1J16A

Benzamidine in complex with rat trypsin mutant x99/175/190rt
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRETYNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASSSFIITDNMVCVGFLEGGKDACQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin II, anionic
molecule tags Hydrolase
source organism Rattus norvegicus
publication title Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-induced Structural Plasticity
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j16A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j16A02
3OX7U 4BTIB 3NXPA 1GVKB 2Q6DA 4KKDA 3OY6U 1C9TA 1MKWH 1ZRKA 1KLIH 1NU7B 1Q31A 1C5UA 2WUBA 2QAAA 3RU4T 1EAWA 2A0QB 2OC0A 4JZ1A 5ESTE 1YBWA 4HI3A 2KAIA 1GBJA 1K1OA 4FUJA 3PTBA 4IGDA 1IQKA 3D23A 3QX5H 3U1IB 4U2WA 2CF8H 1ID5H 5EPNA 2PKSC 1ZJDA 1GI5A 4Y0ZE 4ZKNU 1RTKA 2UUFB 3SV2H 1C2LA 1D3TB 1KSNA 1SGNE 3ITIA 1LVYA 4MTBA 1O3CA 1V2TT 3MU0A 2ZTZA 3SJKA 2Y5HA 5A09A 3BV9B 1HJ8A 1O38A 3Q77A 4WMDA 4OS7A 2FYRA 1OWDA 1LKBA 1J17T 1K9OE 1W7XH 2PLXA 2VVCA 1T8NA 3E6PH 2ZTXA 1TGSZ 4NA9H 2TRMA 3NK8A 1HFDA 1HAVA 4K5ZA 1LHFH 3U1JB 1DWEH 2F9VA 2WPKS 1ZLRA 4H42U 1HAVB 1VJAU 1O30A 1F5RA 3UNQA 5E0GA 1HAGE 3KNXA 1UTNA 2ANWA 4THNH 1O3OA 3E8LA 3ZZAA 5EXMA 3BTGE 1T4UH 2H9EH 4QT8C 1BTZA 2B7DH 1BTWA 4CH2B 1ARBA 2V3OH 1NPMA 2Z3EA 1OWEA 1ZMLA 4XBDA 2VH0A 1BMLA 1VITG 3RXBA 2JETC 2V35A 1NFWA 1O2GH 3TPIZ 2FOCA 1IQEA 2TPIZ 3SHAH 1C4U2 5DP7A 4O3TA 4BANB 3MOCA 3MHWU 4ISOA 4AB8A 3MH5A 1VCWA 3GY4A 1F0RA 1SL3A 1C5RA 2KAIB 3W94A 3ZVDA 3M37A 5EXNA 3URDA 2ZC9H 4X2WA 3RXGA 2QA9E 2Y7XA 4WMEA 3GOVB 3AAUA 2AIPA 3RXRA 3RXCA 1O2IA 1Y3XA 3ZZ7A 2NWNA 4DG4A 3M7TA 1TGNA 4F49A 3H5CB 2ZGCA 4Y6DA 5HXFA 1YKTA 4JK6A 1ZSLA 1EX3A 4MLFB 1AHTH 1KY9A 1THPB 4BAOB 1QURH 1TOCB 1GHBG 1NROH 3U8TH 4HTCH 1UK3A 1PPBH 1SHYA 3RMLH 4Y11E 5DG6A 2FI5E 5K7RA 1EAIA 5EOKA 4LXBH 4XBBA 3VEQB 3UR9A 2F91A 2WYJA 2EC9H 3K6ZA 5L30H 2H9HA 3SV9A 2WPMS 2FESH 3P8FA 1E36B 5E8EH 3VGCC 1DFPA 3M61U 1BMNH 3QN7A 2F83A 1K22H 2D26C 5GPIB 1O35A 4CR9A 3EAJA 4H6TA 1DUAA 2J94A 2PKAB 1WTGH 5A8ZA 3PMJA 4KTCA 3RC6A 2PSYA 3TH2H 4DOQA 2R9PA 3GCOA 4H4FA 2AGIX 3Q76A 3ZVFA 4Q80A 3ODFA 2HWLB 3DHKH 5F6MA 1XKAC 4MQAA 1O2HA 1PYTD 1CGIE 1QRWA 4GSOA 3SJIA 1EJNA 4CHAC 2IPHA 1RD3B 2AGGX 3ODDA 1C5ZB 1DDJA 1W2KH 2TGPZ 2ZECA 2W5EA 4GLYA 4D7GA 3A7ZA 1LPGB 1SLUB 2O8LA 5E0JA 1Z71A 3NKKA 3FAOA 1YGCH 1OP0A 4AZ2B 1GL0E 2GCHG 4RSPA 3A8CA 3VFEA 1C5NH 5FPSA 1FPHH 3RXOA 1C4Y2 1QL9A 1HAOH 1FUJA 1AKSB 3SJOA 3BSQA 2AMQA 2G00A 3A82A 1K1MA 5LPFA 1UCYK 2VIPA 1MTVA 1TPPA 1O39A 2WV4A 1MZAA 1GBKA 1QL8A 1GCDA 2QV1A 1P2OA 2Z9JA 3QGJA 1ANDA 3QO6A 4TY7A 1ZGVA 1OYTH 2GVFA 2VINA 1Z8GA 1XUJA 2XXLA 4Y79A 1SLWB 2LPRA 2ANKH 1EAUA 2ZGHA 6CHAC 5EQQA 1F0SA 4UFFH 2W3IA 1FY8E 1VITF 1ZSKA 1EB2A 5GCHG 3DT0H 4DIIH 1GHXH 1G3EA 5FAHA 1K1IA 4DJZB 1O2NA 2HNTE 2YNAA 1GJCB 3FP8E 1O3FA 4CRBA 2ZGBH 5JBBS 1ZHRA 1SQTA 4FUEA 1DXWA 2BVSH 6GCHF 4OS1A 1IQJA 8LPRA 2GZ8A 1ZHPA 1TNIA 1BA8B 1ZTJA 4HGCA 5C5OA 2FOBA 1QBNA 1V2PT 1C2EA 1HXFH 1FY5A 2ALVA 1EZXC 2STBE 2I6QA 1TOMH 1O2JA 1S5SA 4X0WU 3RXVA 3GDVA 3A8BA 2BOHB 1RIWB 1O2SA 2GTBA 3SNCA 1MTNC 3EGKH 1QRXA 2XWBI 1MAYA 1DWDH 3STJA 3RLYH 5EXLA 4CBNA 1O2WA 5LGOA 2VIOA 4ZUHA 4J1YA 1VITH 3RXIA 3H7TA 4JZDH 4NA8A 1ZTKA 3ZZ9A 5LH8A 1C5PA 1HAPH 5C2ZA 2P3FH 1UVOA 4Q7XA 3LGUA 1BTYA 1W10U 4YLQH 1V2ST 1HDTH 2TGDA 1GJ9B 1TNJA 5ABWA 1AZZA 1L4DA 3KIDU 1XVOA 1QB6A 2F9UA 4AG2A 1UTLM 1UHBA 2HPPH 2SGFE 3SQEE 1THSH 1D9IA 1HYLA 1FXYA 3ZZBA 3RM2H 3OU0A 1P2IA 1HLTH 1P2KA 2XC4A 1EJMA 1L2EA 1ELAA 2HRVA 4DURA 1SGTA 1QTFA 2CF9H 3HKJB 3P6ZB 1ESTA 3B9FH 3RXSA 4JYVH 4DIHH 3E90B 1ETTH 1XUFA 2VJ1A 4FUBA 1W3CA 1EPTA 2BY8X 3DUXH 5TJXA 1V2JT 1GWAA 1EOJA 1TAWA 4LK4A 1NRQH 4UFEH 5F8ZA 3QUMP 5AVDA 1UJ1A 1X7AC 2GCTB 4KELA 3D65E 4TPIZ 4DCDA 1RGQA 1SSXA 2TBSA 3MMGA 1D3QB 2WPHS 4IC6A 2PGQB 1AWFH 1C2MA 1NO9H 5C67A 1L1GA 1P57B 1Z6JH 1BBRE 3SUEA 3VXFH 2Y81A 3GY6A 1MH0A 1KLTA 2Z7FE 1GCTB 1AO5A 1O2XA 1RS0A 5DGJA 1J9CH 3L33A 3A7WA 1TGBA 1DSUA 1ABJH 1V2RT 3PO1C 2RCEA 3BEUA 2VIDA 1YPHC 3UIRA 2VH6A 1Y5UT 5DJ7A 2DE9A 1XMNB 3S9AA 1BBRK 4H6SB 3S9BA 1RJXB 1LPZB 4Y8YA 1CGJE 1G37A 3M5OA 1VCQA 4X8SH 1XXDA 1LPKB 2XBYA 1Q3XA 1UTKA 1SR5C 2ZFPH 4UONA 4ABAA 2H2ZA 2A4OA 3BN9A 1T8MA 4ISLA 4WXVA 3SU2A 1QL7A 3K9XB 4UD9H 5HM2A 1GHAF 2PGBB 1GVLA 1FY4A 5FBEA 1ZZZA 1H8DH 3SUGA 1UHBB 1IQIA 2ZCKP 5GJ4B 4CRAA 1FY3A 1GPZA 1G9IE 5DKMA 1XUIA 3L6PA 2CJIA 1YF4A 5IYTA 2UWPA 3SJ9A 3ATWA 1INCA 4XBCA 1SGDE 3TVJB 1AI8H 4MNVA 3SNEA 2OD3B 2BD9A 1CA8B 2AIQA 3ATLA 2ZHQH 3SBKA 3HK3B 3TJNA 4CRFA 1LO6A 1MTSA 3KHVA 3U8RH 2FOMB 4WY3A 1Y3WA 2A5KA 3NZIA 2Z6BD 4KP0A 2XRCA 3RP2A 1BB0B 1DPOA 4D9RA 3SW2B 4O97A 4NSVA 1AKSA 2BYAX 2EI8A 3W95A 2ZCHP 4R8TB 1PJPA 1Y3VA 2SGPE 4IN2A 1NU9A 5JPMH 4I8JA 3RXUA 2OBOA 2BDIA 1C1SA 1NTPA 3ZZ4A 3VXEH 5F03A 2OUAA 1FJSA 3RMOH 3T27A 1IQGA 2O8MA 3AW0A 2FX6A 2GKVE 2G55A 3M35A 2B0FA 2J92A 2SGEE 2ZDKA 3BTFE 3QGNB 3LGWA 2FWWA 1A2CH 3SU5A 4B2CA 3BEIB 2G8TA 1Y3UA 3NWUA 5HGGA 5TCAA 2Y6TA 1SI5H 3ATKA 2BOKA 1WOFA 1K1JA 2GV7A 2AGEX 4YLUA 3KL6A 1DT2A 2BD4A 3S9CA 2PTNA 1BRUP 4NIYA 4GHQA 2GCHF 2J2UA 2RDLA 1QNJA 2FOHA 3SO3A 2C8WB 4A1TA 1GI7B 1QA7A 1GG6C 2V3HH 2PHBA 1NFYA 2BHGA 4D8NA 4NWKA 3KEEA 8GCHG 1AFQC 1N6XA 2BQ7B 2XTTB 4BAKB 1FLEE 3GCHC 3ATIA 2XCFA 2BD8A 2OINA 5GDSH 2FZZA 1A3EH 1HCGA 1ARCA 1C2IA 1IHTH 1LQDB 1T31A 1EZSC 4AGJA 2FS8A 3QLPH 2H1UA 3LGVA 2ANMH 3SORA 1MTUA 2Z3DA 3SUDA 2SGAA 1MCTA 1SVPA 3Q3KA 1P04A 5C1YA 1TA6A 1G3DA 1U6QA 2BDHA 2F9BH 3L3TA 1GI9B 1DY8A 3MH6A 2BTCE 1RRKA 1OP8A 1P12E 4YO9A 4X6OA 1T7CA 3VB6A 2Y7ZA 2P8OC 2BZ6H 2ZZUH 4DY7B 1O3DA 1GI3A 2O9QA 1FN8A 1H8IH 4K3JA 5TCCA 1TQ7B 4YESB 2BY5X 2PV9B 1IQMA 3MO6A 1TBRH 4E06H 1BHXF 1V2UT 1TX6A 1NFXA 3MI4A 4ASHA 1NN6A 1O36A 1Q2WA 5HM9A 4X2XA 5EQRA 3PLBA 1AN1E 1RIWC 1MBQA 5DP4A 2QF0A 5IDKA 4ZHAA 2Y5GA 3DA9B 3SJ8A 1CT4E 3TLOA 3R3GB 2GMTC 2EA3A 2P94A 3O8DA 1N8OC 2ZKSA 3UNRA 1Z8RA 2GT8A 1TX8A 1XXFA 2ZU1A 4ZKRU 3A83A 1LVOA 4OGYA 2J4IA 1WSSH 3MH7A 4CR5A 1GMDG 1PPGE 1GHAG 2PUQH 4TWWA 3M36A 1GBDA 2V0BA 4AN7A 2ZG0H 1ZRBA 1TALA 2JETB 3RXPA 5ETXA 1OOKB 1SPJA 3DFLA 3HGNA 4WH6A 2ESTE 1Z8IB 3ZVAA 1YCPH 1Y8TA 1C1RA 1MQ5A 1RTFB 1SMFE 1H9IE 2BDGA 3GCTF 3V3MA 3MO9A 1BTHH 1QCPA 2BVRH 4KTSA 1YM0A 2OC8A 2VWOA 3VB5A 1XVMA 1S83A 2R3YA 1TABE 1O2RA 3PMHB 3S69A 3RMNH 1V2LT 2DE8A 1AD8H 1GHYH 2R3UA 4Q7ZA 1FN6A 1O32A 3CS7A 1HPGA 3UY9A 1HJAC 1OWHA 4Y7BA 1BITA 1O2TA 4AYYB 1UTMA 1JXPA 4AOQA 2SNWA 1HAYB 3O8BA 3ELAH 2SNVA 1AGJA 1PQ5A 9ESTA 1WU1A 2ZFFH 1T8OA 2XNIA 2GP9B 3F68H 3BTME 1GBLA 1KXAA 3IG6B 2H5DA 3MU8A 3TIUA 3LIWA 2CV3A 2BLWA 3M5MA 1Z1JA 3OYPA 3VGCB 3TK9A 1YPHE 2ZO3H 4U32A 1GBTA 7GCHG 2O8TA 1AE8H 3E16B 1C1NA 1TONA 1FI8A 1AMHA 1GJBB 5A2MH 3BIVH 1W0YH 2CMYA 3A8AA 2VWNA 1JOUB 5K0HA 3ZZ3A 3FZZA 3EQ0H 1XX9A 3GYMA 3PO1B 1OSSA 2C8XB 4YZUA 3GY2A 2HPQH 2O8UA 3U98H 4ZMAH 4ABBA 2XBXA 1W14U 2FODA 2BY6X 4JZIA 3BTKE 2ZA5A 1O2VA 1C5OH 1O2ZA 1QR3E 2TGTA 3SGBE 5F8TA 1C1WH 4OGXA 1O3IA 7GCHF 3UWIA 2BD5A 4B2BA 1GBMA 1SB1H 1UTOA 2C8ZB 2ZDMA 2B8OH 3TJOA 3KN2A 5CMXH 1QHRB 2BLQA 3LKWA 1F2SE 1C5LH 1NM6A 1AFEH 1S0RA 1CGHA 4NIXA 5JYIA 4NFEA 1S84A 2FS9A 4K1TA 4FUHA 2NU1E 1SLVB 2AS9A 2Q1JA 1Z8JB 4AGKA 1H9HE 3VPKA 5EODA 2NU4E 3GISB 1PPEE 2AMDA 2FLBH 1S81A 3RXLA 3GICB 4A6LA 4NIWA 1QGFA 3OY5U 1NT1A 4E7RG 2Y80A 3GY3A 3P70B 5B6OA 2R0LA 1CU1A 2BQWB 5GWZA 3S7HB 1UVTH 4AYVB 4CRGA 1MU8B 1MTNB 3HKIB 4UDWH 2WINI 2FYQA 1O3NA 1KXFA 1GBEA 1ZGIA 3GYLB 4D76A 1DOJA 4MPXA 1P11E 3LT3A 1CBWB 2BM2A 2F9PA 4X1PU 1IQHA 3U69H 1BTPA 1CA0C 4B73A 1KXBA 6GCHG 3VB7A 1O3MA 2UWOA 4JZFH 1NC6A 1SGCA 2ZU4A 5F8XA 4FU8A 2WV5A 1NRNH 4XFQA 5FX5A 4B75A 1MD8A 4I31A 2Z3CA 2ZTYA 2AERH 5SGAE 2OC1A 1C5VA 2Z94A 3ZZCA 3ZV9A 3NCLA 1BBRH 5DO4H 1CHGA 4BTTB 4MPWA 3V7TA 2XBWA 3RXQA 1HBTH 3C1KA 1A4WH 3F1SB 4I8LA 1JRSA 1V6DA 1D6WA 5CHAB 2A2XH 1T8LA 1D4PB 3A80A 2NU0E 1YPMH 4I7YH 3FANA 1C5TA 1LQEA 4IS5A 5H4IB 1PQ7A 4K1SA 1HB0B 1GMDF 3EA8A 2P59A 1EAXA 5GXPA 1WV7H 3Q00A 3A88A 1DUEA 5DP3A 2A4RA 1FIZA 2ZPSA 2PKSB 4U30A 1SGRE 1W12U 2J38A 3F6UH 4K2YA 4WF8A 1TWXB 5EG4A 1ELBA 3I29A 1O2MA 2ASUB 1KYNA 1O5BB 3AAVA 2R0KA 3PYHA 3MNBA 3FP6E 1F0TA 2AH4X 2VU8E 5A8XA 3TGJE 4Q2KA 2FOGA 3FZDA 1OWJA 1TMUH 2R2WU 2QXIA 4LZ1H 1ZTLA 1G36A 1ZMNA 4E05H 2BD3A 1NRRH 2XWAA 1VR1H 2A4GA 1QFKH 3BTWE 1O2LA 1BDAA 1YLDA 3F9HA 2GCTC 2PFEA 3E0PB 1C1VH 4E7NA 1GDNA 1BJUA 1O3BA 2J95A 1O5EH 5DP5A 3PMBB 3UREA 1DM4B 3M5LA 3O8RA 1PYTC 1T4VH 3UPEA 3UQOA 1GI1A 1YCPK 3SOSA 3B23B 4NFFA 1UTJA 3MYWA 2W3KA 1DWCH 2F3CE 4ZHLU 1AVXA 1C2KA 1TRNA 1ZYOA 1PPCE 3QK1A 4IMQA 3M3TA 3T25A 2BVXH 4I33A 3HATH 5HYOA 3LJOA 4ABIA 4ZROA 3K2UA 3S7KB 1P0SH 2VWMA 3SU3A 1PPFE 1UO6A 4JZEH 1A5IA 1SQOA 1EZQA 5FXLA 2IOTA 4FUCA 1V2WT 4OS2A 1O5GH 2BDAA 2G5NA 1O0DH 1GI2A 1XUHA 1HRTH 1VJ9U 3P8OA 1LCYA 2FXRA 1SBWA 2Z9LA 1YLCA 3A7YA 4JMYA 1A5GH 4NG9H 1H1BA 1O3KA 2O8WA 3E1XB 3GY8A 3SGQE 2STAE 1Y5BT 2VIWA 3E0NB 1C5SA 3OSYA 3F9FA 3QDZB 4D9QA 1SGIB 1E35B 1EQ9A 2BB4A 1V2OT 1GI8B 3R0FA 5JBTA 1JIRA 3UFAA 4NA7A 1GMHF 5DP6A 2PKAA 1BRAA 2ZIQH 1GJ6A 1P8VC 1PQ8A 4HZHA 1WUNH 3SHCH 1GL1A 1K1LA 1W13U 4M7GA 2FOEA 3SGAE 2BDYA 1AIXH 1ZSJA 1OYQA 2HNTC 2J34A 4MDSA 1GHVH 2IN2A 2C3SA 1C1UH 1CBWC 1KDQA 3RC4A 4X1RU 2CHAC 3MNSA 4GCHG 5AHGH 4O9VA 2FX4A 1KDQB 1SOZA 2C90B 1YC0A 1B0EA 2SFAA 1SGEE 1OP2A 1HAZB 3EE0B 1ACBE 1YYY1 4ABGA 1HJ9A 1BCUH 1MKXH 1C5MD 2BLVA 1VZQH 3TNSA 1YCPM 4MNWA 1YP9A 1EKBB 3RDZA 3A86A 2P95A 1XKBC 1C5YB 2Z9IA 3MU1A 1SLXB 1IAUA 1MD7A 4I8GA 1W7GH 3AW1A 4INKA 1TQ0B 3E3TA 2M5TA 2R2MB 1A3BH 1DITH 3ESTA 3UWJH 3V13A 3A87A 1BRCE 1DE7H 1GBHA 4ABDA 1O2OA 1DLEA 1AVWA 3AASA 2A45B 3ZYEA 3PB1E 3HGPA 1FDPA 1W0ZU 1QJ7B 1O2KA 3T62A 2F9NA 3SV7A 4GPGA 2A7HA 3SI4H 2G5VA 1A0LA 1P2JA 4HFPB 4CBOA 4ABHA 4MG3A 2GDDA 5C1UA 5I46H 1GGDC 1L0ZA 1TBZH 2JH0D 2HLCA 4XE4A 2F9OA 4KGAA 1IOEA 2Y82A 6LPRA 1HV7A 1KTSB 1G30B 2UWLA 3KCGH 4FXGH 1ELCA 2B5TB 4X1NU 3BTQE 1NRPH 3F9GA 1WBGB 4B71A 2A31A 2ILNA 1FMGA 2WUCA 1PPZA 1AFQB 3KQCA 3RLWH 1KTTB 2ZP0H 1IHSH 3EYDA 3T5FH 2VWLA 1ELVA 4UEHH 3KQBA 2GX4A 3QTOH 1AY6H 3GY7A 1UVUH 4ZKSU 2D2DA 1B5GH 3PTNA 2SGDE 2QIQA 3STIA 1XUKA 2D8WA 1J14A 5E2OA 4INHA 3TU7H 3SZNA 2UUKB 3ZZ6A 1TIOA 1PQAA 1K1PA 3I78A 1EB1H 1BMAA 3RXTA 3BG4B 3SNAA 3ZVGA 4WWYA 1KXDA 3MFJA 4YTAA 3BTHE 1BQYA 2H5CA 2ZHWH 2HGTH 2ODQA 2Q6GA 1P01A 1JWTA 2WYGA 2ZU3A 1LHEH 1KXEA 1O3JA 4Y76A 4B76A 3N7OA 4FUFA 1TNGA 2ALPA 2ZNKH 3FVFB 5ESBA 2CHAB 2UUJB 1FIWA 9LPRA 3A84A 4X1SU 1O3HA 4BAHB 1C1QA 1P9UA 3ZVCA 1UK2A 3SU4A 2XBVA 2LNCA 1YPGH 2GMTB 1L4ZA 2ZHFH 1ANCA 4Y0YE 4ABEA 2P3TB 1MMJN 2CXVA 3CS0A 1V2QT 1AVGH 1SGFA 3SN8A 1DY9A 4YM9A 3UOPA 1C1MA 1BZXE 2P93A 2PSXA 4AFUA 1G2LA 2PUXB 2VNTA 1C2FA 2H6MA 2ZWLH 5DPAA 2G52A 4X8UH 1CT0E 3KQDA 3P92A 3SV8A 3NUMA 3LU9B 5EPYA 5A0AE 5HMAA 5A8YA 2ZF0H 3A8DA 3FFGA 4Y8ZA 1LHGH 1N8OB 5LPEA 5T6DA 2OP9A 4YT6H 1SGQE 5EQSA 4JK5A 1PFXC 2OQ5A 2OBQA 4CH8B 5FX6A 1D3DB 1P06A 2UUYA 2P8OB 4OS4A 1HIAA 4VGCB 3ZZ8A 1TBQH 1QBVH 2FMJA 2QY0B 4WMFA 1YPLH 1VGCC 1OWKA 1TMTH 1ESAA 3PM3A 1NFUA 2CGAA 1HIAB 1QBOA 2QC2A 1DVAH 4ZH8A 5J4SA 1DLKB 2CN0H 2VB0A 4XSKU 2JH5D 1TE0A 1TGTA 5FCKA 1GJAB 3RU4E 2XCNA 3U8OH 3RXJA 1MQ6A 3P95A 2ZFSA 4UFDH 4Y10E 1GMCG 1TNKA 3HK6B 4I8HA 2A7JA 1SOTA 4TY6A 1A61H 5AF9H 1TNHA 2THFB 1FV9A 1S6FA 4FVDA 2QXHA 4X6NA 1PPHE 4TYDA 3UUZA 3T28A 3UNSA 6CHAB 2FPZA 4WH8A 4ISHH 4DT7B 4AORA 3GDUA 1DX5M 1AU8A 5LPRA 1TB6H 1KXCA 1BT7A 4X6PA 1O5CB 5JB8S 1C5WB 5L2YH 1DXPA 4A5TS 1FAXA 1CVWH 5L2ZH 1ZPZA 3MNCA 1GJ8B 1HJAB 2FLRH 2BY7X 8KME2 1P9SA 1V2NT 3TH3H 1J8AA 1GBFA 3RC5A 2RG3A 1UVPA 3GCTG 1OS8A 2BY9X 1YPJH 1A1RA 1D3PB 2G4TA 5FPTA 1A0HB 1GVZA 4OS6A 4AFQA 3UQVA 4BXSA 3S0NA 4AX9H 4JCNA 2GZ7A 1FONA 2ZDVH 1O34A 4DW2U 1TFXA 1FPCH 2EI7A 4ZXYH 4K8BA 3CP7A 4RKOB 2VGCC 1UK4A 4FUDA 4NSYA 4DVAU 4XDEA 1GBCA 1O3EA 3ENSB 2JKHA 3B8JA 3MH4A 2C4FH 4VGCC 1JRTA 3QZRA 1DSTA 2WPIS 3BTTE 1THRH 2GZ9A 3IWMA 1QB9A 1JIMA 4JYUH 1LKAA 1OPHB 2BD7A 2QXJA 4CREA 4ISNA 1CHOG 2ZU2A 3PLKA 1AUTC 2AMPA 2Q6FA 4JYTA 2ZQ2A 1F5LA 4YOGA 4INLA 4IMZA 1NS3A 1BTUA 2YOLA 1AB9C 1SFQB 1C2JA 4XOJA 1JMOH 5J4QA 3FP7E 1O3PB 4NGAH 3SI3H 1EUFA 1AUJA 2FI4E 5CHAC 3PLPA 1UVSH 1K28D 3GCHB 3QZQA 3TK5A 1EJAA 3JZ1B 1QB1A 5C5NA 2VVVA 4BOHA 1S85A 3UOUA 2BD2A 2W26A 3PWCA 4UFGH 2P16A 3KGPA 4NIVA 1P2MA 1MTWA 3TH4H 3MTYA 1E38B 2A4QA 4TPYA 5T3HA 4FUIA 3SQHE 1GGDB 1EZUC 1MU6B 4A1VA 4ZAEA 4UE7H 1EXFA 5JBAS 1P03A 3RM0H 2PTCE 3NPSA 4WJG2 8GCHF 1CO7E 2B9LA 4BNRA 1GCTC 1TMBH 5JB9S 1UTQA 1MUEB 4KTUA 1AQ7A 1V2KT 2RA0A 5BRRE 2EEKA 1FNIA 2V6NA 1HAXB 1SG8B 1NESE 1ELDE 2ULLA 1O37A 2ZQ1A 3ATMA 1GG6B 8ESTE 3EA9A 2PW8H 1LMWB 2WPJS 1AWHB 1TLDA 4RKJB 1CSOE 4U01A 1QQUA 2A1DB 4WXIA 2XC0A 2OTVA 4MPVA 2FO9A 4AG1A 2NU2E 1E34B 1P02A 1O2UA 1JBUH 1WQSA 1MAXA 3BF6H 4K1EA 4BAMB 1UTPA 1O5FH 5EW1H 3RXAA 1CHOF 1KLJH 2PWXA 3RXDA 4OS5A 3LPRA 1UCYE 3M3VA 2PR3A 1ESBA 5DK1A 1NZQH 4X8TH 1ZHMA 2VVUA 1C5XB 1SHHB 3LH3A 1QY6A 1O31A 4A92A 2BXTH 4A7IB 1S0QA 1OXGA 2HNTF 2XC5A 3ZZDA 1ELEE 1TPOA 3MNXA 1DICA 1S82A 1F7ZA 1ORFA 1SGPE 1O3LA 1K1NA 1G3CA 3P17H 1ANBA 7ESTE 5EU8A 3RUOA 1ETSH 1WTHD 3TGIE 3V0XA 5BPEA 2ZHDA 3MU4A 3LH1A 3LGIA 3P8NA 4ABJA 4YT7H 3A7VA 3SUFA 1F5KU 1GI4A 3D62A 2FP7B 2ZHEH 3SNBA 2Z9KA 2XYAA 4BAQB 3V12A 1J15A 1GDUA 5GIBA 2A5IA 3WY8A 2QN5T 1DS2E 3LC5A 4X2YA 4FVBA 1TPAE 2EI6A 1AZ8A 3AVZA 1O3GA 1O2YA 2ZU5A 3LGYA 4MNYA 4TWYA 2OXSA 1VCPA 2ZEBA 2BDBA 1QIXB 1CT2E 2ODPA 2ANYA 1BRBE 4ZKOU 2G4UA 3LC3A 3IITA 4R0IA 3SU0A 1S6HA 1MBMA 4Y8XA 2QCYA 2OQUA 3T29A 4O3UA 1TPSA 6ESTA 1MKWK 1EP6A 2ZDAH 4D7FA 1AE5A 3EA7A 2FTMA 2J9NA 1GJDB 1ZPCA 4O03A 1NRSH 1LHDH 1QRZA 2GV6A 4I32A 2BMGB 1P2NA 1AB9B 2ZDLA 1HAIH 1W11U 1G2MA 1ANEA 1ELGA 4K60A 5EGMA 4X2VA 1O2PA 1FY1A 1EPTB 3LONA 1LHCH 1D6RA 1ELTA 4IBLH 1QJ1B 3D49H 1GHZA 4B1TA 3ZZ5A 3JZ2B 2GDEH 1V2MT 4X8VH 5C20A 4X1QU 4NCYA 1DWBH 1O33A 2I6SA 3BTDE 4YOJA 1ETRH 1IQFA 2GGVB 3A81A 1LVMA 4NWLA 3KF2A 1EP5A 2W7SA 1GJ4H 1H9LB 2ZI2H 3TK6A 4LOYH 2NU3E 2FI3E 1V3XA 3DFJA 3CENA 2FOFA 1Y3YA 4GAWA 4GCHF 5C3NA 1P09A 3LDXH 2Z9GA 3QTVH 1TYNA 2QF3A 3Q3XA 4WVPE 3PMAB 1L1NA 2FTLE 2ZFQH 4AFSA 2ZGXH 2YNBA 1O5AB 3M7UA 4MVNA 3ZV8A 1O2QA 1TNLA 1XUGA 4GVUA 5CE1A 1BJVA 2ZPRA 2G51A 3C27B 3H7OA 2QYIA 1ZJKA 3BG4C 2P3UB 7KMEH 1GBAA 3I77A 4Y7AA 1K21H 5DP8A 2XW9A 3UR6A 1Z7KA 3GY5A 2FIRH 3MO3A 3T2NA 4F4OC 1SC8U 2BLOA 1TRYA 2WPLS 3ZVBA 1YPEH 3LJJA 1GHBF 2ZCLP 3K65B 1MZDA 4RN6A 1CE5A 1GHWH 2OLGA 5T6GA 3LOXA 1C4V2 4IC5A 2ZFTA 5E0HA 5C1XA 3MWIU 2HOBA 1J16A 2SGQE 1P05A 1Y59T 1C2GA 3URCA 2FM2A 5JDUB 2IJOB 2AYWA 1SFIA 4K8YA 3GCNA 3F9EA 2HALA 3MU5A 1DANH 1EATA 3A89A 3ZYDA 1O5DH 5PTPA 4IW4E 3Q3YA 1TRMA 1HUTH 1CQQA 1RTLA 5FHTA 1W8BH 4I8KA 1A46H 1SQAA 1M9UA 2BZAA 1FZZA 5FCRA 2JH6D 4BTUB 2OCVB 1RFNA 1TA2A 1HAHH 2AFQB 4FU7A 1BOQA 3U9AH 1TX7A 3PV4A 3UTUH 1WYKA 1ELFA 1G3BA 1RXPA 1EPTC 2BDCA 4A1XA 3M7QA 2OC7A 1C1TA 1CA0B 1NY22 5FPYA 1E37B 3TITA 1T32A 5EW2H 4LZ4B 1C5QA 2A32A 4Q7YA 4IN1A 1ZPBA 1F92A 1Z6EA 2GD4B 1KIGH 2AEIH 1C2HA 4Y71A 2QXGA 1IQLA 1HXEH 3RXKA 1ZOMA 1N1LA 3EDXB 3SU6A 3TNTA 1GJ5H 1TGCA 1BIOA 1VGCB 3P8GA 5JBCS 1GJ7B 5I25A 5DP9A 4NZLA 3TJVA 5A0CA 2Y5FA 3LGTA 1K2I1 4ZXXH 1FQ3A 1BTXA 1P2QA 2H9TH 1A5HA 3VB3A 2BXUH 4BXWA 2C93B 5L6NH 1C1PA 2C8YB 2GT7A 2ZPQA 1UMAH 3M3SA 1C2DA 1L1JA 4YOIA 4Z6AH 3KQEA 1B7XB 3RXMA 3G01A 1E0FD 1LTOA 5GCHF 2ZDNA 2BX3A 3SU1A 2W7UA 1IQNA 7LPRA 4FU9A 2BX4A 4GUXA 3M5NA 2FOAA 1BHXB 2ODYB 4AFZA 3T26A 4FUGA 3BIUH 4X6MA 3BTEE 1C1OA 1HNEE 3A85A 3BEFB 4CRDA 3E91A 3A7XA 1XM1A 4SGBE 4CRCA 1GMCF 3VB4A 1P10A 2TGAA 1ABIH 3A7TA 1H4WA 4Z0KA 2BQ6B 1FAKH 2ZFRH 1N6YA 1OWIA 1F0UA 3SNDA 4DGJA 3DD2H 4MNXA 2TIOA 3K6YA 1ZR0A 1MKXK 2FDAA 4ISIH 4SGAE 4B74A 4ESTE 3HPTB 1GBBA 3BG8A 1O3AA 2QGRA 2D1JA 1QQ4A 4NZQA 4GHTA 3OTJE 2VGCB 1OKXA 2A7CA 2ZGJA 1Z1IA 1WQVH 1BMMH 2VIQA 1MCVA 4ZHMU 1EOLA 3RMMH 1WAYB 1A7SA 1QJ6B 1GBIA 4CHAB 1GDQA 3GDSA 1YPKH 2FEQH 4MPUA 2HVXA 2K1QA 4AB9A 1GI6A 5A0BA 2A2QH 3O8CA 1LVBA 1SGYE 4B2AA 1BUIA 1OX1A 1ZMJA 1V2VT 1GMHG 3RXEA 3QWCH 1B0FA 1GI0A 1UCYH 1QA0A 5FBIA 1A0JA 5T6FA 3ZVEA 1EASA 3RXFA 1SGFG 4J2YB 5AFYH 2VIVA 3SV6A 4ABFA 3TJUA 2G81E 2RA3A 4PROA 5AFZH 3TGKE 1WCZA 1P3CA 1C9PA 3PWBA 5E2PA 3RU4D 1LDTT 2DUCA 3RXHA 5G4BA 1Y5AT 1P3EA 1HGTH 3PROA 2A5AA 1G32B 4K69A
chains in the Genus database with same CATH superfamily
3OX7U 4BTIB 3NXPA 1GVKB 2Q6DA 4KKDA 3OY6U 1C9TA 1MKWH 1ZRKA 1KLIH 1NU7B 3KYFA 1Q31A 1C5UA 2WUBA 2QAAA 3RU4T 1EAWA 2A0QB 2OC0A 4JZ1A 5ESTE 1YBWA 4B6EA 4I86A 4HI3A 2KAIA 1GBJA 1K1OA 4FUJA 3PTBA 4IGDA 1IQKA 3D23A 3QX5H 3U1IB 4U2WA 2CF8H 3WWBA 1ID5H 5EPNA 2PKSC 1ZJDA 1GI5A 3OAAD 4Y0ZE 4ZKNU 1RTKA 2UUFB 3SV2H 3FO8D 1C2LA 1D3TB 1KSNA 1SGNE 3ITIA 1LVYA 4MTBA 1O3CA 1V2TT 3MU0A 2ZTZA 3SJKA 2Y5HA 5A09A 4HG6A 3BV9B 1HJ8A 1O38A 3Q77A 4WMDA 4OS7A 3AK5A 2FYRA 1OWDA 1LKBA 1J17T 2GJGA 1K9OE 1W7XH 2PLXA 2VVCA 1T8NA 3E6PH 2ZTXA 1TGSZ 4NA9H 2TRMA 3NK8A 1HFDA 1HAVA 4K5ZA 1LHFH 2J97A 3U1JB 1DWEH 2F9VA 2WPKS 1ZLRA 4H42U 1HAVB 1WXRA 1VJAU 1O30A 1F5RA 3UNQA 5E0GA 1HAGE 3KNXA 1UTNA 2ANWA 4THNH 1O3OA 3E8LA 4DT4A 3ZZAA 5EXMA 3BTGE 1T4UH 2H9EH 4QT8C 1BTZA 2B7DH 4P02A 1BTWA 4CH2B 1ARBA 2V3OH 1NPMA 2Z3EA 1OWEA 1ZMLA 4XBDA 2VH0A 1BMLA 1VITG 3RXBA 2JETC 2V35A 1NFWA 1O2GH 3TPIZ 4FETA 2FOCA 1IQEA 2TPIZ 3SHAH 1C4U2 5DP7A 3F2HA 4O3TA 3MOCA 3MHWU 4ISOA 4AB8A 3MH5A 4BANB 1VCWA 3GY4A 1F0RA 1SL3A 1C5RA 3OEED 5HKKD 2KAIB 3W94A 3ZVDA 3M37A 5EXNA 3URDA 2ZC9H 3CNRA 4X2WA 3RXGA 2QA9E 2Y7XA 4WMEA 3GOVB 3AAUA 2AIPA 3RXRA 3RXCA 1O2IA 1Y3XA 3ZZ7A 2NWNA 3PRDA 4DG4A 3M7TA 1TGNA 4F49A 3H5CB 2ZGCA 4Y6DA 5HXFA 1YKTA 4JK6A 1ZSLA 1EX3A 4MLFB 1AHTH 1KY9A 1THPB 4BAOB 1QURH 1TOCB 1GHBG 1NROH 3U8TH 1W0JD 4HTCH 1UK3A 1PPBH 1SHYA 3RMLH 4Y11E 5DG6A 2FI5E 5K7RA 1EAIA 5EOKA 4LXBH 4XBBA 3VEQB 3UR9A 2F91A 2WYJA 2EC9H 3K6ZA 5L30H 2H9HA 3SV9A 2WPMS 2FESH 3P8FA 1E36B 5E8EH 3VGCC 1DFPA 3M61U 1BMNH 3QN7A 2F83A 1K22H 2D26C 5GPIB 1O35A 4CR9A 3EAJA 4H6TA 1DUAA 2J94A 2PKAB 1WTGH 5A8ZA 3PMJA 4KTCA 3RC6A 2PSYA 3TH2H 4DOQA 2R9PA 3GCOA 4H4FA 2AGIX 3Q76A 3ZVFA 4Q80A 5C0UA 2QF4A 3ODFA 2HWLB 3DHKH 5F6MA 1XKAC 4MQAA 1O2HA 1PYTD 1CGIE 1QRWA 4GSOA 3SJIA 1EJNA 4CHAC 2IPHA 1RD3B 2AGGX 3ODDA 1C5ZB 1DDJA 1W2KH 2TGPZ 2ZECA 2W5EA 4GLYA 4D7GA 3A7ZA 1LPGB 1SLUB 2O8LA 5E0JA 1Z71A 2V3MA 3NKKA 3FAOA 2KCPA 1YGCH 1OP0A 4AZ2B 1GL0E 2GCHG 4RSPA 3A8CA 3VFEA 1C5NH 5FPSA 1FPHH 3RXOA 1C4Y2 1QL9A 1HAOH 1FUJA 1AKSB 3SJOA 3BSQA 2AMQA 2G00A 3A82A 1K1MA 5LPFA 1UCYK 2VIPA 1MTVA 1TPPA 1O39A 2WV4A 1MZAA 1GBKA 1QL8A 1GCDA 2QV1A 1P2OA 2Z9JA 3QGJA 1ANDA 3QO6A 4TY7A 1ZGVA 1OYTH 2GVFA 2VINA 1Z8GA 1XUJA 2XXLA 4Y79A 1SLWB 2LPRA 2ANKH 1EAUA 2ZGHA 6CHAC 5EQQA 1F0SA 4UFFH 2W3IA 1FY8E 1VITF 1ZSKA 1EB2A 5GCHG 3DT0H 4DIIH 1GHXH 1G3EA 5FAHA 1K1IA 4DJZB 1O2NA 2HNTE 3OTPA 2YNAA 1GJCB 3FP8E 1O3FA 4CRBA 2ZGBH 5JBBS 1ZHRA 1SQTA 4FUEA 1DXWA 2BVSH 6GCHF 4OS1A 1IQJA 8LPRA 3WWFA 2GZ8A 1ZHPA 1TNIA 1BA8B 1ZTJA 4HGCA 5C5OA 2FOBA 3NRLA 1QBNA 1V2PT 1C2EA 1HXFH 1FY5A 2ALVA 1EZXC 2STBE 2I6QA 1TOMH 1O2JA 1S5SA 4X0WU 3RXVA 3GDVA 3A8BA 2BOHB 1RIWB 1O2SA 2GTBA 3SNCA 1MTNC 2KCOA 3EGKH 1MABB 1QRXA 2XWBI 1MAYA 1DWDH 3STJA 3RLYH 5EXLA 4CBNA 1O2WA 5LGOA 2VIOA 4ZUHA 4J1YA 1VITH 3RXIA 3H7TA 4JZDH 4NA8A 1ZTKA 3ZZ9A 5LH8A 1C5PA 1HAPH 5C2ZA 2P3FH 1UVOA 4Q7XA 3LGUA 1BTYA 1W10U 4YLQH 1V2ST 1HDTH 2TGDA 1GJ9B 1TNJA 5ABWA 1AZZA 1L4DA 3KIDU 1XVOA 1QB6A 2F9UA 4F48B 2M2AA 4AG2A 1UTLM 1UHBA 2HPPH 2SGFE 3SQEE 1THSH 1D9IA 1HYLA 1FXYA 3ZZBA 3RM2H 3OU0A 1P2IA 1HLTH 1P2KA 2XC4A 1EJMA 1L2EA 1ELAA 2HRVA 4DURA 1SGTA 1QTFA 2CF9H 3HKJB 2L74A 3P6ZB 1ESTA 3B9FH 3RXSA 3UAIC 4JYVH 4DIHH 3E90B 1ETTH 1XUFA 2VJ1A 4FUBA 1W3CA 1EPTA 2BY8X 3DUXH 5TJXA 1V2JT 1GWAA 1EOJA 1TAWA 4LK4A 1NRQH 4UFEH 4P00A 5F8ZA 3QUMP 5AVDA 1UJ1A 1X7AC 2GCTB 4KELA 3D65E 4TPIZ 4DCDA 1RGQA 1SSXA 2TBSA 3MMGA 5DN6D 1D3QB 2WPHS 4IC6A 2PGQB 1AWFH 1C2MA 1NO9H 2WHXA 5C67A 2KZ4A 1L1GA 1P57B 1Z6JH 1BBRE 3SUEA 3VXFH 2Y81A 3GY6A 1MH0A 1KLTA 2Z7FE 1GCTB 1AO5A 1O2XA 1RS0A 5DGJA 1J9CH 3L33A 3A7WA 1TGBA 1DSUA 1ABJH 1V2RT 3PO1C 2RCEA 3BEUA 2VIDA 1YPHC 5GNDA 3UIRA 2VH6A 1Y5UT 5DJ7A 2DE9A 1XMNB 3S9AA 1BBRK 4H6SB 2F43B 1RJXB 3S9BA 1LPZB 4Y8YA 1CGJE 1G37A 3M5OA 1VCQA 3FN8A 4X8SH 1XXDA 2HVYB 1LPKB 2XBYA 1Q3XA 1UTKA 1SR5C 2ZFPH 4UONA 1EFRD 4ABAA 2H2ZA 3DSGA 2A4OA 3BN9A 1T8MA 4ISLA 4WXVA 3SU2A 1QL7A 3K9XB 4UD9H 5HM2A 1GHAF 2PGBB 1GVLA 1FY4A 5FBEA 1ZZZA 1H8DH 3SUGA 2RDEA 1UHBB 1IQIA 2ZCKP 5GJ4B 4CRAA 1FY3A 1GPZA 1G9IE 5DKMA 3PRBA 1XUIA 3L6PA 2CJIA 1YF4A 5IYTA 2UWPA 3SJ9A 3ATWA 1INCA 4XBCA 1SGDE 3TVJB 1NBMD 1AI8H 4MNVA 3SNEA 2OD3B 2BD9A 1CA8B 2AIQA 3ATLA 2ZHQH 3SBKA 3HK3B 3TJNA 4CRFA 1LO6A 1MTSA 3KHVA 3U8RH 2FOMB 4WY3A 1Y3WA 2A5KA 3NZIA 2Z6BD 4KP0A 2XRCA 3RP2A 1BB0B 1DPOA 4D9RA 3SW2B 4O97A 4NSVA 1AKSA 2BYAX 2EI8A 3W95A 2ZCHP 4R8TB 1PJPA 1Y3VA 2SGPE 4IN2A 1NU9A 5JPMH 4I8JA 3RXUA 2OBOA 2BDIA 1C1SA 1NTPA 2XOKD 3ZZ4A 3VXEH 5F03A 2OUAA 1FJSA 3RMOH 3T27A 2JDID 1IQGA 2O8MA 3AW0A 2IPQX 2FX6A 2GKVE 3N7EA 2WSSD 2G55A 3M35A 2B0FA 2J92A 2SGEE 2ZDKA 3BTFE 3QGNB 3LGWA 2FWWA 1A2CH 3DCLA 3SU5A 4B2CA 3BEIB 2G8TA 1Y3UA 3NWUA 5HGGA 5TCAA 2Y6TA 1SI5H 3ATKA 2BOKA 1WOFA 1K1JA 2GV7A 2AGEX 4YLUA 3KL6A 4Q4LA 1DT2A 3F0OA 2BD4A 3S9CA 2PTNA 1BRUP 4NIYA 4ZCNA 4GHQA 2GCHF 2J2UA 2RDLA 1QNJA 2FOHA 3SO3A 2C8WB 4A1TA 1GI7B 1QA7A 1GG6C 2V3HH 2PHBA 1NFYA 2BHGA 3DSOA 4D8NA 4NWKA 3KEEA 8GCHG 1AFQC 1N6XA 2BQ7B 2XTTB 4BAKB 1FLEE 1YWUA 3GCHC 3ATIA 2XCFA 2BD8A 2OINA 5GDSH 2FZZA 1A3EH 2XNDD 1HCGA 1ARCA 1C2IA 1IHTH 1LQDB 1T31A 1EZSC 4AGJA 2FS8A 3QLPH 2H1UA 3LGVA 2ANMH 3SORA 1MTUA 2Z3DA 3SUDA 2SGAA 1MCTA 1SVPA 3Q3KA 1P04A 5C1YA 1TA6A 1G3DA 1U6QA 2BDHA 2F9BH 3L3TA 1GI9B 1DY8A 3MH6A 2BTCE 1RRKA 1OP8A 1P12E 4YO9A 1SQRA 4X6OA 1T7CA 3VB6A 2Y7ZA 2P8OC 2BZ6H 2ZZUH 4DY7B 1O3DA 1GI3A 2O9QA 1FN8A 1H8IH 4K3JA 5TCCA 1TQ7B 4YESB 2BY5X 2PV9B 1IQMA 3MO6A 1TBRH 4E06H 1BHXF 1V2UT 1TX6A 1NFXA 3MI4A 4ASHA 1NN6A 1O36A 1Q2WA 4RT1A 5HM9A 4X2XA 5EQRA 3PLBA 1AN1E 1RIWC 1MBQA 5DP4A 2QF0A 5IDKA 4ZHAA 2Y5GA 3DA9B 3SJ8A 1CT4E 3TLOA 3R3GB 2GMTC 2EA3A 2P94A 3O8DA 1N8OC 2ZKSA 3UNRA 1Z8RA 2GT8A 1TX8A 1XXFA 5EIYA 2ZU1A 4ZKRU 3A83A 1LVOA 4OGYA 2J4IA 1WSSH 3MH7A 4CR5A 1GMDG 1PPGE 1GHAG 2PUQH 2YMSD 4TWWA 3M36A 1GBDA 2V0BA 4AN7A 2ZG0H 1ZRBA 1TALA 2JETB 3RXPA 5ETXA 1OOKB 1SPJA 3DFLA 3HGNA 4WH6A 2ESTE 1Z8IB 3ZVAA 1YCPH 1Y8TA 4TT3D 1C1RA 2F4LA 1MQ5A 1RTFB 1SMFE 1H9IE 2BDGA 3GCTF 3V3MA 3MO9A 1BTHH 1QCPA 2BVRH 4KTSA 1YM0A 2OC8A 2VWOA 3VB5A 1XVMA 1S83A 2R3YA 1TABE 1O2RA 3PMHB 3S69A 3RMNH 1V2LT 2DE8A 1AD8H 1GHYH 2R3UA 4Q7ZA 1FN6A 1O32A 4Q63A 3CS7A 1HPGA 3UY9A 1HJAC 1OWHA 4Y7BA 1FX0B 1BITA 1O2TA 4AYYB 1UTMA 1JXPA 4AOQA 2SNWA 1HAYB 3O8BA 3ELAH 2SNVA 1AGJA 1PQ5A 9ESTA 1WU1A 2ZFFH 1T8OA 2XNIA 2GP9B 3F68H 3BTME 3MQKC 1GBLA 1KXAA 3IG6B 2H5DA 3MU8A 3TIUA 3LIWA 2CV3A 2BLWA 3M5MA 1Z1JA 3OYPA 3VGCB 3TK9A 1YPHE 2ZO3H 4U32A 1GBTA 7GCHG 2O8TA 1AE8H 4ACBA 3E16B 1C1NA 1TONA 1FI8A 1AMHA 1GJBB 5A2MH 3BIVH 1W0YH 2CMYA 2LELA 3A8AA 1H8ED 2VWNA 1JOUB 5K0HA 3ZZ3A 5EJLA 3FZZA 3EQ0H 1XX9A 3GYMA 3PO1B 1OSSA 2C8XB 1S6LA 4YZUA 3GY2A 2HPQH 2O8UA 3U98H 4ZMAH 4ABBA 2XBXA 1W14U 2FODA 2BY6X 4JZIA 3BTKE 2ZA5A 1O2VA 1C5OH 1O2ZA 1QR3E 2TGTA 3SGBE 5F8TA 1C1WH 4OGXA 1O3IA 7GCHF 3F0PA 3UWIA 2BD5A 4B2BA 1GBMA 1SB1H 1UTOA 2C8ZB 2ZDMA 2B8OH 3TJOA 3KN2A 5CMXH 1QHRB 1WDIA 2BLQA 3LKWA 1F2SE 1C5LH 1NM6A 1AFEH 1S0RA 1CGHA 4NIXA 5JYIA 4NFEA 1S84A 2FS9A 4K1TA 4FUHA 2NU1E 1SLVB 2AS9A 2Q1JA 1Z8JB 2QE7D 4AGKA 1H9HE 3VPKA 5EODA 2NU4E 3GISB 1PPEE 2AMDA 2FLBH 1S81A 5F53A 3RXLA 3GICB 4A6LA 4NIWA 1QGFA 3OY5U 1NT1A 4E7RG 2Y80A 3GY3A 3P70B 5B6OA 2R0LA 1CU1A 2BQWB 5GWZA 3S7HB 1UVTH 4AYVB 4CRGA 1MU8B 1E79D 1MTNB 3HKIB 4UDWH 2WINI 2FYQA 1O3NA 1KXFA 1GBEA 1ZGIA 3GYLB 4D76A 1DOJA 4MPXA 1P11E 3LT3A 1CBWB 2BM2A 2F9PA 4X1PU 1IQHA 3U69H 1BTPA 1CA0C 4B73A 1KXBA 6GCHG 3VB7A 1O3MA 2UWOA 4JZFH 1NC6A 1SGCA 2ZU4A 5F8XA 4FU8A 2WV5A 1NRNH 4XFQA 5FX5A 4B75A 1MD8A 4I31A 2Z3CA 2ZTYA 2AERH 5SGAE 2OC1A 1C5VA 2Z94A 3ZZCA 3ZV9A 3NCLA 1H8HD 1BBRH 5DO4H 1CHGA 4BTTB 4MPWA 3V7TA 2XBWA 3RXQA 1HBTH 3C1KA 1A4WH 3F1SB 4I8LA 1JRSA 1V6DA 1D6WA 5CHAB 2A2XH 1T8LA 1D4PB 3A80A 2NU0E 1YPMH 4I7YH 3FANA 1C5TA 1LQEA 4IS5A 5H4IB 1PQ7A 4K1SA 1HB0B 1GMDF 3EA8A 2P59A 1EAXA 3WW7A 5GXPA 1WV7H 3Q00A 3A88A 1UW7A 1DUEA 5DP3A 2A4RA 1FIZA 2ZPSA 2PKSB 4U30A 4ASUD 2KFWA 1SGRE 1W12U 2J38A 3F6UH 4K2YA 4WF8A 1TWXB 5EG4A 1ELBA 3I29A 1O2MA 2ASUB 1KYNA 1O5BB 3AAVA 2R0KA 3PYHA 3MNBA 3FP6E 1F0TA 2AH4X 2VU8E 5A8XA 3TGJE 4Q2KA 2FOGA 3FZDA 1OWJA 1TMUH 2R2WU 2QXIA 4LZ1H 1ZTLA 2J98B 1G36A 1ZMNA 4AC9A 4E05H 2BD3A 1NRRH 2XWAA 1VR1H 2A4GA 1QFKH 3BTWE 1O2LA 1BDAA 1YLDA 3F9HA 2GCTC 2PFEA 3E0PB 2J5UA 1C1VH 4E7NA 1GDNA 3OE7D 1BJUA 1O3BA 2J95A 1O5EH 3DSPA 5DP5A 3PMBB 3UREA 2W6JD 1DM4B 3M5LA 3O8RA 1PYTC 1T4VH 3UPEA 3UQOA 1GI1A 1YCPK 3SOSA 3B23B 4NFFA 1UTJA 3MYWA 2W3KA 1DWCH 2F3CE 4ZHLU 1AVXA 1C2KA 1SKYE 1TRNA 1ZYOA 1PPCE 3QK1A 4IMQA 3M3TA 3T25A 2BVXH 4I33A 3HATH 5HYOA 3LJOA 4ABIA 5CDFE 4ZROA 3K2UA 3S7KB 1P0SH 2VWMA 3SU3A 1PPFE 1UO6A 4JZEH 1A5IA 1SQOA 1EZQA 5FXLA 2IOTA 4FUCA 1V2WT 4OS2A 1O5GH 2BDAA 2G5NA 1O0DH 1GI2A 1XUHA 1HRTH 1VJ9U 3P8OA 1LCYA 2FXRA 1SBWA 2Z9LA 1YLCA 3A7YA 4JMYA 1A5GH 4NG9H 5IK2D 1H1BA 1O3KA 2O8WA 3E1XB 3GY8A 3SGQE 2STAE 1Y5BT 2VIWA 3E0NB 1C5SA 3OSYA 3F9FA 3QDZB 4D9QA 1SGIB 1E35B 1EQ9A 2BB4A 1V2OT 1GI8B 3R0FA 5JBTA 1JIRA 3UFAA 4NA7A 1GMHF 2JIZD 5DP6A 2PKAA 1BRAA 2ZIQH 1GJ6A 1P8VC 1PQ8A 4HZHA 1WUNH 3SHCH 1GL1A 1K1LA 1W13U 4M7GA 5C0TA 2FOEA 3SGAE 2BDYA 1AIXH 1ZSJA 1OYQA 2HNTC 2J34A 4MDSA 1GHVH 2IN2A 2C3SA 1C1UH 1CBWC 1KDQA 3RC4A 4X1RU 2CHAC 3MNSA 4GCHG 5AHGH 4O9VA 4TSFD 2FX4A 1KDQB 1SOZA 2C90B 1YC0A 1B0EA 2SFAA 1SGEE 1OP2A 1HAZB 3EE0B 1ACBE 1YYY1 4ABGA 1HJ9A 1BCUH 1MKXH 1C5MD 2BLVA 1VZQH 3TNSA 1YCPM 4MNWA 1YP9A 1EKBB 3RDZA 3A86A 2P95A 1XKBC 1C5YB 2Z9IA 3MU1A 1SLXB 1IAUA 1MD7A 4I8GA 1W7GH 3AW1A 4INKA 1TQ0B 3E3TA 2M5TA 2R2MB 1A3BH 1DITH 3ESTA 3UWJH 3V13A 3A87A 1BRCE 1DE7H 1GBHA 4ABDA 1O2OA 1DLEA 1AVWA 3AASA 2A45B 3ZYEA 3PB1E 3HGPA 1FDPA 3N7DA 3FOAA 1W0ZU 1QJ7B 1O2KA 3T62A 2F9NA 3SV7A 4GPGA 2OK5A 2A7HA 3SI4H 2G5VA 1A0LA 1P2JA 1BMFD 2WPDD 4HFPB 4CBOA 4ABHA 4MG3A 2GDDA 5C1UA 5I46H 1GGDC 1L0ZA 1TBZH 2JH0D 2HLCA 4XE4A 5HIYA 2F9OA 4KGAA 1IOEA 2Y82A 6LPRA 1HV7A 1KTSB 1G30B 2UWLA 3KCGH 4FXGH 1ELCA 2B5TB 4X1NU 3BTQE 1NRPH 3F9GA 1WBGB 4B71A 2A31A 2ILNA 1FMGA 2WUCA 1PPZA 1AFQB 3KQCA 3RLWH 1KTTB 2ZP0H 1IHSH 3EYDA 3T5FH 2VWLA 1ELVA 4UEHH 3KQBA 2GX4A 3QTOH 1AY6H 3GY7A 1UVUH 4ZKSU 2D2DA 1B5GH 3PTNA 2SGDE 2QIQA 3STIA 1XUKA 2D8WA 1J14A 5E2OA 4INHA 3TU7H 3SZNA 2UUKB 3ZZ6A 1TIOA 1PQAA 1K1PA 1W0KD 1EB1H 1BMAA 3I78A 3RXTA 2JJ1D 2WV9A 3BG4B 3SNAA 3ZVGA 4WWYA 1KXDA 3MFJA 4YTAA 3BTHE 1BQYA 2H5CA 5T1VA 2ZHWH 2HGTH 2ODQA 2Q6GA 1P01A 1JWTA 2WYGA 2ZU3A 3SZEA 1LHEH 1K0HA 1KXEA 1O3JA 4Y76A 4YXWD 4B76A 3N7OA 4FUFA 1TNGA 2ALPA 2ZNKH 3FVFB 5ESBA 2CHAB 2UUJB 1FIWA 9LPRA 3A84A 4X1SU 1O3HA 4BAHB 1C1QA 1P9UA 3ZVCA 1UK2A 3SU4A 2XBVA 2LNCA 1YPGH 2GMTB 1L4ZA 2ZHFH 1ANCA 4OM9A 4Y0YE 1QZ8A 4ABEA 2P3TB 1MMJN 2CXVA 3CS0A 1V2QT 1AVGH 1SGFA 3SN8A 1DY9A 4YM9A 3UOPA 1C1MA 1BZXE 2P93A 2PSXA 4AFUA 1G2LA 2PUXB 2VNTA 1C2FA 2H6MA 2ZWLH 5DPAA 2G52A 4X8UH 2K8IA 1CT0E 3KQDA 3P92A 3SV8A 3NUMA 3LU9B 5EPYA 5A0AE 5HMAA 5A8YA 3UB0A 2ZF0H 3A8DA 3FFGA 4Y8ZA 1LHGH 1N8OB 5LPEA 5T6DA 3GS9A 2OP9A 4YT6H 1SGQE 5EQSA 4JK5A 1PFXC 2OQ5A 2OBQA 4CH8B 5FX6A 1D3DB 1P06A 2UUYA 2P8OB 4OS4A 1HIAA 4VGCB 3ZZ8A 1TBQH 1QBVH 2FMJA 2QY0B 4WMFA 1YPLH 1VGCC 1OWKA 2KR7A 1TMTH 1ESAA 2KM0A 1NFUA 2EQNA 3PM3A 2CGAA 1HIAB 1YY3A 1QBOA 2QC2A 1DVAH 4ZH8A 5J4SA 1DLKB 2CN0H 2VB0A 4XSKU 2QF5A 2JH5D 1TE0A 1TGTA 5FCKA 1GJAB 3RU4E 2XCNA 3U8OH 3RXJA 1MQ6A 3P95A 2ZFSA 4UFDH 5HIZA 4F55A 4Y10E 1GMCG 1TNKA 3HK6B 4I8HA 2A7JA 1SOTA 4TY6A 1A61H 5AF9H 1TNHA 2THFB 1FV9A 1S6FA 4FVDA 2QXHA 4X6NA 1PPHE 4TYDA 3UUZA 3T28A 3UNSA 6CHAB 3OFND 5C94A 2FPZA 4WH8A 4ISHH 4DT7B 4AORA 3GDUA 1DX5M 1AU8A 5LPRA 1TB6H 1KXCA 1BT7A 4X6PA 1O5CB 5JB8S 1C5WB 5L2YH 1DXPA 4A5TS 1FAXA 1CVWH 5L2ZH 1ZPZA 3MNCA 1GJ8B 1HJAB 2FLRH 2BY7X 8KME2 1P9SA 1V2NT 3TH3H 1J8AA 1GBFA 3RC5A 2RG3A 1UVPA 3GCTG 1OS8A 2BY9X 1YPJH 1A1RA 1D3PB 2G4TA 5FPTA 1A0HB 1GVZA 4OS6A 3F2GA 4AFQA 3UQVA 4BXSA 3S0NA 4AX9H 4JCNA 2GZ7A 1FONA 2ZDVH 1O34A 4DW2U 1TFXA 1FPCH 2EI7A 4ZXYH 4K8BA 3CP7A 4RKOB 2VGCC 1UK4A 4FUDA 4NSYA 4DVAU 4XDEA 1GBCA 1O3EA 4B6FA 3ENSB 2JKHA 3B8JA 3MH4A 2C4FH 4VGCC 1JRTA 4Z1MD 3QZRA 1DSTA 2WPIS 3BTTE 1THRH 2GZ9A 3IWMA 1QB9A 1JIMA 4JYUH 1LKAA 1OPHB 2BD7A 2QXJA 4CREA 4ISNA 1CHOG 2ZU2A 3PLKA 1AUTC 3EE7A 2AMPA 2Q6FA 4JYTA 2ZQ2A 1F5LA 4YOGA 4INLA 4IMZA 1NS3A 1BTUA 2YOLA 1AB9C 1SFQB 1C2JA 2YMSB 1JMOH 4XOJA 5J4QA 3FP7E 3H09A 1O3PB 4NGAH 3SI3H 1EUFA 1AUJA 2FI4E 5CHAC 3PLPA 1UVSH 1K28D 3GCHB 3QZQA 2YMSC 1EJAA 3TK5A 1COWD 1QB1A 3JZ1B 5C5NA 2VVVA 4BOHA 1S85A 3UOUA 2BD2A 2W26A 3PWCA 4UFGH 2P16A 3KGPA 2RFKC 4NIVA 1P2MA 3PV2A 1MTWA 3TH4H 3MTYA 2J98A 2A4QA 1E38B 4TPYA 5T3HA 4FUIA 3SQHE 1GGDB 1EZUC 1MU6B 4A1VA 4ZAEA 5DSFA 4UE7H 1EXFA 5JBAS 1P03A 3F2FA 3RM0H 2KCYA 2PTCE 3NPSA 4WJG2 8GCHF 1CO7E 2B9LA 4BNRA 1GCTC 1TMBH 5JB9S 1UTQA 1MUEB 4KTUA 1AQ7A 1V2KT 2RA0A 1NBME 5BRRE 2EEKA 1FNIA 2V6NA 1HAXB 1SG8B 1NESE 1ELDE 2ULLA 3VG8A 2VBCA 4M9FA 1O37A 2ZQ1A 3ATMA 1GG6B 8ESTE 3EA9A 2PW8H 1LMWB 2WPJS 1AWHB 1TLDA 4RKJB 1CSOE 4U01A 1QQUA 2A1DB 4WXIA 2XC0A 2OTVA 4MPVA 2FO9A 4AG1A 2NU2E 1E34B 1P02A 1O2UA 1JBUH 1WQSA 1MAXA 3BF6H 4K1EA 4BAMB 2IJD1 1UTPA 1O5FH 5EW1H 3RXAA 1CHOF 1KLJH 2PWXA 3RXDA 4OS5A 3LPRA 1UCYE 3M3VA 2PR3A 1ESBA 5DK1A 1NZQH 4X8TH 1ZHMA 2VVUA 1C5XB 4FOUC 1SHHB 3LH3A 1QY6A 1O31A 4A92A 2BXTH 4A7IB 1S0QA 1OXGA 3W1EA 2KCAA 3OEHD 2HNTF 2XC5A 3ZZDA 1ELEE 1TPOA 3MNXA 1DICA 1S82A 1F7ZA 5FL7D 1ORFA 1SGPE 1O3LA 1K1NA 1G3CA 3FKSD 1ANBA 3P17H 7ESTE 5EU8A 3RUOA 1ETSH 1WTHD 3TGIE 3V0XA 5BPEA 2ZHDA 3MU4A 3LH1A 3LGIA 3P8NA 4ABJA 4YT7H 1E1QD 3A7VA 3SUFA 1F5KU 1GI4A 3D62A 2FP7B 2ZHEH 3SNBA 2Z9KA 2XYAA 4BAQB 3V12A 1J15A 1GDUA 5GIBA 2A5IA 3WY8A 2QN5T 1DS2E 3LC5A 4X2YA 4FVBA 1TPAE 2EI6A 1AZ8A 3AVZA 1O3GA 1O2YA 2ZU5A 3LGYA 5KECA 4MNYA 4TWYA 2OXSA 1VCPA 2ZEBA 5B6LA 2BDBA 1QIXB 1CT2E 2ODPA 2ANYA 3N99A 3KQ5A 1BRBE 4ZKOU 2G4UA 3LC3A 3IITA 4R0IA 3SU0A 1S6HA 1MBMA 4Y8XA 2QCYA 2OQUA 4RT0A 3T29A 4O3UA 1TPSA 6ESTA 1MKWK 1EP6A 2ZDAH 4D7FA 1AE5A 3EA7A 2FTMA 2J9NA 1GJDB 1ZPCA 4O03A 1NRSH 1LHDH 1QRZA 2GV6A 4I32A 5KGOA 2BMGB 1P2NA 1AB9B 2ZDLA 1HAIH 1W11U 1G2MA 1ANEA 1ELGA 4K60A 5EGMA 4X2VA 1O2PA 1FY1A 4RI0A 1EPTB 3LONA 1LHCH 1D6RA 1ELTA 4IBLH 1QJ1B 2KX4A 2WZQA 1GHZA 3D49H 4XRNA 4B1TA 3ZZ5A 4ACAA 3JZ2B 2LP6A 2GDEH 1V2MT 4X8VH 5C20A 4X1QU 1KMHB 4NCYA 1DWBH 1O33A 2I6SA 3BTDE 4YOJA 1ETRH 1IQFA 2GGVB 3A81A 1LVMA 4NWLA 3KF2A 1EP5A 5C17A 2W7SA 1GJ4H 1H9LB 2ZI2H 3TK6A 4LOYH 2NU3E 3U28C 2FI3E 1V3XA 5EJZA 3DFJA 3CENA 2FOFA 1Y3YA 4GAWA 4GCHF 5C3NA 1P09A 3LDXH 2Z9GA 3QTVH 1TYNA 2QF3A 3Q3XA 4WVPE 3PMAB 1L1NA 1OHHD 2FTLE 2ZFQH 4AFSA 2ZGXH 2YNBA 1O5AB 3M7UA 4MVNA 2CK3D 3ZV8A 1O2QA 1TNLA 1XUGA 4GVUA 5CE1A 1BJVA 2ZPRA 2G51A 3C27B 3H7OA 1E1RD 2QYIA 1ZJKA 3BG4C 2P3UB 7KMEH 1GBAA 3I77A 4Y7AA 1K21H 5DP8A 2V7QD 2XW9A 3UR6A 1Z7KA 3GY5A 2FIRH 3MO3A 3T2NA 4F4OC 1SC8U 2BLOA 1TRYA 2WPLS 3ZVBA 1YPEH 3LJJA 1GHBF 2ZCLP 3K65B 1MZDA 4RN6A 1CE5A 1GHWH 2OLGA 5T6GA 3LOXA 1C4V2 4IC5A 2ZFTA 5E0HA 5C1XA 3MWIU 2HOBA 1J16A 2SGQE 1VKYA 1P05A 1Y59T 1C2GA 3URCA 2FM2A 5JDUB 5KEDA 2IJOB 2AYWA 1SFIA 4K8YA 3GCNA 3F9EA 2HALA 3MU5A 1DANH 3PV5A 1EATA 3A89A 3ZYDA 1O5DH 5PTPA 4IW4E 2HLDD 2PP6A 3Q3YA 1TRMA 1HUTH 1CQQA 1RTLA 5FHTA 2EY4C 1W8BH 4I8KA 1A46H 1SQAA 1M9UA 2BZAA 1FZZA 5FCRA 2JH6D 4BTUB 2OCVB 1RFNA 1TA2A 1HAHH 2AFQB 4FU7A 1BOQA 3U9AH 1TX7A 3PV4A 3UTUH 1WYKA 1ELFA 1G3BA 1RXPA 1EPTC 2BDCA 5CHBA 4A1XA 3M7QA 2OC7A 1C1TA 1CA0B 1NY22 5FPYA 1E37B 3TITA 1T32A 5EW2H 4LZ4B 1C5QA 2A32A 4Q7YA 4IN1A 1ZPBA 1F92A 1Z6EA 2GD4B 1KIGH 2AEIH 1C2HA 4Y71A 2QXGA 1IQLA 1HXEH 3RXKA 1ZOMA 1N1LA 3EDXB 3SU6A 3TNTA 1GJ5H 1TGCA 1BIOA 1VGCB 3P8GA 5JBCS 1GJ7B 5I25A 5DP9A 4NZLA 3TJVA 3F3BA 5A0CA 2Y5FA 3LGTA 1K2I1 4ZXXH 1FQ3A 1BTXA 1P2QA 2H9TH 1A5HA 3VB3A 2BXUH 4BXWA 2L6OA 2C93B 5L6NH 1C1PA 2C8YB 2GT7A 1YLNA 2ZPQA 1UMAH 3M3SA 1C2DA 1L1JA 4YOIA 4Z6AH 3KQEA 1B7XB 3RXMA 3G01A 1E0FD 1LTOA 5GCHF 2ZDNA 2BX3A 3SU1A 2W7UA 1IQNA 7LPRA 4FU9A 2BX4A 4GUXA 3M5NA 2FOAA 1BHXB 2ODYB 4AFZA 3T26A 4FUGA 3BIUH 4X6MA 3BTEE 1C1OA 1HNEE 3A85A 3BEFB 4CRDA 3E91A 3A7XA 1XM1A 4SGBE 4CRCA 1GMCF 3VB4A 1P10A 2TGAA 5EJ1A 1ABIH 3A7TA 1H4WA 4Z0KA 2BQ6B 1FAKH 2ZFRH 1N6YA 1OWIA 1F0UA 4XD7D 3SNDA 4DGJA 2W6ID 2JJ2D 3DD2H 4MNXA 2TIOA 3K6YA 1ZR0A 1MKXK 2FDAA 4ISIH 4SGAE 4B74A 4ESTE 3HPTB 1GBBA 3BG8A 1O3AA 2QGRA 2D1JA 1QQ4A 2K0QA 4GHTA 3OTJE 4NZQA 2VGCB 1OKXA 2A7CA 2ZGJA 1Z1IA 1WQVH 1BMMH 2VIQA 1MCVA 4ZHMU 1EOLA 3RMMH 1WAYB 1A7SA 1QJ6B 1GBIA 3SYJA 4CHAB 1GDQA 3GDSA 1YPKH 2FEQH 4MPUA 2HVXA 2K1QA 4AB9A 1GI6A 5A0BA 2A2QH 3O8CA 1LVBA 1SGYE 4B2AA 1BUIA 3KYGA 1OX1A 1ZMJA 1V2VT 1GMHG 3RXEA 3QWCH 1B0FA 1GI0A 1UCYH 1QA0A 5FBIA 1A0JA 5T6FA 3ZVEA 3ZIAD 1EASA 3RXFA 1SGFG 4J2YB 5AFYH 2VIVA 3SV6A 4ABFA 3TJUA 2G81E 2RA3A 4PROA 5AFZH 3TGKE 1WCZA 1P3CA 1C9PA 3PWBA 5E2PA 3RU4D 1LDTT 2DUCA 3RXHA 5G4BA 1Y5AT 1P3EA 2AHME 1HGTH 3PROA 2A5AA 1G32B 4K69A
chains in the Genus database with same CATH topology
3OX7U 4BTIB 3NXPA 1GVKB 2Q6DA 4KKDA 3OY6U 1C9TA 1MKWH 1ZRKA 1KLIH 1NU7B 1Q31A 1C5UA 2WUBA 2QAAA 3RU4T 1EAWA 2A0QB 2OC0A 4JZ1A 5ESTE 1YBWA 4HI3A 2KAIA 1GBJA 1K1OA 4FUJA 3PTBA 4IGDA 1IQKA 3D23A 3QX5H 3U1IB 4U2WA 2CF8H 1ID5H 5EPNA 2PKSC 1ZJDA 1GI5A 4Y0ZE 4ZKNU 1RTKA 2UUFB 3SV2H 1C2LA 1D3TB 1KSNA 1SGNE 3ITIA 1LVYA 4MTBA 1O3CA 1V2TT 3MU0A 2ZTZA 3SJKA 2Y5HA 5A09A 3BV9B 1HJ8A 1O38A 3Q77A 4WMDA 4OS7A 2FYRA 1OWDA 1LKBA 1J17T 1K9OE 1W7XH 2PLXA 2VVCA 1T8NA 3E6PH 2ZTXA 1TGSZ 4NA9H 2TRMA 3NK8A 1HFDA 1HAVA 4K5ZA 1LHFH 3U1JB 1DWEH 2F9VA 2WPKS 1ZLRA 4H42U 1HAVB 1VJAU 1O30A 1F5RA 3UNQA 5E0GA 1HAGE 3KNXA 1UTNA 2ANWA 4THNH 1O3OA 3E8LA 3ZZAA 5EXMA 3BTGE 1T4UH 2H9EH 4QT8C 1BTZA 2B7DH 1BTWA 4CH2B 1ARBA 2V3OH 1NPMA 2Z3EA 1OWEA 1ZMLA 4XBDA 2VH0A 1BMLA 1VITG 3RXBA 2JETC 2V35A 1NFWA 1O2GH 3TPIZ 2FOCA 1IQEA 2TPIZ 3SHAH 1C4U2 5DP7A 4O3TA 4BANB 3MOCA 3MHWU 4ISOA 4AB8A 3MH5A 1VCWA 3GY4A 1F0RA 1SL3A 1C5RA 2KAIB 3W94A 3ZVDA 3M37A 5EXNA 3URDA 2ZC9H 4X2WA 3RXGA 2QA9E 2Y7XA 4WMEA 3GOVB 3AAUA 2AIPA 3RXRA 3RXCA 1O2IA 1Y3XA 3ZZ7A 2NWNA 4DG4A 3M7TA 1TGNA 4F49A 3H5CB 2ZGCA 4Y6DA 5HXFA 1YKTA 4JK6A 1ZSLA 1EX3A 4MLFB 1AHTH 1KY9A 1THPB 4BAOB 1QURH 1TOCB 1GHBG 1NROH 3U8TH 4HTCH 1UK3A 1PPBH 1SHYA 3RMLH 4Y11E 5DG6A 2FI5E 5K7RA 1EAIA 5EOKA 4LXBH 4XBBA 3VEQB 3UR9A 2F91A 2WYJA 2EC9H 3K6ZA 5L30H 2H9HA 3SV9A 2WPMS 2FESH 3P8FA 1E36B 5E8EH 3VGCC 1DFPA 3M61U 1BMNH 3QN7A 2F83A 1K22H 2D26C 5GPIB 1O35A 4CR9A 3EAJA 4H6TA 1DUAA 2J94A 2PKAB 1WTGH 5A8ZA 3PMJA 4KTCA 3RC6A 2PSYA 3TH2H 4DOQA 2R9PA 3GCOA 4H4FA 2AGIX 3Q76A 3ZVFA 4Q80A 3ODFA 2HWLB 3DHKH 5F6MA 1XKAC 4MQAA 1O2HA 1PYTD 1CGIE 1QRWA 4GSOA 3SJIA 1EJNA 4CHAC 2IPHA 1RD3B 2AGGX 3ODDA 1C5ZB 1DDJA 1W2KH 2TGPZ 2ZECA 2W5EA 4GLYA 4D7GA 3A7ZA 1LPGB 1SLUB 2O8LA 5E0JA 1Z71A 3NKKA 3FAOA 1YGCH 1OP0A 4AZ2B 1GL0E 2GCHG 4RSPA 3A8CA 3VFEA 1C5NH 5FPSA 1FPHH 3RXOA 1C4Y2 1QL9A 1HAOH 1FUJA 1AKSB 3SJOA 3BSQA 2AMQA 2G00A 3A82A 1K1MA 5LPFA 1UCYK 2VIPA 1MTVA 1TPPA 1O39A 2WV4A 1MZAA 1GBKA 1QL8A 1GCDA 2QV1A 1P2OA 2Z9JA 3QGJA 1ANDA 3QO6A 4TY7A 1ZGVA 1OYTH 2GVFA 2VINA 1Z8GA 1XUJA 2XXLA 4Y79A 1SLWB 2LPRA 2ANKH 1EAUA 2ZGHA 6CHAC 5EQQA 1F0SA 4UFFH 2W3IA 1FY8E 1VITF 1ZSKA 1EB2A 5GCHG 3DT0H 4DIIH 1GHXH 1G3EA 5FAHA 1K1IA 4DJZB 1O2NA 2HNTE 2YNAA 1GJCB 3FP8E 1O3FA 4CRBA 2ZGBH 5JBBS 1ZHRA 1SQTA 4FUEA 1DXWA 2BVSH 6GCHF 4OS1A 1IQJA 8LPRA 2GZ8A 1ZHPA 1TNIA 1BA8B 1ZTJA 4HGCA 5C5OA 2FOBA 1QBNA 1V2PT 1C2EA 1HXFH 1FY5A 2ALVA 1EZXC 2STBE 2I6QA 1TOMH 1O2JA 1S5SA 4X0WU 3RXVA 3GDVA 3A8BA 2BOHB 1RIWB 1O2SA 2GTBA 3SNCA 1MTNC 3EGKH 1QRXA 2XWBI 1MAYA 1DWDH 3STJA 3RLYH 5EXLA 4CBNA 1O2WA 5LGOA 2VIOA 4ZUHA 4J1YA 1VITH 3RXIA 3H7TA 4JZDH 4NA8A 1ZTKA 3ZZ9A 5LH8A 1C5PA 1HAPH 5C2ZA 2P3FH 1UVOA 4Q7XA 3LGUA 1BTYA 1W10U 4YLQH 1V2ST 1HDTH 2TGDA 1GJ9B 1TNJA 5ABWA 1AZZA 1L4DA 3KIDU 1XVOA 1QB6A 2F9UA 4AG2A 1UTLM 1UHBA 2HPPH 2SGFE 3SQEE 1THSH 1D9IA 1HYLA 1FXYA 3ZZBA 3RM2H 3OU0A 1P2IA 1HLTH 1P2KA 2XC4A 1EJMA 1L2EA 1ELAA 2HRVA 4DURA 1SGTA 1QTFA 2CF9H 3HKJB 3P6ZB 1ESTA 3B9FH 3RXSA 4JYVH 4DIHH 3E90B 1ETTH 1XUFA 2VJ1A 4FUBA 1W3CA 1EPTA 2BY8X 3DUXH 5TJXA 1V2JT 1GWAA 1EOJA 1TAWA 4LK4A 1NRQH 4UFEH 5F8ZA 3QUMP 5AVDA 1UJ1A 1X7AC 2GCTB 4KELA 3D65E 4TPIZ 4DCDA 1RGQA 1SSXA 2TBSA 3MMGA 1D3QB 2WPHS 4IC6A 2PGQB 1AWFH 1C2MA 1NO9H 5C67A 1L1GA 1P57B 1Z6JH 1BBRE 3SUEA 3VXFH 2Y81A 3GY6A 1MH0A 1KLTA 2Z7FE 1GCTB 1AO5A 1O2XA 1RS0A 5DGJA 1J9CH 3L33A 3A7WA 1TGBA 1DSUA 1ABJH 1V2RT 3PO1C 2RCEA 3BEUA 2VIDA 1YPHC 3UIRA 2VH6A 1Y5UT 5DJ7A 2DE9A 1XMNB 3S9AA 1BBRK 4H6SB 3S9BA 1RJXB 1LPZB 4Y8YA 1CGJE 1G37A 3M5OA 1VCQA 4X8SH 1XXDA 1LPKB 2XBYA 1Q3XA 1UTKA 1SR5C 2ZFPH 4UONA 4ABAA 2H2ZA 2A4OA 3BN9A 1T8MA 4ISLA 4WXVA 3SU2A 1QL7A 3K9XB 4UD9H 5HM2A 1GHAF 2PGBB 1GVLA 1FY4A 5FBEA 1ZZZA 1H8DH 3SUGA 1UHBB 1IQIA 2ZCKP 5GJ4B 4CRAA 1FY3A 1GPZA 1G9IE 5DKMA 1XUIA 3L6PA 2CJIA 1YF4A 5IYTA 2UWPA 3SJ9A 3ATWA 1INCA 4XBCA 1SGDE 3TVJB 1AI8H 4MNVA 3SNEA 2OD3B 2BD9A 1CA8B 2AIQA 3ATLA 2ZHQH 3SBKA 3HK3B 3TJNA 4CRFA 1LO6A 1MTSA 3KHVA 3U8RH 2FOMB 4WY3A 1Y3WA 2A5KA 3NZIA 2Z6BD 4KP0A 2XRCA 3RP2A 1BB0B 1DPOA 4D9RA 3SW2B 4O97A 4NSVA 1AKSA 2BYAX 2EI8A 3W95A 2ZCHP 4R8TB 1PJPA 1Y3VA 2SGPE 4IN2A 1NU9A 5JPMH 4I8JA 3RXUA 2OBOA 2BDIA 1C1SA 1NTPA 3ZZ4A 3VXEH 5F03A 2OUAA 1FJSA 3RMOH 3T27A 1IQGA 2O8MA 3AW0A 2FX6A 2GKVE 2G55A 3M35A 2B0FA 2J92A 2SGEE 2ZDKA 3BTFE 3QGNB 3LGWA 2FWWA 1A2CH 3SU5A 4B2CA 3BEIB 2G8TA 1Y3UA 3NWUA 5HGGA 5TCAA 2Y6TA 1SI5H 3ATKA 2BOKA 1WOFA 1K1JA 2GV7A 2AGEX 4YLUA 3KL6A 1DT2A 2BD4A 3S9CA 2PTNA 1BRUP 4NIYA 4GHQA 2GCHF 2J2UA 2RDLA 1QNJA 2FOHA 3SO3A 2C8WB 4A1TA 1GI7B 1QA7A 1GG6C 2V3HH 2PHBA 1NFYA 2BHGA 4D8NA 4NWKA 3KEEA 8GCHG 1AFQC 1N6XA 2BQ7B 2XTTB 4BAKB 1FLEE 3GCHC 3ATIA 2XCFA 2BD8A 2OINA 5GDSH 2FZZA 1A3EH 1HCGA 1ARCA 1C2IA 1IHTH 1LQDB 1T31A 1EZSC 4AGJA 2FS8A 3QLPH 2H1UA 3LGVA 2ANMH 3SORA 1MTUA 2Z3DA 3SUDA 2SGAA 1MCTA 1SVPA 3Q3KA 1P04A 5C1YA 1TA6A 1G3DA 1U6QA 2BDHA 2F9BH 3L3TA 1GI9B 1DY8A 3MH6A 2BTCE 1RRKA 1OP8A 1P12E 4YO9A 4X6OA 1T7CA 3VB6A 2Y7ZA 2P8OC 2BZ6H 2ZZUH 4DY7B 1O3DA 1GI3A 2O9QA 1FN8A 1H8IH 4K3JA 5TCCA 1TQ7B 4YESB 2BY5X 2PV9B 1IQMA 3MO6A 1TBRH 4E06H 1BHXF 1V2UT 1TX6A 1NFXA 3MI4A 4ASHA 1NN6A 1O36A 1Q2WA 5HM9A 4X2XA 5EQRA 3PLBA 1AN1E 1RIWC 1MBQA 5DP4A 2QF0A 5IDKA 4ZHAA 2Y5GA 3DA9B 3SJ8A 1CT4E 3TLOA 3R3GB 2GMTC 2EA3A 2P94A 3O8DA 1N8OC 2ZKSA 3UNRA 1Z8RA 2GT8A 1TX8A 1XXFA 2ZU1A 4ZKRU 3A83A 1LVOA 4OGYA 2J4IA 1WSSH 3MH7A 4CR5A 1GMDG 1PPGE 1GHAG 2PUQH 4TWWA 3M36A 1GBDA 2V0BA 4AN7A 2ZG0H 1ZRBA 1TALA 2JETB 3RXPA 5ETXA 1OOKB 1SPJA 3DFLA 3HGNA 4WH6A 2ESTE 1Z8IB 3ZVAA 1YCPH 1Y8TA 1C1RA 1MQ5A 1RTFB 1SMFE 1H9IE 2BDGA 3GCTF 3V3MA 3MO9A 1BTHH 1QCPA 2BVRH 4KTSA 1YM0A 2OC8A 2VWOA 3VB5A 1XVMA 1S83A 2R3YA 1TABE 1O2RA 3PMHB 3S69A 3RMNH 1V2LT 2DE8A 1AD8H 1GHYH 2R3UA 4Q7ZA 1FN6A 1O32A 3CS7A 1HPGA 3UY9A 1HJAC 1OWHA 4Y7BA 1BITA 1O2TA 4AYYB 1UTMA 1JXPA 4AOQA 2SNWA 1HAYB 3O8BA 3ELAH 2SNVA 1AGJA 1PQ5A 9ESTA 1WU1A 2ZFFH 1T8OA 2XNIA 2GP9B 3F68H 3BTME 1GBLA 1KXAA 3IG6B 2H5DA 3MU8A 3TIUA 3LIWA 2CV3A 2BLWA 3M5MA 1Z1JA 3OYPA 3VGCB 3TK9A 1YPHE 2ZO3H 4U32A 1GBTA 7GCHG 2O8TA 1AE8H 3E16B 1C1NA 1TONA 1FI8A 1AMHA 1GJBB 5A2MH 3BIVH 1W0YH 2CMYA 3A8AA 2VWNA 1JOUB 5K0HA 3ZZ3A 3FZZA 3EQ0H 1XX9A 3GYMA 3PO1B 1OSSA 2C8XB 4YZUA 3GY2A 2HPQH 2O8UA 3U98H 4ZMAH 4ABBA 2XBXA 1W14U 2FODA 2BY6X 4JZIA 3BTKE 2ZA5A 1O2VA 1C5OH 1O2ZA 1QR3E 2TGTA 3SGBE 5F8TA 1C1WH 4OGXA 1O3IA 7GCHF 3UWIA 2BD5A 4B2BA 1GBMA 1SB1H 1UTOA 2C8ZB 2ZDMA 2B8OH 3TJOA 3KN2A 5CMXH 1QHRB 2BLQA 3LKWA 1F2SE 1C5LH 1NM6A 1AFEH 1S0RA 1CGHA 4NIXA 5JYIA 4NFEA 1S84A 2FS9A 4K1TA 4FUHA 2NU1E 1SLVB 2AS9A 2Q1JA 1Z8JB 4AGKA 1H9HE 3VPKA 5EODA 2NU4E 3GISB 1PPEE 2AMDA 2FLBH 1S81A 3RXLA 3GICB 4A6LA 4NIWA 1QGFA 3OY5U 1NT1A 4E7RG 2Y80A 3GY3A 3P70B 5B6OA 2R0LA 1CU1A 2BQWB 5GWZA 3S7HB 1UVTH 4AYVB 4CRGA 1MU8B 1MTNB 3HKIB 4UDWH 2WINI 2FYQA 1O3NA 1KXFA 1GBEA 1ZGIA 3GYLB 4D76A 1DOJA 4MPXA 1P11E 3LT3A 1CBWB 2BM2A 2F9PA 4X1PU 1IQHA 3U69H 1BTPA 1CA0C 4B73A 1KXBA 6GCHG 3VB7A 1O3MA 2UWOA 4JZFH 1NC6A 1SGCA 2ZU4A 5F8XA 4FU8A 2WV5A 1NRNH 4XFQA 5FX5A 4B75A 1MD8A 4I31A 2Z3CA 2ZTYA 2AERH 5SGAE 2OC1A 1C5VA 2Z94A 3ZZCA 3ZV9A 3NCLA 1BBRH 5DO4H 1CHGA 4BTTB 4MPWA 3V7TA 2XBWA 3RXQA 1HBTH 3C1KA 1A4WH 3F1SB 4I8LA 1JRSA 1V6DA 1D6WA 5CHAB 2A2XH 1T8LA 1D4PB 3A80A 2NU0E 1YPMH 4I7YH 3FANA 1C5TA 1LQEA 4IS5A 5H4IB 1PQ7A 4K1SA 1HB0B 1GMDF 3EA8A 2P59A 1EAXA 5GXPA 1WV7H 3Q00A 3A88A 1DUEA 5DP3A 2A4RA 1FIZA 2ZPSA 2PKSB 4U30A 1SGRE 1W12U 2J38A 3F6UH 4K2YA 4WF8A 1TWXB 5EG4A 1ELBA 3I29A 1O2MA 2ASUB 1KYNA 1O5BB 3AAVA 2R0KA 3PYHA 3MNBA 3FP6E 1F0TA 2AH4X 2VU8E 5A8XA 3TGJE 4Q2KA 2FOGA 3FZDA 1OWJA 1TMUH 2R2WU 2QXIA 4LZ1H 1ZTLA 1G36A 1ZMNA 4E05H 2BD3A 1NRRH 2XWAA 1VR1H 2A4GA 1QFKH 3BTWE 1O2LA 1BDAA 1YLDA 3F9HA 2GCTC 2PFEA 3E0PB 1C1VH 4E7NA 1GDNA 1BJUA 1O3BA 2J95A 1O5EH 5DP5A 3PMBB 3UREA 1DM4B 3M5LA 3O8RA 1PYTC 1T4VH 3UPEA 3UQOA 1GI1A 1YCPK 3SOSA 3B23B 4NFFA 1UTJA 3MYWA 2W3KA 1DWCH 2F3CE 4ZHLU 1AVXA 1C2KA 1TRNA 1ZYOA 1PPCE