3SGAE

Structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
181
structure length
181
Chain Sequence
b'IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE A (SGPA)
publication title Structures of product and inhibitor complexes of Streptomyces griseus protease A at 1.8 A resolution. A model for serine protease catalysis.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1990-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgaE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgaE01
1CU1A 1HJAB 3ELAH 3GCHC 1GBBA 3LOXA 4Q2KA 4ISIH 5C2ZA 4UFGH 5F03A 2J9NA 1NRSH 4NFFA 3S0NA 2DE8A 1C1SA 1GBLA 4I7YH 1QBNA 2OINA 2QN5T 3PMJA 1OYQA 4D7GA 1F2SE 5J4SA 3QTVH 1HAXB 3TH2H 3AVZA 4INLA 3T62A 2FEQH 3O8BA 5GCHF 1NFXA 4QT8C 1PPFE 2G5VA 3BN9A 4BXSA 2O8TA 4MNYA 5HYOA 5C1UA 1T8OA 2BDAA 2EI6A 1C2DA 5CE1A 1HNEE 4GUXA 3URCA 1ZPBA 3GYLB 1O31A 2KAIA 2P8OC 1XUJA 1AKSB 1O3MA 1Q31A 4WMDA 5JBAS 3BG4C 5FPSA 2W7SA 1C1TA 3KQCA 1W11U 3F9GA 2ZU5A 3PWCA 4ABFA 2BZ6H 2R2MB 1XX9A 2UWOA 1CO7E 2WPKS 1O3DA 1A3BH 5F8TA 1O36A 3MU1A 3RXLA 4X8SH 1DLKB 2H9TH 1C5WB 1MKXH 1UCYH 1D3QB 2VIPA 1JBUH 2ZGXH 4INKA 1T32A 1P12E 2EI8A 2ZWLH 3W94A 4KELA 3ZZ7A 1UVUH 4TWWA 1W3CA 3GCNA 2H2ZA 1B7XB 4ISHH 5EXNA 3NUMA 2R3YA 1UCYE 4GVUA 1ZJDA 2BDCA 2WYJA 1TA6A 2GZ9A 1CHOF 5LH8A 4UEHH 1BTZA 1O2LA 2ZCHP 3VPKA 3PO1C 1A61H 1AWFH 2AERH 1E0FD 1EZSC 1CQQA 3P17H 4X6MA 3GCOA 3U98H 1S81A 2ZCLP 3SHCH 1SGIB 3FANA 1YPJH 3U1IB 5L2ZH 1FMGA 1HJAC 3M3VA 4DGJA 1BQYA 3M5LA 2RDLA 1OPHB 1XUHA 1WQVH 1SMFE 1SR5C 1TGCA 1MAYA 1P09A 4X1PU 1OWHA 3STJA 1AE8H 1GI3A 4X6PA 3SU4A 2J4IA 1ZMJA 4NA8A 2XW9A 2AMQA 4F4OC 1C4Y2 1C5LH 1XKBC 2AEIH 3RXIA 4MNVA 1SGFA 4HTCH 4Y7AA 4ZROA 3UPEA 3SJ9A 2HNTE 2GKVE 2J95A 4NG9H 4UD9H 4MQAA 1OX1A 4MG3A 4RN6A 3SQHE 1KDQB 3T27A 3ESTA 4VGCB 1P11E 4CBNA 1AE5A 5HMAA 3ZZBA 1JMOH 4A6LA 3RXVA 4AYYB 1O2OA 1FN8A 1FZZA 1V2VT 2F9VA 4IMQA 4ABBA 4BAKB 1TMUH 3M61U 2FPZA 3TJNA 3U69H 4WVPE 3K6ZA 1DSUA 2XRCA 1ZHPA 1OP2A 2W7UA 3RLYH 2BX3A 5FBEA 1YLDA 3P8OA 1FY8E 7KMEH 4ZKNU 1O32A 3QDZB 4ZKSU 1Q3XA 5TCCA 4YT7H 1UVOA 3RXKA 1O3PB 1VITG 1SQAA 2SGPE 1P2KA 2Z3CA 2GX4A 4BAQB 1AD8H 1DLEA 3SQEE 2Z6BD 1TX7A 2A4GA 2BVRH 1AUTC 3RU4T 3UOUA 3UY9A 1K1IA 4AX9H 3M36A 1P0SH 1C2EA 1GHXH 5K7RA 4JYVH 1EAIA 1FY5A 2ZHQH 3SNCA 1C1MA 3M7UA 1GMDG 1S83A 2D26C 1TRYA 1UTMA 2W3KA 4R0IA 1H9LB 1H8IH 3LPRA 1C5UA 2BY9X 4Y11E 1UK2A 1Y3VA 1L0ZA 2TGAA 4NSYA 4Q80A 1CBWB 1A0JA 1MTUA 3BSQA 4AFZA 3FAOA 1TNHA 1Y5UT 2PV9B 2W26A 1C5OH 1ID5H 3T28A 1AY6H 1G2LA 3GYMA 3ZZ6A 2FESH 4ABGA 2THFB 2QCYA 1SFQB 2OQUA 4Y8YA 1EPTC 2FS8A 3BG8A 4YM9A 3TPIZ 3UQVA 2Z9GA 1ZTKA 2FWWA 2OCVB 2ZFTA 3QZRA 1DWDH 1GJ4H 4E7NA 3UREA 3ODDA 3QUMP 3MYWA 1BITA 5HM9A 1SGFG 5ABWA 3SU6A 1S0RA 4OS4A 1PQAA 2WPLS 4FVBA 7GCHF 2QAAA 1PJPA 3KQEA 5FPTA 5C5OA 2J94A 5DK1A 5L6NH 1E36B 4CRCA 3SU5A 3ZYEA 1C9TA 5GJ4B 1C1RA 2GCTB 2VIVA 2AMPA 2OC8A 4IC5A 1DS2E 4NA9H 4UFDH 2ZDKA 1LVBA 1V3XA 1UO6A 1BT7A 1XXFA 1EP5A 3MNSA 1QQUA 4ZMAH 1G3EA 2ALPA 4B73A 1A7SA 4OS6A 3MH5A 4BANB 2BHGA 7ESTE 5EQRA 4RKOB 3P70B 3PMAB 2PGQB 3A7YA 2BVXH 2Q1JA 3SN8A 1K2I1 1HRTH 2ESTE 3F9FA 2WV5A 3VFEA 1GHVH 1KXEA 1ZGIA 1MMJN 5DG6A 3L3TA 4IN2A 2GT7A 3MTYA 1PQ8A 3TGJE 5DP3A 2ZNKH 1ELBA 1LMWB 3VB4A 1EAUA 1KXFA 1RTFB 2C8WB 1FIZA 8GCHG 3RU4D 1O3EA 1QR3E 2SNVA 1QFKH 1ZLRA 1QY6A 2G5NA 3RM2H 5FXLA 3JZ1B 2HALA 3TGKE 2FOGA 1UTPA 3AAUA 1L4DA 3MHWU 1P57B 4JMYA 6LPRA 3GICB 4DW2U 3RXJA 1N6XA 5FHTA 3BTME 3S7KB 2F9OA 1O2HA 1XUKA 2GMTB 2ULLA 2CV3A 1O30A 1LCYA 2ZU2A 2VH0A 4X8UH 3MNBA 1K28D 1SLXB 4A1VA 4DVAU 2C93B 3VXEH 4WY3A 1QA7A 1Y3WA 3D23A 1DPOA 1FUJA 1GBIA 1IHSH 1YLCA 3ZVBA 1GBEA 1HAGE 3ZZ4A 1F5KU 3DUXH 3KHVA 4X1RU 2CHAB 3BTQE 4Y71A 2G00A 3AAVA 1T8MA 5IDKA 2A0QB 5DPAA 3TH4H 1MCVA 4I8KA 1LHDH 4X8TH 5GIBA 1YCPM 3BTTE 1DDJA 2R0LA 2GCTC 2UWPA 1CE5A 1FQ3A 2ZGJA 1GHBG 4GLYA 1TNLA 2B9LA 1VJ9U 1O3NA 1O3JA 1G3CA 2VIQA 4K5ZA 2BOKA 1Z8JB 3RXSA 4ABAA 1DXWA 3D65E 2ZFPH 1O2JA 2FXRA 5E0GA 4U01A 3RXQA 1O3IA 1ZSLA 2GV6A 3A88A 4OS1A 4B74A 2YOLA 1C5RA 1GCDA 3QK1A 3A7WA 2A7JA 4UE7H 2WPHS 3M35A 1ZHMA 1Z1JA 1Z7KA 1SLVB 3MI4A 3ZV9A 1AB9B 3U8TH 4YOIA 2VH6A 2SGAA 1UVSH 4MPXA 1UK4A 1DUAA 3GY6A 2JH6D 4FUHA 2P94A 3I78A 1X7AC 3OYPA 4K1SA 1MD8A 4AORA 1AVWA 1RTLA 2O8MA 3GDSA 2QXJA 3KEEA 5CHAB 1YPLH 1SG8B 1D9IA 3NXPA 4D9QA 1CHOG 3OX7U 1EQ9A 1QL9A 3TK6A 3OTJE 1B0FA 1C9PA 1S82A 3CENA 2GTBA 3A8AA 3U9AH 1KXAA 1QIXB 2OBOA 3MH6A 1GVLA 2R0KA 4FUBA 1N8OB 4E05H 2TGTA 3M7QA 1QGFA 4GAWA 1TPPA 1XMNB 4HFPB 9ESTA 2BDBA 1ETTH 1C2FA 1MKXK 1UCYK 1TABE 1Q2WA 3FFGA 1A3EH 1T8NA 1MCTA 1P03A 3TNSA 1QB1A 1C5XB 3DT0H 2GMTC 1FLEE 2FOBA 1P2NA 1MD7A 1TALA 2CJIA 1SHYA 3LC5A 1S84A 1W10U 2FYRA 1E38B 3VGCB 1PFXC 1V6DA 3F1SB 3CS0A 2VIOA 4TPIZ 1W13U 1Z8GA 1HUTH 4B1TA 1DXPA 1WYKA 2CHAC 2WPMS 1GHAF 2XBXA 4BTUB 2SGEE 3LGUA 3LT3A 4GHTA 1LPGB 6ESTA 4NIWA 1DM4B 3V12A 2O8WA 1GBMA 2G52A 1ACBE 1NROH 3TK5A 1EAWA 1HJ9A 1F0SA 5EQSA 1D4PB 4K69A 3UOPA 2BD4A 3E0PB 4YT6H 1K1MA 2ZCKP 3GY2A 3BEFB 4FVDA 5T6GA 1OYTH 1TMTH 2EA3A 6GCHF 1C2KA 1W14U 1BTHH 2ZQ1A 3A89A 3PWBA 3V3MA 1M9UA 1MKWH 2TGPZ 2ZDNA 1GPZA 4MVNA 2SGDE 4MPWA 1AB9C 1SGNE 1XVMA 2GGVB 5DKMA 2FOCA 3VXFH 1ELAA 2Z9KA 3MNXA 4JZIA 4YZUA 2BVSH 3KQBA 1A46H 4DIHH 2Z3DA 1NRRH 2ASUB 1SGQE 3FZZA 3A84A 1O5BB 3SUGA 2F9UA 3LKWA 2Q6DA 2NU4E 1KY9A 2B0FA 2FMJA 4GCHG 1GJDB 1K9OE 1T7CA 1LHEH 3SI4H 5C3NA 4I8GA 2SNWA 4MTBA 1OWJA 4ZHAA 3ZZ9A 1AKSA 4JYTA 2GZ7A 1N8OC 3LGYA 4BAMB 1O2UA 2A4QA 1C5MD 2ZG0H 3A7TA 5F8XA 2AS9A 4BXWA 1A2CH 1ELTA 3Q76A 4JZFH 4B76A 1AWHB 4UONA 3LU9B 1W7GH 3U1JB 2QV1A 1Z6JH 4XBDA 2YNAA 3JZ2B 3MMGA 3OY5U 5F6MA 2BLOA 1HFDA 1AU8A 3BEIB 1GJBB 2HGTH 4BTIB 3F9EA 1KTTB 1K21H 3ZZCA 1D6RA 1YPHC 2PUQH 3KL6A 1O5AB 5F8ZA 1F5LA 3RXAA 5AHGH 2ZGHA 3A8DA 2ODQA 1NPMA 2ZHEH 2BXUH 2JH5D 1FAKH 1IQGA 3RXEA 7GCHG 1GJ6A 4CH8B 2UUKB 3SJIA 1W12U 1P2OA 5AF9H 2OC1A 2Y81A 4DURA 5EPNA 4CRAA 3MH7A 2A5IA 1ETRH 4KTCA 2FX6A 2VIDA 1LVYA 1TA2A 1NC6A 2TRMA 1ELVA 1J9CH 1GG6B 2A7HA 1AGJA 2G55A 3T29A 3RP2A 1C5SA 1AZZA 3PLPA 2BB4A 1EP6A 5T3HA 3N7OA 1QB6A 1EATA 3QZQA 2QA9E 3AW1A 2G4UA 1SL3A 2ANWA 4TWYA 1EPTA 1ANEA 2LNCA 2RA0A 4H42U 1V2WT 4KP0A 3TIUA 1NU9A 1EKBB 3TU7H 1J17T 2RCEA 1V2OT 3G01A 1CT4E 4I33A 2K1QA 1ZPZA 3MWIU 4H4FA 1S0QA 1Z8RA 2PR3A 1B0EA 2J38A 2UUFB 1OWKA 1NY22 4AFQA 1HDTH 4X2VA 1OKXA 1SQOA 5JYIA 1C2JA 3UFAA 2D1JA 1KDQA 2XYAA 4DCDA 3MO9A 1MTVA 1O3KA 2ZDLA 1RIWB 3Q3XA 1O5EH 1GHBF 3M3TA 1G36A 1SB1H 1GBAA 2FDAA 1P02A 2ANKH 1UK3A 3EA9A 3M5MA 1WBGB 4O97A 3RXRA 4THNH 2A1DB 4MDSA 3AASA 1BHXB 1T8LA 2FP7B 2A45B 1PQ7A 4CBOA 3WY8A 1A0HB 5A09A 2ZKSA 3SOSA 1WOFA 2ZHWH 4CHAB 4JCNA 1ELGA 1DANH 1SGPE 1C5ZB 1KTSB 3UWIA 4UFEH 1JRTA 1D6WA 3C1KA 2PTNA 1ESAA 4XSKU 1IQFA 3A82A 1FPCH 1BZXE 4K3JA 3FZDA 1DICA 1JIRA 2FX4A 4D8NA 1GG6C 5E8EH 1WU1A 3P95A 4DT7B 2FLBH 2VVVA 1S6FA 1YPEH 1ORFA 1NS3A 4JZ1A 3KF2A 1LVOA 1YP9A 2ZZUH 2QC2A 5LPEA 4YOGA 1YF4A 2H9HA 2V3HH 3RMNH 3HPTB 3EAJA 5HXFA 4KTUA 1TBZH 3NK8A 1HAVB 1O2NA 1EAXA 3RUOA 1RFNA 1V2LT 1LDTT 4ZKRU 5DP9A 1CT0E 1OP0A 5J4QA 1N6YA 3LC3A 1CVWH 2PHBA 1ZRKA 1O5GH 4DG4A 3DD2H 3LH1A 3BTEE 4O03A 1ZJKA 3KQDA 5EW1H 3UWJH 1RIWC 1O3FA 2HRVA 3FP6E 4YLQH 5EGMA 2BOHB 4LZ4B 1C1NA 1O3OA 2I6SA 1K22H 4X1SU 3SJ8A 1IQIA 1O2QA 4ZXXH 5HM2A 1AHTH 1SC8U 2VWLA 4UFFH 4FU7A 1MU8B 2QGRA 3PLKA 1YM0A 2A32A 3LIWA 3GY3A 2D2DA 1EXFA 1O38A 4XFQA 4WF8A 1GMCG 1Z6EA 2KAIB 4PROA 1JOUB 5AFZH 3FP7E 1G30B 1W0ZU 4Y0ZE 4CHAC 1GHAG 1V2ST 1N1LA 1GGDB 3ZZ3A 3RMMH 3Q3KA 1C4U2 2HNTC 1F0TA 1V2TT 4D76A 1GI6A 3SU2A 3P8FA 1OOKB 1TQ0B 1GI8B 1V2JT 4GCHF 1BTXA 3SHAH 2FI5E 1TIOA 1NT1A 1GJ5H 5C1YA 2HPQH 1F92A 2Q6FA 6GCHG 3GY4A 3F9HA 1O34A 1D3PB 3KNXA 1O3GA 5FPYA 1G32B 1MZAA 2H5CA 3V0XA 1GBFA 1TNGA 4X8VH 1SGYE 1FV9A 2R9PA 3RC4A 4X0WU 3SJKA 1DSTA 2Y6TA 5L30H 1QJ6B 3MU8A 1JWTA 4DOQA 1F0RA 3QTOH 2C8XB 3R3GB 1BBRH 5CMXH 3LJOA 1SOTA 1L1JA 1O2WA 3SNBA 4XDEA 1BB0B 1HJ8A 1NU7B 1S85A 1LQDB 1VITH 5C1XA 5I25A 1DE7H 3ZZ8A 3PV4A 1TAWA 1VZQH 1WTGH 4ABEA 1P2MA 5GPIB 1BBRE 4GPGA 4AG2A 3RU4E 2XC0A 4SGAE 1E37B 3B8JA 4VGCC 2Y80A 3GDVA 3T2NA 4FUCA 1XXDA 1WQSA 1OP8A 3Q00A 1ZMNA 4ASHA 3UR6A 4RSPA 1IQJA 4K1TA 1AN1E 1HLTH 2VB0A 3RXUA 3MU4A 1PYTD 2Z9IA 2ZFQH 4NZLA 1IQNA 1KSNA 5K0HA 1C5QA 1ELDE 4B2BA 2Y7XA 1O5DH 3LGIA 3RXMA 1O37A 1OSSA 1NRPH 3QGJA 3PROA 1A4WH 4NGAH 5JB9S 1EJAA 1HB0B 1TBQH 1KIGH 2BQ7B 3ZVAA 4NSVA 1W7XH 3HGPA 3EA8A 3SV9A 1PQ5A 2SFAA 2XWBI 1ARBA 1TGSZ 4DJZB 5DO4H 4TY7A 2VGCB 4KGAA 1NZQH 1P2IA 9LPRA 1BMAA 1F0UA 2CXVA 3O8DA 1WUNH 1GI2A 1P06A 3H7OA 4YOJA 1Z1IA 1EB1H 1L1GA 1NN6A 1FJSA 2BZAA 5A0CA 4ZHMU 2UUYA 1SFIA 4NIXA 1VR1H 3PMHB 4FUIA 4CREA 1CBWC 1RXPA 3TH3H 2BQ6B 1GBJA 5FCRA 2ZHFH 3DFJA 1GBKA 3L33A 3DA9B 4TPYA 5DGJA 5EXLA 3HKIB 3STIA 1XKAC 4Y10E 1U6QA 1AQ7A 1O2VA 1FONA 2BTCE 1HXFH 1Z8IB 2NU2E 2P93A 3MO6A 4JZEH 4I32A 5EXMA 2FOAA 1W0YH 2OXSA 2AGGX 3SU3A 4B2AA 3E8LA 2BD8A 1AFQB 4O9VA 4BOHA 5JDUB 4M7GA 4ZKOU 2VNTA 1SLUB 1DT2A 1TPAE 3UNQA 4Y8ZA 1BMNH 3KCGH 1IAUA 1BMMH 1KXCA 1UVPA 3UNRA 3PMBB 1GBTA 3RDZA 4OGYA 4E7RG 1IQEA 1MTWA 2DE9A 1XUGA 3SO3A 2ZDVH 1QRWA 4X1QU 4KTSA 1FAXA 1TYNA 2BMGB 1T4UH 1BRCE 2ANMH 2C90B 2QF0A 3FVFB 2FS9A 2WV4A 3A81A 1Y3UA 1QL7A 3A7VA 4WXIA 3E16B 2ZGCA 4BAOB 1IQMA 5T6FA 5JBBS 1WV7H 1VCQA 1VCWA 3T26A 1L2EA 2XCNA 5C67A 1FPHH 1QBOA 4X6NA 1A5HA 1G3DA 2ZF0H 3OU0A 4A7IB 1ELEE 3ATWA 2VGCC 2IPHA 4CRFA 1P2QA 5DP7A 2PTCE 4XOJA 2WINI 1TRNA 2OUAA 2ZPSA 1V2MT 2IOTA 4Q7YA 4AFUA 2B5TB 4AFSA 1BIOA 1L1NA 2A2XH 3PLBA 2IN2A 1CT2E 5FX5A 3BIVH 2OP9A 1P10A 3GY8A 1QBVH 1GMHF 1NTPA 3A85A 2OLGA 3F68H 1D3DB 1TGTA 1TGBA 1P9UA 2F9BH 2XC4A 3LGWA 3GCTG 4AGKA 1C5PA 3A80A 1SGEE 2XBWA 1NFWA 2SGFE 2Y5GA 1ABJH 1NO9H 3QWCH 5EG4A 2TGDA 2STAE 3A7XA 4YO9A 3B23B 3ZV8A 1GMCF 2B8OH 4CRDA 2XWAA 1AFQC 2VINA 3BV9B 5A0AE 1Y5BT 2Y82A 4LXBH 4ABHA 4BNRA 1GCTB 3IITA 1EZUC 3GOVB 4FUEA 5ETXA 4IBLH 1UHBB 5LPFA 2BY5X 3RM0H 2PW8H 5A8XA 2ZPRA 4B2CA 3OSYA 1TOMH 2VWOA 3A86A 2ZU1A 1FIWA 3M5OA 4K2YA 2R3UA 1QRXA 1C1UH 1EOLA 1KYNA 1HIAB 2XXLA 3H5CB 1J16A 1SGRE 1GDNA 1SHHB 1DUEA 4ZXYH 2PKAB 5ESBA 2Y7ZA 2GCHF 2RG3A 4X2YA 1G2MA 3P8NA 1LHCH 4LZ1H 3QO6A 4BAHB 3VB5A 3QN7A 4AYVB 4INHA 1E35B 5I46H 5CHAC 1C5YB 1GVZA 3MFJA 3GCHB 1RGQA 2FOFA 5JBCS 1ZSKA 1O35A 3KIDU 3SUFA 1F5RA 1ZTJA 2JH0D 4WMFA 1KLTA 2XC5A 4ZHLU 2BD5A 1CHGA 3TJOA 4AG1A 3PB1E 4K8BA 1QQ4A 4E06H 1EJNA 2A2QH 1SVPA 1ZHRA 5FX6A 3B9FH 4OGXA 1Y5AT 3SU1A 6CHAB 3SV2H 2PSXA 1G3BA 1SLWB 2Z94A 4RKJB 4FUFA 2QY0B 2VWMA 2BXTH 3SI3H 2V3OH 1HAOH 4MNWA 5EU8A 3VGCC 3BTWE 1THPB 3ODFA 5TJXA 4FXGH 2P16A 2FLRH 1UTOA 1LPZB 3LGTA 1O5FH 1C2IA 1P04A 5BRRE 1EJMA 4D7FA 2FO9A 4CR5A 4Z6AH 2ODPA 4Q7ZA 1ZR0A 3IWMA 1S5SA 4JYUH 3K2UA 2PKSB 1GI1A 2FYQA 4KKDA 2AGIX 3ITIA 1CA8B 1HAZB 1ARCA 1TGNA 3ATLA 4BTTB 3S69A 5HGGA 3O8RA 3E3TA 1JXPA 3MH4A 2UWLA 1O2IA 2A4OA 1MAXA 5E0HA 1TNIA 3O8CA 1GBCA 4TYDA 5ESTE 2H1UA 4WH6A 3UIRA 1HPGA 3PTNA 1KLJH 2OC7A 2ZFSA 1DFPA 1JIMA 3D49H 3PO1B 2B7DH 1VCPA 1W8BH 2BD2A 3MNCA 1CSOE 4ESTE 1T31A 4AB9A 1ZTLA 8ESTE 1FXYA 3ZYDA 3Q77A 1V2UT 1TMBH 5JB8S 4OS5A 5LGOA 2EI7A 3GDUA 4A5TS 3SNEA 1BCUH 2BD3A 1QNJA 1TQ7B 2C4FH 3BTHE 3S9AA 4X1NU 1GJAB 4ISLA 5GWZA 1O2PA 2A31A 2ALVA 2CF8H 4NFEA 4NIYA 1ELFA 2BQWB 2ZEBA 4O3TA 1LHFH 4FUDA 1MQ5A 2FIRH 3U8OH 1TPOA 1UVTH 4FU8A 1Y3XA 4AZ2B 3A83A 6CHAC 2NWNA 3SNDA 1AVXA 5FAHA 5SGAE 1FNIA 1ZPCA 3QGNB 1O2KA 1O2RA 1TE0A 1C1PA 1DY8A 4FUGA 2G4TA 1IHTH 5A0BA 1QCPA 3T5FH 3A87A 2XBYA 1ZYOA 4IW4E 3GY7A 4X2WA 1E34B 1LO6A 1TWXB 2BY8X 1XVOA 4NIVA 3RXTA 5E2PA 1C2GA 1GJ8B 3RC5A 1DY9A 1NRNH 1GDQA 2GDDA 1H9HE 1GL0E 1CA0B 2SGQE 2XBVA 4HI3A 4XBBA 2PKSC 2ZECA 1TPSA 4I8LA 1O3AA 3P92A 1ANDA 1G37A 4O3UA 2FTMA 2DUCA 3RXBA 2NU1E 1BDAA 2V35A 2ZFFH 2ODYB 1IQLA 4OS7A 2PLXA 3S9BA 2Y5HA 1HAIH 1PPEE 1UTNA 5DJ7A 1BRAA 2C3SA 2F3CE 2O9QA 2BDGA 1XUFA 1MTNB 2VVCA 3LJJA 2V0BA 4IN1A 4XE4A 1AO5A 3TGIE 1O39A 3GCTF 1OWDA 5EODA 3GY5A 1ESTA 5AFYH 1C1VH 3DFLA 1BUIA 1OWEA 4WJG2 3SJOA 1MUEB 1HAHH 1S6HA 3SV7A 1O2GH 3L6PA 4Y8XA 3TJVA 3TVJB 2BYAX 1WAYB 1PPZA 1DWCH 4A92A 1EPTB 4J2YB 1GBDA 1FI8A 1IOEA 2NU0E 5T6DA 1TLDA 4OS2A 5L2YH 1O3LA 1YKTA 4I8HA 1O2ZA 2ZO3H 4NCYA 4FUJA 1GMHG 3A8CA 2ZTYA 2QIQA 2ZC9H 1C1OA 7LPRA 5EW2H 1SGDE 4ZUHA 1O2SA 1MU6B 3SGAE 3UR9A 2ZPQA 1YYY1 1FN6A 3E90B 1EOJA 4WH8A 3HK6B 5FCKA 1SOZA 5JBTA 3DHKH 5DP5A 3RXCA 4MPUA 3PM3A 3ZVCA 1FDPA 1TX8A 3BTKE 5EQQA 4IGDA 1DWBH 3BEUA 1BTYA 2GVFA 2VJ1A 3SGBE 5H4IB 1K1LA 3E6PH 1LKAA 2WUBA 2GDEH 1AZ8A 1RS0A 1CA0C 3RXOA 3NCLA 1WTHD 3M37A 2P3UB 4U30A 4LOYH 1HV7A 2F9NA 1LKBA 2FOMB 4MNXA 5GDSH 2FTLE 2P3TB 2ZA5A 1QJ1B 3SORA 4K1EA 2V6NA 1QL8A 1D3TB 1ZSJA 1AUJA 2F9PA 1C1QA 4U2WA 1A5GH 3UNSA 2JKHA 3CS7A 1WSSH 3VB7A 3ZVFA 1GHYH 5DP4A 2J92A 4SGBE 4IMZA 2D8WA 2WPJS 3CP7A 1UJ1A 2Z7FE 1G9IE 3RMLH 5DP6A 1THSH 2XTTB 1ZOMA 1UTLM 4MPVA 2GCHG 1MTNC 1ZRBA 4X2XA 2GD4B 1TRMA 1THRH 2R2WU 1UMAH 1AI8H 1GJ9B 3ATMA 4UDWH 4FU9A 1BRBE 1GI4A 3BIUH 3UUZA 1ELCA 1P3EA 3LH3A 2J2UA 1C5TA 4Y7BA 2HWLB 2ILNA 1IQKA 3QLPH 2CF9H 2BM2A 2AIQA 1DVAH 2ZTXA 1MBMA 3LONA 2PUXB 4K8YA 4HZHA 1L4ZA 4MLFB 1VGCB 1H1BA 3BTDE 2F91A 2UUJB 3SBKA 1YCPH 2G8TA 2HPPH 1EB2A 3PYHA 4B75A 1T4VH 2G81E 2WYGA 1BTWA 2I6QA 1AVGH 4NA7A 1A1RA 8KME2 1QA0A 3RXGA 1MKWK 1EUFA 1MBQA 1SBWA 1PYTC 3F6UH 2CN0H 2HOBA 3A7ZA 1FY4A 5LPRA 2BDYA 2JETB 1H8DH 3K6YA 5EPYA 2EEKA 1C1WH 2O8UA 3KGPA 2FI3E 1DOJA 3BTFE 3K65B 1HXEH 3BF6H 1K1OA 1PPBH 3A8BA 1J8AA 3S7HB 1GJ7B 2OTVA 1GI5A 3FP8E 2Q6GA 1GI0A 1ANCA 1WCZA 1O2YA 4DIIH 1GGDC 1BRUP 2XNIA 1GDUA 4WXVA 5IYTA 8LPRA 1AFEH 1NESE 1P8VC 4HGCA 1XM1A 5A8ZA 1QJ7B 2OBQA 1B5GH 5JPMH 1ABIH 2OD3B 4K60A 3RXDA 3EA7A 1V2KT 1MH0A 3URDA 2HLCA 1TFXA 2GV7A 1YPKH 1UTKA 2Y5FA 2A7CA 1NM6A 2J34A 1C5VA 1GBHA 2LPRA 1TX6A 5B6OA 1RTKA 4JK5A 3RXFA 1RD3B 3EQ0H 2M5TA 1SGTA 3SZNA 1OS8A 1AMHA 1YPGH 1KXDA 2BDHA 3SUDA 1LPKB 1INCA 1Y3YA 2C8ZB 2WPIS 3RXPA 3V13A 2VWNA 4WWYA 3RMOH 1TNKA 1BHXF 1CGJE 2ZI2H 3SW2B 1MZDA 5EOKA 4CH2B 1YGCH 4I31A 1V2QT 2ZGBH 1TONA 3OY6U 2IJOB 1K1JA 4AN7A 1NFYA 1HBTH 1VGCC 2H9EH 4ABJA 3MU5A 1O33A 1QRZA 5TCAA 2HNTF 2QF3A 2QXHA 3HATH 1P9SA 2ZFRH 1UHBA 3SV8A 4ISOA 2FOHA 2P59A 1NRQH 4Y6DA 2BY7X 3HKJB 1ZGVA 2ZDAH 4J1YA 1TOCB 5GCHG 1DWEH 1LTOA 3UQOA 3TITA 1SPJA 2FI4E 3T25A 1HIAA 1JRSA 1Z71A 1P05A 2JETC 3NWUA 4YESB 3LDXH 1AIXH 3TLOA 1O0DH 2VU8E 2ZTZA 2PKAA 4Y79A 1YPMH 3E0NB 3ATKA 3TK9A 4D9RA 4XBCA 1H4WA 2QYIA 4NZQA 5E2OA 1LHGH 3V7TA 2CGAA 1EZQA 1EZXC 1F7ZA 2BDIA 4YLUA 4AOQA 3GISB 1C2HA 4R8TB 3ATIA 1H9IE 2QXGA 1HCGA 4LK4A 2GZ8A 1BOQA 2OQ5A 3VEQB 4H6TA 3MO3A 2A5AA 5PTPA 2RA3A 4YTAA 3SGQE 2FODA 3M3SA 2ZU3A 3EYDA 1ZMLA 2O8LA 1ESBA 1O3HA 1QURH 1TNJA 4JK6A 2ZQ2A 2CMYA 3U8RH 2Z3EA 4I8JA 4Y0YE 1BMLA 2PWXA 2TIOA 2TBSA 2W3IA 1GWAA 3D62A 4NWKA 5E0JA 1PPHE 4A1XA 2QXIA 4A1TA 4IS5A 1P01A 3RC6A 3SV6A 2BX4A 3IG6B 3M5NA 4Z0KA 2AMDA 1EX3A 3R0FA 5FBIA 1PPGE 2BD7A 3UTUH 1HAYB 4ISNA 3MU0A 2ZDMA 1XUIA 3W95A 5AVDA 1O3CA 1O2MA 3EE0B 3SNAA 2TPIZ 4ABIA 1CGIE 3H7TA 1MTSA 2H5DA 2NU3E 1GL1A 1W2KH 1VJAU 4U32A 3K9XB 1YC0A 1QB9A 2VVUA 3TNTA 1MQ6A 1O2TA 1VITF 2XCFA 4Q7XA 5G4BA 1BTPA 2Z9JA 3ZVDA 2Z9LA 1C4V2 2A5KA 2BLQA 4F49A 2BLWA 1LQEA 1QHRB 3ZVGA 3TJUA 1C5NH 1HGTH 1P3CA 3SUEA 3EGKH 4AB8A 1C2MA 4GSOA 2YNBA 1BJVA 1GMDF 1KXBA 2OC0A 1RJXB 1LVMA 4NWLA 5DP8A 3LGVA 4ABDA 1UTQA 1ETSH 1OXGA 2W5EA 2ZU4A 4IC6A 3RXHA 1QTFA 1J14A 1EASA 1SGCA 1RRKA 3ZZ5A 1C2LA 1HAPH 1K1NA 3S9CA 3I77A 2BY6X 3PTBA 2ZP0H 3QX5H 2A4RA 3ZZDA 1UTJA 1DX5M 2GT8A 1V2NT 3E1XB 1YPHE 2HVXA 2PFEA 3AW0A 1KLIH 4CRGA 1FY1A 1O2XA 2BLVA 2P3FH 2H6MA 3I29A 1FY3A 3P8GA 2AYWA 4TY6A 3BTGE 4DY7B 5C20A 2G51A 2WUCA 1CGHA 2GP9B 3MOCA 4JZDH 3P6ZB 2P95A 1GI9B 1TB6H 1GJCB 2EC9H 2P8OB 4CR9A 1BJUA 3BG4B 4H6SB 2PSYA 1DITH 2VIWA 3KN2A 3NKKA 1NFUA 2C8YB 2F83A 3Q3YA 1SI5H 1SSXA 1TBRH 1K1PA 1GCTC 1A0LA 1YBWA 3NPSA 1J15A 1O5CB 3ENSB 3ZVEA 3E91A 2ZIQH 4ZH8A 1HYLA 5A2MH 1V2PT 4AGJA 5GXPA 5A8YA 1ANBA 2FM2A 3M7TA 2FZZA 3VB6A 2FOEA 1PPCE 1Y8TA 4WMEA 1BA8B 2STBE 1OWIA 4ZAEA 5BPEA 1IQHA 3C27B 2AFQB 1Y59T 1BBRK 1SQTA 2AGEX 3EDXB 5C5NA 1ZZZA 4Y76A 2ZHDA 4GHQA 2PGBB 1GHWH 3HGNA 3HK3B 3ZZAA 1GVKB 1HAVA 8GCHF 2AH4X 2AIPA 3RLWH 4B71A 1GHZA 2ANYA 3VB3A 2BD9A 3NZIA 1A5IA 1YCPK 4X6OA 3SU0A 1V2RT 4CRBA 1GI7B 1BTUA 1P2JA 1O3BA
chains in the Genus database with same CATH superfamily
1CU1A 1HJAB 3ELAH 3GCHC 1GBBA 3LOXA 4Q2KA 4ISIH 5C2ZA 4UFGH 5F03A 2J9NA 1NRSH 4NFFA 3S0NA 2DE8A 1C1SA 1GBLA 4I7YH 1QBNA 2OINA 2QN5T 3PMJA 1OYQA 4D7GA 1F2SE 5J4SA 2J98B 3QTVH 1HAXB 3TH2H 3AVZA 4INLA 3T62A 2FEQH 3O8BA 5GCHF 1NFXA 4QT8C 1PPFE 2G5VA 3BN9A 4BXSA 2O8TA 4MNYA 5HYOA 5C1UA 1T8OA 2BDAA 2EI6A 1C2DA 5CE1A 1HNEE 4GUXA 3URCA 1ZPBA 3GYLB 1O31A 2KAIA 2P8OC 1XUJA 1AKSB 1O3MA 1Q31A 4WMDA 5JBAS 3BG4C 5FPSA 2W7SA 1C1TA 3KQCA 1W11U 2AHME 3F9GA 2ZU5A 3PWCA 4ABFA 2BZ6H 2R2MB 1XX9A 1NBME 2UWOA 1CO7E 2WPKS 1O3DA 1A3BH 5F8TA 1O36A 3MU1A 3RXLA 4X8SH 1DLKB 2H9TH 1C5WB 1MKXH 1UCYH 1D3QB 2VIPA 1JBUH 2ZGXH 4INKA 1T32A 1P12E 2EI8A 2ZWLH 3W94A 4KELA 3ZZ7A 1UVUH 4TWWA 5HIZA 1W3CA 3GCNA 2H2ZA 1B7XB 4ISHH 4AC9A 5EXNA 3NUMA 2R3YA 1UCYE 4GVUA 1ZJDA 2BDCA 2WYJA 1TA6A 2GZ9A 1CHOF 5LH8A 4UEHH 1BTZA 1O2LA 2ZCHP 3VPKA 3PO1C 1A61H 1AWFH 2AERH 1E0FD 1EZSC 1CQQA 3P17H 4X6MA 3GCOA 3U98H 1S81A 2ZCLP 3SHCH 1SGIB 3FANA 1YPJH 3U1IB 5L2ZH 1FMGA 1HJAC 3M3VA 4DGJA 1BQYA 3M5LA 1NBMD 2RDLA 1OPHB 1XUHA 1WQVH 1SMFE 1SR5C 1YWUA 1TGCA 1MAYA 1P09A 4X1PU 1OWHA 3STJA 2EQNA 1AE8H 1GI3A 4X6PA 3SU4A 2J4IA 1ZMJA 4NA8A 2XW9A 2AMQA 4F4OC 1C4Y2 1C5LH 1XKBC 2AEIH 3RXIA 4MNVA 1SGFA 4HTCH 4Y7AA 5IK2D 4ZROA 3UPEA 3SJ9A 2HNTE 2GKVE 2J95A 4NG9H 4UD9H 4MQAA 1OX1A 4MG3A 4RN6A 3SQHE 1KDQB 3T27A 3ESTA 4VGCB 1P11E 4CBNA 1AE5A 5HMAA 3ZZBA 1JMOH 4A6LA 3RXVA 4AYYB 1O2OA 1FN8A 1FZZA 1V2VT 2F9VA 4DT4A 4IMQA 4ABBA 4BAKB 4ACAA 1TMUH 3M61U 2FPZA 3TJNA 3U69H 3H09A 4WVPE 3K6ZA 1DSUA 2XRCA 1ZHPA 2HLDD 1OP2A 2W7UA 3RLYH 2KM0A 2BX3A 5FBEA 1YLDA 3P8OA 1FY8E 7KMEH 4ZKNU 1O32A 3QDZB 3EE7A 1SQRA 4ZKSU 1Q3XA 5TCCA 4YT7H 1UVOA 3RXKA 1O3PB 1VITG 1SQAA 2SGPE 1P2KA 2Z3CA 2GX4A 4BAQB 1AD8H 1DLEA 2PP6A 3SQEE 2Z6BD 1TX7A 2A4GA 2BVRH 1AUTC 3RU4T 3UOUA 3UY9A 1K1IA 4AX9H 3M36A 1P0SH 1C2EA 1GHXH 5K7RA 4JYVH 1EAIA 1FY5A 2ZHQH 3SNCA 1C1MA 3M7UA 1GMDG 1S83A 2D26C 1TRYA 1UTMA 1COWD 2W3KA 4R0IA 1H9LB 1H8IH 3LPRA 1C5UA 5CHBA 2BY9X 4Y11E 1UK2A 1Y3VA 1L0ZA 2TGAA 2WV9A 4NSYA 1CBWB 1A0JA 1MTUA 3BSQA 4Q80A 4AFZA 3FAOA 1TNHA 1Y5UT 2PV9B 2W26A 1C5OH 1ID5H 3T28A 2K0QA 1AY6H 1G2LA 3GYMA 3ZZ6A 2FESH 4ABGA 2THFB 2QCYA 1SFQB 2OQUA 4Y8YA 1EPTC 2FS8A 3BG8A 4YM9A 3TPIZ 3UQVA 2Z9GA 1ZTKA 2FWWA 2OCVB 2ZFTA 3QZRA 1DWDH 1GJ4H 4E7NA 3UREA 3ODDA 3QUMP 3MYWA 1BITA 5HM9A 1SGFG 5ABWA 3SU6A 1S0RA 4OS4A 1PQAA 2WPLS 4FVBA 7GCHF 2QAAA 1PJPA 3KQEA 5FPTA 5C5OA 2J94A 5DK1A 5L6NH 1E36B 4CRCA 3SU5A 3ZYEA 1C9TA 5GJ4B 3U28C 1C1RA 2GCTB 2VIVA 2AMPA 2OC8A 4IC5A 1DS2E 4NA9H 4UFDH 2ZDKA 2JJ2D 1LVBA 1V3XA 1UO6A 4XD7D 1BT7A 1XXFA 1EP5A 3MNSA 1QQUA 2QF4A 4ZMAH 1G3EA 2ALPA 1EFRD 4B73A 3F3BA 1A7SA 4OS6A 3MH5A 4BANB 2BHGA 7ESTE 5EQRA 4RKOB 1K0HA 3P70B 3PMAB 2PGQB 3A7YA 2BVXH 2Q1JA 3SN8A 1K2I1 1HRTH 2ESTE 3F9FA 2WV5A 3VFEA 1GHVH 1KXEA 1ZGIA 1MMJN 5DG6A 3L3TA 4IN2A 2GT7A 3F0OA 3MTYA 1PQ8A 3TGJE 5DP3A 2ZNKH 1ELBA 1LMWB 3VB4A 1EAUA 1WDIA 1KXFA 1RTFB 2C8WB 1FIZA 8GCHG 3RU4D 1O3EA 1QR3E 2SNVA 3FKSD 1QFKH 1ZLRA 1QY6A 5B6LA 2G5NA 3RM2H 5FXLA 2JIZD 3JZ1B 2HALA 3TGKE 2FOGA 1UTPA 3AAUA 1L4DA 3MHWU 1P57B 4JMYA 6LPRA 3GS9A 3GICB 4DW2U 3RXJA 1N6XA 5FHTA 3BTME 3S7KB 2F9OA 1O2HA 1XUKA 2GMTB 2ULLA 2CV3A 1O30A 1LCYA 2ZU2A 2VH0A 4X8UH 3MNBA 1K28D 1SLXB 4A1VA 4DVAU 2C93B 3VXEH 4WY3A 1QA7A 1Y3WA 3D23A 1DPOA 1VKYA 3AK5A 1FUJA 1GBIA 1IHSH 1YLCA 3ZVBA 1GBEA 1HAGE 3ZZ4A 1F5KU 3DUXH 3KHVA 4X1RU 2CHAB 3BTQE 4Y71A 2G00A 3AAVA 1T8MA 5C0TA 2A0QB 5DPAA 3TH4H 5IDKA 1MCVA 4I8KA 1LHDH 3OEHD 4X8TH 5GIBA 1YCPM 3BTTE 1DDJA 2R0LA 2GCTC 2UWPA 1CE5A 1FQ3A 2ZGJA 1GHBG 4GLYA 1TNLA 2B9LA 1VJ9U 1O3NA 1O3JA 1G3CA 2VIQA 4K5ZA 2BOKA 1Z8JB 3RXSA 4ABAA 1DXWA 3D65E 2ZFPH 1O2JA 2FXRA 5E0GA 4U01A 3RXQA 1O3IA 1ZSLA 2GV6A 3A88A 4OS1A 4B74A 2YOLA 1C5RA 1GCDA 3QK1A 3A7WA 2A7JA 4UE7H 2WPHS 3M35A 1ZHMA 1Z1JA 1Z7KA 1SLVB 3MI4A 5KGOA 3ZV9A 1AB9B 2L74A 3U8TH 4YOIA 2VH6A 4TSFD 2SGAA 1UVSH 4MPXA 1UK4A 3DSPA 1DUAA 3GY6A 2JH6D 4FUHA 2P94A 3I78A 1X7AC 4B6EA 3OYPA 4K1SA 1MD8A 4AORA 1AVWA 1RTLA 2O8MA 3GDSA 2QXJA 3KEEA 5CHAB 2RDEA 1YPLH 2GJGA 1SG8B 1D9IA 3NXPA 4D9QA 1CHOG 3OX7U 1EQ9A 1QL9A 3TK6A 3OTJE 1B0FA 1C9PA 1S82A 3CENA 2GTBA 3A8AA 3U9AH 1KXAA 1QIXB 2OBOA 3MH6A 1GVLA 2KR7A 2R0KA 4FUBA 1N8OB 3WW7A 4E05H 2TGTA 3M7QA 1QGFA 4GAWA 1TPPA 1XMNB 4HFPB 9ESTA 2BDBA 1ETTH 1C2FA 1MKXK 1UCYK 1TABE 5EJZA 1Q2WA 3FFGA 1A3EH 1T8NA 1MCTA 1P03A 2XNDD 3TNSA 1QB1A 1C5XB 3DT0H 2GMTC 1FLEE 4F48B 2FOBA 1P2NA 1MD7A 1TALA 2CJIA 1SHYA 3F0PA 3LC5A 1S84A 1W10U 2FYRA 1E38B 3VGCB 1PFXC 1V6DA 3F1SB 3CS0A 2VIOA 4TPIZ 1W13U 1Z8GA 1HUTH 4B1TA 2YMSB 1DXPA 1WYKA 2CHAC 2WPMS 1GHAF 2XBXA 4BTUB 2SGEE 3LGUA 3LT3A 4GHTA 1LPGB 6ESTA 4NIWA 1DM4B 3V12A 3UAIC 2O8WA 1GBMA 2G52A 1ACBE 1NROH 3TK5A 1EAWA 1HJ9A 1F0SA 5EQSA 1D4PB 4K69A 3UOPA 2BD4A 3E0PB 4YT6H 1K1MA 2ZCKP 3GY2A 3BEFB 4FVDA 5T6GA 5HIYA 1OYTH 1TMTH 2J97A 2EA3A 6GCHF 1C2KA 1W14U 1BTHH 2ZQ1A 3A89A 3PWBA 5EJ1A 3V3MA 1M9UA 1MKWH 2TGPZ 2ZDNA 1GPZA 4MVNA 2SGDE 4MPWA 1AB9C 1SGNE 1XVMA 2GGVB 5DKMA 2FOCA 3VXFH 1ELAA 2Z9KA 3MNXA 4JZIA 4YZUA 2BVSH 3KQBA 1A46H 4DIHH 2Z3DA 1NRRH 2ASUB 1SGQE 3FZZA 3A84A 1O5BB 3SUGA 2F9UA 3LKWA 2Q6DA 2NU4E 1KY9A 2B0FA 2FMJA 1BMFD 4GCHG 1GJDB 1K9OE 1T7CA 1LHEH 3SI4H 5C3NA 4I8GA 2SNWA 4MTBA 1OWJA 4ZHAA 3ZZ9A 1AKSA 4JYTA 3VG8A 2GZ7A 1N8OC 3LGYA 4BAMB 1O2UA 2A4QA 1C5MD 2ZG0H 3A7TA 5F8XA 2AS9A 4BXWA 1A2CH 1ELTA 3Q76A 4JZFH 4B76A 4ASUD 1AWHB 4UONA 3LU9B 4RT1A 1W7GH 3U1JB 2QV1A 1Z6JH 4XBDA 2YNAA 3JZ2B 3MMGA 3OY5U 5F6MA 2BLOA 1HFDA 1AU8A 3BEIB 1GJBB 2V3MA 2HGTH 3CNRA 4BTIB 3F9EA 1KTTB 1K21H 2WZQA 3ZZCA 1D6RA 1YPHC 2PUQH 3KL6A 1O5AB 5F8ZA 1F5LA 3RXAA 5AHGH 2ZGHA 3A8DA 2ODQA 1NPMA 2ZHEH 2BXUH 2JH5D 1FAKH 1IQGA 2XOKD 3RXEA 7GCHG 1GJ6A 4CH8B 2UUKB 3SJIA 1W12U 1P2OA 5AF9H 2OC1A 2Y81A 4DURA 5EPNA 4CRAA 3MH7A 2A5IA 1ETRH 4KTCA 2FX6A 2VIDA 1LVYA 1TA2A 1NC6A 2TRMA 1ELVA 1J9CH 1GG6B 2A7HA 1AGJA 2G55A 3T29A 3RP2A 1C5SA 1AZZA 3PLPA 2BB4A 5EIYA 1EP6A 5T3HA 3N7OA 1QB6A 1EATA 3QZQA 2QA9E 3AW1A 2G4UA 1SL3A 2ANWA 4TWYA 1EPTA 1ANEA 2LNCA 2RA0A 4H42U 1V2WT 4KP0A 3TIUA 4Z1MD 1NU9A 1EKBB 3TU7H 1J17T 2RCEA 1V2OT 3G01A 1CT4E 4I33A 2K1QA 1ZPZA 3MWIU 4H4FA 1S0QA 1Z8RA 2PR3A 1B0EA 2J38A 2UUFB 1OWKA 2RFKC 1NY22 4AFQA 1HDTH 4X2VA 1OKXA 1SQOA 5JYIA 1C2JA 3UFAA 2D1JA 4TT3D 1KDQA 2XYAA 4DCDA 3MO9A 1MTVA 1O3KA 2ZDLA 1RIWB 3Q3XA 1O5EH 1GHBF 3M3TA 1G36A 1SB1H 1GBAA 2FDAA 1P02A 2ANKH 1UK3A 3EA9A 3M5MA 1WBGB 4O97A 3RXRA 3SYJA 4THNH 2A1DB 4MDSA 3AASA 1BHXB 1T8LA 2FP7B 2A45B 1PQ7A 4CBOA 3WY8A 1A0HB 5A09A 2ZKSA 3SOSA 5KEDA 1WOFA 2ZHWH 4CHAB 4JCNA 1ELGA 1DANH 1SGPE 1C5ZB 1KTSB 3UWIA 4UFEH 1JRTA 1D6WA 3C1KA 2PTNA 1ESAA 4XSKU 1IQFA 3A82A 1FPCH 3OTPA 1BZXE 4K3JA 3FZDA 1DICA 1JIRA 2FX4A 4D8NA 1GG6C 5E8EH 1WU1A 3P95A 4DT7B 2FLBH 2VVVA 1S6FA 1YPEH 1ORFA 1NS3A 4JZ1A 3KF2A 1LVOA 1YP9A 2ZZUH 2QC2A 5LPEA 4YOGA 1YF4A 2H9HA 2V3HH 3RMNH 3HPTB 3EAJA 5HXFA 4KTUA 1TBZH 3NK8A 1HAVB 1O2NA 1EAXA 3RUOA 1RFNA 1V2LT 1LDTT 4ZKRU 5DP9A 1CT0E 1OP0A 5J4QA 1N6YA 3LC3A 1CVWH 2PHBA 1ZRKA 1E79D 3WWBA 1O5GH 4DG4A 3DD2H 3LH1A 3KYGA 3BTEE 4O03A 3PRDA 1ZJKA 3KQDA 5EW1H 3UWJH 1RIWC 1O3FA 2HRVA 3FP6E 4YLQH 5EGMA 2BOHB 4LZ4B 1C1NA 1O3OA 2I6SA 1K22H 4X1SU 3SJ8A 1IQIA 1O2QA 4ZXXH 5HM2A 1AHTH 1SC8U 2VWLA 4UFFH 4FU7A 1YY3A 1MU8B 2QGRA 3PLKA 1YM0A 2A32A 3LIWA 3GY3A 2D2DA 1EXFA 1O38A 4XFQA 4WF8A 1GMCG 5T1VA 3F2HA 1Z6EA 2KAIB 4PROA 1JOUB 5AFZH 3FP7E 1G30B 1W0ZU 4Y0ZE 4CHAC 3FN8A 1GHAG 1V2ST 2KCOA 1N1LA 1GGDB 3ZZ3A 3RMMH 3Q3KA 1C4U2 2HNTC 1F0TA 1V2TT 4D76A 1GI6A 3SU2A 3P8FA 1OOKB 1TQ0B 1GI8B 1V2JT 4GCHF 1BTXA 3SHAH 2FI5E 1TIOA 1NT1A 1GJ5H 5C1YA 2HPQH 2CK3D 1F92A 2Q6FA 6GCHG 3GY4A 3F9HA 1O34A 1D3PB 3KNXA 1O3GA 5FPYA 3OAAD 1G32B 1MZAA 2H5CA 3V0XA 1GBFA 1TNGA 4X8VH 1SGYE 1FV9A 2R9PA 3RC4A 4X0WU 3SJKA 1DSTA 2Y6TA 5L30H 1QJ6B 3MU8A 1JWTA 4DOQA 1E1RD 1F0RA 3QTOH 2C8XB 3R3GB 1BBRH 5CMXH 3LJOA 1SOTA 1L1JA 1O2WA 3SNBA 4XDEA 1BB0B 1HJ8A 1NU7B 1S85A 1LQDB 1VITH 5C1XA 5I25A 1DE7H 1W0JD 3ZZ8A 3PV4A 1TAWA 1VZQH 1WTGH 4ABEA 1P2MA 5GPIB 3MQKC 1BBRE 4GPGA 4AG2A 3RU4E 2XC0A 4SGAE 1E37B 3B8JA 4VGCC 2Y80A 3GDVA 3T2NA 4FUCA 1XXDA 1WQSA 1OP8A 3Q00A 1ZMNA 4ASHA 3UR6A 4RSPA 1IQJA 4K1TA 1AN1E 1HLTH 5HKKD 2VB0A 3OE7D 3RXUA 3MU4A 1PYTD 2Z9IA 2ZFQH 4NZLA 1IQNA 1KSNA 5K0HA 1C5QA 1ELDE 4B2BA 2Y7XA 3KQ5A 1O5DH 3LGIA 3RXMA 1O37A 1OSSA 1NRPH 3QGJA 3PROA 1A4WH 4NGAH 5JB9S 1EJAA 1HB0B 1TBQH 1KIGH 2BQ7B 3ZVAA 4NSVA 1W7XH 3HGPA 3EA8A 3SV9A 1PQ5A 2SFAA 2XWBI 1ARBA 1TGSZ 4DJZB 5DO4H 4TY7A 2KX4A 2VGCB 4KGAA 1NZQH 1P2IA 9LPRA 1BMAA 2JJ1D 1F0UA 2CXVA 3O8DA 1WUNH 1GI2A 1P06A 3H7OA 4YOJA 1Z1IA 1EB1H 1L1GA 1NN6A 2QF5A 1FJSA 2BZAA 5A0CA 4ZHMU 2UUYA 1SFIA 4NIXA 1VR1H 3PMHB 4FUIA 4RT0A 4CREA 1CBWC 1RXPA 3W1EA 3TH3H 2BQ6B 3PV2A 1GBJA 5FCRA 5F53A 2ZHFH 3DFJA 2L6OA 1GBKA 3L33A 1WXRA 3DA9B 4TPYA 5DGJA 5EXLA 3UB0A 3HKIB 3STIA 1XKAC 4Y10E 1U6QA 1AQ7A 1O2VA 1FONA 2BTCE 1HXFH 1Z8IB 2F43B 2NU2E 2P93A 3MO6A 4JZEH 1MABB 4I32A 5EXMA 4Q4LA 2FOAA 1W0YH 2OXSA 2AGGX 3OFND 3SU3A 4B2AA 3E8LA 2BD8A 1AFQB 4O9VA 4BOHA 2K8IA 5JDUB 4M7GA 4ZKOU 2VNTA 1SLUB 1FX0B 5CDFE 1DT2A 1TPAE 3UNQA 4Y8ZA 1BMNH 3KCGH 1IAUA 1BMMH 1KXCA 1UVPA 1SKYE 3UNRA 3PMBB 1GBTA 3RDZA 4OGYA 4E7RG 1IQEA 1MTWA 2DE9A 1XUGA 3SO3A 2ZDVH 1QRWA 4X1QU 2KFWA 4KTSA 1FAXA 1TYNA 2BMGB 1T4UH 1BRCE 2ANMH 2C90B 3DSGA 2QF0A 3FVFB 2FS9A 2WV4A 3A81A 1Y3UA 2KZ4A 1QL7A 3A7VA 4WXIA 3E16B 2ZGCA 4BAOB 1IQMA 5T6FA 4P02A 5JBBS 1WV7H 1VCQA 1VCWA 3T26A 1L2EA 5KECA 2XCNA 5C67A 1FPHH 1QBOA 3N7EA 4X6NA 1A5HA 1G3DA 2ZF0H 3OU0A 4A7IB 1ELEE 3ATWA 2VGCC 2IPHA 2OK5A 4CRFA 1P2QA 5DP7A 2PTCE 4XOJA 2WINI 1TRNA 2OUAA 2ZPSA 1V2MT 2IOTA 4Q7YA 4AFUA 2B5TB 4AFSA 1BIOA 1L1NA 2A2XH 3PLBA 2IN2A 1CT2E 5FX5A 3BIVH 2OP9A 2KCPA 1P10A 3GY8A 1QBVH 1GMHF 1NTPA 3A85A 2OLGA 3F68H 1D3DB 1TGTA 1TGBA 1P9UA 2F9BH 2XC4A 3LGWA 3GCTG 4AGKA 1C5PA 3A80A 1SGEE 2XBWA 1NFWA 2SGFE 2Y5GA 1ABJH 1NO9H 3QWCH 5EG4A 2TGDA 2STAE 3A7XA 4YO9A 3B23B 3ZV8A 1GMCF 2B8OH 4CRDA 2XWAA 1AFQC 2VINA 3BV9B 5A0AE 1Y5BT 2Y82A 4LXBH 4ABHA 4BNRA 1GCTB 3IITA 1EZUC 3GOVB 4FUEA 5ETXA 4IBLH 1UHBB 5LPFA 2BY5X 3RM0H 2PW8H 5A8XA 2ZPRA 4B2CA 3OSYA 4ZCNA 1TOMH 2VWOA 3A86A 2ZU1A 1FIWA 3M5OA 4K2YA 3ZIAD 2R3UA 1QRXA 1C1UH 1EOLA 1KYNA 1HIAB 2XXLA 3H5CB 1J16A 1SGRE 1GDNA 1SHHB 1DUEA 4ZXYH 2PKAB 2JDID 5ESBA 2Y7ZA 2GCHF 2RG3A 4X2YA 1G2MA 3P8NA 1LHCH 4LZ1H 3QO6A 4BAHB 3VB5A 2J98A 3QN7A 4AYVB 4INHA 1E35B 5I46H 5EJLA 1QZ8A 5CHAC 1C5YB 1GVZA 3MFJA 3GCHB 1RGQA 2FOFA 5JBCS 1ZSKA 1O35A 3KIDU 3SUFA 1F5RA 5C94A 1ZTJA 2JH0D 4WMFA 1KLTA 2XC5A 4ZHLU 2BD5A 1CHGA 3TJOA 4AG1A 3PB1E 4K8BA 4P00A 1QQ4A 4E06H 1EJNA 2A2QH 1SVPA 1ZHRA 5FX6A 3B9FH 4OGXA 1Y5AT 3SU1A 6CHAB 3SV2H 2PSXA 1G3BA 1SLWB 2Z94A 4RKJB 4FUFA 2QY0B 2VWMA 2BXTH 3SI3H 2V3OH 1HAOH 4MNWA 5EU8A 3VGCC 3BTWE 1THPB 3ODFA 5TJXA 4FXGH 2P16A 2FLRH 2YMSC 1UTOA 1LPZB 3LGTA 3FO8D 1O5FH 1C2IA 1P04A 5BRRE 1EJMA 4D7FA 2FO9A 4CR5A 4Z6AH 2ODPA 4Q7ZA 1ZR0A 3IWMA 3DCLA 1S5SA 4JYUH 3K2UA 2PKSB 1GI1A 2FYQA 4KKDA 2AGIX 3ITIA 1CA8B 1HAZB 1ARCA 1TGNA 3ATLA 4BTTB 3S69A 3NRLA 5HGGA 3O8RA 3E3TA 4RI0A 3PV5A 1JXPA 3MH4A 2UWLA 1O2IA 2A4OA 1MAXA 5E0HA 1TNIA 3O8CA 1GBCA 4TYDA 2J5UA 2LELA 5ESTE 2H1UA 4WH6A 3UIRA 1HPGA 3PTNA 1KLJH 2OC7A 2ZFSA 1DFPA 1JIMA 3D49H 3PO1B 2B7DH 1VCPA 1W8BH 2BD2A 3MNCA 3PRBA 1CSOE 4ESTE 1T31A 4AB9A 1ZTLA 8ESTE 1FXYA 3ZYDA 3Q77A 1V2UT 1TMBH 5JB8S 1E1QD 4OS5A 5LGOA 2EI7A 3GDUA 4A5TS 2EY4C 1BCUH 2BD3A 3SNEA 1QNJA 1TQ7B 2C4FH 3BTHE 3S9AA 4X1NU 1GJAB 4ISLA 5GWZA 1O2PA 2A31A 2ALVA 2CF8H 4NFEA 4NIYA 1ELFA 2BQWB 2ZEBA 4O3TA 1LHFH 2IPQX 3FOAA 4FUDA 1MQ5A 2FIRH 3U8OH 1TPOA 1UVTH 4FU8A 1Y3XA 4AZ2B 4FOUC 2W6ID 3A83A 6CHAC 2NWNA 3SNDA 1AVXA 5FAHA 5SGAE 1FNIA 1ZPCA 3QGNB 1O2KA 1O2RA 1TE0A 1C1PA 1DY8A 4FUGA 2G4TA 1IHTH 5A0BA 1QCPA 3T5FH 3A87A 2XBYA 1ZYOA 4IW4E 3GY7A 4X2WA 3SZEA 5DSFA 1E34B 1LO6A 1TWXB 2BY8X 1XVOA 5DN6D 4NIVA 4FETA 3RXTA 5E2PA 1C2GA 1GJ8B 3RC5A 1DY9A 1NRNH 1GDQA 2M2AA 2GDDA 1H9HE 1GL0E 1CA0B 2SGQE 2XBVA 4HI3A 4XBBA 2PKSC 2ZECA 1TPSA 4I8LA 1O3AA 3P92A 1ANDA 1G37A 4O3UA 2FTMA 2DUCA 3RXBA 2NU1E 1BDAA 2V35A 2ZFFH 2ODYB 1IQLA 4OS7A 2PLXA 3S9BA 2Y5HA 1HAIH 1PPEE 1UTNA 5DJ7A 1BRAA 2C3SA 2F3CE 2BDGA 2O9QA 4M9FA 1XUFA 1MTNB 2VVCA 3LJJA 2V0BA 4IN1A 4XE4A 1AO5A 3TGIE 1O39A 3GCTF 1OWDA 5EODA 3GY5A 1ESTA 5AFYH 1C1VH 3DFLA 1BUIA 1OWEA 4WJG2 3SJOA 1YLNA 1HAHH 1MUEB 1S6HA 1O2GH 3SV7A 3L6PA 4Y8XA 3TJVA 3TVJB 2WHXA 2BYAX 3KYFA 1WAYB 1PPZA 1DWCH 4A92A 1EPTB 4J2YB 1GBDA 1FI8A 1IOEA 2NU0E 2V7QD 5T6DA 1TLDA 3N7DA 4OS2A 5L2YH 1O3LA 1YKTA 4I8HA 1O2ZA 2ZO3H 4NCYA 4FUJA 1GMHG 3A8CA 2ZTYA 2QIQA 2ZC9H 1C1OA 7LPRA 5EW2H 1SGDE 4ZUHA 1O2SA 1MU6B 3SGAE 3UR9A 4HG6A 2ZPQA 1YYY1 1FN6A 3E90B 1EOJA 4WH8A 3HK6B 5FCKA 1SOZA 5JBTA 3DHKH 5DP5A 3RXCA 4MPUA 3PM3A 3ZVCA 2IJD1 1FDPA 1TX8A 3BTKE 5EQQA 4IGDA 1DWBH 3BEUA 1BTYA 2GVFA 2VJ1A 3SGBE 5H4IB 1K1LA 3E6PH 1LKAA 2WUBA 2GDEH 1AZ8A 1RS0A 1CA0C 3RXOA 3NCLA 1WTHD 3M37A 2P3UB 4U30A 4LOYH 1HV7A 2F9NA 1LKBA 2FOMB 4MNXA 5GDSH 2FTLE 2P3TB 2ZA5A 1QJ1B 3SORA 4K1EA 2V6NA 1QL8A 1D3TB 1ZSJA 1AUJA 2F9PA 1C1QA 4U2WA 1A5GH 3UNSA 2JKHA 3CS7A 1WSSH 3VB7A 3ZVFA 1GHYH 5DP4A 2J92A 4SGBE 4IMZA 2D8WA 2WPJS 3CP7A 1UJ1A 2Z7FE 1G9IE 3RMLH 5DP6A 1THSH 2XTTB 1ZOMA 1UTLM 4MPVA 2GCHG 1MTNC 1H8ED 1ZRBA 4X2XA 2GD4B 1TRMA 1THRH 2R2WU 1UMAH 1AI8H 1GJ9B 3ATMA 4UDWH 4FU9A 1BRBE 1GI4A 3BIUH 3UUZA 1ELCA 1P3EA 3LH3A 2J2UA 1C5TA 4Y7BA 2HWLB 2ILNA 1IQKA 1OHHD 3QLPH 2CF9H 2BM2A 2AIQA 1DVAH 2ZTXA 1MBMA 3LONA 2PUXB 4K8YA 4HZHA 1L4ZA 4MLFB 1VGCB 1H1BA 3BTDE 2F91A 2UUJB 3SBKA 1YCPH 2G8TA 2HPPH 1EB2A 3PYHA 4B75A 1T4VH 2G81E 2WYGA 1BTWA 2I6QA 1AVGH 4NA7A 1A1RA 8KME2 1QA0A 3RXGA 1MKWK 1EUFA 1MBQA 1SBWA 1PYTC 3F6UH 2CN0H 2HOBA 3A7ZA 1FY4A 5LPRA 2BDYA 2JETB 1H8DH 3K6YA 5EPYA 2EEKA 1C1WH 2O8UA 3KGPA 2FI3E 1DOJA 3BTFE 3K65B 1HXEH 3BF6H 1K1OA 1PPBH 3A8BA 1J8AA 3S7HB 1UW7A 1GJ7B 2OTVA 1GI5A 3FP8E 2Q6GA 1GI0A 1ANCA 1WCZA 1KMHB 1O2YA 4DIIH 1GGDC 1BRUP 3DSOA 2XNIA 1GDUA 4WXVA 5IYTA 5C0UA 8LPRA 1AFEH 1NESE 1P8VC 4HGCA 1XM1A 5A8ZA 1QJ7B 2OBQA 1B5GH 5JPMH 1ABIH 2OD3B 4K60A 3RXDA 3EA7A 1V2KT 1MH0A 3URDA 2HLCA 1TFXA 2GV7A 1YPKH 1UTKA 2Y5FA 2A7CA 1NM6A 2J34A 1C5VA 1GBHA 2LPRA 1TX6A 5B6OA 1RTKA 4JK5A 3RXFA 1RD3B 2HVYB 3EQ0H 2M5TA 1SGTA 3SZNA 1OS8A 1AMHA 1YPGH 1KXDA 2BDHA 3SUDA 1S6LA 1LPKB 4Q63A 1INCA 1Y3YA 2C8ZB 2WPIS 3RXPA 3V13A 2VWNA 4WWYA 3RMOH 1TNKA 1BHXF 1CGJE 2ZI2H 3SW2B 2LP6A 1MZDA 5EOKA 4CH2B 1YGCH 4I31A 1V2QT 2ZGBH 1TONA 3OY6U 2WPDD 2IJOB 1K1JA 4AN7A 1NFYA 1HBTH 1VGCC 2H9EH 4ABJA 3MU5A 1O33A 1QRZA 5TCAA 2HNTF 2QF3A 2QXHA 3HATH 1P9SA 2ZFRH 1UHBA 3SV8A 4ISOA 2FOHA 2P59A 1NRQH 4Y6DA 4F55A 2BY7X 3HKJB 1ZGVA 2ZDAH 4J1YA 1TOCB 5GCHG 1DWEH 1LTOA 3UQOA 3TITA 1SPJA 2FI4E 3T25A 1HIAA 1JRSA 1Z71A 1P05A 2JETC 3F2GA 3NWUA 3LDXH 1AIXH 4YESB 3TLOA 1O0DH 2VU8E 2ZTZA 2PKAA 4Y79A 1YPMH 3E0NB 3ATKA 3TK9A 4D9RA 2KCYA 4XBCA 1H4WA 1W0KD 2QYIA 4NZQA 5E2OA 1LHGH 3V7TA 2CGAA 1EZQA 1EZXC 1H8HD 2W6JD 1F7ZA 2BDIA 4YLUA 4AOQA 3GISB 1C2HA 4R8TB 3ATIA 1H9IE 2QXGA 1HCGA 4LK4A 2GZ8A 1BOQA 4I86A 2OQ5A 3VEQB 4H6TA 3MO3A 2A5AA 5PTPA 2RA3A 4YTAA 3SGQE 2FODA 3M3SA 2ZU3A 3EYDA 1ZMLA 3N99A 4ACBA 2O8LA 1ESBA 1O3HA 1QURH 1TNJA 4JK6A 2ZQ2A 2CMYA 3U8RH 2Z3EA 4I8JA 4Y0YE 1BMLA 2PWXA 2TIOA 2TBSA 2W3IA 1GWAA 3D62A 4NWKA 5E0JA 1PPHE 4A1XA 2QXIA 4A1TA 4IS5A 1P01A 4XRNA 3RC6A 3SV6A 2BX4A 3IG6B 3M5NA 4Z0KA 2AMDA 1EX3A 3R0FA 5FBIA 1PPGE 2BD7A 3UTUH 1HAYB 4ISNA 3MU0A 2ZDMA 1XUIA 3W95A 5AVDA 1O3CA 1O2MA 3EE0B 3SNAA 2TPIZ 4ABIA 1CGIE 3H7TA 1MTSA 2H5DA 2NU3E 1GL1A 1W2KH 1VJAU 4U32A 3K9XB 1YC0A 2QE7D 1QB9A 2VVUA 3TNTA 1MQ6A 1O2TA 1VITF 2XCFA 4Q7XA 4YXWD 5G4BA 2WSSD 1BTPA 2Z9JA 3ZVDA 2Z9LA 1C4V2 2A5KA 2BLQA 4F49A 2BLWA 1LQEA 1QHRB 3ZVGA 3TJUA 1C5NH 1HGTH 1P3CA 3SUEA 3EGKH 4AB8A 1C2MA 2KCAA 4GSOA 2YNBA 1BJVA 1GMDF 1KXBA 2OC0A 1RJXB 1LVMA 4NWLA 5DP8A 3LGVA 4ABDA 1UTQA 1ETSH 1OXGA 2W5EA 2ZU4A 4IC6A 3RXHA 1QTFA 1J14A 1EASA 1SGCA 1RRKA 3ZZ5A 3F2FA 1C2LA 1HAPH 1K1NA 3S9CA 3I77A 2BY6X 3PTBA 2ZP0H 3QX5H 4B6FA 2A4RA 3ZZDA 1UTJA 1DX5M 2GT8A 1V2NT 3E1XB 1YPHE 2HVXA 2PFEA 3WWFA 3AW0A 1KLIH 4CRGA 1FY1A 1O2XA 2BLVA 2P3FH 2H6MA 4OM9A 3I29A 1FY3A 3P8GA 2AYWA 4TY6A 3BTGE 4DY7B 5C20A 2G51A 2WUCA 1CGHA 2GP9B 3MOCA 4JZDH 3P6ZB 2P95A 1GI9B 1TB6H 1GJCB 2EC9H 2P8OB 4CR9A 1BJUA 3BG4B 4H6SB 2PSYA 5FL7D 1DITH 2VIWA 3KN2A 5GNDA 3NKKA 1NFUA 2C8YB 2F83A 3Q3YA 1SI5H 1SSXA 1TBRH 1K1PA 1GCTC 1A0LA 1YBWA 3NPSA 1J15A 1O5CB 3OEED 3ENSB 3ZVEA 3E91A 2ZIQH 4ZH8A 1HYLA 5A2MH 1V2PT 4AGJA 5GXPA 5A8YA 1ANBA 2FM2A 3M7TA 2FZZA 3VB6A 2FOEA 1PPCE 1Y8TA 2F4LA 1BA8B 2STBE 1OWIA 4WMEA 4ZAEA 5BPEA 1IQHA 3C27B 2AFQB 2YMSD 1Y59T 1BBRK 1SQTA 2AGEX 3EDXB 5C5NA 1ZZZA 4Y76A 2ZHDA 4GHQA 2PGBB 1GHWH 3HGNA 3HK3B 3ZZAA 5C17A 1GVKB 1HAVA 8GCHF 2AH4X 2AIPA 3RLWH 4B71A 1GHZA 2ANYA 3VB3A 2BD9A 3NZIA 1A5IA 1YCPK 4X6OA 3SU0A 2VBCA 1V2RT 4CRBA 1GI7B 1BTUA 1P2JA 1O3BA
chains in the Genus database with same CATH topology
1CU1A 1HJAB 3ELAH 3GCHC 1GBBA 3LOXA 4Q2KA 4ISIH 5C2ZA 4UFGH 5F03A 2J9NA 1NRSH 4NFFA 3S0NA 2DE8A 1C1SA 1GBLA 4I7YH 1QBNA 2OINA 2QN5T 3PMJA 1OYQA 4D7GA 1F2SE 5J4SA 3QTVH 1HAXB 3TH2H 3AVZA 4INLA 3T62A 2FEQH 3O8BA 5GCHF 1NFXA 4QT8C 1PPFE 2G5VA 3BN9A 4BXSA 2O8TA 4MNYA 5HYOA 5C1UA 1T8OA 2BDAA 2EI6A 1C2DA 5CE1A 1HNEE 4GUXA 3URCA 1ZPBA 3GYLB 1O31A 2KAIA 2P8OC 1XUJA 1AKSB 1O3MA 1Q31A 4WMDA 5JBAS 3BG4C 5FPSA 2W7SA 1C1TA 3KQCA 1W11U 3F9GA 2ZU5A 3PWCA 4ABFA 2BZ6H 2R2MB 1XX9A 2UWOA 1CO7E 2WPKS 1O3DA 1A3BH 5F8TA 1O36A 3MU1A 3RXLA 4X8SH 1DLKB 2H9TH 1C5WB 1MKXH 1UCYH 1D3QB 2VIPA 1JBUH 2ZGXH 4INKA 1T32A 1P12E 2EI8A 2ZWLH 3W94A 4KELA 3ZZ7A 1UVUH 4TWWA 1W3CA 3GCNA 2H2ZA 1B7XB 4ISHH 5EXNA 3NUMA 2R3YA 1UCYE 4GVUA 1ZJDA 2BDCA 2WYJA 1TA6A 2GZ9A 1CHOF 5LH8A 4UEHH 1BTZA 1O2LA 2ZCHP 3VPKA 3PO1C 1A61H 1AWFH 2AERH 1E0FD 1EZSC 1CQQA 3P17H 4X6MA 3GCOA 3U98H 1S81A 2ZCLP 3SHCH 1SGIB 3FANA 1YPJH 3U1IB 5L2ZH 1FMGA 1HJAC 3M3VA 4DGJA 1BQYA 3M5LA 2RDLA 1OPHB 1XUHA 1WQVH 1SMFE 1SR5C 1TGCA 1MAYA 1P09A 4X1PU 1OWHA 3STJA 1AE8H 1GI3A 4X6PA 3SU4A 2J4IA 1ZMJA 4NA8A 2XW9A 2AMQA 4F4OC 1C4Y2 1C5LH 1XKBC 2AEIH 3RXIA 4MNVA 1SGFA 4HTCH 4Y7AA 4ZROA 3UPEA 3SJ9A 2HNTE 2GKVE 2J95A 4NG9H 4UD9H 4MQAA 1OX1A 4MG3A 4RN6A 3SQHE 1KDQB 3T27A 3ESTA 4VGCB 1P11E 4CBNA 1AE5A 5HMAA 3ZZBA 1JMOH 4A6LA 3RXVA 4AYYB 1O2OA 1FN8A 1FZZA 1V2VT 2F9VA 4IMQA 4ABBA 4BAKB 1TMUH 3M61U 2FPZA 3TJNA 3U69H 4WVPE 3K6ZA 1DSUA 2XRCA 1ZHPA 1OP2A 2W7UA 3RLYH 2BX3A 5FBEA 1YLDA 3P8OA 1FY8E 7KMEH 4ZKNU 1O32A 3QDZB 4ZKSU 1Q3XA 5TCCA 4YT7H 1UVOA 3RXKA 1O3PB 1VITG 1SQAA 2SGPE 1P2KA 2Z3CA 2GX4A 4BAQB 1AD8H 1DLEA 3SQEE 2Z6BD 1TX7A 2A4GA 2BVRH 1AUTC 3RU4T 3UOUA 3UY9A 1K1IA 4AX9H 3M36A 1P0SH 1C2EA 1GHXH 5K7RA 4JYVH 1EAIA 1FY5A 2ZHQH 3SNCA 1C1MA 3M7UA 1GMDG 1S83A 2D26C 1TRYA 1UTMA 2W3KA 4R0IA 1H9LB 1H8IH 3LPRA 1C5UA 2BY9X 4Y11E 1UK2A 1Y3VA 1L0ZA 2TGAA 4NSYA 4Q80A 1CBWB 1A0JA 1MTUA 3BSQA 4AFZA 3FAOA 1TNHA 1Y5UT 2PV9B 2W26A 1C5OH 1ID5H 3T28A 1AY6H 1G2LA 3GYMA 3ZZ6A 2FESH 4ABGA 2THFB 2QCYA 1SFQB 2OQUA 4Y8YA 1EPTC 2FS8A 3BG8A 4YM9A 3TPIZ 3UQVA 2Z9GA 1ZTKA 2FWWA 2OCVB 2ZFTA 3QZRA 1DWDH 1GJ4H 4E7NA 3UREA 3ODDA 3QUMP 3MYWA 1BITA 5HM9A 1SGFG 5ABWA 3SU6A 1S0RA 4OS4A 1PQAA 2WPLS 4FVBA 7GCHF 2QAAA 1PJPA 3KQEA 5FPTA 5C5OA 2J94A 5DK1A 5L6NH 1E36B 4CRCA 3SU5A 3ZYEA 1C9TA 5GJ4B 1C1RA 2GCTB 2VIVA 2AMPA 2OC8A 4IC5A 1DS2E 4NA9H 4UFDH 2ZDKA 1LVBA 1V3XA 1UO6A 1BT7A 1XXFA 1EP5A 3MNSA 1QQUA 4ZMAH 1G3EA 2ALPA 4B73A 1A7SA 4OS6A 3MH5A 4BANB 2BHGA 7ESTE 5EQRA 4RKOB 3P70B 3PMAB 2PGQB 3A7YA 2BVXH 2Q1JA 3SN8A 1K2I1 1HRTH 2ESTE 3F9FA 2WV5A 3VFEA 1GHVH 1KXEA 1ZGIA 1MMJN 5DG6A 3L3TA 4IN2A 2GT7A 3MTYA 1PQ8A 3TGJE 5DP3A 2ZNKH 1ELBA 1LMWB 3VB4A 1EAUA 1KXFA 1RTFB 2C8WB 1FIZA 8GCHG 3RU4D 1O3EA 1QR3E 2SNVA 1QFKH 1ZLRA 1QY6A 2G5NA 3RM2H 5FXLA 3JZ1B 2HALA 3TGKE 2FOGA 1UTPA 3AAUA 1L4DA 3MHWU 1P57B 4JMYA 6LPRA 3GICB 4DW2U 3RXJA 1N6XA 5FHTA 3BTME 3S7KB 2F9OA 1O2HA 1XUKA 2GMTB 2ULLA 2CV3A 1O30A 1LCYA 2ZU2A 2VH0A 4X8UH 3MNBA 1K28D 1SLXB 4A1VA 4DVAU 2C93B 3VXEH 4WY3A 1QA7A 1Y3WA 3D23A 1DPOA 1FUJA 1GBIA 1IHSH 1YLCA 3ZVBA 1GBEA 1HAGE 3ZZ4A 1F5KU 3DUXH 3KHVA 4X1RU 2CHAB 3BTQE 4Y71A 2G00A 3AAVA 1T8MA 5IDKA 2A0QB 5DPAA 3TH4H 1MCVA 4I8KA 1LHDH 4X8TH 5GIBA 1YCPM 3BTTE 1DDJA 2R0LA 2GCTC 2UWPA 1CE5A 1FQ3A 2ZGJA 1GHBG 4GLYA 1TNLA 2B9LA 1VJ9U 1O3NA 1O3JA 1G3CA 2VIQA 4K5ZA 2BOKA 1Z8JB 3RXSA 4ABAA 1DXWA 3D65E 2ZFPH 1O2JA 2FXRA 5E0GA 4U01A 3RXQA 1O3IA 1ZSLA 2GV6A 3A88A 4OS1A 4B74A 2YOLA 1C5RA 1GCDA 3QK1A 3A7WA 2A7JA 4UE7H 2WPHS 3M35A 1ZHMA 1Z1JA 1Z7KA 1SLVB 3MI4A 3ZV9A 1AB9B 3U8TH 4YOIA 2VH6A 2SGAA 1UVSH 4MPXA 1UK4A 1DUAA 3GY6A 2JH6D 4FUHA 2P94A 3I78A 1X7AC 3OYPA 4K1SA 1MD8A 4AORA 1AVWA 1RTLA 2O8MA 3GDSA 2QXJA 3KEEA 5CHAB 1YPLH 1SG8B 1D9IA 3NXPA 4D9QA 1CHOG 3OX7U 1EQ9A 1QL9A 3TK6A 3OTJE 1B0FA 1C9PA 1S82A 3CENA 2GTBA 3A8AA 3U9AH 1KXAA 1QIXB 2OBOA 3MH6A 1GVLA 2R0KA 4FUBA 1N8OB 4E05H 2TGTA 3M7QA 1QGFA 4GAWA 1TPPA 1XMNB 4HFPB 9ESTA 2BDBA 1ETTH 1C2FA 1MKXK 1UCYK 1TABE 1Q2WA 3FFGA 1A3EH 1T8NA 1MCTA 1P03A 3TNSA 1QB1A 1C5XB 3DT0H 2GMTC 1FLEE 2FOBA 1P2NA 1MD7A 1TALA 2CJIA 1SHYA 3LC5A 1S84A 1W10U 2FYRA 1E38B 3VGCB 1PFXC 1V6DA 3F1SB 3CS0A 2VIOA 4TPIZ 1W13U 1Z8GA 1HUTH 4B1TA 1DXPA 1WYKA 2CHAC 2WPMS 1GHAF 2XBXA 4BTUB 2SGEE 3LGUA 3LT3A 4GHTA 1LPGB 6ESTA 4NIWA 1DM4B 3V12A 2O8WA 1GBMA 2G52A 1ACBE 1NROH 3TK5A 1EAWA 1HJ9A 1F0SA 5EQSA 1D4PB 4K69A 3UOPA 2BD4A 3E0PB 4YT6H 1K1MA 2ZCKP 3GY2A 3BEFB 4FVDA 5T6GA 1OYTH 1TMTH 2EA3A 6GCHF 1C2KA 1W14U 1BTHH 2ZQ1A 3A89A 3PWBA 3V3MA 1M9UA 1MKWH 2TGPZ 2ZDNA 1GPZA 4MVNA 2SGDE 4MPWA 1AB9C 1SGNE 1XVMA 2GGVB 5DKMA 2FOCA 3VXFH 1ELAA 2Z9KA 3MNXA 4JZIA 4YZUA 2BVSH 3KQBA 1A46H 4DIHH 2Z3DA 1NRRH 2ASUB 1SGQE 3FZZA 3A84A 1O5BB 3SUGA 2F9UA 3LKWA 2Q6DA 2NU4E 1KY9A 2B0FA 2FMJA 4GCHG 1GJDB 1K9OE 1T7CA 1LHEH 3SI4H 5C3NA 4I8GA 2SNWA 4MTBA 1OWJA 4ZHAA 3ZZ9A 1AKSA 4JYTA 2GZ7A 1N8OC 3LGYA 4BAMB 1O2UA 2A4QA 1C5MD 2ZG0H 3A7TA 5F8XA 2AS9A 4BXWA 1A2CH 1ELTA 3Q76A 4JZFH 4B76A 1AWHB 4UONA 3LU9B 1W7GH 3U1JB 2QV1A 1Z6JH 4XBDA 2YNAA 3JZ2B 3MMGA 3OY5U 5F6MA 2BLOA 1HFDA 1AU8A 3BEIB 1GJBB 2HGTH 4BTIB 3F9EA 1KTTB 1K21H 3ZZCA 1D6RA 1YPHC 2PUQH 3KL6A 1O5AB 5F8ZA 1F5LA 3RXAA 5AHGH 2ZGHA 3A8DA 2ODQA 1NPMA 2ZHEH 2BXUH 2JH5D 1FAKH 1IQGA 3RXEA 7GCHG 1GJ6A 4CH8B 2UUKB 3SJIA 1W12U 1P2OA 5AF9H 2OC1A 2Y81A 4DURA 5EPNA 4CRAA 3MH7A 2A5IA 1ETRH 4KTCA 2FX6A 2VIDA 1LVYA 1TA2A 1NC6A 2TRMA 1ELVA 1J9CH 1GG6B 2A7HA 1AGJA 2G55A 3T29A 3RP2A 1C5SA 1AZZA 3PLPA 2BB4A 1EP6A 5T3HA 3N7OA 1QB6A 1EATA 3QZQA 2QA9E 3AW1A 2G4UA 1SL3A 2ANWA 4TWYA 1EPTA 1ANEA 2LNCA 2RA0A 4H42U 1V2WT 4KP0A 3TIUA 1NU9A 1EKBB 3TU7H 1J17T 2RCEA 1V2OT 3G01A 1CT4E 4I33A 2K1QA 1ZPZA 3MWIU 4H4FA 1S0QA 1Z8RA 2PR3A 1B0EA 2J38A 2UUFB 1OWKA 1NY22 4AFQA 1HDTH 4X2VA 1OKXA 1SQOA 5JYIA 1C2JA 3UFAA 2D1JA 1KDQA 2XYAA 4DCDA 3MO9A 1MTVA 1O3KA 2ZDLA 1RIWB 3Q3XA 1O5EH 1GHBF 3M3TA 1G36A 1SB1H 1GBAA 2FDAA 1P02A 2ANKH 1UK3A 3EA9A 3M5MA 1WBGB 4O97A 3RXRA 4THNH 2A1DB 4MDSA 3AASA 1BHXB 1T8LA 2FP7B 2A45B 1PQ7A 4CBOA 3WY8A 1A0HB 5A09A 2ZKSA 3SOSA 1WOFA 2ZHWH 4CHAB 4JCNA 1ELGA 1DANH 1SGPE 1C5ZB 1KTSB 3UWIA 4UFEH 1JRTA 1D6WA 3C1KA 2PTNA 1ESAA 4XSKU 1IQFA 3A82A 1FPCH 1BZXE 4K3JA 3FZDA 1DICA 1JIRA 2FX4A 4D8NA 1GG6C 5E8EH 1WU1A 3P95A 4DT7B 2FLBH 2VVVA 1S6FA 1YPEH 1ORFA 1NS3A 4JZ1A 3KF2A 1LVOA 1YP9A 2ZZUH 2QC2A 5LPEA 4YOGA 1YF4A 2H9HA 2V3HH 3RMNH 3HPTB 3EAJA 5HXFA 4KTUA 1TBZH 3NK8A 1HAVB 1O2NA 1EAXA 3RUOA 1RFNA 1V2LT 1LDTT 4ZKRU 5DP9A 1CT0E 1OP0A 5J4QA 1N6YA 3LC3A 1CVWH 2PHBA 1ZRKA 1O5GH 4DG4A 3DD2H 3LH1A 3BTEE 4O03A 1ZJKA 3KQDA 5EW1H 3UWJH 1RIWC 1O3FA 2HRVA 3FP6E 4YLQH 5EGMA 2BOHB 4LZ4B 1C1NA 1O3OA 2I6SA 1K22H 4X1SU 3SJ8A 1IQIA 1O2QA 4ZXXH 5HM2A 1AHTH 1SC8U 2VWLA 4UFFH 4FU7A 1MU8B 2QGRA 3PLKA 1YM0A 2A32A 3LIWA 3GY3A 2D2DA 1EXFA 1O38A 4XFQA 4WF8A 1GMCG 1Z6EA 2KAIB 4PROA 1JOUB 5AFZH 3FP7E 1G30B 1W0ZU 4Y0ZE 4CHAC 1GHAG 1V2ST 1N1LA 1GGDB 3ZZ3A 3RMMH 3Q3KA 1C4U2 2HNTC 1F0TA 1V2TT 4D76A 1GI6A 3SU2A 3P8FA 1OOKB 1TQ0B 1GI8B 1V2JT 4GCHF 1BTXA 3SHAH 2FI5E 1TIOA 1NT1A 1GJ5H 5C1YA 2HPQH 1F92A 2Q6FA 6GCHG 3GY4A 3F9HA 1O34A 1D3PB 3KNXA 1O3GA 5FPYA 1G32B 1MZAA 2H5CA 3V0XA 1GBFA 1TNGA 4X8VH 1SGYE 1FV9A 2R9PA 3RC4A 4X0WU 3SJKA 1DSTA 2Y6TA 5L30H 1QJ6B 3MU8A 1JWTA 4DOQA 1F0RA 3QTOH 2C8XB 3R3GB 1BBRH 5CMXH 3LJOA 1SOTA 1L1JA 1O2WA 3SNBA 4XDEA 1BB0B 1HJ8A 1NU7B 1S85A 1LQDB 1VITH 5C1XA 5I25A 1DE7H 3ZZ8A 3PV4A 1TAWA 1VZQH 1WTGH 4ABEA 1P2MA 5GPIB 1BBRE 4GPGA 4AG2A 3RU4E 2XC0A 4SGAE 1E37B 3B8JA 4VGCC 2Y80A 3GDVA 3T2NA 4FUCA 1XXDA 1WQSA 1OP8A 3Q00A 1ZMNA 4ASHA 3UR6A 4RSPA 1IQJA 4K1TA 1AN1E 1HLTH 2VB0A 3RXUA 3MU4A 1PYTD 2Z9IA 2ZFQH 4NZLA 1IQNA 1KSNA 5K0HA 1C5QA 1ELDE 4B2BA 2Y7XA 1O5DH 3LGIA 3RXMA 1O37A 1OSSA 1NRPH 3QGJA 3PROA 1A4WH 4NGAH 5JB9S 1EJAA 1HB0B 1TBQH 1KIGH 2BQ7B 3ZVAA 4NSVA 1W7XH 3HGPA 3EA8A 3SV9A 1PQ5A 2SFAA 2XWBI 1ARBA 1TGSZ 4DJZB 5DO4H 4TY7A 2VGCB 4KGAA 1NZQH 1P2IA 9LPRA 1BMAA 1F0UA 2CXVA 3O8DA 1WUNH 1GI2A 1P06A 3H7OA