLA 3SU3A 3S9CA 2BD2A 3B9FH 3BEUA 2ZG0H 2FI4E 4CHAB 2BQ7B 2P8OC 2BLWA 3VB7A 1QB1A 1FONA 1A46H 1P2KA 1T7CA 2THFB 1GI3A 1SLWB 3TIUA 4XOJA 3UTUH 5F8TA 5FAHA 1JIMA 1ZPZA 1L1GA 2WPMS 1ANDA 1DLKB 5SGAE 4IN1A 3QO6A 1GJ8B 1WTGH 5E2OA 2FOAA 4Y11E 1UHBB 1FAKH 1CE5A 4XSKU 1G3CA 1THSH 1UHBA 2R2MB 1A7SA 3SU6A 2FTMA 4NSYA 2F83A 1J17T 4OGYA 6LPRA 2FXRA 3GCOA 3BN9A 1DSTA 1GHVH 1D4PB 1UK2A 5GCHF 4XFQA 5T6DA 2JH5D 1O2JA 3SNDA 4CRFA 4DIHH 1ZYOA 1YYY1 2B5TB 4WF8A 2ZF0H 3GYLB 3S9BA 4QT8C 3LGUA 4O9VA 3S0NA 2UUKB 3FP8E 2FOFA 3MU1A 2NU0E 3TLOA 1DE7H 1GMCF 1KY9A 3SNBA 3ZVEA 1O2KA 4K69A 3ATMA 4YLUA 3PTNA 2BD5A 1EB2A 3OYPA 2ZGHA 5JB8S 3WY8A 8GCHF 3TK6A 1ELAA 4ASHA 1P04A 1T8MA 1S84A 1O3CA 2UWLA 3RXFA 2VGCB 3DHKH 1MCTA 1NROH 4Y7AA 1W7XH 2J2UA 5LPRA 1TPSA 1ZSKA 1CHOG 2FESH 2Q1JA 1BMLA 4FVDA 4X6MA 1O38A 2VH6A 4THNH 1SFQB 1LQDB 1GPZA 3QN7A 5GXPA 3D23A 1KSNA 3EQ0H 4K8BA 3LKWA 5L2YH 1ETTH 4DT7B 1NT1A 2PSYA 5A0BA 4YTAA 3GCNA 3GDVA 3LPRA 5FBEA 5LGOA 4INLA 5BPEA 3KNXA 1RGQA 3M36A 1DWDH 4FU7A 1PPCE 3MNSA 2AFQB 4R8TB 1SGQE 3URCA 3SNAA 4U32A 1O3NA 4K2YA 1O2XA 2HGTH 4XDEA 4A1XA 1EZUC 1KYNA 2PKSC 1XUGA 3E1XB 2ILNA 1N8OC 4FUBA 3SUEA 2VJ1A 5EU8A 2SGAA 3Q76A 5GIBA 3A7WA 5DKMA 1W13U 1ZZZA 2G55A 2ZDNA 3QWCH 4CRAA 1FDPA 1RXPA 1PYTD 3UREA 1GMDF 1A5GH 3M37A 2PGQB 1JXPA 1O35A 4UFDH 3UNQA 1SL3A 5EQRA 1AUTC 4HTCH 1TGCA 2ZP0H 1MTSA 3SO3A 1YLCA 1FNIA 1D6WA 4BAMB 1TNGA 2P16A 3GY5A 1QA0A 4CRDA 2CF8H 3UOPA 2VIDA 2OC8A 4MG3A 1O2PA 1AQ7A 1OKXA 4CBOA 4NFEA 2BMGB 3C1KA 1O3HA 1TX8A 3RC4A 1C5ZB 1ID5H 2PHBA 3S7HB 2YOLA 2ZPSA 3SJ8A 1A3EH 1YKTA 4MNWA 3KQCA 1ORFA 2GZ9A 2ZKSA 1S5SA 5PTPA 2CXVA 2A32A 2P3TB 2BDYA 1S83A 4BAOB 1C1TA 2B8OH 3NZIA 1GJ9B 4WH6A 1AI8H 1H8IH 5A0AE 3M7UA 3O8BA 4MPUA 3VB5A 1W8BH 2O8UA 2Z7FE 1YPHE 3VB6A 3GCTF 5FX5A 2OUAA 3STJA 1ZPBA 3LC3A 1UTOA 1XUKA 2ASUB 1F7ZA 4YESB 2ZGCA 3S9AA 1MU8B 1S85A 1TNIA 2CHAB 2ZHDA 3T28A 2FM2A 3FP7E 1F0SA 2VU8E 2NWNA 2UWOA 3UNSA 1JRSA 5LPEA 3URDA 4BOHA 3RLWH 1NFYA 2Y6TA 3PMHB 1NU7B 1MBMA 1C2EA 1XVMA 1ELGA 4YOJA 2VWOA 4MPVA 4GLYA 1D6RA 3SV2H 2PFEA 1QQUA 1XUFA 1MTUA 4AB9A 3SJKA 1LKBA 1TQ0B 1WV7H 2Y80A 4J2YB 2D2DA 2OXSA 3UOUA 2F91A 1GI8B 1BB0B 2FYRA 1TE0A 2TIOA 3A88A 3TK5A 1K1IA 2AGEX 2W3KA 1MD8A 5J4SA 1IQFA 4Y79A 1Y3WA 1VZQH 2PSXA 1JBUH 4ZMAH 3P8NA 1C5RA 3T2NA 3ESTA 3L33A 3PO1C 2XBYA 3SJ9A 1A5HA 1NRRH 1SGTA 1MU6B 3TNTA 1OWJA 1RJXB 1C5TA 3BSQA 2VH0A 4JYTA 2CMYA 4INKA 4Q7XA 1BITA 2ZWLH 1THRH 1PFXC 1P12E 4A1TA 1TMUH 1AFEH 1E34B 2C3SA 3D65E 2AMDA 3T29A 3FFGA 2FOCA 4X2VA 1BIOA 1TQ7B 2PR3A 5C1XA 2ZHWH 1CGIE 5C5NA 1WAYB 2HRVA 1XKBC 1MZAA 2WPHS 1HAYB 4O3UA 4CHAC 3MH6A 1GBFA 1QL7A 1W7GH 3ZYDA 1O3PB 1LHDH 1ZTKA 3PB1E 1FN8A 1GBIA 1QHRB 1LPZB 4FUHA 3UWIA 1XKAC 3QK1A 2XC0A 4IN2A 1YLDA 3VXFH 5HXFA 1D3PB 1P2JA 2XBVA 4LZ4B 3NCLA 1EQ9A 1G37A 3AW1A 3MU8A 5HYOA 5BRRE 1O0DH 1QB9A 3NK8A 4K1EA 4RSPA 2GZ8A 4AZ2B 1AUJA 4CH8B 1BHXF 2UUFB 3GY2A 4B73A 5CE1A 3VFEA 3F1SB 3MO6A 1C1UH 4O3TA 1SI5H 3RXGA 1DXWA 4TPYA 7LPRA 2HALA 5DP5A 1G2LA 1QGFA 4I8LA 4NZQA 2SGPE 2FOBA 1WSSH 1NRSH 3EBNA 1BOQA 3CENA 1AVXA 1IQGA 2BD7A 2W5EA 3RXKA 3ITIA 1MZDA 1P11E 4KGAA 3RMMH 2FI5E 3AAUA 1QJ1B 4A7IB 1C2MA 1C5QA 1BTWA 1QRWA 4KTCA 5GJ4B 2HVXA 1PPZA 2FLRH 4BANB 2BDCA 3Q3YA 1GBEA 4NA7A 1W2KH 2LIZA 3ZZ7A 3EDXB 1HAIH 4CR9A 1TNHA 1GJ5H 5EW2H 1GHZA 3SI4H 5DP4A 1V2OT 1E37B 4HI3A 5T6FA 3VGCB 1MMJN 1AVGH 2FX4A 1K2I1 1C2KA 4JZDH 1BBRK 4CRGA 1HYLA 1F5RA 2VGCC 2BY8X 3KQEA 1F0RA 1IAUA 3TVJB 1CT4E 4D9RA 1NPMA 3BV9B 4K5ZA 4NIYA 1B0EA 1GMCG 8LPRA 4FVBA 1V2LT 1Z8RA 1QB6A 4Y0ZE 4D76A 4ZHMU 1C5MD 7GCHF 1UVTH 1EOJA 4X2XA 3RDZA 2VWNA 1DWEH 1F92A 8GCHG 4K3JA 1EP6A 4U30A 2D8WA 3O8CA 1HRTH 1V2VT 4ISOA 2A0QB 5L30H 3HGPA 3E6PH 1DPOA 2YNBA 1IQKA 4X0WU 3M5LA 4NG9H 1LHCH 3U69H 4JZEH 3SOSA 2WUBA 2WPLS 2VIQA 1YC0A 2AGGX 1ACBE 1GG6B 1GJCB 1XMNB 3D62A 1F5LA 2Y82A 1HJAB 1A61H 2GD4B 1OWKA 1V2WT 3LJOA 3RXPA 3M7QA 1TBRH 3SW2B 3SU5A 1O39A 1O2ZA 2A2QH 2H9HA 3RMLH 6ESTA 2BOKA 1L0ZA 1Y59T 2G81E 1O2IA 1NC6A 1FZZA 3RC5A 2ZEBA 5A8YA 3Q77A 4XBDA 4FUIA 2Z94A 5DP8A 1FY1A 2FODA 3ZVFA 3SJOA 4ISIH 1GBMA 1UTJA 4DIIH 5EXMA 1O2UA 5C67A 1QJ6B 5ESBA 5L6NH 4ZKRU 4TYDA 1O2YA 3RXEA 1P2MA 1L2EA 4AFZA 3HKIB 3NXPA 4BTUB 3I78A 3A8DA 2FOGA 5FPYA 1CVWH 1BTZA 4I8HA 1GMDG 3GY3A 3RXOA 1V2MT 1FPHH 1TWXB 2BTCE 1FY3A 4KTSA 1T4VH 4GHQA 4CBNA 1C5PA 1GDQA 4NGAH 2C8WB 2V35A 1O3OA 2ESTE 3QDZB 2OCVB 2BDIA 1O32A 2QXJA 1DFPA 1O2MA 1SLUB 1VGCB 4Y8XA 1P2IA 4ISNA 5E0HA 1ZTJA 2KAIA 1JOUB 1WTHD 2CHAC 1ELTA 2WINI 1IQJA 1UTKA 5C5OA 5EW1H 2ZIQH 1EAUA 4KKDA 2D26C 2HLCA 1LKAA 5DPAA 1SGEE 3LGWA 4D7FA 1GHXH 1YPEH 2BM2A 2H9EH 1BRCE 2GP9B 3A7XA 4Q80A 3GCTG 4BXWA 1CGJE 1J9CH 1E35B 3TJUA 1O2GH 3UWJH 1XM1A 3RM2H 4ESTE 4MPXA 3N7OA 2VINA 4AYVB 1CA8B 4NIXA 4H6TA 1ZSLA 3ATIA 3U1JB 1YGCH 1EZQA 1ELDE 1O2NA 5DP6A 1BRAA 3A7YA 2ZFSA 4Y76A 1XX9A 1C1VH 2GZ7A 1QQ4A 3BIVH 1Q2WA 3O8RA 1IOEA 2PUXB 2XW9A 3ZZ9A 3DT0H 3P8FA 1TMTH 2BX4A 1HAOH 1Y3YA 3Q3KA 1DVAH 1O2WA 5JB9S 2H9TH 3P8OA 5FPSA 1PQ7A 1V2UT 2XCNA 3CS7A 1K1MA 5E0JA 2GMTB 1TALA 4NIWA 3NUMA 1BMMH 3MNBA 2GDDA 1O3AA 1TGTA 1LCYA 1EOLA 1Y5BT 1FN6A 3ENSB 2GT8A 1FV9A 1AE5A 8ESTE 2BLQA 2QXIA 2A4QA 3QLPH 1ZLRA 2JKHA 4JK5A 1SQOA 2F9VA 1T8NA 2C8YB 2ANYA 1HXEH 1MUEB 1LVOA 5DO4H 1NZQH 3MH7A 1TGBA 3RU4T 5C3NA 1SGDE 2NU4E 1H9HE 2BXTH 2F9UA 3U9AH 1GJ6A 2TGPZ 1ANEA 2Y5GA 2A4GA 4BAQB 1EJMA 3KIDU 1SVPA 4X8VH 1RS0A 2BDBA 4TPIZ 1AWFH 1PYTC 2G5VA 4JYUH 4ABAA 1KXFA 3M61U 3R3GB 3M7TA 4BTTB 1EJNA 2QC2A 4IC5A 1PQ8A 1DM4B 1GBTA 1QBOA 4WXVA 3VB4A 1BUIA 3AVZA 1ELEE 3S7KB 1Z71A 1GI4A 2HOBA 1BHXB 2G52A 4MNXA 5DP3A 2OBQA 1L4DA 1K1LA 5AVDA 4WXIA 3RXTA 3RXHA 1BMNH 1J14A 3EA7A 1O2HA 1MQ6A 2VIPA 3RXJA 1V2PT 1BJUA 1NFUA 4AOQA 5C20A 1FUJA 2IPHA 2P59A 4K1SA 4B2BA 4NCYA 1FIWA 1V2ST 3VGCC 3MFJA 2AEIH 2QF0A 5FPTA 5J4QA 3TNSA 4WMFA 2BXUH 3MU4A 3BTME 1VJAU 3SV8A 2OC1A 3LT3A 1HJ8A 1NY22 4OS7A 1GHAF 2ULLA 2Z6BD 5FCKA 1SHYA 2BB4A 1TBQH 1ARCA 1Z8JB 3GCHC 3DUXH 4MLFB 1OPHB 1GI9B 1P01A 1SC8U 1W10U 3A83A 5TJXA 3ZZ5A 1ELFA 2GVFA 1QFKH 2G4UA 2ZTYA 5C2ZA 1HPGA 1UVUH 1N1LA 2A5AA 1YPKH 5AFYH 2XNIA 2PUQH 2V0BA 3P17H 2WYGA 1P9UA 3UQVA 1V6DA 1YP9A 2G4TA 3BTFE 3BF6H 2H1UA 3Q3XA 1AE8H 2SNWA 7GCHG 2F9BH 2ZHQH 3TH4H 1GG6C 2BVXH 2FZZA 3SU2A 1W14U 3UR9A 1IQLA 1J15A 3V3MA 1HJAC 2Z9LA 1TFXA 2ZQ1A 2BDGA 2ODYB 3BTGE 2VVCA 1MAYA 1YPGH 4FXGH 3SNCA 1UO6A 3KEEA 1RD3B 2JH6D 1EP5A 3VB3A 3ZVBA 3ATWA 4JZFH 4X1NU 1QIXB 4AORA 1DY8A 4X8UH 5CHAB 3U8RH 4R0IA 2Z9KA 1QY6A 3GDUA 1OWEA 1ZGVA 4Y10E 3KHVA 2Z9JA 2K7XA 1V2JT 1QBVH 3GISB 3GOVB 1ZHPA 1W12U 3PMJA 1O5GH 1KTTB 1P09A 2RA0A 1CQQA 3LGTA 3P8GA 4X1SU 2A4RA 1GVLA 1HUTH 4A1VA 1WQVH 4WMDA 1YBWA 4UEHH 1TB6H 1AWHB 3MNCA