3SGAE

Structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE A (SGPA)
publication title Structures of product and inhibitor complexes of Streptomyces griseus protease A at 1.8 A resolution. A model for serine protease catalysis.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1990-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgaE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgaE01
1C5TA 1MAXA 5DKMA 4CRBA 1LHFH 1W14U 3HPTB 1IHTH 2VVCA 2H1UA 4I8JA 3SU3A 4J2YB 1TGNA 3M3SA 3E3TA 3RXAA 2QCYA 1LQEA 1O3LA 1A3EH 1WQSA 1AUJA 3A7VA 2ZDMA 3WY8A 3A86A 2V3HH 5ETXA 3AW1A 1DVAH 2SGPE 3EA8A 2G55A 3TVJB 1YKTA 3RMOH 3E8LA 2ZF0H 4NZQA 3LDXH 4JZ1A 2ZA5A 3A8DA 1F0TA 1OP2A 1Y5UT 4JYVH 1MTSA 3STIA 1KDQA 1ZMLA 9LPRA 1QHRB 3DUXH 4Y0ZE 1HXEH 3L6PA 1MU8B 4ABHA 1UO6A 2TGTA 3F9GA 1K1OA 1DICA 1P2NA 2BZ6H 3CS0A 2ZHFH 4INHA 2F91A 3MHWU 1F0RA 1GVKB 1V2JT 1FN8A 3FZDA 1EASA 2ZU3A 1TNGA 2O8MA 1P09A 1W2KH 1TRMA 8KME2 1BRAA 1O3CA 2A4RA 3M5LA 2G5NA 3T5FH 2Y7ZA 1MAYA 2AH4X 1CA0B 4BAQB 1HAPH 2GCHF 2QXHA 2J9NA 1VCWA 1O2OA 2Z3EA 1C1TA 2XRCA 3SNAA 3PV4A 3ENSB 1ID5H 1DITH 1AWFH 2FLBH 3A83A 5K7RA 2VIPA 1A0HB 1AE5A 4CR9A 2FWWA 3EE0B 5GXPA 4KGAA 1V2VT 4FUFA 3BIUH 2GMTB 1IAUA 1B7XB 4IBLH 4A92A 4X6OA 1K1IA 2ZC9H 1HAOH 3RM0H 3A87A 5I25A 1BBRE 3UIRA 1KXDA 3PM3A 2R3UA 1O2LA 1V2ST 2FOAA 5DK1A 1ANBA 3NCLA 1ARBA 1SFQB 1EZXC 4NWLA 4B73A 2UWLA 2BD3A 3SJKA 1HAVA 4J1YA 3OYPA 4RKJB 4NSYA 2NU0E 1TPAE 4ZXXH 1G3BA 3BTME 3JZ1B 4NA8A 1V6DA 1Z8JB 2FTMA 2KAIA 3E6PH 4Y76A 4GPGA 4CRDA 1CA0C 2JETB 1XUGA 2D1JA 5JBTA 3LH3A 2SGQE 1FONA 1TMUH 4HGCA 3EA7A 1GBDA 4GHQA 1BMAA 1VITH 1PPCE 3IITA 3Q3YA 2PLXA 2Y5FA 3U8TH 1W0ZU 3MYWA 1PPFE 1P2MA 1TMTH 2GMTC 1K1MA 2ODPA 1LKAA 2C8WB 3MI4A 3ZZ7A 1EPTC 4K69A 2I6SA 3SGAE 1MBMA 5ESTE 1IQHA 4O3UA 3T26A 3AW0A 5C20A 1A7SA 4ZXYH 3ZVAA 3VB6A 3S9BA 3RDZA 5DPAA 1KSNA 4LXBH 2G5VA 2WPKS 2WV5A 3A7ZA 1HAHH 1UHBA 3LJOA 3A7TA 1BBRH 3UQOA 1G37A 1EUFA 3PWCA 3H7OA 3SI4H 3Q76A 5C1YA 4Y8YA 4FVBA 3ODDA 4R8TB 4X2YA 1HJAC 5AHGH 5EQSA 1G9IE 1HV7A 1O2XA 3SHAH 3M36A 1O2WA 4XFQA 2ZTXA 1MBQA 2JETC 1MH0A 4B1TA 5C2ZA 5FAHA 1RS0A 3VB4A 1FXYA 3K9XB 1YPEH 1XMNB 4FUHA 1QB1A 1BBRK 7LPRA 1O3FA 1DY9A 1C2HA 1OYQA 3TNSA 1GJ7B 1O2JA 1G32B 1Q2WA 5PTPA 4FUGA 1XVOA 1UTKA 1MKWK 1WAYB 1VR1H 2F9UA 5FHTA 2TGDA 3MU1A 4FUEA 1NFUA 2STBE 3P8GA 5JBBS 2W3KA 5GIBA 1HIAB 5J4SA 2R9PA 3MWIU 2WPJS 3MU8A 3RXGA 4E7NA 2Z94A 3UTUH 1ZGIA 2ZDVH 1C5XB 2VNTA 2BMGB 2Z9GA 2HGTH 1LPGB 1AKSA 3BEUA 3MO3A 1O3IA 1TNLA 1O31A 2ZU2A 3ZZBA 4INKA 2V3OH 3LU9B 1ELAA 5E8EH 2AIPA 2NU2E 2FLRH 3BTKE 4NGAH 1TNKA 1HAZB 1A46H 2ANWA 3QK1A 4ISNA 4WVPE 3C27B 1WTGH 3RXRA 3SNCA 3GOVB 2CMYA 5F03A 1A1RA 1BRCE 3FFGA 1SGTA 1GDUA 1ZHRA 2C8XB 2C93B 4GHTA 2VVUA 3U8OH 1GJ6A 3BTGE 1UTQA 3F68H 1VJ9U 1Y8TA 3ODFA 1DWDH 4XDEA 3VFEA 3ZVBA 3A7XA 1T31A 1TOMH 3ATIA 1EKBB 1O34A 1NFXA 2UWOA 4XBBA 3EAJA 1SGNE 1AHTH 3LT3A 1EZSC 1C1PA 2AIQA 1HJ9A 2F9VA 1YLCA 1K1LA 3P95A 4MLFB 4WMFA 3RC4A 2D26C 1C5NH 2OC8A 2OINA 3FP6E 1QA0A 1S84A 4A1TA 5DG6A 3W94A 1GBLA 2XNIA 1F5KU 2ZFQH 2VWLA 8LPRA 2P93A 4ZKNU 1KXEA 4DT7B 2ZFFH 2R2MB 4DIIH 2HPPH 2ZO3H 1LTOA 4UE7H 2GD4B 3RXFA 2PR3A 2CHAB 4FXGH 3BV9B 1ESTA 1AY6H 1NM6A 2BY5X 4ESTE 2F9BH 2BD5A 1S6FA 4UFEH 2AGGX 2IPHA 1FIZA 2BM2A 2J95A 1KLTA 3PTBA 1QBNA 5EGMA 1MQ5A 1GI3A 2AGEX 4R0IA 1V2QT 2DE8A 1GI7B 3UREA 5LGOA 3B8JA 3RXIA 5C5NA 5AVDA 1YCPK 4CRFA 3M7TA 4Y7BA 1AB9B 1XXFA 1C9TA 1VJAU 3D49H 1SG8B 2WPHS 1EAXA 3MNCA 3A80A 1KXCA 2VWNA 1EP5A 3C1KA 1TNIA 4TYDA 1TGCA 1DLKB 3KQBA 1LQDB 1G36A 1EATA 2A2XH 1NESE 3LGVA 1ARCA 3FP8E 5I46H 1O2HA 1KTSB 2C4FH 1GJ5H 1FMGA 1TBZH 2OBQA 4LZ4B 1E35B 2J94A 2BVRH 2BDCA 2QY0B 1V3XA 3Q3XA 5IDKA 3OX7U 1HGTH 5EQQA 3RU4D 1OOKB 4X8VH 3SUEA 3LKWA 1C5UA 4D76A 1D3PB 1UTNA 1TAWA 1Y3WA 1H9HE 5DO4H 5T3HA 2TPIZ 3GDVA 1ESBA 4NFFA 2FESH 3IWMA 1IQMA 4M7GA 4UEHH 1K2I1 2FODA 3SJ8A 3MH6A 1UTJA 1VITF 1C2EA 1SLUB 1OWKA 3LONA 5L2ZH 1RRKA 1UTPA 3SBKA 4KTCA 2VWMA 2BVSH 1C4U2 2PFEA 4U30A 3SGQE 1IQJA 1SGCA 1L1GA 4AYVB 1BA8B 3QZQA 1ACBE 1O2NA 4X1SU 1NROH 3NKKA 5TCCA 1PQ5A 1ZLRA 1P12E 3SQHE 2Y6TA 3K2UA 3M3TA 3ZV8A 2QXJA 1BTHH 1E38B 2R0LA 3TH3H 2ZG0H 1L4ZA 1EAWA 1E37B 1AO5A 3A85A 4XE4A 2TGPZ 1KDQB 3QWCH 3TK6A 2IOTA 2TRMA 4FUCA 4OGXA 3VB5A 1O3MA 5GCHF 1RIWC 3BTHE 4I8KA 1MTNB 5DGJA 5T6GA 3ZZ3A 2VB0A 4K1SA 3GCNA 5EODA 2ZU4A 1UVUH 2H9HA 2TGAA 4K1TA 5EXLA 3PMHB 4AB9A 1WYKA 2BDBA 4ABBA 1SLWB 2PW8H 1OSSA 1QRZA 1O2TA 3PMAB 1DANH 4RKOB 1AIXH 2VIWA 1A5IA 1EZUC 1ELVA 1ZPZA 3IG6B 1B0FA 3DA9B 5SGAE 5HYOA 4Q80A 1BHXB 1OS8A 2A7HA 3OU0A 5AF9H 3TGIE 4D9RA 4X6NA 1GBHA 2PUQH 4O9VA 4ZHMU 4WH8A 4U32A 5A8YA 3N7OA 2ZGBH 2SGAA 2A32A 2Z9LA 3UY9A 4AFQA 2IJOB 5T6DA 3V13A 3ZV9A 3RXVA 4BOHA 1HB0B 1HRTH 1O3AA 1YPGH 1G3EA 2BY6X 1DUAA 1SQTA 3SU1A 1PQAA 1D6WA 3V3MA 1S5SA 4A1XA 3AAVA 1QBOA 3MH5A 1LVMA 2AYWA 1THSH 1MTNC 5LH8A 2UUFB 4K1EA 3TIUA 4FUJA 2UUKB 1GJ8B 2WPMS 1C5WB 2FX6A 3D65E 2GV6A 3HGNA 3RXEA 3RXHA 2ALVA 1HPGA 5AFYH 1TA6A 2B9LA 4GAWA 1GJAB 1Y3VA 1L1JA 4I7YH 2BOKA 2HPQH 1GBMA 2W7UA 3SORA 1AN1E 3SUFA 1FPHH 4ZAEA 3RMNH 5FPTA 2BD4A 1OWDA 4ISIH 1OWEA 2SGFE 1SGYE 1D3TB 3GDSA 4I8HA 3S0NA 4BAMB 5EOKA 1SOZA 4CHAB 1GBBA 3M61U 2VU8E 2PTNA 2WINI 1GI5A 2F3CE 1G3CA 7GCHF 3ELAH 3U1IB 4TPYA 1SOTA 3I29A 2G4UA 4NSVA 2CF9H 1MD7A 2H5CA 3GY6A 3RXLA 1NRPH 3E0NB 1O2SA 2ZFSA 2PTCE 3SV8A 1IQEA 1YF4A 1AGJA 4DVAU 4JK6A 1WCZA 1J14A 3QX5H 4WJG2 1QJ6B 2A31A 1J8AA 1GWAA 1QFKH 1PPBH 4IN2A 1GMCF 1O2YA 1SGRE 1UHBB 4BANB 1QJ1B 1SGFA 3GY3A 2J2UA 4D8NA 4BXSA 1HAGE 5CHAB 3DFJA 5FX6A 1C9PA 3B23B 1AZ8A 1QQUA 2QC2A 2ZP0H 1D3DB 2P3UB 1GJDB 2UWPA 4AN7A 2YOLA 4SGBE 1E36B 1FY5A 2F9OA 1K21H 2ZFTA 2FIRH 3G01A 2HNTE 3MNSA 2FXRA 1YGCH 3PTNA 1NRRH 1ABJH 1NRQH 1JMOH 4NZLA 1BMLA 3BTTE 3RP2A 2XBVA 1K1PA 1OP8A 1P57B 1UCYE 1TABE 2ZDKA 3FANA 1TX7A 1DX5M 3RLWH 1RD3B 5K0HA 1GHWH 2FYRA 2A4QA 3SJOA 4X8UH 4MG3A 3V0XA 8GCHG 1BB0B 2FYQA 2J92A 2ZKSA 1LHDH 1AKSB 4A6LA 2A5IA 4TY6A 4YOJA 4ISLA 1O3EA 1BTXA 1Y3XA 3RXKA 3DFLA 4A7IB 1HCGA 4AFZA 4DJZB 3SNBA 4CBOA 1TNJA 2PKSB 1FI8A 1GMDF 3SU5A 4WWYA 1HAXB 1H9LB 3A7YA 3LGIA 4BAHB 5CHAC 4QT8C 2W3IA 3QUMP 3ZVGA 3DD2H 1ZZZA 2XCFA 3A8BA 3P70B 5FCRA 1GI0A 1V2OT 1O2IA 3RXTA 6GCHF 3EYDA 3F9HA 1ELEE 3A8AA 1UJ1A 3UUZA 2H6MA 3D62A 1ELCA 4AFSA 1B0EA 1TLDA 1FY1A 1A0LA 5A0BA 1HUTH 4MQAA 4LZ1H 4ABFA 4DOQA 1GBJA 5EU8A 4JYUH 3KEEA 1O36A 5JDUB 5JYIA 2QIQA 1Y5BT 2BD9A 3TK9A 4O97A 3R3GB 1A4WH 1QRWA 1ZOMA 2OCVB 1D9IA 2A7CA 2Y80A 3K6YA 3MFJA 1MUEB 3TNTA 2VH0A 2TIOA 1LPKB 1Z8IB 1GMHG 3LPRA 1YLDA 2BLVA 1VITG 5C5OA 1DSTA 1LHEH 1YC0A 1O2UA 1P10A 2J4IA 4CR5A 4X1PU 2XYAA 1ZSLA 1V2LT 2Q1JA 1IQKA 2ASUB 1BJUA 1C5LH 3GICB 1Z8GA 1UCYK 4X2XA 1K1JA 3Q3KA 7KMEH 3RXPA 2GV7A 1XKBC 3V7TA 3NUMA 1ETRH 3ATMA 3P6ZB 6CHAB 1C2IA 1EP6A 4TWYA 2W5EA 1LVYA 1T8MA 2XCNA 1TA2A 1JWTA 2UUYA 2FI3E 1P05A 5C1XA 1UVPA 1CHOG 4UD9H 4YO9A 1W3CA 3ATWA 2BDIA 4GSOA 1H8DH 3O8CA 2BTCE 2JH6D 3HKIB 3R0FA 1QRXA 1P2KA 2C90B 1YPHE 4BXWA 1LHCH 4NA9H 1JRTA 4XBDA 1LHGH 1FV9A 4K8BA 3LOXA 2GGVB 1EOLA 2B7DH 1GHAG 4WF8A 1LKBA 3L33A 1P2QA 2FS8A 1PPHE 1RTKA 3BSQA 4CREA 1F2SE 1C2LA 4ABIA 3AASA 4B71A 4LOYH 4YZUA 4IMZA 4MPWA 3K6ZA 3OY6U 3P92A 4IN1A 3SUGA 2VIVA 4MNXA 4HZHA 1LPZB 2VIOA 1O2PA 2P3TB 3SO3A 3U8RH 2ZCKP 1BMMH 1MKWH 1BCUH 1S0RA 5GWZA 1C5OH 3A7WA 5JBAS 4X8TH 1EJAA 1V2NT 3RXSA 2FZZA 2GZ7A 1CT4E 1DE7H 1TB6H 4IGDA 5J4QA 1WSSH 1P04A 1PYTD 1F0UA 1KXAA 1A2CH 2AMPA 1JIMA 1V2WT 6ESTA 3SW2B 1O37A 1AMHA 3AAUA 2P8OB 2VVVA 5ESBA 1KXBA 1TOCB 2BY7X 4Y7AA 1TPSA 2XXLA 2M5TA 2FOFA 3EA9A 3HATH 3GCTG 2P16A 1SQOA 2PV9B 5E2PA 4I31A 3VGCB 4K8YA 3ZVCA 2ZNKH 1T8NA 1ZR0A 1GJ4H 1GL1A 1O2GH 1CE5A 3TJVA 2ZQ2A 7GCHG 5EG4A 3AVZA 5ABWA 4UDWH 1C2DA 2A45B 1F0SA 1TWXB 1S82A 1NN6A 1P9SA 5B6OA 4FUIA 2VJ1A 1CT0E 2PUXB 4KKDA 1GBAA 1GVLA 2OQUA 2WYJA 4WMDA 1A3BH 1Z6EA 1ZSKA 1V2KT 1GHBF 4ZH8A 2WPLS 1QURH 1Q3XA 2BD8A 4XSKU 3SV2H 4BNRA 1GBCA 1BTZA 2ANYA 1Y3YA 3OTJE 2GTBA 2AMDA 1ETSH 2C8ZB 3TJNA 4MVNA 5EXNA 4X0WU 4TWWA 4Y8XA 1NFYA 1C1RA 2ZHEH 3ZZ4A 4AFUA 4CRCA 1O3JA 4ZUHA 2HALA 2G00A 1A0JA 3SNDA 3QLPH 2P8OC 4VGCB 2AERH 4GCHG 4K5ZA 4UFGH 3BF6H 2FMJA 4H6TA 1D3QB 3HK6B 3VGCC 2QYIA 1HDTH 3MO9A 1BQYA 1QIXB 1GI4A 2Z9JA 4OS5A 1H8IH 1GDQA 1J17T 2BHGA 1PPGE 3GCHB 4FVDA 1P11E 3FAOA 3ZZ6A 3M3VA 4LK4A 3PLPA 4ABGA 3A81A 5F8XA 3E90B 3RU4E 2FTLE 3OSYA 1YCPH 2Q6GA 2A4OA 2EC9H 3LGWA 1O2VA 1YPMH 4AX9H 1TE0A 4INLA 2W7SA 1O39A 3S7KB 5DJ7A 4ZMAH 3GYLB 2V6NA 4NCYA 1C5SA 4YT6H 1P3EA 5F8TA 4DCDA 2STAE 1OKXA 4H42U 1IQGA 1EAIA 1ANDA 4MNYA 2ZDLA 1FY3A 1EAUA 3ITIA 4OS4A 4VGCC 3VEQB 5LPFA 1SGEE 4Z0KA 1ORFA 1QY6A 1O32A 1SC8U 3U1JB 5L30H 1GBTA 4BTTB 1NS3A 2XTTB 3MMGA 1V2PT 1BT7A 1OPHB 2BVXH 1O3PB 2ZGCA 1FN6A 4OS2A 2GCHG 3BEFB 4PROA 5FCKA 3RC5A 1EJMA 1N1LA 3F9EA 2PWXA 4GUXA 5C67A 1IHSH 4UFDH 1V2TT 2ULLA 1SHYA 2FOBA 1NRSH 1K9OE 2FM2A 1P01A 2Z7FE 2CHAC 4H6SB 1AZZA 3E16B 3LH1A 4X2VA 2ZWLH 1W11U 2H9EH 1Q31A 1MZAA 2FX4A 1FNIA 3ATLA 4B2BA 1ZYOA 5L6NH 1KYNA 2BOHB 4CRGA 3VPKA 1N6YA 5GDSH 1AB9C 3SV7A 1YPJH 4ABJA 3UNQA 3M35A 3P17H 1BMNH 1SGDE 2ZHWH 3SNEA 4JZIA 2RCEA 1DXWA 4AGKA 1EOJA 3SZNA 2XBWA 1C2GA 1SGPE 1NFWA 1V2RT 3QGNB 2H9TH 5E0HA 1U6QA 3NWUA 4AG2A 5JB8S 1LO6A 1O2KA 1W7XH 1TQ7B 3P8OA 1OX1A 2RG3A 3ZYDA 4BTUB 1UK4A 3SUDA 1Z1IA 3S7HB 1KLJH 2ZIQH 1HJ8A 2ESTE 1P06A 3MU4A 2A1DB 1FJSA 2VH6A 2C8YB 3NK8A 1BZXE 1ZMJA 1T8LA 4AB8A 1ZPBA 1XUFA 4B2CA 4RN6A 4OGYA 1GHVH 3TITA 2QF0A 3GYMA 2P59A 1WBGB 1O2MA 4WY3A 4Y0YE 5FBEA 2JKHA 7ESTE 1BDAA 1ELBA 2HWLB 2UUJB 1O33A 4HI3A 4NG9H 1OXGA 1C5MD 1O3NA 4JYTA 4JZEH 1SFIA 3A89A 3TJUA 2HVXA 4DURA 2ZCHP 1TBRH 1JOUB 1TGTA 1X7AC 3KL6A 3UNRA 1SHHB 1XUHA 2GVFA 1LCYA 4ZROA 1C5QA 1ZHMA 4CH2B 3BTEE 2GP9B 1NY22 2GKVE 3L3TA 3KIDU 1C1SA 1VZQH 1QJ7B 1SQAA 1GCTB 1C5VA 1O3DA 1N8OB 4OS6A 3TPIZ 2ZDAH 1GI8B 1E34B 1NT1A 2A0QB 1GGDB 1MZDA 1MTUA 1W13U 1GL0E 3ZZAA 4D9QA 2GZ9A 2XWBI 3CP7A 2P3FH 1GG6B 2FO9A 1O3OA 4ZKRU 1QL8A 3QO6A 2PKAB 2QV1A 1SLVB 1ZPCA 4MPUA 1Y3UA 2CN0H 3CS7A 4O3TA 1BRUP 5JB9S 3MNXA 2OTVA 1PJPA 5EW2H 1CGIE 1HFDA 2FDAA 3F1SB 1Z7KA 2GDDA 1XVMA 1BTUA 2RDLA 4B75A 2EI8A 3GISB 2FS9A 2XC0A 3A84A 1G2LA 4I8GA 2FEQH 4FU7A 4ZHLU 5IYTA 2Z9IA 2OUAA 1NTPA 4KTSA 2B8OH 2QAAA 1H9IE 2ZI2H 4KELA 5E2OA 5DP5A 1YPLH 4AGJA 3EDXB 5TCAA 3K65B 4X1RU 2XBYA 3GCOA 1O5DH 1P0SH 2QXGA 1PPEE 4WMEA 3LC5A 2FOHA 5DP4A 1M9UA 4DGJA 1GCTC 1N8OC 2ANMH 2XBXA 3BIVH 4YT7H 1C1WH 4B2AA 2QN5T 2FI4E 1C1MA 1GGDC 1AD8H 1GJBB 1CHGA 1P03A 2BDAA 4IS5A 5F8ZA 4Y10E 3NXPA 5DP9A 1E0FD 3HK3B 3T62A 1PYTC 1GG6C 1MCVA 2G81E 2GT8A 3TLOA 4D7GA 2BXTH 5EQRA 3PYHA 2WV4A 3BTFE 2B5TB 1AFEH 2QXIA 1D4PB 1ZTLA 5CMXH 1FPCH 2Y5HA 3DT0H 2GDEH 3MH4A 2Y82A 2A5KA 1GHZA 4DIHH 1GPZA 2J38A 3M5MA 2H2ZA 1B5GH 1GI9B 2NU4E 3A82A 1BJVA 2GT7A 3TJOA 1ELTA 2EI7A 3UOUA 1D6RA 4Y71A 1XXDA 3H5CB 3M7UA 5FXLA 3W95A 3SU2A 3M37A 4FUBA 3FP7E 1SI5H 1N6XA 1J16A 4NIYA 3ZVDA 5C3NA 1SMFE 4JCNA 5TJXA 5L2YH 1QL9A 2ZU5A 4AZ2B 4OS7A 2BQ6B 3T29A 2CJIA 3ZYEA 4ABEA 4CHAC 1QNJA 3SI3H 2ANKH 1XUKA 4YLQH 1PPZA 4FUDA 1P2IA 3QTOH 1DFPA 2FOEA 2RA3A 4K2YA 2G4TA 5EPNA 1O5BB 2ZGXH 1GI1A 3PO1B 3MU0A 3U98H 4NIWA 1KTTB 3NPSA 3D23A 1SGFG 1OYTH 1NPMA 2R0KA 1UTMA 1O5EH 2ZFRH 1QR3E 1UMAH 5BPEA 3ZZ8A 1AVWA 1TX6A 1F5LA 3U69H 2R2WU 4IC5A 5EW1H 2ZFPH 2JH5D 1T7CA 1TPPA 4Q7XA 2ZPSA 4TY7A 1ANCA 2GCTB 1MTVA 1P3CA 1SB1H 5FPYA 4DY7B 3V12A 3F9FA 2IN2A 3PWBA 3RMLH 1QCPA 5F6MA 2BZAA 3KQEA 3ZZ9A 4Y6DA 5C1UA 5FX5A 2JH0D 1W12U 1L2EA 1RXPA 3RXQA 4UONA 1RJXB 3KNXA 2WPIS 3TH2H 5AFZH 9ESTA 4X8SH 3LC3A 3KN2A 3BG4B 1LMWB 1CBWB 1HYLA 1Z6JH 2QF3A 1O3GA 1JXPA 1CO7E 3SU6A 2XWAA 1CQQA 4ZHAA 3PO1C 4BTIB 1RTLA 2BQ7B 1OWIA 3ESTA 3P8NA 2G52A 4Q2KA 1GBFA 2HRVA 2ZPQA 2BY9X 1O3HA 3RXCA 3Q77A 1UCYH 4MNVA 4NIXA 2PSYA 2BLWA 2SFAA 3KGPA 1A5GH 3BG8A 1W8BH 2H5DA 3UOPA 1BTYA 2A7JA 1ZRKA 1SPJA 2ZDNA 3VB3A 1P02A 2Y81A 1WTHD 1WV7H 2PKAA 2ZQ1A 3RU4T 2PKSC 2AFQB 1ZGVA 2GCTC 1BIOA 3SN8A 1O0DH 3SGBE 3STJA 1EQ9A 1TGSZ 2QA9E 3MH7A 4JK5A 2G51A 3ATKA 1C1OA 3UPEA 1O5CB 1IQLA 1EPTB 1W10U 1UVSH 1GBEA 5E0JA 5GCHG 1IQFA 2ZCLP 1S6HA 2BX4A 1O2RA 2ODQA 4F49A 1DS2E 1EB2A 1THRH 3P8FA 4MTBA 5LPRA 1FIWA 4ABAA 3RMMH 1AQ7A 2VIQA 2V35A 3BG4C 1VCPA 1CBWC 2SGEE 2Z9KA 1AI8H 1GI6A 2Z6BD 3UNSA 3URDA 3RXOA 1TPOA 1YM0A 1YPKH 1F92A 1C2KA 4AG1A 3ZVFA 1FY8E 1HJAB 1ABIH 2A5AA 1TBQH 3EGKH 2ZEBA 3GY4A 4X1QU 1BITA 1ZJDA 1AE8H 4RSPA 1EZQA 3MU5A 3O8BA 1A61H 1NZQH 4WH6A 2YNAA 1XKAC 1A5HA 1IQNA 1KY9A 4KTUA 1SVPA 4U01A 1DWCH 2ZPRA 1UVOA 2CV3A 4E7RG 4U2WA 1TRNA 1PQ7A 1QGFA 1CA8B 3TGJE 1BTWA 1DWBH 1BUIA 2XC5A 2ALPA 2AS9A 3ZVEA 2BD2A 6CHAC 4B74A 4CBNA 1DWEH 2GZ8A 4TPIZ 1RTFB 3A8CA 4YLUA 3UWIA 3ZZDA 4CH8B 3RXUA 1NU7B 2XW9A 1UVTH 2XC4A 4I8LA 3T28A 2K1QA 2BDHA 4IW4E 1TX8A 4SGAE 2BDGA 2VGCB 2EI6A 2GX4A 2RA0A 2WUCA 1QBVH 4MPVA 1T4VH 3HKJB 1L1NA 1GVZA 2G8TA 2F9NA 1C5PA 2THFB 5A8ZA 5A2MH 1EX3A 4ZKOU 1KXFA 1Y59T 3KQCA 3VXFH 1IQIA 1O38A 4JMYA 2PGBB 1YYY1 1H4WA 1UTOA 2EA3A 4DG4A 5CE1A 3GY5A 1DLEA 3VB7A 4AORA 1H1BA 2A4GA 1GBIA 1Y5AT 1XM1A 1J9CH 3BTDE 2AMQA 2ZHDA 2FOCA 2P95A 4THNH 1C5YB 1O2QA 3RXJA 5HGGA 5A09A 2B0FA 1V2MT 1C2JA 2PGQB 4YOGA 1G3DA 1ELGA 5EPYA 4BAKB 1TQ0B 1LVOA 1ELFA 2ZHQH 1GMCG 3QDZB 4K3JA 1HAYB 1AWHB 2LNCA 3MOCA 1DUEA 5A0CA 3ZZCA 1W7GH 1FQ3A 2FP7B 3UWJH 1WUNH 1S0QA 4UFFH 2VGCC 1HAIH 1L0ZA 4O03A 3RXMA 5A0AE 4HFPB 3KHVA 3SOSA 3QTVH 4AOQA 1VGCB 2EEKA 2OC7A 2BYAX 1PQ8A 2OLGA 2BDYA 8ESTE 2ZTYA 4XOJA 5DP3A 4ISHH 3EQ0H 3RM2H 2D8WA 5H4IB 5JBCS 1ZHPA 3PLKA 1P2JA 3MNBA 3GY8A 4Y79A 4H4FA 1CGJE 1ETTH 5EXMA 2PSXA 1TGBA 1SGIB 4IMQA 1NC6A 4F4OC 2A2QH 5FPSA 2Z3DA 3KF2A 1CGHA 4MDSA 1CSOE 1TYNA 4NIVA 2BB4A 4K60A 3F6UH 4X6MA 3RXDA 4A1VA 1EPTA 3LGTA 2HNTF 4YM9A 4A5TS 1GMDG 1ESAA 1QTFA 5HM2A 4KP0A 2W26A 4YTAA 3T27A 1CVWH 1RGQA 3QN7A 2O8TA 4Y8ZA 1RFNA 1EB1H 1P9UA 3PROA 2FPZA 1VGCC 2BLOA 1T32A 3BTWE 1TFXA 6GCHG 1S83A 2OQ5A 1GBKA 1MCTA 4NA7A 1GCDA 1GJCB 3RUOA 3KCGH 8GCHF 2PHBA 2BX3A 2BXUH 1KIGH 1DM4B 3H7TA 3O8DA 3KQDA 2DUCA 4NFEA 2ILNA 4ISOA 4ZKSU 3GCHC 4IC6A 2P94A 2Z3CA 3TH4H 3PMJA 1QQ4A 2OBOA 5E0GA 5A8XA 4YOIA 3FZZA 2O8LA 1P8VC 4B76A 4XBCA 2Q6DA 3TU7H 3BTQE 2O8WA 1S85A 1IOEA 1EJNA 1LVBA 1NRNH 4WXIA 1BTPA 1KLIH 1XX9A 1TALA 2ZECA 2VWOA 1DPOA 1HBTH 3M7QA 1RIWB 1CU1A 2C3SA 1ELDE 1PFXC 1J15A 1O5GH 3RC6A 2BQWB 2DE9A 1UTLM 1QL7A 3PB1E 2WYGA 4FU8A 2VIDA 2OC1A 1F7ZA 1Z71A 1C4V2 4NWKA 5HM9A 3B9FH 1UK2A 1GMHF 1O30A 1DSUA 3JZ2B 4MNWA 1INCA 1LDTT 2TBSA 3DHKH 1TIOA 3T25A 3BEIB 1ANEA 3PMBB 2YNBA 3M5OA 3SHCH 4I33A 3UR9A 1AUTC 4ASHA 1EXFA 2HNTC 1HXFH 5DP7A 4BAOB 2O9QA 1K1NA 1SSXA 3GY7A 2Q6FA 3UQVA 1C1QA 3A88A 1DOJA 4I32A 1FAKH 1CT2E 4X1NU 1BHXF 1DT2A 3U9AH 3QGJA 3UFAA 5G4BA 3SJ9A 4D7FA 2R3YA 1QB6A 2FOMB 1JBUH 2ZGJA 2V0BA 1HIAA 1O3BA 2ZU1A 1MQ6A 2FI5E 2NWNA 3E1XB 1FUJA 5GJ4B 1CHOF 1JRSA 5FBIA 1UK3A 1GI2A 1C5ZB 1L4DA 1OP0A 2VINA 1AFQB 1TRYA 2SNVA 5DP6A 3RXBA 4GVUA 1TNHA 5HMAA 1AVXA 6LPRA 2OP9A 4AYYB 1K22H 2AEIH 4Z6AH 1YP9A 2CGAA 3S69A 3E0PB 3LIWA 2BY8X 4OS1A 1GHAF 3SU4A 3NZIA 1BRBE 3OY5U 1S81A 1WOFA 1C1NA 2QGRA 1AU8A 1MD8A 1O3KA 3LGUA 1C4Y2 2F83A 5HXFA 5BRRE 1SLXB 1O35A 1MKXH 1O5FH 3URCA 2O8UA 3SJIA 2LPRA 3ZZ5A 1SL3A 1THPB 3Q00A 5DP8A 2AGIX 3VXEH 1TMBH 1W0YH 1FAXA 1T4UH 4E06H 3LGYA 3MO6A 2I6QA 2HLCA 2SNWA 1C2FA 2NU3E 2OC0A 3SU0A 1MKXK 1SGQE 3LJJA 3M5NA 2BD7A 3GDUA 1OWHA 1TONA 5JPMH 2J34A 1WQVH 2HOBA 2Y7XA 4YESB 1C5RA 1AFQC 4ABDA 1DDJA 1GHXH 1HAVB 2BLQA 1Z8RA 2NU1E 1OWJA 4JZFH 1ZSJA 5LPEA 1GHYH 2D2DA 1F5RA 4DW2U 2OXSA 3O8RA 4MPXA 1V2UT 1G30B 1C2MA 2KAIB 3E91A 2CF8H 2SGDE 1GHBG 1HNEE 1XUJA 1FZZA 4JZDH 4X6PA 4Y11E 3T2NA 1P2OA 3GCTF 1K28D 3UR6A 1JIRA 3I78A 1GDNA 1T8OA 1VCQA 1DXPA 1QB9A 3GY2A 3TGKE 1G2MA 1ZTJA 3RLYH 1YBWA 1Z1JA 1SBWA 1O5AB 3TK5A 4Q7YA 1DY8A 4GLYA 1ZMNA 1AVGH 1C1UH 2ZTZA 1HLTH 5T6FA 2F9PA 2ODYB 2ZZUH 2OD3B 1NU9A 3SV6A 4CRAA 1MU6B 4WXVA 3I77A 1XUIA 1MMJN 1FDPA 2ZGHA 3MTYA 1FLEE 3BN9A 1ZJKA 3HGPA 3SV9A 3FVFB 4FU9A 3PLBA 1WU1A 3CENA 1YPHC 1NO9H 1QA7A 4Q7ZA 5GPIB 1YCPM 4X2WA 1BOQA 1FY4A 1ZTKA 2WUBA 3QZRA 4E05H 2CXVA 1ZRBA 1MTWA 3SQEE 2Y5GA 2FOGA 3S9CA 1C1VH 4GCHF 1SR5C 4HTCH 1GJ9B 1O2ZA 3S9AA
chains in the Genus database with same CATH superfamily
1C5TA 1MAXA 5DKMA 4CRBA 1LHFH 1W14U 3HPTB 1IHTH 2VVCA 2H1UA 4I8JA 3SU3A 4J2YB 1TGNA 3M3SA 3E3TA 3RXAA 5KECA 2QCYA 1LQEA 1O3LA 1A3EH 5KEDA 1WQSA 1AUJA 3A7VA 3VG8A 2ZDMA 3WY8A 3A86A 2V3HH 5ETXA 3AW1A 1DVAH 2SGPE 3EA8A 2G55A 3TVJB 1YKTA 3RMOH 4RT0A 3E8LA 2ZF0H 4NZQA 3LDXH 4JZ1A 2ZA5A 3A8DA 1F0TA 1OP2A 1Y5UT 4JYVH 1MTSA 3STIA 1KDQA 3PRDA 1ZMLA 9LPRA 1QHRB 3DUXH 4Y0ZE 1HXEH 3L6PA 4ACBA 1MU8B 4ABHA 1UO6A 2TGTA 3F9GA 1K1OA 1DICA 1P2NA 2BZ6H 3CS0A 2ZHFH 4INHA 2F91A 2KM0A 3MHWU 1F0RA 1GVKB 1V2JT 1FN8A 3FZDA 1EASA 2ZU3A 1TNGA 2O8MA 1P09A 1W2KH 1TRMA 8KME2 1BRAA 1O3CA 2A4RA 2L6OA 3M5LA 2G5NA 2XOKD 3T5FH 2Y7ZA 1MAYA 2AH4X 1CA0B 4BAQB 1HAPH 3F0PA 2GCHF 2QXHA 2J9NA 1VCWA 1O2OA 2Z3EA 1C1TA 2XRCA 4XD7D 3SNAA 3PV4A 3ENSB 1ID5H 1DITH 1AWFH 2FLBH 3A83A 5K7RA 2VIPA 1A0HB 1AE5A 4CR9A 2FWWA 3EE0B 5GXPA 4KGAA 1V2VT 4FUFA 3BIUH 2GMTB 1IAUA 1B7XB 4IBLH 4A92A 4X6OA 1K1IA 2ZC9H 1HAOH 3RM0H 3A87A 5I25A 2WPDD 1BBRE 3UIRA 1KXDA 3PM3A 2R3UA 1O2LA 1V2ST 2FOAA 2QF4A 5DK1A 1ANBA 3NCLA 1ARBA 4B6FA 1SFQB 1EZXC 4NWLA 4B73A 2UWLA 2BD3A 3SJKA 1HAVA 4J1YA 3OYPA 4RKJB 4P02A 4NSYA 2NU0E 1TPAE 2RDEA 4ZXXH 1G3BA 3BTME 3JZ1B 4NA8A 1V6DA 1Z8JB 2FTMA 2KAIA 3E6PH 4Y76A 4GPGA 2QF5A 4CRDA 1CA0C 2JETB 1XUGA 2D1JA 5JBTA 3LH3A 2SGQE 1FONA 1TMUH 4HGCA 3EA7A 1GBDA 4GHQA 1BMAA 1VITH 1PPCE 3IITA 3Q3YA 2PLXA 2KCAA 2Y5FA 3U8TH 1W0ZU 3MYWA 1PPFE 1P2MA 1TMTH 2GMTC 1K1MA 2ODPA 1LKAA 2C8WB 3MI4A 3ZZ7A 1EPTC 4K69A 2I6SA 3SGAE 1MBMA 5ESTE 1IQHA 4O3UA 3T26A 3AW0A 5C20A 1A7SA 4ZXYH 3ZVAA 3VB6A 3S9BA 3RDZA 5DPAA 1KSNA 4LXBH 2G5VA 2WPKS 2WV5A 3A7ZA 1HAHH 1UHBA 3LJOA 3A7TA 1BBRH 3UQOA 1G37A 1EUFA 3PWCA 3H7OA 3SI4H 3Q76A 5C1YA 4Y8YA 4FVBA 3ODDA 4R8TB 4X2YA 1HJAC 5AHGH 5EQSA 1G9IE 1HV7A 4Q4LA 1O2XA 3SHAH 3M36A 1O2WA 4XFQA 2ZTXA 1MBQA 2JETC 1MH0A 4B1TA 5C2ZA 5FAHA 1RS0A 3VB4A 1FXYA 3K9XB 1YPEH 1XMNB 4FUHA 1QB1A 1BBRK 7LPRA 1O3FA 1DY9A 1C2HA 1OYQA 3TNSA 1GJ7B 1O2JA 1G32B 1Q2WA 5PTPA 4FUGA 3SYJA 1XVOA 1UTKA 1MKWK 1WAYB 1VR1H 2F9UA 5FHTA 2TGDA 3MU1A 4FUEA 1W0KD 1NFUA 2STBE 3P8GA 5JBBS 3AK5A 2W3KA 5GIBA 1HIAB 5J4SA 2R9PA 3MWIU 2WPJS 3MU8A 3RXGA 4E7NA 2Z94A 3UTUH 1ZGIA 2ZDVH 1C5XB 2VNTA 2BMGB 2Z9GA 2HGTH 1LPGB 1AKSA 3BEUA 3MO3A 1O3IA 1TNLA 1O31A 2ZU2A 3ZZBA 4INKA 2V3OH 3LU9B 1ELAA 5E8EH 2AIPA 2NU2E 2FLRH 3BTKE 4NGAH 1TNKA 1HAZB 1A46H 2ANWA 3QK1A 4ISNA 4WVPE 3C27B 1WTGH 3RXRA 3SNCA 3GOVB 2CMYA 5F03A 1A1RA 1BRCE 3FFGA 1SGTA 1GDUA 1ZHRA 2C8XB 5C94A 2C93B 4GHTA 2VVUA 3U8OH 1GJ6A 3BTGE 1UTQA 3F68H 1VJ9U 1Y8TA 3ODFA 1DWDH 4XDEA 3VFEA 3ZVBA 3A7XA 1T31A 1TOMH 3ATIA 1EKBB 1O34A 1NFXA 2UWOA 4XBBA 3EAJA 1SGNE 1AHTH 3LT3A 1EZSC 1C1PA 2AIQA 1HJ9A 2F9VA 1YLCA 1K1LA 2WSSD 3P95A 4MLFB 4WMFA 3RC4A 2D26C 1C5NH 2OC8A 2OINA 3FP6E 1QA0A 1S84A 5CHBA 4A1TA 5DG6A 1KMHB 3OE7D 3W94A 1GBLA 2XNIA 1F5KU 2ZFQH 2VWLA 8LPRA 2P93A 4ZKNU 1KXEA 4DT7B 2ZFFH 2R2MB 4DIIH 2HPPH 2ZO3H 1LTOA 4UE7H 2GD4B 3RXFA 2PR3A 2CHAB 2V3MA 4FXGH 3BV9B 1ESTA 1AY6H 1NM6A 2BY5X 4ESTE 2F9BH 2BD5A 1S6FA 4UFEH 2AGGX 2IPHA 1FIZA 2BM2A 2J95A 1FX0B 1KLTA 3PTBA 1QBNA 5EGMA 1MQ5A 1GI3A 4FETA 2AGEX 4R0IA 1V2QT 5GNDA 2DE8A 1GI7B 3UREA 5LGOA 3B8JA 3RXIA 5C5NA 1NBME 5AVDA 1YCPK 4CRFA 3M7TA 4Y7BA 1AB9B 1XXFA 1C9TA 1VJAU 3D49H 1SG8B 2WPHS 1EAXA 3MNCA 3A80A 1KXCA 2VWNA 1WXRA 3W1EA 1EP5A 3C1KA 1TNIA 4TYDA 1TGCA 3S7KB 1DLKB 3KQBA 1LQDB 1G36A 1EATA 2A2XH 1NESE 3LGVA 1ARCA 3FP8E 5I46H 1O2HA 1KTSB 2C4FH 1GJ5H 1FMGA 1TBZH 2OBQA 4LZ4B 1E35B 2J94A 2BVRH 2BDCA 2QY0B 1V3XA 3Q3XA 5IDKA 3KYFA 3OX7U 1HGTH 4ACAA 5EQQA 3RU4D 1OOKB 4X8VH 3SUEA 3LKWA 1C5UA 4D76A 1D3PB 1UTNA 1TAWA 1Y3WA 1H9HE 5DO4H 1YY3A 5T3HA 2TPIZ 3GDVA 1ESBA 4NFFA 2FESH 3IWMA 1IQMA 4M7GA 4UEHH 1K2I1 2FODA 3SJ8A 3MH6A 1UTJA 1VITF 2W6ID 1C2EA 1SLUB 1OWKA 3LONA 5L2ZH 1RRKA 1UTPA 3SBKA 4KTCA 2VWMA 2BVSH 1C4U2 2PFEA 4U30A 3SGQE 1IQJA 1SGCA 1L1GA 4AYVB 1BA8B 3QZQA 1ACBE 1O2NA 4X1SU 1NROH 3NKKA 5TCCA 1PQ5A 1ZLRA 1P12E 3SQHE 2Y6TA 3K2UA 3M3TA 3ZV8A 2QXJA 1BTHH 1E38B 2R0LA 3TH3H 2ZG0H 1L4ZA 1EAWA 1E37B 1AO5A 3A85A 3DSOA 4XE4A 2TGPZ 1KDQB 3QWCH 3TK6A 2IOTA 2TRMA 4FUCA 4OGXA 3VB5A 1O3MA 5GCHF 2QE7D 1RIWC 3BTHE 4I8KA 1MTNB 5DGJA 5T6GA 3ZZ3A 2VB0A 4K1SA 3GCNA 5EODA 2ZU4A 1UVUH 2H9HA 2TGAA 4K1TA 5EXLA 3PMHB 4AB9A 1WYKA 2BDBA 3OFND 4ABBA 1SLWB 2PW8H 1OSSA 1QRZA 1O2TA 3PMAB 1DANH 4RKOB 1AIXH 2VIWA 1A5IA 1EZUC 1ELVA 1ZPZA 3IG6B 1B0FA 3DA9B 5SGAE 5HYOA 4Q80A 1BHXB 1OS8A 2A7HA 3OU0A 5AF9H 3TGIE 2WV9A 4D9RA 4X6NA 1GBHA 2PUQH 4O9VA 4ZHMU 4WH8A 4U32A 5A8YA 5C17A 3N7OA 2ZGBH 3F3BA 2SGAA 2A32A 2Z9LA 3UY9A 4AFQA 2IJOB 5T6DA 3V13A 3ZV9A 3RXVA 4BOHA 1HB0B 1HRTH 1O3AA 1YPGH 1G3EA 2BY6X 1DUAA 1SQTA 3SU1A 1PQAA 1D6WA 3V3MA 1S5SA 4A1XA 3AAVA 1QBOA 3MH5A 1LVMA 2AYWA 1THSH 1MTNC 5LH8A 2UUFB 4K1EA 3TIUA 4FUJA 2UUKB 1GJ8B 2WPMS 1C5WB 2FX6A 3D65E 2GV6A 3HGNA 3RXEA 3RXHA 2ALVA 1HPGA 5AFYH 1TA6A 2B9LA 4GAWA 1GJAB 1Y3VA 1L1JA 4I7YH 2BOKA 2HPQH 1GBMA 2W7UA 3SORA 1AN1E 3SUFA 1FPHH 4ZAEA 3RMNH 5FPTA 2BD4A 1OWDA 1UW7A 4ISIH 1OWEA 2SGFE 1SGYE 1D3TB 3GDSA 4I8HA 3S0NA 4BAMB 5EOKA 1SOZA 4CHAB 1GBBA 3M61U 2VU8E 2PTNA 2WINI 1GI5A 2F3CE 1G3CA 7GCHF 3ELAH 3U1IB 2IJD1 4TPYA 1SOTA 3I29A 2G4UA 4NSVA 2CF9H 1MD7A 2H5CA 3GY6A 2WHXA 3RXLA 1NRPH 3E0NB 1O2SA 2ZFSA 2PTCE 3SV8A 1IQEA 1YF4A 1AGJA 4DVAU 4JK6A 1WCZA 1J14A 3QX5H 4WJG2 1QJ6B 2A31A 1J8AA 1GWAA 1QFKH 1PPBH 4M9FA 4IN2A 1GMCF 1O2YA 1SGRE 4Z1MD 1UHBB 4BANB 1QJ1B 1SGFA 3GY3A 2J2UA 4D8NA 4BXSA 1HAGE 5CHAB 3DFJA 4B6EA 5FX6A 1C9PA 3B23B 1AZ8A 1QQUA 2QC2A 2ZP0H 1D3DB 2P3UB 1GJDB 2UWPA 4AN7A 2YOLA 4SGBE 1E36B 1FY5A 2F9OA 1K21H 2ZFTA 2FIRH 3G01A 2HNTE 3MNSA 2FXRA 1YGCH 3PTNA 1NRRH 1ABJH 1NRQH 1JMOH 4NZLA 1BMLA 3BTTE 3RP2A 2XBVA 1K1PA 1OP8A 2HLDD 1P57B 1UCYE 1TABE 2ZDKA 3FANA 1TX7A 1DX5M 3RLWH 1RD3B 5K0HA 1GHWH 2FYRA 2A4QA 3SJOA 4X8UH 4MG3A 3V0XA 8GCHG 1BB0B 2FYQA 2J92A 2ZKSA 1LHDH 1AKSB 4A6LA 2A5IA 4TY6A 3PV5A 4YOJA 4ISLA 1O3EA 1BTXA 1Y3XA 3RXKA 3DFLA 4A7IB 1HCGA 4AFZA 4DJZB 3SNBA 4CBOA 1TNJA 2PKSB 1FI8A 1GMDF 3SU5A 4WWYA 1HAXB 1H9LB 3A7YA 3LGIA 4BAHB 5CHAC 3DSPA 4QT8C 2W3IA 3QUMP 3ZVGA 3DD2H 1ZZZA 2XCFA 3A8BA 3P70B 5FCRA 1GI0A 1V2OT 1O2IA 3RXTA 6GCHF 3EYDA 3F9HA 3OEED 1ELEE 3A8AA 1UJ1A 3UUZA 2H6MA 3D62A 1ELCA 4AFSA 1B0EA 1TLDA 1FY1A 1A0LA 5A0BA 1HUTH 4MQAA 4LZ1H 4ABFA 4DOQA 1GBJA 5EU8A 4JYUH 3KEEA 1O36A 5JDUB 5JYIA 2QIQA 1Y5BT 2BD9A 3TK9A 4O97A 3R3GB 2JIZD 1A4WH 1QRWA 1ZOMA 2OCVB 1D9IA 2A7CA 2Y80A 3K6YA 3MFJA 1MUEB 3TNTA 2VH0A 2TIOA 1LPKB 1Z8IB 1GMHG 3LPRA 1YLDA 2BLVA 1VITG 5C5OA 1DSTA 1LHEH 1YC0A 2KZ4A 5EJLA 1O2UA 1P10A 2J4IA 4CR5A 4X1PU 2XYAA 1ZSLA 1V2LT 2Q1JA 1IQKA 2ASUB 3WW7A 1BJUA 1C5LH 3GICB 1Z8GA 1UCYK 4X2XA 1K1JA 3Q3KA 7KMEH 3RXPA 2GV7A 1XKBC 3V7TA 3NUMA 1ETRH 3ATMA 3P6ZB 6CHAB 1C2IA 1EP6A 4TWYA 2W5EA 1LVYA 1T8MA 2XCNA 1TA2A 3NRLA 1JWTA 2UUYA 3GS9A 2FI3E 2EY4C 1P05A 5C1XA 1UVPA 1CHOG 4UD9H 4YO9A 1W3CA 3ATWA 2BDIA 4GSOA 1H8DH 3O8CA 2BTCE 2JH6D 3HKIB 4XRNA 3R0FA 1QRXA 1P2KA 2C90B 1YPHE 4BXWA 1LHCH 2CK3D 4NA9H 1JRTA 4XBDA 1LHGH 1FV9A 4K8BA 5EJZA 3LOXA 2GGVB 1EOLA 2B7DH 1GHAG 4WF8A 1LKBA 5B6LA 3EE7A 3L33A 1P2QA 2FS8A 1PPHE 4P00A 1RTKA 3BSQA 4CREA 1F2SE 1C2LA 4ABIA 3AASA 4B71A 4LOYH 4YZUA 4IMZA 2KX4A 4MPWA 3K6ZA 3OY6U 3P92A 4IN1A 3SUGA 2VIVA 4MNXA 4HZHA 1LPZB 2VIOA 1O2PA 2P3TB 3SO3A 3U8RH 2ZCKP 1BMMH 1MKWH 1BCUH 1S0RA 5GWZA 1C5OH 3A7WA 4OM9A 5JBAS 4X8TH 1EJAA 1V2NT 3RXSA 2FZZA 2GZ7A 1CT4E 1DE7H 1TB6H 4IGDA 5C0UA 5J4QA 1WSSH 1P04A 1PYTD 1F0UA 1KXAA 1A2CH 2AMPA 1JIMA 1V2WT 6ESTA 1YWUA 3SW2B 1O37A 1AMHA 3AAUA 2P8OB 2VVVA 5ESBA 1KXBA 1K0HA 1TOCB 2BY7X 4Y7AA 1TPSA 2XXLA 2M5TA 2FOFA 2F43B 3EA9A 3HATH 2EQNA 3GCTG 2P16A 1SQOA 2PV9B 5E2PA 4I31A 3VGCB 4K8YA 3ZVCA 2ZNKH 1T8NA 1ZR0A 1GJ4H 1GL1A 1O2GH 1CE5A 3TJVA 2ZQ2A 7GCHG 5EG4A 3AVZA 5ABWA 4UDWH 1C2DA 2A45B 1F0SA 1TWXB 1S82A 1NN6A 1P9SA 5B6OA 4FUIA 2VJ1A 1CT0E 2PUXB 4KKDA 1MABB 1GBAA 1GVLA 2OQUA 2WYJA 3F2GA 4WMDA 1A3BH 1Z6EA 1ZSKA 1V2KT 4I86A 1GHBF 4ZH8A 2WPLS 1QURH 1Q3XA 2BD8A 2YMSB 4XSKU 3SV2H 4BNRA 1GBCA 1BTZA 5DSFA 2ANYA 1Y3YA 3OTJE 2GTBA 2AMDA 1ETSH 2C8ZB 3TJNA 2J98B 4MVNA 5EXNA 4X0WU 4TWWA 4Y8XA 1NFYA 1C1RA 2ZHEH 3ZZ4A 4AFUA 4CRCA 1O3JA 4ZUHA 2HALA 2G00A 1A0JA 3SNDA 3QLPH 2P8OC 4VGCB 2AERH 4GCHG 4K5ZA 4UFGH 3BF6H 2FMJA 4H6TA 1D3QB 3HK6B 3VGCC 2QYIA 1HDTH 3MO9A 1BQYA 1QIXB 1GI4A 2Z9JA 4OS5A 1H8IH 1GDQA 1J17T 2KCOA 2BHGA 1PPGE 3GCHB 4FVDA 1P11E 2W6JD 3FAOA 3ZZ6A 3M3VA 3UB0A 4LK4A 3PLPA 4ABGA 3A81A 5F8XA 3E90B 3RU4E 2FTLE 3OSYA 1YCPH 2Q6GA 2A4OA 2EC9H 3LGWA 1O2VA 1YPMH 4AX9H 1TE0A 4INLA 2W7SA 1O39A 2KCYA 5DJ7A 2YMSC 1OHHD 3GYLB 2V6NA 4NCYA 1C5SA 4ZMAH 4YT6H 1P3EA 4RI0A 5F8TA 4DCDA 2STAE 1OKXA 4H42U 1IQGA 1EAIA 5HKKD 1ANDA 4MNYA 2AHME 2ZDLA 1FY3A 1EAUA 3ITIA 4OS4A 4VGCC 3VEQB 5LPFA 1SGEE 4Z0KA 1ORFA 1QY6A 1O32A 1SC8U 3U1JB 3F2HA 5L30H 1GBTA 4BTTB 1NS3A 2XTTB 3MMGA 1V2PT 1BT7A 1OPHB 2BVXH 1O3PB 2ZGCA 1FN6A 4OS2A 2GCHG 3BEFB 4PROA 5FCKA 3RC5A 1EJMA 1N1LA 3F9EA 2PWXA 4GUXA 5C67A 1IHSH 4UFDH 1V2TT 2ULLA 1SHYA 2FOBA 1NRSH 1K9OE 2FM2A 1P01A 2Z7FE 2CHAC 4H6SB 1AZZA 2PP6A 3E16B 3LH1A 4X2VA 2ZWLH 1W11U 2H9EH 1Q31A 1MZAA 2FX4A 1FNIA 3ATLA 4B2BA 1ZYOA 5HIZA 5L6NH 4AC9A 1KYNA 2BOHB 4CRGA 3VPKA 1N6YA 5GDSH 1AB9C 3SV7A 1YPJH 4ABJA 3UNQA 3M35A 3P17H 1BMNH 1SGDE 2ZHWH 3SNEA 4JZIA 2RCEA 1DXWA 4AGKA 1EOJA 3SZNA 2XBWA 1C2GA 1SGPE 1NFWA 1V2RT 3QGNB 4YXWD 2H9TH 5E0HA 1U6QA 3NWUA 4AG2A 5JB8S 1LO6A 1O2KA 1W7XH 1TQ7B 3P8OA 1OX1A 2RG3A 3ZYDA 4BTUB 1UK4A 5FL7D 3SUDA 1Z1IA 3S7HB 1KLJH 2ZIQH 5F53A 1HJ8A 2ESTE 1P06A 3MU4A 2A1DB 1FJSA 2VH6A 2C8YB 3NK8A 1BZXE 1ZMJA 1T8LA 4AB8A 1ZPBA 1XUFA 4B2CA 4RN6A 4OGYA 1GHVH 3TITA 2QF0A 3GYMA 2P59A 1WBGB 1O2MA 4WY3A 4Y0YE 5FBEA 2JKHA 7ESTE 1BDAA 1ELBA 2HWLB 2UUJB 1O33A 4HI3A 4NG9H 1OXGA 1C5MD 1O3NA 4JYTA 2F4LA 4JZEH 1SFIA 3A89A 3TJUA 2HVXA 4DURA 3FN8A 2ZCHP 1TBRH 1W0JD 1JOUB 1TGTA 1X7AC 3KL6A 2KCPA 1SHHB 3UNRA 1XUHA 2GVFA 1LCYA 4ZROA 1C5QA 1ZHMA 4CH2B 3BTEE 2GP9B 1NY22 2GKVE 3L3TA 3KIDU 1C1SA 1VZQH 1QJ7B 1SQAA 2J98A 1GCTB 1H8HD 1C5VA 1O3DA 1N8OB 4OS6A 3TPIZ 2ZDAH 1GI8B 1E34B 1NT1A 2A0QB 1GGDB 1MZDA 1MTUA 1W13U 1H8ED 1GL0E 3ZZAA 4D9QA 2GZ9A 2XWBI 3CP7A 2P3FH 1GG6B 2FO9A 1O3OA 5DN6D 4ZKRU 1QL8A 3QO6A 2PKAB 2QV1A 1SLVB 1ZPCA 4MPUA 1Y3UA 2CN0H 3CS7A 4O3TA 1BRUP 5JB9S 3MNXA 2OTVA 1PJPA 5EW2H 1CGIE 1HFDA 2FDAA 3F1SB 1Z7KA 2GDDA 1XVMA 2K0QA 1BTUA 2RDLA 4B75A 2EI8A 3GISB 2FS9A 2XC0A 3A84A 1G2LA 4I8GA 2FEQH 4FU7A 4ZHLU 5IYTA 2Z9IA 2OUAA 1NTPA 4KTSA 2OK5A 2B8OH 2QAAA 1H9IE 2ZI2H 4KELA 5E2OA 5DP5A 1YPLH 4AGJA 3EDXB 5TCAA 3K65B 4X1RU 2XBYA 3GCOA 1O5DH 1P0SH 2QXGA 1PPEE 3OAAD 4WMEA 3OTPA 3LC5A 2FOHA 5DP4A 1M9UA 4DGJA 1GCTC 1N8OC 2ANMH 2XBXA 3BIVH 4YT7H 1C1WH 4B2AA 2QN5T 2FI4E 1C1MA 1GGDC 1AD8H 1GJBB 1CHGA 1P03A 2BDAA 4IS5A 5F8ZA 4Y10E 3NXPA 5DP9A 1E0FD 3HK3B 3T62A 1PYTC 1GG6C 1MCVA 1QZ8A 2G81E 2GT8A 3TLOA 4D7GA 2BXTH 5EQRA 4ASUD 5CDFE 3PYHA 2WV4A 3BTFE 2B5TB 1AFEH 2QXIA 1D4PB 1ZTLA 5CMXH 1FPCH 2LELA 2Y5HA 3DT0H 5KGOA 2GDEH 3MH4A 2Y82A 2A5KA 2J5UA 1GHZA 4DIHH 1GPZA 2YMSD 1EFRD 2J38A 2H2ZA 1B5GH 3M5MA 1GI9B 2NU4E 3A82A 5HIYA 1BJVA 2GT7A 3TJOA 1ELTA 2EI7A 3UOUA 1D6RA 4Y71A 1XXDA 3H5CB 3M7UA 5FXLA 3W95A 3SU2A 3M37A 4FUBA 3FP7E 1SI5H 1N6XA 1J16A 4NIYA 3ZVDA 5C3NA 1SMFE 4JCNA 5TJXA 5L2YH 1QL9A 2ZU5A 4AZ2B 4OS7A 2BQ6B 3T29A 2CJIA 3ZYEA 4ABEA 4CHAC 1QNJA 3SI3H 2ANKH 3MQKC 1XUKA 4YLQH 1PPZA 4FUDA 3U28C 1P2IA 1SKYE 3QTOH 1DFPA 2FOEA 2RA3A 4K2YA 2G4TA 5EPNA 1O5BB 2ZGXH 1GI1A 3PO1B 3MU0A 3U98H 4NIWA 1KTTB 3NPSA 3D23A 1SGFG 1OYTH 1NPMA 3FOAA 2R0KA 1UTMA 1O5EH 2ZFRH 1QR3E 1UMAH 5BPEA 3ZZ8A 1AVWA 1TX6A 1F5LA 3U69H 2R2WU 4IC5A 5EW1H 2ZFPH 2JH5D 1T7CA 1TPPA 4Q7XA 2ZPSA 4TY7A 1ANCA 2GCTB 1MTVA 1P3CA 1SB1H 5FPYA 4DY7B 3V12A 3F9FA 2IN2A 3PWBA 1E79D 3RMLH 1QCPA 5F6MA 2BZAA 3KQEA 3SZEA 3ZZ9A 4Y6DA 5C1UA 5FX5A 2JH0D 1W12U 1L2EA 1RXPA 3RXQA 4UONA 1RJXB 3KNXA 2WPIS 3TH2H 5AFZH 9ESTA 4X8SH 2L74A 3F2FA 3LC3A 3CNRA 2IPQX 3KN2A 3BG4B 1LMWB 1CBWB 1HYLA 1Z6JH 2QF3A 1O3GA 1JXPA 1CO7E 3SU6A 2XWAA 1CQQA 4ZHAA 3PO1C 4BTIB 1RTLA 2BQ7B 1OWIA 3ESTA 3P8NA 4ZCNA 2G52A 4Q2KA 1GBFA 2HRVA 2ZPQA 2BY9X 1O3HA 3RXCA 3Q77A 1UCYH 4MNVA 4NIXA 2PSYA 2BLWA 2SFAA 3KGPA 1A5GH 3BG8A 1W8BH 2H5DA 3UOPA 1BTYA 2A7JA 1ZRKA 1SPJA 2ZDNA 3VB3A 1P02A 2KR7A 2Y81A 1WTHD 1WV7H 2PKAA 2ZQ1A 3RU4T 2PKSC 2AFQB 1ZGVA 1BMFD 2GCTC 1BIOA 3SN8A 1O0DH 3SGBE 3STJA 1EQ9A 5C0TA 1TGSZ 2QA9E 3MH7A 4JK5A 2G51A 3ATKA 1C1OA 3UPEA 1O5CB 1IQLA 1EPTB 1W10U 1UVSH 1GBEA 5E0JA 5GCHG 1IQFA 2ZCLP 1S6HA 2BX4A 1O2RA 2ODQA 4F49A 1DS2E 1EB2A 1THRH 3P8FA 4MTBA 5LPRA 1FIWA 4ABAA 3RMMH 1AQ7A 2VIQA 2V35A 3BG4C 1VCPA 1CBWC 2SGEE 2Z9KA 1AI8H 1GI6A 2Z6BD 4RT1A 3UNSA 3RXOA 1TPOA 1YM0A 3URDA 1YPKH 1F92A 1C2KA 4AG1A 3ZVFA 1FY8E 1HJAB 1ABIH 2A5AA 1TBQH 3EGKH 2ZEBA 3GY4A 4X1QU 1BITA 1ZJDA 1AE8H 4RSPA 1EZQA 3MU5A 4TSFD 3O8BA 1A61H 1NZQH 4WH6A 2YNAA 1XKAC 1A5HA 1IQNA 1KY9A 4KTUA 1SVPA 4U01A 1DWCH 2ZPRA 1E1QD 1UVOA 2CV3A 4E7RG 4U2WA 1TRNA 4Q63A 1PQ7A 1QGFA 1CA8B 3TGJE 1BTWA 1DWBH 1BUIA 2XC5A 2ALPA 2AS9A 3ZVEA 2BD2A 6CHAC 4B74A 4CBNA 1DWEH 2GZ8A 4TPIZ 1RTFB 3A8CA 4YLUA 3UWIA 3ZZDA 4CH8B 3RXUA 1SQRA 1NU7B 2XW9A 1UVTH 2XC4A 4I8LA 4TT3D 3T28A 2K1QA 2BDHA 4IW4E 1TX8A 4SGAE 2BDGA 2VGCB 2EI6A 2GX4A 2RA0A 2WUCA 1QBVH 4MPVA 1T4VH 3HKJB 1L1NA 1GVZA 2G8TA 2F9NA 1C5PA 2THFB 5A8ZA 5A2MH 1EX3A 4ZKOU 1KXFA 1Y59T 3KQCA 3VXFH 1IQIA 1O38A 4JMYA 2PGBB 1YYY1 1H4WA 1UTOA 2EA3A 4DG4A 5CE1A 3GY5A 1COWD 1DLEA 3VB7A 4AORA 1H1BA 2A4GA 1GBIA 1Y5AT 1XM1A 1J9CH 3BTDE 2AMQA 2ZHDA 2FOCA 2P95A 4THNH 1C5YB 1O2QA 3RXJA 5HGGA 5A09A 2B0FA 1V2MT 3WWBA 3OEHD 1C2JA 2PGQB 4YOGA 1G3DA 1ELGA 1VKYA 5EPYA 3N7DA 4BAKB 1TQ0B 3UAIC 1LVOA 2WZQA 1ELFA 2ZHQH 1GMCG 3QDZB 4K3JA 1HAYB 1AWHB 2LNCA 3MOCA 1DUEA 5A0CA 3ZZCA 1W7GH 3DCLA 1FQ3A 5T1VA 2FP7B 3UWJH 1WUNH 1S0QA 4UFFH 2VGCC 1HAIH 1L0ZA 1WDIA 4O03A 3RXMA 5A0AE 4HFPB 3KHVA 2V7QD 3SOSA 3QTVH 4AOQA 1VGCB 2EEKA 2OC7A 4DT4A 4F48B 2BYAX 1PQ8A 2OLGA 2BDYA 8ESTE 2JJ1D 2KFWA 2VBCA 2ZTYA 4XOJA 5DP3A 3FO8D 4ISHH 3EQ0H 3RM2H 2D8WA 5H4IB 5JBCS 1ZHPA 3PLKA 1P2JA 3MNBA 3GY8A 2J97A 4Y79A 4H4FA 1CGJE 1ETTH 5EXMA 2PSXA 1TGBA 1SGIB 4IMQA 3KYGA 1NC6A 4F4OC 2A2QH 5FPSA 2Z3DA 3KF2A 1CGHA 4MDSA 1CSOE 1TYNA 4NIVA 2BB4A 4K60A 3F6UH 4X6MA 3WWFA 3RXDA 4A1VA 1EPTA 3LGTA 2HNTF 4YM9A 4A5TS 1GMDG 2HVYB 1ESAA 1QTFA 5HM2A 4KP0A 2W26A 4YTAA 3T27A 1CVWH 1RGQA 3QN7A 2O8TA 4Y8ZA 1RFNA 1EB1H 1P9UA 3PROA 2FPZA 1VGCC 2BLOA 1T32A 3BTWE 1TFXA 6GCHG 1S83A 1E1RD 2OQ5A 1GBKA 1MCTA 4NA7A 1GCDA 1GJCB 5EJ1A 3RUOA 3KCGH 3H09A 8GCHF 2PHBA 2BX3A 2BXUH 1KIGH 1DM4B 3H7TA 3O8DA 3KQDA 3N99A 2DUCA 4NFEA 2ILNA 4ISOA 4ZKSU 3GCHC 4IC6A 2P94A 2Z3CA 3TH4H 3PMJA 1QQ4A 2OBOA 5E0GA 5A8XA 4YOIA 3FZZA 2O8LA 1P8VC 4B76A 4XBCA 2Q6DA 3TU7H 3BTQE 2O8WA 1S85A 1S6LA 1IOEA 1EJNA 1LVBA 3FKSD 1NRNH 4WXIA 1BTPA 1KLIH 1XX9A 1TALA 2ZECA 4FOUC 2VWOA 1DPOA 1HBTH 3M7QA 1RIWB 1CU1A 2C3SA 1ELDE 1PFXC 1J15A 1O5GH 3RC6A 2BQWB 2DE9A 1UTLM 1QL7A 3PB1E 2WYGA 4FU8A 2VIDA 2OC1A 1F7ZA 1Z71A 1C4V2 4NWKA 5HM9A 3B9FH 2LP6A 1UK2A 1GMHF 1O30A 1DSUA 2M2AA 3JZ2B 4MNWA 1INCA 1LDTT 2TBSA 3DHKH 1TIOA 3T25A 3BEIB 1ANEA 3PMBB 1NBMD 2YNBA 3M5OA 3SHCH 4I33A 3UR9A 1AUTC 4ASHA 1EXFA 2HNTC 4F55A 1HXFH 5DP7A 4BAOB 2O9QA 1K1NA 1SSXA 3GY7A 2Q6FA 3UQVA 1C1QA 3F0OA 3A88A 1DOJA 4I32A 1FAKH 1CT2E 4X1NU 1BHXF 1DT2A 3U9AH 3QGJA 3UFAA 5G4BA 3SJ9A 4D7FA 2R3YA 1QB6A 2FOMB 1JBUH 2ZGJA 2V0BA 1HIAA 1O3BA 2ZU1A 2RFKC 1MQ6A 2FI5E 2NWNA 3E1XB 3PV2A 1FUJA 5IK2D 5GJ4B 3PRBA 1CHOF 1JRSA 5FBIA 1UK3A 1GI2A 1C5ZB 1L4DA 1OP0A 2VINA 1AFQB 1TRYA 2SNVA 2JDID 5DP6A 3RXBA 4GVUA 1TNHA 5HMAA 1AVXA 6LPRA 2OP9A 4AYYB 1K22H 2AEIH 4Z6AH 1YP9A 1YLNA 2CGAA 3S69A 3E0PB 3LIWA 2BY8X 4OS1A 1GHAF 3SU4A 3NZIA 1BRBE 3OY5U 1S81A 1WOFA 1C1NA 2QGRA 3DSGA 1AU8A 1MD8A 1O3KA 3LGUA 1C4Y2 2F83A 5HXFA 5BRRE 2XNDD 1SLXB 1O35A 1MKXH 1O5FH 3URCA 2O8UA 2GJGA 3SJIA 2LPRA 3ZZ5A 1SL3A 1THPB 3Q00A 5DP8A 2AGIX 3VXEH 1TMBH 1W0YH 1FAXA 1T4UH 4E06H 3LGYA 3MO6A 2I6QA 2HLCA 2SNWA 1C2FA 2NU3E 2K8IA 2OC0A 3SU0A 1MKXK 1SGQE 3LJJA 3M5NA 2BD7A 3GDUA 1OWHA 1TONA 5JPMH 2J34A 1WQVH 2HOBA 2Y7XA 4YESB 1C5RA 1AFQC 4ABDA 1DDJA 1GHXH 1HAVB 2BLQA 1Z8RA 2NU1E 1OWJA 4JZFH 1ZSJA 5LPEA 1GHYH 2D2DA 1F5RA 4DW2U 2OXSA 3O8RA 4MPXA 1V2UT 1G30B 1C2MA 2KAIB 5EIYA 3E91A 2CF8H 2SGDE 1GHBG 1HNEE 1XUJA 1FZZA 4JZDH 4X6PA 4Y11E 3T2NA 1P2OA 3GCTF 1K28D 3UR6A 1JIRA 3I78A 1GDNA 1T8OA 1VCQA 1DXPA 1QB9A 3GY2A 3TGKE 1G2MA 3N7EA 1ZTJA 3RLYH 1YBWA 1Z1JA 1SBWA 1O5AB 3KQ5A 3TK5A 4Q7YA 1DY8A 4GLYA 1ZMNA 1AVGH 1C1UH 2ZTZA 1HLTH 5T6FA 2F9PA 2ODYB 2ZZUH 2OD3B 1NU9A 3SV6A 4CRAA 1MU6B 4WXVA 3ZIAD 3I77A 1XUIA 1MMJN 1FDPA 2ZGHA 3MTYA 1FLEE 4HG6A 3BN9A 1ZJKA 3HGPA 2JJ2D 3FVFB 3SV9A 4FU9A 3PLBA 1WU1A 3CENA 1YPHC 1NO9H 1QA7A 4Q7ZA 5GPIB 1YCPM 4X2WA 1BOQA 1FY4A 1ZTKA 2WUBA 3QZRA 4E05H 2CXVA 1ZRBA 1MTWA 3SQEE 2Y5GA 2FOGA 3S9CA 1C1VH 4GCHF 1SR5C 4HTCH 1GJ9B 1O2ZA 3S9AA
chains in the Genus database with same CATH topology
1C5TA 1MAXA 5DKMA 4CRBA 1LHFH 1W14U 3HPTB 1IHTH 2VVCA 2H1UA 4I8JA 3SU3A 4J2YB 1TGNA 3M3SA 3E3TA 3RXAA 2QCYA 1LQEA 1O3LA 1A3EH 1WQSA 1AUJA 3A7VA 2ZDMA 3WY8A 3A86A 2V3HH 5ETXA 3AW1A 1DVAH 2SGPE 3EA8A 2G55A 3TVJB 1YKTA 3RMOH 3E8LA 2ZF0H 4NZQA 3LDXH 4JZ1A 2ZA5A 3A8DA 1F0TA 1OP2A 1Y5UT 4JYVH 1MTSA 3STIA 1KDQA 1ZMLA 9LPRA 1QHRB 3DUXH 4Y0ZE 1HXEH 3L6PA 1MU8B 4ABHA 1UO6A 2TGTA 3F9GA 1K1OA 1DICA 1P2NA 2BZ6H 3CS0A 2ZHFH 4INHA 2F91A 3MHWU 1F0RA 1GVKB 1V2JT 1FN8A 3FZDA 1EASA 2ZU3A 1TNGA 2O8MA 1P09A 1W2KH 1TRMA 8KME2 1BRAA 1O3CA 2A4RA 3M5LA 2G5NA 3T5FH 2Y7ZA 1MAYA 2AH4X 1CA0B 4BAQB 1HAPH 2GCHF 2QXHA 2J9NA 1VCWA 1O2OA 2Z3EA 1C1TA 2XRCA 3SNAA 3PV4A 3ENSB 1ID5H 1DITH 1AWFH 2FLBH 3A83A 5K7RA 2VIPA 1A0HB 1AE5A 4CR9A 2FWWA 3EE0B 5GXPA 4KGAA 1V2VT 4FUFA 3BIUH 2GMTB 1IAUA 1B7XB 4IBLH 4A92A 4X6OA 1K1IA 2ZC9H 1HAOH 3RM0H 3A87A 5I25A 1BBRE 3UIRA 1KXDA 3PM3A 2R3UA 1O2LA 1V2ST 2FOAA 5DK1A 1ANBA 3NCLA 1ARBA 1SFQB 1EZXC 4NWLA 4B73A 2UWLA 2BD3A 3SJKA 1HAVA 4J1YA 3OYPA 4RKJB 4NSYA 2NU0E 1TPAE 4ZXXH 1G3BA 3BTME 3JZ1B 4NA8A 1V6DA 1Z8JB 2FTMA 2KAIA 3E6PH 4Y76A 4GPGA 4CRDA 1CA0C 2JETB 1XUGA 2D1JA 5JBTA 3LH3A 2SGQE 1FONA 1TMUH 4HGCA 3EA7A 1GBDA 4GHQA 1BMAA 1VITH 1PPCE 3IITA 3Q3YA 2PLXA 2Y5FA 3U8TH 1W0ZU 3MYWA 1PPFE 1P2MA 1TMTH 2GMTC 1K1MA 2ODPA 1LKAA 2C8WB 3MI4A 3ZZ7A 1EPTC 4K69A 2I6SA 3SGAE 1MBMA 5ESTE 1IQHA 4O3UA 3T26A 3AW0A 5C20A 1A7SA 4ZXYH 3ZVAA 3VB6A 3S9BA 3RDZA 5DPAA 1KSNA 4LXBH 2G5VA 2WPKS 2WV5A 3A7ZA 1HAHH 1UHBA 3LJOA 3A7TA 1BBRH 3UQOA 1G37A 1EUFA 3PWCA 3H7OA 3SI4H 3Q76A 5C1YA 4Y8YA 4FVBA 3ODDA 4R8TB 4X2YA 1HJAC 5AHGH 5EQSA 1G9IE 1HV7A 1O2XA 3SHAH 3M36A 1O2WA 4XFQA 2ZTXA 1MBQA 2JETC 1MH0A 4B1TA 5C2ZA 5FAHA 1RS0A 3VB4A 1FXYA 3K9XB 1YPEH 1XMNB 4FUHA 1QB1A 1BBRK 7LPRA 1O3FA 1DY9A 1C2HA 1OYQA 3TNSA 1GJ7B 1O2JA 1G32B 1Q2WA 5PTPA 4FUGA 1XVOA 1UTKA 1MKWK 1WAYB 1VR1H 2F9UA 5FHTA 2TGDA 3MU1A 4FUEA 1NFUA 2STBE 3P8GA 5JBBS 2W3KA 5GIBA 1HIAB 5J4SA 2R9PA 3MWIU 2WPJS 3MU8A 3RXGA 4E7NA 2Z94A 3UTUH 1ZGIA 2ZDVH 1C5XB 2VNTA 2BMGB 2Z9GA 2HGTH 1LPGB 1AKSA 3BEUA 3MO3A 1O3IA 1TNLA 1O31A 2ZU2A 3ZZBA 4INKA 2V3OH 3LU9B 1ELAA 5E8EH 2AIPA 2NU2E 2FLRH 3BTKE 4NGAH 1TNKA 1HAZB 1A46H 2ANWA 3QK1A 4ISNA 4WVPE 3C27B 1WTGH 3RXRA 3SNCA 3GOVB 2CMYA 5F03A 1A1RA 1BRCE 3FFGA 1SGTA 1GDUA 1ZHRA 2C8XB 2C93B 4GHTA 2VVUA 3U8OH 1GJ6A 3BTGE 1UTQA 3F68H 1VJ9U 1Y8TA 3ODFA 1DWDH 4XDEA 3VFEA 3ZVBA 3A7XA 1T31A 1TOMH 3ATIA 1EKBB 1O34A 1NFXA 2UWOA 4XBBA 3EAJA 1SGNE 1AHTH 3LT3A 1EZSC 1C1PA 2AIQA 1HJ9A 2F9VA 1YLCA 1K1LA 3P95A 4MLFB 4WMFA 3RC4A 2D26C 1C5NH 2OC8A 2OINA 3FP6E 1QA0A 1S84A 4A1TA 5DG6A 3W94A 1GBLA 2XNIA 1F5KU 2ZFQH 2VWLA 8LPRA 2P93A 4ZKNU 1KXEA 4DT7B 2ZFFH 2R2MB 4DIIH 2HPPH 2ZO3H 1LTOA 4UE7H 2GD4B 3RXFA 2PR3A 2CHAB 4FXGH 3BV9B 1ESTA 1AY6H 1NM6A 2BY5X 4ESTE 2F9BH 2BD5A 1S6FA 4UFEH 2AGGX 2IPHA 1FIZA 2BM2A 2J95A 1KLTA 3PTBA 1QBNA 5EGMA 1MQ5A 1GI3A 2AGEX 4R0IA 1V2QT 2DE8A 1GI7B 3UREA 5LGOA 3B8JA 3RXIA 5C5NA 5AVDA 1YCPK 4CRFA 3M7TA 4Y7BA 1AB9B 1XXFA 1C9TA 1VJAU 3D49H 1SG8B 2WPHS 1EAXA 3MNCA 3A80A 1KXCA 2VWNA 1EP5A 3C1KA 1TNIA 4TYDA 1TGCA 1DLKB 3KQBA 1LQDB 1G36A 1EATA 2A2XH 1NESE 3LGVA 1ARCA 3FP8E 5I46H 1O2HA 1KTSB 2C4FH 1GJ5H 1FMGA 1TBZH 2OBQA 4LZ4B 1E35B 2J94A 2BVRH 2BDCA 2QY0B 1V3XA 3Q3XA 5IDKA 3OX7U 1HGTH 5EQQA 3RU4D 1OOKB 4X8VH 3SUEA 3LKWA 1C5UA 4D76A 1D3PB 1UTNA 1TAWA 1Y3WA 1H9HE 5DO4H 5T3HA 2TPIZ 3GDVA 1ESBA 4NFFA 2FESH 3IWMA 1IQMA 4M7GA 4UEHH 1K2I1 2FODA 3SJ8A 3MH6A 1UTJA 1VITF 1C2EA 1SLUB 1OWKA 3LONA 5L2ZH 1RRKA 1UTPA 3SBKA 4KTCA 2VWMA 2BVSH 1C4U2 2PFEA 4U30A 3SGQE 1IQJA 1SGCA 1L1GA 4AYVB 1BA8B 3QZQA 1ACBE 1O2NA 4X1SU 1NROH 3NKKA 5TCCA 1PQ5A 1ZLRA 1P12E 3SQHE 2Y6TA 3K2UA 3M3TA 3ZV8A 2QXJA 1BTHH 1E38B 2R0LA 3TH3H 2ZG0H 1L4ZA 1EAWA 1E37B 1AO5A 3A85A 4XE4A 2TGPZ 1KDQB 3QWCH 3TK6A 2IOTA 2TRMA 4FUCA 4OGXA 3VB5A 1O3MA 5GCHF 1RIWC 3BTHE 4I8KA 1MTNB 5DGJA 5T6GA 3ZZ3A 2VB0A 4K1SA 3GCNA 5EODA 2ZU4A 1UVUH 2H9HA 2TGAA 4K1TA 5EXLA 3PMHB 4AB9A 1WYKA 2BDBA 4ABBA 1SLWB 2PW8H 1OSSA 1QRZA 1O2TA 3PMAB 1DANH 4RKOB 1AIXH 2VIWA 1A5IA 1EZUC 1ELVA 1ZPZA 3IG6B 1B0FA 3DA9B 5SGAE 5HYOA 4Q80A 1BHXB 1OS8A 2A7HA 3OU0A 5AF9H 3TGIE 4D9RA 4X6NA 1GBHA 2PUQH 4O9VA 4ZHMU 4WH8A 4U32A 5A8YA 3N7OA 2ZGBH 2SGAA 2A32A 2Z9LA 3UY9A 4AFQA 2IJOB 5T6DA 3V13A 3ZV9A 3RXVA 4BOHA 1HB0B 1HRTH 1O3AA 1YPGH 1G3EA 2BY6X 1DUAA 1SQTA 3SU1A 1PQAA 1D6WA 3V3MA 1S5SA 4A1XA 3AAVA 1QBOA 3MH5A 1LVMA 2AYWA 1THSH 1MTNC 5LH8A 2UUFB 4K1EA 3TIUA 4FUJA 2UUKB 1GJ8B 2WPMS 1C5WB 2FX6A 3D65E 2GV6A 3HGNA 3RXEA 3RXHA 2ALVA 1HPGA 5AFYH 1TA6A 2B9LA 4GAWA 1GJAB 1Y3VA 1L1JA 4I7YH 2BOKA 2HPQH 1GBMA 2W7UA 3SORA 1AN1E 3SUFA 1FPHH 4ZAEA 3RMNH 5FPTA 2BD4A 1OWDA 4ISIH 1OWEA 2SGFE 1SGYE 1D3TB 3GDSA 4I8HA 3S0NA 4BAMB 5EOKA 1SOZA 4CHAB 1GBBA 3M61U 2VU8E 2PTNA 2WINI 1GI5A 2F3CE 1G3CA 7GCHF 3ELAH 3U1IB 4TPYA 1SOTA 3I29A 2G4UA 4NSVA 2CF9H 1MD7A 2H5CA 3GY6A 3RXLA 1NRPH 3E0NB 1O2SA 2ZFSA 2PTCE 3SV8A 1IQEA 1YF4A 1AGJA 4DVAU 4JK6A 1WCZA 1J14A 3QX5H 4WJG2 1QJ6B 2A31A 1J8AA 1GWAA 1QFKH 1PPBH 4IN2A 1GMCF 1O2YA 1SGRE 1UHBB 4BANB 1QJ1B 1SGFA 3GY3A 2J2UA 4D8NA 4BXSA 1HAGE 5CHAB 3DFJA 5FX6A 1C9PA 3B23B 1AZ8A 1QQUA 2QC2A 2ZP0H 1D3DB 2P3UB 1GJDB 2UWPA 4AN7A 2YOLA 4SGBE 1E36B 1FY5A 2F9OA 1K21H 2ZFTA 2FIRH 3G01A 2HNTE 3MNSA 2FXRA 1YGCH 3PTNA 1NRRH 1ABJH 1NRQH 1JMOH 4NZLA 1BMLA 3BTTE 3RP2A 2XBVA 1K1PA 1OP8A 1P57B 1UCYE 1TABE 2ZDKA 3FANA 1TX7A 1DX5M 3RLWH 1RD3B 5K0HA 1GHWH 2FYRA 2A4QA 3SJOA 4X8UH 4MG3A 3V0XA 8GCHG 1BB0B 2FYQA 2J92A 2ZKSA 1LHDH 1AKSB 4A6LA 2A5IA 4TY6A 4YOJA 4ISLA 1O3EA 1BTXA 1Y3XA 3RXKA 3DFLA 4A7IB 1HCGA 4AFZA 4DJZB 3SNBA 4CBOA 1TNJA 2PKSB 1FI8A 1GMDF 3SU5A 4WWYA 1HAXB 1H9LB 3A7YA 3LGIA 4BAHB 5CHAC 4QT8C 2W3IA 3QUMP 3ZVGA 3DD2H 1ZZZA 2XCFA 3A8BA 3P70B 5FCRA 1GI0A 1V2OT 1O2IA 3RXTA 6GCHF 3EYDA 3F9HA 1ELEE 3A8AA 1UJ1A 3UUZA 2H6MA 3D62A 1ELCA 4AFSA 1B0EA 1TLDA 1FY1A 1A0LA 5A0BA 1HUTH 4MQAA 4LZ1H 4ABFA 4DOQA 1GBJA 5EU8A 4JYUH 3KEEA 1O36A 5JDUB 5JYIA 2QIQA 1Y5BT 2BD9A 3TK9A 4O97A 3R3GB 1A4WH 1QRWA 1ZOMA 2OCVB 1D9IA 2A7CA 2Y80A 3K6YA 3MFJA 1MUEB 3TNTA 2VH0A 2TIOA 1LPKB 1Z8IB 1GMHG 3LPRA 1YLDA 2BLVA 1VITG 5C5OA 1DSTA 1LHEH 1YC0A 1O2UA 1P10A 2J4IA 4CR5A 4X1PU 2XYAA 1ZSLA 1V2LT 2Q1JA 1IQKA 2ASUB 1BJUA 1C5LH 3GICB 1Z8GA 1UCYK 4X2XA 1K1JA 3Q3KA 7KMEH 3RXPA 2GV7A 1XKBC 3V7TA 3NUMA 1ETRH 3ATMA 3P6ZB 6CHAB 1C2IA 1EP6A 4TWYA 2W5EA 1LVYA 1T8MA 2XCNA 1TA2A 1JWTA 2UUYA 2FI3E 1P05A 5C1XA 1UVPA 1CHOG 4UD9H 4YO9A 1W3CA 3ATWA 2BDIA 4GSOA 1H8DH 3O8CA 2BTCE 2JH6D 3HKIB 3R0FA 1QRXA 1P2KA 2C90B 1YPHE 4BXWA 1LHCH 4NA9H 1JRTA 4XBDA 1LHGH 1FV9A 4K8BA 3LOXA 2GGVB 1EOLA 2B7DH 1GHAG 4WF8A 1LKBA 3L33A 1P2QA 2FS8A 1PPHE 1RTKA 3BSQA 4CREA 1F2SE 1C2LA 4ABIA 3AASA 4B71A 4LOYH 4YZUA 4IMZA 4MPWA 3K6ZA 3OY6U 3P92A 4IN1A 3SUGA 2VIVA 4MNXA 4HZHA 1LPZB 2VIOA 1O2PA 2P3TB 3SO3A 3U8RH 2ZCKP 1BMMH 1MKWH 1BCUH 1S0RA 5GWZA 1C5OH 3A7WA 5JBAS 4X8TH 1EJAA 1V2NT 3RXSA 2FZZA 2GZ7A 1CT4E 1DE7H 1TB6H 4IGDA 5J4QA 1WSSH 1P04A 1PYTD 1F0UA 1KXAA 1A2CH 2AMPA 1JIMA 1V2WT 6ESTA 3SW2B 1O37A 1AMHA 3AAUA 2P8OB 2VVVA 5ESBA 1KXBA 1TOCB 2BY7X 4Y7AA 1TPSA 2XXLA 2M5TA 2FOFA 3EA9A 3HATH 3GCTG 2P16A 1SQOA 2PV9B 5E2PA 4I31A 3VGCB 4K8YA 3ZVCA 2ZNKH 1T8NA 1ZR0A 1GJ4H 1GL1A 1O2GH 1CE5A 3TJVA 2ZQ2A 7GCHG 5EG4A 3AVZA 5ABWA 4UDWH 1C2DA 2A45B 1F0SA 1TWXB 1S82A 1NN6A 1P9SA 5B6OA 4FUIA 2VJ1A 1CT0E 2PUXB 4KKDA 1GBAA 1GVLA 2OQUA 2WYJA 4WMDA 1A3BH 1Z6EA 1ZSKA 1V2KT 1GHBF 4ZH8A 2WPLS 1QURH 1Q3XA 2BD8A 4XSKU 3SV2H 4BNRA 1GBCA 1BTZA 2ANYA 1Y3YA 3OTJE 2GTBA 2AMDA 1ETSH 2C8ZB 3TJNA 4MVNA 5EXNA 4X0WU 4TWWA 4Y8XA 1NFYA 1C1RA 2ZHEH 3ZZ4A 4AFUA 4CRCA 1O3JA 4ZUHA 2HALA 2G00A 1A0JA 3SNDA 3QLPH 2P8OC 4VGCB 2AERH 4GCHG 4K5ZA 4UFGH 3BF6H 2FMJA 4H6TA 1D3QB 3HK6B 3VGCC 2QYIA 1HDTH 3MO9A 1BQYA 1QIXB 1GI4A 2Z9JA 4OS5A 1H8IH 1GDQA 1J17T 2BHGA 1PPGE 3GCHB 4FVDA 1P11E 3FAOA 3ZZ6A 3M3VA 4LK4A 3PLPA 4ABGA 3A81A 5F8XA 3E90B 3RU4E 2FTLE 3OSYA 1YCPH 2Q6GA 2A4OA 2EC9H 3LGWA 1O2VA 1YPMH 4AX9H 1TE0A 4INLA 2W7SA 1O39A