1J16A

Benzamidine in complex with rat trypsin mutant x99/175/190rt
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRETYNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASSSFIITDNMVCVGFLEGGKDACQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-induced Structural Plasticity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Trypsin II, anionic
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j16A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j16A02
1BMNH 1WBGB 4CBOA 4VGCC 4ZKNU 1K28D 2LNCA 2QCYA 3LU9B 1C2MA 1AUTC 2R3UA 2A4RA 4E7RG 1HDTH 4X0WU 2AERH 1Z8JB 1EUFA 1CT2E 2FOCA 3QUMP 1V2OT 1UHBA 4ABBA 2OQUA 2BHGA 1GHZA 5EODA 1K1OA 4Q2KA 1O3NA 3MU4A 1G30B 1PQ8A 1NC6A 5E0GA 4ZMAH 1AI8H 1GHVH 3ATWA 3E16B 2XC5A 4OS7A 3W95A 5I25A 4BXSA 1Y5AT 3F9FA 1L4ZA 3KN2A 4MNYA 1CO7E 3TGKE 1QTFA 3DUXH 3V0XA 1GPZA 1P2OA 3GY3A 2FWWA 1ZSLA 1CHGA 1JIRA 2ZTYA 1NPMA 1GI3A 2FYQA 2GV7A 1S83A 1C1RA 3VB6A 1O3DA 1LVOA 1HAOH 3ZZ6A 4JZ1A 5C1UA 4OS5A 3LKWA 3S9CA 3S7HB 1ELCA 1IQMA 2FDAA 1OXGA 1DSUA 4DW2U 2GT8A 3RLYH 4B73A 4MQAA 5DP5A 2AEIH 2NWNA 1DWDH 2THFB 3HPTB 1W3CA 1O34A 1DSTA 4B76A 1XXDA 2UUKB 4ZUHA 3EYDA 4DIIH 1GI5A 1O2SA 1IOEA 1YPHC 4Y7BA 2ZGHA 1GBEA 2P16A 4Y10E 4I32A 3RXFA 1OKXA 1F0SA 2HGTH 2DE9A 1ESAA 3S9AA 1W13U 1DFPA 2ANMH 1GDNA 1UTQA 1AVGH 1C4U2 3PLPA 2QY0B 4X2YA 3QZRA 1K1PA 3A8AA 1V2QT 2C8YB 1GWAA 1O3JA 1O3EA 4FUIA 4MNVA 3LJOA 1J8AA 3LGWA 4I8KA 2HPPH 1CGIE 5EQRA 2PFEA 1P2JA 3VGCB 1C9PA 1T32A 2GZ9A 1ZTLA 2P3FH 3UQVA 1DM4B 1CA8B 1DY8A 1GL0E 1UTPA 2BX4A 2J38A 5AHGH 3UOUA 2CF8H 3GY4A 3T29A 1C2KA 1MMJN 3ZZDA 1F0RA 4A92A 1TOCB 2PGBB 4ISLA 4XBCA 1OPHB 3RXSA 2F9VA 5T3HA 2BDHA 5A0BA 2F9UA 2IJOB 3Q3KA 4O03A 1IHTH 2J34A 1UVUH 3GCTF 1O30A 2FOAA 2H9EH 1NRNH 5H4IB 2Y5GA 3ZZ9A 1ZGIA 2BXUH 2AGIX 4KP0A 3TNTA 1SQAA 3AASA 1SGFG 2Y7XA 2SNVA 1K21H 1KYNA 2V35A 2P3TB 3M7QA 1NFWA 4NIXA 3D62A 1KXAA 2CF9H 4Y8ZA 1NESE 3SV2H 1O32A 4DG4A 1AWFH 5FHTA 2ZHFH 3O8DA 3TPIZ 2D1JA 4B1TA 2ZU4A 1UTMA 3ZYEA 2Z9LA 3HGPA 3SJKA 2KAIB 1O5FH 3SORA 1O2YA 5FCRA 1L0ZA 1H9IE 2XBWA 3UR6A 1HRTH 3KQCA 3RUOA 1CA0B 1MCVA 5I46H 1ORFA 5AFZH 4YOJA 1ELAA 3ATLA 3RXRA 2PGQB 1AGJA 1B0FA 2W7UA 2BDBA 2G52A 4WH6A 4KTCA 3BTKE 2F9PA 1FY3A 2CHAB 3NZIA 4AFUA 4FU8A 1PPEE 2H9HA 1GL1A 1AB9B 4MPVA 3BG8A 2HNTC 2ZFSA 3ZVDA 3I78A 1HAGE 3T28A 1P11E 4CRGA 1XVOA 5FPTA 4B71A 1AZ8A 5C3NA 2GKVE 3SO3A 3SU1A 2PKAA 2PW8H 4FVDA 3E90B 4INKA 2WPHS 2SFAA 1VITH 2RA3A 2ZQ2A 1SBWA 4BAMB 2BLWA 1O0DH 2H2ZA 4ABIA 4AB8A 3PLBA 1O5BB 3OU0A 1OYQA 4Y6DA 4U2WA 2GVFA 1AFQB 2QF0A 3SN8A 4XFQA 1FN8A 2G55A 1J9CH 2I6QA 2BD8A 5A0AE 5EU8A 1BMAA 1LVBA 1SLVB 1SG8B 3D65E 1WU1A 1FQ3A 4X6NA 5LGOA 4MNWA 4UEHH 2QF3A 1SMFE 3T2NA 1GG6C 1C2DA 3KQEA 1L4DA 5LH8A 3P17H 2BD7A 4Y8XA 4KELA 3A82A 5GWZA 1BT7A 2QXHA 3SQHE 1O5GH 1QIXB 1TPAE 2VGCB 1BMLA 1SGTA 1D4PB 5A8ZA 1EB1H 2CJIA 5CHAC 1PPCE 2EC9H 1VJ9U 2BB4A 4IMZA 3F1SB 2RG3A 1S81A 2ZPSA 1C1SA 5F8TA 2AGGX 1N8OB 2VIPA 2SNWA 2FM2A 2Y80A 2NU2E 1L1JA 3DD2H 1TX7A 3TGJE 3OYPA 5A09A 3RDZA 1GI2A 2Y82A 3ZVFA 1K9OE 1GMCF 1TGTA 1QRZA 2FOMB 4Y8YA 4AOQA 4ABDA 1ZGVA 1CSOE 1HBTH 1GCTC 1MQ6A 5L6NH 2ALVA 1Z6JH 1GBTA 3K2UA 2FESH 5GCHF 1E34B 4IC5A 1P9UA 1KXBA 1SGRE 2ZDMA 5EXNA 3M5MA 3A7WA 1LDTT 5C1XA 4JK6A 4UFFH 1EOJA 1GHYH 1QBOA 3Q3XA 2P93A 3QX5H 3SGQE 1WCZA 2D2DA 3U69H 1LHGH 2A2XH 3SV9A 1LPZB 3O8BA 3ZZ7A 3H7OA 4AGKA 3EDXB 4K1SA 1BBRE 3FP8E 4ISHH 3C27B 1ZJKA 1JRTA 1V2KT 1UTJA 1ESTA 2BOKA 4CHAC 1OP2A 1C1QA 2VWMA 2AMQA 3VB3A 1T7CA 1G3DA 3SU5A 4CRAA 4TYDA 1LHCH 2ZU1A 1LMWB 2GMTB 1ANBA 3SGBE 2P59A 1AMHA 3SHAH 1DUEA 2BXTH 1DDJA 3GY6A 1PJPA 1J16A 1ELDE 3RC5A 1HAXB 4U01A 5FPYA 4M7GA 1TMTH 2VH6A 1O3IA 3P8NA 2ZP0H 1S0QA 1TRNA 3MNSA 1K1NA 3T5FH 1TABE 5EOKA 2ANWA 1V2RT 1UK4A 1PFXC 1Y59T 1O2OA 3KNXA 4UFDH 4OS6A 3RMLH 1SGNE 1ZSKA 4J2YB 1VGCB 1MH0A 3RXVA 1SOZA 2PKSC 2VIDA 3PMBB 3NXPA 5DGJA 2FP7B 1C5ZB 2OINA 1ZHPA 4H6SB 3KQBA 4BAHB 3P92A 1L1GA 3VB4A 3ZVCA 1O2NA 3M7TA 3MWIU 1FMGA 4RKJB 3G01A 2W3KA 1PQAA 2SGFE 2J95A 1FAKH 3ATKA 1RFNA 2BZAA 2XC4A 2ANYA 1CA0C 1SVPA 3E0NB 1ANCA 3RXTA 1VZQH 3SNDA 1Y5BT 1O2RA 1V3XA 2FOFA 1D3PB 3MO6A 1IHSH 1T4VH 1EP5A 2BDYA 1NROH 1Z1IA 2OBOA 1GMDG 1XMNB 3B8JA 3EQ0H 3MTYA 3GY2A 1TX8A 1MKWH 1TYNA 1YCPM 1QRWA 2IPHA 2GCTC 2HOBA 1GCTB 1EAWA 2FOGA 1T8NA 4FVBA 3U98H 1AWHB 4XBDA 1FZZA 3JZ2B 3SUDA 3TVJB 1YKTA 3TITA 5EQQA 1RTLA 1SQTA 1C5LH 1O5AB 2FLRH 4DVAU 1ARCA 5C2ZA 2BDGA 3ELAH 3ZZCA 9ESTA 1SI5H 2STBE 1LCYA 1Z7KA 1SGYE 2JETC 4ZKOU 4TY7A 5J4QA 4MVNA 4CRDA 1GHBF 3O8RA 1TB6H 3A89A 2ZU2A 2UWLA 1MAYA 1ANDA 3LGYA 3M5OA 1S5SA 2ZCKP 1BZXE 1IQKA 2BY9X 4X6OA 1KXCA 4MLFB 1UHBB 2Z7FE 5T6GA 1GVLA 4BTTB 3TJOA 2P3UB 3GCHC 3SJ9A 4AX9H 3P8FA 3SV7A 1W7XH 2WPLS 4D9RA 1GVZA 3IWMA 1BRUP 1P2NA 2O8UA 2G4UA 1WOFA 2GP9B 3HK3B 2FX6A 3RMOH 3E1XB 2ZPRA 2M5TA 2GT7A 1C5XB 3LH1A 3RXQA 2FTLE 1O2XA 1IQEA 1YLDA 3A7TA 4WH8A 4ZH8A 3WY8A 5EW1H 3MOCA 5IYTA 4NIVA 4Y71A 1F5RA 2JH0D 4OS1A 3QWCH 2V0BA 4GCHF 1IQJA 3OSYA 2TPIZ 1A5GH 1KSNA 2QXIA 1FN6A 3EA7A 1EXFA 1FIWA 5AVDA 2VH0A 1WUNH 2B8OH 1DOJA 3F68H 1ZPCA 1HAVB 2GMTC 2QIQA 1YF4A 5ESTE 3MU1A 1C2LA 4D9QA 1QRXA 1TIOA 2Y6TA 4NIWA 1P05A 4NSYA 2Q6DA 1SHHB 2VIVA 1GHWH 1O3BA 1C5NH 1ESBA 2BVXH 5EG4A 1P2IA 4AFSA 4THNH 1YPLH 4BOHA 2FMJA 1BIOA 3Q77A 3TU7H 1GGDB 1UK2A 1HLTH 1ZYOA 3CS7A 1RXPA 1C4V2 2BD9A 1C5OH 1GHXH 2ZECA 1PYTC 1EZSC 4GVUA 4PROA 4TPIZ 3F6UH 2FI3E 1A46H 1ELEE 3RXDA 1XKBC 1F0TA 2J4IA 3U9AH 4I7YH 2FX4A 3UOPA 5CHAB 1PPZA 4YOGA 4B74A 1TGCA 5DP7A 4F49A 4B2AA 1KLTA 5A2MH 1P9SA 3ZZ3A 2YOLA 2WV4A 4YO9A 1N6YA 3SHCH 2BVRH 3OY6U 5DG6A 2GCHG 2B5TB 1NFYA 1BBRK 5IDKA 1TPPA 2HNTF 1O3FA 2ODPA 3TGIE 2TRMA 3P6ZB 4JMYA 3BTEE 1C1MA 3LT3A 5HM2A 3BN9A 1D6RA 4X6MA 2BLVA 5PTPA 2STAE 3LC5A 3VPKA 3SQEE 2Z94A 1HJAC 3K9XB 4DCDA 1G3EA 1O3OA 3GCTG 5EXLA 9LPRA 1YCPK 1TMBH 1KDQB 3GICB 1EPTB 1GBAA 1W0YH 4HI3A 5ABWA 3ZZ5A 3TH2H 1HGTH 2EI7A 4WXVA 1GHAG 1Z8IB 1DVAH 4XBBA 4XE4A 4YTAA 1D9IA 2G51A 3MHWU 1TA6A 1TWXB 3VB7A 1V2NT 1O2GH 5EQSA 1F0UA 3E8LA 3M36A 5EPNA 2Y81A 1YCPH 3UNRA 2ZDNA 1SL3A 1DUAA 4TY6A 2GZ7A 1Y3WA 3RXUA 1HCGA 1G3BA 5T6FA 4LXBH 1C2FA 1SGDE 3DFJA 2A5KA 2SGAA 3P8OA 1YPGH 1Z8GA 1AVWA 1CT0E 2F3CE 1P0SH 1O3GA 2UWPA 1V2TT 4IS5A 2TGAA 2WPIS 5C67A 5DPAA 2ZTZA 4IW4E 5C20A 1C1UH 3EA9A 1FY5A 3QZQA 1EKBB 4WVPE 3KCGH 1VGCC 1O2VA 5K0HA 3H7TA 2ZCHP 1CGHA 3MU8A 3TK5A 4A1XA 3PTNA 1CHOF 2A1DB 3KHVA 1RS0A 3RXCA 6GCHF 1ZMNA 1TNKA 1JRSA 1O2QA 1B7XB 2ZU3A 3STJA 3TNSA 2ZGCA 3RXHA 4ZXXH 2Q6GA 1SFIA 4OS4A 1MTSA 5JB9S 4X1PU 4TPYA 5CMXH 2ZFTA 5T6DA 1TA2A 1NRSH 3MI4A 3ODDA 3TJVA 5A8YA 3M35A 1LO6A 1ZLRA 3LPRA 1GJCB 4YOIA 1BUIA 2AH4X 1GBHA 3KIDU 1Y5UT 1E38B 1G32B 1A5IA 1C9TA 1LPGB 2ZG0H 1W11U 1WV7H 3QGJA 1FY1A 2PWXA 3TIUA 4ZXYH 1ZPBA 3SJIA 1A7SA 2Z9KA 4FUCA 1DT2A 2VWNA 3A85A 1UMAH 5JB8S 2ESTE 2PUQH 1FPHH 5GCHG 2FYRA 1Y3XA 1IQFA 2FODA 2C90B 1A0LA 1O2JA 4IN2A 2W7SA 1UVTH 2OC7A 1G9IE 4RKOB 5JPMH 1W0ZU 1T4UH 3T62A 3UUZA 1HFDA 4A5TS 1DWBH 1MZAA 2A4OA 1FY4A 2BLOA 1UTKA 2DE8A 4AG2A 3ITIA 2B7DH 2AMPA 1MBMA 1YYY1 3PTBA 1A4WH 3ATMA 4AYVB 1QY6A 3BTDE 1EAIA 1WYKA 4KTSA 1MTWA 3RLWH 1S85A 5E2OA 2TBSA 1YPJH 3SZNA 2ZDLA 1SC8U 3ZV9A 3OTJE 4AN7A 2IN2A 3DT0H 2ASUB 1HJAB 2XWAA 3MH7A 4NWKA 2XNIA 2Z3DA 1A3EH 2OP9A 3CENA 2H6MA 1H8DH 3FZDA 2H9TH 1OWKA 2ODQA 2Q1JA 3MMGA 4DOQA 3SU2A 2C4FH 2XRCA 1HIAB 2O8MA 2A5AA 2ZGJA 2ZWLH 1UCYK 4A1TA 4H4FA 3RXIA 1CVWH 3LGTA 5JBAS 2P8OC 1OWDA 4BAKB 1CQQA 3U8RH 1EATA 1S84A 2ZFPH 1G2MA 7LPRA 5JDUB 1V2UT 2XBXA 1HNEE 1VCWA 3AW1A 3OX7U 1H8IH 1HB0B 3AAVA 2FI4E 3URDA 3L3TA 1P03A 2FZZA 1OP0A 3BTFE 1C5YB 2GDEH 2ZFFH 4YZUA 1GI9B 2OUAA 5LPEA 4K1TA 4ZKSU 4ISOA 1SLWB 3GYLB 4MNXA 4OS2A 2NU3E 3A86A 1FXYA 1EB2A 1OOKB 1NRRH 1GGDC 1HIAA 2P95A 7ESTE 4UFGH 4MTBA 3SV8A 1OWHA 1KTSB 4K1EA 4UONA 2PKSB 3M5LA 2JH6D 2XBYA 1T8OA 3PB1E 1DX5M 4JYUH 2VGCC 2FOEA 2C3SA 1A3BH 1MKXH 1YPHE 1XKAC 4JZFH 2ZZUH 4CR5A 1JMOH 2Y7ZA 4NWLA 4NFFA 1HJ9A 1EPTA 1C1WH 1O3HA 2FS8A 4A1VA 4X6PA 1W14U 3U1JB 2O9QA 4IGDA 3CS0A 2A0QB 2WYJA 1HJ8A 3SNCA 4NSVA 4X1SU 1MCTA 2PHBA 3SW2B 2BY8X 1OYTH 2HWLB 2A4GA 1OWJA 5HM9A 4FUJA 1S0RA 4UFEH 4X1RU 3RU4D 1T8MA 3O8CA 5DJ7A 4CHAB 3BSQA 1YM0A 1GJ8B 1EPTC 2W3IA 1VITF 1A0HB 1QJ7B 1S6FA 1GMCG 1EQ9A 4I8GA 2P94A 4HTCH 1QHRB 4CH8B 1F5KU 1AHTH 2O8LA 1W12U 5E2PA 5AFYH 3M7UA 4Y11E 5JBCS 4XDEA 3V7TA 4FUEA 1AZZA 1O2LA 3RXMA 3E0PB 4ABJA 2AGEX 3P70B 5LPRA 4DT7B 4Y79A 2A31A 3GCNA 1BRBE 4I8HA 1OP8A 1Y3YA 1PQ7A 4A6LA 1DICA 1FLEE 1P57B 5C5NA 1A61H 4NIYA 2HALA 1RIWB 2R0LA 1XUFA 3A87A 1GI0A 5FXLA 2QGRA 2ZO3H 5SGAE 5TCCA 2QAAA 3A7VA 2BY6X 3GDVA 3PO1B 2XXLA 1AIXH 5GIBA 2QXJA 4TWYA 1C1NA 3BTGE 1O5EH 1G2LA 1GJDB 3ZYDA 4HZHA 1QB9A 2WPKS 1V2ST 2BDCA 4ZHLU 3R0FA 2YNAA 3V3MA 2ZHWH 1RTKA 3ESTA 2R0KA 1UCYE 4MG3A 1EJAA 4ZHAA 4AFZA 2QC2A 3ODFA 2Z3CA 1ZOMA 1QR3E 2F9NA 1DXWA 2GCTB 3HKIB 4O9VA 3S7KB 1YPEH 2HVXA 1Z8RA 4X2XA 2BZ6H 1VJAU 2OC0A 4DIHH 8ESTE 1EAUA 2ZEBA 3MH6A 4BXWA 4GUXA 1SLXB 3M5NA 3NCLA 1O39A 1FAXA 1H1BA 4I8LA 2G8TA 3QDZB 3M61U 4ZAEA 1F92A 2PLXA 4B2CA 4O3TA 1QFKH 2BQWB 1GHAF 2OD3B 1SSXA 3UNSA 4WMEA 2ZHEH 1GBDA 2HPQH 2QN5T 1MZDA 1IQGA 4IN1A 3JZ1B 1WAYB 2C8WB 3S9BA 2TIOA 4DURA 5C1YA 1EOLA 2H1UA 3A8BA 2W5EA 2Z9GA 2D8WA 3RC4A 1QURH 3F9HA 3BEFB 2VVVA 2VU8E 1OSSA 1P02A 1FJSA 5FBEA 1TRYA 1ACBE 1BTUA 4CREA 5GDSH 4X8UH 5EPYA 2ZIQH 1MTVA 1V6DA 3VEQB 1HXFH 2H5CA 1KLJH 2GCHF 4U30A 2FTMA 2Z3EA 1MTNB 4WMFA 2WINI 1TPOA 1TGSZ 3Q00A 7GCHF 1O38A 1DS2E 1ID5H 1YLCA 4AFQA 3M3VA 4ASHA 2B9LA 3B9FH 1NRQH 2VVCA 1WQSA 1BJVA 4LZ1H 2NU1E 3Q76A 1P3CA 3PLKA 1GMDF 4IMQA 1WTHD 1MD7A 3PWBA 1C2HA 5F8ZA 3ATIA 2AYWA 1HAIH 1NRPH 1NY22 2EI6A 3HGNA 1J17T 7KMEH 2BDAA 5K7RA 2AIQA 1VR1H 1GJ4H 2XCNA 2FIRH 4E06H 1C1TA 4Y7AA 1H9HE 5FBIA 2OCVB 3EAJA 4JK5A 3QK1A 2ZDVH 1TNIA 2F83A 3SBKA 1P8VC 1W8BH 1CGJE 3NK8A 1DPOA 1O37A 3FP7E 1TE0A 3SNEA 1C2JA 3TLOA 2OC8A 1W7GH 1TBZH 3FZZA 1K1MA 1O3CA 1UTOA 1AUJA 1DITH 2G00A 4NCYA 2BD4A 1C4Y2 3RC6A 1GMHF 5L2ZH 1QNJA 4I33A 4K2YA 1C5VA 4J1YA 1TBRH 5F6MA 1HYLA 2WYGA 1GHBG 1LVYA 1H9LB 1CT4E 4ISIH 1C5QA 2ZFQH 1G36A 1QJ1B 4U32A 5JBBS 2GTBA 4XSKU 2ZGBH 1FPCH 1ZSJA 1HXEH 4ZHMU 4A7IB 2RA0A 1H4WA 1YGCH 3DFLA 4OGYA 2FS9A 4Y0ZE 1Y3VA 1TAWA 4BAOB 3PMJA 1EZQA 1V2JT 1SFQB 1E35B 3GY5A 4K5ZA 3UNQA 1T8LA 2OLGA 3B23B 7GCHG 1HAPH 2XYAA 1GBKA 1OX1A 2BD2A 4NZLA 1ELVA 1XUJA 1TALA 1DWEH 4GAWA 1MUEB 5FAHA 1JWTA 2JKHA 1MTNC 3SI4H 4AYYB 2CGAA 3KGPA 2ZDAH 3BG4B 4MDSA 2TGDA 2ZHQH 4JZDH 1XM1A 1DLKB 1O2KA 2ULLA 1AE5A 1BTWA 1LHFH 3BIVH 3AVZA 1MQ5A 2AMDA 3ZVBA 1TPSA 4SGBE 1GBBA 5DP3A 1VCQA 3F9GA 2ZNKH 3ZVEA 1C5PA 1O3PB 4H6TA 3A84A 1JOUB 1XXFA 1TNHA 4ZKRU 1BCUH 3HK6B 1CE5A 3I29A 3RXJA 3QTOH 2AS9A 4X2VA 4TWWA 6CHAB 3PWCA 3RMMH 1FONA 1GVKB 1INCA 1UVPA 2A7CA 2ZC9H 3SNAA 4MPWA 3NWUA 4RSPA 1Z1JA 3KL6A 1L2EA 8GCHF 4O3UA 3HKJB 1UK3A 1MBQA 3BTWE 1CHOG 4ABAA 2J94A 4K3JA 5ETXA 2BM2A 4UD9H 3GCOA 1GG6B 1NTPA 3LGUA 1GI8B 2P8OB 1ZTJA 2A7JA 1V2PT 2ZDKA 1P3EA 3VFEA 1GMHG 1QL7A 2JH5D 1QCPA 1KXDA 3ENSB 3GDUA 5BRRE 1UCYH 4AGJA 1N8OC 3MNCA 1YBWA 2VWOA 5DKMA 1C5MD 3MNXA 2BD5A 3SU0A 3T27A 3K6YA 2HRVA 1PQ5A 1M9UA 2BTCE 1RTFB 2O8TA 5A8XA 5AF9H 1V2VT 3RXBA 5GPIB 3TJUA 1ETRH 2XC0A 2G4TA 2FI5E 1Q31A 1S6HA 2W26A 3F9EA 4Q7XA 4GPGA 4Q7YA 3UIRA 1AQ7A 2EA3A 4ZROA 1O2WA 1A1RA 3ZVAA 1SGEE 1F7ZA 1AD8H 4K8BA 3STIA 3M3SA 1X7AC 5TCAA 1EJNA 1D3TB 1MAXA 3E3TA 3SUEA 4WJG2 3SI3H 3BEIB 3QN7A 4FXGH 1SOTA 1FI8A 3GY7A 1ELTA 3TJNA 1C5RA 3PMHB 1QB6A 2GX4A 4X1NU 2FLBH 1YPKH 1FNIA 1LQEA 3NUMA 1NT1A 3SV6A 3QTVH 2FXRA 1BA8B 4I31A 1A0JA 1Z71A 2PTCE 1BMMH 4SGAE 3SU4A 5DP6A 1NU7B 2KAIA 3TK9A 1NS3A 4IC6A 2OQ5A 1EP6A 2SGPE 3N7OA 1W10U 1P06A 2A7HA 1NN6A 2VINA 1QB1A 1O2UA 2WUCA 1BTPA 1C5UA 3PROA 4XOJA 3PYHA 5TJXA 1SGPE 2BD3A 3VXFH 4D7GA 3C1KA 4O97A 1AKSA 1MKXK 5DP8A 3RXKA 1BDAA 1B0EA 1E0FD 1KXEA 3EE0B 1KIGH 1FY8E 1ZHRA 2CMYA 1V2LT 3A81A 4X2WA 6GCHG 2BY7X 4CBNA 1RRKA 5JYIA 2J9NA 1ZMJA 1KY9A 3LOXA 4AB9A 1GCDA 2VVUA 2F9OA 3VGCC 4AZ2B 1TQ7B 2SGEE 1D3DB 1HV7A 2RCEA 3MU5A 1BHXF 1AO5A 1IQNA 2OC1A 3LGIA 3GYMA 3BTTE 2XWBI 4LOYH 1EZXC 1DY9A 1O2HA 2WPMS 1MD8A 2SGQE 4NA9H 4E7NA 1PYTD 4GHTA 1ANEA 4ABGA 4B2BA 1BTZA 1SGFA 2QA9E 2GV6A 2CXVA 2QYIA 4VGCB 1GJAB 1UTNA 3A88A 2YNBA 1TBQH 1P2MA 1BTHH 3U8TH 2VIWA 1ETTH 1VCPA 3FP6E 1GJ9B 5G4BA 1GDQA 1ZR0A 2GGVB 3BTME 3P8GA 3U1IB 1A2CH 1XUGA 3URCA 5L2YH 3SUGA 4D7FA 3UR9A 1E37B 2Z9IA 2UWOA 1LQDB 4CRBA 3SU6A 5FPSA 1N6XA 1SQOA 1P04A 2PSXA 2JETB 1GI7B 1SPJA 2ANKH 1QBVH 6LPRA 1O2TA 2FO9A 2J92A 2UUJB 3M37A 1QA7A 1V2MT 1TMUH 2OXSA 1VITG 1BTXA 5A0CA 3GISB 4CR9A 3EGKH 2ZTXA 4FUDA 2ZKSA 3RXLA 1O2MA 2Y5HA 4KGAA 4MPUA 4HGCA 1SHYA 1ABJH 4NG9H 2PUXB 1GJ7B 4CH2B 4WY3A 4YT7H 5FX6A 2C8XB 3RXPA 1GI4A 2LPRA 1MU6B 3LDXH 2VNTA 1GBMA 1GDUA 1PPHE 2GZ8A 4KKDA 5EW2H 1BRCE 2Y5FA 3VXEH 2C93B 4R0IA 3IITA 3FVFB 1LKAA 2HLCA 4GSOA 2BMGB 1HAYB 4E05H 1THPB 2ZF0H 4D8NA 3UFAA 1BQYA 1THSH 1TLDA 3E91A 2XBVA 2K1QA 1RIWC 4BNRA 2R9PA 2ZI2H 1K22H 1GI1A 3BF6H 1QL9A 1AFEH 3GY8A 1E36B 3SOSA 3QGNB 3EA8A 2BQ7B 1ELFA 1ZHMA 1SGQE 1AB9C 5HGGA 2ZQ1A 3U8OH 4BANB 2D26C 1KXFA 4WXIA 3M3TA 3S69A 3MFJA 1TQ0B 2IOTA 4JZIA 1UVOA 3PO1C 2SGDE 2AFQB 1ABIH 1FIZA 6ESTA 5HXFA 2ZCLP 1EX3A 3SJ8A 1D6WA 1GJ5H 1RJXB 3PMAB 2F9BH 2HNTE 1LKBA 1JIMA 2VB0A 1BJUA 1A5HA 2BVSH 2WUBA 2NU4E 1HAZB 5EXMA 2BQ6B 3A80A 1TGNA 3SUFA 1K2I1 3UPEA 5L30H 1NFUA 2QV1A 5F03A 1L1NA 1J14A 5HMAA 1CU1A 4X8VH 1NU9A 4FU7A 2ALPA 4X1QU 3TH4H 5JBTA 4WMDA 1SR5C 5DO4H 1BBRH 1O5DH 1UJ1A 2G5VA 1AFQC 3PV4A 1QBNA 1J15A 1TNGA 1OWIA 2V6NA 1O3MA 1P01A 3A8CA 2Q6FA 4FUHA 1ETSH 1P2KA 2ZPQA 4INLA 1WSSH 1XX9A 1P2QA 2Z6BD 4ISNA 3FFGA 1QQ4A 1TGBA 1GBCA 1GBIA 3I77A 1SGIB 3KEEA 4Q80A 5DK1A 5E0JA 1DANH 2PV9B 3MU0A 1K1JA 1GI6A 3H5CB 2CV3A 1AKSB 3BIUH 2PR3A 1C5WB 1C2EA 1GBJA 1KDQA 5EGMA 1ARBA 3MYWA 1PPFE 3MO9A 3T26A 3SGAE 3RP2A 1S82A 2Z9JA 1C5SA 1YP9A 1EZUC 1CBWC 3DA9B 3LH3A 4JCNA 3D23A 1O35A 4FUBA 3V12A 4D76A 4ABHA 1FDPA 1IQHA 1C1PA 3LONA 2A2QH 3UQOA 2AIPA 3A7YA 2EI8A 2R2MB 2BX3A 1G3CA 4KTUA 1U6QA 1TONA 3HATH 4UE7H 3RXAA 1C1OA 3D49H 1QGFA 1PPGE 1YC0A 2ZHDA 2FOBA 2XW9A 4YLQH 3BTHE 1GJBB 1LHEH 1FV9A 2OTVA 3SNBA 1TNJA 1LTOA 1OS8A 2XTTB 3A8DA 3LGVA 1MU8B 3MNBA 8LPRA 3FAOA 2FOHA 1OWEA 3P95A 3NKKA 3A7ZA 3GDSA 1EJMA 1QA0A 2VIOA 4K8YA 4LZ4B 1P10A 4RN6A 4QT8C 4Q7ZA 1MTUA 1ZJDA 3ZV8A 1XUHA 2G5NA 4FUFA 4NFEA 3RM2H 1IQLA 2I6SA 2C8ZB 1TOMH 2QXGA 1YPMH 2R2WU 1DXPA 1LPKB 1NM6A 2V3HH 4BAQB 1QJ6B 2RDLA 4ESTE 1O2ZA 1RD3B 5BPEA 3SU3A 1ZTKA 1NO9H 2V3OH 1HUTH 1BITA 1Q3XA 1NZQH 1F5LA 2PTNA 4WWYA 1P12E 1AE8H 3T25A 1LVMA 3BEUA 1ZRKA 4NGAH 1TNLA 2A5IA 4JZEH 2VIQA 6CHAC 1O3LA 1WTGH 3MH5A 1O3AA 1DE7H 1UTLM 2R3YA 1K1LA 1O36A 2H5DA 4B75A 5CE1A 1KTTB 2ZGXH 3LC3A 4FUGA 5GJ4B 2ZFRH 8GCHG 1AU8A 1BOQA 1BTYA 4GCHG 1T31A 1LHDH 3V13A 3K65B 4AORA 2VJ1A 4OGXA 2BYAX 4K60A 5GXPA 3IG6B 2A32A 3AW0A 1BRAA 4NA7A 4CRCA 1GBLA 4GHQA 1F2SE 1SGCA 3L33A 3RXEA 3R3GB 2NU0E 2UUYA 5DP4A 4HFPB 1ZPZA 3LIWA 1Y3UA 1ELBA 1UVSH 4MPXA 5FCKA 4Y76A 5C5OA 4IBLH 1SLUB 4BTUB 2ODYB 3Q3YA 2FPZA 1P09A 1QQUA 4X8TH 2BOHB 1HPGA 4R8TB 5E0HA 4Z6AH 3W94A 2UUFB 3BTQE 1EAXA 1GBFA 1IAUA 2F91A 4LK4A 4ABFA 3ZZAA 4JYVH 3KF2A 2BLQA 1JBUH 2A4QA 1AVXA 2EEKA 1DLEA 2ZA5A 2VWLA 1BB0B 2WPJS 1IQIA 1C2IA 3ZZ8A 4YLUA 4YESB 3L6PA 1B5GH 1SB1H 4K69A 2ZU5A 1NFXA 2XCFA 1QL8A 3UWIA 4GLYA 2J2UA 5HYOA 1BHXB 4YT6H 3RU4E 3QO6A 1EASA 3TH3H 3RM0H 1Z6EA 5DP9A 3RXGA 3GOVB 1PPBH 2WV5A 2TGPZ 1K1IA 3A83A 4NA8A 1FUJA 2FEQH 4UDWH 2ILNA 1G37A 2CHAC 5ESBA 2GD4B 3K6ZA 4H42U 2O8WA 1O33A 3AAUA 1ELGA 1TRMA 2BDIA 1KLIH 1ZZZA 1XUKA 1ZRBA 5E8EH 3DHKH 3S0NA 3MO3A 3UY9A 1TX6A 1HAHH 1AY6H 3FANA 3CP7A 1XVMA 3VB5A 5B6OA 4NZQA 3ZVGA 2GDDA 1THRH 4I8JA 1UO6A 8KME2 1DWCH 4WF8A 1RGQA 3BG4C 2B0FA 2G81E 2PKAB 3E6PH 3QLPH 1V2WT 3UWJH 3NPSA 3PM3A 3RXOA 5LPFA 3ZZ4A 4DY7B 2DUCA 4ABEA 1D3QB 3TK6A 3A7XA 4DGJA 1GJ6A 1Y8TA 4F4OC 4AG1A 4Y0YE 4INHA 1C5TA 1JXPA 2TGTA 3UREA 1O2IA 3KQDA 4YM9A 1HAVA 1O5CB 3OY5U 1Q2WA 3RMNH 1XUIA 3ZZBA 1O2PA 4CRFA 2OBQA 5FX5A 4DJZB 1C1VH 3BV9B 4JYTA 1MKWK 1AN1E 1ZMLA 1TFXA 5F8XA 1O3KA 2CN0H 4X8SH 3GCHB 3UTUH 2BY5X 4BTIB 3SJOA 1O31A 4FU9A 5J4SA 1CBWB 3RU4T 3MH4A 4Z0KA 3LJJA 1WQVH 1W2KH 1N1LA 2PSYA 2A45B 1C2GA
chains in the Genus database with same CATH superfamily
1BMNH 1WBGB 4CBOA 4VGCC 4ZKNU 1K28D 5EJLA 2LNCA 2QCYA 3LU9B 1C2MA 1AUTC 2YMSC 2R3UA 2A4RA 4E7RG 1HDTH 4X0WU 2AERH 1Z8JB 1EUFA 1CT2E 2FOCA 3QUMP 1V2OT 1UHBA 4ABBA 2OQUA 5CDFE 2BHGA 1GHZA 5EODA 1K1OA 4Q2KA 1O3NA 3MU4A 1G30B 1PQ8A 1NC6A 5E0GA 2WHXA 4ZMAH 1AI8H 1GHVH 2J97A 3ATWA 3E16B 2XC5A 4OS7A 3W95A 5I25A 4BXSA 1Y5AT 3F9FA 1L4ZA 3KN2A 4MNYA 1CO7E 3TGKE 1QTFA 3DUXH 3V0XA 1GPZA 1P2OA 3GY3A 2FWWA 3F3BA 1ZSLA 1CHGA 1JIRA 2ZTYA 1NPMA 1GI3A 2FYQA 2GV7A 3F0PA 1S83A 1C1RA 3VB6A 1O3DA 1LVOA 1HAOH 3ZZ6A 4JZ1A 5C1UA 4OS5A 3LKWA 3S9CA 4RT1A 3S7HB 1ELCA 1IQMA 2FDAA 1OXGA 1DSUA 4DW2U 2GT8A 3RLYH 4B73A 4MQAA 5DP5A 2AEIH 2NWNA 1DWDH 2THFB 3HPTB 1W3CA 1O34A 1DSTA 4B76A 1XXDA 2UUKB 4ZUHA 3EYDA 4DIIH 1GI5A 1O2SA 1IOEA 1H8ED 1YPHC 4Y7BA 2ZGHA 1GBEA 2P16A 4Y10E 4I32A 3RXFA 1OKXA 1F0SA 2HGTH 2DE9A 2JDID 1ESAA 3S9AA 1W13U 1YWUA 1DFPA 2ANMH 1GDNA 1UTQA 1AVGH 1C4U2 3PLPA 2QY0B 2PP6A 4X2YA 3QZRA 1K1PA 3NRLA 2JJ1D 3A8AA 1V2QT 2C8YB 1GWAA 2IPQX 1O3JA 1O3EA 4FUIA 4MNVA 3LJOA 1J8AA 3LGWA 4I8KA 2HPPH 1CGIE 5EQRA 2PFEA 1P2JA 3VGCB 1C9PA 1T32A 2GZ9A 1ZTLA 2KCAA 2P3FH 3UQVA 1DM4B 1CA8B 1DY8A 1GL0E 1UTPA 2BX4A 2J38A 3FKSD 5AHGH 3UOUA 1BMFD 2CF8H 3GY4A 3T29A 1C2KA 1MMJN 3ZZDA 1F0RA 4A92A 1TOCB 2PGBB 4ISLA 4XBCA 1OPHB 3RXSA 2F9VA 2KCOA 5T3HA 2BDHA 5A0BA 2F9UA 2IJOB 3Q3KA 4O03A 1IHTH 2J34A 1UVUH 3GCTF 1O30A 2FOAA 2H9EH 1NRNH 5H4IB 2Y5GA 3ZZ9A 1ZGIA 2BXUH 2AGIX 4KP0A 3TNTA 1SQAA 3AASA 1SGFG 2Y7XA 2SNVA 1K21H 1KYNA 2V35A 2P3TB 3M7QA 1NFWA 4NIXA 3D62A 1KXAA 2CF9H 4Y8ZA 2LP6A 2YMSD 1NESE 3SV2H 1O32A 1E79D 4DG4A 1AWFH 5FHTA 5EJ1A 2ZHFH 3O8DA 3TPIZ 2D1JA 4B1TA 2ZU4A 1UTMA 3ZYEA 2EY4C 2Z9LA 3HGPA 3SJKA 2KAIB 1O5FH 3SORA 1O2YA 5FCRA 1L0ZA 1H9IE 2XBWA 3UR6A 1HRTH 3KQCA 3RUOA 1CA0B 1MCVA 5I46H 1ORFA 5AFZH 4YOJA 1ELAA 3ATLA 3RXRA 2PGQB 1AGJA 1B0FA 2W7UA 2BDBA 2G52A 4WH6A 4KTCA 3BTKE 2F9PA 1FY3A 2CHAB 3NZIA 4AFUA 4FU8A 1PPEE 2H9HA 1GL1A 1AB9B 4MPVA 3AK5A 3BG8A 2HNTC 2ZFSA 3ZVDA 3I78A 1HAGE 3T28A 1P11E 4CRGA 1XVOA 5FPTA 4B71A 1AZ8A 5C3NA 2GKVE 3SO3A 3SU1A 2PKAA 2PW8H 4FVDA 3E90B 4INKA 2WPHS 2SFAA 1VITH 2RA3A 2ZQ2A 1SBWA 3OFND 4BAMB 2BLWA 1O0DH 2H2ZA 4ABIA 4AB8A 3PLBA 1O5BB 1KMHB 3OU0A 1OYQA 4Y6DA 4U2WA 2GVFA 1AFQB 2QF0A 3SN8A 4XFQA 1FN8A 2G55A 1J9CH 2I6QA 1S6LA 2BD8A 5A0AE 5EU8A 1BMAA 1LVBA 1SLVB 3OE7D 1SG8B 3D65E 1WU1A 1FQ3A 4X6NA 5LGOA 4MNWA 1K0HA 4UEHH 2QF3A 1SMFE 3T2NA 1GG6C 1C2DA 3KQEA 1L4DA 5LH8A 3P17H 2BD7A 2WPDD 4KELA 4Y8XA 3SZEA 3A82A 5GWZA 1BT7A 2QXHA 3SQHE 1O5GH 1QIXB 1TPAE 2VGCB 1BMLA 1SGTA 1D4PB 5A8ZA 1W0KD 1EB1H 2CJIA 5CHAC 1PPCE 2EC9H 1VJ9U 2BB4A 4IMZA 3F1SB 2RG3A 1S81A 2ZPSA 1C1SA 5F8TA 2AGGX 1N8OB 2VIPA 2SNWA 2FM2A 2Y80A 2NU2E 1L1JA 3DD2H 1TX7A 3TGJE 3OYPA 5A09A 3RDZA 1GI2A 2Y82A 3ZVFA 1K9OE 1GMCF 1TGTA 1QRZA 2FOMB 4Y8YA 4AOQA 4ABDA 1ZGVA 1CSOE 1HBTH 1GCTC 1MQ6A 5L6NH 2ALVA 1Z6JH 1GBTA 3K2UA 2FESH 5GCHF 1E34B 4IC5A 1P9UA 1KXBA 1SGRE 2ZDMA 5EXNA 3M5MA 3A7WA 1LDTT 5C1XA 4JK6A 4UFFH 1EOJA 1GHYH 1QBOA 3Q3XA 1SKYE 1YY3A 2P93A 3QX5H 3SGQE 1WCZA 2D2DA 3U69H 1LHGH 2A2XH 3SV9A 1LPZB 3O8BA 3ZZ7A 3H7OA 4AGKA 3WWFA 3EDXB 4K1SA 1BBRE 3FP8E 3CNRA 4ISHH 3C27B 1ZJKA 1JRTA 1FX0B 1V2KT 3MQKC 1UTJA 4Q63A 1ESTA 2BOKA 2J98A 4CHAC 1OP2A 1C1QA 2VWMA 2AMQA 3VB3A 1T7CA 1G3DA 3SU5A 4CRAA 4TYDA 1LHCH 2ZU1A 1LMWB 2GMTB 1ANBA 3SGBE 2P59A 1AMHA 3SHAH 1DUEA 2BXTH 1DDJA 3GY6A 1PJPA 1J16A 1ELDE 3RC5A 1HAXB 4U01A 5FPYA 4M7GA 1TMTH 2VH6A 1O3IA 3P8NA 2ZP0H 1S0QA 1TRNA 3MNSA 1K1NA 3T5FH 1TABE 5EOKA 2ANWA 1V2RT 1UK4A 1PFXC 1Y59T 1O2OA 3KNXA 4UFDH 4OS6A 3RMLH 1SGNE 1ZSKA 4J2YB 1VGCB 1MH0A 3RXVA 1SOZA 2PKSC 2VIDA 3PMBB 3NXPA 5DGJA 2FP7B 1C5ZB 2OINA 1ZHPA 4H6SB 3KQBA 5FL7D 4BAHB 3P92A 1L1GA 3VB4A 3ZVCA 1O2NA 3M7TA 3MWIU 1FMGA 2KX4A 2AHME 4RKJB 3G01A 2W3KA 1PQAA 2SGFE 2J95A 1FAKH 3ATKA 1RFNA 2BZAA 2XC4A 5HKKD 2ANYA 1CA0C 1SVPA 3E0NB 1ANCA 3RXTA 1VZQH 3SNDA 1Y5BT 1O2RA 1V3XA 2FOFA 1D3PB 3MO6A 1IHSH 1T4VH 1EP5A 2BDYA 2F4LA 1NROH 1Z1IA 2OBOA 1GMDG 1XMNB 3B8JA 3EQ0H 3MTYA 3GY2A 1TX8A 1MKWH 1TYNA 1YCPM 1QRWA 1COWD 2IPHA 2GCTC 2HOBA 1GCTB 1EAWA 2FOGA 1T8NA 4FVBA 3U98H 1AWHB 1NBMD 4XBDA 1FZZA 3JZ2B 3SUDA 3TVJB 3F2GA 1YKTA 3TITA 5EQQA 1RTLA 1SQTA 1C5LH 1O5AB 2FLRH 4DVAU 1ARCA 5C2ZA 2BDGA 4ACBA 3ELAH 3ZZCA 9ESTA 1SI5H 2STBE 3GS9A 4AC9A 1LCYA 1Z7KA 2KFWA 1SGYE 2JETC 3WW7A 4ZKOU 4TY7A 5J4QA 4MVNA 4CRDA 1GHBF 3O8RA 1TB6H 3A89A 2ZU2A 2UWLA 1MAYA 1ANDA 3LGYA 3M5OA 1S5SA 2ZCKP 1BZXE 1IQKA 2BY9X 4X6OA 1KXCA 4MLFB 1UHBB 2Z7FE 5T6GA 1GVLA 4BTTB 3TJOA 2P3UB 1WDIA 3GCHC 3SJ9A 4AX9H 3P8FA 3SV7A 1W7XH 2WPLS 4D9RA 1GVZA 3IWMA 3N99A 1BRUP 1P2NA 2O8UA 2G4UA 1WOFA 2GP9B 3HK3B 2FX6A 3RMOH 3E1XB 2ZPRA 4XRNA 2M5TA 2GT7A 1C5XB 3LH1A 3RXQA 2FTLE 1O2XA 1IQEA 1YLDA 3A7TA 4WH8A 4ZH8A 3WY8A 5EW1H 3MOCA 5IYTA 4NIVA 4Y71A 1F5RA 2JH0D 4OS1A 3QWCH 2V0BA 4GCHF 1IQJA 3OSYA 2TPIZ 1A5GH 1KSNA 3EE7A 2QXIA 1FN6A 3EA7A 1EXFA 1FIWA 5AVDA 2VH0A 1WUNH 2B8OH 1DOJA 3F68H 4Z1MD 1ZPCA 1HAVB 2GMTC 2QIQA 1YF4A 3UAIC 5ESTE 3MU1A 1C2LA 4D9QA 1QRXA 1TIOA 2Y6TA 4NIWA 1P05A 4NSYA 2Q6DA 1SHHB 2VIVA 1GHWH 1O3BA 1C5NH 1ESBA 2BVXH 5EG4A 1P2IA 4AFSA 4THNH 1YPLH 4BOHA 2FMJA 1BIOA 3Q77A 2LELA 3TU7H 1GGDB 1UK2A 1HLTH 1ZYOA 3CS7A 1RXPA 1C4V2 2BD9A 1C5OH 1GHXH 2ZECA 1PYTC 1EZSC 4GVUA 4PROA 4TPIZ 3F6UH 2FI3E 1A46H 1ELEE 3RXDA 3DCLA 1XKBC 1F0TA 2J4IA 3U9AH 4I7YH 2FX4A 3UOPA 5CHAB 1PPZA 4YOGA 4B74A 1TGCA 5DP7A 4F49A 4B2AA 1KLTA 5A2MH 1P9SA 3ZZ3A 2YOLA 2WV4A 4YO9A 1N6YA 3SHCH 2BVRH 3OY6U 5DG6A 2GCHG 2B5TB 1NFYA 1BBRK 5IDKA 1TPPA 2HNTF 1O3FA 2ODPA 3TGIE 2TRMA 3P6ZB 4JMYA 3BTEE 1C1MA 3LT3A 5HM2A 3BN9A 1D6RA 4X6MA 2BLVA 5PTPA 2STAE 3LC5A 3VPKA 3SQEE 2Z94A 1HJAC 2IJD1 3K9XB 4DCDA 1G3EA 1O3OA 3GCTG 5EXLA 9LPRA 1YCPK 1TMBH 1KDQB 3GICB 1EPTB 1GBAA 1W0YH 4HI3A 5ABWA 3ZZ5A 3TH2H 1HGTH 2EI7A 4WXVA 3FO8D 1GHAG 1Z8IB 1DVAH 4XBBA 4XE4A 4YTAA 1D9IA 2G51A 3MHWU 2F43B 1TA6A 1TWXB 3VB7A 1V2NT 1O2GH 5EQSA 1F0UA 3E8LA 3M36A 5EPNA 2Y81A 3N7EA 1YCPH 3UNRA 2ZDNA 1SL3A 1DUAA 4TY6A 2GZ7A 1Y3WA 3RXUA 1HCGA 1G3BA 5T6FA 4LXBH 1C2FA 1SGDE 3DFJA 2A5KA 2SGAA 3P8OA 1YPGH 1Z8GA 1AVWA 3KYFA 1CT0E 2F3CE 1P0SH 1O3GA 2UWPA 1V2TT 4IS5A 2TGAA 2WPIS 5C67A 5F53A 5DPAA 2ZTZA 4IW4E 5C20A 1C1UH 3EA9A 1FY5A 3QZQA 1EKBB 4WVPE 3KCGH 1VGCC 1O2VA 5K0HA 3H7TA 2ZCHP 1CGHA 3MU8A 3TK5A 4A1XA 3PTNA 1CHOF 2A1DB 3KHVA 1RS0A 3RXCA 6GCHF 2V7QD 1ZMNA 1TNKA 3PRBA 1JRSA 1O2QA 1B7XB 2ZU3A 3STJA 3TNSA 2ZGCA 3RXHA 4ZXXH 2Q6GA 1SFIA 4OS4A 1MTSA 5JB9S 5DSFA 4X1PU 2KM0A 4TPYA 5CMXH 2ZFTA 5T6DA 1TA2A 1NRSH 3MI4A 3ODDA 4TT3D 3TJVA 5A8YA 3M35A 1LO6A 1ZLRA 3LPRA 1GJCB 4YOIA 1BUIA 2AH4X 1GBHA 3VG8A 3KIDU 1Y5UT 1E38B 1G32B 1A5IA 1C9TA 1LPGB 2ZG0H 1W11U 1WV7H 3QGJA 1FY1A 2PWXA 3TIUA 4ZXYH 1ZPBA 3SJIA 1A7SA 2Z9KA 4FUCA 1DT2A 2VWNA 3A85A 1UMAH 5JB8S 5C17A 2ESTE 2PUQH 1FPHH 5GCHG 2FYRA 3FOAA 5IK2D 1Y3XA 1IQFA 2FODA 2C90B 1A0LA 1O2JA 4IN2A 2W7SA 1UVTH 2OC7A 1G9IE 4RKOB 5JPMH 1W0ZU 1T4UH 3T62A 4P00A 3UUZA 1HFDA 4A5TS 1DWBH 1MZAA 2A4OA 1FY4A 2BLOA 1UTKA 2DE8A 4AG2A 3ITIA 2B7DH 2AMPA 1MBMA 1YYY1 3PTBA 1A4WH 3ATMA 4AYVB 1QY6A 3BTDE 2CK3D 1EAIA 1WYKA 4KTSA 1MTWA 3RLWH 1S85A 5E2OA 2TBSA 1YPJH 3SZNA 2ZDLA 4YXWD 1SC8U 3ZV9A 3OTJE 4AN7A 2IN2A 3DT0H 2ASUB 1HJAB 2XWAA 3MH7A 4NWKA 2XNIA 2Z3DA 1A3EH 4Q4LA 2JIZD 2OP9A 3CENA 2H6MA 1H8DH 3FZDA 2H9TH 1OWKA 2ODQA 2Q1JA 3MMGA 4DOQA 3SU2A 2C4FH 2XRCA 1HIAB 2O8MA 2A5AA 2ZGJA 2ZWLH 1UCYK 4A1TA 4H4FA 3RXIA 2QE7D 1CVWH 3LGTA 5JBAS 2P8OC 1OWDA 4RI0A 4BAKB 1CQQA 3U8RH 1EATA 1S84A 2ZFPH 1G2MA 7LPRA 5JDUB 1V2UT 2XBXA 1HNEE 4ZCNA 1VCWA 3AW1A 3OX7U 1H8IH 1HB0B 3AAVA 2FI4E 3URDA 3L3TA 1P03A 2FZZA 1OP0A 3BTFE 1C5YB 2GDEH 2ZFFH 4YZUA 1GI9B 2OUAA 5LPEA 4K1TA 4ZKSU 4ISOA 1SLWB 3GYLB 4MNXA 4OS2A 2NU3E 3A86A 1FXYA 1EB2A 1OOKB 1NRRH 1GGDC 1HIAA 2P95A 7ESTE 2K8IA 4MTBA 4UFGH 3SV8A 1OWHA 1KTSB 4K1EA 4UONA 2PKSB 3M5LA 2JH6D 2XBYA 1T8OA 3PB1E 1DX5M 4JYUH 2VGCC 2FOEA 2C3SA 1A3BH 1MKXH 3OEHD 1YPHE 1XKAC 4JZFH 2ZZUH 4CR5A 1JMOH 2Y7ZA 4NWLA 4NFFA 1HJ9A 1EPTA 1C1WH 1O3HA 2FS8A 4A1VA 4X6PA 1W14U 3U1JB 2O9QA 4IGDA 3CS0A 2WSSD 2A0QB 2WYJA 1HJ8A 3DSGA 4NSVA 3SNCA 2W6ID 5HIYA 4X1SU 1MCTA 2PHBA 3SW2B 2BY8X 1OYTH 2HWLB 2A4GA 5C0UA 1OWJA 5HM9A 4FUJA 1S0RA 4UFEH 4X1RU 3RU4D 1T8MA 3O8CA 5DJ7A 4CHAB 3BSQA 1YM0A 1GJ8B 1EPTC 2W3IA 1VITF 1A0HB 1QJ7B 1S6FA 1GMCG 1EQ9A 4I8GA 1H8HD 2P94A 4HTCH 1QHRB 5GNDA 4CH8B 1F5KU 1AHTH 2O8LA 1W12U 5E2PA 5AFYH 3M7UA 4Y11E 5JBCS 4XDEA 3V7TA 4F48B 4FUEA 1AZZA 2YMSB 1O2LA 3RXMA 3E0PB 4ABJA 4B6FA 2AGEX 3P70B 5LPRA 4DT7B 4Y79A 2A31A 3GCNA 1BRBE 4I8HA 1OP8A 1Y3YA 1PQ7A 4A6LA 1DICA 1FLEE 1P57B 5C5NA 1A61H 4NIYA 2HALA 1RIWB 2R0LA 1XUFA 3A87A 1GI0A 5FXLA 2QGRA 2ZO3H 5SGAE 5TCCA 2QAAA 3A7VA 2L74A 2BY6X 3GDVA 3PO1B 2XXLA 1AIXH 5GIBA 2QXJA 4TWYA 1C1NA 3BTGE 1O5EH 1G2LA 1GJDB 3ZYDA 4HZHA 1QB9A 2WPKS 1V2ST 2BDCA 4ZHLU 3R0FA 2YNAA 3V3MA 2ZHWH 2KR7A 1RTKA 3ESTA 2R0KA 1UCYE 4MG3A 1EJAA 4ZHAA 4AFZA 2QC2A 3ODFA 2Z3CA 1ZOMA 1QR3E 2F9NA 5DN6D 1DXWA 2GCTB 3HKIB 4O9VA 3S7KB 1YPEH 2HVXA 3W1EA 1Z8RA 4X2XA 2BZ6H 1VJAU 2OC0A 4DIHH 8ESTE 1EAUA 2ZEBA 3MH6A 4BXWA 4ACAA 4GUXA 1SLXB 3M5NA 3NCLA 1O39A 1FAXA 1H1BA 4I8LA 2G8TA 3QDZB 3M61U 4ZAEA 1F92A 2PLXA 4B2CA 4O3TA 1QFKH 2BQWB 1GHAF 2OD3B 1SSXA 3UNSA 4WMEA 2ZHEH 1GBDA 2HPQH 2QN5T 1MZDA 2WV9A 1IQGA 4IN1A 3JZ1B 1WAYB 2C8WB 3U28C 3S9BA 2TIOA 4DURA 5C1YA 1EOLA 2H1UA 3A8BA 2W5EA 2Z9GA 2D8WA 3RC4A 1QURH 3F9HA 3BEFB 2VVVA 2VU8E 1OSSA 1P02A 1FJSA 5FBEA 1TRYA 1ACBE 1BTUA 4CREA 5GDSH 4X8UH 5EPYA 2ZIQH 1MTVA 1V6DA 3VEQB 1HXFH 2H5CA 1KLJH 2GCHF 4U30A 2FTMA 2Z3EA 1MTNB 4WMFA 2WINI 1TPOA 1TGSZ 3Q00A 7GCHF 1O38A 1DS2E 1ID5H 1YLCA 4AFQA 3M3VA 1OHHD 3DSPA 4ASHA 2B9LA 3B9FH 1NRQH 2VVCA 1WQSA 1BJVA 4LZ1H 2NU1E 3Q76A 1P3CA 3PLKA 1GMDF 4IMQA 1WTHD 1MD7A 3PWBA 1C2HA 5F8ZA 1MABB 3ATIA 2AYWA 1HAIH 1NRPH 1NY22 2EI6A 3HGNA 1J17T 7KMEH 4P02A 2BDAA 5K7RA 2AIQA 1VR1H 1GJ4H 2XCNA 2FIRH 4E06H 1C1TA 4Y7AA 1H9HE 5FBIA 2OCVB 3EAJA 4JK5A 3OTPA 3QK1A 2ZDVH 1TNIA 2F83A 3SBKA 1P8VC 1W8BH 1CGJE 3NK8A 1DPOA 1O37A 3FP7E 1TE0A 3SNEA 1C2JA 3TLOA 2RDEA 2OC8A 1W7GH 1TBZH 3FZZA 1K1MA 1O3CA 1UTOA 1AUJA 1DITH 2G00A 4NCYA 2BD4A 1C4Y2 3RC6A 1GMHF 5L2ZH 1QNJA 4I33A 4K2YA 1C5VA 4J1YA 1TBRH 5F6MA 1HYLA 1GHBG 2WYGA 1LVYA 1H9LB 1CT4E 4ISIH 1C5QA 2ZFQH 1G36A 1QJ1B 4U32A 5JBBS 2GTBA 4XSKU 2ZGBH 1FPCH 1ZSJA 1HXEH 4ZHMU 4A7IB 2RA0A 1H4WA 1YGCH 3DFLA 4OGYA 2FS9A 4Y0ZE 1Y3VA 1TAWA 3H09A 4BAOB 3PMJA 1EZQA 1V2JT 2XNDD 1SFQB 1E35B 3GY5A 4K5ZA 3UNQA 1T8LA 2OLGA 3B23B 7GCHG 1HAPH 1WXRA 2XYAA 1GBKA 1OX1A 2BD2A 4NZLA 1ELVA 1XUJA 1TALA 1DWEH 4GAWA 1MUEB 5FAHA 1JWTA 2JKHA 1MTNC 5KGOA 3SI4H 4AYYB 2CGAA 3KGPA 2ZDAH 3BG4B 4MDSA 2TGDA 2ZHQH 4JZDH 1XM1A 1DLKB 1O2KA 2ULLA 1AE5A 1BTWA 1LHFH 4B6EA 3BIVH 3AVZA 1MQ5A 2AMDA 3ZVBA 1TPSA 4SGBE 1GBBA 5DP3A 1VCQA 3F9GA 2ZNKH 3ZVEA 1C5PA 1O3PB 2WZQA 4H6TA 3A84A 1JOUB 1XXFA 1TNHA 4ZKRU 1BCUH 1UW7A 3HK6B 1CE5A 3I29A 3RXJA 4RT0A 3QTOH 2AS9A 4X2VA 4TWWA 5C94A 6CHAB 3PWCA 3RMMH 1FONA 1GVKB 1INCA 1UVPA 2A7CA 2ZC9H 3SNAA 4MPWA 3NWUA 4RSPA 1Z1JA 3KYGA 2XOKD 3KL6A 1L2EA 8GCHF 1SQRA 4O3UA 5KECA 3HKJB 2QF5A 1UK3A 5T1VA 1MBQA 3BTWE 1CHOG 2JJ2D 4ABAA 2J94A 4K3JA 5ETXA 2BM2A 4ASUD 4UD9H 3GCOA 1GG6B 1NTPA 3LGUA 1GI8B 2P8OB 1ZTJA 2A7JA 1V2PT 2ZDKA 1P3EA 3VFEA 1GMHG 5C0TA 2J5UA 1QL7A 2JH5D 1QCPA 1KXDA 3ENSB 3GDUA 5BRRE 1UCYH 4AGJA 5CHBA 1N8OC 3MNCA 1YBWA 2VWOA 5DKMA 1C5MD 3MNXA 2BD5A 3SU0A 3T27A 3K6YA 2HRVA 1PQ5A 1M9UA 2BTCE 1RTFB 2O8TA 5A8XA 5AF9H 1V2VT 3RXBA 5GPIB 3TJUA 1ETRH 2XC0A 2G4TA 2FI5E 1Q31A 1S6HA 2W26A 3F9EA 4Q7XA 4GPGA 4Q7YA 3UIRA 1AQ7A 2EA3A 4ZROA 1O2WA 1A1RA 3ZVAA 1SGEE 1F7ZA 1AD8H 4K8BA 2KCPA 3STIA 3M3SA 1X7AC 5TCAA 1EJNA 1D3TB 1MAXA 3E3TA 3SUEA 4WJG2 3SI3H 3BEIB 3QN7A 4FXGH 1SOTA 1FI8A 3GY7A 1ELTA 3TJNA 1C5RA 5KEDA 3PMHB 1QB6A 2GX4A 4X1NU 2FLBH 1YPKH 1FNIA 1LQEA 3NUMA 1NT1A 3SV6A 3QTVH 2FXRA 1BA8B 4I31A 1A0JA 1Z71A 2PTCE 1BMMH 4SGAE 3SU4A 5DP6A 1NU7B 2KAIA 3TK9A 1NS3A 4IC6A 3F2FA 2OQ5A 1EP6A 2SGPE 3N7OA 1W10U 1P06A 2A7HA 1NN6A 2VINA 1QB1A 1O2UA 2WUCA 1BTPA 1C5UA 3PROA 4XOJA 3PYHA 5TJXA 1SGPE 2BD3A 3VXFH 4D7GA 3C1KA 4O97A 1AKSA 1MKXK 5DP8A 3RXKA 1BDAA 1B0EA 1E0FD 1KXEA 3EE0B 1KIGH 1FY8E 1ZHRA 1VKYA 1V2LT 2CMYA 3A81A 4X2WA 6GCHG 2BY7X 4CBNA 1RRKA 5JYIA 2J9NA 1ZMJA 1KY9A 3LOXA 4AB9A 1GCDA 2VVUA 2F9OA 2VBCA 3VGCC 4AZ2B 1TQ7B 3DSOA 2HVYB 2SGEE 1D3DB 1HV7A 2RCEA 3MU5A 1BHXF 3N7DA 4M9FA 1AO5A 1IQNA 2OC1A 3LGIA 3GYMA 3BTTE 2XWBI 4LOYH 4I86A 1EZXC 1DY9A 1O2HA 2WPMS 1MD8A 2SGQE 4NA9H 4E7NA 1PYTD 4GHTA 1ANEA 3F2HA 4ABGA 4B2BA 1BTZA 1SGFA 2QA9E 2GV6A 2CXVA 2QYIA 4VGCB 1GJAB 1UTNA 3A88A 2YNBA 1TBQH 1P2MA 1BTHH 3U8TH 2VIWA 1ETTH 1VCPA 3FP6E 1GJ9B 3OAAD 5G4BA 1GDQA 1ZR0A 2GGVB 3BTME 3P8GA 3U1IB 1A2CH 1QZ8A 1XUGA 3URCA 5L2YH 3SUGA 4D7FA 3UR9A 1E37B 2Z9IA 2UWOA 1LQDB 4CRBA 3SU6A 5FPSA 1N6XA 1SQOA 1P04A 2PSXA 2JETB 1GI7B 1SPJA 2ANKH 1QBVH 6LPRA 1O2TA 2FO9A 2J92A 2UUJB 3M37A 1QA7A 1V2MT 1TMUH 2OXSA 1VITG 1BTXA 5A0CA 3GISB 4CR9A 3EGKH 2ZTXA 4FUDA 2ZKSA 3RXLA 1O2MA 2Y5HA 4KGAA 4MPUA 4HGCA 1SHYA 1ABJH 4NG9H 2PUXB 1GJ7B 4CH2B 4WY3A 4YT7H 5FX6A 2C8XB 3RXPA 1GI4A 2LPRA 1MU6B 3LDXH 2VNTA 1GBMA 1GDUA 1PPHE 2GZ8A 4KKDA 5EW2H 1BRCE 2Y5FA 3VXEH 2C93B 4R0IA 3IITA 3FVFB 1LKAA 2HLCA 4GSOA 2BMGB 1HAYB 4E05H 1THPB 2ZF0H 4D8NA 3UFAA 1BQYA 1THSH 1TLDA 3E91A 2XBVA 2K1QA 1RIWC 4BNRA 2R9PA 2ZI2H 1K22H 1GI1A 3BF6H 4OM9A 1QL9A 1AFEH 3GY8A 1E36B 3SOSA 3QGNB 3EA8A 2BQ7B 1ELFA 1ZHMA 1SGQE 1AB9C 5HGGA 2ZQ1A 3U8OH 4BANB 2D26C 1KXFA 4WXIA 3M3TA 3S69A 3MFJA 1TQ0B 4DT4A 2IOTA 4JZIA 1UVOA 3PO1C 2SGDE 2AFQB 1ABIH 1FIZA 6ESTA 5HXFA 2ZCLP 1EX3A 3SJ8A 1D6WA 1GJ5H 1RJXB 3PMAB 2F9BH 2HNTE 1LKBA 1JIMA 2VB0A 1BJUA 1A5HA 2BVSH 2WUBA 2NU4E 1HAZB 5EXMA 4F55A 2BQ6B 3A80A 1TGNA 3SUFA 1K2I1 3UPEA 5L30H 1NFUA 2QV1A 5F03A 1L1NA 1J14A 5HMAA 1CU1A 3WWBA 4X8VH 1NU9A 4FU7A 2ALPA 4X1QU 3TH4H 5JBTA 4WMDA 1NBME 1SR5C 5DO4H 1BBRH 1EFRD 1O5DH 1UJ1A 2G5VA 1AFQC 2RFKC 3PV4A 1QBNA 1J15A 1TNGA 2QF4A 2V3MA 1OWIA 2V6NA 5HIZA 1O3MA 1P01A 3A8CA 2Q6FA 4FUHA 1ETSH 1P2KA 2ZPQA 4INLA 1WSSH 1XX9A 1P2QA 2Z6BD 4ISNA 3FFGA 1QQ4A 1TGBA 1GBCA 1GBIA 3I77A 1SGIB 3KEEA 4Q80A 5DK1A 5E0JA 1DANH 2PV9B 3MU0A 1K1JA 1GI6A 3H5CB 2CV3A 1AKSB 3BIUH 2PR3A 1C5WB 1C2EA 1GBJA 1KDQA 3PV2A 5EGMA 1ARBA 3MYWA 1PPFE 2W6JD 3MO9A 3T26A 3SGAE 2K0QA 3RP2A 1S82A 2Z9JA 1C5SA 1YP9A 2KZ4A 1EZUC 1CBWC 3DA9B 3LH3A 4JCNA 3D23A 4TSFD 1O35A 4FUBA 3V12A 4FOUC 2EQNA 4D76A 1E1QD 4ABHA 1FDPA 1IQHA 1C1PA 3LONA 2A2QH 3UQOA 2AIPA 3A7YA 2EI8A 2R2MB 2KCYA 2BX3A 1G3CA 4KTUA 1U6QA 1TONA 3HATH 4UE7H 3RXAA 1C1OA 3D49H 1QGFA 1PPGE 1YC0A 2ZHDA 2FOBA 2XW9A 4YLQH 2GJGA 3BTHE 1GJBB 1LHEH 1FV9A 2OTVA 3SNBA 1TNJA 1LTOA 1OS8A 2XTTB 3A8DA 3LGVA 1YLNA 1MU8B 3MNBA 8LPRA 3FAOA 2FOHA 1OWEA 3P95A 3NKKA 3ZIAD 3A7ZA 3GDSA 1EJMA 1QA0A 2VIOA 4K8YA 4LZ4B 1P10A 4RN6A 4QT8C 4Q7ZA 1MTUA 1ZJDA 1E1RD 3ZV8A 1XUHA 2G5NA 4FUFA 4NFEA 3RM2H 1IQLA 2I6SA 2C8ZB 1TOMH 2QXGA 1YPMH 2R2WU 1DXPA 1LPKB 1NM6A 2V3HH 4BAQB 1QJ6B 2RDLA 4ESTE 1O2ZA 1RD3B 5BPEA 3SU3A 1W0JD 1ZTKA 1NO9H 2V3OH 1HUTH 1BITA 1Q3XA 1NZQH 1F5LA 2PTNA 4WWYA 1P12E 1AE8H 3T25A 1LVMA 3BEUA 1ZRKA 4NGAH 1TNLA 2A5IA 4JZEH 2VIQA 6CHAC 1O3LA 1WTGH 3MH5A 1O3AA 1DE7H 1UTLM 2R3YA 1K1LA 3OEED 1O36A 2H5DA 4B75A 5CE1A 1KTTB 2ZGXH 3LC3A 4FUGA 5GJ4B 2ZFRH 8GCHG 4FETA 1AU8A 1BOQA 1BTYA 4GCHG 1T31A 1LHDH 3F0OA 3V13A 3K65B 4AORA 2VJ1A 4OGXA 2BYAX 4K60A 5GXPA 3IG6B 2A32A 3AW0A 1BRAA 4NA7A 4CRCA 1GBLA 4GHQA 1F2SE 1SGCA 3PV5A 3L33A 3RXEA 3R3GB 2NU0E 2UUYA 5DP4A 4HFPB 1ZPZA 3LIWA 1Y3UA 1ELBA 1UVSH 4MPXA 5FCKA 4Y76A 5C5OA 4IBLH 1SLUB 4BTUB 3UB0A 2ODYB 3Q3YA 2FPZA 1P09A 1QQUA 4X8TH 2BOHB 1HPGA 4R8TB 5E0HA 4Z6AH 2M2AA 3W94A 2UUFB 3BTQE 1EAXA 1GBFA 1IAUA 2F91A 4LK4A 4ABFA 3ZZAA 4JYVH 3KF2A 2BLQA 1JBUH 2A4QA 1AVXA 2EEKA 1DLEA 2ZA5A 2VWLA 1BB0B 2WPJS 1IQIA 1C2IA 3ZZ8A 4YLUA 4YESB 3L6PA 1B5GH 1SB1H 4K69A 2ZU5A 1NFXA 2XCFA 1QL8A 3UWIA 4GLYA 2J2UA 5HYOA 1BHXB 4YT6H 3RU4E 3QO6A 1EASA 3TH3H 3RM0H 1Z6EA 3SYJA 5DP9A 3RXGA 3GOVB 2OK5A 1PPBH 2WV5A 2TGPZ 1K1IA 3A83A 4NA8A 1FUJA 2FEQH 4UDWH 2ILNA 1G37A 2CHAC 5ESBA 2GD4B 5B6LA 3K6ZA 4H42U 2O8WA 1O33A 3AAUA 1ELGA 1TRMA 2BDIA 1KLIH 1ZZZA 1XUKA 1ZRBA 5E8EH 3DHKH 3S0NA 3MO3A 3UY9A 5EIYA 1TX6A 1HAHH 1AY6H 3FANA 3CP7A 1XVMA 3VB5A 5B6OA 4NZQA 3ZVGA 2GDDA 1THRH 4I8JA 1UO6A 8KME2 1DWCH 4WF8A 1RGQA 3BG4C 2B0FA 2G81E 2PKAB 3E6PH 3QLPH 1V2WT 3UWJH 3NPSA 3PM3A 3RXOA 5LPFA 3ZZ4A 4DY7B 2DUCA 4ABEA 1D3QB 3TK6A 3A7XA 4DGJA 1GJ6A 1Y8TA 4F4OC 4AG1A 4Y0YE 4INHA 1C5TA 1JXPA 2TGTA 3UREA 1O2IA 3KQDA 4YM9A 3PRDA 1HAVA 1O5CB 3OY5U 1Q2WA 3RMNH 1XUIA 3ZZBA 1O2PA 4CRFA 2OBQA 5FX5A 4DJZB 3KQ5A 1C1VH 3BV9B 4JYTA 1MKWK 4HG6A 2L6OA 1AN1E 1ZMLA 1TFXA 5F8XA 1O3KA 2CN0H 2J98B 4X8SH 2HLDD 3GCHB 3UTUH 2BY5X 3FN8A 3SJOA 4BTIB 1O31A 4FU9A 5J4SA 5EJZA 1CBWB 3RU4T 3MH4A 4Z0KA 3LJJA 1WQVH 1W2KH 1N1LA 2PSYA 2A45B 1C2GA 4XD7D
chains in the Genus database with same CATH topology
1BMNH 1WBGB 4CBOA 4VGCC 4ZKNU 1K28D 2LNCA 2QCYA 3LU9B 1C2MA 1AUTC 2R3UA 2A4RA 4E7RG 1HDTH 4X0WU 2AERH 1Z8JB 1EUFA 1CT2E 2FOCA 3QUMP 1V2OT 1UHBA 4ABBA 2OQUA 2BHGA 1GHZA 5EODA 1K1OA 4Q2KA 1O3NA 3MU4A 1G30B 1PQ8A 1NC6A 5E0GA 4ZMAH 1AI8H 1GHVH 3ATWA 3E16B 2XC5A 4OS7A 3W95A 5I25A 4BXSA 1Y5AT 3F9FA 1L4ZA 3KN2A 4MNYA 1CO7E 3TGKE 1QTFA 3DUXH 3V0XA 1GPZA 1P2OA 3GY3A 2FWWA 1ZSLA 1CHGA 1JIRA 2ZTYA 1NPMA 1GI3A 2FYQA 2GV7A 1S83A 1C1RA 3VB6A 1O3DA 1LVOA 1HAOH 3ZZ6A 4JZ1A 5C1UA 4OS5A 3LKWA 3S9CA 3S7HB 1ELCA 1IQMA 2FDAA 1OXGA 1DSUA 4DW2U 2GT8A 3RLYH 4B73A 4MQAA 5DP5A 2AEIH 2NWNA 1DWDH 2THFB 3HPTB 1W3CA 1O34A 1DSTA 4B76A 1XXDA 2UUKB 4ZUHA 3EYDA 4DIIH 1GI5A 1O2SA 1IOEA 1YPHC 4Y7BA 2ZGHA 1GBEA 2P16A 4Y10E 4I32A 3RXFA 1OKXA 1F0SA 2HGTH 2DE9A 1ESAA 3S9AA 1W13U 1DFPA 2ANMH 1GDNA 1UTQA 1AVGH 1C4U2 3PLPA 2QY0B 4X2YA 3QZRA 1K1PA 3A8AA 1V2QT 2C8YB 1GWAA 1O3JA 1O3EA 4FUIA 4MNVA 3LJOA 1J8AA 3LGWA 4I8KA 2HPPH 1CGIE 5EQRA 2PFEA 1P2JA 3VGCB 1C9PA 1T32A 2GZ9A 1ZTLA 2P3FH 3UQVA 1DM4B 1CA8B 1DY8A 1GL0E 1UTPA 2BX4A 2J38A 5AHGH 3UOUA 2CF8H 3GY4A 3T29A 1C2KA 1MMJN 3ZZDA 1F0RA 4A92A 1TOCB 2PGBB 4ISLA 4XBCA 1OPHB 3RXSA 2F9VA 5T3HA 2BDHA 5A0BA 2F9UA 2IJOB 3Q3KA 4O03A 1IHTH 2J34A 1UVUH 3GCTF 1O30A 2FOAA 2H9EH 1NRNH 5H4IB 2Y5GA 3ZZ9A 1ZGIA 2BXUH 2AGIX 4KP0A 3TNTA 1SQAA 3AASA 1SGFG 2Y7XA 2SNVA 1K21H 1KYNA 2V35A 2P3TB 3M7QA 1NFWA 4NIXA 3D62A 1KXAA 2CF9H 4Y8ZA 1NESE 3SV2H 1O32A 4DG4A 1AWFH 5FHTA 2ZHFH 3O8DA 3TPIZ 2D1JA 4B1TA 2ZU4A 1UTMA 3ZYEA 2Z9LA 3HGPA 3SJKA 2KAIB 1O5FH 3SORA 1O2YA 5FCRA 1L0ZA 1H9IE 2XBWA 3UR6A 1HRTH 3KQCA 3RUOA 1CA0B 1MCVA 5I46H 1ORFA 5AFZH 4YOJA 1ELAA 3ATLA 3RXRA 2PGQB 1AGJA 1B0FA 2W7UA 2BDBA 2G52A 4WH6A 4KTCA 3BTKE 2F9PA 1FY3A 2CHAB 3NZIA 4AFUA 4FU8A 1PPEE 2H9HA 1GL1A 1AB9B 4MPVA 3BG8A 2HNTC 2ZFSA 3ZVDA 3I78A 1HAGE 3T28A 1P11E 4CRGA 1XVOA 5FPTA 4B71A 1AZ8A 5C3NA 2GKVE 3SO3A 3SU1A 2PKAA 2PW8H 4FVDA 3E90B 4INKA 2WPHS 2SFAA 1VITH 2RA3A 2ZQ2A 1SBWA 4BAMB 2BLWA 1O0DH 2H2ZA 4ABIA 4AB8A 3PLBA 1O5BB 3OU0A 1OYQA 4Y6DA 4U2WA 2GVFA 1AFQB 2QF0A 3SN8A 4XFQA 1FN8A 2G55A 1J9CH 2I6QA 2BD8A 5A0AE 5EU8A 1BMAA 1LVBA 1SLVB 1SG8B 3D65E 1WU1A 1FQ3A 4X6NA 5LGOA 4MNWA 4UEHH 2QF3A 1SMFE 3T2NA 1GG6C 1C2DA 3KQEA 1L4DA 5LH8A 3P17H 2BD7A 4Y8XA 4KELA 3A82A 5GWZA 1BT7A 2QXHA 3SQHE 1O5GH 1QIXB 1TPAE 2VGCB 1BMLA 1SGTA 1D4PB 5A8ZA 1EB1H 2CJIA 5CHAC 1PPCE 2EC9H 1VJ9U 2BB4A 4IMZA 3F1SB 2RG3A 1S81A 2ZPSA 1C1SA 5F8TA 2AGGX 1N8OB 2VIPA 2SNWA 2FM2A 2Y80A 2NU2E 1L1JA 3DD2H 1TX7A 3TGJE 3OYPA 5A09A 3RDZA 1GI2A 2Y82A 3ZVFA 1K9OE 1GMCF 1TGTA 1QRZA 2FOMB 4Y8YA 4AOQA 4ABDA 1ZGVA 1CSOE 1HBTH 1GCTC 1MQ6A 5L6NH 2ALVA 1Z6JH 1GBTA 3K2UA 2FESH 5GCHF 1E34B 4IC5A 1P9UA 1KXBA 1SGRE 2ZDMA 5EXNA 3M5MA 3A7WA 1LDTT 5C1XA 4JK6A 4UFFH 1EOJA 1GHYH 1QBOA 3Q3XA 2P93A 3QX5H 3SGQE 1WCZA 2D2DA 3U69H 1LHGH 2A2XH 3SV9A 1LPZB 3O8BA 3ZZ7A 3H7OA 4AGKA 3EDXB 4K1SA 1BBRE 3FP8E 4ISHH 3C27B 1ZJKA 1JRTA 1V2KT 1UTJA 1ESTA 2BOKA 4CHAC 1OP2A 1C1QA 2VWMA 2AMQA 3VB3A 1T7CA 1G3DA 3SU5A 4CRAA 4TYDA 1LHCH 2ZU1A 1LMWB 2GMTB 1ANBA 3SGBE 2P59A 1AMHA 3SHAH 1DUEA 2BXTH 1DDJA 3GY6A 1PJPA 1J16A 1ELDE 3RC5A 1HAXB 4U01A 5FPYA 4M7GA 1TMTH 2VH6A 1O3IA 3P8NA 2ZP0H 1S0QA 1TRNA 3MNSA 1K1NA 3T5FH 1TABE 5EOKA 2ANWA 1V2RT 1UK4A 1PFXC 1Y59T 1O2OA 3KNXA 4UFDH 4OS6A 3RMLH 1SGNE 1ZSKA 4J2YB 1VGCB 1MH0A 3RXVA 1SOZA 2PKSC 2VIDA 3PMBB 3NXPA 5DGJA 2FP7B 1C5ZB 2OINA 1ZHPA 4H6SB 3KQBA 4BAHB 3P92A 1L1GA 3VB4A 3ZVCA 1O2NA 3M7TA 3MWIU 1FMGA 4RKJB 3G01A 2W3KA 1PQAA 2SGFE 2J95A 1FAKH 3ATKA 1RFNA 2BZAA 2XC4A 2ANYA 1CA0C 1SVPA 3E0NB 1ANCA 3RXTA 1VZQH 3SNDA 1Y5BT 1O2RA 1V3XA 2FOFA 1D3PB 3MO6A 1IHSH 1T4VH 1EP5A 2BDYA 1NROH 1Z1IA 2OBOA 1GMDG 1XMNB 3B8JA 3EQ0H 3MTYA 3GY2A 1TX8A 1MKWH 1TYNA 1YCPM 1QRWA 2IPHA 2GCTC 2HOBA 1GCTB 1EAWA 2FOGA 1T8NA 4FVBA 3U98H 1AWHB 4XBDA 1FZZA 3JZ2B 3SUDA 3TVJB 1YKTA 3TITA 5EQQA 1RTLA 1SQTA 1C5LH 1O5AB 2FLRH 4DVAU 1ARCA 5C2ZA 2BDGA 3ELAH 3ZZCA 9ESTA 1SI5H 2STBE 1LCYA 1Z7KA 1SGYE 2JETC 4ZKOU 4TY7A 5J4QA 4MVNA 4CRDA 1GHBF 3O8RA 1TB6H 3A89A 2ZU2A 2UWLA 1MAYA 1ANDA 3LGYA 3M5OA 1S5SA 2ZCKP 1BZXE 1IQKA 2BY9X 4X6OA 1KXCA 4MLFB 1UHBB 2Z7FE 5T6GA 1GVLA 4BTTB 3TJOA 2P3UB 3GCHC 3SJ9A 4AX9H 3P8FA 3SV7A 1W7XH 2WPLS 4D9RA 1GVZA 3IWMA 1BRUP 1P2NA 2O8UA 2G4UA 1WOFA 2GP9B 3HK3B 2FX6A 3RMOH 3E1XB 2ZPRA 2M5TA 2GT7A 1C5XB 3LH1A 3RXQA 2FTLE 1O2XA 1IQEA 1YLDA 3A7TA 4WH8A 4ZH8A 3WY8A 5EW1H 3MOCA 5IYTA 4NIVA 4Y71A 1F5RA 2JH0D 4OS1A 3QWCH 2V0BA 4GCHF 1IQJA 3OSYA 2TPIZ 1A5GH 1KSNA 2QXIA 1FN6A 3EA7A 1EXFA 1FIWA 5AVDA 2VH0A 1WUNH 2B8OH 1DOJA 3F68H 1ZPCA 1HAVB 2GMTC 2QIQA 1YF4A 5ESTE 3MU1A 1C2LA 4D9QA 1QRXA 1TIOA 2Y6TA 4NIWA 1P05A 4NSYA 2Q6DA 1SHHB 2VIVA 1GHWH 1O3BA 1C5NH 1ESBA 2BVXH 5EG4A 1P2IA 4AFSA 4THNH 1YPLH 4BOHA 2FMJA 1BIOA 3Q77A 3TU7H 1GGDB 1UK2A 1HLTH 1ZYOA 3CS7A 1RXPA 1C4V2 2BD9A 1C5OH 1GHXH 2ZECA 1PYTC 1EZSC 4GVUA 4PROA 4TPIZ 3F6UH 2FI3E 1A46H 1ELEE 3RXDA 1XKBC 1F0TA 2J4IA 3U9AH 4I7YH 2FX4A 3UOPA 5CHAB 1PPZA 4YOGA 4B74A 1TGCA 5DP7A 4F49A 4B2AA 1KLTA 5A2MH 1P9SA 3ZZ3A 2YOLA 2WV4A 4YO9A 1N6YA 3SHCH 2BVRH 3OY6U 5DG6A 2GCHG 2B5TB 1NFYA 1BBRK 5IDKA 1TPPA 2HNTF 1O3FA 2ODPA 3TGIE 2TRMA 3P6ZB 4JMYA 3BTEE 1C1MA 3LT3A 5HM2A 3BN9A 1D6RA 4X6MA 2BLVA 5PTPA 2STAE 3LC5A 3VPKA 3SQEE 2Z94A 1HJAC 3K9XB 4DCDA 1G3EA 1O3OA 3GCTG 5EXLA 9LPRA 1YCPK 1TMBH 1KDQB 3GICB 1EPTB 1GBAA 1W0YH 4HI3A 5ABWA 3ZZ5A 3TH2H 1HGTH 2EI7A 4WXVA 1GHAG 1Z8IB 1DVAH 4XBBA 4XE4A 4YTAA 1D9IA 2G51A 3MHWU 1TA6A 1TWXB 3VB7A 1V2NT 1O2GH 5EQSA 1F0UA 3E8LA 3M36A 5EPNA 2Y81A 1YCPH 3UNRA 2ZDNA 1SL3A 1DUAA 4TY6A 2GZ7A 1Y3WA 3RXUA 1HCGA 1G3BA 5T6FA 4LXBH 1C2FA 1SGDE 3DFJA 2A5KA 2SGAA 3P8OA 1YPGH 1Z8GA 1AVWA 1CT0E 2F3CE 1P0SH 1O3GA 2UWPA 1V2TT 4IS5A 2TGAA 2WPIS 5C67A 5DPAA 2ZTZA 4IW4E 5C20A 1C1UH 3EA9A 1FY5A 3QZQA 1EKBB 4WVPE 3KCGH 1VGCC 1O2VA 5K0HA 3H7TA 2ZCHP 1CGHA 3MU8A 3TK5A 4A1XA 3PTNA 1CHOF 2A1DB 3KHVA 1RS0A 3RXCA 6GCHF 1ZMNA 1TNKA 1JRSA 1O2QA 1B7XB 2ZU3A 3STJA 3TNSA 2ZGCA 3RXHA 4ZXXH 2Q6GA 1SFIA 4OS4A 1MTSA 5JB9S 4X1PU 4TPYA 5CMXH 2ZFTA 5T6DA 1TA2A 1NRSH 3MI4A 3ODDA 3TJVA 5A8YA 3M35A 1LO6A 1ZLRA 3LPRA 1GJCB 4YOIA 1BUIA 2AH4X 1GBHA 3KIDU 1Y5UT 1E38B 1G32B 1A5IA 1C9TA 1LPGB 2ZG0H 1W11U 1WV7H 3QGJA 1FY1A 2PWXA 3TIUA 4ZXYH 1ZPBA 3SJIA 1A7SA 2Z9KA 4FUCA 1DT2A 2VWNA 3A85A 1UMAH 5JB8S 2ESTE 2PUQH 1FPHH 5GCHG 2FYRA 1Y3XA 1IQFA 2FODA 2C90B 1A0LA 1O2JA 4IN2A 2W7SA 1UVTH 2OC7A 1G9IE 4RKOB 5JPMH 1W0ZU 1T4UH 3T62A 3UUZA 1HFDA 4A5TS 1DWBH 1MZAA 2A4OA 1FY4A 2BLOA 1UTKA 2DE8A 4AG2A 3ITIA 2B7DH 2AMPA 1MBMA 1YYY1 3PTBA 1A4WH 3ATMA 4AYVB 1QY6A 3BTDE 1EAIA 1WYKA 4KTSA 1MTWA 3RLWH 1S85A 5E2OA 2TBSA 1YPJH 3SZNA 2ZDLA 1SC8U 3ZV9A 3OTJE 4AN7A 2IN2A 3DT0H 2ASUB 1HJAB 2XWAA 3MH7A 4NWKA 2XNIA 2Z3DA 1A3EH 2OP9A 3CENA 2H6MA 1H8DH 3FZDA 2H9TH 1OWKA 2ODQA 2Q1JA 3MMGA 4DOQA 3SU2A 2C4FH 2XRCA 1HIAB 2O8MA 2A5AA 2ZGJA 2ZWLH 1UCYK 4A1TA 4H4FA 3RXIA 1CVWH 3LGTA 5JBAS 2P8OC 1OWDA 4BAKB 1CQQA 3U8RH 1EATA 1S84A 2ZFPH 1G2MA 7LPRA 5JDUB 1V2UT 2XBXA 1HNEE 1VCWA 3AW1A 3OX7U 1H8IH 1HB0B 3AAVA 2FI4E 3URDA 3L3TA 1P03A 2FZZA 1OP0A 3BTFE 1C5YB 2GDEH 2ZFFH 4YZUA 1GI9B 2OUAA 5LPEA 4K1TA 4ZKSU 4ISOA 1SLWB 3GYLB 4MNXA 4OS2A 2NU3E 3A86A 1FXYA 1EB2A 1OOKB 1NRRH 1GGDC 1HIAA 2P95A 7ESTE 4UFGH 4MTBA 3SV8A 1OWHA 1KTSB 4K1EA 4UONA 2PKSB 3M5LA 2JH6D 2XBYA 1T8OA 3PB1E 1DX5M 4JYUH 2VGCC 2FOEA 2C3SA 1A3BH 1MKXH 1YPHE 1XKAC 4JZFH 2ZZUH 4CR5A 1JMOH 2Y7ZA 4NWLA 4NFFA 1HJ9A 1EPTA 1C1WH 1O3HA 2FS8A 4A1VA 4X6PA 1W14U 3U1JB 2O9QA 4IGDA 3CS0A 2A0QB 2WYJA 1HJ8A 3SNCA 4NSVA 4X1SU 1MCTA 2PHBA 3SW2B 2BY8X 1OYTH 2HWLB 2A4GA 1OWJA 5HM9A 4FUJA 1S0RA 4UFEH 4X1RU 3RU4D 1T8MA 3O8CA 5DJ7A 4CHAB 3BSQA 1YM0A 1GJ8B 1EPTC 2W3IA 1VITF 1A0HB 1QJ7B 1S6FA 1GMCG 1EQ9A 4I8GA 2P94A 4HTCH 1QHRB 4CH8B 1F5KU 1AHTH 2O8LA 1W12U 5E2PA 5AFYH 3M7UA 4Y11E 5JBCS 4XDEA 3V7TA 4FUEA 1AZZA 1O2LA 3RXMA 3E0PB 4ABJA 2AGEX 3P70B 5LPRA 4DT7B 4Y79A 2A31A 3GCNA 1BRBE 4I8HA 1OP8A 1Y3YA 1PQ7A 4A6LA 1DICA 1FLEE 1P57B 5C5NA 1A61H 4NIYA 2HALA 1RIWB 2R0LA