1J16A

Benzamidine in complex with rat trypsin mutant x99/175/190rt
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRETYNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASSSFIITDNMVCVGFLEGGKDACQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin II, anionic
publication title Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-induced Structural Plasticity
pubmed doi rcsb
source organism Rattus norvegicus
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j16A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j16A02
1LPGB 5EQQA 2TBSA 1G37A 3RXKA 3HKIB 2Y5GA 3SJ8A 3E0PB 3M7TA 4ABJA 2FOEA 1EATA 3QUMP 5DG6A 4BAQB 1GMDG 2OC8A 2XC5A 1WQSA 1A4WH 3CS0A 4Y8YA 2GX4A 1ZTJA 3MTYA 4TY6A 3KQDA 5A8YA 2CGAA 2BD2A 2VWOA 4AORA 1RIWC 1C1RA 1BBRE 2IJOB 1BTPA 1XUJA 4GCHF 2XC4A 2SGAA 3P70B 5E2OA 2ZFSA 3VB7A 1G32B 2P59A 1ZPZA 2WPJS 3UQVA 4Z0KA 3ZVDA 2TGAA 3SJ9A 3NKKA 1O3OA 3A8AA 2BY9X 3Q3KA 4J2YB 3GY2A 1XM1A 2FOAA 1UJ1A 1F5LA 3GY8A 5LPEA 1X7AC 3BV9B 2P93A 4OS1A 1H1BA 1YYY1 2BD9A 2GTBA 2P94A 1IHTH 5A2MH 3EAJA 3RXVA 2ZDLA 3RMMH 3M35A 4NFEA 4X8TH 4UE7H 4HGCA 4X8VH 4AB9A 1O31A 3BTKE 3MFJA 3KQBA 2A2QH 2BY8X 4ZXXH 3RXEA 3ZVEA 3U8OH 5SGAE 1OWIA 3SJKA 5C5OA 3EA9A 3EDXB 4YM9A 3HGNA 1AVWA 1A1RA 1GI5A 1TONA 4YO9A 4K3JA 1A3EH 4VGCB 1O5AB 3IWMA 1C1VH 1AE8H 1P8VC 2GCTB 1FY8E 2ZTXA 3ZZCA 5LPFA 1AQ7A 2HPPH 5EU8A 5JPMH 1C4Y2 3MO6A 8KME2 1G2MA 1UTLM 1XVMA 4ISLA 2BY6X 3A88A 2ZDAH 1BTZA 4XE4A 1PQAA 1WYKA 1O2IA 4BAOB 3LONA 1HCGA 1T8OA 3SNBA 2Z9IA 1LVOA 4ABEA 1XKBC 2XWBI 1Y3UA 2Z3EA 1QRXA 1UVPA 3E91A 4NA7A 1W2KH 1LMWB 4MQAA 3LC3A 1L2EA 1QR3E 1O2QA 1HNEE 3RLWH 1J14A 2V3HH 1D4PB 4X1NU 4YTAA 2CF8H 2GDDA 3A81A 2VIQA 3NWUA 4B74A 1TGBA 2I6QA 3GOVB 3QWCH 2HRVA 7LPRA 1XKAC 3BTDE 3M36A 2GP9B 3HK3B 4CHAC 4I31A 2BHGA 1GVKB 1HLTH 1SGTA 2B8OH 3QGNB 1ZZZA 4LZ4B 2NU2E 4OS4A 1NM6A 1YPJH 3EE0B 1ZR0A 2QXHA 3Q3YA 4XOJA 3VB6A 2VGCB 1BRBE 1DY9A 1CGIE 3STJA 1A2CH 2WPMS 1GI9B 3RXRA 3VFEA 1C5VA 1HB0B 2F9UA 1SQOA 1C2FA 2G00A 3SBKA 1TX8A 1GHVH 2VJ1A 1O2WA 3V0XA 1TMTH 1XUKA 3DA9B 2ZDNA 2BTCE 2VB0A 1C5NH 1NRRH 1EP6A 1ESTA 1YBWA 2ZFFH 1SLVB 1GVZA 1A5IA 3V7TA 3LH3A 1LKBA 4WMFA 3MH7A 1OYTH 4QT8C 3QDZB 4FXGH 1QCPA 1UO6A 4ASHA 2Y7XA 3A8CA 1P2MA 5J4SA 1P09A 4E05H 3QX5H 3R0FA 4D7GA 1JIRA 5LH8A 3T28A 1OS8A 2ODPA 1P3CA 1MZDA 1G36A 1AZZA 1CA0C 1F2SE 1SGEE 3M3TA 1ANCA 2D8WA 4Y76A 3PO1B 4TPIZ 1BBRH 1AGJA 2PKAA 3ZYEA 1O3AA 3PB1E 2ZU5A 1C5QA 3KHVA 3F9HA 1GI1A 1V2JT 1SBWA 1YPHE 2EA3A 4XBBA 4X2YA 1EJMA 4FVDA 1GI2A 5L6NH 1P2KA 1P12E 5K7RA 1IAUA 3E90B 3TJVA 4BTUB 1YGCH 4BTTB 4UDWH 1QJ7B 1Z8JB 1V2VT 3LKWA 3TJUA 1WBGB 5FX5A 3TNSA 3SQEE 1GI3A 3A87A 3ENSB 4ISNA 1O2NA 2STBE 3F6UH 3P8GA 4MNYA 5CMXH 1SHHB 4OGXA 1B7XB 1XXFA 3SNCA 3ZZAA 2ZFTA 4K1SA 3TJNA 2W3KA 3BTWE 4CH8B 1XUGA 4K8BA 2BZAA 1MCVA 4AN7A 1V2QT 1S6HA 5F03A 2BX4A 1DICA 1P57B 1TNKA 1WOFA 2B0FA 2JKHA 3K65B 4Y8XA 1VITG 4RSPA 1J16A 2GMTB 2BDHA 1O5EH 1TMBH 7GCHF 3T2NA 1T8LA 3LOXA 5I46H 5DP4A 1ZPCA 4KTUA 3ZZ3A 2FEQH 4O03A 1EX3A 1TX6A 3SHAH 5LGOA 1WUNH 4X6MA 1D6WA 1BHXF 3QZQA 1ZJDA 2ZU2A 2H6MA 4IN1A 1AB9C 1SI5H 4GHTA 3NUMA 3SU2A 1P9SA 5DP8A 1FDPA 1QA7A 2Z9JA 1GBDA 4ABDA 3LU9B 2H9EH 1A5HA 2BXTH 1FQ3A 1EQ9A 1V2MT 3B9FH 1OWJA 1JRSA 2A5IA 2ZCHP 2P8OC 3URCA 1VGCC 2OQUA 3FVFB 2GT8A 4UFFH 3BG4C 1RIWB 4WVPE 1DXPA 1CT0E 3KCGH 3E16B 2ANKH 4H4FA 4M7GA 3M5OA 3AAUA 3RXQA 3OU0A 4JZDH 1DPOA 1V3XA 1Y5BT 1THRH 4E06H 1XX9A 1C5RA 4FU7A 3TNTA 1EZUC 1GDUA 1O2SA 1IQKA 1ZJKA 1TPSA 1NN6A 2O9QA 2AMDA 2WYJA 1O5BB 3RU4E 1ELDE 1NU9A 4ZKSU 1HAVB 3S9BA 3MI4A 4KP0A 1ZGVA 1YLDA 2HNTE 1W0YH 4IBLH 1CGJE 1O3FA 3TLOA 2OLGA 3EA8A 2VVVA 4H6SB 1FY5A 2A4RA 4AGKA 2ZGBH 3TVJB 2ZNKH 1Z7KA 4NFFA 1CQQA 1L4ZA 1C9PA 2XCFA 2TRMA 4MPXA 3ZZ5A 1NRNH 3GICB 2F83A 1QGFA 1WCZA 1D9IA 2Y82A 3ZV9A 1O3BA 2BQ6B 2HALA 3UY9A 1QJ1B 1KY9A 2PGBB 3U8TH 3A85A 4Y10E 1UTOA 2A0QB 3QO6A 1EB2A 1DDJA 2CV3A 1AHTH 4Y7BA 2BDYA 4IW4E 2NWNA 3M3SA 2TPIZ 3A7TA 2ZI2H 1QRZA 5K0HA 1Z1JA 1AZ8A 2ZFRH 3MU0A 1MH0A 4Q80A 1K1NA 1FPHH 1OWHA 4E7NA 1BTWA 1DWCH 4NWLA 5HM9A 2ODQA 3E1XB 3SV2H 5ESTE 3IG6B 3SORA 2HWLB 2WPIS 1G2LA 3RXAA 1A5GH 2FODA 1W8BH 2PWXA 1KSNA 3ODDA 4B2CA 4IC5A 3AASA 1YCPK 2BD5A 2LNCA 3RMNH 4Y8ZA 4TPYA 4IN2A 1ZMJA 4BTIB 5GPIB 2PGQB 4AOQA 3ATLA 3T26A 2TGTA 4UONA 2WINI 4CHAB 4IMZA 3SU1A 1BTYA 1UVSH 1AD8H 2A7JA 1P2NA 1SGYE 2ZU4A 1GBBA 1Q3XA 3OX7U 1LHDH 2KAIB 8GCHG 1T7CA 4AG2A 4I8KA 5AVDA 4I7YH 1B0EA 1BOQA 1GI4A 3RP2A 2JH5D 1ELCA 4MNVA 1T4VH 3KL6A 3LC5A 3RMLH 1JIMA 1S6FA 3T29A 1THSH 5EQSA 2R3UA 1HV7A 5FBEA 4YLQH 2D26C 4UFDH 5AF9H 3QK1A 1Q31A 1NFYA 1SGCA 2V35A 1S82A 4GHQA 2VGCC 1QB6A 1RTKA 4X6PA 3RXHA 2FS9A 2ZGHA 2B7DH 4B2BA 1GJ7B 3GDVA 2F9NA 5DPAA 5TCAA 2G4TA 3A8BA 1PYTC 4I8GA 1GDNA 2GZ9A 2ZFQH 2QF0A 1LO6A 3BEIB 1SGFG 4ZHMU 1GMHG 3BIUH 4Y11E 1AN1E 1OWKA 3PV4A 1HJ9A 3V13A 4ABIA 2XBVA 2FTLE 1T4UH 4WWYA 1TIOA 4JZ1A 4DY7B 1UVUH 1CA0B 3A7WA 3M37A 1QBVH 4ZMAH 5FAHA 4K8YA 1O2GH 4ISHH 5EXLA 1FY1A 1P11E 3SHCH 1K1OA 3LGIA 5EW2H 2BDAA 1O2HA 3LGWA 1IQEA 2Q1JA 3V3MA 1LPZB 1GBKA 3HATH 1ABJH 3TGJE 1AE5A 1SGIB 1OOKB 1ACBE 3FANA 2J34A 1OP0A 1TPPA 2Z3DA 2QXGA 5C1XA 1H8DH 1SL3A 3MO3A 3FP8E 1O32A 1AI8H 1MTNC 3P95A 1SLXB 2GCHF 1ORFA 2TGPZ 1W0ZU 1RXPA 1TBQH 1SOZA 1LHFH 3P6ZB 3QTOH 5F8XA 3RXOA 1QJ6B 3RM0H 1C2GA 1DANH 4ZH8A 1O3DA 4Y6DA 3ITIA 2RA0A 1O3MA 2BLQA 4Y71A 1DS2E 1Y3WA 1P02A 2BB4A 2GZ7A 4X0WU 1PPHE 3MNCA 3P92A 1QA0A 4KTCA 2AGEX 1MQ5A 1CHOG 1UK3A 1V2TT 1GBJA 3UNQA 4NIXA 1FMGA 1AU8A 1QTFA 3FFGA 1OP8A 4A92A 3UWIA 5F8TA 5EG4A 1DFPA 1TPAE 1TOMH 1AB9B 3QTVH 1O2YA 4XDEA 1DY8A 1ETSH 4F4OC 1ARCA 1NRPH 4X6NA 3SUDA 2C8WB 1RGQA 3D49H 2WV4A 2AH4X 1DSUA 2V6NA 2ZPQA 1XUHA 3RC5A 2ZKSA 1VGCB 1LQDB 3BG4B 3KF2A 1LHGH 2B5TB 1W3CA 1C2EA 2AEIH 4A6LA 5A8XA 2R9PA 3ZVBA 3SZNA 1J15A 3ATWA 4CR9A 2GV7A 3BTFE 1W13U 2V0BA 4YT7H 1UTKA 2V3OH 1DWBH 4GCHG 2ZGXH 4BANB 3GY7A 4TWYA 2FOMB 1GCTC 1IQHA 4X2WA 1KXDA 5DJ7A 2YOLA 1O2TA 2GKVE 4MTBA 1FAXA 3S7KB 1PPCE 2OC7A 5E0JA 3STIA 5JBCS 2XBXA 1CSOE 3R3GB 2Z94A 1C5OH 3O8DA 1QQ4A 3F9FA 3RU4D 1BMAA 4B76A 1BJUA 5E0HA 1HYLA 1UHBB 5L2ZH 4Y0YE 1Z8IB 2VNTA 1L4DA 1YPHC 3LGTA 2CN0H 4K1TA 1UVTH 5ETXA 1CGHA 5FHTA 1FIZA 3VPKA 1O33A 2A4GA 2F9OA 4YOJA 2PHBA 3RUOA 1C5ZB 2BY7X 3BEUA 4ISOA 5T6FA 1FY3A 1GHXH 3KQCA 4GAWA 3RXTA 2H9TH 2BD7A 4UD9H 3UWJH 4SGAE 1NY22 1IQIA 1C1UH 3OY5U 1GBLA 5FPTA 1A0HB 1EAUA 2Q6FA 4JCNA 1O2ZA 1TPOA 1IQLA 2ULLA 2VIWA 1TRYA 3AW0A 5IYTA 1F0TA 1SHYA 1NESE 3C1KA 4U2WA 1O2VA 2C93B 1HAVA 3O8CA 3S69A 4K69A 2FOGA 1BBRK 2PSXA 3PMJA 1SFIA 1GHWH 2ZECA 3SU0A 3UNSA 5FPYA 3ZZDA 1TRMA 2FOBA 1O3NA 6GCHF 8LPRA 2ZDMA 1MKWH 1C5LH 1F92A 1T32A 1ESBA 5HYOA 1F5RA 2P95A 1J8AA 1Y59T 5HM2A 2OD3B 4FUBA 1QB1A 1O3LA 1S83A 1GBCA 3BTHE 1BMLA 5GWZA 4UEHH 4A7IB 3FAOA 1ELFA 3SNEA 2QXJA 1BTHH 4FUHA 2P3UB 4AFUA 6CHAB 4NIYA 1K9OE 1Y3VA 2C90B 2ZQ1A 5FCKA 1AUTC 2SGDE 5E8EH 1GJ9B 3ZYDA 1O5FH 3URDA 2ZO3H 3OY6U 1GHBF 2J95A 3VXEH 3F9GA 3F9EA 1GJAB 1SR5C 3GCOA 4DVAU 4FUIA 1V2WT 2FESH 5FXLA 2QY0B 3TPIZ 1BUIA 5T6GA 1DLKB 2C8ZB 3A89A 1C5WB 1V2UT 3SV6A 1O36A 5GJ4B 2XRCA 1VJ9U 3KGPA 1O2JA 2Z9KA 3CENA 1DOJA 1HAPH 1JWTA 1PQ8A 4ABHA 1K2I1 2ZU1A 1NRSH 2DE9A 3G01A 3B8JA 2O8LA 5E2PA 3MMGA 1HJAB 4BXWA 1EZQA 1MQ6A 1GBAA 1EP5A 1IHSH 4WXVA 2W7SA 2HNTC 2QC2A 1DUEA 5FBIA 3P8NA 1SQTA 3A86A 3SN8A 3RXUA 1FUJA 3ZZBA 2CJIA 3QN7A 2C4FH 2H5DA 4ABGA 4CRDA 3UUZA 2FM2A 1NO9H 4NZLA 1EPTC 5ESBA 2C3SA 5TCCA 3F1SB 1ETRH 4E7RG 1MD8A 2CF9H 4AZ2B 5C2ZA 2IOTA 2BVSH 2KAIA 3ZZ8A 2OXSA 1F0SA 1FZZA 1BB0B 2SNWA 1NU7B 3TK5A 1MU6B 5DP7A 2GZ8A 4RN6A 1MTNB 2R2WU 2BLWA 1TGSZ 1O3EA 4NSVA 4DIIH 3MO9A 1PPBH 3LH1A 1ELVA 2VU8E 3KNXA 1YPKH 3SW2B 3VB4A 2Z7FE 1O3JA 2AIPA 1P0SH 4FVBA 2BD3A 1FI8A 3SUFA 1N6YA 2XBWA 4NWKA 1KTTB 5C5NA 3NXPA 3TK9A 1C2KA 2ESTE 3GYLB 1V6DA 3BIVH 1B5GH 5GXPA 1C5MD 1WV7H 4HTCH 4CRFA 2Z3CA 2XXLA 2H5CA 2ZGCA 1BDAA 3VGCC 2QCYA 5C1UA 3A7XA 2BVXH 1THPB 2A7CA 4X8SH 4XBCA 4NG9H 1GCDA 4A1XA 2XCNA 3SO3A 5AFZH 4ZXYH 4FUDA 1DM4B 2VH6A 3BTGE 4FUGA 3RXDA 3SGQE 4X8UH 1ELTA 1SGRE 1DWEH 4YLUA 4KKDA 1HPGA 1Z1IA 3B23B 4B2AA 2PV9B 7GCHG 5DP6A 5J4QA 3OYPA 2O8WA 1H9LB 1ZYOA 1YCPM 4THNH 1P2QA 1ZMLA 3I29A 4Y0ZE 1SG8B 2BYAX 4D9RA 1C1TA 3QLPH 3SNAA 2UUFB 1O37A 4CRAA 5I25A 3U9AH 2OBOA 4NCYA 3RXSA 2BLOA 1UTPA 1OWEA 2HGTH 1KXEA 4X1QU 3VB5A 1SOTA 1KXFA 1WQVH 1CE5A 3SV9A 2AIQA 2G8TA 1YC0A 4NA9H 4X1RU 1D3DB 3AW1A 1VCQA 5HXFA 2QA9E 2J94A 1KXBA 1M9UA 1UTNA 1MKXH 2ZWLH 3A83A 2WPLS 1MMJN 4U01A 2HPQH 2ZG0H 3BF6H 3DUXH 3NCLA 1VITH 4CR5A 2BX3A 3PMAB 1DLEA 1QY6A 2R3YA 3MHWU 1LKAA 1ZLRA 1ANBA 3A7YA 3L3TA 2Q6GA 1GCTB 2OUAA 1NT1A 2PKSC 1EJNA 1DT2A 4R0IA 2NU4E 1ZTLA 4DCDA 1CO7E 2H1UA 2XC0A 4MDSA 1ZSLA 2WYGA 3S9CA 1W11U 5F6MA 4KGAA 1U6QA 5C67A 2PTNA 1ESAA 1ZOMA 1E35B 4XFQA 1YPLH 1IQMA 4HFPB 2UUKB 1CU1A 4AYYB 1EASA 4U30A 1WTGH 5GCHF 2Z9LA 3GCTG 1N8OC 1PQ7A 3GCTF 1AKSB 1C2HA 2PR3A 3SV8A 1W7GH 1JOUB 1TGCA 1NROH 3SGBE 1Y8TA 1YPEH 3U69H 2OC1A 1CVWH 1OPHB 2GGVB 4AG1A 1TLDA 4X1PU 1QRWA 5DP5A 1A0JA 1O39A 1AY6H 1E34B 2ZA5A 3P8OA 1CHGA 1ELGA 1O35A 1V2KT 2BDCA 4FUEA 3A82A 1G3BA 4XSKU 5DP3A 5JYIA 3UR6A 3VEQB 1LVYA 2R0LA 1LVMA 4O97A 1H9HE 4A1VA 1P3EA 1QB9A 1S81A 1Z8RA 1QQUA 4KELA 1AFQC 4I32A 1ZPBA 1GBMA 1ZTKA 4Y7AA 2THFB 1EUFA 2EI6A 4CRGA 1GL0E 2A2XH 5EPNA 1UHBA 3H7OA 2G51A 1ZHPA 6LPRA 3UR9A 2VIOA 1J9CH 2A7HA 1LHCH 4D9QA 2OBQA 4JYTA 1QBNA 1RD3B 2GVFA 1E37B 1V2RT 3GY3A 1C2MA 1A61H 5H4IB 4UFEH 4Z6AH 1TA6A 2ASUB 4RKOB 1ETTH 3P8FA 1TWXB 1Y3XA 2VIVA 1GBFA 1GBEA 3BN9A 2FI5E 2ZPSA 1PJPA 1KXAA 5JB8S 6CHAC 4WY3A 1A46H 1ZMNA 2ZHWH 5DO4H 1AO5A 1L0ZA 2ZPRA 1SGQE 2VIPA 3EQ0H 2Y81A 5JDUB 1SFQB 4CRCA 3MU4A 3L6PA 3VXFH 1PQ5A 3QZRA 5JBTA 1SB1H 1BQYA 1OWDA 4MPWA 2JH0D 2VH0A 5JBAS 1BRUP 2A4OA 1FLEE 1F5KU 2Y7ZA 3KIDU 3ZZ6A 2RA3A 1CT2E 5AFYH 1H4WA 1UCYE 3TK6A 2J9NA 4DURA 3TH2H 1EPTB 3M7UA 1B0FA 1F0RA 2G5VA 3SU4A 4AYVB 4ZKRU 1UK2A 1Q2WA 2ZP0H 1O3IA 3ATIA 3Q3XA 4B71A 3Q77A 2W5EA 3PLKA 1HJAC 1BTXA 1TBZH 2RCEA 2FX4A 2VWMA 4NIWA 2FX6A 1RJXB 4WJG2 1GMCF 5ABWA 2J38A 4F49A 4ESTE 2A1DB 4BNRA 1HRTH 2A5AA 3UIRA 1Z8GA 1OX1A 4HI3A 1MBMA 1P04A 1O3PB 4D76A 1D6RA 3D62A 4ZHLU 1HAZB 2IPHA 1PFXC 2R2MB 1LTOA 3NK8A 2FI3E 1MD7A 1HBTH 2ANMH 2ZDKA 1HAGE 2GT7A 4U32A 3RM2H 3ZVAA 3RMOH 4D7FA 3BTEE 2HNTF 1HAOH 1O30A 1K21H 5C20A 3ODFA 2JH6D 1S84A 5A0AE 1GI7B 2ZC9H 1GI0A 2OQ5A 1TABE 3ZVCA 2GCHG 2G5NA 4ZROA 3VGCB 4AFQA 7ESTE 4JYVH 1N6XA 3RXJA 1AMHA 2J4IA 2C8YB 2PUQH 2VWNA 3WY8A 2A32A 4TYDA 1A3BH 3Q76A 2FTMA 2ZZUH 1PPGE 3M5NA 1TE0A 1QL7A 1O2UA 1HXFH 2OTVA 1V2ST 2AGGX 4YOGA 3H5CB 1S0QA 3TIUA 3SUEA 1F7ZA 1HDTH 4WMDA 4BAKB 1EAWA 1P2OA 1GBIA 1MTWA 2R0KA 4IS5A 1CA8B 3M61U 1GJ8B 1BT7A 1ZRBA 4DW2U 5C3NA 2Q6DA 3NZIA 2HVXA 1NFUA 1HXEH 2G81E 3E3TA 1P9UA 1IQJA 2UWOA 3SUGA 1C2DA 4YESB 2XNIA 1K1PA 2QGRA 2AMQA 1NFWA 1G9IE 1GHZA 4I33A 1O2RA 1MKWK 4K60A 2GD4B 3GISB 4ZUHA 4CREA 3CP7A 3ZZ9A 2BDBA 1JMOH 1P10A 1DE7H 1C5SA 3KN2A 2BQWB 2BY5X 1FONA 1XXDA 3PWBA 1RTFB 4BAHB 2OC0A 1HIAB 2PKSB 2WPKS 3EYDA 3TH3H 1RTLA 3BSQA 2SGEE 1TYNA 2QF3A 2VVCA 1BITA 2ZCLP 2AERH 1AWHB 1AUJA 4YOIA 5FCRA 2PLXA 4OGYA 1C5YB 5DP9A 1EOLA 1V2NT 1MCTA 3M5LA 2VIDA 2ODYB 2UUJB 2GV6A 4WMEA 3IITA 1N8OB 1TALA 1Z6JH 3DFLA 5CHAC 3SGAE 1GMDF 1Z6EA 1V2PT 3Q00A 1HAYB 3UPEA 2FOCA 1N1LA 1C1MA 1EB1H 1IQFA 1GG6B 1GL1A 3M5MA 1INCA 1SC8U 1G3EA 3PMBB 9ESTA 4B75A 2ZHEH 3SU3A 2EI7A 2STAE 3I78A 3MNSA 5HMAA 1QBOA 1BTUA 1KDQB 1FIWA 2ZFPH 1GDQA 3RLYH 5AHGH 1VZQH 1UCYH 2G52A 3KQEA 3PTBA 3SU6A 1J17T 3K6ZA 4FUJA 1V2OT 1KLJH 1KLIH 1HAIH 2P3FH 4ZAEA 2W26A 4AFSA 2SFAA 2AFQB 1W10U 1MTVA 4O9VA 1LCYA 1O5CB 2AGIX 1AFQB 2FYRA 3W94A 1C4U2 2ILNA 4WH6A 4GSOA 4K5ZA 3ZZ7A 3FP6E 3PROA 1A7SA 4GLYA 1MAYA 1NPMA 3MU8A 2AS9A 3T5FH 1EZSC 4D8NA 2J2UA 1MZAA 1P2IA 8ESTE 1F0UA 4OS2A 1ANDA 4ZKNU 1NRQH 2RDLA 3A80A 5IDKA 1C5TA 3GY5A 1AKSA 6GCHG 1C5PA 2BMGB 2WUBA 4XBDA 1YF4A 2QIQA 3TJOA 2P3TB 2OP9A 2Y6TA 1BRCE 2ZGJA 4NZQA 4RKJB 1AVXA 1T8NA 2ZHFH 5A09A 4I8JA 3MYWA 1EOJA 2BLVA 1O5GH 1BZXE 2QXIA 3S0NA 2FWWA 3GCHC 2FLRH 1QHRB 3UOPA 1ANEA 1Y5UT 1GHBG 1TAWA 1TNGA 1YKTA 2JETC 1GGDB 2W3IA 1O5DH 4WXIA 4H6TA 4A5TS 4X2XA 4CH2B 3GYMA 1UVOA 3PLPA 2HOBA 1QIXB 1VCWA 2HLCA 4DJZB 4DIHH 3MWIU 1TOCB 1JXPA 2BOKA 1TMUH 1ID5H 4AGJA 3MNXA 2FMJA 3RXPA 2B9LA 3PLBA 2M5TA 1KTSB 4LK4A 1O2KA 3TITA 2F9VA 4IMQA 1IOEA 1G30B 2XW9A 3CS7A 3D23A 1SPJA 2FIRH 4B1TA 1SMFE 5JBBS 1FAKH 4IC6A 1L1NA 2FI4E 4JZEH 2G4UA 4JZIA 4I8LA 1QNJA 3JZ2B 2GDEH 1FPCH 1ZSJA 4CRBA 2PTCE 1SLWB 4MNWA 1C1WH 1S85A 4R8TB 3H7TA 1ELAA 1TNLA 1L1GA 1C5XB 4SGBE 1MKXK 1T31A 3BEFB 5L30H 2ALPA 3LJOA 5EOKA 3K2UA 1CBWB 2XBYA 2CHAC 4TWWA 4ZHAA 4DG4A 2Z6BD 1HFDA 2TGDA 1XMNB 1PPZA 4CBNA 2ZHDA 4MPUA 4B73A 3TGIE 2BOHB 1SVPA 3V12A 1GHAG 1FNIA 2ALVA 2FS8A 5LPRA 1GHAF 2XTTB 1SGFA 5BPEA 3DFJA 5BRRE 2DE8A 1OYQA 1LPKB 1FN6A 4MVNA 5TJXA 1K1MA 1O3CA 3K9XB 1EPTA 4BAMB 5DGJA 1GJ5H 5G4BA 3ATMA 3SQHE 1QL8A 1E0FD 3UREA 2QYIA 1WU1A 2EI8A 2BXUH 2ZIQH 3S7HB 3GY4A 2D1JA 4X2VA 1BA8B 1DSTA 1AVGH 2A5KA 3SJOA 2I6SA 2TIOA 3C27B 3UFAA 1KLTA 4WH8A 1W14U 2EEKA 2J92A 3BTTE 1EKBB 1WAYB 1O2XA 1BHXB 1WSSH 5T3HA 1FJSA 1OP2A 2CMYA 1AWFH 1TRNA 1VR1H 3LT3A 1BJVA 3N7OA 3DD2H 1TGNA 1LQEA 4JMYA 5A8ZA 1ZSKA 1DX5M 3U1IB 1O0DH 3E0NB 1VJAU 1C1OA 2BVRH 1OSSA 2W7UA 2BD8A 1L1JA 1C2IA 1YM0A 2YNAA 3A8DA 3GDUA 3TU7H 3RDZA 1G3DA 1GBHA 1NZQH 2ZDVH 5PTPA 4LXBH 1E36B 1HAHH 2FZZA 1VITF 1GBTA 2FOFA 2F9BH 4LZ1H 1O3KA 3E8LA 1LHEH 3M3VA 5HGGA 1O2MA 1O2LA 1ZHRA 1SSXA 1ABIH 4BOHA 4ZKOU 2QN5T 5L2YH 2FO9A 1K1LA 2A45B 1NS3A 3RXGA 2XYAA 3MOCA 1O34A 1EXFA 1DWDH 3ZZ4A 1D3PB 3AAVA 1FY4A 3ZVFA 3S9AA 1E38B 4O3UA 3A7ZA 1EAIA 2O8TA 2G55A 1SGPE 5CHAB 2VINA 1UTQA 2FP7B 2BDGA 3LIWA 2NU1E 3U98H 2Z9GA 3U8RH 4ABBA 3LPRA 4I8HA 1P01A 3RC4A 5C1YA 5EODA 5GIBA 5GCHG 2OINA 2Y5HA 1H9IE 4ABFA 3A84A 9LPRA 2SGPE 2QAAA 1FXYA 2C8XB 1GI6A 3BG8A 3LJJA 3PTNA 3SU5A 1ZHMA 4INKA 1GG6C 1XUIA 4UFGH 1YP9A 1K28D 3PM3A 3DT0H 2ANYA 2SGQE 2PFEA 1MBQA 1Y3YA 2SNVA 3LDXH 5GDSH 3U1JB 3LGVA 1HIAA 1H8IH 3T25A 3RXIA 1IQNA 4DGJA 4GPGA 3GY6A 5EGMA 2QV1A 1RFNA 3E6PH 4INHA 1PPFE 1KYNA 1YPGH 2BM2A 1NTPA 3GDSA 3FZZA 1KIGH 3AVZA 1AIXH 4K1EA 4JYUH 2RG3A 2WPHS 1PYTD 1GHYH 1TNHA 4OS5A 2A31A 1MU8B 1ARBA 3PWCA 4Q2KA 2NU3E 2ZCKP 2FYQA 1TBRH 1WTHD 5E0GA 3O8RA 1SLUB 3RXCA 1D3QB 1QURH 2UWLA 2WV5A 3FZDA 4Q7XA 1O3GA 3HK6B 1KXCA 2ZTZA 2PSYA 1GWAA 3D65E 2AYWA 3DHKH 2WUCA 3SI3H 2BQ7B 1UTJA 3RC6A 3RXBA 4KTSA 1O3HA 6ESTA 1CT4E 1KDQA 3LGUA 3L33A 4TY7A 4O3TA 1T8MA 1GJDB 1ELEE 3NPSA 3MU1A 3GCHB 1GJ4H 4K2YA 2ZHQH 4FU9A 4VGCC 1A0LA 1SQAA 4NSYA 2FPZA 2JETB 4ISIH 2GCTC 4J1YA 5A0BA 2OCVB 4HZHA 3ELAH 1GPZA 3OTJE 1C1SA 1BMMH 3VB3A 1C1PA 4OS7A 3ZV8A 1GJ6A 1DVAH 1DUAA 1TFXA 1TGTA 4NGAH 2F9PA 2VWLA 1TB6H 2ZTYA 3T62A 5EXNA 3T27A 1ELBA 1BIOA 4PROA 1TQ7B 2ZQ2A 1GGDC 1K22H 2FDAA 1FV9A 1VCPA 2ZEBA 1BRAA 3RXLA 1C2JA 2P16A 7KMEH 1EAXA 4MPVA 1SGDE 1MTSA 1UMAH 3HGPA 2VVUA 4H42U 1D3TB 5EPYA 1O38A 1P06A 2FLBH 2O8UA 3MU5A 3O8BA 1GVLA 1HUTH 1S0RA 8GCHF 3SV7A 5EW1H 1YLCA 1K1JA 1TNIA 1Y5AT 3GCNA 3UOUA 4X1SU 1C9TA 5A0CA 4Q7ZA 2CHAB 3SNDA 2PKAB 3RU4T 1UTMA 2EC9H 1TX7A 1GMCG 2K1QA 4IGDA 4INLA 2IN2A 2F3CE 3MH4A 3PYHA 1LDTT 3SOSA 3MNBA 3BTME 3UNRA 1C5UA 4JK5A 1K1IA 1RS0A 1ZGIA 1MTUA 2ANWA 1ZRKA 4AX9H 1CBWC 4BXSA 3UTUH 3F68H 4AB8A 4DOQA 3PMHB 1O2OA 3QGJA 2NU0E 1YPMH 3ZVGA 1GMHF 3ATKA 3W95A 1W12U 2Y5FA 1Z71A 4YT6H 5EQRA 2XWAA 1C2LA 5EXMA 4Q7YA 2O8MA 4OS6A 4FUFA 3M7QA 1C1NA 5F8ZA 3I77A 1HAXB 5FPSA 4DT7B 2UWPA 1EZXC 1PPEE 2PUXB 1G3CA 1BCUH 2BDIA 1TNJA 1XVOA 4GVUA 4A1TA 1FN8A 4JZFH 1MAXA 1EJAA 2ZU3A 4NA8A 3TH4H 1GJBB 1MUEB 1C4V2 1RRKA 1UCYK 2BD4A 2SGFE 2UUYA 5DK1A 4WF8A 3BTQE 1TA2A 3SJIA 3PO1C 1JBUH 4CBOA 3SI4H 1YCPH 2ZF0H 2H2ZA 3KEEA 1GJCB 1V2LT 3JZ1B 1P03A 3A7VA 1OXGA 3LGYA 5T6DA 1IQGA 1AFEH 1SGNE 4ABAA 2FXRA 1LVBA 1OKXA 4FUCA 3K6YA 5JB9S 3HKJB 1W7XH 4Y79A 4AFZA 1HJ8A 1JRTA 2LPRA 3RXMA 1S5SA 2CXVA 1NFXA 3FP7E 4LOYH 4X6OA 3EA7A 2Y80A 1QL9A 1NC6A 3OSYA 4YZUA 3RXFA 2F91A 3MH6A 3UQOA 1P2JA 1C1QA 3P17H 1XUFA 4MG3A 2FOHA 3MH5A 1CHOF 4NIVA 4MNXA 5B6OA 2A4QA 2DUCA 3TGKE 2PW8H 1BMNH 3ESTA 4JK6A 2GMTC 1QFKH 5DKMA 5FX6A 1UK4A 5CE1A 2BZ6H 1GI8B 1DXWA 2AMPA 4MLFB 1O2PA 1P05A 1HGTH 2YNBA 1TQ0B 1DITH 3EGKH 3HPTB 2D2DA 2H9HA 2P8OB 4FU8A 4GUXA
chains in the Genus database with same CATH superfamily
1LPGB 3OEED 5EQQA 2TBSA 1G37A 3RXKA 3HKIB 2Y5GA 3SJ8A 3E0PB 3M7TA 4ABJA 2FOEA 1EATA 3QUMP 5DG6A 4BAQB 1GMDG 2OC8A 2XC5A 1WQSA 1A4WH 3CS0A 5KECA 4Y8YA 2GX4A 1ZTJA 3MTYA 4TY6A 3KQDA 5A8YA 2CGAA 2BD2A 2VWOA 3U28C 4AORA 1RIWC 1C1RA 1BBRE 2IJOB 1BTPA 1XUJA 4GCHF 2XC4A 2SGAA 3P70B 5E2OA 2ZFSA 3VB7A 1G32B 2L6OA 2P59A 1ZPZA 2WPJS 3UQVA 4Z0KA 3ZVDA 2TGAA 3SJ9A 3NKKA 1O3OA 3A8AA 4B6FA 2BY9X 3Q3KA 4J2YB 3GY2A 1W0KD 1XM1A 2FOAA 1UJ1A 1F5LA 3GY8A 5LPEA 4Q4LA 1X7AC 3BV9B 2P93A 4OS1A 5EJLA 1H1BA 1YYY1 2BD9A 2GTBA 2P94A 1IHTH 5A2MH 3EAJA 3RXVA 2ZDLA 3RMMH 3M35A 4NFEA 4X8TH 4UE7H 4HGCA 4X8VH 4AB9A 1O31A 3BTKE 3MFJA 2F4LA 3KQBA 2A2QH 2BY8X 4ZXXH 3RXEA 3ZVEA 3U8OH 5SGAE 1OWIA 3SJKA 5C5OA 3EA9A 3EDXB 4YM9A 3HGNA 1AVWA 1A1RA 1GI5A 1TONA 4YO9A 4K3JA 1A3EH 4VGCB 1O5AB 3IWMA 1C1VH 1AE8H 1P8VC 2GCTB 1FY8E 2ZTXA 3ZZCA 5LPFA 1AQ7A 2HPPH 5EU8A 5JPMH 2CK3D 1C4Y2 2YMSB 3MO6A 8KME2 1G2MA 1UTLM 1XVMA 4ISLA 2BY6X 3A88A 2ZDAH 1BTZA 4XE4A 1PQAA 1WYKA 1O2IA 4BAOB 3LONA 1HCGA 1T8OA 3SNBA 2Z9IA 1LVOA 4ABEA 1XKBC 2XWBI 1Y3UA 2Z3EA 3OTPA 1QRXA 1UVPA 3E91A 4NA7A 1W2KH 1LMWB 2KCOA 4MQAA 3LC3A 1L2EA 1QR3E 1O2QA 1HNEE 3RLWH 1J14A 2V3HH 1D4PB 4X1NU 4YTAA 2CF8H 2GDDA 3A81A 2VIQA 3NWUA 4B74A 1TGBA 2I6QA 3GOVB 3QWCH 2HRVA 7LPRA 1XKAC 3BTDE 3M36A 2GP9B 3HK3B 4CHAC 4I31A 2BHGA 1GVKB 1HLTH 3F2FA 1SGTA 1W0JD 2B8OH 3QGNB 1ZZZA 4LZ4B 2NU2E 4OS4A 1NM6A 1YPJH 3EE0B 1ZR0A 2QXHA 3Q3YA 4XOJA 3VB6A 2VGCB 1BRBE 1DY9A 1CGIE 3STJA 1A2CH 2WPMS 5IK2D 1GI9B 3RXRA 4TT3D 3VFEA 1C5VA 1HB0B 2F9UA 1SQOA 1C2FA 2G00A 3SBKA 1TX8A 1GHVH 2VJ1A 1O2WA 3V0XA 1TMTH 1XUKA 3DA9B 2ZDNA 2BTCE 2VB0A 1C5NH 1NRRH 1EP6A 1ESTA 1YBWA 2ZFFH 4F48B 1SLVB 5DSFA 1GVZA 1A5IA 3V7TA 3LH3A 1LKBA 4WMFA 3MH7A 1OYTH 3VG8A 4QT8C 3QDZB 4FXGH 1COWD 1QCPA 1UO6A 4ASHA 2Y7XA 3A8CA 1P2MA 5J4SA 1P09A 4E05H 3QX5H 3R0FA 4D7GA 1JIRA 5LH8A 3T28A 1OS8A 2ODPA 1P3CA 1MZDA 1G36A 1AZZA 1CA0C 2M2AA 1F2SE 1SGEE 3M3TA 1ANCA 2D8WA 4Y76A 3PO1B 4TPIZ 1BBRH 1AGJA 2PKAA 3ZYEA 1O3AA 3PB1E 2ZU5A 1C5QA 2GJGA 3KHVA 3F9HA 1GI1A 1V2JT 1SBWA 1YPHE 4YXWD 2EA3A 4XBBA 3ZIAD 2JJ2D 1EJMA 4FVDA 4X2YA 1GI2A 5L6NH 1P2KA 1YWUA 1P12E 5K7RA 5HIYA 1IAUA 3E90B 3TJVA 4BTUB 1YGCH 4BTTB 4UDWH 1QJ7B 1Z8JB 1V2VT 3LKWA 3TJUA 1WBGB 5FX5A 3TNSA 3SQEE 1GI3A 3A87A 3ENSB 3PV2A 4ISNA 1O2NA 2STBE 3F6UH 3P8GA 4MNYA 5CMXH 1SHHB 4OGXA 1B7XB 1XXFA 3SNCA 3ZZAA 2ZFTA 4K1SA 3TJNA 2W3KA 3BTWE 4CH8B 1XUGA 4K8BA 2BZAA 1MCVA 4AN7A 1V2QT 2WZQA 1S6HA 5F03A 2BX4A 1DICA 1P57B 1TNKA 1WOFA 2B0FA 2JKHA 3K65B 4Y8XA 1VITG 4RSPA 1J16A 2GMTB 2BDHA 1O5EH 1TMBH 7GCHF 2V7QD 1T8LA 3LOXA 3T2NA 5I46H 5DP4A 1ZPCA 4Q63A 4KTUA 3ZZ3A 2FEQH 4O03A 1EX3A 1TX6A 3SHAH 5LGOA 1WUNH 4X6MA 1D6WA 1BHXF 3QZQA 1ZJDA 3WW7A 2ZU2A 2H6MA 4IN1A 1AB9C 1SI5H 4GHTA 3NUMA 3SU2A 1P9SA 5DP8A 1FDPA 1QA7A 2K0QA 2Z9JA 1GBDA 4ABDA 3LU9B 2H9EH 1A5HA 2BXTH 1FQ3A 1EQ9A 1V2MT 3B9FH 1OWJA 1JRSA 2A5IA 2ZCHP 2P8OC 3URCA 1VGCC 2OQUA 3FVFB 2GT8A 4UFFH 3BG4C 1RIWB 4WVPE 1DXPA 1OHHD 1CT0E 3KCGH 3E16B 2ANKH 4H4FA 4M7GA 3M5OA 5KGOA 3AAUA 3RXQA 3KYFA 3OU0A 4JZDH 1DPOA 1V3XA 1Y5BT 1THRH 4E06H 1XX9A 1C5RA 4FU7A 3TNTA 1EZUC 1GDUA 1O2SA 1IQKA 1ZJKA 1TPSA 1NN6A 2O9QA 2AMDA 2WYJA 1O5BB 3RU4E 1ELDE 1NU9A 4ZKSU 1HAVB 3S9BA 3MI4A 4KP0A 1ZGVA 1YLDA 2HNTE 1W0YH 4IBLH 1CGJE 1O3FA 3TLOA 2OLGA 3EA8A 2VVVA 4H6SB 1FY5A 2A4RA 4AGKA 2ZGBH 3TVJB 2ZNKH 1Z7KA 3DSGA 4NFFA 1CQQA 1L4ZA 1C9PA 2XCFA 2TRMA 4MPXA 3ZZ5A 1NRNH 3GICB 2F83A 1QGFA 1WCZA 1D9IA 2Y82A 3ZV9A 1O3BA 2BQ6B 2HALA 3UY9A 1QJ1B 1KY9A 2PGBB 3U8TH 3A85A 4Y10E 1UTOA 2A0QB 3QO6A 1EB2A 1DDJA 2CV3A 3N99A 1AHTH 4Y7BA 2BDYA 4IW4E 2NWNA 3M3SA 2TPIZ 3A7TA 2ZI2H 1QRZA 5K0HA 1Z1JA 1AZ8A 2ZFRH 3MU0A 1MH0A 4Q80A 1K1NA 1FPHH 1OWHA 4E7NA 1BTWA 1DWCH 4NWLA 5HM9A 2ODQA 3E1XB 3SV2H 5ESTE 3AK5A 3IG6B 3SORA 2HWLB 2WPIS 1G2LA 3RXAA 1A5GH 2FODA 1W8BH 2PWXA 1KSNA 3ODDA 4B2CA 4IC5A 3AASA 1YCPK 2BD5A 2LNCA 3RMNH 4Y8ZA 4TPYA 4IN2A 1ZMJA 4BTIB 5GPIB 2PGQB 4AOQA 3ATLA 3T26A 2TGTA 4UONA 2WINI 4CHAB 5CDFE 4IMZA 3SU1A 1BTYA 1UVSH 1AD8H 2A7JA 3SYJA 1P2NA 4P00A 1SGYE 2ZU4A 1GBBA 2LELA 1Q3XA 3OX7U 1LHDH 2KAIB 8GCHG 1T7CA 4AG2A 4I8KA 5AVDA 4I7YH 1B0EA 1BOQA 1GI4A 3RP2A 2JH5D 1ELCA 4MNVA 1T4VH 3DSPA 3KL6A 3LC5A 3RMLH 1JIMA 1S6FA 3T29A 3OAAD 1THSH 5EQSA 2R3UA 1HV7A 5FBEA 4YLQH 2D26C 4UFDH 5AF9H 5EJZA 3QK1A 1Q31A 1NFYA 1SGCA 2V35A 1S82A 4GHQA 2VGCC 1QB6A 1RTKA 4X6PA 3RXHA 2FS9A 2ZGHA 2B7DH 4B2BA 4FOUC 1H8ED 1GJ7B 3GDVA 2F9NA 5DPAA 5TCAA 2G4TA 3A8BA 1PYTC 4I8GA 1GDNA 2GZ9A 2ZFQH 2QF0A 1LO6A 3BEIB 1SGFG 4ZHMU 1GMHG 3BIUH 4TSFD 4Y11E 1AN1E 1OWKA 3PV4A 1HJ9A 3V13A 4ABIA 2XBVA 2FTLE 1T4UH 4WWYA 1TIOA 4JZ1A 4DY7B 1UVUH 1CA0B 3A7WA 3M37A 1QBVH 4ZMAH 5FAHA 4K8YA 1O2GH 4ISHH 5EXLA 1FY1A 1P11E 3SHCH 1K1OA 3LGIA 5EW2H 2BDAA 1O2HA 3LGWA 1IQEA 2Q1JA 3V3MA 1LPZB 1GBKA 3HATH 1ABJH 3TGJE 1AE5A 1SGIB 1OOKB 1ACBE 3FANA 2J34A 1OP0A 1TPPA 2Z3DA 2JJ1D 2QXGA 5C1XA 1H8DH 1SL3A 3MO3A 1E79D 1O32A 3FP8E 1AI8H 1MTNC 3P95A 1SLXB 3N7DA 2GCHF 1ORFA 2TGPZ 1W0ZU 1RXPA 1TBQH 1SOZA 1LHFH 3P6ZB 3QTOH 5F8XA 3RXOA 1QJ6B 5KEDA 3RM0H 1C2GA 1DANH 4ZH8A 1O3DA 4Y6DA 3ITIA 2RA0A 1O3MA 1VKYA 2BLQA 4Y71A 1DS2E 1Y3WA 1P02A 2BB4A 2GZ7A 4X0WU 1PPHE 3MNCA 3P92A 1QA0A 4KTCA 2AGEX 1MQ5A 1CHOG 1UK3A 1V2TT 1GBJA 3UNQA 4NIXA 1FMGA 1AU8A 1QTFA 3FFGA 1OP8A 4A92A 3UWIA 5F8TA 5EG4A 1DFPA 1TPAE 1TOMH 1AB9B 3QTVH 1O2YA 4XDEA 1DY8A 1ETSH 4F4OC 1ARCA 1NRPH 4X6NA 3SUDA 2C8WB 1RGQA 3D49H 2WV4A 2AH4X 1DSUA 2V6NA 2ZPQA 1XUHA 3RC5A 2ZKSA 1VGCB 1LQDB 3BG4B 3KF2A 1LHGH 2B5TB 1W3CA 1C2EA 2AEIH 1WDIA 4A6LA 5A8XA 2R9PA 3ZVBA 3SZNA 1J15A 3ATWA 4CR9A 2GV7A 3BTFE 1W13U 2HLDD 2V0BA 4YT7H 1UTKA 2V3OH 5B6LA 1DWBH 4GCHG 2ZGXH 4BANB 3GY7A 4TWYA 2FOMB 4F55A 3SZEA 1GCTC 1IQHA 4X2WA 1KXDA 5DJ7A 2YOLA 1O2TA 2GKVE 4MTBA 1FAXA 3S7KB 1PPCE 2OC7A 5E0JA 3STIA 5JBCS 2XBXA 1CSOE 3R3GB 2Z94A 1C5OH 3O8DA 1QQ4A 3F9FA 3RU4D 1BMAA 4B76A 1BJUA 5E0HA 1HYLA 1UHBB 5L2ZH 4Y0YE 1Z8IB 2VNTA 1L4DA 1YPHC 3LGTA 2CN0H 4K1TA 1UVTH 5ETXA 1CGHA 5FHTA 1FIZA 3VPKA 2IPQX 1O33A 2A4GA 2F9OA 4YOJA 2PHBA 3FOAA 3RUOA 1C5ZB 2BY7X 3BEUA 4ISOA 5T6FA 1FY3A 1GHXH 3KQCA 4GAWA 3RXTA 2H9TH 2BD7A 4UD9H 3UWJH 4SGAE 1NY22 4XD7D 2KM0A 1IQIA 4Z1MD 1C1UH 2QE7D 3OY5U 1GBLA 5FPTA 1A0HB 1EAUA 2Q6FA 4JCNA 1O2ZA 1TPOA 1IQLA 2ULLA 2VIWA 1TRYA 3AW0A 4RI0A 1F0TA 1SHYA 5IYTA 1NESE 3C1KA 4U2WA 1O2VA 5C94A 2C93B 1HAVA 3O8CA 3S69A 4K69A 2FOGA 1BBRK 2PSXA 3PMJA 4AC9A 2IJD1 1SFIA 1GHWH 2ZECA 3SU0A 3UNSA 5FPYA 3ZZDA 1TRMA 2FOBA 1O3NA 6GCHF 8LPRA 2ZDMA 1MKWH 1C5LH 1F92A 1T32A 1ESBA 5HYOA 1F5RA 2P95A 1J8AA 1Y59T 5HM2A 2OD3B 4FUBA 2XNDD 1QB1A 1O3LA 1S83A 1GBCA 3BTHE 1BMLA 5GWZA 4UEHH 4A7IB 3FAOA 1ELFA 3SNEA 2QXJA 1BTHH 4FUHA 2P3UB 4AFUA 6CHAB 4NIYA 1K9OE 1Y3VA 2C90B 2ZQ1A 5FCKA 1AUTC 2KZ4A 2SGDE 5E8EH 1GJ9B 3ZYDA 1O5FH 3URDA 2ZO3H 3OY6U 1GHBF 2J95A 3VXEH 3F9GA 3F9EA 1GJAB 1SR5C 3GCOA 4DVAU 4FUIA 1V2WT 2FESH 5FXLA 3UB0A 2QY0B 3TPIZ 1BUIA 5T6GA 1DLKB 2C8ZB 3A89A 1C5WB 1V2UT 3SV6A 1O36A 3F2GA 5GJ4B 2XRCA 1VJ9U 3KGPA 1O2JA 2Z9KA 2J98B 3CENA 1DOJA 2JIZD 1HAPH 1JWTA 1PQ8A 4ABHA 1K2I1 2ZU1A 1NRSH 2DE9A 3G01A 3B8JA 2O8LA 5E2PA 3MMGA 1HJAB 4BXWA 1EZQA 1MQ6A 1GBAA 1EP5A 1IHSH 4WXVA 2W7SA 2HNTC 2QC2A 1DUEA 5FBIA 3P8NA 1SQTA 3A86A 3SN8A 3RXUA 1FUJA 3ZZBA 2CJIA 3QN7A 2C4FH 2H5DA 4ABGA 4CRDA 3UUZA 2FM2A 1NO9H 4NZLA 1EPTC 5ESBA 2C3SA 5TCCA 3F1SB 1ETRH 4E7RG 1MD8A 2CF9H 4AZ2B 5C2ZA 2IOTA 2BVSH 2KAIA 1SQRA 2KCPA 3ZZ8A 2OXSA 1F0SA 1FZZA 1BB0B 1E1QD 2SNWA 2F43B 1NU7B 3TK5A 1MU6B 5DP7A 2GZ8A 4RN6A 1MTNB 2R2WU 2BLWA 1TGSZ 1O3EA 4NSVA 4DIIH 2HVYB 3MO9A 1PPBH 3LH1A 2L74A 1ELVA 3GS9A 2VU8E 3KNXA 1YPKH 3SW2B 3PV5A 3VB4A 2Z7FE 1O3JA 2AIPA 1P0SH 4FVBA 2BD3A 1FI8A 2WV9A 1N6YA 3SUFA 2XBWA 4NWKA 1KTTB 5C5NA 3NXPA 3TK9A 1C2KA 2ESTE 3GYLB 1V6DA 3BIVH 1B5GH 3FO8D 5GXPA 1C5MD 1WV7H 4HTCH 4CRFA 2Z3CA 2XXLA 2H5CA 2ZGCA 1BDAA 3VGCC 2QCYA 4M9FA 3A7XA 2BVXH 1THPB 2A7CA 4X8SH 4XBCA 5C1UA 4NG9H 1GCDA 4A1XA 2XCNA 3SO3A 5AFZH 4ZXYH 4FUDA 2RFKC 1DM4B 2VH6A 3BTGE 4FUGA 3RXDA 3SGQE 4X8UH 1ELTA 1SGRE 1DWEH 3F0PA 4YLUA 4KKDA 1HPGA 1Z1IA 2KR7A 3B23B 4B2AA 2PV9B 7GCHG 5DP6A 5J4QA 3OYPA 2O8WA 1H9LB 1ZYOA 1YCPM 4THNH 1P2QA 1ZMLA 3I29A 4Y0ZE 1SG8B 2BYAX 4D9RA 1C1TA 3QLPH 3SNAA 2XOKD 2UUFB 1O37A 4CRAA 5I25A 3U9AH 2OBOA 4NCYA 3RXSA 2BLOA 1UTPA 1OWEA 2HGTH 1KXEA 4X1QU 3VB5A 5EJ1A 1SOTA 1KXFA 1WQVH 1CE5A 3SV9A 2AIQA 2G8TA 1YC0A 4NA9H 4X1RU 1D3DB 3AW1A 1VCQA 5HXFA 2QA9E 2J94A 1KXBA 1M9UA 1UTNA 1MKXH 2ZWLH 3A83A 2WPLS 1MMJN 4U01A 2HPQH 2ZG0H 3BF6H 3DUXH 3NCLA 1VITH 4CR5A 2BX3A 3PMAB 1DLEA 1QY6A 2R3YA 3MHWU 1LKAA 1ZLRA 1ANBA 1QZ8A 3A7YA 3L3TA 2Q6GA 1GCTB 2OUAA 1NT1A 2PKSC 1EJNA 1DT2A 4R0IA 2NU4E 1ZTLA 4DCDA 1CO7E 2H1UA 2XC0A 4MDSA 1ZSLA 2WYGA 3S9CA 1W11U 5F6MA 4KGAA 1U6QA 5C67A 2PTNA 1ESAA 1ZOMA 1E35B 4XFQA 1YPLH 1IQMA 2JDID 4HFPB 2UUKB 3DSOA 1CU1A 4AYYB 1EASA 2KCYA 4U30A 1WTGH 5GCHF 2Z9LA 4FETA 3GCTG 1N8OC 1PQ7A 3GCTF 1AKSB 1C2HA 2PR3A 3SV8A 1W7GH 1JOUB 1TGCA 1NROH 3SGBE 1Y8TA 1YPEH 3U69H 2OC1A 1CVWH 1OPHB 2GGVB 4AG1A 1TLDA 4X1PU 2LP6A 1QRWA 5DP5A 1A0JA 1O39A 1AY6H 1E34B 2ZA5A 3P8OA 1CHGA 1ELGA 1O35A 1V2KT 2BDCA 4FUEA 3A82A 1G3BA 4XSKU 5DP3A 5JYIA 3UR6A 3VEQB 1LVYA 2R0LA 1LVMA 4O97A 1H9HE 4A1VA 1P3EA 1QB9A 1S81A 1Z8RA 1QQUA 2K8IA 4KELA 1AFQC 4I32A 1ZPBA 1GBMA 1ZTKA 4Y7AA 2THFB 1EUFA 2EI6A 4CRGA 1GL0E 2A2XH 5EPNA 1UHBA 3H7OA 2G51A 1ZHPA 6LPRA 3UR9A 2VIOA 1J9CH 2A7HA 1LHCH 4D9QA 2OBQA 4JYTA 1QBNA 1RD3B 2GVFA 1E37B 1V2RT 3GY3A 1C2MA 1A61H 5H4IB 4UFEH 4Z6AH 1TA6A 2ASUB 4RKOB 3F0OA 1ETTH 3P8FA 1TWXB 5C0TA 1Y3XA 2VIVA 1GBFA 1GBEA 3BN9A 2FI5E 2ZPSA 1PJPA 1KXAA 5JB8S 6CHAC 4WY3A 1A46H 1ZMNA 2ZHWH 5DO4H 1AO5A 1L0ZA 2ZPRA 1SGQE 2VIPA 3EQ0H 2Y81A 5JDUB 1SFQB 4CRCA 3MU4A 3L6PA 3VXFH 1PQ5A 3QZRA 5JBTA 1UW7A 1KMHB 1SB1H 1BQYA 1OWDA 4MPWA 2JH0D 2VH0A 5JBAS 1BRUP 2A4OA 1FLEE 1F5KU 2Y7ZA 2EY4C 3KIDU 3ZZ6A 2RA3A 1CT2E 5AFYH 1H4WA 1UCYE 3TK6A 2J9NA 4DURA 3TH2H 1EPTB 3M7UA 1B0FA 1F0RA 2G5VA 3SU4A 4AYVB 4ZKRU 1UK2A 1Q2WA 2ZP0H 1O3IA 3ATIA 3Q3XA 4B71A 3Q77A 2W5EA 3PLKA 1HJAC 3FKSD 1BTXA 1TBZH 2RCEA 2FX4A 2VWMA 4NIWA 2FX6A 1RJXB 3H09A 4WJG2 1GMCF 5ABWA 2J38A 4F49A 4ESTE 2A1DB 4BNRA 1HRTH 2A5AA 3UIRA 1Z8GA 1OX1A 4HI3A 1MBMA 1P04A 1O3PB 4D76A 1D6RA 3D62A 3KQ5A 4ZHLU 1HAZB 2IPHA 1PFXC 2R2MB 1LTOA 3NK8A 2FI3E 1MD7A 1HBTH 2ANMH 2ZDKA 5HKKD 1HAGE 2GT7A 2J98A 4U32A 3RM2H 5F53A 3ZVAA 3RMOH 4D7FA 3BTEE 2HNTF 1HAOH 1O30A 1K21H 5C20A 5C17A 3ODFA 2JH6D 1S84A 5A0AE 1GI7B 2ZC9H 1GI0A 2OQ5A 1TABE 3ZVCA 2GCHG 2G5NA 4ZROA 3VGCB 4AFQA 7ESTE 4JYVH 1N6XA 3RXJA 1FX0B 1AMHA 2J4IA 2C8YB 2PUQH 2VWNA 3WY8A 2VBCA 2A32A 4TYDA 1A3BH 3Q76A 2FTMA 2ZZUH 1PPGE 2V3MA 3M5NA 1TE0A 1QL7A 1O2UA 1HXFH 2OTVA 1V2ST 2AGGX 4YOGA 3H5CB 1S0QA 3TIUA 3SUEA 1F7ZA 1HDTH 4WMDA 4BAKB 1EAWA 1P2OA 1GBIA 1MTWA 2R0KA 4IS5A 1CA8B 3M61U 1GJ8B 5T1VA 1BT7A 1ZRBA 4DW2U 5C3NA 2Q6DA 3NZIA 2HVXA 1NFUA 1HXEH 2G81E 3E3TA 1P9UA 1IQJA 2QF4A 2UWOA 3SUGA 1C2DA 4YESB 2XNIA 1K1PA 2QGRA 2AMQA 1NFWA 1G9IE 1GHZA 1YLNA 4I33A 1O2RA 1MKWK 4K60A 2GD4B 1E1RD 3GISB 4ZUHA 4CREA 3CP7A 3ZZ9A 2BDBA 1JMOH 1P10A 1DE7H 3N7EA 1C5SA 3KN2A 2BQWB 2WSSD 2BY5X 1FONA 1XXDA 3PWBA 1RTFB 4BAHB 2OC0A 1HIAB 2PKSB 2WPKS 3EYDA 3TH3H 1RTLA 3BSQA 2SGEE 1TYNA 2QF3A 2VVCA 1BITA 2ZCLP 2AERH 1AWHB 1AUJA 4YOIA 5FCRA 2PLXA 4OGYA 1C5YB 5DP9A 1EOLA 1V2NT 5GNDA 3WWFA 1MCTA 3M5LA 2VIDA 2ODYB 2UUJB 2QF5A 2GV6A 4WMEA 3IITA 1N8OB 1TALA 1Z6JH 4ACBA 3DFLA 5CHAC 3SGAE 1GMDF 1Z6EA 1V2PT 3Q00A 1HAYB 3UPEA 2FOCA 1N1LA 1C1MA 1EB1H 1IQFA 1GG6B 1GL1A 3M5MA 1INCA 1SC8U 4I86A 1G3EA 3PMBB 9ESTA 3WWBA 4B75A 3MQKC 2KCAA 2ZHEH 3SU3A 2EI7A 2STAE 3I78A 3MNSA 5HMAA 1QBOA 1BTUA 1KDQB 1FIWA 2ZFPH 1GDQA 3RLYH 5AHGH 1VZQH 2KX4A 1UCYH 2G52A 3KQEA 3PTBA 3SU6A 1J17T 3K6ZA 4FUJA 1V2OT 1KLJH 1KLIH 1HAIH 2P3FH 4ZAEA 2W26A 4AFSA 2SFAA 2AFQB 1W10U 1MTVA 4O9VA 1LCYA 1O5CB 2AGIX 1AFQB 2FYRA 3W94A 1C4U2 2ILNA 4WH6A 4GSOA 4K5ZA 3ZZ7A 3FP6E 3PROA 1A7SA 4GLYA 1MAYA 1NPMA 3MU8A 2AS9A 3T5FH 1EZSC 4D8NA 2J2UA 1MZAA 1P2IA 8ESTE 1F0UA 4OS2A 1ANDA 4ZKNU 1NRQH 2RDLA 3A80A 5IDKA 1C5TA 3GY5A 1AKSA 6GCHG 1C5PA 2BMGB 2WUBA 4XBDA 1YF4A 2QIQA 3TJOA 2P3TB 2OP9A 2Y6TA 1BRCE 2ZGJA 4NZQA 4RKJB 1AVXA 1T8NA 2ZHFH 5A09A 4I8JA 3MYWA 1EOJA 2BLVA 3FN8A 1O5GH 1BZXE 2QXIA 2J97A 3S0NA 2FWWA 3GCHC 2FLRH 1QHRB 3UOPA 1ANEA 1Y5UT 1GHBG 1TAWA 1TNGA 1YKTA 2JETC 1GGDB 2W3IA 1O5DH 4WXIA 2KFWA 4H6TA 4A5TS 4X2XA 4CH2B 3GYMA 1UVOA 3PLPA 2HOBA 1QIXB 1VCWA 2HLCA 4DJZB 4DIHH 2W6JD 3MWIU 1TOCB 1JXPA 2BOKA 1TMUH 1ID5H 4AGJA 3MNXA 2FMJA 3RXPA 2B9LA 3PLBA 2M5TA 1KTSB 4LK4A 1O2KA 3TITA 2F9VA 4IMQA 1IOEA 1G30B 2XW9A 3CS7A 3D23A 3W1EA 1SPJA 2FIRH 1EFRD 4B1TA 1SMFE 5JBBS 1FAKH 4IC6A 1L1NA 2FI4E 4JZEH 2G4UA 4JZIA 4I8LA 1QNJA 3JZ2B 3KYGA 2GDEH 1FPCH 1ZSJA 4CRBA 2PTCE 1SLWB 4MNWA 1C1WH 1S85A 4R8TB 3OFND 3H7TA 1ELAA 1TNLA 1L1GA 1C5XB 4SGBE 1MKXK 1T31A 3BEFB 5L30H 2ALPA 3LJOA 5EOKA 3K2UA 1CBWB 2XBYA 2CHAC 4TWWA 4ZHAA 4DG4A 2Z6BD 1HFDA 2AHME 2TGDA 1XMNB 4B6EA 1PPZA 4CBNA 2ZHDA 4MPUA 4B73A 3TGIE 2BOHB 1SVPA 3V12A 1GHAG 1FNIA 2ALVA 2FS8A 5LPRA 1GHAF 2XTTB 1SGFA 5BPEA 3DFJA 5BRRE 3PRBA 2DE8A 1OYQA 1LPKB 1FN6A 2EQNA 4MVNA 5TJXA 1K1MA 1O3CA 3K9XB 1EPTA 4BAMB 5DGJA 1GJ5H 5G4BA 3ATMA 3SQHE 1QL8A 4XRNA 1E0FD 3UREA 2QYIA 1WU1A 2EI8A 2BXUH 4RT1A 2ZIQH 3S7HB 3GY4A 2D1JA 4X2VA 1BA8B 1DSTA 1AVGH 2A5KA 3SJOA 2I6SA 2TIOA 3C27B 3UFAA 1KLTA 4WH8A 1W14U 2EEKA 1NBME 2J92A 3BTTE 1EKBB 1WAYB 1O2XA 1BHXB 1WSSH 5CHBA 5T3HA 1FJSA 1OP2A 2CMYA 5C0UA 1AWFH 1TRNA 1VR1H 3LT3A 3OE7D 1BJVA 3N7OA 3DD2H 1TGNA 1LQEA 4JMYA 5A8ZA 1ZSKA 1DX5M 3U1IB 1O0DH 3E0NB 3PRDA 4P02A 1VJAU 1C1OA 2BVRH 1OSSA 2W7UA 2BD8A 1L1JA 1C2IA 2W6ID 1YM0A 2YNAA 3A8DA 3GDUA 3OEHD 3TU7H 3UAIC 3RDZA 1G3DA 1GBHA 1NZQH 2ZDVH 3F2HA 5PTPA 4LXBH 1E36B 1HAHH 2RDEA 2FZZA 1VITF 1GBTA 2FOFA 2F9BH 4LZ1H 1O3KA 3E8LA 1LHEH 3EE7A 3M3VA 5HGGA 1O2MA 1O2LA 1ZHRA 1SSXA 1K0HA 1ABIH 4BOHA 4ZKOU 2QN5T 2YMSD 5L2YH 2FO9A 1K1LA 2A45B 1NS3A 3RXGA 2XYAA 3MOCA 1O34A 1EXFA 1DWDH 3ZZ4A 1D3PB 3AAVA 1FY4A 3ZVFA 3S9AA 1E38B 4O3UA 3A7ZA 1EAIA 2O8TA 2G55A 1SGPE 5CHAB 2VINA 1UTQA 2FP7B 2BDGA 3LIWA 2PP6A 2NU1E 3U98H 5HIZA 2Z9GA 3U8RH 4ABBA 3LPRA 4I8HA 1P01A 3NRLA 3RC4A 5C1YA 5DN6D 5EODA 5GIBA 5GCHG 2OINA 2Y5HA 1H9IE 4ABFA 3A84A 9LPRA 2SGPE 2QAAA 1FXYA 2C8XB 1GI6A 3BG8A 3LJJA 3PTNA 3SU5A 1ZHMA 4DT4A 1SKYE 4INKA 1GG6C 1XUIA 4UFGH 1MABB 1YP9A 1K28D 3PM3A 3DT0H 2ANYA 2SGQE 2PFEA 1MBQA 1Y3YA 2SNVA 3LDXH 1S6LA 5GDSH 3U1JB 3LGVA 1HIAA 1H8IH 2OK5A 3T25A 3RXIA 1IQNA 4DGJA 4GPGA 3GY6A 5EGMA 2QV1A 1RFNA 3E6PH 4INHA 1PPFE 5EIYA 1KYNA 1YPGH 2BM2A 1NTPA 3GDSA 3FZZA 1KIGH 3AVZA 1AIXH 4K1EA 4JYUH 2RG3A 2WPHS 1PYTD 1GHYH 4ASUD 1TNHA 4OS5A 2A31A 1MU8B 1ARBA 3PWCA 4Q2KA 2NU3E 2ZCKP 2FYQA 1TBRH 1WTHD 5E0GA 3O8RA 1SLUB 3RXCA 1D3QB 1QURH 2UWLA 2WV5A 3FZDA 4Q7XA 1O3GA 3HK6B 1KXCA 2ZTZA 2PSYA 1GWAA 3D65E 2AYWA 3DHKH 2WUCA 3SI3H 2BQ7B 1UTJA 3RC6A 3RXBA 4KTSA 1O3HA 6ESTA 1CT4E 1KDQA 3LGUA 3L33A 4TY7A 1YY3A 4O3TA 1T8MA 1GJDB 1ELEE 3NPSA 3MU1A 3GCHB 1GJ4H 4K2YA 2ZHQH 4FU9A 4VGCC 1A0LA 1SQAA 4NSYA 2FPZA 2JETB 4ISIH 2GCTC 4J1YA 5A0BA 2OCVB 4HZHA 3ELAH 1GPZA 2YMSC 3OTJE 1C1SA 1BMMH 2WPDD 3VB3A 1C1PA 4OS7A 3ZV8A 1GJ6A 1DVAH 1DUAA 1TFXA 1TGTA 4NGAH 4OM9A 2F9PA 2VWLA 1TB6H 2ZTYA 3T62A 5EXNA 3T27A 1ELBA 1BIOA 4PROA 1TQ7B 2ZQ2A 1GGDC 1K22H 3DCLA 2FDAA 1FV9A 1VCPA 2ZEBA 1BRAA 3RXLA 1C2JA 2P16A 7KMEH 1EAXA 4MPVA 1SGDE 1MTSA 1UMAH 3HGPA 2VVUA 4H42U 1D3TB 5EPYA 1O38A 1P06A 2FLBH 2O8UA 3MU5A 3O8BA 1GVLA 1HUTH 1S0RA 8GCHF 3SV7A 5EW1H 2J5UA 1YLCA 1K1JA 1TNIA 1Y5AT 3CNRA 3GCNA 3UOUA 4X1SU 1C9TA 5A0CA 4Q7ZA 2CHAB 3SNDA 2PKAB 3RU4T 1UTMA 2EC9H 1TX7A 1GMCG 2K1QA 4IGDA 4INLA 2IN2A 2F3CE 3MH4A 3PYHA 1LDTT 3SOSA 3MNBA 3BTME 3UNRA 1C5UA 4JK5A 1K1IA 1RS0A 1ZGIA 1MTUA 2ANWA 1ZRKA 4AX9H 1CBWC 4BXSA 3UTUH 3F68H 4AB8A 4DOQA 3PMHB 1O2OA 3QGJA 2NU0E 1YPMH 3ZVGA 1GMHF 3ATKA 3W95A 1W12U 2Y5FA 1Z71A 4YT6H 5EQRA 2XWAA 1C2LA 5EXMA 4Q7YA 2O8MA 4OS6A 4FUFA 3M7QA 1C1NA 5F8ZA 3I77A 4ZCNA 1HAXB 5FPSA 4DT7B 2UWPA 1EZXC 1PPEE 2PUXB 1G3CA 1BCUH 2BDIA 1BMFD 1TNJA 1XVOA 4GVUA 4A1TA 1FN8A 4JZFH 1MAXA 1EJAA 2ZU3A 4NA8A 3TH4H 1GJBB 1MUEB 1C4V2 1RRKA 1UCYK 2BD4A 2SGFE 2UUYA 5DK1A 4WF8A 3BTQE 1TA2A 3SJIA 3PO1C 1JBUH 4CBOA 4RT0A 3SI4H 1YCPH 1WXRA 2ZF0H 2H2ZA 3KEEA 1GJCB 1NBMD 1V2LT 3JZ1B 1P03A 3A7VA 1OXGA 3LGYA 5T6DA 1IQGA 1AFEH 1SGNE 4ABAA 2FXRA 1H8HD 1LVBA 1OKXA 4FUCA 3K6YA 5JB9S 4ACAA 3HKJB 1W7XH 4Y79A 4AFZA 1HJ8A 1JRTA 2LPRA 3RXMA 1S5SA 2CXVA 1NFXA 3FP7E 4LOYH 4X6OA 3EA7A 2Y80A 1QL9A 1NC6A 3OSYA 4YZUA 3RXFA 2F91A 3MH6A 3UQOA 1P2JA 1C1QA 3P17H 1XUFA 5FL7D 4MG3A 2FOHA 3MH5A 1CHOF 4NIVA 4MNXA 5B6OA 3F3BA 2A4QA 2DUCA 3TGKE 2PW8H 1BMNH 4HG6A 3ESTA 4JK6A 2GMTC 1QFKH 5DKMA 5FX6A 1UK4A 5CE1A 2BZ6H 1GI8B 1DXWA 2AMPA 4MLFB 1O2PA 1P05A 1HGTH 2YNBA 1TQ0B 2WHXA 1DITH 3EGKH 3HPTB 2D2DA 2H9HA 2P8OB 4FU8A 4GUXA
chains in the Genus database with same CATH topology
1LPGB 5EQQA 2TBSA 1G37A 3RXKA 3HKIB 2Y5GA 3SJ8A 3E0PB 3M7TA 4ABJA 2FOEA 1EATA 3QUMP 5DG6A 4BAQB 1GMDG 2OC8A 2XC5A 1WQSA 1A4WH 3CS0A 4Y8YA 2GX4A 1ZTJA 3MTYA 4TY6A 3KQDA 5A8YA 2CGAA 2BD2A 2VWOA 4AORA 1RIWC 1C1RA 1BBRE 2IJOB 1BTPA 1XUJA 4GCHF 2XC4A 2SGAA 3P70B 5E2OA 2ZFSA 3VB7A 1G32B 2P59A 1ZPZA 2WPJS 3UQVA 4Z0KA 3ZVDA 2TGAA 3SJ9A 3NKKA 1O3OA 3A8AA 2BY9X 3Q3KA 4J2YB 3GY2A 1XM1A 2FOAA 1UJ1A 1F5LA 3GY8A 5LPEA 1X7AC 3BV9B 2P93A 4OS1A 1H1BA 1YYY1 2BD9A 2GTBA 2P94A 1IHTH 5A2MH 3EAJA 3RXVA 2ZDLA 3RMMH 3M35A 4NFEA 4X8TH 4UE7H 4HGCA 4X8VH 4AB9A 1O31A 3BTKE 3MFJA 3KQBA 2A2QH 2BY8X 4ZXXH 3RXEA 3ZVEA 3U8OH 5SGAE 1OWIA 3SJKA 5C5OA 3EA9A 3EDXB 4YM9A 3HGNA 1AVWA 1A1RA 1GI5A 1TONA 4YO9A 4K3JA 1A3EH 4VGCB 1O5AB 3IWMA 1C1VH 1AE8H 1P8VC 2GCTB 1FY8E 2ZTXA 3ZZCA 5LPFA 1AQ7A 2HPPH 5EU8A 5JPMH 1C4Y2 3MO6A 8KME2 1G2MA 1UTLM 1XVMA 4ISLA 2BY6X 3A88A 2ZDAH 1BTZA 4XE4A 1PQAA 1WYKA 1O2IA 4BAOB 3LONA 1HCGA 1T8OA 3SNBA 2Z9IA 1LVOA 4ABEA 1XKBC 2XWBI 1Y3UA 2Z3EA 1QRXA 1UVPA 3E91A 4NA7A 1W2KH 1LMWB 4MQAA 3LC3A 1L2EA 1QR3E 1O2QA 1HNEE 3RLWH 1J14A 2V3HH 1D4PB 4X1NU 4YTAA 2CF8H 2GDDA 3A81A 2VIQA 3NWUA 4B74A 1TGBA 2I6QA 3GOVB 3QWCH 2HRVA 7LPRA 1XKAC 3BTDE 3M36A 2GP9B 3HK3B 4CHAC 4I31A 2BHGA 1GVKB 1HLTH 1SGTA 2B8OH 3QGNB 1ZZZA 4LZ4B 2NU2E 4OS4A 1NM6A 1YPJH 3EE0B 1ZR0A 2QXHA 3Q3YA 4XOJA 3VB6A 2VGCB 1BRBE 1DY9A 1CGIE 3STJA 1A2CH 2WPMS 1GI9B 3RXRA 3VFEA 1C5VA 1HB0B 2F9UA 1SQOA 1C2FA 2G00A 3SBKA 1TX8A 1GHVH 2VJ1A 1O2WA 3V0XA 1TMTH 1XUKA 3DA9B 2ZDNA 2BTCE 2VB0A 1C5NH 1NRRH 1EP6A 1ESTA 1YBWA 2ZFFH 1SLVB 1GVZA 1A5IA 3V7TA 3LH3A 1LKBA 4WMFA 3MH7A 1OYTH 4QT8C 3QDZB 4FXGH 1QCPA 1UO6A 4ASHA 2Y7XA 3A8CA 1P2MA 5J4SA 1P09A 4E05H 3QX5H 3R0FA 4D7GA 1JIRA 5LH8A 3T28A 1OS8A 2ODPA 1P3CA 1MZDA 1G36A 1AZZA 1CA0C 1F2SE 1SGEE 3M3TA 1ANCA 2D8WA 4Y76A 3PO1B 4TPIZ 1BBRH 1AGJA 2PKAA 3ZYEA 1O3AA 3PB1E 2ZU5A 1C5QA 3KHVA 3F9HA 1GI1A 1V2JT 1SBWA 1YPHE 2EA3A 4XBBA 4X2YA 1EJMA 4FVDA 1GI2A 5L6NH 1P2KA 1P12E 5K7RA 1IAUA 3E90B 3TJVA 4BTUB 1YGCH 4BTTB 4UDWH 1QJ7B 1Z8JB 1V2VT 3LKWA 3TJUA 1WBGB 5FX5A 3TNSA 3SQEE 1GI3A 3A87A 3ENSB 4ISNA 1O2NA 2STBE 3F6UH 3P8GA 4MNYA 5CMXH 1SHHB 4OGXA 1B7XB 1XXFA 3SNCA 3ZZAA 2ZFTA 4K1SA 3TJNA 2W3KA 3BTWE 4CH8B 1XUGA 4K8BA 2BZAA 1MCVA 4AN7A 1V2QT 1S6HA 5F03A 2BX4A 1DICA 1P57B 1TNKA 1WOFA 2B0FA 2JKHA 3K65B 4Y8XA 1VITG 4RSPA 1J16A 2GMTB 2BDHA 1O5EH 1TMBH 7GCHF 3T2NA 1T8LA 3LOXA 5I46H 5DP4A 1ZPCA 4KTUA 3ZZ3A 2FEQH 4O03A 1EX3A 1TX6A 3SHAH 5LGOA 1WUNH 4X6MA 1D6WA 1BHXF 3QZQA 1ZJDA 2ZU2A 2H6MA 4IN1A 1AB9C 1SI5H 4GHTA 3NUMA 3SU2A 1P9SA 5DP8A 1FDPA 1QA7A 2Z9JA 1GBDA 4ABDA 3LU9B 2H9EH 1A5HA 2BXTH 1FQ3A 1EQ9A 1V2MT 3B9FH 1OWJA 1JRSA 2A5IA 2ZCHP 2P8OC 3URCA 1VGCC 2OQUA 3FVFB 2GT8A 4UFFH 3BG4C 1RIWB 4WVPE 1DXPA 1CT0E 3KCGH 3E16B 2ANKH 4H4FA 4M7GA 3M5OA 3AAUA 3RXQA 3OU0A 4JZDH 1DPOA 1V3XA 1Y5BT 1THRH 4E06H 1XX9A 1C5RA 4FU7A 3TNTA 1EZUC 1GDUA 1O2SA 1IQKA 1ZJKA 1TPSA 1NN6A 2O9QA 2AMDA 2WYJA 1O5BB 3RU4E 1ELDE 1NU9A 4ZKSU 1HAVB 3S9BA 3MI4A 4KP0A 1ZGVA 1YLDA 2HNTE 1W0YH 4IBLH 1CGJE 1O3FA 3TLOA 2OLGA 3EA8A 2VVVA 4H6SB 1FY5A 2A4RA 4AGKA 2ZGBH 3TVJB 2ZNKH 1Z7KA 4NFFA 1CQQA 1L4ZA 1C9PA 2XCFA 2TRMA 4MPXA 3ZZ5A 1NRNH 3GICB 2F83A 1QGFA 1WCZA 1D9IA 2Y82A 3ZV9A 1O3BA 2BQ6B 2HALA 3UY9A 1QJ1B 1KY9A 2PGBB 3U8TH 3A85A 4Y10E 1UTOA 2A0QB 3QO6A 1EB2A 1DDJA 2CV3A 1AHTH 4Y7BA 2BDYA 4IW4E 2NWNA 3M3SA 2TPIZ 3A7TA 2ZI2H 1QRZA 5K0HA 1Z1JA 1AZ8A 2ZFRH 3MU0A 1MH0A 4Q80A 1K1NA 1FPHH 1OWHA 4E7NA 1BTWA 1DWCH 4NWLA 5HM9A 2ODQA 3E1XB 3SV2H 5ESTE 3IG6B 3SORA 2HWLB 2WPIS 1G2LA 3RXAA 1A5GH 2FODA 1W8BH 2PWXA 1KSNA 3ODDA 4B2CA 4IC5A 3AASA 1YCPK 2BD5A 2LNCA 3RMNH 4Y8ZA 4TPYA 4IN2A 1ZMJA 4BTIB 5GPIB 2PGQB 4AOQA 3ATLA 3T26A 2TGTA 4UONA 2WINI 4CHAB 4IMZA 3SU1A 1BTYA 1UVSH 1AD8H 2A7JA 1P2NA 1SGYE 2ZU4A 1GBBA 1Q3XA 3OX7U 1LHDH 2KAIB 8GCHG 1T7CA 4AG2A 4I8KA 5AVDA 4I7YH 1B0EA 1BOQA 1GI4A 3RP2A 2JH5D 1ELCA 4MNVA 1T4VH 3KL6A 3LC5A 3RMLH 1JIMA 1S6FA 3T29A 1THSH 5EQSA 2R3UA 1HV7A 5FBEA 4YLQH 2D26C 4UFDH 5AF9H 3QK1A 1Q31A 1NFYA 1SGCA 2V35A 1S82A 4GHQA 2VGCC 1QB6A 1RTKA 4X6PA 3RXHA 2FS9A 2ZGHA 2B7DH 4B2BA 1GJ7B 3GDVA 2F9NA 5DPAA 5TCAA 2G4TA 3A8BA 1PYTC 4I8GA 1GDNA 2GZ9A 2ZFQH 2QF0A 1LO6A 3BEIB 1SGFG 4ZHMU 1GMHG 3BIUH 4Y11E 1AN1E 1OWKA 3PV4A 1HJ9A 3V13A 4ABIA 2XBVA 2FTLE 1T4UH 4WWYA 1TIOA 4JZ1A 4DY7B 1UVUH 1CA0B 3A7WA 3M37A 1QBVH 4ZMAH 5FAHA 4K8YA 1O2GH 4ISHH 5EXLA 1FY1A 1P11E 3SHCH 1K1OA 3LGIA 5EW2H 2BDAA 1O2HA 3LGWA 1IQEA 2Q1JA 3V3MA 1LPZB 1GBKA 3HATH 1ABJH 3TGJE 1AE5A 1SGIB 1OOKB 1ACBE 3FANA 2J34A 1OP0A 1TPPA 2Z3DA 2QXGA 5C1XA 1H8DH 1SL3A 3MO3A 3FP8E 1O32A 1AI8H 1MTNC 3P95A 1SLXB 2GCHF 1ORFA 2TGPZ 1W0ZU 1RXPA 1TBQH 1SOZA 1LHFH 3P6ZB 3QTOH 5F8XA 3RXOA 1QJ6B 3RM0H 1C2GA 1DANH 4ZH8A 1O3DA 4Y6DA 3ITIA 2RA0A 1O3MA 2BLQA 4Y71A 1DS2E 1Y3WA 1P02A 2BB4A 2GZ7A 4X0WU 1PPHE 3MNCA 3P92A 1QA0A 4KTCA 2AGEX 1MQ5A 1CHOG 1UK3A 1V2TT 1GBJA 3UNQA 4NIXA 1FMGA 1AU8A 1QTFA 3FFGA 1OP8A 4A92A 3UWIA 5F8TA 5EG4A 1DFPA 1TPAE 1TOMH 1AB9B 3QTVH 1O2YA 4XDEA 1DY8A 1ETSH 4F4OC 1ARCA 1NRPH 4X6NA 3SUDA 2C8WB 1RGQA 3D49H 2WV4A 2AH4X 1DSUA 2V6NA 2ZPQA 1XUHA 3RC5A 2ZKSA 1VGCB 1LQDB 3BG4B 3KF2A 1LHGH 2B5TB 1W3CA 1C2EA 2AEIH 4A6LA 5A8XA 2R9PA 3ZVBA 3SZNA 1J15A 3ATWA 4CR9A 2GV7A 3BTFE 1W13U 2V0BA 4YT7H 1UTKA 2V3OH 1DWBH 4GCHG 2ZGXH 4BANB 3GY7A 4TWYA 2FOMB 1GCTC 1IQHA 4X2WA 1KXDA 5DJ7A 2YOLA 1O2TA 2GKVE 4MTBA 1FAXA 3S7KB 1PPCE 2OC7A 5E0JA 3STIA 5JBCS 2XBXA 1CSOE 3R3GB 2Z94A 1C5OH 3O8DA 1QQ4A 3F9FA 3RU4D 1BMAA 4B76A 1BJUA 5E0HA 1HYLA 1UHBB 5L2ZH 4Y0YE 1Z8IB 2VNTA 1L4DA 1YPHC 3LGTA 2CN0H 4K1TA 1UVTH 5ETXA 1CGHA 5FHTA 1FIZA 3VPKA 1O33A 2A4GA 2F9OA 4YOJA 2PHBA 3RUOA 1C5ZB 2BY7X 3BEUA 4ISOA 5T6FA 1FY3A 1GHXH 3KQCA 4GAWA 3RXTA 2H9TH 2BD7A 4UD9H 3UWJH 4SGAE 1NY22 1IQIA 1C1UH 3OY5U 1GBLA 5FPTA 1A0HB 1EAUA 2Q6FA 4JCNA 1O2ZA 1TPOA 1IQLA 2ULLA 2VIWA 1TRYA 3AW0A 5IYTA 1F0TA 1SHYA 1NESE 3C1KA 4U2WA 1O2VA 2C93B 1HAVA 3O8CA 3S69A 4K69A 2FOGA 1BBRK 2PSXA 3PMJA 1SFIA 1GHWH 2ZECA 3SU0A 3UNSA 5FPYA 3ZZDA 1TRMA 2FOBA 1O3NA 6GCHF 8LPRA 2ZDMA 1MKWH 1C5LH 1F92A 1T32A 1ESBA 5HYOA 1F5RA 2P95A 1J8AA 1Y59T 5HM2A 2OD3B 4FUBA 1QB1A 1O3LA 1S83A 1GBCA 3BTHE 1BMLA 5GWZA 4UEHH 4A7IB 3FAOA 1ELFA 3SNEA 2QXJA 1BTHH 4FUHA 2P3UB 4AFUA 6CHAB 4NIYA 1K9OE 1Y3VA 2C90B 2ZQ1A 5FCKA 1AUTC 2SGDE 5E8EH 1GJ9B 3ZYDA 1O5FH 3URDA 2ZO3H 3OY6U 1GHBF 2J95A 3VXEH 3F9GA 3F9EA 1GJAB 1SR5C 3GCOA 4DVAU 4FUIA 1V2WT 2FESH 5FXLA 2QY0B 3TPIZ 1BUIA 5T6GA 1DLKB 2C8ZB 3A89A 1C5WB 1V2UT 3SV6A 1O36A 5GJ4B 2XRCA 1VJ9U 3KGPA 1O2JA 2Z9KA 3CENA 1DOJA 1HAPH 1JWTA 1PQ8A 4ABHA 1K2I1 2ZU1A 1NRSH 2DE9A 3G01A 3B8JA 2O8LA 5E2PA 3MMGA 1HJAB 4BXWA 1EZQA 1MQ6A 1GBAA 1EP5A 1IHSH 4WXVA 2W7SA 2HNTC 2QC2A 1DUEA 5FBIA 3P8NA 1SQTA 3A86A 3SN8A 3RXUA 1FUJA 3ZZBA 2CJIA 3QN7A 2C4FH 2H5DA 4ABGA 4CRDA 3UUZA 2FM2A 1NO9H 4NZLA 1EPTC 5ESBA 2C3SA 5TCCA 3F1SB 1ETRH 4E7RG 1MD8A 2CF9H 4AZ2B 5C2ZA 2IOTA 2BVSH 2KAIA 3ZZ8A 2OXSA 1F0SA 1FZZA 1BB0B 2SNWA 1NU7B 3TK5A 1MU6B 5DP7A 2GZ8A 4RN6A 1MTNB 2R2WU 2BLWA 1TGSZ 1O3EA 4NSVA 4DIIH 3MO9A 1PPBH 3LH1A 1ELVA 2VU8E 3KNXA 1YPKH 3SW2B 3VB4A 2Z7FE 1O3JA 2AIPA 1P0SH 4FVBA 2BD3A 1FI8A 3SUFA 1N6YA 2XBWA 4NWKA 1KTTB 5C5NA 3NXPA 3TK9A 1C2KA 2ESTE 3GYLB 1V6DA 3BIVH 1B5GH 5GXPA 1C5MD 1WV7H 4HTCH 4CRFA 2Z3CA 2XXLA 2H5CA 2ZGCA 1BDAA 3VGCC 2QCYA 5C1UA 3A7XA 2BVXH 1THPB 2A7CA 4X8SH 4XBCA 4NG9H 1GCDA 4A1XA 2XCNA 3SO3A 5AFZH 4ZXYH 4FUDA 1DM4B 2VH6A 3BTGE 4FUGA 3RXDA 3SGQE 4X8UH 1ELTA 1SGRE 1DWEH 4YLUA 4KKDA 1HPGA 1Z1IA 3B23B 4B2AA 2PV9B 7GCHG 5DP6A 5J4QA 3OYPA 2O8WA 1H9LB 1ZYOA 1YCPM 4THNH 1P2QA 1ZMLA 3I29A 4Y0ZE 1SG8B 2BYAX 4D9RA 1C1TA 3QLPH 3SNAA 2UUFB 1O37A 4CRAA 5I25A 3U9AH 2OBOA 4NCYA 3RXSA 2BLOA 1UTPA 1OWEA 2HGTH 1KXEA 4X1QU 3VB5A 1SOTA 1KXFA 1WQVH 1CE5A 3SV9A 2AIQA 2G8TA 1YC0A 4NA9H 4X1RU 1D3DB 3AW1A 1VCQA 5HXFA 2QA9E 2J94A 1KXBA 1M9UA 1UTNA 1MKXH 2ZWLH 3A83A 2WPLS 1MMJN 4U01A 2HPQH 2ZG0H 3BF6H 3DUXH 3NCLA 1VITH 4CR5A 2BX3A 3PMAB 1DLEA 1QY6A 2R3YA 3MHWU 1LKAA 1ZLRA