1J16A

Benzamidine in complex with rat trypsin mutant x99/175/190rt
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRETYNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASSSFIITDNMVCVGFLEGGKDACQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin II, anionic
publication title Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-induced Structural Plasticity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j16A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j16A02
3LU9B 5FAHA 1YPMH 2G4TA 3KGPA 2SGEE 1TE0A 2SNWA 1RXPA 3EA9A 1PYTC 3LH1A 1GHYH 1E34B 5JB9S 4B75A 3RLYH 3M5LA 4XSKU 1GDUA 5A0AE 1DWBH 1LHEH 1W0YH 2AMPA 1NU7B 2A5AA 3C1KA 3RC4A 1UHBA 1PQ5A 3MU1A 1O37A 3URDA 1BBRK 3RXHA 5EQQA 2PKSB 1C5QA 3A86A 2BHGA 1IQEA 1HAPH 3PROA 2ODQA 1TPOA 4WF8A 1NZQH 4NWKA 2FMJA 2XBVA 2VVVA 1GHBF 2TGAA 2FODA 1GI1A 1G2MA 5FPTA 2BDCA 1LVBA 4A7IB 1EOJA 4QT8C 4D9RA 2AMQA 1BITA 1MKXH 3QGJA 1QY6A 2Z3DA 1TQ0B 1SOZA 2ZPSA 5A8YA 1ZTJA 1O3EA 1VZQH 4NZLA 4WWYA 4FVBA 2JH5D 1H8IH 3ZYDA 2VIDA 3RXQA 2BD7A 2BY5X 5AHGH 1ESAA 1UHBB 1WUNH 4I33A 1T31A 1SGFA 3M35A 3SNDA 4AX9H 1V3XA 3LIWA 4XDEA 1ZHPA 2F91A 2Y81A 1UK3A 1IQKA 1A0LA 3S9CA 1S5SA 1DFPA 4FU8A 3O8BA 4IC6A 4K8BA 1ANDA 2XCFA 1D3QB 2A4RA 2ANKH 3DFJA 3FZDA 3RUOA 1OWJA 2F3CE 3VXEH 2GVFA 2QGRA 1C2MA 1O2VA 4UONA 3P8GA 3TH2H 2ZNKH 2FI5E 3O8RA 1PPEE 1ZSKA 1JRSA 4JK5A 1SGIB 4GCHG 4NIWA 3U9AH 1O36A 2FP7B 2NU4E 5IDKA 5A0CA 4GHTA 1QBNA 2ZO3H 3E6PH 1GVZA 9ESTA 5AFZH 2VH6A 3VB7A 1EZXC 1ELGA 1XUFA 3UQVA 1MD7A 5FBEA 1ZMJA 3V12A 7GCHF 3RMOH 5EPYA 1S6FA 2C8WB 2AS9A 1DXPA 3ZZ9A 3BEFB 2HPPH 3RXEA 2J34A 1C4Y2 1Y3WA 4IN2A 1V2VT 1CGJE 2OC0A 6CHAB 1ZZZA 3SORA 1GJAB 1YPEH 2A31A 2ZDKA 3EGKH 3VPKA 3R0FA 3SBKA 1QIXB 5GIBA 1DE7H 4XBBA 4SGAE 1GJ9B 1C2JA 4RKOB 1QJ1B 1BMAA 2ZHEH 2ASUB 1DLKB 5DG6A 5E0JA 3SO3A 5GWZA 4WXVA 1NTPA 3RXLA 1GGDC 4XBDA 1TPPA 4LK4A 2W7SA 2C8YB 2VWNA 1GBLA 4Z6AH 4NIXA 1T4VH 1PPFE 2CN0H 1F7ZA 4THNH 2XXLA 1GHXH 5GDSH 1G2LA 2O8UA 1ELDE 4O3UA 1F0SA 1OWKA 1ZPCA 1OP8A 3SI3H 2O8MA 2OINA 1WYKA 4KKDA 2ANYA 1Z8JB 4FUIA 1ELTA 1RJXB 4XBCA 4IGDA 4NSYA 4I31A 3P6ZB 3TLOA 1F2SE 1TABE 1THPB 2V3HH 4BXSA 2G51A 1KDQA 2J92A 1BJVA 2R9PA 3A8AA 2ZU1A 1PPBH 4AFUA 3ZVEA 3ZZBA 1LKBA 3A7VA 4JZ1A 4LOYH 1AGJA 1GI4A 4I7YH 1KTSB 1O38A 3MH7A 2XC0A 1UMAH 4X6NA 5CE1A 1C1UH 1F0UA 2OC8A 2WPJS 1ELVA 1A5IA 1K1OA 5EXNA 1G9IE 2OTVA 2Q6DA 2P93A 1PPCE 1O2YA 2ZFTA 2CF8H 1FN6A 2VWMA 5IYTA 1ACBE 1P2JA 2TRMA 1O2JA 1FPHH 3A85A 1IAUA 1KDQB 3GCTF 2EI8A 3RM0H 1O5BB 2GV6A 3TJOA 2PKSC 1TNJA 4E7RG 1LMWB 2BXUH 1C5NH 1F92A 3I78A 1FY5A 2FYRA 2Y7ZA 1TBQH 1C1VH 2EI6A 2ZTZA 2H6MA 2UUFB 4X8TH 1AMHA 1F5LA 3MNXA 3GY5A 3VB6A 4OS1A 1H4WA 3RXDA 2RCEA 1WOFA 1IQNA 4I32A 2B0FA 5EW1H 1T7CA 3A84A 1Q3XA 3TPIZ 1O5GH 2ZDAH 4FVDA 3SU4A 2ZFFH 1AZZA 1QNJA 4CR5A 1MMJN 1HDTH 3F1SB 3ODFA 1BHXF 4F49A 4RN6A 4BANB 1WSSH 1CHOF 4YO9A 2ZFQH 1C5ZB 1MAYA 1AZ8A 2W3KA 3EQ0H 2FOGA 1CA0B 1G36A 2OP9A 3MI4A 1O2UA 1D6WA 1SGTA 5FBIA 3A80A 3OY6U 4ISOA 3FVFB 1O3KA 2FI3E 3KL6A 2BM2A 5FPYA 2FLRH 2QV1A 4CRFA 2BLQA 3M3VA 1ZTKA 4FUGA 1QL7A 3MTYA 1SGNE 3KNXA 1W3CA 3P8NA 3O8CA 3Q3KA 4INHA 3RXTA 4JZDH 1HAXB 3GYMA 3U98H 1V2ST 2PUXB 1YCPM 2RDLA 3NPSA 3TVJB 2XC4A 1O3PB 2QXGA 3GYLB 3GCHC 2R2MB 2AH4X 2VB0A 1GJ5H 3MO9A 2UUYA 2UWPA 2QAAA 2F9PA 2PUQH 4NZQA 1MCVA 3BN9A 4ZXXH 1MBMA 2DE9A 3GDUA 1ELEE 4JYUH 3SUGA 1P10A 2FXRA 1F5RA 2P16A 1BBRE 1YF4A 1O5AB 2WPMS 3T62A 4DVAU 1IQLA 5A2MH 2XYAA 3SGQE 5C2ZA 2FOFA 3SU2A 1BTHH 3Q3YA 1UO6A 2QA9E 2ZPRA 1C5LH 1L1NA 1LPZB 4NG9H 3MWIU 4RKJB 3UY9A 2K1QA 2VGCC 5E0GA 3ZZ8A 3RP2A 1C1PA 3MH5A 3MNBA 5CMXH 5BPEA 1ELAA 4X1NU 1V2UT 2HGTH 1AE8H 1ESTA 1ZOMA 2RG3A 1EAIA 8GCHG 2WYJA 3UREA 4MNXA 1FIZA 1ID5H 1LHGH 3UOPA 1WV7H 3QX5H 1HJAB 1MTSA 1TNGA 3ZZ6A 3BEIB 5CHAC 9LPRA 1O3JA 4B2BA 1FLEE 2G81E 1CQQA 3UUZA 2HVXA 1Y8TA 2AERH 2VINA 3IWMA 2I6SA 1P0SH 1GI9B 3TITA 2SFAA 5A0BA 3K6YA 5K0HA 1P11E 1GBEA 2WINI 1O3AA 1MKXK 3BG8A 3TJUA 1W8BH 1T8MA 1XKBC 1G3EA 1O2RA 5TCCA 4DJZB 4U2WA 2EEKA 1OWDA 3PTNA 2PKAB 1O3BA 1J17T 1MZDA 4K60A 1A0JA 5J4SA 1HV7A 1TPSA 3RU4E 3V13A 1GJ6A 1C1NA 2WUCA 2BDHA 4WMFA 4O97A 2A7JA 2NWNA 3AVZA 4NGAH 3BEUA 2VWOA 1SSXA 2ZPQA 5C3NA 4WH8A 1C2GA 3GISB 3MMGA 3BTME 1HIAA 2WPIS 1YYY1 4DG4A 3RMLH 5EPNA 1CU1A 1ETRH 3PM3A 4PROA 2Y82A 2VIQA 4AGKA 2GT8A 1P12E 2GCTB 2OUAA 1C5TA 3SN8A 3RXPA 1BTUA 1Y5AT 1A46H 2F9VA 4BAHB 2J94A 5A09A 3GDSA 2ESTE 1XXDA 5DPAA 1BHXB 2A7CA 4ABBA 3EAJA 1EPTA 4FUDA 3RM2H 5FX6A 1AY6H 6GCHG 2NU2E 5T6FA 5JBCS 4FU9A 4BTTB 1RIWB 1NU9A 4ABGA 4D9QA 4A1XA 1HIAB 4I8LA 2GV7A 4K8YA 2FOAA 3PLPA 1Z1IA 1GBFA 1IQHA 2QY0B 1EASA 3M5MA 5B6OA 1WU1A 3DUXH 1VITG 4UE7H 1CVWH 3LT3A 3ELAH 1DX5M 1OXGA 1G30B 1QRWA 2P3UB 3P92A 4M7GA 2XTTB 1ARBA 1V2KT 3SJOA 2FEQH 2SNVA 5FPSA 3ZVCA 1GG6B 4K3JA 1KLJH 1QJ6B 1CA0C 1SGEE 4I8KA 3T2NA 3BTHE 4UFGH 1DSUA 1EPTB 1C5UA 1MTVA 3PB1E 2GDEH 2J2UA 1Y5UT 2ZG0H 1BT7A 4K2YA 1FY3A 2BD5A 2G52A 1O2QA 3K9XB 4CHAB 2P59A 4X1SU 2ZECA 2ZHWH 3A7TA 3SNCA 3P8OA 1D3DB 1P06A 1VGCB 1OYTH 1SVPA 1SGYE 2XWBI 4CBNA 4YT6H 3HK3B 3KCGH 1M9UA 3ZVBA 2P94A 3AAVA 1N8OB 1KXAA 1HPGA 2HPQH 7ESTE 1GI0A 1O3GA 1DITH 1GBBA 3QO6A 2ZTYA 2R3YA 2O9QA 2YNBA 3QWCH 1XUIA 4KTCA 4DIHH 4TYDA 2ZCHP 2HWLB 1QJ7B 1YPHC 5HXFA 3MH4A 1IOEA 4O03A 2A7HA 2GD4B 1FY1A 3SGAE 1BCUH 1C4U2 1OKXA 1OWHA 4NWLA 3UWJH 3VB5A 1FNIA 1GBMA 5ABWA 1H8DH 1MBQA 1C2EA 4B1TA 4A6LA 4OGYA 3PMAB 1HXFH 1SI5H 2P95A 3M7QA 2AFQB 3E3TA 2FI4E 2FYQA 3LJJA 2ZA5A 3LDXH 3RXVA 2P8OB 3MO6A 1O2ZA 4IC5A 1AIXH 1AI8H 1KY9A 1MH0A 1FY8E 1TX6A 5GCHG 1W2KH 4NIVA 1HJAC 2XBWA 4ABIA 1LCYA 4Y71A 1CGHA 1J16A 1V2LT 1Z7KA 4ZAEA 1MQ5A 5DGJA 3E90B 1PPZA 1LHDH 4AG1A 1GMCF 1INCA 3ZZ4A 3ODDA 4DGJA 4B2CA 1C1WH 5C20A 1ARCA 1BRAA 4UFDH 2BX4A 2OC1A 1RTKA 2Z9IA 3A7XA 5JBBS 1Z1JA 3MNCA 1BB0B 3F68H 3PWBA 5GXPA 1SFIA 2ZCLP 1LVOA 1GJ7B 1X7AC 2VVCA 3SHAH 2FS8A 2Z9LA 4GSOA 1UK4A 3SU5A 1DOJA 2W7UA 5EW2H 2D1JA 2A2QH 1P01A 1UVPA 2GCHF 3GY7A 1EP5A 4WJG2 4DCDA 1CA8B 1K28D 3SI4H 1GJDB 3SGBE 3U1IB 2W26A 1ELBA 1FZZA 1AN1E 3DT0H 3IITA 1J14A 1P57B 1NESE 1HJ8A 5ESTE 1O2NA 2BY9X 3BSQA 1BRUP 4YT7H 1BMLA 4MPVA 5C1UA 2Z3CA 2GCTC 5HMAA 1SHHB 4R0IA 4H6SB 4ZROA 2B7DH 1EAWA 1CBWB 1BJUA 3SU3A 3ZVDA 2BVXH 1P8VC 2VVUA 4CR9A 3MHWU 1K22H 3ZV9A 4AN7A 1HXEH 5FCKA 2SGFE 2HNTC 3FP8E 4YTAA 1YLCA 1RIWC 1AB9B 2LPRA 1V2WT 3FP7E 4ABFA 4TPYA 1ZR0A 3D23A 4MPXA 1UJ1A 1NS3A 1QRXA 1ANCA 1LKAA 1JWTA 1BTZA 2EC9H 1LVMA 3H7OA 4GAWA 2BQ6B 1O2LA 3FANA 2D2DA 2D8WA 3TK5A 4ZMAH 1T8LA 2HOBA 3SJIA 3U8OH 1AE5A 2FO9A 3MNSA 3RXRA 1GHAG 1TA2A 4NIYA 2TBSA 2FOBA 3H7TA 1A61H 4FUEA 3SW2B 2F9UA 5EXLA 3BF6H 2FOMB 4HFPB 3FP6E 1C5RA 1AD8H 4AFSA 2J9NA 1L1JA 2GDDA 1OP2A 1TNHA 3M3SA 4UDWH 4CH8B 2ZU3A 1GHVH 4NA7A 1GHWH 4A1TA 4WMEA 1GBIA 1UTLM 1C1MA 1BQYA 1O3MA 1H1BA 1D9IA 3LONA 1VGCC 1NN6A 1AQ7A 4MLFB 4K5ZA 1GBCA 1NFYA 1O39A 2A4GA 1AVWA 5T3HA 1RTFB 3SQEE 5J4QA 1HGTH 1SLWB 1DANH 1FN8A 1TYNA 4OS2A 4D7GA 1VCWA 2THFB 4MPUA 4K1SA 3STIA 2ZFPH 1UTMA 1K9OE 1A5HA 1WAYB 5EQSA 1KTTB 2FOEA 1JOUB 1GWAA 1TB6H 1FY4A 2ANWA 1TPAE 4IMQA 1GDQA 4DOQA 1SGRE 1KXFA 1YM0A 1BTYA 3K2UA 3GOVB 1VCQA 3EE0B 1TNLA 5C67A 1AO5A 5C1XA 5ETXA 1NFWA 1EAUA 2FIRH 1K21H 2ZFRH 4E7NA 2AGGX 4D7FA 3GY6A 4AFQA 1NFXA 3KQDA 3BTEE 3A89A 1ZSLA 1J8AA 1NRPH 5A8XA 2A0QB 2GX4A 4JMYA 1K1IA 1CHGA 1O5CB 3U1JB 5DJ7A 1UTQA 2C8XB 3SV7A 1D4PB 1E35B 1FV9A 1XX9A 4JK6A 5C5OA 4CH2B 3S7KB 1SQTA 1DLEA 3M3TA 2GMTB 5EQRA 1YBWA 5TCAA 4XOJA 3UIRA 4X2YA 1EJAA 3ENSB 2CXVA 1WCZA 1ZMNA 1UTPA 1THSH 5E0HA 1GI6A 3SU1A 8ESTE 1ZPBA 2VJ1A 3ITIA 1NY22 4GHQA 5DP9A 1L4DA 4NCYA 1O3NA 3BV9B 4YLQH 1TGBA 1UCYH 1AUJA 2C4FH 1QBOA 3L33A 3T26A 2A4OA 3UTUH 1TX7A 2ODPA 2BMGB 2FLBH 2W3IA 2XWAA 2V3OH 3F6UH 1SR5C 1GMDF 3S69A 1JIMA 3T29A 1TRMA 5JBTA 1HAIH 1T8NA 2ZHQH 1FMGA 3SNBA 3MH6A 1DPOA 1EOLA 3JZ2B 4BAMB 5DP5A 5H4IB 1BUIA 1NPMA 5HM2A 1SG8B 1TRNA 1ZJKA 4B76A 1H9IE 2B8OH 2FDAA 2SGDE 1LVYA 3JZ1B 1S6HA 2Y5GA 4ESTE 1GVKB 3RXJA 4GLYA 1CBWC 1SGCA 1BTXA 1O2PA 1O3DA 3ZZAA 4ZHMU 2QF0A 2ANMH 1UVSH 2XCNA 1SQOA 3SV9A 1B5GH 2YNAA 2BQWB 2O8WA 2PFEA 1P3EA 3M7TA 1J9CH 3UPEA 2ZGHA 3ZYEA 5HM9A 1P05A 3EA8A 4MNVA 3VGCB 2BVRH 4AB8A 1GHZA 1TA6A 4ZH8A 2ZEBA 1XMNB 2Z9GA 1L4ZA 1SGFG 3CP7A 3Q77A 1V2QT 3FFGA 1W7GH 3RXMA 4KTSA 1AUTC 1P09A 1Y59T 5EG4A 5L6NH 2ZZUH 2I6QA 4Y10E 3ATWA 1O2HA 1BTWA 1BDAA 2Z9KA 2Z9JA 2EI7A 4K1EA 3RXUA 3GY4A 5AFYH 1DDJA 5LPFA 1XVOA 2BDIA 1GI5A 1OPHB 2XRCA 1QB9A 1ZJDA 1UTKA 1O2WA 2OD3B 1P03A 1GCDA 4D8NA 4CBOA 1CT0E 3PMJA 4AORA 1CO7E 2JETB 4GUXA 1NC6A 1K1LA 2A45B 3PLBA 3MU0A 2H5DA 3E8LA 4J2YB 6CHAC 2WV5A 4GCHF 4IS5A 1GHAF 1A4WH 2J95A 1GDNA 1C2LA 2WUBA 3HGNA 1KYNA 3ATLA 1DXWA 5E2PA 1EQ9A 3V0XA 1ZMLA 4LZ4B 4Y6DA 1HAOH 5DKMA 3LGTA 1TLDA 4I8GA 3E16B 1YPHE 1N6XA 2PKAA 5JBAS 4BTIB 1C5MD 3V7TA 1C2KA 3M5NA 5EXMA 1V2OT 5C5NA 5PTPA 2G00A 1PJPA 1TIOA 2H5CA 4O3TA 8LPRA 4A1VA 1T8OA 1Z8IB 3B9FH 1SB1H 2ZHDA 4H6TA 3SJ8A 3T5FH 5JDUB 3E0NB 2CHAB 3QZQA 2OQ5A 3S7HB 2AMDA 3LGVA 1O3CA 1OSSA 3URCA 2A2XH 3GICB 1CT2E 1A0HB 2H9HA 1TNIA 1CE5A 1UVUH 3OYPA 4CRGA 1QB6A 2ALPA 1C1TA 1DY9A 4VGCB 3UR6A 1FAKH 2O8LA 4ZKNU 1PQ8A 2H2ZA 1RGQA 1EZQA 3MOCA 1DS2E 3U8TH 3SNEA 1WBGB 1O35A 3GY8A 2GMTC 1A2CH 1BIOA 3BTFE 1O33A 5F8TA 3A81A 2ZFSA 2JH0D 2HALA 3LC3A 2VWLA 3ATKA 1SGQE 2JKHA 1XVMA 3KQCA 1SLUB 1GL1A 3TH4H 1TNKA 1KXBA 4ABAA 4BAKB 1OP0A 1XKAC 2TGPZ 1NRRH 3RMMH 3KN2A 2A4QA 3P95A 2WPLS 4DIIH 2A5IA 1SMFE 1A7SA 5E8EH 2DE8A 4B74A 4MQAA 4X6PA 2G5NA 4A92A 4ASHA 2VNTA 4YOIA 1FDPA 1FIWA 2BQ7B 4KTUA 3IG6B 1C5XB 2OXSA 3OX7U 4U01A 5LH8A 2J4IA 2C93B 1AHTH 1QGFA 3RXKA 2PTNA 5DP4A 1EJNA 2B9LA 1LQDB 1PFXC 1W12U 3OTJE 1EJMA 2UWLA 2AIQA 3P70B 1DUEA 1GJBB 2G8TA 1UTNA 1WTHD 1IQJA 3W95A 3M61U 4UFFH 3DA9B 1V6DA 2ZGJA 3Q00A 1P9UA 2AGEX 4Y11E 2ODYB 1O3FA 2Z3EA 1O2TA 1GBJA 1P2IA 3A82A 1FAXA 1P2OA 3RC5A 1AKSA 2PV9B 1IHTH 3GY3A 1W10U 2O8TA 4NA8A 4HZHA 5HGGA 4FUHA 2ILNA 3I29A 2ZU5A 4YLUA 3A7WA 4NFEA 4Y7BA 4TPIZ 1L2EA 1S0RA 1BMNH 2HNTE 1IQIA 1YCPH 1LDTT 1O31A 1O2IA 4ZUHA 6ESTA 1O34A 2IPHA 2HLCA 1RD3B 4KELA 1B7XB 3SU6A 1MKWH 4XFQA 1GBTA 3VGCC 1N6YA 1O2KA 2BY7X 3UR9A 1NRNH 1YC0A 3EDXB 1NRSH 3UOUA 3UQOA 1AKSB 1QL8A 3K65B 3BG4B 1B0EA 7KMEH 1YGCH 1LTOA 4I8JA 1VCPA 2Y5FA 3TNTA 4U30A 1W11U 1E36B 1QA0A 1GJ4H 2OLGA 4UFEH 5DO4H 3MFJA 4Y76A 3TIUA 1CT4E 2FESH 4OS4A 1GI3A 5BRRE 1Q31A 1JIRA 4ISNA 5EU8A 1TGSZ 4AGJA 2FOHA 2FS9A 1S82A 3BTWE 1NM6A 2JETC 1WQVH 5JB8S 1QR3E 1QCPA 5F8ZA 4AYYB 3O8DA 1HJ9A 2GZ7A 4JZFH 2FX6A 2BY6X 4JZIA 1O2SA 3PYHA 2Q1JA 4A5TS 3A87A 1IQFA 3HKIB 3RMNH 3SUEA 4WY3A 1O5EH 2BZAA 3GY2A 1C5YB 1UCYK 1GGDB 1MTNB 1AVXA 4Y8YA 3ATIA 4JZEH 4B73A 4BNRA 4ISIH 1O2XA 4AFZA 2GZ9A 1S84A 1V2PT 2BD8A 3UWIA 5DP7A 3Q76A 2PSXA 5GJ4B 3NCLA 1Q2WA 5G4BA 4ZXYH 2FPZA 1XUJA 4X1QU 1UVOA 3STJA 2ZCKP 3SUFA 3S9BA 4AYVB 1ZSJA 1TAWA 4XE4A 1BRBE 1G32B 1O3IA 4KP0A 2CHAC 2NU1E 3VFEA 1T4UH 4X0WU 5TJXA 2QXHA 4BAOB 1GBDA 1C5OH 3MYWA 2BDGA 8GCHF 3GCNA 1TONA 2QXJA 3LGUA 3T28A 1MZAA 4WMDA 4ABDA 1GI7B 1C9PA 1HNEE 2BD9A 2PW8H 3GCTG 1GBAA 2BB4A 3LGWA 2Y5HA 4VGCC 1J15A 1JXPA 4FXGH 3PV4A 2ZDNA 5DP6A 1C4V2 3GDVA 3RXGA 3AW0A 4Y8XA 2GKVE 2VIPA 4X2WA 1ABJH 3LKWA 3M5OA 4AZ2B 1KSNA 4F4OC 2H1UA 1TOMH 4IMZA 2F9BH 2QXIA 1C2IA 1ELFA 4X6OA 2B5TB 1O2MA 2R2WU 1G37A 3MU8A 4GVUA 2ZTXA 3WY8A 1QURH 5F8XA 3PWCA 2FTMA 1DSTA 2J38A 3RXFA 4AG2A 3SV2H 3EYDA 1GPZA 4D76A 1CHOG 2AGIX 3LH3A 2QN5T 4GPGA 1SHYA 1ZGVA 1P02A 1S85A 3RC6A 1Z6EA 3PTBA 2F9OA 3D49H 1EXFA 4MTBA 3D65E 1C1RA 1C5WB 2Y6TA 4K69A 3HATH 2PSYA 1SL3A 1SPJA 3AAUA 1Y3VA 2ZGBH 3F9GA 1MU8B 1T32A 1B0FA 2P3TB 1RTLA 2DUCA 2F83A 2AYWA 2CJIA 2BZ6H 1KXDA 4X8VH 3HGPA 3I77A 3QN7A 5LGOA 3QGNB 2ZDVH 3TNSA 3ZZ3A 1L1GA 2PR3A 2BDBA 1EZUC 4BTUB 2CMYA 2P3FH 5E2OA 1FONA 1JBUH 2CGAA 5DP3A 1GG6C 4I8HA 1HCGA 3CS0A 1E0FD 3NWUA 2FM2A 5K7RA 3FAOA 2PGQB 4E05H 6GCHF 1QBVH 1MCTA 1EPTC 5L30H 3TJNA 3EA7A 3VB3A 2FOCA 4H42U 1TWXB 3AW1A 3TJVA 1XUKA 1OWEA 2WPHS 1QRZA 4CHAC 1A1RA 1MU6B 2PTCE 1VITF 1C2DA 3PMHB 4ZHLU 1UTJA 1TFXA 4X8UH 4OS6A 3UNSA 3QTOH 2ZGCA 1K1PA 3GCHB 3BG4C 1EB1H 3A7ZA 4Y7AA 1K1NA 1Y5BT 3HK6B 4ABJA 1QQUA 2Z94A 1Z8RA 3K6ZA 1F0TA 1G3DA 1N8OC 4OS5A 1SOTA 2QC2A 3LPRA 1ELCA 2BTCE 2ZIQH 2UUJB 1H9HE 2H9EH 3Q3XA 4TWWA 1Z71A 2SGPE 1IHSH 2BLWA 1QFKH 4HI3A 1NT1A 1JMOH 2V35A 3PO1B 3LC5A 4INKA 2VGCB 2JH6D 2WPKS 3A83A 2V6NA 1VJ9U 3BIUH 1BOQA 2ZWLH 8KME2 1H9LB 5LPEA 5GPIB 2YOLA 1ZRBA 4Q7YA 1AVGH 5I46H 1PQAA 1ZYOA 2VH0A 3TGIE 3A8BA 5FHTA 1MTNC 4YOJA 4X1RU 2P8OC 5CHAB 1O3HA 2C8ZB 3C27B 3N7OA 1GMHG 2G5VA 2BX3A 1HFDA 1JRTA 3AASA 1ETTH 1SGPE 4CRAA 3F9FA 5ESBA 1KXCA 3KQBA 1OWIA 1KIGH 3LOXA 4SGBE 1G3CA 3E91A 1N1LA 2HRVA 3B8JA 4JYVH 2QIQA 4X2VA 3TK6A 7LPRA 1RFNA 1TGNA 2ALVA 1C2HA 2PGBB 3VXFH 3QDZB 1FPCH 3U69H 1YP9A 1XXFA 4X8SH 5JPMH 3TGJE 2BLVA 1LHCH 2BYAX 2GTBA 5GCHF 3PMBB 1TX8A 1HAYB 2OBOA 4BAQB 4TY7A 1Z6JH 2ZC9H 2XC5A 6LPRA 1O32A 2TPIZ 1GJCB 1YCPK 2BD3A 3RLWH 3FZZA 3MU5A 4MNWA 5L2ZH 1G3BA 3M37A 4Q7XA 1TALA 2ZDMA 1P2QA 4ISHH 1MKWK 4JYTA 4TY6A 1L0ZA 2CV3A 1K2I1 2ZI2H 3QTVH 2Y7XA 1BA8B 3SU0A 1ANEA 2XW9A 1AFEH 1PQ7A 3M36A 4AOQA 1K1JA 3TGKE 1IQGA 2STAE 1VJAU 1HB0B 3A88A 3S9AA 1AU8A 1ESBA 2TGDA 4ZHAA 4ZKRU 3HPTB 1D6RA 4Q2KA 2SGQE 2BVSH 3D62A 2R0KA 5A8ZA 4YOGA 2ZU2A 1C5SA 2NU0E 2W5EA 2FWWA 3B23B 3T25A 5FXLA 1P2KA 1UCYE 4Y8ZA 1O2GH 1MTWA 4UEHH 4J1YA 1HLTH 4IBLH 1P04A 1K1MA 1GBHA 2M5TA 4ZKOU 2V0BA 4YZUA 1TQ7B 1SBWA 3BTQE 3SUDA 1VITH 4ABHA 3SNAA 1AB9C 1O0DH 1SC8U 1WTGH 4FUBA 3KF2A 3QK1A 3OSYA 4X2XA 1LPGB 2HNTF 1W0ZU 3ZZCA 2ZKSA 2UUKB 4CRCA 1PPGE 2KAIA 3ZZ7A 4MG3A 1MD8A 2STBE 5DK1A 1DWCH 1BBRH 3A8DA 2SGAA 1D3PB 1QL9A 3SOSA 1S83A 4LXBH 1GCTB 1Y3YA 1DWEH 1O2OA 4LZ1H 1V2JT 3G01A 1D3TB 2XBYA 1FQ3A 4NSVA 1O5FH 3U8RH 1BTPA 1KLIH 5T6DA 1DY8A 1GL0E 2Z6BD 1HAVA 1Y3XA 2QF3A 3W94A 3QZRA 4HGCA 1W13U 4E06H 3RU4D 1C1SA 1SQAA 3NUMA 4MVNA 1NO9H 1ZRKA 3ESTA 2ULLA 1HUTH 5DP8A 3P17H 3UNQA 3KEEA 4YM9A 3RXOA 3BTTE 3SV6A 2KAIB 1GJ8B 1YPKH 1PYTD 1ZPZA 3L6PA 1A3BH 4Y0YE 1GI2A 1O30A 3TU7H 1C9TA 1Z8GA 2WV4A 3H5CB 5FX5A 4DT7B 1VR1H 3PO1C 3UNRA 3RXSA 2OCVB 1TOCB 5AF9H 3NZIA 3SJKA 1KXEA 1GMCG 1QB1A 1HAVB 2C3SA 1OS8A 4FUJA 1W7XH 4CRBA 2H9TH 4DY7B 2XBXA 2D26C 1GI8B 1HAHH 4ZKSU 3GCOA 3L3TA 2TIOA 2TGTA 3QLPH 1C1OA 2LNCA 1NFUA 2R3UA 1SGDE 2A5KA 5F6MA 1UVTH 2GP9B 3NKKA 1MUEB 2A1DB 2OBQA 2AEIH 3QUMP 1A3EH 1CSOE 3MU4A 3S0NA 2ZU4A 1P2NA 1FJSA 1C5PA 2GCHG 1AFQB 1TMBH 3ZVGA 4R8TB 2A32A 3PLKA 1GHBG 1YPGH 3KQEA 2BD4A 1EZSC 2Q6FA 4WXIA 4Y0ZE 1BMMH 3HKJB 3RXCA 3RXIA 1ETSH 3F9EA 3ZVFA 1DWDH 1XUGA 1LO6A 3SZNA 1GMHF 2R0LA 4IN1A 1MQ6A 3KHVA 3SV8A 1HYLA 1U6QA 3DHKH 1F0RA 1EKBB 4UD9H 1TBZH 5T6GA 1HAZB 4WH6A 1BZXE 3OU0A 5AVDA 1DUAA 1ANBA 1P2MA 1V2RT 1YPJH 3DFLA 3MO3A 3BIVH 5FCRA 1C2FA 2VIWA 4FUCA 1MTUA 4MPWA 5JYIA 2BY8X 3RDZA 4FUFA 3SJ9A 1E38B 2BDYA 1S0QA 2RA3A 5I25A 1DM4B 1O5DH 1OOKB 2OC7A 1C5VA 1F5KU 2VIVA 3NXPA 1EP6A 2VIOA 2ZGXH 3F9HA 1KLTA 1EX3A 1Y3UA 2XNIA 3T27A 2Q6GA 4Q7ZA 1HBTH 1SLVB 4OGXA 2GGVB 3VEQB 1RS0A 1ZGIA 1EATA 1E37B 1XUHA 1C1QA 2PHBA 1RRKA 4IW4E 1FXYA 3A8CA 5C1YA 3V3MA 4AB9A 1TGTA 4B71A 7GCHG 4MDSA 5HYOA 4DW2U 2WYGA 1AWFH 3RXAA 1NROH 2RA0A 4YESB 1V2MT 3RXBA 2BLOA 1FUJA 4OS7A 4U32A 3ZZDA 3BTKE 1OYQA 4MNYA 3BTDE 1QA7A 3ATMA 4DURA 2G4UA 3CS7A 2ZHFH 1YLDA 1P3CA 3ZV8A 4X1PU 1DVAH 1OX1A 4O9VA 3NK8A 3UFAA 2VU8E 3ZVAA 2G55A 5EOKA 2PLXA 1ZHRA 5L2YH 4CREA 4TWYA 1SLXB 2GT7A 4WVPE 1GVLA 1TBRH 5SGAE 2BDAA 1YKTA 1P9SA 1LHFH 4Y79A 3ZZ5A 2QCYA 3R3GB 1GCTC 3OY5U 5F03A 3DD2H 1YPLH 3E1XB 1ORFA 5EGMA 2EA3A 3VB4A 1XM1A 4X6MA 1O3OA 2NU3E 1AWHB 4FU7A 4ISLA 1W14U 2BXTH 1EUFA 2UWOA 3KIDU 2AIPA 5LPRA 2Y80A 3CENA 3E0PB 3TK9A 1QQ4A 4B2AA 1UK2A 1BRCE 1MAXA 3LGIA 2BOKA 3LGYA 4JCNA 1ABIH 2F9NA 2GZ8A 4Q80A 2ZQ2A 4CRDA 1QTFA 1LQEA 1THRH 1O3LA 1EAXA 1LPKB 5EODA 3M7UA 4NFFA 4ABEA 2ZF0H 1WQSA 3RU4T 2ZP0H 4INLA 1V2NT 2BOHB 1QHRB 2OQUA 1HRTH 1ZHMA 4KGAA 3P8FA 1A5GH 4RSPA 1EB2A 1TMTH 1PPHE 3SHCH 1FI8A 2QYIA 1TMUH 2ZQ1A 2FTLE 2ZDLA 4Z0KA 1CGIE 2FZZA 1DT2A 1TRYA 2IN2A 4K1TA 2IOTA 1UTOA 1NRQH 1S81A 2IJOB 1SFQB 2PWXA 4HTCH 2Z7FE 2C90B 2FX4A 1HAGE 1ZTLA 3SQHE 4H4FA 4BXWA 3LJOA 4NA9H 4BOHA 1GBKA 3TH3H 1IQMA 3BTGE 2BD2A 1GMDG 2CF9H 1AFQC 1DICA 1ZLRA 1V2TT 1TGCA 3A7YA
chains in the Genus database with same CATH superfamily
3LU9B 5FAHA 1YPMH 2G4TA 3KGPA 2SGEE 1TE0A 3U28C 2SNWA 1RXPA 3EA9A 1PYTC 3LH1A 1GHYH 1E34B 5JB9S 4B75A 3RLYH 3M5LA 4XSKU 1GDUA 5A0AE 5HIYA 1DWBH 1LHEH 1W0YH 2AMPA 1NU7B 2A5AA 3C1KA 3RC4A 1UHBA 1PQ5A 3MU1A 1O37A 3URDA 1BBRK 3RXHA 5EQQA 2PKSB 1C5QA 3A86A 2BHGA 1IQEA 1HAPH 3GS9A 3PROA 2ODQA 1TPOA 4WF8A 1NZQH 4NWKA 2FMJA 2XBVA 2VVVA 1GHBF 2TGAA 2FODA 1GI1A 1G2MA 5FPTA 2BDCA 1LVBA 4A7IB 1EOJA 4QT8C 4D9RA 2AMQA 1BITA 1E1RD 1MKXH 3QGJA 1QY6A 2Z3DA 1TQ0B 1SKYE 1SOZA 2ZPSA 5A8YA 1ZTJA 1O3EA 1VZQH 4NZLA 4WWYA 4FVBA 2JH5D 1H8IH 3ZYDA 2VIDA 3RXQA 2BD7A 2BY5X 5AHGH 1ESAA 1UHBB 1WUNH 4I33A 1T31A 1SGFA 3M35A 3SNDA 4AX9H 1V3XA 3LIWA 4XDEA 1ZHPA 2F91A 2Y81A 2OK5A 1UK3A 1IQKA 1A0LA 2K8IA 3S9CA 1S5SA 1DFPA 4FU8A 3O8BA 3DSPA 4IC6A 4K8BA 1ANDA 2XCFA 1D3QB 2A4RA 2ANKH 3DFJA 3FZDA 3RUOA 1OWJA 2F3CE 3VXEH 2GVFA 3PV5A 2QGRA 1C2MA 1O2VA 4UONA 3P8GA 3TH2H 2ZNKH 2FI5E 3O8RA 1PPEE 1ZSKA 1JRSA 4JK5A 1SGIB 4GCHG 4NIWA 1VKYA 4HG6A 3U9AH 1O36A 2FP7B 2NU4E 5IDKA 5A0CA 4GHTA 1QBNA 2ZO3H 3E6PH 1GVZA 9ESTA 5AFZH 2VH6A 3VB7A 1EZXC 1ELGA 1XUFA 3UQVA 1MD7A 5FBEA 1ZMJA 3V12A 7GCHF 3RMOH 5EPYA 1S6FA 2C8WB 2AS9A 1DXPA 3ZZ9A 3BEFB 2HPPH 3RXEA 2J34A 1C4Y2 1Y3WA 4IN2A 1V2VT 1CGJE 2OC0A 6CHAB 1ZZZA 3SORA 1GJAB 1YPEH 2A31A 2WV9A 2ZDKA 3EGKH 3VPKA 3R0FA 3SBKA 1QIXB 5GIBA 1DE7H 4XBBA 4SGAE 1GJ9B 1C2JA 4RKOB 1QJ1B 1E79D 1H8ED 1BMAA 2QF5A 2ZHEH 2ASUB 1DLKB 5DG6A 5E0JA 3SO3A 5GWZA 4WXVA 1NTPA 3RXLA 1GGDC 4XBDA 1TPPA 4LK4A 2W7SA 2C8YB 2VWNA 1GBLA 3FN8A 4Z6AH 4NIXA 1T4VH 4ACAA 1PPFE 2L74A 2CN0H 4M9FA 1F7ZA 4THNH 2XXLA 1GHXH 5GDSH 1G2LA 2O8UA 1ELDE 4O3UA 1F0SA 1OWKA 1ZPCA 1OP8A 3SI3H 2O8MA 2OINA 1WYKA 4KKDA 2ANYA 1Z8JB 4FUIA 1ELTA 1RJXB 4XBCA 4IGDA 4NSYA 4I31A 3P6ZB 3TLOA 1F2SE 1TABE 1THPB 2V3HH 4BXSA 2G51A 2WSSD 1KDQA 2J92A 1BJVA 2R9PA 3A8AA 2ZU1A 1PPBH 4AFUA 3ZVEA 3FOAA 1YY3A 3ZZBA 1LKBA 3A7VA 4JZ1A 4LOYH 1AGJA 1GI4A 4I7YH 3F3BA 1KTSB 1O38A 3MH7A 2XC0A 1UMAH 4X6NA 5CE1A 1C1UH 1F0UA 2OC8A 2WPJS 1ELVA 1A5IA 1K1OA 5EXNA 1G9IE 2OTVA 2Q6DA 2P93A 1PPCE 1O2YA 2ZFTA 2CF8H 1FN6A 2VWMA 5IYTA 1ACBE 1P2JA 2TRMA 1O2JA 1FPHH 5C17A 3A85A 1IAUA 1KDQB 4B6EA 1SQRA 3GCTF 2EI8A 3RM0H 1O5BB 2GV6A 3TJOA 2PKSC 1TNJA 4E7RG 1LMWB 2BXUH 1C5NH 1F92A 3I78A 1FY5A 2FYRA 2Y7ZA 1TBQH 1C1VH 2EI6A 2ZTZA 2H6MA 2UUFB 4X8TH 1AMHA 1F5LA 3MNXA 3GY5A 3VB6A 4OS1A 1H4WA 3RXDA 2RCEA 1WOFA 1IQNA 4I32A 2B0FA 5EW1H 1T7CA 3A84A 1Q3XA 3TPIZ 1O5GH 1MABB 2ZDAH 4FVDA 3SU4A 2ZFFH 1AZZA 1QNJA 4CR5A 1MMJN 1HDTH 3F1SB 3ODFA 1BHXF 4F49A 4RN6A 4BANB 1WSSH 1CHOF 4YO9A 3PRDA 2ZFQH 1C5ZB 1MAYA 1AZ8A 2W3KA 3EQ0H 2FOGA 1CA0B 1G36A 2OP9A 3MI4A 1O2UA 1D6WA 1SGTA 5FBIA 3A80A 3OY6U 4ISOA 3FVFB 1O3KA 2FI3E 3KL6A 2BM2A 2CK3D 5FPYA 2FLRH 2QV1A 4CRFA 2BLQA 3M3VA 1ZTKA 4FUGA 3W1EA 1QL7A 3MTYA 1SGNE 3KNXA 1W3CA 3P8NA 3O8CA 3Q3KA 4INHA 3RXTA 4JZDH 1HAXB 3GYMA 3U98H 1V2ST 2PUXB 1YCPM 2RDLA 3NPSA 3TVJB 2XC4A 2LP6A 1O3PB 2QXGA 3GYLB 3GCHC 2R2MB 2AH4X 2VB0A 1GJ5H 3MO9A 2UUYA 2UWPA 2QAAA 2F9PA 2PUQH 4NZQA 1MCVA 3BN9A 4ZXXH 1MBMA 2DE9A 3GDUA 1ELEE 4JYUH 3SUGA 1P10A 2FXRA 1F5RA 2P16A 1BBRE 1YF4A 1O5AB 2WPMS 3T62A 4DVAU 1IQLA 5A2MH 2XYAA 3SGQE 5C2ZA 2FOFA 3SU2A 1BTHH 3Q3YA 1UO6A 2QA9E 2ZPRA 1C5LH 1L1NA 1LPZB 4NG9H 3MWIU 4RKJB 3UY9A 2K1QA 2VGCC 5E0GA 3ZZ8A 3RP2A 1C1PA 3MH5A 3MNBA 5CMXH 5BPEA 1ELAA 4X1NU 1V2UT 5CHBA 2HGTH 1AE8H 1ESTA 1ZOMA 2RG3A 1EAIA 8GCHG 2WYJA 3UREA 4MNXA 5EJLA 1FIZA 1ID5H 1LHGH 3UOPA 1WV7H 3QX5H 1HJAB 1MTSA 1TNGA 3ZZ6A 3BEIB 5CHAC 9LPRA 1O3JA 4B2BA 1FLEE 2G81E 1CQQA 3UUZA 2JDID 2HVXA 1Y8TA 2AERH 2VINA 3IWMA 2I6SA 1P0SH 1GI9B 3TITA 2SFAA 5A0BA 3K6YA 5K0HA 1P11E 1GBEA 1BMFD 2WINI 1O3AA 1MKXK 3BG8A 5C0UA 3TJUA 1W8BH 1T8MA 1XKBC 1G3EA 1O2RA 5TCCA 4DJZB 4U2WA 2EEKA 1OWDA 3PTNA 2PKAB 1O3BA 1J17T 1MZDA 4K60A 1A0JA 5J4SA 1HV7A 2GJGA 1TPSA 3RU4E 3V13A 1GJ6A 1C1NA 2WUCA 2BDHA 4WMFA 4O97A 2A7JA 5IK2D 2NWNA 3AVZA 4NGAH 3BEUA 2VWOA 1SSXA 2ZPQA 2AHME 5C3NA 4WH8A 1C2GA 3GISB 3MMGA 3BTME 1HIAA 2HLDD 2WPIS 1YYY1 4DG4A 3RMLH 5EPNA 1CU1A 1ETRH 3PM3A 4PROA 2Y82A 2VIQA 4AGKA 2RDEA 2GT8A 1P12E 2GCTB 2OUAA 1C5TA 4I86A 3SN8A 3RXPA 1BTUA 1Y5AT 1A46H 2F9VA 4BAHB 2J94A 5A09A 3GDSA 4RT0A 5CDFE 2ESTE 1XXDA 5DPAA 1BHXB 2A7CA 4ABBA 3EAJA 1EPTA 4FUDA 2HVYB 3RM2H 5FX6A 1AY6H 6GCHG 2NU2E 2J98A 5T6FA 5JBCS 4FU9A 4BTTB 1RIWB 1NU9A 4ABGA 4D9QA 4A1XA 1HIAB 4I8LA 2GV7A 4K8YA 2FOAA 3PLPA 1Z1IA 1GBFA 1IQHA 2QY0B 1EASA 3M5MA 5B6OA 1WU1A 3DUXH 1VITG 4UE7H 1CVWH 3LT3A 1OHHD 3ELAH 1DX5M 1OXGA 2WZQA 1G30B 1QRWA 2P3UB 3P92A 4XD7D 4M7GA 2XTTB 1ARBA 1V2KT 3SJOA 2FEQH 2SNVA 5FPSA 3ZVCA 1GG6B 4K3JA 1W0JD 1KLJH 1QJ6B 1CA0C 1SGEE 4I8KA 3T2NA 3BTHE 4UFGH 1DSUA 1EPTB 1C5UA 1MTVA 3PB1E 5KECA 2GDEH 2J2UA 1Y5UT 2ZG0H 1BT7A 4K2YA 1FY3A 2BD5A 4ZCNA 2G52A 1O2QA 3K9XB 2J98B 4CHAB 2P59A 4X1SU 2ZECA 2ZHWH 3A7TA 3SNCA 3P8OA 1D3DB 1P06A 1WXRA 1VGCB 1OYTH 1SVPA 1SGYE 2XWBI 4CBNA 4YT6H 3HK3B 3KCGH 1M9UA 3ZVBA 2P94A 3AAVA 1N8OB 1KXAA 1HPGA 2HPQH 7ESTE 1GI0A 1O3GA 1DITH 2W6JD 1GBBA 3QO6A 2ZTYA 2R3YA 2O9QA 2YNBA 3QWCH 1XUIA 4KTCA 4DIHH 4TYDA 2ZCHP 2HWLB 1QJ7B 1YPHC 5HXFA 3MH4A 1IOEA 3UAIC 1YWUA 4O03A 2A7HA 2GD4B 1FY1A 3SGAE 1BCUH 1C4U2 1OKXA 1OWHA 4NWLA 1COWD 3UWJH 3VB5A 1FNIA 1GBMA 5ABWA 1H8DH 1MBQA 1C2EA 4B1TA 4A6LA 4OGYA 3PMAB 1HXFH 2XOKD 1SI5H 2P95A 3M7QA 2AFQB 3E3TA 2FI4E 2FYQA 3LJJA 2ZA5A 3LDXH 3RXVA 2P8OB 4P02A 3MO6A 1O2ZA 4IC5A 1AIXH 1AI8H 1KY9A 1MH0A 1FY8E 1TX6A 5GCHG 1W2KH 3F2FA 4NIVA 1HJAC 2XBWA 4ABIA 1LCYA 4Y71A 1CGHA 1J16A 3DSOA 1V2LT 1Z7KA 4ZAEA 1MQ5A 5DGJA 3E90B 1PPZA 1LHDH 4AG1A 1GMCF 1INCA 3ZZ4A 3ODDA 4DGJA 3KYFA 4B2CA 1C1WH 5C20A 1ARCA 1BRAA 4UFDH 2BX4A 2OC1A 1RTKA 2Z9IA 3A7XA 5JBBS 1Z1JA 3MNCA 1BB0B 3F68H 3PWBA 5GXPA 1SFIA 2ZCLP 1LVOA 1GJ7B 1X7AC 2VVCA 3SHAH 2FS8A 2Z9LA 4GSOA 1UK4A 3SU5A 1DOJA 2W7UA 5EW2H 2D1JA 2A2QH 1P01A 1UVPA 2GCHF 3GY7A 1EP5A 4P00A 4WJG2 4DCDA 1CA8B 1K28D 3SI4H 1GJDB 3SGBE 3U1IB 2W26A 1ELBA 1FZZA 1AN1E 3DT0H 3IITA 1J14A 1P57B 1NESE 1HJ8A 5ESTE 1O2NA 2BY9X 3BSQA 1BRUP 4YT7H 1BMLA 4MPVA 5C1UA 2Z3CA 2GCTC 5HMAA 1SHHB 4R0IA 4H6SB 4ZROA 5T1VA 2B7DH 1EAWA 1CBWB 1BJUA 3OE7D 3SU3A 2BVXH 1P8VC 3ZVDA 2VVUA 4CR9A 3MHWU 1K22H 3ZV9A 4AN7A 1HXEH 5FCKA 2SGFE 2HNTC 3FP8E 4YTAA 1YLCA 1RIWC 1AB9B 2LPRA 1V2WT 3FP7E 4ABFA 4TPYA 1ZR0A 3D23A 4MPXA 1UJ1A 1NS3A 1QRXA 2V7QD 1ANCA 1LKAA 3NRLA 1JWTA 1BTZA 2EC9H 1LVMA 5GNDA 3H7OA 4GAWA 2BQ6B 1O2LA 3FANA 2D2DA 2D8WA 3TK5A 4ZMAH 1T8LA 2HOBA 3SJIA 3U8OH 1AE5A 2FO9A 3MNSA 3RXRA 1GHAG 1TA2A 4NIYA 2TBSA 2FOBA 3H7TA 1A61H 4FUEA 3SW2B 2F9UA 4RI0A 5EXLA 3BF6H 2FOMB 4HFPB 3FP6E 1C5RA 1AD8H 4AFSA 2J9NA 1L1JA 2GDDA 1OP2A 1TNHA 3M3SA 2EQNA 4UDWH 4CH8B 2ZU3A 1GHVH 4NA7A 1GHWH 4A1TA 4WMEA 1GBIA 2KCPA 1UTLM 5F53A 1C1MA 1BQYA 1O3MA 1H1BA 1D9IA 3LONA 1VGCC 1NN6A 1AQ7A 4MLFB 4K5ZA 1S6LA 1GBCA 2PP6A 1NFYA 1O39A 2KCYA 2A4GA 1AVWA 5T3HA 1RTFB 3SQEE 3OEHD 3FO8D 5J4QA 1HGTH 1SLWB 1DANH 1FN8A 1TYNA 4OS2A 4D7GA 1VCWA 2THFB 4MPUA 4K1SA 2IJD1 3STIA 2ZFPH 1UTMA 1K9OE 1A5HA 1WAYB 5EQSA 1KTTB 2FOEA 1JOUB 1GWAA 1TB6H 1FY4A 2ANWA 1TPAE 4IMQA 1GDQA 4DOQA 1SGRE 1KXFA 1YM0A 1BTYA 3K2UA 3GOVB 1VCQA 3EE0B 1TNLA 5C67A 1AO5A 5C1XA 5ETXA 1NFWA 1EAUA 2FIRH 1K21H 2ZFRH 2L6OA 4Q4LA 4E7NA 1NBMD 2AGGX 4D7FA 3GY6A 4AFQA 1NFXA 3KQDA 3BTEE 3A89A 2V3MA 3OTPA 1ZSLA 4OM9A 3WWBA 1J8AA 1NRPH 5A8XA 2A0QB 2GX4A 4JMYA 1K1IA 2W6ID 1CHGA 1O5CB 3U1JB 5DJ7A 1UTQA 2C8XB 4Z1MD 3SV7A 1D4PB 1E35B 1FV9A 1XX9A 4JK6A 5C5OA 4CH2B 3S7KB 1SQTA 1DLEA 3M3TA 2GMTB 5EQRA 1YBWA 5TCAA 4XOJA 3UIRA 4X2YA 1EJAA 3ENSB 2CXVA 1WCZA 1EFRD 1ZMNA 1UTPA 1THSH 5E0HA 1GI6A 3SU1A 8ESTE 1ZPBA 2VJ1A 3ITIA 1NY22 4GHQA 5DP9A 1L4DA 4NCYA 1O3NA 3BV9B 4YLQH 1TGBA 1UCYH 1AUJA 2C4FH 1QBOA 3L33A 3T26A 2A4OA 3UTUH 1TX7A 5DN6D 2ODPA 2BMGB 2FLBH 2W3IA 2XWAA 2V3OH 3F6UH 1SR5C 1GMDF 3S69A 1JIMA 3MQKC 3T29A 1TRMA 5JBTA 1HAIH 1T8NA 2ZHQH 1FMGA 3SNBA 3MH6A 1DPOA 1EOLA 3JZ2B 4BAMB 5DP5A 5H4IB 1BUIA 1NPMA 5HM2A 1SG8B 3UB0A 1TRNA 1ZJKA 4B76A 1H9IE 2B8OH 2FDAA 2SGDE 1LVYA 3JZ1B 1S6HA 2Y5GA 4ESTE 1GVKB 3RXJA 5KGOA 4GLYA 1CBWC 1SGCA 1BTXA 1O2PA 1O3DA 3ZZAA 4ZHMU 2QF0A 2ANMH 1UVSH 2XCNA 5DSFA 1SQOA 3SV9A 1B5GH 2YNAA 2BQWB 2O8WA 2PFEA 2WPDD 1P3EA 3M7TA 1J9CH 3UPEA 2XNDD 2ZGHA 3ZYEA 5HM9A 1P05A 3EA8A 4MNVA 3VGCB 2BVRH 4AB8A 1GHZA 1TA6A 4ZH8A 2JIZD 2ZEBA 1XMNB 2Z9GA 1L4ZA 1SGFG 3CP7A 3Q77A 1V2QT 3FFGA 1W7GH 3RXMA 4KTSA 1AUTC 1P09A 1Y59T 5EG4A 5L6NH 2ZZUH 2I6QA 4Y10E 3ATWA 1O2HA 1BTWA 1BDAA 4ACBA 2Z9KA 2Z9JA 2EI7A 3CNRA 4K1EA 3RXUA 3GY4A 5AFYH 1DDJA 5LPFA 1XVOA 2BDIA 1GI5A 1OPHB 2XRCA 1QB9A 4Q63A 3F0OA 1ZJDA 1UTKA 1O2WA 2OD3B 1P03A 1GCDA 4D8NA 4CBOA 1CT0E 3PMJA 4AORA 1CO7E 2JETB 2KX4A 4GUXA 1NC6A 1K1LA 2A45B 3PLBA 3MU0A 2H5DA 3E8LA 4J2YB 6CHAC 2WV5A 4GCHF 4IS5A 1GHAF 1A4WH 2J95A 1GDNA 1C2LA 2WUBA 3HGNA 1KYNA 3ATLA 1DXWA 5E2PA 1EQ9A 3V0XA 1ZMLA 4LZ4B 4Y6DA 1HAOH 5DKMA 3LGTA 1TLDA 4I8GA 3E16B 1YPHE 1N6XA 2PKAA 5JBAS 4BTIB 1C5MD 3V7TA 1C2KA 3M5NA 5EXMA 1V2OT 3EE7A 5C5NA 5PTPA 2G00A 1PJPA 1TIOA 2H5CA 4ASUD 4O3TA 8LPRA 4A1VA 1T8OA 1Z8IB 2WHXA 3B9FH 1SB1H 2ZHDA 4H6TA 3SJ8A 3T5FH 5JDUB 3E0NB 2CHAB 3QZQA 2OQ5A 3S7HB 2AMDA 3LGVA 1O3CA 1OSSA 3URCA 2A2XH 3GICB 1CT2E 1A0HB 2H9HA 1TNIA 1CE5A 1UVUH 3OYPA 4CRGA 1QB6A 2ALPA 3N7DA 1C1TA 1DY9A 4VGCB 3UR6A 1FAKH 2O8LA 4ZKNU 1PQ8A 2H2ZA 1RGQA 1EZQA 3MOCA 1DS2E 3U8TH 3SNEA 1WBGB 1O35A 3GY8A 2GMTC 1A2CH 1BIOA 3BTFE 1O33A 5LH8A 5F8TA 3A81A 3AK5A 2ZFSA 2JH0D 2EY4C 2HALA 3LC3A 2VWLA 3ATKA 1SGQE 2JKHA 5C0TA 1XVMA 3KQCA 4RT1A 1SLUB 1GL1A 3TH4H 1TNKA 5KEDA 1KXBA 4ABAA 4BAKB 1OP0A 1XKAC 2TGPZ 1NRRH 3RMMH 3KN2A 2A4QA 3P95A 2WPLS 4DIIH 2A5IA 1SMFE 1A7SA 5E8EH 2DE8A 4B74A 4MQAA 4X6PA 2G5NA 4A92A 4ASHA 2VNTA 4YOIA 1FDPA 1FIWA 2BQ7B 3PRBA 3IG6B 1C5XB 2OXSA 3OX7U 4KTUA 4U01A 5FL7D 2J4IA 2C93B 1AHTH 1QGFA 3RXKA 2PTNA 5DP4A 1EJNA 2B9LA 1LQDB 2J97A 1PFXC 1W12U 3OTJE 1EJMA 2UWLA 2AIQA 3P70B 1DUEA 1GJBB 2G8TA 1UTNA 1WTHD 1IQJA 3W95A 3M61U 4UFFH 3DA9B 1V6DA 2ZGJA 3Q00A 1P9UA 2AGEX 4Y11E 2ODYB 2JJ2D 1O3FA 2Z3EA 1O2TA 1GBJA 1P2IA 3A82A 1FAXA 1P2OA 3RC5A 1AKSA 2PV9B 1IHTH 3GY3A 1W10U 2O8TA 4NA8A 4HZHA 5HGGA 4FUHA 2ILNA 3I29A 2ZU5A 4YLUA 3A7WA 4NFEA 4Y7BA 2K0QA 4TPIZ 1L2EA 1S0RA 1BMNH 2QE7D 2HNTE 4AC9A 1IQIA 1YCPH 1LDTT 1O31A 1O2IA 4ZUHA 6ESTA 1O34A 2IPHA 2HLCA 1RD3B 4KELA 1B7XB 3SU6A 1MKWH 4XFQA 1GBTA 3VGCC 1N6YA 2VBCA 1O2KA 2BY7X 3UR9A 1NRNH 1YC0A 3EDXB 1NRSH 3UOUA 3UQOA 1AKSB 1QL8A 1H8HD 3K65B 3BG4B 1B0EA 7KMEH 1YGCH 1LTOA 4I8JA 1VCPA 2Y5FA 3TNTA 4U30A 1W11U 1E36B 1QA0A 1GJ4H 2OLGA 4UFEH 5DO4H 3MFJA 4Y76A 3TIUA 1CT4E 2FESH 4OS4A 2F4LA 2QF4A 1GI3A 3F2HA 5BRRE 1Q31A 1JIRA 4ISNA 5EU8A 2KCAA 1TGSZ 4AGJA 2FOHA 2FS9A 1S82A 3BTWE 1NM6A 2JETC 1WQVH 5JB8S 1QR3E 1QCPA 5F8ZA 4AYYB 3O8DA 1HJ9A 2GZ7A 4JZFH 5C94A 2FX6A 2BY6X 4JZIA 1O2SA 3PYHA 3H09A 2Q1JA 4A5TS 3A87A 5HKKD 1IQFA 3HKIB 3RMNH 3SUEA 4WY3A 1O5EH 2BZAA 3GY2A 4FETA 1C5YB 1UCYK 1GGDB 1MTNB 1AVXA 4Y8YA 3ATIA 4JZEH 4B73A 4BNRA 4ISIH 1O2XA 4AFZA 2GZ9A 1S84A 1V2PT 2BD8A 3UWIA 5DP7A 3Q76A 2PSXA 5GJ4B 3NCLA 1Q2WA 5G4BA 4ZXYH 2FPZA 1XUJA 4X1QU 1UVOA 3STJA 2ZCKP 3SUFA 3S9BA 4AYVB 5EJZA 1ZSJA 1TAWA 4XE4A 1BRBE 1G32B 1O3IA 4KP0A 2CHAC 2NU1E 3WW7A 3VFEA 1T4UH 4X0WU 5TJXA 2QXHA 4BAOB 1GBDA 3DCLA 1C5OH 3MYWA 2BDGA 8GCHF 3GCNA 1TONA 1K0HA 2QXJA 3LGUA 3T28A 1MZAA 4WMDA 4ABDA 4YXWD 1GI7B 1C9PA 1HNEE 3OEED 2BD9A 2PW8H 3GCTG 1GBAA 1QZ8A 2BB4A 3LGWA 2Y5HA 4VGCC 1J15A 1JXPA 4FXGH 3PV4A 2ZDNA 5DP6A 1C4V2 3GDVA 3RXGA 3AW0A 4Y8XA 2GKVE 2VIPA 4X2WA 1ABJH 3LKWA 3M5OA 4AZ2B 1KSNA 4F4OC 2H1UA 1TOMH 4IMZA 2F9BH 2QXIA 1C2IA 1ELFA 4X6OA 2B5TB 1O2MA 2R2WU 1G37A 3MU8A 4GVUA 2ZTXA 3WY8A 1QURH 5F8XA 3PWCA 2FTMA 1DSTA 2J38A 3RXFA 4AG2A 3SV2H 1WDIA 3EYDA 1GPZA 4D76A 1CHOG 2AGIX 3LH3A 2QN5T 4GPGA 1SHYA 1ZGVA 1P02A 1S85A 3RC6A 1Z6EA 3PTBA 2F9OA 3D49H 1EXFA 4MTBA 3D65E 1C1RA 1C5WB 2Y6TA 5HIZA 4K69A 3HATH 2PSYA 1SL3A 1SPJA 3AAUA 1Y3VA 2ZGBH 3F9GA 1MU8B 1T32A 1B0FA 2P3TB 3DSGA 1RTLA 2DUCA 2F83A 3PV2A 4F48B 2AYWA 2CJIA 2BZ6H 1KXDA 4X8VH 3HGPA 3I77A 3QN7A 5LGOA 3QGNB 2ZDVH 3TNSA 3ZZ3A 1L1GA 2PR3A 2BDBA 1EZUC 4BTUB 2CMYA 2P3FH 5E2OA 1FONA 1JBUH 2CGAA 5DP3A 1GG6C 4I8HA 1HCGA 3CS0A 1E0FD 3NWUA 2FM2A 5K7RA 3FAOA 2PGQB 4E05H 6GCHF 1QBVH 1MCTA 1EPTC 5L30H 3TJNA 3EA7A 3VB3A 2FOCA 4H42U 2KCOA 1TWXB 3AW1A 3TJVA 1XUKA 1OWEA 2WPHS 1QRZA 4CHAC 1A1RA 1MU6B 2PTCE 1VITF 1C2DA 3PMHB 4ZHLU 1UTJA 1TFXA 4X8UH 4OS6A 3UNSA 3QTOH 2KR7A 2ZGCA 1K1PA 3GCHB 3BG4C 1EB1H 3A7ZA 4Y7AA 1K1NA 1Y5BT 3HK6B 4ABJA 1QQUA 2Z94A 1YLNA 1Z8RA 2IPQX 3K6ZA 1F0TA 1G3DA 1N8OC 4OS5A 4FOUC 1SOTA 2QC2A 3LPRA 1ELCA 2BTCE 2ZIQH 2UUJB 1H9HE 2H9EH 3Q3XA 4TWWA 1Z71A 3N99A 2SGPE 1IHSH 2BLWA 1QFKH 4HI3A 1NT1A 1JMOH 2V35A 3PO1B 3LC5A 4INKA 2VGCB 2JH6D 4TT3D 2WPKS 3A83A 2V6NA 1VJ9U 3BIUH 1BOQA 2ZWLH 8KME2 1H9LB 5LPEA 3F2GA 1E1QD 5GPIB 2YOLA 1ZRBA 4Q7YA 1AVGH 5I46H 1PQAA 1ZYOA 2VH0A 3TGIE 3A8BA 5FHTA 1MTNC 4YOJA 4X1RU 2P8OC 5CHAB 1O3HA 2C8ZB 3C27B 3N7OA 1GMHG 2G5VA 2BX3A 1HFDA 1JRTA 3AASA 1ETTH 1SGPE 4CRAA 3F9FA 5ESBA 1KXCA 3KQBA 1OWIA 1KIGH 3LOXA 4SGBE 1G3CA 2JJ1D 3E91A 1N1LA 2HRVA 3B8JA 4JYVH 2QIQA 4X2VA 3TK6A 7LPRA 1RFNA 1TGNA 2ALVA 3SZEA 1C2HA 2YMSD 2PGBB 3VXFH 3QDZB 1FPCH 3U69H 1YP9A 1XXFA 4X8SH 5JPMH 3TGJE 2BLVA 1LHCH 2BYAX 2GTBA 5GCHF 3PMBB 1TX8A 1HAYB 2OBOA 4BAQB 4TY7A 1Z6JH 2ZC9H 4XRNA 2XC5A 6LPRA 1O32A 2TPIZ 1GJCB 1YCPK 2BD3A 3RLWH 3FZZA 3MU5A 4MNWA 5L2ZH 1G3BA 3M37A 4Q7XA 1TALA 2ZDMA 1P2QA 4ISHH 1MKWK 4JYTA 4TY6A 1L0ZA 3WWFA 2CV3A 1K2I1 2ZI2H 3QTVH 3OFND 2Y7XA 1BA8B 3SU0A 1ANEA 2XW9A 1AFEH 1PQ7A 3M36A 4AOQA 1K1JA 5EIYA 3TGKE 1IQGA 2STAE 1VJAU 1HB0B 3A88A 3S9AA 1AU8A 1ESBA 2TGDA 4ZHAA 4ZKRU 3HPTB 1D6RA 4Q2KA 2SGQE 2BVSH 3D62A 2R0KA 5A8ZA 4YOGA 2ZU2A 1C5SA 2NU0E 2W5EA 2FWWA 3B23B 2KZ4A 3T25A 5FXLA 1P2KA 1UCYE 4Y8ZA 1NBME 1O2GH 4DT4A 1MTWA 4UEHH 4J1YA 1HLTH 4IBLH 1P04A 1K1MA 1GBHA 2YMSB 2M5TA 4ZKOU 2V0BA 4YZUA 1TQ7B 1SBWA 3BTQE 3SUDA 1VITH 4ABHA 3SNAA 1AB9C 2J5UA 1O0DH 1SC8U 1WTGH 4FUBA 3KF2A 3QK1A 3OSYA 4X2XA 1LPGB 2HNTF 1W0ZU 3ZZCA 2ZKSA 2UUKB 4CRCA 1PPGE 2KAIA 3ZZ7A 4MG3A 3KYGA 1MD8A 2STBE 5DK1A 1DWCH 1BBRH 3A8DA 2SGAA 1D3PB 1QL9A 3SOSA 1S83A 4LXBH 1GCTB 1Y3YA 1DWEH 1O2OA 4LZ1H 1V2JT 3G01A 1D3TB 2XBYA 1FQ3A 4NSVA 1O5FH 3U8RH 1BTPA 1KLIH 5T6DA 1DY8A 1GL0E 2Z6BD 1HAVA 1Y3XA 2QF3A 3W94A 3SYJA 3QZRA 4HGCA 1W13U 4E06H 3RU4D 1C1SA 1SQAA 3NUMA 4MVNA 1NO9H 1ZRKA 3ESTA 2ULLA 1HUTH 5DP8A 3P17H 3UNQA 3KEEA 4YM9A 3RXOA 3BTTE 3SV6A 2KAIB 1GJ8B 1YPKH 1PYTD 1ZPZA 3L6PA 1A3BH 4Y0YE 1GI2A 1O30A 3TU7H 1C9TA 1Z8GA 2WV4A 3H5CB 5FX5A 4DT7B 1VR1H 2KM0A 3PO1C 3UNRA 3RXSA 3ZIAD 2OCVB 1TOCB 5AF9H 3NZIA 3SJKA 1KXEA 1GMCG 1QB1A 1HAVB 2C3SA 1OS8A 4FUJA 1W7XH 3KQ5A 4B6FA 4CRBA 2H9TH 4DY7B 2XBXA 2D26C 1GI8B 1HAHH 4ZKSU 3GCOA 3L3TA 2TIOA 2TGTA 3QLPH 1C1OA 2LNCA 1NFUA 2R3UA 1SGDE 2A5KA 5F6MA 1UVTH 2GP9B 3NKKA 1MUEB 2A1DB 2OBQA 2AEIH 3QUMP 1A3EH 1CSOE 3MU4A 3S0NA 2ZU4A 1P2NA 1FJSA 1C5PA 2GCHG 1AFQB 1TMBH 3ZVGA 4R8TB 2A32A 3PLKA 1GHBG 1YPGH 3KQEA 2BD4A 5B6LA 1EZSC 2Q6FA 4WXIA 4Y0ZE 1BMMH 3HKJB 3RXCA 3RXIA 1ETSH 3F9EA 3ZVFA 1DWDH 1XUGA 1LO6A 3SZNA 1GMHF 2R0LA 4IN1A 1MQ6A 3KHVA 3SV8A 1HYLA 1U6QA 3DHKH 1F0RA 1EKBB 4UD9H 1TBZH 5T6GA 1HAZB 4WH6A 1BZXE 3OU0A 5AVDA 1DUAA 1ANBA 1P2MA 1V2RT 1YPJH 2M2AA 3DFLA 3MO3A 3BIVH 5FCRA 1C2FA 2VIWA 2F43B 4FUCA 1MTUA 1W0KD 4MPWA 3OAAD 4TSFD 5JYIA 2BY8X 3RDZA 4FUFA 3SJ9A 1E38B 2BDYA 1S0QA 2RA3A 5I25A 1DM4B 1O5DH 1OOKB 2OC7A 4F55A 1C5VA 1F5KU 2VIVA 3NXPA 1EP6A 3FKSD 2VIOA 2ZGXH 3F9HA 1KLTA 1EX3A 1Y3UA 2XNIA 3T27A 2Q6GA 4Q7ZA 1HBTH 1SLVB 4OGXA 2GGVB 3VEQB 1RS0A 1ZGIA 1EATA 1E37B 1XUHA 1C1QA 1UW7A 2PHBA 3VG8A 1RRKA 4IW4E 1FXYA 2YMSC 3A8CA 5C1YA 3V3MA 4AB9A 1TGTA 4B71A 7GCHG 4MDSA 5HYOA 3N7EA 2WYGA 4DW2U 1AWFH 3RXAA 1NROH 2RA0A 4YESB 1V2MT 3RXBA 2BLOA 1FUJA 4OS7A 4U32A 3ZZDA 3BTKE 1OYQA 4MNYA 3BTDE 1QA7A 3ATMA 4DURA 2G4UA 3CS7A 2ZHFH 1YLDA 1P3CA 2RFKC 3ZV8A 4X1PU 1DVAH 1OX1A 4O9VA 3NK8A 3UFAA 2VU8E 3ZVAA 2G55A 5EOKA 2PLXA 1ZHRA 5L2YH 2KFWA 4CREA 4TWYA 1SLXB 2GT7A 4WVPE 1GVLA 1TBRH 5SGAE 2BDAA 1YKTA 1P9SA 1LHFH 4Y79A 3ZZ5A 2QCYA 3R3GB 1GCTC 3OY5U 5F03A 3DD2H 1YPLH 3E1XB 1ORFA 5EGMA 2EA3A 3VB4A 1XM1A 4X6MA 1O3OA 2NU3E 1AWHB 4FU7A 4ISLA 1W14U 2BXTH 1EUFA 2UWOA 3KIDU 2AIPA 5LPRA 2Y80A 3CENA 3E0PB 3TK9A 1QQ4A 4B2AA 1UK2A 1BRCE 1MAXA 3LGIA 2BOKA 3LGYA 4JCNA 1ABIH 2F9NA 2GZ8A 4Q80A 2ZQ2A 4CRDA 1QTFA 1LQEA 3F0PA 1THRH 1O3LA 1EAXA 1LPKB 5EODA 5EJ1A 3M7UA 4NFFA 4ABEA 2ZF0H 1WQSA 3RU4T 2ZP0H 4INLA 1V2NT 2BOHB 1QHRB 2OQUA 1HRTH 1ZHMA 4KGAA 3P8FA 1A5GH 4RSPA 1EB2A 1TMTH 1PPHE 3SHCH 1FI8A 2QYIA 1TMUH 2ZQ1A 2FTLE 2ZDLA 4Z0KA 1FX0B 1CGIE 2FZZA 1DT2A 1TRYA 2IN2A 4K1TA 2IOTA 1UTOA 1NRQH 1S81A 1KMHB 2LELA 2IJOB 1SFQB 2PWXA 4HTCH 2Z7FE 2C90B 2FX4A 1HAGE 1ZTLA 3SQHE 4H4FA 4BXWA 3LJOA 4NA9H 4BOHA 1GBKA 3TH3H 1IQMA 3BTGE 2BD2A 1GMDG 2CF9H 1AFQC 1DICA 1ZLRA 1V2TT 1TGCA 3A7YA
chains in the Genus database with same CATH topology
3LU9B 5FAHA 1YPMH 2G4TA 3KGPA 2SGEE 1TE0A 2SNWA 1RXPA 3EA9A 1PYTC 3LH1A 1GHYH 1E34B 5JB9S 4B75A 3RLYH 3M5LA 4XSKU 1GDUA 5A0AE 1DWBH 1LHEH 1W0YH 2AMPA 1NU7B 2A5AA 3C1KA 3RC4A 1UHBA 1PQ5A 3MU1A 1O37A 3URDA 1BBRK 3RXHA 5EQQA 2PKSB 1C5QA 3A86A 2BHGA 1IQEA 1HAPH 3PROA 2ODQA 1TPOA 4WF8A 1NZQH 4NWKA 2FMJA 2XBVA 2VVVA 1GHBF 2TGAA 2FODA 1GI1A 1G2MA 5FPTA 2BDCA 1LVBA 4A7IB 1EOJA 4QT8C 4D9RA 2AMQA 1BITA 1MKXH 3QGJA 1QY6A 2Z3DA 1TQ0B 1SOZA 2ZPSA 5A8YA 1ZTJA 1O3EA 1VZQH 4NZLA 4WWYA 4FVBA 2JH5D 1H8IH 3ZYDA 2VIDA 3RXQA 2BD7A 2BY5X 5AHGH 1ESAA 1UHBB 1WUNH 4I33A 1T31A 1SGFA 3M35A 3SNDA 4AX9H 1V3XA 3LIWA 4XDEA 1ZHPA 2F91A 2Y81A 1UK3A 1IQKA 1A0LA 3S9CA 1S5SA 1DFPA 4FU8A 3O8BA 4IC6A 4K8BA 1ANDA 2XCFA 1D3QB 2A4RA 2ANKH 3DFJA 3FZDA 3RUOA 1OWJA 2F3CE 3VXEH 2GVFA 2QGRA 1C2MA 1O2VA 4UONA 3P8GA 3TH2H 2ZNKH 2FI5E 3O8RA 1PPEE 1ZSKA 1JRSA 4JK5A 1SGIB 4GCHG 4NIWA 3U9AH 1O36A 2FP7B 2NU4E 5IDKA 5A0CA 4GHTA 1QBNA 2ZO3H 3E6PH 1GVZA 9ESTA 5AFZH 2VH6A 3VB7A 1EZXC 1ELGA 1XUFA 3UQVA 1MD7A 5FBEA 1ZMJA 3V12A 7GCHF 3RMOH 5EPYA 1S6FA 2C8WB 2AS9A 1DXPA 3ZZ9A 3BEFB 2HPPH 3RXEA 2J34A 1C4Y2 1Y3WA 4IN2A 1V2VT 1CGJE 2OC0A 6CHAB 1ZZZA 3SORA 1GJAB 1YPEH 2A31A 2ZDKA 3EGKH 3VPKA 3R0FA 3SBKA 1QIXB 5GIBA 1DE7H 4XBBA 4SGAE 1GJ9B 1C2JA 4RKOB 1QJ1B 1BMAA 2ZHEH 2ASUB 1DLKB 5DG6A 5E0JA 3SO3A 5GWZA 4WXVA 1NTPA 3RXLA 1GGDC 4XBDA 1TPPA 4LK4A 2W7SA 2C8YB 2VWNA 1GBLA 4Z6AH 4NIXA 1T4VH 1PPFE 2CN0H 1F7ZA 4THNH 2XXLA 1GHXH 5GDSH 1G2LA 2O8UA 1ELDE 4O3UA 1F0SA 1OWKA 1ZPCA 1OP8A 3SI3H 2O8MA 2OINA 1WYKA 4KKDA 2ANYA 1Z8JB 4FUIA 1ELTA 1RJXB 4XBCA 4IGDA 4NSYA 4I31A 3P6ZB 3TLOA 1F2SE 1TABE 1THPB 2V3HH 4BXSA 2G51A 1KDQA 2J92A 1BJVA 2R9PA 3A8AA 2ZU1A 1PPBH 4AFUA 3ZVEA 3ZZBA 1LKBA 3A7VA 4JZ1A 4LOYH 1AGJA 1GI4A 4I7YH 1KTSB 1O38A 3MH7A 2XC0A 1UMAH 4X6NA 5CE1A 1C1UH 1F0UA 2OC8A 2WPJS 1ELVA 1A5IA 1K1OA 5EXNA 1G9IE 2OTVA 2Q6DA 2P93A 1PPCE 1O2YA 2ZFTA 2CF8H 1FN6A 2VWMA 5IYTA 1ACBE 1P2JA 2TRMA 1O2JA 1FPHH 3A85A 1IAUA 1KDQB 3GCTF 2EI8A 3RM0H 1O5BB 2GV6A 3TJOA 2PKSC 1TNJA 4E7RG 1LMWB 2BXUH 1C5NH 1F92A 3I78A 1FY5A 2FYRA 2Y7ZA 1TBQH 1C1VH 2EI6A 2ZTZA 2H6MA 2UUFB 4X8TH 1AMHA 1F5LA 3MNXA 3GY5A 3VB6A 4OS1A 1H4WA 3RXDA 2RCEA 1WOFA 1IQNA 4I32A 2B0FA 5EW1H 1T7CA 3A84A 1Q3XA 3TPIZ 1O5GH 2ZDAH 4FVDA 3SU4A 2ZFFH 1AZZA 1QNJA 4CR5A 1MMJN 1HDTH 3F1SB 3ODFA 1BHXF 4F49A 4RN6A 4BANB 1WSSH 1CHOF 4YO9A 2ZFQH 1C5ZB 1MAYA 1AZ8A 2W3KA 3EQ0H 2FOGA 1CA0B 1G36A 2OP9A 3MI4A 1O2UA 1D6WA 1SGTA 5FBIA 3A80A 3OY6U 4ISOA 3FVFB 1O3KA 2FI3E 3KL6A 2BM2A 5FPYA 2FLRH 2QV1A 4CRFA 2BLQA 3M3VA 1ZTKA 4FUGA 1QL7A 3MTYA 1SGNE 3KNXA 1W3CA 3P8NA 3O8CA 3Q3KA 4INHA 3RXTA 4JZDH 1HAXB 3GYMA 3U98H 1V2ST 2PUXB 1YCPM 2RDLA 3NPSA 3TVJB 2XC4A 1O3PB 2QXGA 3GYLB 3GCHC 2R2MB 2AH4X 2VB0A 1GJ5H 3MO9A 2UUYA 2UWPA 2QAAA 2F9PA 2PUQH 4NZQA 1MCVA 3BN9A 4ZXXH 1MBMA 2DE9A 3GDUA 1ELEE 4JYUH 3SUGA 1P10A 2FXRA 1F5RA 2P16A 1BBRE 1YF4A 1O5AB 2WPMS 3T62A 4DVAU 1IQLA 5A2MH 2XYAA 3SGQE 5C2ZA 2FOFA 3SU2A 1BTHH 3Q3YA 1UO6A 2QA9E 2ZPRA 1C5LH 1L1NA 1LPZB 4NG9H 3MWIU 4RKJB 3UY9A 2K1QA 2VGCC 5E0GA 3ZZ8A 3RP2A 1C1PA 3MH5A 3MNBA 5CMXH 5BPEA 1ELAA 4X1NU 1V2UT 2HGTH 1AE8H 1ESTA 1ZOMA 2RG3A 1EAIA 8GCHG 2WYJA 3UREA 4MNXA 1FIZA 1ID5H 1LHGH 3UOPA 1WV7H 3QX5H 1HJAB 1MTSA 1TNGA 3ZZ6A 3BEIB 5CHAC 9LPRA 1O3JA 4B2BA 1FLEE 2G81E 1CQQA 3UUZA 2HVXA 1Y8TA 2AERH 2VINA 3IWMA 2I6SA 1P0SH 1GI9B 3TITA 2SFAA 5A0BA 3K6YA 5K0HA 1P11E 1GBEA 2WINI 1O3AA 1MKXK 3BG8A 3TJUA 1W8BH 1T8MA 1XKBC 1G3EA 1O2RA 5TCCA 4DJZB 4U2WA 2EEKA 1OWDA 3PTNA 2PKAB 1O3BA 1J17T 1MZDA 4K60A 1A0JA 5J4SA 1HV7A 1TPSA 3RU4E 3V13A 1GJ6A 1C1NA 2WUCA 2BDHA 4WMFA 4O97A 2A7JA 2NWNA 3AVZA 4NGAH 3BEUA 2VWOA 1SSXA 2ZPQA 5C3NA 4WH8A 1C2GA 3GISB 3MMGA 3BTME 1HIAA 2WPIS 1YYY1 4DG4A 3RMLH 5EPNA 1CU1A 1ETRH 3PM3A 4PROA 2Y82A 2VIQA 4AGKA 2GT8A 1P12E 2GCTB 2OUAA 1C5TA 3SN8A 3RXPA 1BTUA 1Y5AT 1A46H 2F9VA 4BAHB 2J94A 5A09A 3GDSA 2ESTE 1XXDA 5DPAA 1BHXB 2A7CA 4ABBA 3EAJA 1EPTA 4FUDA 3RM2H 5FX6A 1AY6H 6GCHG 2NU2E 5T6FA 5JBCS 4FU9A 4BTTB 1RIWB 1NU9A 4ABGA 4D9QA 4A1XA 1HIAB 4I8LA 2GV7A 4K8YA 2FOAA 3PLPA 1Z1IA 1GBFA 1IQHA 2QY0B 1EASA 3M5MA 5B6OA 1WU1A 3DUXH 1VITG 4UE7H 1CVWH 3LT3A 3ELAH 1DX5M 1OXGA 1G30B 1QRWA 2P3UB 3P92A 4M7GA 2XTTB 1ARBA 1V2KT 3SJOA 2FEQH 2SNVA 5FPSA 3ZVCA 1GG6B 4K3JA 1KLJH 1QJ6B 1CA0C 1SGEE 4I8KA 3T2NA 3BTHE 4UFGH 1DSUA 1EPTB 1C5UA 1MTVA 3PB1E 2GDEH 2J2UA 1Y5UT 2ZG0H 1BT7A 4K2YA 1FY3A 2BD5A 2G52A 1O2QA 3K9XB 4CHAB 2P59A 4X1SU 2ZECA 2ZHWH 3A7TA 3SNCA 3P8OA 1D3DB 1P06A 1VGCB 1OYTH 1SVPA 1SGYE 2XWBI 4CBNA 4YT6H 3HK3B 3KCGH 1M9UA 3ZVBA 2P94A 3AAVA 1N8OB 1KXAA 1HPGA 2HPQH 7ESTE 1GI0A 1O3GA 1DITH 1GBBA 3QO6A 2ZTYA 2R3YA 2O9QA 2YNBA 3QWCH 1XUIA 4KTCA 4DIHH 4TYDA 2ZCHP 2HWLB 1QJ7B 1YPHC 5HXFA 3MH4A 1IOEA 4O03A 2A7HA 2GD4B 1FY1A 3SGAE 1BCUH 1C4U2 1OKXA 1OWHA 4NWLA 3UWJH 3VB5A 1FNIA 1GBMA 5ABWA 1H8DH 1MBQA 1C2EA 4B1TA 4A6LA 4OGYA 3PMAB 1HXFH 1SI5H 2P95A 3M7QA 2AFQB 3E3TA 2FI4E 2FYQA 3LJJA 2ZA5A 3LDXH 3RXVA 2P8OB 3MO6A 1O2ZA 4IC5A 1AIXH 1AI8H 1KY9A 1MH0A 1FY8E 1TX6A 5GCHG 1W2KH 4NIVA 1HJAC 2XBWA 4ABIA 1LCYA 4Y71A 1CGHA 1J16A 1V2LT 1Z7KA 4ZAEA 1MQ5A 5DGJA 3E90B 1PPZA 1LHDH 4AG1A 1GMCF 1INCA 3ZZ4A 3ODDA 4DGJA 4B2CA 1C1WH 5C20A 1ARCA 1BRAA 4UFDH 2BX4A 2OC1A 1RTKA 2Z9IA 3A7XA 5JBBS 1Z1JA 3MNCA 1BB0B 3F68H 3PWBA 5GXPA 1SFIA 2ZCLP 1LVOA 1GJ7B 1X7AC 2VVCA 3SHAH 2FS8A 2Z9LA 4GSOA 1UK4A 3SU5A 1DOJA 2W7UA 5EW2H 2D1JA 2A2QH 1P01A 1UVPA 2GCHF 3GY7A 1EP5A 4WJG2 4DCDA 1CA8B 1K28D 3SI4H 1GJDB 3SGBE 3U1IB 2W26A 1ELBA 1FZZA 1AN1E 3DT0H 3IITA 1J14A 1P57B 1NESE 1HJ8A 5ESTE 1O2NA 2BY9X 3BSQA 1BRUP 4YT7H 1BMLA 4MPVA 5C1UA 2Z3CA 2GCTC 5HMAA 1SHHB 4R0IA 4H6SB 4ZROA 2B7DH 1EAWA 1CBWB 1BJUA 3SU3A 3ZVDA 2BVXH 1P8VC 2VVUA 4CR9A 3MHWU 1K22H 3ZV9A 4AN7A 1HXEH 5FCKA 2SGFE 2HNTC 3FP8E 4YTAA 1YLCA 1RIWC 1AB9B 2LPRA 1V2WT 3FP7E 4ABFA 4TPYA 1ZR0A 3D23A 4MPXA 1UJ1A 1NS3A 1QRXA 1ANCA 1LKAA 1JWTA 1BTZA 2EC9H 1LVMA 3H7OA 4GAWA 2BQ6B 1O2LA 3FANA 2D2DA 2D8WA 3TK5A 4ZMAH 1T8LA 2HOBA 3SJIA 3U8OH 1AE5A 2FO9A 3MNSA 3RXRA 1GHAG 1TA2A 4NIYA 2TBSA 2FOBA 3H7TA 1A61H 4FUEA 3SW2B 2F9UA 5EXLA 3BF6H 2FOMB 4HFPB 3FP6E 1C5RA 1AD8H 4AFSA 2J9NA 1L1JA 2GDDA 1OP2A 1TNHA 3M3SA 4UDWH 4CH8B 2ZU3A 1GHVH 4NA7A 1GHWH 4A1TA 4WMEA 1GBIA 1UTLM 1C1MA 1BQYA 1O3MA 1H1BA 1D9IA 3LONA 1VGCC 1NN6A 1AQ7A 4MLFB 4K5ZA 1GBCA 1NFYA 1O39A 2A4GA 1AVWA 5T3HA 1RTFB 3SQEE 5J4QA 1HGTH 1SLWB 1DANH 1FN8A 1TYNA 4OS2A 4D7GA 1VCWA 2THFB 4MPUA 4K1SA 3STIA 2ZFPH 1UTMA 1K9OE 1A5HA 1WAYB 5EQSA 1KTTB 2FOEA 1JOUB 1GWAA 1TB6H 1FY4A 2ANWA 1TPAE 4IMQA 1GDQA 4DOQA 1SGRE 1KXFA 1YM0A 1BTYA 3K2UA 3GOVB 1VCQA 3EE0B 1TNLA 5C67A 1AO5A 5C1XA 5ETXA 1NFWA 1EAUA 2FIRH 1K21H 2ZFRH 4E7NA 2AGGX 4D7FA 3GY6A 4AFQA 1NFXA 3KQDA 3BTEE 3A89A 1ZSLA 1J8AA 1NRPH 5A8XA 2A0QB 2GX4A 4JMYA 1K1IA 1CHGA 1O5CB 3U1JB 5DJ7A 1UTQA 2C8XB 3SV7A 1D4PB 1E35B 1FV9A 1XX9A 4JK6A 5C5OA 4CH2B 3S7KB 1SQTA 1DLEA 3M3TA 2GMTB 5EQRA 1YBWA 5TCAA 4XOJA 3UIRA 4X2YA 1EJAA 3ENSB 2CXVA 1WCZA 1ZMNA 1UTPA 1THSH 5E0HA 1GI6A 3SU1A 8ESTE 1ZPBA 2VJ1A 3ITIA 1NY22 4GHQA 5DP9A 1L4DA 4NCYA 1O3NA 3BV9B 4YLQH 1TGBA 1UCYH 1AUJA 2C4FH 1QBOA 3L33A 3T26A 2A4OA 3UTUH 1TX7A 2ODPA 2BMGB 2FLBH 2W3IA 2XWAA 2V3OH 3F6UH 1SR5C 1GMDF 3S69A 1JIMA 3T29A 1TRMA 5JBTA 1HAIH 1T8NA 2ZHQH 1FMGA 3SNBA 3MH6A 1DPOA 1EOLA 3JZ2B 4BAMB 5DP5A 5H4IB 1BUIA 1NPMA 5HM2A 1SG8B 1TRNA 1ZJKA 4B76A 1H9IE 2B8OH 2FDAA 2SGDE 1LVYA 3JZ1B 1S6HA 2Y5GA 4ESTE 1GVKB 3RXJA 4GLYA 1CBWC 1SGCA 1BTXA 1O2PA 1O3DA 3ZZAA 4ZHMU 2QF0A 2ANMH 1UVSH 2XCNA 1SQOA 3SV9A 1B5GH 2YNAA 2BQWB 2O8WA 2PFEA 1P3EA 3M7TA 1J9CH 3UPEA 2ZGHA 3ZYEA 5HM9A 1P05A 3EA8A 4MNVA 3VGCB 2BVRH 4AB8A 1GHZA 1TA6A 4ZH8A 2ZEBA 1XMNB 2Z9GA 1L4ZA 1SGFG 3CP7A 3Q77A 1V2QT 3FFGA 1W7GH 3RXMA 4KTSA 1AUTC 1P09A 1Y59T 5EG4A 5L6NH 2ZZUH 2I6QA 4Y10E 3ATWA 1O2HA 1BTWA 1BDAA 2Z9KA 2Z9JA 2EI7A 4K1EA 3RXUA 3GY4A 5AFYH 1DDJA 5LPFA 1XVOA 2BDIA 1GI5A 1OPHB 2XRCA 1QB9A 1ZJDA 1UTKA 1O2WA 2OD3B 1P03A 1GCDA 4D8NA 4CBOA 1CT0E 3PMJA 4AORA 1CO7E 2JETB 4GUX