2YNAA

Crystal structure of the main protease of coronavirus hku4
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
b'SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-LIKE PROTEINASE
publication title Inhibitor for the Main Protease of Coronavirus Hku4
rcsb
source organism Tylonycteris bat coronavirus hku4
molecule tags Hydrolase
total genus 84
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2ynaA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ynaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ynaA02
1C1WH 5DP3A 5C5NA 1ORFA 1OX1A 1SGPE 1QB6A 1KXEA 1LPZB 4Y76A 1UTOA 1QHRB 2G81E 1E38B 1A1RA 4TPIZ 1SGIB 1DM4B 1F5KU 2W3IA 5G4BA 4CRBA 1O30A 1QL8A 1C5YB 1VZQH 2R0LA 1MTNB 5DGJA 3GY7A 1BHXF 1S85A 4GPGA 4Z6AH 2VVVA 4X8SH 3BTHE 5IDKA 2FTLE 1THRH 2QYIA 3E16B 1C9PA 1O5BB 1P2QA 4RSPA 2F91A 3A8DA 2A4RA 1HBTH 2UUFB 1O2GH 1JBUH 1CU1A 1BRUP 3RXAA 1CA8B 4B2AA 4JMYA 4Y7AA 3SU1A 2A4GA 4TPYA 1EB1H 4K5ZA 3RXIA 1GBFA 2RCEA 2VIOA 3S7HB 3BEIB 2BD9A 1KDQB 3ITIA 3M7QA 2PKSC 1BIOA 4Q7YA 4IW4E 1Y3VA 1HXEH 3RU4E 3A8BA 2AFQB 1Q2WA 2XCFA 2FTMA 3MU0A 1BRCE 3SHCH 1D6RA 4ZAEA 1TRMA 1B7XB 1O2MA 2VWOA 4O03A 2BQWB 1K28D 3SNCA 2P3FH 2FM2A 4U30A 4YOGA 3QO6A 4IC6A 2P95A 2BMGB 2VWLA 1J15A 1UCYE 1OWKA 1TPAE 1XUJA 4NCYA 2VH6A 2W5EA 1O2VA 1TBQH 5EQQA 1S6FA 2VVCA 5T6DA 1G30B 3A7YA 1Z8JB 5JYIA 1NN6A 2XNIA 3UWIA 3BIUH 2P16A 3RXVA 1LCYA 6ESTA 1BCUH 2PKAA 4BXWA 1BBRH 4AORA 1PFXC 4ISHH 2HOBA 3FVFB 1O2WA 4CHAC 5HMAA 3TGIE 1XM1A 3KQEA 4KKDA 4XSKU 1DITH 1EOJA 2OBOA 1HJ8A 1ANCA 2R0KA 4R8TB 1N6YA 2VIPA 2P3UB 1LKAA 3GY6A 2DE8A 3KCGH 2VVUA 1BTZA 3S9CA 1O3GA 4CRCA 2IPHA 4UFGH 1K22H 3ATKA 4CR5A 1P57B 1J14A 1GCTB 1YKTA 1L1JA 2ZGBH 3TK6A 1UO6A 1SGYE 1ZSLA 1B5GH 2D8WA 3UQOA 1FAXA 1F5RA 1LVOA 3RXBA 5JB9S 3BTKE 7LPRA 4QT8C 1GVLA 3ZZ9A 1O3PB 1ELCA 4JYUH 2THFB 1P11E 3BTDE 2CHAB 1ELDE 1AKSA 1FZZA 1EJMA 2CV3A 4YOJA 3OY6U 3BEFB 3JZ1B 3GYLB 1ZHPA 1L0ZA 1G37A 4D76A 3TJUA 1T8OA 3P8OA 1O2SA 1IQNA 2PSYA 1F5LA 4NIYA 5BPEA 4Y8YA 4X6OA 6CHAC 1GJBB 2AIPA 3K2UA 1FNIA 2BDIA 2ZFSA 1P03A 3SV8A 1W0YH 2FEQH 3RLYH 2ZDMA 4AFZA 1MKXK 3Q76A 1E35B 5GIBA 2GCHG 2WPHS 2D1JA 3U8OH 3UTUH 3Q00A 3MH5A 3F1SB 4B76A 3RXTA 3ODDA 4YM9A 5EQRA 5AHGH 1P12E 1XUHA 2VU8E 2J9NA 4YZUA 1ZMJA 1C5MD 4J2YB 3BF6H 1DWBH 1CT4E 2XCNA 4ZXYH 3TGKE 1MBQA 2PTCE 2J34A 4I8GA 4KTCA 1W3CA 1E34B 4ABGA 2ULLA 4KTUA 1FY5A 2J2UA 2WUCA 3A8CA 1O39A 1TNHA 2HNTC 2EI7A 1OP2A 3FANA 2BD7A 1P2OA 4LZ4B 5LPEA 2R3UA 5EXLA 4CREA 3QZQA 1OP0A 1BB0B 2BZAA 1D3QB 1C2LA 1EPTA 1MTVA 3FP7E 4Y10E 4MNWA 2EA3A 1GBCA 2ZCHP 1GJ4H 1AZZA 1B0FA 4NIXA 2BY9X 1SLUB 1V2NT 1WQSA 3SUGA 1QR3E 1QGFA 2VWNA 1PYTD 3E3TA 1O5EH 1S0QA 4Q7XA 4WH8A 1K1LA 4JZIA 1K1OA 2Z3CA 4KELA 2V6NA 3TH4H 3PROA 1V2LT 3JZ2B 2QAAA 3SUFA 1ABIH 4BAMB 1DE7H 2KAIB 4ZUHA 1CA0B 2FI3E 5L6NH 2TRMA 2FOMB 1IQMA 3UREA 3GY2A 1NRQH 1FY1A 1O5CB 3E8LA 4AG2A 3ZVGA 2HWLB 5JB8S 1ZLRA 2UWLA 3HK6B 1KLIH 3PLBA 3DA9B 4DG4A 2ZGXH 3UR6A 4GVUA 1MZAA 2P59A 3SV9A 3SZNA 3BSQA 3TU7H 2TGPZ 3O8CA 3UUZA 1D3PB 1O0DH 1F2SE 2AIQA 5JBBS 3A88A 1GHBG 1SL3A 1MD8A 1Z8GA 1L4ZA 2Y7XA 1OP8A 1TNIA 2PUQH 1TPPA 2Z9JA 3M3TA 1TLDA 1YLDA 2EI8A 1BTHH 1SGRE 4BAKB 4WMDA 2STAE 3AAUA 1A5HA 1TALA 3A7WA 4JZDH 1O33A 1GDQA 1PQAA 1SHHB 2ODYB 4GLYA 4Y8XA 5HGGA 1D6WA 5HXFA 1P05A 1HAHH 2H9EH 2OXSA 1V2PT 3O8BA 1L4DA 2XTTB 1KDQA 5EPYA 1W2KH 2GP9B 4JCNA 3SO3A 1MUEB 1D3TB 4MVNA 5CE1A 3TH3H 1DY9A 3E91A 3PMJA 1GBKA 2ALPA 3W94A 2A31A 2C8WB 1ZHMA 2WV5A 1UVTH 1G9IE 1WBGB 4WMEA 3HK3B 3VXFH 1EOLA 2OQ5A 5AFZH 5A2MH 4AG1A 1S5SA 1EUFA 4MDSA 1MBMA 1VCQA 2ILNA 3QTVH 2GCHF 3A80A 1W10U 1VCPA 1BA8B 1A0LA 2NWNA 2ZDKA 3SW2B 1FIWA 3NKKA 3VB4A 1G3EA 3H5CB 4WMFA 4E05H 1UVSH 3A86A 2F83A 2ZHEH 2BDAA 3UR9A 3E90B 1V2UT 2VIQA 1UCYK 1GI1A 5FCRA 1CVWH 3WY8A 1UTPA 3MO3A 4Y0ZE 1WTHD 4GUXA 5C1UA 1IHSH 1Z1IA 1V2QT 1OKXA 1GPZA 1C5VA 2GV7A 5GJ4B 5I25A 1HCGA 1NFWA 3DD2H 1G36A 1GI9B 1Z8IB 2WINI 2FOEA 1TMTH 2BDCA 1MTWA 4OS1A 1GBAA 2WPIS 1PPGE 1BMMH 1MZDA 2CF8H 1K21H 1GBTA 2BD8A 3VFEA 1GG6C 1F0RA 1WUNH 3STIA 3A81A 2Y5GA 3A89A 3E0PB 2ODQA 2QXHA 2FOHA 2QF0A 5AVDA 2WPMS 2HPQH 5EOKA 2R2MB 4A1TA 2ZFPH 2V3OH 1GL1A 3SUEA 3QTOH 2LIZA 1RJXB 1UTKA 1TGBA 1H9LB 1AWHB 2F9PA 4FUCA 3SU6A 2G00A 1H8DH 1H9IE 1C5SA 1TOCB 3BTTE 3P8FA 4FXGH 1J9CH 2C93B 4IMZA 1FN8A 3NWUA 1KLJH 1VGCC 1AVGH 5GDSH 1P2JA 2Y6TA 1FPHH 3PMAB 3UY9A 5EW1H 1SVPA 1THPB 2PLXA 4VGCB 3O8DA 4CHAB 1INCA 1ARCA 4LXBH 1EASA 4KGAA 3VB3A 3RXQA 3EE0B 1GI2A 1OYQA 1WCZA 1GVKB 2VIVA 1Y3YA 4I32A 2A4OA 1K1MA 4ZXXH 3D65E 1E37B 1NO9H 2P93A 2ZC9H 3K9XB 1GHBF 3PV4A 3LU9B 1UVUH 2AMQA 4YESB 3T62A 1TOMH 2Z3DA 3TH2H 1A5IA 4J1YA 1KY9A 5I46H 2FPZA 3L6PA 4ZHLU 1ELVA 1PPEE 4XOJA 3TJOA 1AVWA 4H4FA 2ZCLP 2WUBA 3QN7A 3BV9B 1WTGH 1TYNA 1UVPA 2PWXA 3V3MA 1GMDG 3GISB 5JBCS 1XVOA 6GCHF 4BTIB 3LKWA 3VB6A 1L1GA 1SB1H 3QDZB 3TK5A 2VNTA 4M7GA 1P04A 2AGEX 1H1BA 3SI3H 2ZPRA 2XC5A 1GCDA 2ZGHA 3ZZAA 1AIXH 4K2YA 5E0JA 3RXPA 1O37A 4FVDA 3NXPA 4CR9A 2TBSA 1GL0E 1O3OA 1YCPH 4K1SA 2GV6A 3MH7A 3UNQA 1TA6A 2G52A 1ZGVA 2NU3E 1O2YA 3OX7U 6CHAB 1GHXH 3QGJA 3T25A 4AYVB 1WAYB 3UNSA 1C4Y2 1SQOA 2A5IA 2GX4A 3T29A 4DOQA 1AQ7A 3ZVDA 2QCYA 1GVZA 1G3DA 1HB0B 1XUGA 1JOUB 1HRTH 5A0CA 4Z0KA 3TJVA 2SGEE 1AFQC 1UHBB 2ZIQH 3MO6A 3P8GA 3UFAA 1C9TA 2BDBA 3F68H 2V0BA 1TGTA 3RC6A 3OY5U 3MOCA 3U1IB 4BANB 2A5AA 1V3XA 4D8NA 2KAIA 1O2IA 3A7VA 3MH6A 1KTTB 1C5WB 4X2YA 3T28A 3UIRA 1W8BH 5FPSA 1ABJH 3Q3KA 3G01A 3MO9A 3LH3A 3KEEA 3LGVA 2Z6BD 4I8LA 3RXJA 1P2MA 1AD8H 1GJDB 5HM9A 3RMLH 4A6LA 2VINA 1LVMA 3BTFE 1C1MA 2BHGA 2CXVA 2ZEBA 1GJAB 1MTSA 2ASUB 3SGBE 1TNJA 4UFDH 1U6QA 3SV2H 2J95A 1T8MA 2GCTC 1TE0A 4K3JA 1QJ6B 3TIUA 4MPVA 1IQJA 1XKAC 2ANYA 1NS3A 3D49H 3M5LA 5EW2H 4X8VH 4CRAA 4E06H 3M61U 1E36B 2Q6DA 1NRNH 4UE7H 3F9EA 3FP6E 1K1PA 1T4UH 5FPTA 1HAGE 3L3TA 3GCTF 3D62A 1MQ6A 1O2JA 1O2UA 4ABAA 2QY0B 1V2ST 1TNKA 3HPTB 4XDEA 3F6UH 1OWIA 2VJ1A 1NROH 2H5CA 2OTVA 1BJUA 1BTWA 1NESE 4MPUA 1A3EH 2HRVA 3SJ8A 1RTFB 1C5ZB 3ZVFA 4LK4A 1QBVH 4NZQA 2D2DA 1PPZA 5TCAA 5PTPA 2P8OC 1ID5H 3R3GB 4WVPE 1DWCH 2HNTE 2Z7FE 4ABDA 3LT3A 1FPCH 4DCDA 1DWEH 2J38A 5J4SA 1TNGA 3RUOA 1ZTJA 2PUXB 5GPIB 1WQVH 4E7RG 2ZU3A 2A32A 4YT7H 1P8VC 1SLXB 3BG4C 4FUGA 1CHOG 2B0FA 1EAIA 5L2YH 1DSUA 3KNXA 4BAQB 1PYTC 1TA2A 1YM0A 1TB6H 3SNDA 4YO9A 4WXVA 2PHBA 2BTCE 2GTBA 4K8BA 3RMNH 2A1DB 3GY4A 1V2JT 3VEQB 1YYY1 1BITA 2BM2A 3PWCA 1KXBA 2W7SA 1AE5A 2ZHDA 2O9QA 8GCHG 1TAWA 2BX4A 2ZQ2A 4X2WA 1CGJE 2JH0D 3FZDA 3SJ9A 1GJ6A 1AZ8A 3PTNA 4NFEA 2O8TA 1NRRH 1RIWC 1MD7A 2GZ9A 1V2RT 1E0FD 4DY7B 2ZCKP 3ATLA 1HXFH 2XW9A 3ELAH 1XXFA 3ESTA 4UFEH 2XBYA 4ASHA 4ZHMU 3KL6A 1JXPA 1T4VH 1CT0E 3GCOA 2OQUA 4TY6A 4X1PU 1DLEA 2ANKH 3V7TA 1VITH 1EATA 2JKHA 1HJAC 2QGRA 2NU2E 1ETSH 1PQ5A 1FN6A 3KF2A 3L33A 3RDZA 1C1UH 1RD3B 3URCA 2Z9GA 1L2EA 2ODPA 3IITA 4BAHB 2LNCA 1DY8A 5L30H 5C20A 4FUEA 2ZFTA 1O5GH 1H8IH 3LJOA 2FYQA 1EJNA 1ELFA 2FI4E 1DDJA 1A0JA 1B0EA 4D7GA 4ISIH 4OGYA 1KXAA 1ZMNA 1XXDA 1ZPZA 1ZTKA 1HAIH 2GT8A 1GHWH 1MTUA 2SNVA 2ZI2H 1WV7H 1IHTH 1OYTH 3SJKA 4CRGA 3GCHC 3B23B 2BD4A 1S6HA 2O8WA 3ZZDA 1OWHA 1IQHA 2YOLA 4LOYH 3EA7A 4OS5A 1YPLH 1O3JA 1SI5H 2ZZUH 2UUJB 3BG8A 2FOBA 2R2WU 2FLRH 1O3AA 3BIVH 2G4TA 3GDUA 4SGAE 1Y3WA 3FFGA 2TPIZ 4AX9H 4FUHA 3U9AH 2JH6D 1VGCB 1BTUA 3S0NA 3SU2A 1G2MA 1RXPA 1FXYA 3M37A 4ZKOU 2J94A 1Y5UT 4Y11E 1QL9A 1EJAA 2ZPQA 1BRBE 2C90B 2I6QA 5A0BA 4UEHH 4WXIA 2PGBB 1GHAG 3QK1A 1T8LA 2BLOA 3LOXA 2I6SA 1XUIA 2GT7A 2CF9H 3M5NA 1A46H 1GBLA 2DE9A 1O5AB 1QCPA 3A82A 1SFQB 1SOZA 3EAJA 1SC8U 4ABFA 3MU5A 3HKJB 3GY5A 4A92A 2PV9B 1P10A 3GY3A 2PFEA 1UHBA 5DP7A 3VPKA 5EU8A 1TABE 1A3BH 1O2NA 2SGFE 2BY8X 3QZRA 4YT6H 5LPRA 3SQHE 3GCNA 2LPRA 1C5OH 1C1RA 2M5TA 4SGBE 2FDAA 1ZGIA 1P3EA 2RA0A 4XE4A 4U2WA 2VIWA 3RXSA 3PB1E 3TVJB 3BN9A 2V35A 2GMTC 1AGJA 2CMYA 1QURH 3NUMA 5JBTA 4CH8B 3QWCH 1IAUA 1BTYA 2A7JA 2ZWLH 3DFJA 4A5TS 1QFKH 1YCPM 2B8OH 3U98H 4O97A 1IQFA 1TRYA 3TNTA 3KQDA 3ZZ7A 2SGQE 5F03A 1FAKH 1QB1A 4B1TA 4ISOA 4K60A 5DP8A 3GDVA 1CBWC 1P9UA 4K69A 1ZPBA 5E0GA 1NPMA 1YGCH 4RN6A 3O8RA 2ZECA 5DJ7A 1NY22 4JZEH 3MTYA 1NU7B 2Y7ZA 1AFQB 3C27B 1KXFA 2G55A 1LDTT 3KHVA 5DPAA 3RXOA 2J4IA 1GHYH 4F49A 1XUFA 2ANMH 2OC0A 3STJA 2BQ6B 2R3YA 1TGCA 1EX3A 3LGYA 4X2XA 3RC4A 2F9BH 1O2XA 4TY7A 1J16A 4X6PA 7KMEH 1M9UA 4B74A 1GI3A 1HJ9A 3SU5A 7GCHG 1UVOA 3PYHA 1G3BA 4JK6A 4FUJA 3S7KB 3OYPA 1EP6A 1PQ8A 1GJ9B 1ZJDA 2ZHFH 3EA8A 1ETRH 3ZZ5A 3TITA 2GZ7A 3PLKA 1QJ1B 2ZDAH 2ZG0H 1LHEH 4H42U 4D9QA 1C2IA 2BDGA 3U69H 2AEIH 2GCTB 4ISLA 4ZH8A 1V2KT 1ACBE 2JETC 1SGNE 2Q6FA 2JH5D 2PSXA 1SGFA 1C1VH 1O3HA 4IN2A 1T7CA 4GAWA 4WY3A 2GVFA 1N8OC 3MHWU 1S83A 1V2MT 1GMCG 2PGQB 2HPPH 4O9VA 2OINA 4Q80A 4B2CA 2C4FH 5BRRE 5TCCA 1GHAF 1ZTLA 3KIDU 3KQCA 4INKA 2AH4X 2FS8A 4ABJA 1BBRE 3A84A 4K8YA 1QQ4A 5E2PA 1PPFE 2OUAA 8ESTE 1W13U 1OWJA 4CBOA 2BZ6H 2FODA 1LHFH 4TYDA 2Z9IA 5EPNA 1CE5A 5IYTA 1FY8E 2P8OB 2PKSB 4CRFA 4BTTB 2TIOA 3RU4T 1VJAU 2A45B 1FY4A 1UTJA 4CH2B 1T31A 1O3MA 1SGFG 3BG4B 3AAVA 1O3NA 1TMUH 2FZZA 3VB5A 3I78A 4AB8A 2QXJA 3MH4A 4WH6A 3MNXA 5E0HA 1ZSJA 2YNBA 3MWIU 2OBQA 2Z94A 5HM2A 3U1JB 4GSOA 1NU9A 1AFEH 4ABBA 1DUEA 5FAHA 1LQDB 5DP6A 2SGAA 3I29A 5DK1A 1FONA 3RU4D 3RXMA 1FMGA 1MQ5A 1RTKA 1YPHC 1BJVA 2H5DA 5F8TA 1AUTC 1KXDA 1MAYA 1Y3UA 4AGKA 1GJ7B 3LGIA 4DURA 4MLFB 4DIHH 1ESBA 2Q1JA 1RIWB 4X1RU 1TGNA 1GBEA 3AASA 1ZMLA 1TX7A 3BTME 1C1SA 1IQGA 1WOFA 1T32A 2A7CA 3GY8A 1C5NH 1AWFH 1EKBB 3URDA 1QJ7B 4JYVH 4NGAH 1LVBA 1O31A 1H9HE 4ZHAA 1QA0A 1QRXA 4AGJA 2AS9A 2FXRA 2W26A 3OTJE 3ENSB 4B73A 5J4QA 2Y5HA 4ABIA 1O3BA 1C5PA 4FU9A 3S69A 1BDAA 2HNTF 1DS2E 1BOQA 3E1XB 4CBNA 4JZFH 4YTAA 1AY6H 5C67A 5DKMA 1GI7B 4THNH 1SGCA 2BB4A 1O3KA 3DUXH 1UK4A 2BYAX 1C5TA 2TGAA 2W3KA 1THSH 1JRTA 1ZOMA 2P3TB 3T5FH 1OWEA 3K6YA 3ZYDA 5ESTE 1YCPK 3SJIA 1CT2E 3MU1A 3BTQE 4Q7ZA 3RXHA 3M35A 1O38A 2IJOB 1D4PB 1DPOA 2FX4A 1O2KA 2C8ZB 1AB9C 4FUBA 1DWDH 3GCHB 1EAWA 1IOEA 3M7UA 4DGJA 1Z6EA 1IQEA 1C2HA 2ZP0H 4K1EA 1KIGH 2VB0A 2WPLS 1EZQA 1MKWH 1C1NA 4HI3A 3PO1C 2ZDNA 3LGWA 1DICA 2BVXH 1JIMA 1A0HB 1GMCF 1Y5AT 3V0XA 1ZR0A 1YPJH 3Q3YA 1YF4A 5A0AE 2NU1E 3FAOA 2C8XB 5EXMA 1F0TA 4Y8ZA 1JWTA 3ZZ3A 1FIZA 3IWMA 1FDPA 4JYTA 1EP5A 2P94A 4HZHA 2ZNKH 2ZGCA 1GI5A 1CGIE 5AFYH 1V2OT 3ZV9A 5A8XA 1DXPA 2CN0H 1RGQA 4IS5A 3KQBA 1AU8A 3AVZA 1YPMH 1C4V2 1WYKA 3P6ZB 1XUKA 4WF8A 1BT7A 5CMXH 4AYYB 2BY7X 2FYRA 1EQ9A 4XBBA 1XMNB 3BTGE 1GMHG 2B7DH 3ZV8A 8LPRA 4YLQH 1FV9A 3MNSA 3TPIZ 2FX6A 2ESTE 5EXNA 4NSVA 5DP5A 1FJSA 4E7NA 1S84A 1O2RA 4B2BA 1EXFA 4ZKSU 1K1NA 3SHAH 1C2MA 1C4U2 1TWXB 2GKVE 1JMOH 3ZVBA 2BX3A 2FOGA 5FPYA 5H4IB 4ZKRU 1RFNA 2QXIA 2QV1A 1LHCH 1YP9A 1EZSC 4MPWA 8KME2 1CSOE 5E8EH 3PTBA 5GCHG 1A7SA 1ZJKA 2UUYA 4D9RA 2WYJA 3MFJA 4Y79A 1HAXB 2XC4A 2C8YB 1NFUA 1HUTH 2TGTA 2ZU5A 3S9BA 3RXGA 2O8LA 1Z8RA 1GGDC 4MG3A 3HGPA 1C2JA 2G8TA 2BD2A 1A61H 1PPCE 2ZHQH 2F3CE 5DP4A 2PW8H 1O5FH 1J17T 3ZZ4A 1HAVB 3K65B 2A5KA 4R0IA 4Y0YE 2BVRH 2TGDA 4IC5A 1CBWB 2BLWA 4B71A 1BMLA 1GBIA 4X6NA 4X1NU 1GJCB 2BD3A 2V3HH 3B8JA 3OSYA 3RXRA 3ZZ8A 1IQIA 1GI4A 2ZTZA 2FOCA 3LPRA 1TBRH 4D7FA 2Y5FA 1TX6A 3UNRA 2OP9A 4RKOB 2ZU2A 2CJIA 3I77A 3B9FH 3FP8E 1Q31A 1TONA 3EQ0H 4GCHG 1GMDF 1C5LH 4I8HA 4TWWA 2H6MA 5T6GA 1C2EA 4MTBA 1MMJN 4FU7A 1VITG 5C1XA 3LIWA 1ANEA 5EQSA 5F6MA 2YNAA 2FIRH 4DJZB 3UQVA 4BTUB 1O34A 1W11U 3RXCA 1JRSA 3RXEA 1W14U 3ATWA 2GDDA 3SU4A 3RXKA 4WJG2 1C1QA 2Z9KA 1BBRK 1GI8B 4X0WU 9ESTA 1UTLM 1N1LA 1UTQA 1ELGA 1OS8A 1X7AC 5CHAC 4AFQA 4OS4A 2F9OA 1P01A 4I7YH 2XC0A 3DFLA 1DANH 2H1UA 4KTSA 1SQTA 3TNSA 1ELAA 5F8ZA 1QQUA 3MMGA 1SGEE 3M36A 3P92A 2JETB 3QUMP 1TFXA 4X1QU 3DT0H 3S9AA 3T26A 2NU0E 3SJOA 2BXUH 4LZ1H 3EDXB 3EYDA 3IG6B 1MAXA 4H6TA 1N8OB 1Y3XA 2XWAA 3A85A 1J8AA 2F9NA 3Q3XA 3SV6A 5FXLA 1VCWA 2ZU1A 1F0UA 1O3FA 2G4UA 5FHTA 6LPRA 4X1SU 4VGCC 4NZLA 3M3VA 3K6ZA 3ZVEA 1BQYA 1SLWB 3GICB 2XYAA 1NTPA 2QA9E 2ZKSA 1GMHF 1BHXB 2FP7B 4HGCA 4Y6DA 1QL7A 1O32A 5DO4H 1KLTA 1TIOA 5C5OA 5HYOA 1L1NA 4NA7A 4H6SB 1V2TT 3MNBA 1SGDE 1LPKB 1RTLA 1P02A 3OU0A 1C5QA 1NM6A 1TX8A 4HFPB 2FESH 9LPRA 4Y71A 1TMBH 5E2OA 2OD3B 4X2VA 1O2QA 5EG4A 5K0HA 1ELTA 1YPGH 2WYGA 5T6FA 1SR5C 4HTCH 1GG6B 4ESTE 1GBDA 5GCHF 1SSXA 2H9TH 1QTFA 3ATMA 1XVMA 3VB7A 1O3EA 5C1YA 3A7ZA 3MU4A 2GZ8A 3PMBB 3CS7A 1ZRKA 2Z9LA 5DP9A 4NA9H 4MNXA 1TNLA 2BXTH 2A4QA 1MCTA 4ABEA 2Y82A 1AI8H 3M5OA 4OGXA 1GBMA 2W7UA 2VH0A 1HIAB 1MU6B 1O3CA 2B5TB 2Z3EA 1VJ9U 4NWKA 3NK8A 1MU8B 2AERH 3RXDA 1O35A 1UTNA 1ZHRA 3R0FA 5FX6A 2AGIX 2SFAA 1HAZB 3PMHB 1G3CA 3TGJE 1P2KA 2XBWA 1O2HA 5EODA 1DUAA 1FQ3A 4XBCA 1AHTH 1G2LA 2FI5E 2HGTH 1ZPCA 1ANBA 4NIVA 3RM0H 2Q6GA 1JIRA 2BLVA 2AYWA 1SFIA 1O5DH 2VGCC 1Z71A 1K2I1 2EI6A 1CHGA 2F9VA 3LGTA 4GCHF 1O2ZA 4GHQA 2BOKA 5JBAS 5GWZA 4BXSA 1PPHE 2ALVA 1EB2A 1MH0A 3UOUA 2BD5A 3LJJA 1EPTC 1CHOF 2IOTA 4I8JA 1VITF 2F9UA 1MKXH 4BOHA 3V13A 1HGTH 2ZGJA 1W7XH 1GWAA 3NPSA 4MQAA 1H4WA 3MI4A 1WSSH 3E0NB 3H7TA 4O3TA 3CENA 1W7GH 3VGCC 1HLTH 3E6PH 1SG8B 1PQ7A 3LONA 4FU8A 1LO6A 3KGPA 1C5UA 2QF3A 1YC0A 8GCHF 1KYNA 2UWPA 4AOQA 2HLCA 2G5NA 1AB9B 1GI6A 2HVXA 3RM2H 5JPMH 1K1JA 2FOFA 3EA9A 3LH1A 1YPHE 5GXPA 3LGUA 2ZTYA 1NZQH 3PO1B 1SGTA 2FS9A 1F7ZA 3GYMA 3HATH 1K1IA 2A0QB 1FLEE 3SNEA 1TQ7B 1OOKB 1Y8TA 2FWWA 5AF9H 4BNRA 5EGMA 1A5GH 5JDUB 5ESBA 2CGAA 1DXWA 1GDNA 1TPSA 3ODFA 1MTNC 1SGQE 2FMJA 1XX9A 2PR3A 2BOHB 4IMQA 1O2PA 2AMPA 1LHDH 1UMAH 1QBOA 4DVAU 1AO5A 1S81A 2H9HA 4BAOB 4MPXA 1A2CH 1FUJA 1HNEE 2Y81A 1GBHA 1GBBA 4AFUA 2K1QA 1HAVA 1C5RA 1QBNA 3CP7A 1BMNH 3RMOH 2QIQA 4NA8A 3ZVAA 1HDTH 5A8ZA 1O36A 1BTXA 2FO9A 2XXLA 2O8UA 3F9FA 1LKBA 2BDHA 1ANDA 2A7HA 1VR1H 3PM3A 4NFFA 1T8NA 1TQ0B 4MNVA 2WPKS 1C2FA 1C1TA 1F92A 4O3UA 3QX5H 3SNBA 1NFXA 3NZIA 4K1TA 2SGDE 1TGSZ 2D26C 1DX5M 3D23A 1OSSA 1O2TA 4INLA 2A2QH 3F9HA 2XBXA 1NRPH 5A09A 1O2LA 4I8KA 1DSTA 1LMWB 6GCHG 1TBZH 1HPGA 1MCVA 4KP0A 1SLVB 4NG9H 3SN8A 2OCVB 1LQEA 2ZA5A 3PWBA 3P8NA 4MNYA 1V6DA 3V12A 1ZYOA 1OPHB 5T3HA 3ZZ6A 5LGOA 1GGDB 2R9PA 4XBDA 3UOPA 1FI8A 5C3NA 1O3LA 4ZKNU 1HAPH 5FX5A 2ZU4A 2J92A 2WPJS 3HKIB 1C5XB 3UPEA 4UONA 2O8MA 2BDYA 3FZZA 2STBE 1YBWA 2RDLA 4FVBA 1P9SA 1NRSH 4NIWA 1Y59T 3TJNA 4A1VA 3A87A 1AE8H 2SGPE 1Z1JA 1G32B 1ESAA 3SNAA 1C1OA 4A7IB 4AFSA 4IBLH 3PLPA 3U8RH 3EBNA 4YOIA 2BY6X 2ZHWH 2SNWA 3N7OA 3RXUA 1SOTA 1RRKA 4DT7B 5B6OA 5FBEA 3T2NA 1P06A 3SUDA 1D9IA 4INHA 1AN1E 1QRWA 2Y80A 2ZTXA 2ZFFH 2OLGA 1GCTC 4RKJB 4PROA 1HAYB 1AUJA 2ZF0H 4I33A 3A83A 1DOJA 1GJ8B 3MYWA 2ZDVH 1F0SA 3DHKH 2BQ7B 1UCYH 3VXEH 4OS2A 1QB9A 7ESTE 1P0SH 1FY3A 3P95A 4ABHA 1AMHA 1BZXE 3QGNB 3SU3A 2WV4A 1HYLA 1W12U 3NCLA 1SMFE 1ARBA 2AGGX 3ZZBA 1ELEE 3BTEE 4OS6A 4AZ2B 1C2KA 2ANWA 4B75A 1SHYA 4CRDA 5FCKA 1DLKB 1ZZZA 4WWYA 3SGQE 2CHAC 2IN2A 5CHAB 1NT1A 2FLBH 3SU0A 1N6XA 5SGAE 2PKAB 2RG3A 1S0RA 1AVXA 5TJXA 2FOAA 4JK5A 1C1PA 2QN5T 3UWJH 1NC6A 1V2WT 5LPFA 2ZO3H 4IN1A 1IQLA 2BY5X 2GGVB 1UTMA 1O3IA 3F9GA 1A4WH 1LHGH 1XKBC 4Y7BA 1LPGB 1QY6A 3A8AA 1KTSB 2ZDLA 1YLCA 4X8UH 3CS0A 4ISNA 1P2NA 3M3SA 1SQAA 2AMDA 3GDSA 3HGNA 2XWBI 1C2DA 2VIDA 1D3DB 3SQEE 2XRCA 3P17H 2OC8A 1O2OA 3GOVB 1BTPA 1CQQA 1HIAA 3RC5A 1GI0A 1ZRBA 3SOSA 1O3DA 3EGKH 1P2IA 1GHZA 1HJAB 1W0ZU 2ZQ1A 4OS7A 1GHVH 1OXGA 1UK2A 3GCTG 1GBJA 2ZFQH 3QLPH 2PTNA 3TK9A 1QA7A 1EAXA 4NSYA 7GCHF 3T27A 1UJ1A 1LVYA 1ESTA 5F8XA 3A7TA 1DFPA 5K7RA 4JZ1A 1EZUC 4Q2KA 2DUCA 1IQKA 1PJPA 5C2ZA 3RP2A 4DW2U 4XFQA 1HV7A 1Q3XA 3RLWH 1TPOA 1MKWK 3ZYEA 4X6MA 1AKSB 4UD9H 4AN7A 2ZFRH 2UUKB 4U32A 3MU8A 3TLOA 1DT2A 2GD4B 3P70B 1S82A 2OC1A 1SPJA 1TRNA 1EAUA 1Y5BT 2G5VA 4I31A 2G51A 1QIXB 2GDEH 4UFFH 1BRAA 4DIIH 5DG6A 2C3SA 1ELBA 3SBKA 2QXGA 1NFYA 4FUFA 1P09A 1ZSKA 1KXCA 3A7XA 3U8TH 2BLQA 1GJ5H 2UWOA 3BEUA 4FUIA 3RXFA 3MNCA 1Z6JH 4A1XA 2BVSH 1QRZA 3BTWE 1HAOH 1CO7E 1BMAA 3AW1A 1EZXC 3SV7A 1SBWA 2EEKA 5FBIA 1C2GA 4GHTA 1PPBH 4X8TH 4ZMAH 4YLUA 1CA0C 1ETTH 3SORA 5A8YA 3SI4H 2H2ZA 1KSNA 4UDWH 5ABWA 4AB9A 2RA3A 3KN2A 4NWLA 2VGCB 2K7XA 1K9OE 3LDXH 4FUDA 1DVAH 5ETXA 2A2XH 3SGAE 3M5MA 1UK3A 2OC7A 1HFDA 3C1KA 1Z7KA 1P3CA 1RS0A 1EPTB 3W95A 5LH8A 2XBVA 1BUIA 3RXLA 3M7TA 3RMMH 1YPKH 1OWDA 1LTOA 2HALA 4TWYA 3Q77A 3H7OA 2ZPSA 4F4OC 1GDUA 4IGDA 4U01A 3AW0A 2EC9H 2VWMA 3ZVCA 1V2VT 2B9LA 4ZROA 3VGCB 2NU4E 1WU1A 1QNJA 3LC3A 3LC5A 2QC2A 1YPEH 3ZZCA 2GMTB 1CGHA 5L2ZH 3ATIA
chains in the Genus database with same CATH superfamily
1C1WH 3F3BA 5DP3A 5C5NA 1ORFA 1OX1A 1SGPE 1QB6A 1KXEA 1LPZB 4Y76A 3DSPA 5DSFA 1UTOA 1QHRB 2G81E 1E38B 1A1RA 4TPIZ 1SGIB 4OM9A 1DM4B 4Z1MD 1F5KU 2W3IA 5G4BA 4TT3D 4CRBA 1O30A 1QL8A 1C5YB 1VZQH 2R0LA 1KMHB 1MTNB 5DGJA 3GY7A 1BHXF 1S85A 4GPGA 4Z6AH 2VVVA 4X8SH 3BTHE 5IDKA 2FTLE 1THRH 2QYIA 3E16B 1C9PA 1O5BB 1P2QA 4RSPA 2F91A 3A8DA 2A4RA 1HBTH 2UUFB 2V7QD 1O2GH 1JBUH 1CU1A 1BRUP 3RXAA 1CA8B 4B2AA 4JMYA 4Y7AA 3SU1A 2A4GA 4TPYA 1EB1H 4K5ZA 3RXIA 1GBFA 1YWUA 2RCEA 2VIOA 3S7HB 3BEIB 2BD9A 1KDQB 3ITIA 1WXRA 3M7QA 2PKSC 1BIOA 4Q7YA 4IW4E 1Y3VA 1HXEH 3RU4E 3A8BA 4FOUC 2AFQB 1Q2WA 2XCFA 2FTMA 3MU0A 1BRCE 3SHCH 1D6RA 4ZAEA 1TRMA 1B7XB 1O2MA 2VWOA 4O03A 2BQWB 1E79D 1K28D 3SNCA 2P3FH 2FM2A 4U30A 4YOGA 3QO6A 4IC6A 2P95A 2BMGB 2VWLA 1J15A 1UCYE 1OWKA 1TPAE 1XUJA 4NCYA 2VH6A 2W5EA 1O2VA 1TBQH 5EQQA 3OTPA 1OHHD 1S6FA 2VVCA 5T6DA 1G30B 4ZCNA 3A7YA 1Z8JB 5GNDA 5JYIA 1NN6A 2XNIA 3UWIA 3BIUH 2P16A 4FETA 3RXVA 1LCYA 6ESTA 1BCUH 2F4LA 2PKAA 4BXWA 1BBRH 2YMSD 4AORA 1PFXC 4ISHH 2HOBA 3FVFB 1O2WA 4CHAC 5T1VA 5HMAA 3TGIE 1XM1A 3DSOA 3KQEA 4KKDA 4XSKU 1DITH 1EOJA 2OBOA 1HJ8A 1ANCA 2R0KA 4R8TB 1N6YA 2VIPA 2P3UB 1LKAA 3GY6A 2DE8A 3KCGH 1S6LA 2VVUA 1BTZA 3S9CA 1O3GA 4CRCA 2J98B 2IPHA 4UFGH 1K22H 1EFRD 3ATKA 4CR5A 1P57B 1J14A 1GCTB 1YKTA 2LELA 1L1JA 2ZGBH 3TK6A 1UO6A 1SGYE 1ZSLA 1B5GH 2D8WA 3UQOA 1FAXA 1F5RA 1LVOA 3RXBA 5JB9S 3BTKE 7LPRA 2VBCA 4QT8C 1GVLA 3PRBA 3ZZ9A 1O3PB 1ELCA 4JYUH 2THFB 1P11E 3BTDE 2CHAB 1ELDE 1AKSA 1FZZA 1EJMA 2CV3A 4YOJA 2KCOA 3OY6U 3BEFB 3JZ1B 3GYLB 1ZHPA 1L0ZA 1G37A 4D76A 2KR7A 3TJUA 1T8OA 3P8OA 1O2SA 1IQNA 2PSYA 1F5LA 4NIYA 5BPEA 4Y8YA 4X6OA 5C94A 6CHAC 1GJBB 2AIPA 3K2UA 1FNIA 2BDIA 2ZFSA 1P03A 3SV8A 1W0YH 2FEQH 3RLYH 2ZDMA 4AFZA 1MKXK 3Q76A 1E35B 5GIBA 2GCHG 2WPHS 5EIYA 2D1JA 3U8OH 3UTUH 3Q00A 3MH5A 3F1SB 4B76A 3RXTA 3ODDA 4YM9A 5EQRA 5AHGH 1P12E 1XUHA 2VU8E 2J9NA 4YZUA 1ZMJA 1C5MD 4Q63A 4J2YB 3BF6H 1DWBH 1CT4E 2XCNA 3MQKC 4ZXYH 3TGKE 1MBQA 2PTCE 2J34A 4I8GA 4KTCA 1W3CA 1E34B 4ABGA 2ULLA 4KTUA 1FY5A 2J2UA 2WUCA 3A8CA 1O39A 1TNHA 2HNTC 2EI7A 1OP2A 3FANA 1YLNA 2BD7A 1P2OA 4LZ4B 5LPEA 2R3UA 5EXLA 4CREA 3QZQA 1OP0A 1BB0B 2BZAA 1D3QB 1C2LA 1EPTA 1MTVA 3FP7E 4Y10E 4MNWA 2EA3A 1GBCA 2ZCHP 1GJ4H 1AZZA 1B0FA 4NIXA 2BY9X 1SLUB 1V2NT 1WQSA 3SUGA 1QR3E 1QGFA 2VWNA 1PYTD 3E3TA 1O5EH 1S0QA 4Q7XA 4WH8A 1K1LA 4JZIA 1K1OA 2Z3CA 4KELA 2V6NA 3TH4H 3PROA 5C0TA 1V2LT 3JZ2B 2QAAA 3SUFA 1ABIH 4BAMB 1DE7H 2KAIB 4ZUHA 1CA0B 2FI3E 5L6NH 2TRMA 2FOMB 1IQMA 3UREA 3GY2A 1NRQH 1FY1A 1O5CB 3E8LA 4AG2A 3ZVGA 2HWLB 5JB8S 1ZLRA 2UWLA 3HK6B 1KLIH 3PLBA 3DA9B 4DG4A 2ZGXH 3UR6A 4GVUA 1MZAA 2P59A 3SV9A 3SZNA 3BSQA 3TU7H 2TGPZ 3O8CA 3UUZA 1D3PB 1O0DH 1F2SE 2AIQA 5JBBS 3A88A 1GHBG 1SL3A 1MD8A 1Z8GA 1L4ZA 4B6EA 2Y7XA 1OP8A 2RFKC 1TNIA 2PUQH 1TPPA 2Z9JA 3M3TA 1TLDA 1YLDA 2EI8A 1BTHH 5KEDA 1SGRE 4BAKB 4WMDA 2STAE 3AAUA 1A5HA 1TALA 3A7WA 4JZDH 1O33A 1GDQA 1PQAA 1SHHB 2ODYB 4GLYA 4Y8XA 5HGGA 1D6WA 5HXFA 1P05A 1HAHH 2H9EH 2OXSA 1V2PT 3O8BA 1L4DA 2XTTB 1KDQA 5EPYA 1W2KH 2GP9B 4JCNA 3SO3A 1MUEB 1D3TB 4MVNA 5CE1A 3TH3H 1DY9A 3E91A 3PMJA 1GBKA 2ALPA 3W94A 2A31A 2C8WB 1ZHMA 2WV5A 1UVTH 1G9IE 1WBGB 4WMEA 3HK3B 3VXFH 1EOLA 2OQ5A 5IK2D 5AFZH 5A2MH 4AG1A 1S5SA 1EUFA 4MDSA 1MBMA 1VCQA 2ILNA 3QTVH 2GCHF 3A80A 1W10U 1VCPA 1BA8B 1A0LA 2NWNA 2ZDKA 3SW2B 1FIWA 3NKKA 3VB4A 1G3EA 3H5CB 4WMFA 4TSFD 4E05H 1UVSH 3A86A 2F83A 2ZHEH 2BDAA 3UR9A 3E90B 1V2UT 2VIQA 1UCYK 1GI1A 5FCRA 1CVWH 3WY8A 1UTPA 3MO3A 4Y0ZE 1WTHD 4GUXA 5C1UA 1IHSH 1Z1IA 1V2QT 1OKXA 1GPZA 1C5VA 2GV7A 5GJ4B 3N99A 1HCGA 1NFWA 5I25A 3DD2H 1G36A 1GI9B 1Z8IB 2WINI 2FOEA 1TMTH 2BDCA 1MTWA 4OS1A 1E1QD 1GBAA 2WPIS 1PPGE 1BMMH 1MZDA 2CF8H 1K21H 1GBTA 2BD8A 3VFEA 1GG6C 2J98A 1F0RA 1WUNH 3STIA 3A81A 2Y5GA 3A89A 3E0PB 2ODQA 4RT0A 2QXHA 2FOHA 2QF0A 5AVDA 2WPMS 2EY4C 2HPQH 5EOKA 2R2MB 4A1TA 2ZFPH 2V3OH 1GL1A 3SUEA 3QTOH 2LIZA 1RJXB 1UTKA 2IPQX 4M9FA 3F2GA 1TGBA 1H9LB 1AWHB 2F9PA 4FUCA 3SU6A 2G00A 1H8DH 1H9IE 1C5SA 1TOCB 3BTTE 3P8FA 4FXGH 1J9CH 2C93B 4IMZA 1FN8A 3NWUA 1KLJH 1VGCC 1AVGH 5GDSH 1P2JA 2Y6TA 1FPHH 3PMAB 3UY9A 5EW1H 1SVPA 1THPB 2PLXA 4VGCB 3O8DA 4CHAB 1INCA 1ARCA 4LXBH 1EASA 2KM0A 4KGAA 3VB3A 3RXQA 3EE0B 1GI2A 1OYQA 1WCZA 1GVKB 2VIVA 2GJGA 1Y3YA 4I32A 2A4OA 1K1MA 4ZXXH 3D65E 1E37B 1NO9H 2P93A 2ZC9H 3K9XB 1GHBF 3PV4A 3LU9B 1UVUH 2AMQA 1COWD 4YESB 3T62A 1TOMH 2Z3DA 3TH2H 1A5IA 4J1YA 1KY9A 5I46H 2FPZA 3L6PA 4ZHLU 1ELVA 1PPEE 4XOJA 3SZEA 3TJOA 1AVWA 4H4FA 2ZCLP 2WUBA 3QN7A 3BV9B 1WTGH 1TYNA 1UVPA 2PWXA 3V3MA 1GMDG 3GISB 5JBCS 1XVOA 6GCHF 4BTIB 3LKWA 3VB6A 1L1GA 1SB1H 3QDZB 3TK5A 2VNTA 4M7GA 1P04A 2AGEX 1H1BA 3SI3H 2ZPRA 2XC5A 1GCDA 2ZGHA 3ZZAA 1AIXH 4K2YA 1QZ8A 5E0JA 3GS9A 3RXPA 2YMSC 1O37A 4FVDA 3NXPA 4CR9A 2TBSA 1GL0E 1O3OA 1YCPH 4K1SA 2GV6A 3MH7A 3UNQA 1TA6A 2G52A 1ZGVA 2NU3E 1O2YA 3OX7U 6CHAB 1GHXH 3QGJA 3T25A 4AYVB 1WAYB 3UNSA 1C4Y2 1SQOA 2A5IA 2GX4A 2XNDD 3T29A 4DOQA 1AQ7A 3ZVDA 2QCYA 1GVZA 1G3DA 1HB0B 1XUGA 1JOUB 1HRTH 5A0CA 4Z0KA 3TJVA 4I86A 2SGEE 1AFQC 1UHBB 1FX0B 2ZIQH 3MO6A 3P8GA 3UFAA 1C9TA 2BDBA 3F68H 2V0BA 1TGTA 3RC6A 3OY5U 3MOCA 3U1IB 4BANB 2A5AA 1V3XA 4D8NA 2KAIA 1O2IA 3A7VA 3MH6A 1KTTB 1C5WB 4X2YA 3T28A 3UIRA 1W8BH 5FPSA 1ABJH 3Q3KA 3G01A 3MO9A 3LH3A 3KEEA 3LGVA 2Z6BD 4I8LA 3RXJA 1P2MA 1AD8H 1GJDB 5HM9A 3RMLH 4A6LA 2VINA 3PV2A 1LVMA 3BTFE 1C1MA 2BHGA 2CXVA 2ZEBA 1GJAB 1MTSA 2ASUB 3SGBE 1TNJA 4UFDH 1U6QA 3SV2H 2J95A 1T8MA 2GCTC 1TE0A 4K3JA 1QJ6B 3TIUA 4MPVA 1IQJA 2KCPA 1XKAC 2ANYA 1NS3A 3D49H 3M5LA 5EW2H 4X8VH 4CRAA 4E06H 3M61U 1E36B 2Q6DA 1NRNH 4UE7H 3F9EA 3FP6E 3DCLA 1K1PA 1T4UH 5FPTA 1HAGE 3L3TA 3GCTF 3D62A 1MQ6A 1O2JA 1O2UA 4ABAA 2QY0B 1H8HD 1V2ST 1TNKA 3HPTB 4XDEA 3F6UH 1OWIA 2VJ1A 1NROH 2H5CA 2K0QA 2OTVA 1BJUA 1BTWA 1NESE 2JIZD 4MPUA 1A3EH 2HRVA 1MABB 3SJ8A 1RTFB 1C5ZB 3ZVFA 4LK4A 1QBVH 4NZQA 2D2DA 1PPZA 5TCAA 3OE7D 5PTPA 2P8OC 1ID5H 3R3GB 4WVPE 1DWCH 2HNTE 2Z7FE 4ABDA 3LT3A 1FPCH 4DCDA 1DWEH 2J38A 5J4SA 1TNGA 3RUOA 1ZTJA 2PUXB 5GPIB 1WQVH 2HLDD 4E7RG 2ZU3A 2A32A 4YT7H 1P8VC 1SLXB 3BG4C 4FUGA 1CHOG 2B0FA 2LP6A 1EAIA 5L2YH 1DSUA 3KNXA 4F48B 4BAQB 1PYTC 1TA2A 1YM0A 1TB6H 3SNDA 4YO9A 1UW7A 4WXVA 2PHBA 2BTCE 2GTBA 4K8BA 3RMNH 3H09A 2A1DB 3GY4A 1V2JT 3VEQB 1YYY1 1BITA 2BM2A 3PWCA 1KXBA 2W7SA 1AE5A 2ZHDA 2O9QA 8GCHG 3WWBA 1TAWA 2BX4A 2ZQ2A 4X2WA 1CGJE 2JH0D 3FZDA 3SJ9A 1GJ6A 1AZ8A 3PTNA 4NFEA 2O8TA 1NRRH 1RIWC 1MD7A 2GZ9A 1V2RT 1E0FD 4DY7B 2ZCKP 3ATLA 1HXFH 2XW9A 3ELAH 1XXFA 3ESTA 4UFEH 2XBYA 4ASHA 4ZHMU 3KL6A 1JXPA 1T4VH 1CT0E 2CK3D 3GCOA 2OQUA 4TY6A 4X1PU 1DLEA 2ANKH 3V7TA 1VITH 1EATA 2JKHA 1HJAC 2QGRA 2NU2E 1ETSH 1PQ5A 1FN6A 3KF2A 3L33A 3RDZA 1C1UH 1RD3B 3URCA 2Z9GA 1L2EA 2ODPA 3IITA 4BAHB 2LNCA 1DY8A 5L30H 5C20A 4FUEA 2ZFTA 1O5GH 1H8IH 3LJOA 2FYQA 1EJNA 1ELFA 2FI4E 1DDJA 1A0JA 1B0EA 4D7GA 4ISIH 4OGYA 1KXAA 1ZMNA 1XXDA 1ZPZA 1SKYE 1ZTKA 1HAIH 2GT8A 1GHWH 1MTUA 2SNVA 2ZI2H 1WV7H 1IHTH 1OYTH 3SJKA 4CRGA 3F0OA 3GCHC 3B23B 2BD4A 1S6HA 2O8WA 3ZZDA 1OWHA 1IQHA 2YOLA 4LOYH 3EA7A 4OS5A 1YPLH 1O3JA 1SI5H 2ZZUH 2UUJB 3BG8A 2FOBA 2R2WU 2FLRH 1O3AA 3BIVH 2G4TA 3GDUA 4SGAE 1Y3WA 3FFGA 2TPIZ 4AX9H 4FUHA 3U9AH 2JH6D 1VGCB 1BTUA 3S0NA 3SU2A 1G2MA 1RXPA 1FXYA 3M37A 4ZKOU 2J94A 1Y5UT 5KGOA 4Y11E 1QL9A 1EJAA 2ZPQA 1BRBE 2C90B 2I6QA 5A0BA 4XRNA 4UEHH 4WXIA 2PGBB 1GHAG 3QK1A 1T8LA 2BLOA 3LOXA 2I6SA 1XUIA 2GT7A 2CF9H 3M5NA 1A46H 1GBLA 2DE9A 1O5AB 1QCPA 3A82A 1SFQB 1SOZA 5HIZA 3EAJA 1SC8U 4ABFA 3MU5A 3HKJB 3GY5A 4A92A 2PV9B 1P10A 3GY3A 2PFEA 1UHBA 5DP7A 3VPKA 5EU8A 1TABE 1A3BH 1O2NA 2SGFE 2BY8X 3QZRA 4YT6H 5LPRA 3SQHE 3GCNA 2XOKD 2LPRA 1C5OH 1C1RA 2M5TA 4SGBE 2FDAA 1ZGIA 1P3EA 2RA0A 4XE4A 4U2WA 2VIWA 3RXSA 3PB1E 3TVJB 3BN9A 2V35A 2GMTC 1AGJA 2CMYA 1QURH 3NUMA 5JBTA 4CH8B 3QWCH 1IAUA 2J97A 1BTYA 2A7JA 2ZWLH 3DFJA 3ZIAD 1QFKH 2YMSB 4A5TS 1YCPM 2B8OH 3WWFA 3U98H 4O97A 1IQFA 1TRYA 3TNTA 3KQDA 3ZZ7A 2SGQE 5F03A 1FAKH 1QB1A 4B1TA 4ISOA 4K60A 5DP8A 3GDVA 1CBWC 1P9UA 4K69A 1ZPBA 5E0GA 1NPMA 1YGCH 4RN6A 3O8RA 2ZECA 5DJ7A 1NY22 4JZEH 3MTYA 1NU7B 2Y7ZA 1AFQB 3C27B 1KXFA 2G55A 1LDTT 3KHVA 5DPAA 3RXOA 2J4IA 1GHYH 4F49A 1XUFA 2AHME 2ANMH 2OC0A 3STJA 2BQ6B 2R3YA 1TGCA 1EX3A 3LGYA 4X2XA 3RC4A 3OEHD 2F9BH 1O2XA 4TY7A 1J16A 4X6PA 7KMEH 1M9UA 5C17A 3WW7A 4B74A 1GI3A 1HJ9A 2WZQA 5CHBA 3SU5A 7GCHG 1UVOA 3PYHA 1G3BA 4JK6A 4FUJA 4ACBA 3S7KB 3OYPA 1EP6A 1NBMD 1PQ8A 1GJ9B 1ZJDA 2ZHFH 3EA8A 1ETRH 3ZZ5A 3TITA 2GZ7A 3PLKA 3UAIC 1QJ1B 2QF5A 2ZDAH 2ZG0H 1LHEH 4H42U 4D9QA 1C2IA 2BDGA 3U69H 2AEIH 2GCTB 4ISLA 4ZH8A 1V2KT 1ACBE 2JETC 1SGNE 2Q6FA 2JH5D 2PSXA 1SGFA 1C1VH 1O3HA 5HKKD 4IN2A 1T7CA 4GAWA 4WY3A 2GVFA 1N8OC 3MHWU 1S83A 1V2MT 1GMCG 2PGQB 2HPPH 4O9VA 2OINA 4Q80A 4B2CA 2C4FH 5BRRE 5TCCA 1GHAF 1ZTLA 3KIDU 3KQCA 4INKA 2AH4X 2FS8A 3EE7A 4ABJA 1BBRE 3A84A 4K8YA 1QQ4A 5E2PA 1PPFE 2KFWA 2OUAA 8ESTE 1W13U 2W6ID 1OWJA 4CBOA 2BZ6H 2FODA 1LHFH 4TYDA 2Z9IA 5EPNA 5EJZA 1CE5A 5IYTA 1FY8E 2P8OB 2PKSB 4CRFA 4BTTB 2TIOA 3RU4T 1VJAU 2A45B 1FY4A 5F53A 1UTJA 4Q4LA 4CH2B 1T31A 1O3MA 1SGFG 3BG4B 3AAVA 1O3NA 1TMUH 2FZZA 3VB5A 3I78A 4AB8A 2QXJA 3MH4A 4WH6A 3MNXA 5E0HA 1ZSJA 2YNBA 3MWIU 2OBQA 2Z94A 1WDIA 5HM2A 3U1JB 4GSOA 1NU9A 1AFEH 4ABBA 1DUEA 5FAHA 1LQDB 5DP6A 2SGAA 2JJ1D 3I29A 5DK1A 1BMFD 1FONA 2QF4A 3N7EA 3RU4D 3RXMA 1FMGA 1MQ5A 1RTKA 1YPHC 1BJVA 2H5DA 5F8TA 1AUTC 1KXDA 1MAYA 1Y3UA 3OEED 4AGKA 1GJ7B 3LGIA 4DURA 4MLFB 4DIHH 1ESBA 2Q1JA 1RIWB 3PV5A 4X1RU 1TGNA 1GBEA 3AASA 1ZMLA 1TX7A 3BTME 1C1SA 1IQGA 1WOFA 1T32A 2A7CA 3GY8A 1C5NH 1AWFH 1EKBB 3URDA 1QJ7B 4JYVH 4NGAH 1LVBA 1O31A 1H9HE 2M2AA 4ZHAA 3KQ5A 1QA0A 1QRXA 4AGJA 2AS9A 2FXRA 2W26A 3OTJE 3ENSB 4B73A 5J4QA 2Y5HA 4ABIA 1O3BA 1C5PA 4FU9A 3S69A 1BDAA 2HNTF 1DS2E 1BOQA 3E1XB 4CBNA 5B6LA 4JZFH 4YTAA 1AY6H 5C67A 5DKMA 1GI7B 4THNH 1SGCA 2BB4A 1O3KA 3DUXH 1UK4A 2BYAX 1C5TA 2TGAA 2W3KA 1THSH 1JRTA 1ZOMA 2P3TB 3T5FH 1OWEA 3K6YA 3ZYDA 5ESTE 1YCPK 3SJIA 1CT2E 3MU1A 3BTQE 4Q7ZA 3RXHA 3M35A 1O38A 2IJOB 1D4PB 1DPOA 2FX4A 1O2KA 2C8ZB 1AB9C 4FUBA 1DWDH 3GCHB 1EAWA 1IOEA 3M7UA 4DGJA 1Z6EA 5KECA 1IQEA 1C2HA 2ZP0H 4K1EA 1KIGH 2VB0A 2WPLS 1EZQA 1MKWH 1C1NA 4HI3A 3PO1C 2ZDNA 3LGWA 1DICA 2BVXH 1JIMA 1A0HB 1GMCF 1Y5AT 3V0XA 1ZR0A 1YPJH 3Q3YA 1K0HA 1YF4A 5A0AE 2NU1E 3FAOA 2C8XB 5EXMA 1F0TA 4Y8ZA 1JWTA 3ZZ3A 1FIZA 3IWMA 1FDPA 2KX4A 4JYTA 1EP5A 2P94A 4HZHA 2ZNKH 2ZGCA 1GI5A 1CGIE 5AFYH 1V2OT 3ZV9A 5A8XA 1DXPA 2CN0H 1RGQA 4IS5A 3KQBA 1AU8A 3AVZA 1YPMH 1C4V2 1WYKA 3P6ZB 2JJ2D 1XUKA 4WF8A 1BT7A 5CMXH 4AYYB 2BY7X 2FYRA 1EQ9A 4XBBA 1XMNB 3BTGE 1GMHG 2B7DH 3ZV8A 8LPRA 4YLQH 1FV9A 3MNSA 3NRLA 3TPIZ 2FX6A 2ESTE 5EXNA 4NSVA 5DP5A 1FJSA 5HIYA 4E7NA 1S84A 1O2RA 4B2BA 1EXFA 3PRDA 4ZKSU 1K1NA 3SHAH 1C2MA 1C4U2 1TWXB 2GKVE 1JMOH 3ZVBA 2BX3A 2FOGA 5FPYA 5H4IB 4ZKRU 1RFNA 2QXIA 2QV1A 1LHCH 1YP9A 1EZSC 4MPWA 8KME2 1CSOE 5E8EH 3PTBA 5GCHG 1A7SA 1ZJKA 2UUYA 4D9RA 2WYJA 3MFJA 4Y79A 1HAXB 2XC4A 2C8YB 1NFUA 1HUTH 2TGTA 2ZU5A 3S9BA 3OAAD 3RXGA 2O8LA 3AK5A 1Z8RA 1GGDC 4MG3A 3HGPA 1C2JA 2G8TA 2BD2A 1A61H 1PPCE 2ZHQH 2F3CE 2KCYA 5DP4A 2PW8H 1O5FH 1J17T 3ZZ4A 1HAVB 3K65B 2A5KA 4R0IA 4Y0YE 2BVRH 2TGDA 4IC5A 1CBWB 2BLWA 4B71A 1BMLA 1GBIA 4X6NA 5DN6D 4X1NU 1W0KD 1GJCB 2BD3A 2V3HH 3B8JA 3OSYA 3RXRA 3ZZ8A 1IQIA 1GI4A 2ZTZA 2FOCA 3LPRA 1TBRH 4D7FA 2Y5FA 1TX6A 3W1EA 3UNRA 2OP9A 4RKOB 2ZU2A 2CJIA 3I77A 3B9FH 3FP8E 5EJ1A 1Q31A 1TONA 3EQ0H 4GCHG 1GMDF 1C5LH 4I8HA 4TWWA 3U28C 2H6MA 5T6GA 1C2EA 4MTBA 1MMJN 4FU7A 1VITG 3F2HA 5C1XA 3LIWA 1ANEA 5EQSA 4P00A 5F6MA 2YNAA 2FIRH 4DJZB 3UQVA 4BTUB 1O34A 1W11U 3RXCA 1JRSA 3RXEA 1W14U 3ATWA 2GDDA 3SU4A 3RXKA 4WJG2 1C1QA 2Z9KA 1BBRK 1GI8B 1VKYA 4X0WU 9ESTA 1UTLM 1N1LA 1UTQA 1ELGA 1OS8A 1X7AC 5CHAC 4AFQA 4OS4A 2F9OA 1P01A 4I7YH 2XC0A 3DFLA 1DANH 2H1UA 4KTSA 1SQTA 3TNSA 1ELAA 5F8ZA 1QQUA 3MMGA 1SGEE 3M36A 3P92A 2JETB 3QUMP 1TFXA 4X1QU 3DT0H 2W6JD 3S9AA 3T26A 2NU0E 3SJOA 2BXUH 3N7DA 4LZ1H 3EDXB 3EYDA 3IG6B 1MAXA 4H6TA 1N8OB 1Y3XA 2XWAA 5C0UA 3A85A 4ASUD 1J8AA 2F9NA 3Q3XA 3SV6A 5FXLA 1VCWA 2ZU1A 1F0UA 1O3FA 2G4UA 5FHTA 6LPRA 4X1SU 4VGCC 1E1RD 4NZLA 3M3VA 3K6ZA 3ZVEA 1BQYA 1SLWB 3GICB 2XYAA 1NTPA 2QA9E 2ZKSA 4RI0A 1GMHF 2WPDD 1BHXB 2FP7B 4HGCA 4Y6DA 1QL7A 1O32A 5DO4H 1KLTA 1TIOA 5C5OA 5HYOA 1L1NA 4NA7A 4H6SB 1V2TT 3MNBA 1SGDE 1LPKB 1RTLA 1P02A 3OU0A 2OK5A 1C5QA 1NM6A 1TX8A 4HFPB 2FESH 9LPRA 4Y71A 1TMBH 5CDFE 5E2OA 2OD3B 4X2VA 1O2QA 5EG4A 5K0HA 1ELTA 1YPGH 2WYGA 5T6FA 1SR5C 4HTCH 1GG6B 4ESTE 1GBDA 5GCHF 1SSXA 2H9TH 1QTFA 3ATMA 1XVMA 3VB7A 1O3EA 5C1YA 3A7ZA 1W0JD 2GZ8A 3MU4A 4HG6A 2V3MA 3PMBB 3CS7A 1ZRKA 2Z9LA 5DP9A 4NA9H 4MNXA 1TNLA 2BXTH 2A4QA 1MCTA 4ABEA 2Y82A 1AI8H 3M5OA 4OGXA 1GBMA 2W7UA 2VH0A 1HIAB 1MU6B 1O3CA 2B5TB 2Z3EA 1VJ9U 4NWKA 3NK8A 4DT4A 1MU8B 2AERH 3RXDA 1O35A 1UTNA 1ZHRA 3R0FA 5FX6A 2AGIX 2SFAA 1HAZB 3PMHB 1G3CA 3TGJE 1P2KA 2XBWA 1O2HA 5EODA 1DUAA 1FQ3A 4XBCA 1AHTH 1G2LA 2FI5E 2HGTH 1ZPCA 1ANBA 4NIVA 3RM0H 2Q6GA 1JIRA 2BLVA 2RDEA 2AYWA 1SFIA 1O5DH 2VGCC 1Z71A 1K2I1 2EI6A 1CHGA 2F9VA 3LGTA 4GCHF 1O2ZA 4GHQA 2BOKA 5JBAS 5GWZA 4BXSA 1PPHE 3CNRA 2ALVA 1EB2A 1MH0A 3UOUA 2BD5A 3LJJA 1EPTC 1CHOF 2IOTA 4I8JA 2L6OA 1VITF 2F9UA 1MKXH 4BOHA 3V13A 1HGTH 2ZGJA 1W7XH 1GWAA 3NPSA 3FO8D 4MQAA 1H4WA 3MI4A 1WSSH 3E0NB 3H7TA 4O3TA 3CENA 3KYGA 1W7GH 3VGCC 1HLTH 3E6PH 1SG8B 1PQ7A 3LONA 4FU8A 1LO6A 4YXWD 3KGPA 1C5UA 2QF3A 1SQRA 1YC0A 8GCHF 1KYNA 2UWPA 4AOQA 2HLCA 2G5NA 1AB9B 1GI6A 2HVXA 3RM2H 5JPMH 1K1JA 2FOFA 3EA9A 3LH1A 1YPHE 5GXPA 3LGUA 2ZTYA 1NZQH 3PO1B 1SGTA 2FS9A 1F7ZA 3GYMA 3HATH 1K1IA 2A0QB 1FLEE 3SNEA 1TQ7B 1OOKB 1Y8TA 2FWWA 5AF9H 4BNRA 5EGMA 1A5GH 5JDUB 5ESBA 2CGAA 1DXWA 1GDNA 1H8ED 2WSSD 1TPSA 4P02A 3ODFA 1MTNC 1SGQE 2FMJA 1XX9A 2PR3A 2BOHB 4IMQA 1O2PA 2AMPA 1LHDH 1UMAH 1QBOA 4DVAU 1AO5A 1S81A 2H9HA 4BAOB 4MPXA 1A2CH 1FUJA 1HNEE 2Y81A 1GBHA 1GBBA 2KZ4A 4AFUA 2K1QA 1HAVA 1C5RA 1QBNA 3CP7A 1BMNH 3RMOH 2QIQA 4NA8A 3ZVAA 1HDTH 3F2FA 5A8ZA 1O36A 1BTXA 2FO9A 2XXLA 2O8UA 3F9FA 1LKBA 2BDHA 1ANDA 2A7HA 1VR1H 3PM3A 4NFFA 1T8NA 1TQ0B 4MNVA 2WPKS 1C2FA 1C1TA 1F92A 4O3UA 3QX5H 3SNBA 1NFXA 3NZIA 4K1TA 2SGDE 1TGSZ 2D26C 3FN8A 1DX5M 3D23A 1OSSA 1O2TA 4INLA 2A2QH 2JDID 4B6FA 3F9HA 2XBXA 1NRPH 5A09A 1O2LA 4I8KA 1DSTA 1LMWB 6GCHG 1TBZH 1HPGA 1MCVA 4KP0A 1SLVB 4NG9H 3SN8A 2OCVB 2WV9A 1LQEA 2ZA5A 3PWBA 3P8NA 4MNYA 1V6DA 3V12A 1ZYOA 1OPHB 5T3HA 3ZZ6A 5LGOA 1GGDB 2R9PA 4XBDA 3UOPA 1FI8A 5C3NA 1O3LA 4ZKNU 1HAPH 5FX5A 2ZU4A 2J92A 4F55A 2WPJS 3HKIB 1C5XB 3UPEA 4UONA 2O8MA 2BDYA 3FZZA 2STBE 1YBWA 2RDLA 4FVBA 1P9SA 1NRSH 4NIWA 1Y59T 3TJNA 4A1VA 3A87A 1AE8H 2SGPE 1Z1JA 1G32B 1ESAA 3SNAA 3FOAA 1C1OA 4A7IB 4AFSA 4IBLH 3PLPA 3U8RH 3EBNA 4YOIA 2BY6X 2ZHWH 2SNWA 3N7OA 3RXUA 1SOTA 1RRKA 4DT7B 5B6OA 5FBEA 3T2NA 1P06A 3SUDA 2IJD1 1D9IA 4INHA 4XD7D 1AN1E 1QRWA 2Y80A 2HVYB 2ZTXA 2ZFFH 2OLGA 1GCTC 4RKJB 4PROA 1HAYB 1AUJA 2ZF0H 4I33A 3A83A 3UB0A 1DOJA 1GJ8B 3MYWA 2ZDVH 1F0SA 3DHKH 2BQ7B 1UCYH 3VXEH 4OS2A 1QB9A 7ESTE 1P0SH 1FY3A 3P95A 4ABHA 1AMHA 1BZXE 3QGNB 3SU3A 2WV4A 1HYLA 1W12U 3NCLA 1SMFE 1ARBA 2AGGX 3ZZBA 1ELEE 3BTEE 4OS6A 4AZ2B 1C2KA 2ANWA 4B75A 1SHYA 4CRDA 5FCKA 1DLKB 1ZZZA 4WWYA 3SGQE 2CHAC 2F43B 1YY3A 2IN2A 5CHAB 1NT1A 2FLBH 3SU0A 1N6XA 2K8IA 5SGAE 2PKAB 2RG3A 1S0RA 1AVXA 5TJXA 2FOAA 4JK5A 1C1PA 2QN5T 3UWJH 1NC6A 1V2WT 5LPFA 2ZO3H 4IN1A 1IQLA 2BY5X 1UTMA 2GGVB 1O3IA 3F9GA 1A4WH 1LHGH 1XKBC 4Y7BA 2KCAA 1LPGB 1QY6A 3A8AA 1KTSB 2ZDLA 1YLCA 4X8UH 3CS0A 4ISNA 1P2NA 3M3SA 1SQAA 2AMDA 3GDSA 2QE7D 3HGNA 2XWBI 1C2DA 2VIDA 1D3DB 4RT1A 3SQEE 2XRCA 3P17H 2OC8A 1O2OA 3GOVB 1BTPA 1CQQA 1HIAA 3RC5A 1GI0A 1ZRBA 3SOSA 1O3DA 3EGKH 1P2IA 1GHZA 1HJAB 1W0ZU 2ZQ1A 4OS7A 1GHVH 1OXGA 1UK2A 3GCTG 1GBJA 2ZFQH 3QLPH 2PTNA 3TK9A 1QA7A 1EAXA 4NSYA 7GCHF 3T27A 1UJ1A 1LVYA 5FL7D 1ESTA 5F8XA 3A7TA 1DFPA 5K7RA 4JZ1A 1EZUC 4Q2KA 2DUCA 1IQKA 1PJPA 4AC9A 3RP2A 4DW2U 5C2ZA 4XFQA 1HV7A 1Q3XA 3RLWH 1TPOA 1MKWK 3ZYEA 4X6MA 1AKSB 4UD9H 4AN7A 2ZFRH 2UUKB 3OFND 4U32A 3SYJA 3MU8A 3TLOA 2L74A 1DT2A 2GD4B 3P70B 1S82A 2OC1A 1SPJA 1TRNA 1EAUA 2PP6A 1Y5BT 2G5VA 3F0PA 4I31A 2G51A 1QIXB 2GDEH 3DSGA 1BRAA 4UFFH 5DG6A 2C3SA 4DIIH 3FKSD 2WHXA 1ELBA 3SBKA 2QXGA 1NFYA 4FUFA 1P09A 1ZSKA 1KXCA 3A7XA 3U8TH 2BLQA 1GJ5H 2UWOA 3BEUA 4FUIA 3RXFA 3MNCA 1Z6JH 4A1XA 2BVSH 1QRZA 3BTWE 1HAOH 1CO7E 1BMAA 3AW1A 1EZXC 3SV7A 1SBWA 2EEKA 5FBIA 1C2GA 4GHTA 1PPBH 2J5UA 4X8TH 4ZMAH 4YLUA 1CA0C 1ETTH 3SORA 5A8YA 3SI4H 2H2ZA 5EJLA 1KSNA 4UDWH 5ABWA 4AB9A 3VG8A 2RA3A 3KN2A 4NWLA 2VGCB 2K7XA 1K9OE 3LDXH 4FUDA 1DVAH 5ETXA 2A2XH 3SGAE 4ACAA 3M5MA 1UK3A 2OC7A 1HFDA 1NBME 3C1KA 1Z7KA 1P3CA 2EQNA 1RS0A 1EPTB 3W95A 5LH8A 2XBVA 1BUIA 3RXLA 3M7TA 3RMMH 1YPKH 3KYFA 1OWDA 1LTOA 2HALA 4TWYA 3Q77A 3H7OA 2ZPSA 4F4OC 1GDUA 4IGDA 4U01A 3AW0A 2EC9H 2VWMA 3ZVCA 1V2VT 2B9LA 4ZROA 3VGCB 2NU4E 1WU1A 1QNJA 3LC3A 3LC5A 2QC2A 1YPEH 3ZZCA 2GMTB 1CGHA 5L2ZH 3ATIA
chains in the Genus database with same CATH topology
1C1WH 5DP3A 5C5NA 1ORFA 1OX1A 1SGPE 1QB6A 1KXEA 1LPZB 4Y76A 1UTOA 1QHRB 2G81E 1E38B 1A1RA 4TPIZ 1SGIB 1DM4B 1F5KU 2W3IA 5G4BA 4CRBA 1O30A 1QL8A 1C5YB 1VZQH 2R0LA 1MTNB 5DGJA 3GY7A 1BHXF 1S85A 4GPGA 4Z6AH 2VVVA 4X8SH 3BTHE 5IDKA 2FTLE 1THRH 2QYIA 3E16B 1C9PA 1O5BB 1P2QA 4RSPA 2F91A 3A8DA 2A4RA 1HBTH 2UUFB 1O2GH 1JBUH 1CU1A 1BRUP 3RXAA 1CA8B 4B2AA 4JMYA 4Y7AA 3SU1A 2A4GA 4TPYA 1EB1H 4K5ZA 3RXIA 1GBFA 2RCEA 2VIOA 3S7HB 3BEIB 2BD9A 1KDQB 3ITIA 3M7QA 2PKSC 1BIOA 4Q7YA 4IW4E 1Y3VA 1HXEH 3RU4E 3A8BA 2AFQB 1Q2WA 2XCFA 2FTMA 3MU0A 1BRCE 3SHCH 1D6RA 4ZAEA 1TRMA 1B7XB 1O2MA 2VWOA 4O03A 2BQWB 1K28D 3SNCA 2P3FH 2FM2A 4U30A 4YOGA 3QO6A 4IC6A 2P95A 2BMGB 2VWLA 1J15A 1UCYE 1OWKA 1TPAE 1XUJA 4NCYA 2VH6A 2W5EA 1O2VA 1TBQH 5EQQA 1S6FA 2VVCA 5T6DA 1G30B 3A7YA 1Z8JB 5JYIA 1NN6A 2XNIA 3UWIA 3BIUH 2P16A 3RXVA 1LCYA 6ESTA 1BCUH 2PKAA 4BXWA 1BBRH 4AORA 1PFXC 4ISHH 2HOBA 3FVFB 1O2WA 4CHAC 5HMAA 3TGIE 1XM1A 3KQEA 4KKDA 4XSKU 1DITH 1EOJA 2OBOA 1HJ8A 1ANCA 2R0KA 4R8TB 1N6YA 2VIPA 2P3UB 1LKAA 3GY6A 2DE8A 3KCGH 2VVUA 1BTZA 3S9CA 1O3GA 4CRCA 2IPHA 4UFGH 1K22H 3ATKA 4CR5A 1P57B 1J14A 1GCTB 1YKTA 1L1JA 2ZGBH 3TK6A 1UO6A 1SGYE 1ZSLA 1B5GH 2D8WA 3UQOA 1FAXA 1F5RA 1LVOA 3RXBA 5JB9S 3BTKE 7LPRA 4QT8C 1GVLA 3ZZ9A 1O3PB 1ELCA 4JYUH 2THFB 1P11E 3BTDE 2CHAB 1ELDE 1AKSA 1FZZA 1EJMA 2CV3A 4YOJA 3OY6U 3BEFB 3JZ1B 3GYLB 1ZHPA 1L0ZA 1G37A 4D76A 3TJUA 1T8OA 3P8OA 1O2SA 1IQNA 2PSYA 1F5LA 4NIYA 5BPEA 4Y8YA 4X6OA 6CHAC 1GJBB 2AIPA 3K2UA 1FNIA 2BDIA 2ZFSA 1P03A 3SV8A 1W0YH 2FEQH 3RLYH 2ZDMA 4AFZA 1MKXK 3Q76A 1E35B 5GIBA 2GCHG 2WPHS 2D1JA 3U8OH 3UTUH 3Q00A 3MH5A 3F1SB 4B76A 3RXTA 3ODDA 4YM9A 5EQRA 5AHGH 1P12E 1XUHA 2VU8E 2J9NA 4YZUA 1ZMJA 1C5MD 4J2YB 3BF6H 1DWBH 1CT4E 2XCNA 4ZXYH 3TGKE 1MBQA 2PTCE 2J34A 4I8GA 4KTCA 1W3CA 1E34B 4ABGA 2ULLA 4KTUA 1FY5A 2J2UA 2WUCA 3A8CA 1O39A 1TNHA 2HNTC 2EI7A 1OP2A 3FANA 2BD7A 1P2OA 4LZ4B 5LPEA 2R3UA 5EXLA 4CREA 3QZQA 1OP0A 1BB0B 2BZAA 1D3QB 1C2LA 1EPTA 1MTVA 3FP7E 4Y10E 4MNWA 2EA3A 1GBCA 2ZCHP 1GJ4H 1AZZA 1B0FA 4NIXA 2BY9X 1SLUB 1V2NT 1WQSA 3SUGA 1QR3E 1QGFA 2VWNA 1PYTD 3E3TA 1O5EH 1S0QA 4Q7XA 4WH8A 1K1LA 4JZIA 1K1OA 2Z3CA 4KELA 2V6NA 3TH4H 3PROA 1V2LT 3JZ2B 2QAAA 3SUFA 1ABIH 4BAMB 1DE7H 2KAIB 4ZUHA 1CA0B 2FI3E 5L6NH 2TRMA 2FOMB 1IQMA 3UREA 3GY2A 1NRQH 1FY1A 1O5CB 3E8LA 4AG2A 3ZVGA 2HWLB 5JB8S 1ZLRA 2UWLA 3HK6B 1KLIH 3PLBA 3DA9B 4DG4A 2ZGXH 3UR6A 4GVUA 1MZAA 2P59A 3SV9A 3SZNA 3BSQA 3TU7H 2TGPZ 3O8CA 3UUZA 1D3PB 1O0DH 1F2SE 2AIQA 5JBBS 3A88A 1GHBG 1SL3A 1MD8A 1Z8GA 1L4ZA 2Y7XA 1OP8A 1TNIA 2PUQH 1TPPA 2Z9JA 3M3TA 1TLDA 1YLDA 2EI8A 1BTHH 1SGRE 4BAKB 4WMDA 2STAE 3AAUA 1A5HA 1TALA 3A7WA 4JZDH 1O33A 1GDQA 1PQAA 1SHHB 2ODYB 4GLYA 4Y8XA 5HGGA 1D6WA 5HXFA 1P05A 1HAHH 2H9EH 2OXSA 1V2PT 3O8BA 1L4DA 2XTTB 1KDQA 5EPYA 1W2KH 2GP9B 4JCNA 3SO3A 1MUEB 1D3TB 4MVNA 5CE1A 3TH3H 1DY9A 3E91A 3PMJA 1GBKA 2ALPA 3W94A 2A31A 2C8WB 1ZHMA 2WV5A 1UVTH 1G9IE 1WBGB 4WMEA 3HK3B 3VXFH 1EOLA 2OQ5A 5AFZH 5A2MH 4AG1A 1S5SA 1EUFA 4MDSA 1MBMA 1VCQA 2ILNA 3QTVH 2GCHF 3A80A 1W10U 1VCPA 1BA8B 1A0LA 2NWNA 2ZDKA 3SW2B 1FIWA 3NKKA 3VB4A 1G3EA 3H5CB 4WMFA 4E05H 1UVSH 3A86A 2F83A 2ZHEH 2BDAA 3UR9A 3E90B 1V2UT 2VIQA 1UCYK 1GI1A 5FCRA 1CVWH 3WY8A 1UTPA 3MO3A 4Y0ZE 1WTHD 4GUXA 5C1UA 1IHSH 1Z1IA 1V2QT 1OKXA 1GPZA 1C5VA 2GV7A 5GJ4B 5I25A 1HCGA 1NFWA 3DD2H 1G36A 1GI9B 1Z8IB 2WINI 2FOEA 1TMTH 2BDCA 1MTWA 4OS1A 1GBAA 2WPIS 1PPGE 1BMMH 1MZDA 2CF8H 1K21H 1GBTA 2BD8A 3VFEA 1GG6C 1F0RA 1WUNH 3STIA 3A81A 2Y5GA 3A89A 3E0PB 2ODQA 2QXHA 2FOHA 2QF0A 5AVDA 2WPMS 2HPQH 5EOKA 2R2MB 4A1TA 2ZFPH 2V3OH 1GL1A 3SUEA 3QTOH 2LIZA 1RJXB 1UTKA 1TGBA 1H9LB 1AWHB 2F9PA 4FUCA 3SU6A 2G00A 1H8DH 1H9IE 1C5SA 1TOCB 3BTTE 3P8FA 4FXGH 1J9CH 2C93B 4IMZA 1FN8A 3NWUA 1KLJH 1VGCC 1AVGH 5GDSH 1P2JA 2Y6TA 1FPHH 3PMAB 3UY9A 5EW1H 1SVPA 1THPB 2PLXA 4VGCB 3O8DA 4CHAB 1INCA 1ARCA 4LXBH 1EASA 4KGAA 3VB3A 3RXQA 3EE0B 1GI2A 1OYQA 1WCZA 1GVKB 2VIVA 1Y3YA 4I32A 2A4OA 1K1MA 4ZXXH 3D65E 1E37B 1NO9H 2P93A 2ZC9H 3K9XB 1GHBF 3PV4A 3LU9B 1UVUH 2AMQA 4YESB 3T62A 1TOMH 2Z3DA 3TH2H 1A5IA 4J1YA 1KY9A 5I46H 2FPZA 3L6PA 4ZHLU 1ELVA 1PPEE 4XOJA 3TJOA 1AVWA 4H4FA 2ZCLP 2WUBA 3QN7A 3BV9B 1WTGH 1TYNA 1UVPA 2PWXA 3V3MA 1GMDG 3GISB 5JBCS 1XVOA 6GCHF 4BTIB 3LKWA 3VB6A 1L1GA 1SB1H 3QDZB 3TK5A 2VNTA 4M7GA 1P04A 2AGEX 1H1BA 3SI3H 2ZPRA 2XC5A 1GCDA 2ZGHA 3ZZAA 1AIXH 4K2YA 5E0JA 3RXPA 1O37A 4FVDA 3NXPA 4CR9A 2TBSA 1GL0E 1O3OA 1YCPH 4K1SA 2GV6A 3MH7A 3UNQA 1TA6A 2G52A 1ZGVA 2NU3E 1O2YA 3OX7U 6CHAB 1GHXH 3QGJA 3T25A 4AYVB 1WAYB 3UNSA 1C4Y2 1SQOA 2A5IA 2GX4A 3T29A 4DOQA 1AQ7A 3ZVDA 2QCYA 1GVZA 1G3DA 1HB0B 1XUGA 1JOUB 1HRTH 5A0CA 4Z0KA 3TJVA 2SGEE 1AFQC 1UHBB 2ZIQH 3MO6A 3P8GA 3UFAA 1C9TA 2BDBA 3F68H 2V0BA 1TGTA 3RC6A 3OY5U 3MOCA 3U1IB 4BANB 2A5AA 1V3XA 4D8NA 2KAIA 1O2IA 3A7VA 3MH6A 1KTTB 1C5WB 4X2YA 3T28A 3UIRA 1W8BH 5FPSA 1ABJH 3Q3KA 3G01A 3MO9A 3LH3A 3KEEA 3LGVA 2Z6BD 4I8LA 3RXJA 1P2MA 1AD8H 1GJDB 5HM9A 3RMLH 4A6LA 2VINA 1LVMA 3BTFE 1C1MA 2BHGA 2CXVA 2ZEBA 1GJAB 1MTSA 2ASUB 3SGBE 1TNJA 4UFDH 1U6QA 3SV2H 2J95A 1T8MA 2GCTC 1TE0A 4K3JA 1QJ6B 3TIUA 4MPVA 1IQJA 1XKAC 2ANYA 1NS3A 3D49H 3M5LA 5EW2H 4X8VH 4CRAA 4E06H 3M61U 1E36B 2Q6DA 1NRNH 4UE7H 3F9EA 3FP6E 1K1PA 1T4UH 5FPTA 1HAGE 3L3TA 3GCTF 3D62A 1MQ6A 1O2JA 1O2UA 4ABAA 2QY0B 1V2ST 1TNKA 3HPTB 4XDEA 3F6UH 1OWIA 2VJ1A 1NROH 2H5CA 2OTVA 1BJUA 1BTWA 1NESE 4MPUA 1A3EH 2HRVA 3SJ8A 1RTFB 1C5ZB 3ZVFA 4LK4A 1QBVH 4NZQA 2D2DA 1PPZA 5TCAA 5PTPA 2P8OC 1ID5H 3R3GB 4WVPE 1DWCH 2HNTE 2Z7FE 4ABDA 3LT3A 1FPCH 4DCDA 1DWEH 2J38A 5J4SA 1TNGA 3RUOA 1ZTJA 2PUXB 5GPIB 1WQVH 4E7RG 2ZU3A 2A32A 4YT7H 1P8VC 1SLXB 3BG4C 4FUGA 1CHOG 2B0FA 1EAIA 5L2YH 1DSUA 3KNXA 4BAQB 1PYTC 1TA2A 1YM0A 1TB6H 3SNDA 4YO9A 4WXVA 2PHBA 2BTCE 2GTBA 4K8BA 3RMNH 2A1DB 3GY4A 1V2JT 3VEQB 1YYY1 1BITA 2BM2A 3PWCA 1KXBA 2W7SA 1AE5A 2ZHDA 2O9QA 8GCHG 1TAWA 2BX4A 2ZQ2A 4X2WA 1CGJE 2JH0D 3FZDA 3SJ9A 1GJ6A 1AZ8A 3PTNA 4NFEA 2O8TA 1NRRH 1RIWC 1MD7A 2GZ9A 1V2RT 1E0FD 4DY7B 2ZCKP 3ATLA 1HXFH 2XW9A 3ELAH 1XXFA 3ESTA 4UFEH 2XBYA 4ASHA 4ZHMU 3KL6A 1JXPA 1T4VH 1CT0E 3GCOA 2OQUA 4TY6A 4X1PU 1DLEA 2ANKH 3V7TA 1VITH 1EATA 2JKHA 1HJAC 2QGRA 2NU2E 1ETSH 1PQ5A 1FN6A 3KF2A 3L33A 3RDZA 1C1UH 1RD3B 3URCA 2Z9GA 1L2EA 2ODPA 3IITA 4BAHB 2LNCA 1DY8A 5L30H 5C20A 4FUEA 2ZFTA 1O5GH 1H8IH 3LJOA 2FYQA 1EJNA 1ELFA 2FI4E 1DDJA 1A0JA 1B0EA 4D7GA 4ISIH 4OGYA 1KXAA 1ZMNA 1XXDA 1ZPZA 1ZTKA 1HAIH 2GT8A 1GHWH 1MTUA 2SNVA 2ZI2H 1WV7H 1IHTH 1OYTH 3SJKA 4CRGA 3GCHC 3B23B 2BD4A 1S6HA 2O8WA 3ZZDA 1OWHA 1IQHA 2YOLA 4LOYH 3EA7A 4OS5A 1YPLH 1O3JA 1SI5H 2ZZUH 2UUJB 3BG8A 2FOBA 2R2WU 2FLRH 1O3AA 3BIVH 2G4TA 3GDUA 4SGAE 1Y3WA 3FFGA 2TPIZ 4AX9H 4FUHA 3U9AH 2JH6D 1VGCB 1BTUA 3S0NA 3SU2A 1G2MA 1RXPA 1FXYA 3M37A 4ZKOU 2J94A 1Y5UT 4Y11E 1QL9A 1EJAA 2ZPQA 1BRBE 2C90B 2I6QA 5A0BA 4UEHH 4WXIA 2PGBB 1GHAG 3QK1A 1T8LA 2BLOA 3LOXA 2I6SA 1XUIA 2GT7A 2CF9H 3M5NA 1A46H 1GBLA 2DE9A 1O5AB 1QCPA 3A82A 1SFQB 1SOZA 3EAJA 1SC8U 4ABFA 3MU5A 3HKJB 3GY5A 4A92A 2PV9B 1P10A 3GY3A 2PFEA 1UHBA 5DP7A 3VPKA 5EU8A 1TABE 1A3BH 1O2NA 2SGFE 2BY8X 3QZRA 4YT6H 5LPRA 3SQHE 3GCNA 2LPRA 1C5OH 1C1RA 2M5TA 4SGBE 2FDAA 1ZGIA 1P3EA 2RA0A 4XE4A 4U2WA 2VIWA 3RXSA 3PB1E 3TVJB 3BN9A 2V35A 2GMTC 1AGJA 2CMYA 1QURH 3NUMA 5JBTA 4CH8B 3QWCH 1IAUA 1BTYA 2A7JA 2ZWLH 3DFJA 4A5TS 1QFKH 1YCPM 2B8OH 3U98H 4O97A 1IQFA 1TRYA 3TNTA 3KQDA 3ZZ7A 2SGQE 5F03A 1FAKH 1QB1A 4B1TA 4ISOA 4K60A 5DP8A 3GDVA 1CBWC 1P9UA 4K69A 1ZPBA 5E0GA 1NPMA 1YGCH 4RN6A 3O8RA 2ZECA 5DJ7A 1NY22 4JZEH 3MTYA 1NU7B 2Y7ZA 1AFQB 3C27B 1KXFA 2G55A 1LDTT 3KHVA 5DPAA 3RXOA 2J4IA 1GHYH 4F49A 1XUFA 2ANMH 2OC0A 3STJA 2BQ6B 2R3YA 1TGCA 1EX3A 3LGYA 4X2XA 3RC4A 2F9BH 1O2XA 4TY7A 1J16A 4X6PA 7KMEH 1M9UA 4B74A 1GI3A 1HJ9A 3SU5A 7GCHG 1UVOA 3PYHA 1G3BA 4JK6A 4FUJA 3S7KB 3OYPA 1EP6A 1PQ8A 1GJ9B 1ZJDA 2ZHFH 3EA8A 1ETRH 3ZZ5A 3TITA 2GZ7A 3PLKA 1QJ1B 2ZDAH 2ZG0H 1LHEH 4H42U 4D9QA 1C2IA 2BDGA 3U69H 2AEIH 2GCTB 4ISLA 4ZH8A