3SGAE

Structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of product and inhibitor complexes of Streptomyces griseus protease A at 1.8 A resolution. A model for serine protease catalysis.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE A (SGPA)
total genus 53
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1990-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgaE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgaE01
1TB6H 5C5NA 3A80A 3O8CA 3KNXA 3K6ZA 2GCHF 1RRKA 1E34B 1MKXK 1O3LA 1Y3YA 2WPKS 1QJ6B 1SQOA 1AGJA 1LMWB 1MZDA 1IAUA 3O8BA 1LPKB 5SGAE 1ARCA 1O2HA 2Y7ZA 5HXFA 1UTQA 1DANH 2BDAA 3F68H 1ZPZA 3QTVH 2P16A 1QA0A 2VVUA 3UNSA 1VJ9U 1GJ6A 2ZG0H 1QNJA 1O2JA 4Y8YA 1HAHH 2I6SA 4ZHMU 4X6OA 3V7TA 1MD7A 5AFYH 1HAOH 3SV9A 4DVAU 2BVXH 4CREA 2OC1A 4TY6A 2XCFA 4RN6A 3SGQE 1NRSH 2OP9A 3MI4A 2FODA 3AAVA 2Q6FA 2QGRA 4HZHA 1C2DA 2A45B 4K8BA 2R3UA 2ZO3H 1B0FA 3JZ2B 4Z6AH 2W7UA 3UNQA 1OP8A 1O2MA 3UPEA 1G2MA 1ZMLA 1HIAB 2WINI 2BY7X 4OS5A 3A85A 1SLXB 1GBBA 2ZFTA 4UFGH 3MNSA 4B2AA 3RXFA 1NRPH 3I29A 3P8GA 4ZHAA 2ZWLH 2Q6DA 1K1OA 1F7ZA 4YESB 3BTQE 1ABIH 3MHWU 3K65B 2Z9JA 2XC4A 1QJ1B 1AWFH 4Q7ZA 1GI7B 3ZVEA 3P70B 1GJDB 1PJPA 1K22H 1C5SA 3ZYEA 2SGFE 3VXFH 2VVCA 1CHOG 1O3JA 3RXMA 1FDPA 3WY8A 1OXGA 2F9OA 1LO6A 1A0LA 4GHQA 1ESBA 2OC8A 1ELVA 3DA9B 1TMBH 1DSTA 1UK3A 2SNVA 2ANKH 1MMJN 2PKSB 3HATH 3ZZ8A 2ANYA 4AFQA 1HNEE 1GMCG 2NU3E 1KXFA 1LHFH 1LTOA 4ZHLU 2AS9A 3E90B 5DO4H 2WPMS 2D26C 3T26A 9LPRA 1DSUA 3EQ0H 1JMOH 1CHOF 1OOKB 5FBIA 1UK2A 2TGDA 5HMAA 1O3CA 3E6PH 3ZZ7A 2FP7B 1T8OA 8LPRA 4UONA 1G30B 1HAGE 2GCTC 2M5TA 3B23B 6ESTA 3Q77A 1YCPK 1UTJA 5E8EH 3IITA 3SGBE 1C9PA 1GBKA 1JRTA 1QBNA 4I32A 5JPMH 1LKAA 1ZSKA 1BTPA 2QF0A 5LPEA 4DY7B 2A5AA 3ENSB 1SGFG 1TNLA 1OWEA 1Y59T 1EOJA 3B9FH 4M7GA 1MBMA 2NU2E 1ZRBA 2ZHDA 3TVJB 2WV5A 2HALA 1O36A 4NIYA 1CGHA 1TA6A 2ZECA 2Q1JA 4E7NA 2H9EH 1MZAA 2YNBA 1ZHRA 2WV4A 3KN2A 4D76A 1P9UA 2R2MB 2R3YA 2PLXA 1Z8IB 1SGPE 3VGCB 3SV2H 1Y8TA 4H42U 5DKMA 3DT0H 3TH2H 3SV7A 3RC6A 1V2WT 3EE0B 1P2MA 3TGKE 1CE5A 1C5LH 3HK3B 5F6MA 1PQ5A 2QXJA 1ELGA 5DP7A 4VGCB 3TGIE 2B5TB 1HAVB 1O3MA 1P12E 1PYTC 2ALVA 1O2XA 1AHTH 1A1RA 2AIPA 1L1NA 2A1DB 3BG8A 3GOVB 3NWUA 5EODA 5GCHF 2C4FH 1Y3UA 1O5BB 4NSVA 1O2VA 1F0TA 6GCHF 5LPFA 1BUIA 1XX9A 3A89A 2H9HA 4ABDA 2P59A 3K2UA 4ZH8A 1GBJA 5ESBA 1H1BA 2GZ7A 1HGTH 1DWBH 2EI8A 4NA9H 2PTNA 1GI6A 2GP9B 2WPJS 4MQAA 2XTTB 3S69A 2FO9A 1GDUA 3HKIB 1BJUA 1K1NA 3SU1A 3HGPA 5DP3A 2A2QH 1GMDF 1YPGH 1FY3A 1EAIA 1XUJA 3GY4A 3C1KA 3RXDA 1NN6A 1C2KA 2ZU4A 2F3CE 1YPKH 1AE5A 3QUMP 2V6NA 1MH0A 1WOFA 1WQSA 2FOBA 5FBEA 1EB2A 1L4ZA 1C2JA 4RKOB 2IN2A 4DGJA 2BX3A 2RDLA 2ZDMA 1OP0A 1E38B 2BZ6H 3IG6B 4JZ1A 4AG2A 2J95A 4O9VA 2H2ZA 2FI4E 3OX7U 3LDXH 1WYKA 4IN2A 1DFPA 1O3BA 3FP8E 1EPTB 3MFJA 3U69H 4WJG2 1Y5UT 1A3BH 1ETRH 4NWKA 1HJAB 1YCPM 1GHAG 2ZGHA 1XUIA 2VH0A 1ZJDA 3A7WA 3TITA 1O3PB 1AMHA 1C2HA 1P3EA 2P3TB 5I25A 2ZFSA 4Y10E 5GDSH 5JBCS 2A4OA 1O2KA 5CHAC 4I7YH 2OD3B 3NK8A 5T6GA 1WU1A 4OS1A 2YNAA 3QTOH 1AB9B 1VGCC 2ZQ1A 4MTBA 1HB0B 4X8SH 2VWNA 3A8AA 4B74A 1Z71A 5FHTA 1PQ7A 4ASHA 2RA3A 4ABFA 4ESTE 3P6ZB 2UUJB 2BY8X 1MTSA 2Z9KA 8GCHF 3ODDA 4B76A 3SNEA 1ETTH 4OGYA 2XBXA 1SLVB 1H8DH 1NRRH 1GHWH 3U8OH 2AH4X 1ELTA 1EZXC 1P03A 4WXIA 2VIQA 1XUKA 1O2SA 5ESTE 3ESTA 1GWAA 3LGUA 1GCDA 2AEIH 2Y80A 1J17T 2WPHS 1VITH 4IBLH 4U32A 5DP8A 1BBRE 2DE8A 4CRCA 1PPBH 1Z8GA 3H7OA 2G5NA 1GG6C 1SQAA 1WTHD 2H9TH 3V12A 2STBE 3QGNB 3FAOA 3KL6A 1GDQA 1MQ5A 1SOTA 4ABJA 2V35A 4FUHA 1FAXA 1UHBA 1XUHA 2PKSC 3QZRA 1YKTA 1EOLA 4MNXA 1AO5A 2G52A 3FP7E 3Q00A 3OSYA 4B1TA 1IQNA 1J16A 5I46H 2ZGXH 3MNXA 5E0JA 2EEKA 4FU9A 1RTLA 4TPYA 1MTVA 3MU1A 2J4IA 1TOCB 1N6XA 5ETXA 2GCHG 3PLBA 1XKAC 3GICB 4WWYA 5C3NA 1HJ9A 1SGNE 3VB4A 1FLEE 2ANWA 4IMZA 1CBWC 4H6TA 6LPRA 4Y76A 3GY3A 3QDZB 3E91A 2BY6X 2XYAA 3N7OA 1BTZA 1UCYH 5LPRA 1KLJH 4DOQA 3ITIA 2HRVA 1O5FH 3STIA 2BLVA 7KMEH 5A8ZA 2WYGA 5DP6A 2ZGBH 1Y3VA 1O3AA 2C8WB 4K60A 4LK4A 4LXBH 3SI4H 1C1VH 1LDTT 2XCNA 1V2ST 1ZR0A 7GCHF 2ZGJA 1HV7A 5TCCA 1N6YA 2C8ZB 4CHAB 6CHAB 2F9NA 4X1SU 1ZTKA 1TYNA 1G32B 1OP2A 1MQ6A 1XVMA 4K5ZA 4INKA 1OS8A 1W11U 3O8RA 3E0NB 1GL1A 4K69A 4I8KA 1FY1A 1V2QT 3S9CA 3K6YA 2FWWA 4F4OC 3KQBA 1W2KH 5FX6A 2ZCKP 3W95A 1DY8A 3ZZ9A 1PYTD 4X2VA 1QFKH 2P3UB 2GZ9A 4BAMB 1IQIA 1XXFA 2J2UA 2VINA 5PTPA 2P8OB 2XWAA 4LZ4B 2BVRH 3E16B 4FUDA 5T6DA 1FXYA 1WBGB 3IWMA 4TPIZ 4FU8A 3UWIA 2H5CA 3MH5A 3ATIA 1C1UH 2BHGA 1EXFA 2ZEBA 3QN7A 3RXPA 1GMHG 4UFFH 4ABHA 1PQAA 1GI4A 2BD8A 3SJOA 1JXPA 1UK4A 1Y3WA 1K2I1 2ESTE 1LQDB 2A7JA 4OGXA 3MH4A 1QA7A 2QF3A 3TK6A 2ZZUH 1B5GH 1A3EH 3H7TA 2R9PA 2FOGA 2ZKSA 5IDKA 4YLQH 5JB9S 1Z1IA 1O30A 4BAHB 4UD9H 2OQ5A 1BTHH 1O3KA 1PQ8A 3SU6A 1F0UA 1TA2A 1C4V2 1C2EA 1E35B 4CH2B 1AZZA 1UVPA 1GBCA 1OPHB 1CA8B 1RJXB 1C5RA 1W3CA 3F6UH 1UJ1A 1D6RA 2FS9A 2PV9B 1Z1JA 1SFIA 2THFB 3ZZDA 5HYOA 4WMDA 1GBTA 3OYPA 4FUBA 1LVOA 1Y5BT 5AFZH 3I78A 3G01A 1V2MT 2TGPZ 2GT7A 3QX5H 4OS2A 2TIOA 4JMYA 1J15A 1ELCA 1EZSC 2FYQA 3OY6U 1F0RA 4NA8A 3ATMA 1YYY1 3ZZ5A 2A5IA 5J4SA 1GJ8B 4BOHA 2ZTXA 2JH6D 1C5MD 2UWPA 4AYYB 5TJXA 5FAHA 4GCHG 1CA0C 1GVZA 4CR5A 4ABGA 1QRWA 1QBVH 2ZFFH 4AFUA 1SHYA 1MAYA 2W3KA 2ZF0H 1GBEA 1G37A 2Y5GA 1BQYA 1QL7A 2ODYB 1LVYA 4WMEA 4KTSA 1YP9A 4DIIH 1BMNH 1QY6A 2F9BH 4VGCC 3TU7H 3F1SB 1EAUA 1EAWA 5C20A 1GJAB 1IQEA 5EQSA 1P05A 1GMCF 1UTKA 1W8BH 1GMHF 1SFQB 1TBRH 1ANBA 1DXWA 1LKBA 1TPPA 2VGCC 5K7RA 1H9HE 1NRNH 3PV4A 5G4BA 1F5LA 3UOPA 2ZHQH 1P10A 3MU8A 3LGYA 3NCLA 1BT7A 5DGJA 4NFFA 1C1SA 3M37A 4B2CA 1Z8RA 2KAIA 1BHXB 1C1MA 2G51A 4NIWA 1BTWA 4ISHH 2WPIS 2FZZA 4AGJA 2BD3A 2A0QB 2GV6A 2GMTB 3F9EA 1C5ZB 2SGEE 1QQ4A 2HPPH 5L30H 4NG9H 4BANB 1FY4A 4FVBA 1BJVA 4FUIA 3SJ8A 2V3HH 3M3TA 4YLUA 2CGAA 1HAYB 4FUGA 3M3SA 5FPSA 2FI5E 1K1IA 3S7HB 1CHGA 1CGIE 3RC4A 4A1TA 1XVOA 3BTGE 1BBRH 1RGQA 2H6MA 3T2NA 4Q2KA 3KEEA 5TCAA 3PMBB 1N8OB 1BTUA 3SU0A 1UVSH 1YLCA 3M36A 2OLGA 1QJ7B 2P95A 3EA7A 1VCWA 2AERH 4WH6A 2XRCA 4I33A 2Z9GA 3TH3H 5EQRA 3MTYA 2BLQA 4HI3A 4K2YA 4WY3A 3LOXA 3A8DA 3TNTA 3QGJA 1T8LA 5E2OA 2J94A 5A09A 1KTSB 4MG3A 2CF8H 2EC9H 3QLPH 4A6LA 3T28A 1W10U 3V0XA 2HPQH 3HPTB 1LHDH 5CHAB 2HGTH 2BDYA 3HGNA 1DXPA 2PSXA 4ISIH 4A92A 4FVDA 3TK5A 1OX1A 2A2XH 2OUAA 3H5CB 3P17H 3A7TA 2FEQH 3U1IB 5ABWA 4AFSA 1EP5A 1S85A 3BTWE 2JKHA 3VB5A 2K1QA 1FNIA 1S0RA 1ZTLA 3UR9A 3ATWA 1XXDA 5DP9A 3BTHE 3CS7A 1MU6B 1O5GH 4FUCA 1KLIH 3UNRA 6GCHG 1BITA 2PKAB 3M7QA 1AVXA 1ORFA 1QHRB 2VVVA 4IMQA 4X6NA 2ZP0H 1BOQA 1UHBB 4ABEA 2OXSA 2PGBB 4JZFH 5DPAA 3Q3YA 1D3PB 1AI8H 4TWYA 1DWEH 2H5DA 2SNWA 4O03A 1P02A 1SQTA 3ZVDA 3AW1A 1EPTA 2G8TA 2QYIA 1FN8A 1SOZA 3MOCA 5FCRA 1YPEH 3CS0A 1VITF 3SN8A 1L0ZA 1C5QA 1TOMH 1OWHA 2ODQA 2XXLA 4Y79A 3M35A 1P2JA 1QR3E 9ESTA 2QXIA 2FX6A 3RXRA 3UQOA 5C5OA 4SGAE 3GYLB 1V2JT 1O5AB 2ZQ2A 4XSKU 3R3GB 2LPRA 3HK6B 3PMAB 4MVNA 1ANCA 4DT7B 3OU0A 4HTCH 3L6PA 2ZHWH 3RXUA 1ZGIA 1EASA 1TBZH 1OKXA 1GBIA 1BCUH 1KXEA 1RTKA 2BM2A 1ZHMA 4LOYH 4ZKRU 2FOEA 7ESTE 3ATLA 4GPGA 3ZVBA 2TGAA 2VIPA 2Y7XA 5GCHG 1AD8H 3R0FA 4DW2U 1SGYE 1GDNA 1NFYA 1EQ9A 2Z3CA 3MNCA 1DUAA 5DG6A 1IQGA 1EB1H 3KGPA 3QZQA 4KTCA 1O3EA 1GCTC 1DICA 1V2RT 2G5VA 4E05H 3SUEA 3RDZA 1ARBA 1HAIH 1O2PA 3EA8A 1TX8A 3SO3A 4FUEA 4NZQA 1O3OA 5FXLA 1BMMH 3GCOA 4Y0ZE 2PW8H 4BTTB 1MAXA 2ALPA 3BEFB 4MPXA 2ZFPH 1TWXB 1ETSH 4MLFB 5A0AE 2CF9H 2B8OH 1UCYK 2F9VA 4MNWA 3SNAA 5F8ZA 3SOSA 1YC0A 2XBVA 2R2WU 1BMAA 1O31A 4BAOB 1LHEH 2GDDA 1D3QB 1TGCA 2ZU1A 1P2IA 1Z7KA 4K3JA 5EPNA 2O8MA 1GJ5H 7GCHG 3M5MA 5JDUB 2UUFB 4AB9A 3DHKH 1T32A 4WMFA 4GLYA 1ELFA 1QB6A 1LHGH 1T7CA 2BD4A 4WVPE 4Y71A 1H4WA 2IOTA 2XBWA 1ELAA 3MH6A 2BD9A 1G3DA 2BMGB 5T6FA 2TGTA 2ZGCA 3AAUA 5JBAS 1SGRE 4INHA 2ZU3A 1S81A 2XWBI 2AIQA 1O2ZA 1IHTH 2JETB 3RU4T 1TMTH 1DWDH 4XBBA 4WH8A 3ZV9A 4CBOA 4NZLA 1JRSA 3UOUA 2AMQA 4AB8A 3FFGA 3RXKA 2GTBA 1O3FA 2XBYA 2AGIX 2EI6A 4ZROA 3ZZ4A 5A0BA 1NTPA 4ZAEA 4X6PA 1WSSH 3LPRA 1A5HA 2JH0D 1QBOA 5DP4A 5GPIB 3SZNA 4KTUA 3URDA 3EA9A 2O8LA 1FONA 4YTAA 1GPZA 1O3IA 3FANA 1FIZA 3A86A 1UTOA 1O2NA 1NESE 5HM9A 1G3BA 2HLCA 1V2PT 5AVDA 1ABJH 3PMHB 3UFAA 3ZZ6A 5EW2H 4YT7H 1YGCH 4IC6A 1TRYA 1Q31A 3AASA 5AF9H 3GCTG 1O2LA 4XOJA 3QK1A 3SUGA 1MCTA 3LJJA 3PTBA 4Q7YA 3BTME 1O2TA 1SL3A 3SNCA 1KXCA 3F9HA 2PUXB 4I8JA 4ISLA 1MKWH 1FIWA 1BB0B 2FOAA 5B6OA 2J34A 1BRCE 1ZHPA 3GY7A 1SI5H 5E0HA 1Z8JB 3O8DA 3SV6A 1IQKA 4AGKA 1JWTA 2C93B 3BF6H 1ZPBA 1MKWK 3PROA 1DVAH 4AG1A 3PLKA 1PPHE 1N1LA 4HFPB 3SV8A 2SGDE 4ZKOU 4HGCA 1P3CA 4GVUA 1LPZB 2FTMA 3RXLA 1FI8A 1A5GH 1JBUH 1O34A 1K1MA 1O35A 1V2VT 1T8MA 3EYDA 1YPHC 4MPVA 4AFZA 4BXWA 5LH8A 4Y11E 3S0NA 1L2EA 2G00A 2XC5A 2FOMB 3FZDA 2FXRA 3M5LA 2WUCA 2D8WA 4XDEA 3RM0H 4CRBA 3PTNA 3MMGA 3SU5A 5EXNA 1O2WA 1SSXA 1BIOA 1NU7B 2G4TA 2GVFA 1GGDC 3ZVGA 3LGIA 3UY9A 1HUTH 3PO1B 4FU7A 5F03A 3F9FA 1FZZA 2R0LA 2RG3A 4GAWA 3RM2H 2C90B 4X0WU 5DJ7A 2GV7A 3C27B 5F8TA 1AIXH 1GCTB 3KHVA 3GCHB 1T8NA 4B2BA 2D2DA 4O3UA 1Q3XA 1TABE 1GMDG 3OTJE 4CRGA 4I8GA 1VJAU 3MU0A 3TJOA 1GI0A 1C5WB 3RP2A 1YBWA 3T62A 1FN6A 2QXGA 3LGTA 1ZLRA 5C1YA 1HYLA 3SJ9A 1S0QA 2P3FH 1GI2A 3MYWA 1AVWA 2O8WA 4UFDH 3TK9A 1XMNB 1C5PA 1ZYOA 3BN9A 2ZFRH 1SMFE 2FMJA 4Y8XA 3SJIA 3M3VA 3RMNH 3GDSA 2GD4B 4NA7A 2ZDKA 2W3IA 4F49A 3FVFB 1EAXA 1KLTA 1GBHA 1ZZZA 1TRMA 3LGVA 1A4WH 1C5TA 1W0YH 3RLWH 1VR1H 1YCPH 1MTWA 1NPMA 2TPIZ 4O3TA 2OQUA 4YZUA 2AGGX 1DT2A 3SUFA 3MWIU 1H8IH 1DX5M 3SJKA 1QB1A 2P93A 3DUXH 4NFEA 1ESTA 4YT6H 1NU9A 3UREA 3KQEA 1O2UA 2Z94A 2WYJA 1ELBA 2ZTYA 4K1SA 4YOIA 1E0FD 2PFEA 1CA0B 2QAAA 2ZHEH 2DE9A 2BD7A 8GCHG 5FX5A 3S7KB 1LQEA 1NT1A 1AY6H 1HIAA 5A8XA 3ZVCA 2ZCHP 3VXEH 1GHBG 2UWLA 5CE1A 1JIRA 1K21H 1AFEH 4BTUB 4KELA 1A7SA 1UTPA 2C8YB 3CENA 1EZQA 4OS6A 1UTLM 3E3TA 4ABIA 2A7CA 1QL8A 2I6QA 1IHSH 3AW0A 1CU1A 1O38A 5EU8A 3T29A 4X8UH 3GY5A 1G3EA 1YPHE 1PPEE 3LGWA 3UWJH 2C3SA 1HAZB 2HNTC 1BBRK 1ZPCA 5EG4A 2QCYA 3SI3H 3D65E 2O9QA 3BV9B 1P2OA 1D3DB 2ZFQH 4E7RG 5JB8S 3VB3A 1CT0E 4Y6DA 3RXIA 3GY2A 1WUNH 4FXGH 1WV7H 2GMTC 2PHBA 1GHVH 1UVUH 3DFJA 3SGAE 1K1PA 1HAXB 2BDBA 1V2TT 1FY5A 2ZTZA 1OWIA 1TAWA 1GBLA 4Y0YE 1KDQB 4TWWA 2OBQA 1FY8E 1EKBB 4D7FA 1THRH 1VCQA 4XBDA 1BA8B 5EOKA 4ISOA 2ULLA 1A5IA 4CRDA 2BDHA 1HDTH 2ZPSA 3LC3A 2PKAA 2JH5D 4AYVB 4B75A 2OCVB 3FP6E 2BOKA 2QN5T 4GHTA 3LC5A 4D9RA 1TONA 3TGJE 1AUTC 1W0ZU 4U2WA 1MU8B 1FPCH 3NPSA 2F9UA 4D8NA 8KME2 1NFWA 3LKWA 4Y7BA 2W7SA 4IS5A 2DUCA 4IW4E 1P0SH 5T3HA 2ZC9H 2W26A 3M61U 3SBKA 5J4QA 3P8FA 3VB6A 4NCYA 2VH6A 2HOBA 1ACBE 1HJAC 2BD5A 2QY0B 3PO1C 3TIUA 2OBOA 5E2PA 2PWXA 1P2QA 2ANMH 1KDQA 2SGPE 1O3GA 1CT2E 1MUEB 4D9QA 1GBAA 4JK5A 1C2IA 3A7VA 3L33A 3RXEA 1IOEA 2FESH 1TNIA 3PMJA 3SU3A 2H1UA 3ZVFA 3RXBA 1SGQE 2OC0A 2BQ6B 1G9IE 3BSQA 3URCA 1GL0E 3A84A 5FPYA 1C1PA 1ZRKA 1C2FA 2J92A 3STJA 1V3XA 1KXDA 1DS2E 4CBNA 1F5KU 3P8NA 3GCHC 1GI8B 4KP0A 1HFDA 1PPCE 1X7AC 2Z3DA 1NC6A 1O3HA 3UIRA 2B7DH 1QTFA 2ILNA 5C1XA 1IQJA 4AN7A 4JZEH 1MBQA 4XE4A 1C1NA 1C5VA 1OYTH 1AFQB 5GIBA 2FTLE 3U8RH 2VIOA 2J9NA 1S6FA 4ZKNU 1O5CB 2BB4A 1IQLA 2OINA 2AGEX 1GHAF 3A8CA 2HNTF 3BEUA 3M7TA 4YOJA 1GJ4H 1TNKA 3PB1E 1GI5A 1C4U2 1O5DH 3KIDU 1IQMA 3UUZA 2ZHFH 3NXPA 2GX4A 2Y6TA 3SHCH 1M9UA 2Q6GA 2IPHA 2V3OH 4DIHH 2QV1A 1E37B 2ZA5A 3B8JA 3ZYDA 1O5EH 4Y8ZA 1O2RA 1SGIB 2VIWA 2D1JA 1W12U 1P06A 2ZU2A 3V3MA 2CHAC 2BOHB 1QGFA 2BZAA 1OSSA 1C1RA 3RMLH 4WXVA 2CN0H 1MTNB 1P09A 1SVPA 2NU4E 1AUJA 1OYQA 3GISB 1GJ7B 4FUFA 3MU4A 1W13U 1OWDA 3KCGH 1T31A 4XBCA 1C2GA 1PPZA 3RXOA 3RXTA 1OWKA 2O8TA 4NGAH 3BTEE 4MNVA 1TPAE 1GI9B 3Q3XA 4O97A 2A4RA 1KSNA 4FUJA 1BHXF 3FZZA 2A32A 4DG4A 3SW2B 4Q7XA 1Z6EA 3ZZBA 1GG6B 4I31A 5FPTA 1GI1A 1O2GH 4X6MA 1D3TB 4X2WA 2AFQB 4CR9A 1J14A 1A61H 1H9IE 2NWNA 3RMOH 3TJVA 4ZMAH 1WQVH 2AMPA 1YPLH 3BIUH 4K1TA 2WPLS 2KAIB 2BLWA 1QRXA 1WTGH 1CSOE 4E06H 3CP7A 1EJAA 4TYDA 1GVLA 1HBTH 2BLOA 2CJIA 1GBMA 1FUJA 2Z3EA 1ELEE 2BVSH 2ZU5A 4DCDA 1NS3A 1O0DH 4R0IA 2R0KA 1D6WA 2ZPQA 1ZJKA 1NY22 1EPTC 3RMMH 2BTCE 8ESTE 5K0HA 1L1GA 2Z9IA 1DLEA 5C1UA 1GBFA 2A4GA 2FI3E 5EGMA 3SHAH 3SORA 1RIWB 1UVOA 3A83A 1KXAA 3JZ1B 5L2ZH 1C5YB 1K1LA 1V2UT 4BNRA 4PROA 1AKSA 1TNGA 2ZCLP 4BXSA 1FQ3A 3SQHE 3Q76A 1TGTA 2CV3A 1W7XH 4A1XA 4CRFA 1ID5H 1G2LA 1JOUB 4DJZB 3VFEA 1HAPH 2FM2A 2OTVA 1BTXA 3MNBA 3L3TA 1SPJA 2Z9LA 1TFXA 1SC8U 3PYHA 2PTCE 5F8XA 1BRUP 1ZSJA 1HCGA 3UR6A 3TNSA 1QIXB 2J38A 1P2NA 3MO6A 3RXVA 2QA9E 3E8LA 1PPFE 1PPGE 2GDEH 1MTUA 4ZUHA 3W94A 1O37A 3QWCH 1SR5C 1VZQH 2BDIA 4NIVA 1F0SA 1UO6A 3RU4D 3DFLA 5EW1H 4BAQB 5CMXH 1MD8A 3A81A 1BRBE 1V2NT 1NZQH 5HM2A 1TX6A 3TLOA 2Y5HA 4K8YA 1B0EA 2P8OC 3F9GA 4GCHF 3T27A 3UTUH 1SGEE 1V2OT 1KXBA 3ZV8A 4U01A 2W5EA 3LIWA 3ZZCA 1L4DA 3D49H 1TBQH 2Z6BD 1V6DA 1BTYA 1KTTB 2FOFA 2BY5X 1SB1H 3A82A 2Y5FA 3GYMA 1O39A 4WF8A 1A0HB 1HAVA 2QC2A 1CBWB 1C2MA 3T5FH 3TJUA 2FIRH 2NU1E 1K28D 1O2YA 1C9TA 4MDSA 1A2CH 5GJ4B 5JBBS 2UUKB 2FX4A 2V0BA 1TIOA 3SNBA 1SHHB 1DPOA 4CRAA 1TX7A 3GDUA 4NIXA 2ODPA 5BPEA 2Y82A 1GHBF 2AYWA 2VIVA 1A0JA 1CO7E 1UCYE 1AVGH 4NSYA 1THSH 3RXHA 4CHAC 4THNH 4JZIA 2B9LA 3ZZ3A 2F9PA 2SFAA 1WCZA 1YF4A 1L1JA 1C4Y2 3GY8A 4I8LA 1SG8B 4JCNA 1FMGA 1NO9H 1A46H 4K1EA 2Y81A 1P01A 3KF2A 3SU2A 1J9CH 2A4QA 2VIDA 3K9XB 3E0PB 4SGBE 1YM0A 3U1JB 2A5KA 4KKDA 2TRMA 2GCTB 1F92A 1P2KA 1C2LA 2FPZA 3SUDA 1RD3B 2BQWB 5EXMA 2UUYA 2ZDLA 4AZ2B 3RXSA 1DITH 4GSOA 2HWLB 1LPGB 1INCA 2ASUB 1V2KT 1J8AA 4XFQA 1NRQH 1GVKB 1O32A 2XC0A 2LNCA 4RKJB 2WUBA 1TRNA 1QURH 4X1RU 4AORA 4CH8B 1EJNA 3PWCA 4X8VH 2HVXA 3HKJB 3BG4B 1TNHA 2CHAB 1UTNA 1S82A 3M7UA 4AX9H 1VITG 1BMLA 2NU0E 2BDCA 3BTFE 1BRAA 1TLDA 1MTNC 1NM6A 1AKSB 1Y3XA 3D62A 2PUQH 3P8OA 4UFEH 1TNJA 1GJCB 4J2YB 1HPGA 2PSYA 2UWOA 4OS4A 1FJSA 1W14U 2P94A 1DOJA 1YPMH 3ATKA 4IN1A 1P04A 1TQ7B 4RSPA 1T4VH 3RXQA 1SGFA 4UEHH 1C1WH 1QL9A 3A8BA 1AZ8A 7LPRA 1YLDA 1AFQC 4Z0KA 5EXLA 4ABAA 1C5UA 1ZMNA 3TPIZ 3BEIB 3SQEE 1IQFA 4X8TH 1C5OH 3MU5A 3U9AH 1KYNA 2XNIA 4X1QU 5E0GA 1XKBC 4ZXYH 3NKKA 1GHZA 2QXHA 1MCVA 5AHGH 4ZKSU 2IJOB 1SLWB 2VWLA 1D4PB 1DLKB 1XUGA 2C8XB 1G36A 3VB7A 5GWZA 5JBTA 4JK6A 1NFUA 1Q2WA 4D7GA 1DY9A 1S6HA 1B7XB 2ZPRA 1N8OC 4JYVH 1FPHH 3P92A 1KIGH 3VEQB 2BXUH 1GHXH 1K1JA 2VB0A 2PGQB 1Z6JH 2ZI2H 3BTTE 1G3CA 1P57B 5A0CA 3KQCA 2QIQA 5JYIA 1UVTH 1Y5AT 2ZIQH 3E1XB 3S9AA 2BD2A 4OS7A 5L6NH 1C1TA 5IYTA 3U98H 3LH1A 2GKVE 1CVWH 1NROH 2BDGA 2BQ7B 1S83A 1O2IA 1CT4E 1H9LB 3PWBA 4AOQA 1XUFA 1HLTH 2VWMA 3EAJA 2VU8E 1CQQA 1O3NA 5C2ZA 1HRTH 1RTFB 4QT8C 3RXGA 1HJ8A 2F83A 4B73A 1TGBA 1TE0A 4INLA 1ESAA 1ANDA 4J1YA 2FYRA 1U6QA 3A87A 1V2LT 2SGAA 5LGOA 3EGKH 1ELDE 5FCKA 2BX4A 5HGGA 2VGCB 1TGNA 2BY9X 1RFNA 3RXAA 1O33A 1P9SA 3GDVA 3ELAH 3M5OA 5DP5A 2FOCA 2G81E 1NFXA 4IGDA 1AB9C 1THPB 3NUMA 1AQ7A 1O2QA 2GGVB 1PFXC 3GCNA 3MH7A 1EUFA 3ZVAA 3BIVH 1C5NH 3AVZA 2GT8A 1BDAA 1HXEH 1FV9A 1DWCH 4NWLA 4YM9A 4Y7AA 1HXFH 4GUXA 1AWHB 1RIWC 2G4UA 3BTDE 3V13A 1DE7H 1QRZA 2FOHA 3A7XA 1EJMA 1QB9A 3LONA 3LT3A 2O8UA 3ODFA 5EPYA 3VGCC 2ZNKH 5GXPA 3EDXB 3T25A 4JYTA 2OC7A 1W7GH 2ZDNA 1KY9A 1QCPA 2RA0A 4H4FA 4ISNA 2EI7A 1SGDE 4LZ1H 1P11E 2TBSA 2EA3A 4A7IB 2F91A 2ZDVH 1LVMA 1O2OA 1SGTA 1EZUC 3VPKA 1C1QA 5EQQA 2RCEA 1RS0A 1AU8A 2VWOA 1TPOA 1YPJH 2VJ1A 4B71A 4TY7A 3LH3A 1T4UH 4IC5A 1OWJA 2FS8A 2YOLA 1IQHA 5BRRE 1GI3A 1LHCH 1GGDB 3QO6A 2FLBH 3KQDA 4ZXXH 1C5XB 3LU9B 3MO3A 1TALA 3RXCA 1O3DA 3I77A 3D23A 5C67A 3PM3A 1P8VC 3MO9A 1RXPA 2A7HA 1BZXE 2STAE 1LVBA 2A31A 2BXTH 4ABBA 1MKXH 2AMDA 1GJBB 3OY5U 4BTIB 3SNDA 1SBWA 4JYUH 4X2XA 2PR3A 2Z7FE 1D9IA 5A8YA 3GY6A 5H4IB 4Q80A 1DM4B 3TH4H 1DDJA 4BAKB 4MNYA 2GZ8A 1S84A 3GCTF 6CHAC 3Q3KA 4A1VA 1K9OE 1EATA 2HNTE 3RU4E 4UE7H 3DD2H 4KGAA 1DUEA 1XM1A 1WAYB 1TGSZ 1QQUA 3NZIA 4MPUA 5A2MH 3P95A 1SGCA 2FDAA 4YOGA 1EX3A 4X1PU 2VNTA 2B0FA 1ZGVA 1SLUB 4I8HA 2SGQE 1C1OA 1CGJE 2G55A 1VCPA 2ZDAH 1GBDA 4MPWA 3SU4A 1LCYA 3PLPA 3TJNA 2JETC 4JZDH 1GJ9B 1TQ0B 3BTKE 4R8TB 4X2YA 1E36B 1F2SE 2CMYA 1ZMJA 1AE8H 3S9BA 3A88A 1JIMA 4UDWH 4DURA 1FAKH 1F5RA 1S5SA 3UQVA 2CXVA 2FLRH 1EP6A 4X1NU 3RLYH 4A5TS 3A7YA 3ZZAA 1UMAH 1ANEA 3RC5A 1GHYH 2BYAX 1TMUH 3LJOA 1ZTJA 5DK1A 1TPSA 1ZSLA 4H6SB 3RUOA 1ZOMA 3BG4C 4YO9A 1UTMA 3A7ZA 3RXJA 5L2YH 4U30A 1VGCB 2XW9A 3M5NA 1AN1E 3U8TH
chains in the Genus database with same CATH superfamily
1TB6H 5C5NA 3A80A 3SZEA 3O8CA 3KNXA 3K6ZA 2GCHF 1RRKA 1E34B 5B6LA 1MKXK 1O3LA 1Y3YA 2WPKS 1QJ6B 1SQOA 1AGJA 1LMWB 1MZDA 1IAUA 3O8BA 1LPKB 5SGAE 1ARCA 1O2HA 2Y7ZA 5HXFA 1UTQA 1DANH 2BDAA 3F68H 1ZPZA 3QTVH 2P16A 2WHXA 1QA0A 2VVUA 3UNSA 1VJ9U 1GJ6A 2ZG0H 1QNJA 1O2JA 4Y8YA 1HAHH 2I6SA 4ZHMU 4X6OA 3V7TA 1MD7A 5AFYH 1HAOH 3SV9A 4DVAU 2BVXH 4CREA 2OC1A 4TY6A 2XCFA 4RN6A 3SGQE 1NRSH 2OP9A 3MI4A 2FODA 2YMSC 3AAVA 2Q6FA 2QGRA 4HZHA 1C2DA 2A45B 4K8BA 2R3UA 2ZO3H 1B0FA 3JZ2B 4Z6AH 2W7UA 3UNQA 1OP8A 1O2MA 3UPEA 1G2MA 1ZMLA 1HIAB 2WINI 2BY7X 4OS5A 3A85A 1SLXB 1GBBA 2ZFTA 4UFGH 3MNSA 4B2AA 3RXFA 1NRPH 3I29A 3P8GA 4ZHAA 2ZWLH 2Q6DA 2QF4A 1K1OA 1F7ZA 4YESB 3BTQE 1ABIH 3MHWU 3K65B 2Z9JA 2XC4A 1QJ1B 1AWFH 4Q7ZA 1GI7B 3ZVEA 3P70B 1GJDB 1PJPA 1K22H 2L6OA 1C5SA 3ZYEA 2SGFE 3VXFH 2VVCA 1CHOG 1O3JA 3RXMA 1FDPA 3WY8A 1OXGA 2F9OA 1LO6A 1A0LA 4GHQA 1ESBA 2OC8A 1ELVA 1WXRA 3DA9B 1TMBH 1DSTA 1UK3A 2KCOA 2ANKH 1MMJN 2PKSB 2SNVA 3HATH 3ZZ8A 2ANYA 4AFQA 1HNEE 1GMCG 2NU3E 3OE7D 1KXFA 1LHFH 1LTOA 4ZHLU 2AS9A 3E90B 5DO4H 2WPMS 2D26C 3T26A 9LPRA 3UB0A 1DSUA 3EQ0H 1JMOH 1CHOF 1OOKB 5FBIA 1UK2A 2TGDA 5HMAA 1O3CA 3E6PH 3ZZ7A 2FP7B 1T8OA 8LPRA 4UONA 1G30B 1HAGE 2GCTC 2M5TA 3B23B 3N99A 6ESTA 3Q77A 1YCPK 1UTJA 5E8EH 3DSOA 3IITA 1C9PA 1GBKA 1JRTA 1QBNA 4I32A 3SGBE 4ACBA 5JPMH 1LKAA 1ZSKA 1BTPA 2QF0A 5LPEA 4DY7B 2A5AA 3ENSB 4DT4A 1SGFG 1TNLA 1OWEA 1Y59T 1EOJA 3B9FH 4M7GA 1MBMA 2NU2E 1ZRBA 2ZHDA 3TVJB 2WV5A 2HALA 1O36A 4NIYA 1CGHA 1TA6A 2ZECA 2Q1JA 4E7NA 2H9EH 1MZAA 2YNBA 1ZHRA 2WV4A 3KN2A 4D76A 1P9UA 2R2MB 2R3YA 2PLXA 1Z8IB 1SGPE 3VGCB 3SV2H 1Y8TA 4H42U 5DKMA 3DT0H 3TH2H 3SV7A 3RC6A 1V2WT 3EE0B 3F2FA 1P2MA 3TGKE 1CE5A 1C5LH 3HK3B 5F6MA 1PQ5A 2QXJA 1ELGA 5DP7A 4VGCB 3TGIE 1W0KD 2B5TB 1HAVB 1O3MA 1P12E 1PYTC 1KMHB 2ALVA 1O2XA 1AHTH 1A1RA 2AIPA 1L1NA 2A1DB 3BG8A 3GOVB 3NWUA 5EODA 5GCHF 2C4FH 1Y3UA 1O5BB 4NSVA 1O2VA 1F0TA 6GCHF 2KCPA 5LPFA 1BUIA 1XX9A 3A89A 2H9HA 4ABDA 2P59A 3K2UA 4ZH8A 1GBJA 5ESBA 1H1BA 2GZ7A 1HGTH 1DWBH 2EI8A 4NA9H 2PTNA 1GI6A 2GP9B 2WPJS 4MQAA 2XTTB 3S69A 2FO9A 1GDUA 3HKIB 1BJUA 1K1NA 3SU1A 3HGPA 5DP3A 2A2QH 1GMDF 1YPGH 3DSGA 1FY3A 1EAIA 1XUJA 3GY4A 3C1KA 3RXDA 1NN6A 1C2KA 2ZU4A 2F3CE 1S6LA 5FL7D 1YPKH 1AE5A 3QUMP 2V6NA 1MH0A 1WOFA 1WQSA 2FOBA 5FBEA 1EB2A 1L4ZA 1C2JA 4RKOB 2IN2A 4DGJA 2BX3A 2RDLA 2ZDMA 1OP0A 3CNRA 1E38B 2BZ6H 3IG6B 4JZ1A 4AG2A 2J95A 4O9VA 2H2ZA 2FI4E 3OX7U 3LDXH 5HIZA 1WYKA 4IN2A 2RDEA 1DFPA 1O3BA 3FP8E 1EPTB 3MFJA 3U69H 4WJG2 1Y5UT 1A3BH 1ETRH 4NWKA 1HJAB 1YCPM 1GHAG 2ZGHA 1XUIA 2VH0A 1ZJDA 3A7WA 3TITA 1O3PB 1AMHA 1C2HA 1P3EA 2P3TB 5I25A 2ZFSA 4Y10E 5GDSH 5JBCS 2A4OA 1O2KA 5CHAC 4I7YH 2OD3B 3NK8A 5T6GA 1WU1A 4OS1A 2YNAA 3QTOH 1AB9B 1VGCC 2ZQ1A 4MTBA 1HB0B 4X8SH 2VWNA 3A8AA 4B74A 3PRBA 1Z71A 5FHTA 1PQ7A 3ZIAD 4ASHA 2RA3A 4ABFA 4ESTE 3P6ZB 2UUJB 2BY8X 1MTSA 2Z9KA 3KYGA 3ODDA 8GCHF 4B76A 3SNEA 1ETTH 4OGYA 2XBXA 1SLVB 1H8DH 1NRRH 1GHWH 3U8OH 2AH4X 1P03A 1EZXC 1BMFD 1ELTA 2VIQA 4WXIA 1XUKA 1O2SA 5ESTE 3ESTA 1GWAA 4XRNA 3LGUA 1GCDA 2AEIH 2Y80A 1J17T 2WPHS 1VITH 4IBLH 4U32A 5DP8A 1BBRE 2DE8A 4CRCA 1PPBH 1Z8GA 3H7OA 2G5NA 2CK3D 1GG6C 1SQAA 1WTHD 2H9TH 3V12A 2STBE 3QGNB 3FAOA 3KL6A 1GDQA 1MQ5A 1SOTA 4ABJA 2V35A 4FUHA 1FAXA 1UHBA 1XUHA 2PKSC 3QZRA 1YKTA 1EOLA 4MNXA 1AO5A 2G52A 3FP7E 3Q00A 3OSYA 4B1TA 1IQNA 1J16A 5I46H 2ZGXH 3MNXA 5E0JA 2EEKA 4FU9A 1RTLA 4TPYA 1MTVA 3MU1A 2J4IA 1TOCB 1N6XA 5ETXA 2GCHG 3PLBA 1XKAC 3GICB 4WWYA 5C3NA 1HJ9A 1SGNE 3VB4A 1FLEE 2ANWA 4IMZA 2IJD1 1CBWC 4H6TA 6LPRA 4Y76A 3GY3A 3QDZB 3E91A 2BY6X 2XYAA 3N7OA 1BTZA 1W0JD 1UCYH 5LPRA 1KLJH 4DOQA 3ITIA 2HRVA 1O5FH 3STIA 2BLVA 7KMEH 5A8ZA 2WYGA 5DP6A 2ZGBH 1Y3VA 1O3AA 2C8WB 4K60A 4LK4A 3FKSD 4LXBH 3SI4H 1C1VH 1E1QD 1LDTT 2XCNA 1V2ST 1ZR0A 7GCHF 2ZGJA 1HV7A 5C94A 5TCCA 1N6YA 2C8ZB 4CHAB 6CHAB 2F9NA 4X1SU 1ZTKA 1TYNA 1G32B 1OP2A 2WZQA 3PV2A 1MQ6A 1XVMA 4K5ZA 4INKA 1OS8A 1W11U 3O8RA 3E0NB 1GL1A 4K69A 4I8KA 1FY1A 4B6EA 1V2QT 3S9CA 3K6YA 2FWWA 2M2AA 4F4OC 3KQBA 1W2KH 5FX6A 2ZCKP 5HKKD 3W95A 1DY8A 3ZZ9A 1PYTD 4X2VA 1QFKH 2P3UB 2GZ9A 4BAMB 1IQIA 1XXFA 2J2UA 2VINA 5PTPA 2P8OB 2XWAA 4LZ4B 2BVRH 3E16B 4FUDA 5T6DA 1FXYA 1WBGB 3IWMA 4TPIZ 4FU8A 3UWIA 2H5CA 3MH5A 3ATIA 1UW7A 1C1UH 2BHGA 1EXFA 2ZEBA 3QN7A 3RXPA 1GMHG 4UFFH 4ABHA 1PQAA 1QZ8A 1GI4A 2BD8A 3SJOA 1JXPA 1UK4A 1Y3WA 5C0TA 1K2I1 1NBME 2ESTE 5C0UA 1LQDB 2A7JA 4OGXA 3MH4A 1QA7A 2QF3A 3TK6A 2ZZUH 1B5GH 1A3EH 3H7TA 2R9PA 2FOGA 2ZKSA 3OEED 4YLQH 5IDKA 5JB9S 1Z1IA 1O30A 4BAHB 4UD9H 2OQ5A 1BTHH 1O3KA 1PQ8A 3SU6A 1F0UA 4Z1MD 1TA2A 1C4V2 1C2EA 1E35B 4CH2B 1AZZA 1UVPA 1GBCA 1OPHB 1CA8B 1RJXB 1C5RA 1W3CA 3F6UH 1UJ1A 1D6RA 5HIYA 2FS9A 2PV9B 1Z1JA 1SFIA 2THFB 3ZZDA 5HYOA 4WMDA 1GBTA 3OYPA 4FUBA 4F55A 1LVOA 1Y5BT 5AFZH 3I78A 3G01A 1V2MT 2TGPZ 2GT7A 3QX5H 4OS2A 2TIOA 4JMYA 1J15A 1ELCA 1EZSC 2FYQA 3OY6U 1F0RA 4NA8A 3ATMA 1YYY1 3ZZ5A 2A5IA 5J4SA 1GJ8B 4BOHA 2ZTXA 3VG8A 2JH6D 4ZCNA 1C5MD 2UWPA 4AYYB 5TJXA 5FAHA 4GCHG 1CA0C 1GVZA 4CR5A 4ABGA 1QRWA 3EE7A 1QBVH 2ZFFH 4AFUA 1SHYA 2KCAA 1MAYA 2W3KA 2ZF0H 1GBEA 1G37A 2Y5GA 1BQYA 1QL7A 2ODYB 1LVYA 4WMEA 4KTSA 3WW7A 1YP9A 4DIIH 1BMNH 1QY6A 2F9BH 2XOKD 4VGCC 3TU7H 3F1SB 4AC9A 1EAUA 1EAWA 5C20A 1GJAB 1IQEA 5EQSA 1P05A 1GMCF 1UTKA 1W8BH 1GMHF 1SFQB 1TBRH 1ANBA 1DXWA 1LKBA 1TPPA 2VGCC 5K7RA 1H9HE 1NRNH 3PV4A 5G4BA 1F5LA 3UOPA 2ZHQH 1P10A 3MU8A 3LGYA 3NCLA 1BT7A 3F0PA 4NFFA 5DGJA 1C1SA 3M37A 4B2CA 1Z8RA 2KAIA 1BHXB 1C1MA 2G51A 2KX4A 2VBCA 4NIWA 1BTWA 4ISHH 2WPIS 2FZZA 4AGJA 2BD3A 2A0QB 2GV6A 2GMTB 3F9EA 1C5ZB 2SGEE 1QQ4A 2HPPH 5L30H 4NG9H 4BANB 1FY4A 4FVBA 1BJVA 4FUIA 3SJ8A 2V3HH 3M3TA 4YLUA 2CGAA 1HAYB 4FUGA 3M3SA 5FPSA 2FI5E 1K1IA 3S7HB 1CHGA 1CGIE 3RC4A 4A1TA 1XVOA 3BTGE 1BBRH 1RGQA 2H6MA 3T2NA 4Q2KA 3KEEA 5TCAA 3PMBB 1N8OB 1BTUA 3SU0A 1UVSH 1YLCA 3M36A 2OLGA 1QJ7B 2P95A 3EA7A 1VCWA 2AERH 4WH6A 2XRCA 4I33A 2Z9GA 3TH3H 3OTPA 5EQRA 3MTYA 2BLQA 4HI3A 4K2YA 4WY3A 3LOXA 3A8DA 3TNTA 3QGJA 1T8LA 5E2OA 2J94A 5A09A 1KTSB 2PP6A 4MG3A 2CF8H 2EC9H 3QLPH 4A6LA 3T28A 1W10U 3V0XA 2HPQH 3HPTB 1LHDH 5CHAB 2HGTH 2BDYA 3HGNA 1DXPA 2PSXA 4ISIH 4A92A 4FVDA 3TK5A 1OX1A 2A2XH 2OUAA 3H5CB 3P17H 3A7TA 2FEQH 3U1IB 5ABWA 4AFSA 1EP5A 1S85A 3BTWE 2JKHA 3VB5A 2K1QA 1WDIA 1FNIA 1S0RA 1ZTLA 3UR9A 3ATWA 1XXDA 5DP9A 3BTHE 3CS7A 1MU6B 1O5GH 4FUCA 1KLIH 3UNRA 6GCHG 1BITA 2PKAB 3M7QA 1AVXA 1ORFA 1QHRB 2VVVA 4IMQA 4X6NA 2ZP0H 1BOQA 1UHBB 4ABEA 2OXSA 2PGBB 4JZFH 5DPAA 3Q3YA 1D3PB 1AI8H 4TWYA 1DWEH 2H5DA 2SNWA 4O03A 1P02A 1SQTA 3ZVDA 3AW1A 1EPTA 2G8TA 2QYIA 1FN8A 1SOZA 3MOCA 5FCRA 1YPEH 3CS0A 1VITF 3SN8A 1L0ZA 1C5QA 1TOMH 1OWHA 2ODQA 2XXLA 4Y79A 3M35A 1P2JA 1QR3E 9ESTA 2QXIA 2FX6A 3RXRA 3UQOA 5C5OA 4SGAE 3GYLB 1V2JT 1O5AB 2ZQ2A 4XSKU 4FETA 3R3GB 2J98A 2LPRA 3HK6B 3PMAB 4MVNA 1ANCA 4DT7B 3OU0A 4HTCH 3L6PA 1H8ED 2ZHWH 3RXUA 1ZGIA 1EASA 1TBZH 1OKXA 1GBIA 1BCUH 1KXEA 1RTKA 2BM2A 1ZHMA 4LOYH 4ZKRU 2FOEA 7ESTE 3ATLA 4GPGA 3ZVBA 2TGAA 2VIPA 2Y7XA 5GCHG 1AD8H 3R0FA 4DW2U 1SGYE 1GDNA 1NFYA 1EQ9A 2Z3CA 3MNCA 1DUAA 5DG6A 3N7EA 1IQGA 1EB1H 3KGPA 3QZQA 4KTCA 1O3EA 1GCTC 5DSFA 1DICA 1V2RT 2G5VA 4E05H 3SUEA 3RDZA 1ARBA 1HAIH 1O2PA 3EA8A 1TX8A 3SO3A 4FUEA 4NZQA 1O3OA 5FXLA 1BMMH 3GCOA 4Y0ZE 2PW8H 4TT3D 4BTTB 1MAXA 2ALPA 3BEFB 4MPXA 2ZFPH 1TWXB 1ETSH 3N7DA 4MLFB 5A0AE 2CF9H 2B8OH 1UCYK 2F9VA 4MNWA 3SNAA 5F8ZA 3SOSA 1YC0A 2R2WU 2XBVA 1BMAA 1O31A 4BAOB 1LHEH 2GDDA 1D3QB 1TGCA 2ZU1A 1P2IA 1Z7KA 4K3JA 5EPNA 2O8MA 1GJ5H 7GCHG 3M5MA 5JDUB 2UUFB 3GS9A 4AB9A 3DHKH 3PV5A 1T32A 4WMFA 4GLYA 1ELFA 1QB6A 1LHGH 1T7CA 2BD4A 4WVPE 4Y71A 1H4WA 2IOTA 2XBWA 1ELAA 3MH6A 2BD9A 1G3DA 2BMGB 5T6FA 5EJ1A 2TGTA 2ZGCA 2EQNA 3AAUA 5JBAS 1SGRE 4INHA 2ZU3A 1S81A 2XWBI 2AIQA 1O2ZA 1IHTH 2JETB 3RU4T 1TMTH 1DWDH 4XBBA 4WH8A 3ZV9A 4CBOA 4NZLA 1JRSA 3UOUA 2AMQA 4AB8A 3FFGA 3RXKA 2GTBA 1O3FA 2J97A 2AGIX 2EI6A 2XBYA 4ZROA 3ZZ4A 5A0BA 1NTPA 4ZAEA 4X6PA 1WSSH 3LPRA 1A5HA 2JH0D 2YMSB 1QBOA 5DP4A 5GPIB 3SZNA 4KTUA 3URDA 3EA9A 2O8LA 1FONA 4YTAA 1GPZA 1O3IA 3FANA 1FIZA 3A86A 1UTOA 1O2NA 1NESE 5HM9A 1G3BA 2HLCA 1V2PT 5AVDA 1ABJH 3NRLA 3PMHB 3UFAA 3ZZ6A 5EW2H 4YT7H 1YGCH 4IC6A 1TRYA 1Q31A 3AASA 5AF9H 3GCTG 1O2LA 4XOJA 2LELA 3QK1A 3SUGA 1MCTA 3LJJA 3PTBA 4Q7YA 3BTME 1O2TA 1SL3A 3SNCA 4B6FA 2WSSD 1KXCA 3F9HA 2PUXB 4I8JA 4ISLA 1MKWH 3H09A 1FIWA 1BB0B 2FOAA 5B6OA 2J34A 1BRCE 5EIYA 1ZHPA 3GY7A 1SI5H 5E0HA 1Z8JB 3O8DA 3SV6A 1IQKA 4AGKA 1JWTA 2C93B 3BF6H 1ZPBA 1MKWK 3PROA 1DVAH 4AG1A 3PLKA 1PPHE 1N1LA 4HFPB 3SV8A 4F48B 2SGDE 4ZKOU 4HGCA 1P3CA 4GVUA 1LPZB 2FTMA 3RXLA 1FI8A 1A5GH 1JBUH 1O34A 1K1MA 1O35A 1V2VT 1T8MA 3EYDA 1YPHC 2V7QD 4MPVA 4AFZA 4BXWA 5LH8A 4Y11E 3S0NA 1L2EA 2G00A 2XC5A 2FOMB 3FZDA 2FXRA 3M5LA 2WUCA 2D8WA 2WV9A 4XDEA 3RM0H 4CRBA 3PTNA 3MMGA 3SU5A 5EXNA 1O2WA 1SSXA 4Q4LA 3KYFA 1BIOA 1NU7B 2G4TA 5EJZA 2GVFA 1GGDC 3ZVGA 3LGIA 3UY9A 1HUTH 3PO1B 4FU7A 5F03A 3F9FA 2KCYA 1FZZA 2R0LA 2RG3A 4GAWA 3RM2H 2C90B 4X0WU 5DJ7A 2GV7A 3C27B 5F8TA 1AIXH 1GCTB 2JIZD 3KHVA 3GCHB 1T8NA 4B2BA 2JJ1D 2D2DA 4O3UA 1Q3XA 1TABE 1GMDG 3OTJE 4CRGA 4I8GA 1VJAU 3MU0A 3TJOA 1GI0A 1C5WB 3RP2A 1YBWA 2EY4C 1FN6A 3T62A 2QXGA 3LGTA 1ZLRA 1SQRA 5C1YA 1HYLA 3SJ9A 1S0QA 2P3FH 1GI2A 3MYWA 1AVWA 2O8WA 4UFDH 3TK9A 1XMNB 1C5PA 2RFKC 1ZYOA 3BN9A 2ZFRH 1SMFE 2FMJA 4Y8XA 3SJIA 3M3VA 3RMNH 3GDSA 2GD4B 4NA7A 2ZDKA 2W3IA 4F49A 3FVFB 1EAXA 1KLTA 1GBHA 1ZZZA 1TRMA 3LGVA 1A4WH 1C5TA 1W0YH 3RLWH 1VR1H 1YCPH 1MTWA 1NPMA 2TPIZ 4O3TA 2OQUA 4YZUA 2AGGX 1DT2A 3SUFA 3MWIU 1H8IH 1DX5M 3SJKA 1QB1A 2P93A 3DUXH 4NFEA 1ESTA 4YT6H 1NU9A 3UREA 3KQEA 1O2UA 2Z94A 2WYJA 3OAAD 1ELBA 2ZTYA 4K1SA 4YOIA 1E0FD 2PFEA 1CA0B 2QAAA 2ZHEH 2DE9A 2BD7A 8GCHG 5FX5A 3S7KB 1LQEA 1NT1A 1AY6H 3DSPA 1HIAA 5A8XA 3ZVCA 2ZCHP 3VXEH 1GHBG 2UWLA 5CE1A 1JIRA 1K21H 1AFEH 4BTUB 4KELA 1A7SA 1UTPA 2C8YB 3CENA 1EZQA 4OS6A 1UTLM 3E3TA 4ABIA 2A7CA 1QL8A 2I6QA 1IHSH 3AW0A 1CU1A 1O38A 5EU8A 3T29A 4X8UH 2XNDD 3GY5A 1G3EA 1YPHE 1PPEE 3LGWA 3UWJH 2C3SA 1HAZB 2HNTC 1BBRK 1ZPCA 5EG4A 2QCYA 3SI3H 3D65E 2O9QA 3BV9B 1P2OA 1D3DB 2ZFQH 4E7RG 5JB8S 3VB3A 1CT0E 4Y6DA 3RXIA 1YY3A 3GY2A 1WUNH 4FXGH 1WV7H 2GMTC 2PHBA 1GHVH 1UVUH 3DFJA 3SGAE 1K1PA 1HAXB 2BDBA 1V2TT 1FY5A 2ZTZA 1OWIA 1TAWA 1GBLA 4Y0YE 1KDQB 4TWWA 2OBQA 5IK2D 1FY8E 1EKBB 4D7FA 1THRH 1VCQA 4XBDA 3SYJA 1BA8B 5EOKA 4ISOA 2ULLA 4RI0A 1A5IA 4CRDA 2BDHA 1HDTH 2ZPSA 3LC3A 2PKAA 2JH5D 4AYVB 4B75A 2OCVB 3FOAA 3FP6E 2BOKA 2QN5T 4GHTA 3LC5A 4D9RA 1TONA 3TGJE 1AUTC 1W0ZU 4U2WA 1MU8B 1FPCH 3NPSA 2F9UA 4D8NA 8KME2 1NFWA 3LKWA 4Y7BA 2W7SA 4IS5A 2DUCA 4IW4E 1P0SH 5T3HA 2ZC9H 1MABB 2W26A 3M61U 3SBKA 5J4QA 1NBMD 3P8FA 3VB6A 4NCYA 2VH6A 2HOBA 1ACBE 1HJAC 2BD5A 2QY0B 3PO1C 3TIUA 2OBOA 5E2PA 2PWXA 1P2QA 2ANMH 1KDQA 2SGPE 2IPQX 1O3GA 1CT2E 1MUEB 4D9QA 1GBAA 4JK5A 3FO8D 1C2IA 2J98B 3A7VA 3L33A 3RXEA 1IOEA 2QE7D 2FESH 1TNIA 3PMJA 3SU3A 2H1UA 3ZVFA 3RXBA 1SGQE 2OC0A 2BQ6B 1G9IE 3BSQA 3URCA 1GL0E 3A84A 5FPYA 1C1PA 1ZRKA 1C2FA 2J92A 3STJA 1V3XA 1KXDA 1DS2E 2F43B 4CBNA 1F5KU 3P8NA 3GCHC 1GI8B 4KP0A 1HFDA 1PPCE 1X7AC 2Z3DA 1NC6A 1O3HA 3UIRA 2B7DH 1QTFA 4RT0A 2ILNA 5C1XA 1IQJA 4AN7A 4JZEH 1MBQA 2K0QA 1C1NA 1C5VA 1OYTH 1AFQB 4XE4A 5GIBA 2FTLE 3U8RH 2VIOA 2J9NA 1S6FA 4ZKNU 1O5CB 2BB4A 1IQLA 2OINA 2AGEX 1GHAF 3A8CA 2HNTF 3BEUA 3M7TA 4YOJA 1GJ4H 1TNKA 3PB1E 1GI5A 1C4U2 1O5DH 3KIDU 1IQMA 3UUZA 2ZHFH 3NXPA 2GX4A 2Y6TA 3SHCH 1M9UA 2Q6GA 2IPHA 2V3OH 4DIHH 2QV1A 1E37B 2ZA5A 3B8JA 3ZYDA 5KECA 1O5EH 5F53A 4Y8ZA 1O2RA 1SGIB 2VIWA 2WPDD 2D1JA 1W12U 4HG6A 1P06A 2ZU2A 3V3MA 2CHAC 1OHHD 1QGFA 2BOHB 2BZAA 1OSSA 1C1RA 3RMLH 4WXVA 2CN0H 1MTNB 1P09A 1SVPA 2NU4E 1AUJA 1OYQA 3GISB 1GJ7B 4FUFA 3MU4A 1W13U 1OWDA 3KCGH 1T31A 4XBCA 1C2GA 1PPZA 3RXOA 3RXTA 1OWKA 2O8TA 4NGAH 3BTEE 4MNVA 1TPAE 1GI9B 3Q3XA 4O97A 2A4RA 2OK5A 1KSNA 4FUJA 1BHXF 3FZZA 1YLNA 2A32A 4DG4A 3SW2B 4Q7XA 1Z6EA 3ZZBA 1GG6B 4I31A 5FPTA 1GI1A 1O2GH 4X6MA 1D3TB 4X2WA 2AFQB 4CR9A 4YXWD 1J14A 1A61H 1H9IE 2NWNA 3RMOH 3TJVA 4ZMAH 1WQVH 2AMPA 1YPLH 3BIUH 4K1TA 2WPLS 4P02A 2KAIB 2BLWA 1QRXA 1WTGH 1CSOE 4E06H 3CP7A 1EJAA 4TYDA 1GVLA 1HBTH 2BLOA 2CJIA 1GBMA 1FUJA 2Z3EA 3U28C 1ELEE 2BVSH 2ZU5A 4DCDA 1NS3A 1O0DH 4R0IA 2R0KA 1D6WA 2ZPQA 1ZJKA 1NY22 1EPTC 3RMMH 2BTCE 8ESTE 5K0HA 1L1GA 2Z9IA 1DLEA 5C1UA 1EFRD 1GBFA 2A4GA 2FI3E 5EGMA 3UAIC 3SHAH 3SORA 1RIWB 1UVOA 3A83A 1KXAA 3JZ1B 5L2ZH 1C5YB 1K1LA 1V2UT 5EJLA 4BNRA 4PROA 1AKSA 1TNGA 2ZCLP 4BXSA 1FQ3A 3SQHE 3Q76A 1TGTA 2CV3A 1W7XH 4A1XA 4CRFA 1ID5H 5C17A 1G2LA 1JOUB 4DJZB 3VFEA 1HAPH 2FM2A 2OTVA 1BTXA 3MNBA 3L3TA 1SPJA 2Z9LA 1TFXA 1SC8U 3PYHA 2PTCE 5F8XA 1BRUP 1ZSJA 1HCGA 3UR6A 3TNSA 1QIXB 1FX0B 2J38A 1P2NA 3MO6A 3RXVA 2QA9E 3E8LA 1PPFE 1PPGE 2GDEH 1MTUA 4P00A 4ZUHA 3W94A 1O37A 2KR7A 3QWCH 1SR5C 1VZQH 2BDIA 3AK5A 4NIVA 1F0SA 1UO6A 3RU4D 5DN6D 3DFLA 5EW1H 4BAQB 5CMXH 1MD8A 3A81A 1BRBE 1V2NT 1NZQH 5HM2A 1TX6A 3TLOA 2Y5HA 4K8YA 1B0EA 2P8OC 3F9GA 4GCHF 3T27A 3UTUH 1SGEE 1V2OT 1KXBA 3ZV8A 4U01A 2W5EA 3LIWA 3ZZCA 1L4DA 3D49H 1TBQH 2Z6BD 1V6DA 1BTYA 1KTTB 2FOFA 2BY5X 1SB1H 3A82A 2Y5FA 3GYMA 1O39A 4WF8A 1A0HB 1HAVA 2QC2A 1CBWB 1C2MA 4TSFD 3T5FH 3TJUA 2FIRH 5CHBA 2NU1E 1K28D 1O2YA 1C9TA 4MDSA 3F3BA 1A2CH 2W6ID 5GJ4B 5JBBS 2UUKB 2FX4A 2V0BA 1TIOA 3SNBA 3WWBA 5KEDA 1SHHB 1DPOA 4CRAA 1TX7A 3GDUA 4NIXA 5GNDA 2ODPA 5BPEA 2Y82A 1GHBF 2AYWA 2QF5A 2VIVA 1A0JA 2KM0A 1CO7E 1UCYE 1AVGH 4NSYA 3W1EA 1THSH 3RXHA 4CHAC 4THNH 4JZIA 2B9LA 2GJGA 2V3MA 3ZZ3A 2F9PA 2SFAA 1WCZA 1YF4A 1L1JA 1C4Y2 3GY8A 4I8LA 1SG8B 4JCNA 1FMGA 1NO9H 1A46H 4K1EA 2Y81A 1P01A 3KF2A 3SU2A 1J9CH 2A4QA 2VIDA 3K9XB 3E0PB 4SGBE 1YM0A 3U1JB 2A5KA 4KKDA 2TRMA 2AHME 2GCTB 1F92A 1P2KA 1C2LA 2FPZA 5T1VA 3OEHD 3PRDA 3SUDA 1RD3B 2BQWB 5EXMA 2UUYA 2ZDLA 4AZ2B 3RXSA 1DITH 4GSOA 2HWLB 1LPGB 1INCA 2ASUB 2W6JD 1V2KT 1J8AA 4XFQA 1NRQH 1GVKB 1O32A 2XC0A 2LNCA 4RKJB 2WUBA 1TRNA 1QURH 1SKYE 4X1RU 4AORA 4CH8B 1EJNA 3PWCA 4X8VH 2HVXA 3HKJB 3BG4B 3FN8A 1TNHA 2CHAB 1UTNA 1S82A 3M7UA 4AX9H 1VITG 1BMLA 2NU0E 2BDCA 2JDID 3BTFE 1BRAA 1TLDA 1MTNC 1NM6A 1AKSB 1Y3XA 3D62A 2PUQH 3P8OA 4UFEH 1TNJA 1GJCB 4J2YB 1HPGA 2PSYA 2UWOA 4OS4A 1FJSA 1W14U 2P94A 1DOJA 1YPMH 3ATKA 4IN1A 1P04A 1TQ7B 4Q63A 4RSPA 1T4VH 1COWD 3RXQA 1SGFA 4UEHH 1C1WH 1QL9A 3A8BA 1AZ8A 4M9FA 4FOUC 7LPRA 1YLDA 1AFQC 4Z0KA 5EXLA 4ABAA 1C5UA 1ZMNA 3TPIZ 3BEIB 3SQEE 1IQFA 4X8TH 1C5OH 3MU5A 3U9AH 1KYNA 2XNIA 4X1QU 5E0GA 3MQKC 1XKBC 4ZXYH 2YMSD 3NKKA 1GHZA 2QXHA 1MCVA 5AHGH 4ZKSU 2IJOB 1SLWB 1VKYA 2VWLA 1D4PB 1DLKB 1XUGA 2C8XB 1G36A 3VB7A 5GWZA 5JBTA 4JK6A 1NFUA 1Q2WA 4D7GA 1DY9A 1S6HA 1B7XB 2ZPRA 1N8OC 4JYVH 1FPHH 3P92A 1KIGH 2K8IA 3VEQB 2BXUH 1GHXH 1K1JA 2VB0A 2PGQB 1Z6JH 2ZI2H 3BTTE 1G3CA 1P57B 5A0CA 3KQCA 2QIQA 5JYIA 1UVTH 1Y5AT 2ZIQH 3E1XB 3S9AA 2BD2A 4OS7A 5L6NH 1C1TA 5IYTA 3U98H 2HLDD 3LH1A 2GKVE 4OM9A 1CVWH 1NROH 2BDGA 2BQ7B 1S83A 1O2IA 1CT4E 1H9LB 3F0OA 3PWBA 4AOQA 1XUFA 1HLTH 2VWMA 3EAJA 2VU8E 1CQQA 2KFWA 1O3NA 5C2ZA 1HRTH 1RTFB 4QT8C 3RXGA 1HJ8A 2F83A 4B73A 1TGBA 1TE0A 4INLA 1ESAA 1ANDA 4J1YA 3F2GA 2FYRA 1U6QA 3A87A 1V2LT 2SGAA 5LGOA 3EGKH 1ELDE 5FCKA 5KGOA 2BX4A 5HGGA 2VGCB 1TGNA 2BY9X 1RFNA 4I86A 3RXAA 1O33A 1P9SA 3GDVA 3ELAH 3M5OA 5DP5A 2FOCA 2G81E 1NFXA 4IGDA 1AB9C 2JJ2D 1THPB 3NUMA 1AQ7A 1O2QA 2GGVB 1PFXC 2J5UA 3GCNA 5CDFE 3MH7A 1EUFA 3ZVAA 3BIVH 1C5NH 3AVZA 2GT8A 1BDAA 1HXEH 1FV9A 1DWCH 4NWLA 4YM9A 4Y7AA 1HXFH 4GUXA 1AWHB 1RIWC 2G4UA 3BTDE 3V13A 1DE7H 1QRZA 2FOHA 3KQ5A 3A7XA 1EJMA 1QB9A 3LONA 3LT3A 2O8UA 3ODFA 5EPYA 3VGCC 2ZNKH 5GXPA 3EDXB 3T25A 4JYTA 2OC7A 1W7GH 2ZDNA 1KY9A 1QCPA 2RA0A 4H4FA 4ISNA 1E79D 2EI7A 1SGDE 4LZ1H 1P11E 2TBSA 2EA3A 4A7IB 2F91A 2ZDVH 1LVMA 1O2OA 2HVYB 1SGTA 1EZUC 3VPKA 1C1QA 5EQQA 2RCEA 1RS0A 3DCLA 1AU8A 1YPJH 1TPOA 2VJ1A 2VWOA 4B71A 4TY7A 3LH3A 1T4UH 1H8HD 4IC5A 1OWJA 4ACAA 2FS8A 2YOLA 1IQHA 5BRRE 1GI3A 1LHCH 1GGDB 3QO6A 2FLBH 3KQDA 4ZXXH 1C5XB 3LU9B 3MO3A 1TALA 3RXCA 1O3DA 3I77A 2LP6A 3D23A 5C67A 3PM3A 1P8VC 3MO9A 1RXPA 2A7HA 1BZXE 2STAE 1LVBA 2A31A 2BXTH 4ABBA 1MKXH 2AMDA 1GJBB 3OY5U 4BTIB 3SNDA 1SBWA 4JYUH 4X2XA 2PR3A 3WWFA 2Z7FE 1D9IA 5A8YA 3GY6A 5H4IB 4Q80A 1DM4B 3TH4H 1DDJA 4BAKB 4MNYA 2GZ8A 1S84A 3GCTF 6CHAC 3Q3KA 4A1VA 1K9OE 1EATA 2HNTE 3RU4E 4UE7H 3DD2H 4KGAA 1DUEA 1XM1A 2KZ4A 1WAYB 1TGSZ 1QQUA 3NZIA 4MPUA 5A2MH 3P95A 1SGCA 2FDAA 4YOGA 1EX3A 4X1PU 2VNTA 2B0FA 1ZGVA 1SLUB 3F2HA 4I8HA 2SGQE 1C1OA 1CGJE 2G55A 1VCPA 2ZDAH 1GBDA 4MPWA 3SU4A 1LCYA 3PLPA 3TJNA 2JETC 4JZDH 1GJ9B 1TQ0B 3BTKE 4R8TB 4X2YA 1E36B 1F2SE 2CMYA 3OFND 1ZMJA 1AE8H 3S9BA 1YWUA 3A88A 1JIMA 4UDWH 4DURA 1FAKH 2L74A 1F5RA 1S5SA 3UQVA 2CXVA 2FLRH 1E1RD 1EP6A 4X1NU 3RLYH 4A5TS 3A7YA 4XD7D 3ZZAA 1UMAH 1ANEA 3RC5A 1GHYH 2BYAX 1TMUH 3LJOA 1ZTJA 4ASUD 5DK1A 2F4LA 1TPSA 1ZSLA 4H6SB 3RUOA 1ZOMA 3BG4C 4YO9A 1UTMA 3A7ZA 3RXJA 5L2YH 4U30A 1K0HA 1VGCB 2XW9A 3M5NA 1AN1E 4RT1A 3U8TH
chains in the Genus database with same CATH topology
1TB6H 5C5NA 3A80A 3O8CA 3KNXA 3K6ZA 2GCHF 1RRKA 1E34B 1MKXK 1O3LA 1Y3YA 2WPKS 1QJ6B 1SQOA 1AGJA 1LMWB 1MZDA 1IAUA 3O8BA 1LPKB 5SGAE 1ARCA 1O2HA 2Y7ZA 5HXFA 1UTQA 1DANH 2BDAA 3F68H 1ZPZA 3QTVH 2P16A 1QA0A 2VVUA 3UNSA 1VJ9U 1GJ6A 2ZG0H 1QNJA 1O2JA 4Y8YA 1HAHH 2I6SA 4ZHMU 4X6OA 3V7TA 1MD7A 5AFYH 1HAOH 3SV9A 4DVAU 2BVXH 4CREA 2OC1A 4TY6A 2XCFA 4RN6A 3SGQE 1NRSH 2OP9A 3MI4A 2FODA 3AAVA 2Q6FA 2QGRA 4HZHA 1C2DA 2A45B 4K8BA 2R3UA 2ZO3H 1B0FA 3JZ2B 4Z6AH 2W7UA 3UNQA 1OP8A 1O2MA 3UPEA 1G2MA 1ZMLA 1HIAB 2WINI 2BY7X 4OS5A 3A85A 1SLXB 1GBBA 2ZFTA 4UFGH 3MNSA 4B2AA 3RXFA 1NRPH 3I29A 3P8GA 4ZHAA 2ZWLH 2Q6DA 1K1OA 1F7ZA 4YESB 3BTQE 1ABIH 3MHWU 3K65B 2Z9JA 2XC4A 1QJ1B 1AWFH 4Q7ZA 1GI7B 3ZVEA 3P70B 1GJDB 1PJPA 1K22H 1C5SA 3ZYEA 2SGFE 3VXFH 2VVCA 1CHOG 1O3JA 3RXMA 1FDPA 3WY8A 1OXGA 2F9OA 1LO6A 1A0LA 4GHQA 1ESBA 2OC8A 1ELVA 3DA9B 1TMBH 1DSTA 1UK3A 2SNVA 2ANKH 1MMJN 2PKSB 3HATH 3ZZ8A 2ANYA 4AFQA 1HNEE 1GMCG 2NU3E 1KXFA 1LHFH 1LTOA 4ZHLU 2AS9A 3E90B 5DO4H 2WPMS 2D26C 3T26A 9LPRA 1DSUA 3EQ0H 1JMOH 1CHOF 1OOKB 5FBIA 1UK2A 2TGDA 5HMAA 1O3CA 3E6PH 3ZZ7A 2FP7B 1T8OA 8LPRA 4UONA 1G30B 1HAGE 2GCTC 2M5TA 3B23B 6ESTA 3Q77A 1YCPK 1UTJA 5E8EH 3IITA 3SGBE 1C9PA 1GBKA 1JRTA 1QBNA 4I32A 5JPMH 1LKAA 1ZSKA 1BTPA 2QF0A 5LPEA 4DY7B 2A5AA 3ENSB 1SGFG 1TNLA 1OWEA 1Y59T 1EOJA 3B9FH 4M7GA 1MBMA 2NU2E 1ZRBA 2ZHDA 3TVJB 2WV5A 2HALA 1O36A 4NIYA 1CGHA 1TA6A 2ZECA 2Q1JA 4E7NA 2H9EH 1MZAA 2YNBA 1ZHRA 2WV4A 3KN2A 4D76A 1P9UA 2R2MB 2R3YA 2PLXA 1Z8IB 1SGPE 3VGCB 3SV2H 1Y8TA 4H42U 5DKMA 3DT0H 3TH2H 3SV7A 3RC6A 1V2WT 3EE0B 1P2MA 3TGKE 1CE5A 1C5LH 3HK3B 5F6MA 1PQ5A 2QXJA 1ELGA 5DP7A 4VGCB 3TGIE 2B5TB 1HAVB 1O3MA 1P12E 1PYTC 2ALVA 1O2XA 1AHTH 1A1RA 2AIPA 1L1NA 2A1DB 3BG8A 3GOVB 3NWUA 5EODA 5GCHF 2C4FH 1Y3UA 1O5BB 4NSVA 1O2VA 1F0TA 6GCHF 5LPFA 1BUIA 1XX9A 3A89A 2H9HA 4ABDA 2P59A 3K2UA 4ZH8A 1GBJA 5ESBA 1H1BA 2GZ7A 1HGTH 1DWBH 2EI8A 4NA9H 2PTNA 1GI6A 2GP9B 2WPJS 4MQAA 2XTTB 3S69A 2FO9A 1GDUA 3HKIB 1BJUA 1K1NA 3SU1A 3HGPA 5DP3A 2A2QH 1GMDF 1YPGH 1FY3A 1EAIA 1XUJA 3GY4A 3C1KA 3RXDA 1NN6A 1C2KA 2ZU4A 2F3CE 1YPKH 1AE5A 3QUMP 2V6NA 1MH0A 1WOFA 1WQSA 2FOBA 5FBEA 1EB2A 1L4ZA 1C2JA 4RKOB 2IN2A 4DGJA 2BX3A 2RDLA 2ZDMA 1OP0A 1E38B 2BZ6H 3IG6B 4JZ1A 4AG2A 2J95A 4O9VA 2H2ZA 2FI4E 3OX7U 3LDXH 1WYKA 4IN2A 1DFPA 1O3BA 3FP8E 1EPTB 3MFJA 3U69H 4WJG2 1Y5UT 1A3BH 1ETRH 4NWKA 1HJAB 1YCPM 1GHAG 2ZGHA 1XUIA 2VH0A 1ZJDA 3A7WA 3TITA 1O3PB 1AMHA 1C2HA 1P3EA 2P3TB 5I25A 2ZFSA 4Y10E 5GDSH 5JBCS 2A4OA 1O2KA 5CHAC 4I7YH 2OD3B 3NK8A 5T6GA 1WU1A 4OS1A 2YNAA 3QTOH 1AB9B 1VGCC 2ZQ1A 4MTBA 1HB0B 4X8SH 2VWNA 3A8AA 4B74A 1Z71A 5FHTA 1PQ7A 4ASHA 2RA3A 4ABFA 4ESTE 3P6ZB 2UUJB 2BY8X 1MTSA 2Z9KA 8GCHF 3ODDA 4B76A 3SNEA 1ETTH 4OGYA 2XBXA 1SLVB 1H8DH 1NRRH 1GHWH 3U8OH 2AH4X 1ELTA 1EZXC 1P03A 4WXIA 2VIQA 1XUKA 1O2SA 5ESTE 3ESTA 1GWAA 3LGUA 1GCDA 2AEIH 2Y80A 1J17T 2WPHS 1VITH 4IBLH 4U32A 5DP8A 1BBRE 2DE8A 4CRCA 1PPBH 1Z8GA 3H7OA 2G5NA 1GG6C 1SQAA 1WTHD 2H9TH 3V12A 2STBE 3QGNB 3FAOA 3KL6A 1GDQA 1MQ5A 1SOTA 4ABJA 2V35A 4FUHA 1FAXA 1UHBA 1XUHA 2PKSC 3QZRA 1YKTA 1EOLA 4MNXA 1AO5A 2G52A 3FP7E 3Q00A 3OSYA 4B1TA 1IQNA 1J16A 5I46H 2ZGXH 3MNXA 5E0JA 2EEKA 4FU9A 1RTLA 4TPYA 1MTVA 3MU1A 2J4IA 1TOCB 1N6XA 5ETXA 2GCHG 3PLBA 1XKAC 3GICB 4WWYA 5C3NA 1HJ9A 1SGNE 3VB4A 1FLEE 2ANWA 4IMZA 1CBWC 4H6TA 6LPRA 4Y76A 3GY3A 3QDZB 3E91A 2BY6X 2XYAA 3N7OA 1BTZA 1UCYH 5LPRA 1KLJH 4DOQA 3ITIA 2HRVA 1O5FH 3STIA 2BLVA 7KMEH 5A8ZA 2WYGA 5DP6A 2ZGBH 1Y3VA 1O3AA 2C8WB 4K60A 4LK4A 4LXBH 3SI4H 1C1VH 1LDTT 2XCNA 1V2ST 1ZR0A 7GCHF 2ZGJA 1HV7A 5TCCA 1N6YA 2C8ZB 4CHAB 6CHAB 2F9NA 4X1SU 1ZTKA 1TYNA 1G32B 1OP2A 1MQ6A 1XVMA 4K5ZA 4INKA 1OS8A 1W11U 3O8RA 3E0NB 1GL1A 4K69A 4I8KA 1FY1A 1V2QT 3S9CA 3K6YA 2FWWA 4F4OC 3KQBA 1W2KH 5FX6A 2ZCKP 3W95A 1DY8A 3ZZ9A 1PYTD 4X2VA 1QFKH 2P3UB 2GZ9A 4BAMB 1IQIA 1XXFA 2J2UA 2VINA 5PTPA 2P8OB 2XWAA 4LZ4B 2BVRH 3E16B 4FUDA 5T6DA 1FXYA 1WBGB 3IWMA 4TPIZ 4FU8A 3UWIA 2H5CA 3MH5A 3ATIA 1C1UH 2BHGA 1EXFA 2ZEBA 3QN7A 3RXPA 1GMHG 4UFFH 4ABHA 1PQAA 1GI4A 2BD8A 3SJOA 1JXPA 1UK4A 1Y3WA 1K2I1 2ESTE 1LQDB 2A7JA 4OGXA 3MH4A 1QA7A 2QF3A 3TK6A 2ZZUH 1B5GH 1A3EH 3H7TA 2R9PA 2FOGA 2ZKSA 5IDKA 4YLQH 5JB9S 1Z1IA 1O30A 4BAHB 4UD9H 2OQ5A 1BTHH 1O3KA 1PQ8A 3SU6A 1F0UA 1TA2A 1C4V2 1C2EA 1E35B 4CH2B 1AZZA 1UVPA 1GBCA 1OPHB 1CA8B 1RJXB 1C5RA 1W3CA 3F6UH 1UJ1A 1D6RA 2FS9A 2PV9B 1Z1JA 1SFIA 2THFB 3ZZDA 5HYOA 4WMDA 1GBTA 3OYPA 4FUBA 1LVOA 1Y5BT 5AFZH 3I78A 3G01A 1V2MT 2TGPZ 2GT7A 3QX5H 4OS2A 2TIOA 4JMYA 1J15A 1ELCA 1EZSC 2FYQA 3OY6U 1F0RA 4NA8A 3ATMA 1YYY1 3ZZ5A 2A5IA 5J4SA 1GJ8B 4BOHA 2ZTXA 2JH6D 1C5MD 2UWPA 4AYYB 5TJXA 5FAHA 4GCHG 1CA0C 1GVZA 4CR5A 4ABGA 1QRWA 1QBVH 2ZFFH 4AFUA 1SHYA 1MAYA 2W3KA 2ZF0H 1GBEA 1G37A 2Y5GA 1BQYA 1QL7A 2ODYB 1LVYA 4WMEA 4KTSA 1YP9A 4DIIH 1BMNH 1QY6A 2F9BH 4VGCC 3TU7H 3F1SB 1EAUA 1EAWA 5C20A 1GJAB 1IQEA 5EQSA 1P05A 1GMCF 1UTKA 1W8BH 1GMHF 1SFQB 1TBRH 1ANBA 1DXWA 1LKBA 1TPPA 2VGCC 5K7RA 1H9HE 1NRNH 3PV4A 5G4BA 1F5LA 3UOPA 2ZHQH 1P10A 3MU8A 3LGYA 3NCLA 1BT7A 5DGJA 4NFFA 1C1SA 3M37A 4B2CA 1Z8RA 2KAIA 1BHXB 1C1MA 2G51A 4NIWA 1BTWA 4ISHH 2WPIS 2FZZA 4AGJA 2BD3A 2A0QB 2GV6A 2GMTB 3F9EA 1C5ZB 2SGEE 1QQ4A 2HPPH 5L30H 4NG9H 4BANB 1FY4A 4FVBA 1BJVA 4FUIA 3SJ8A 2V3HH 3M3TA 4YLUA 2CGAA 1HAYB 4FUGA 3M3SA 5FPSA 2FI5E 1K1IA 3S7HB 1CHGA 1CGIE 3RC4A 4A1TA 1XVOA 3BTGE 1BBRH 1RGQA 2H6MA 3T2NA 4Q2KA 3KEEA 5TCAA 3PMBB 1N8OB 1BTUA 3SU0A 1UVSH 1YLCA 3M36A 2OLGA 1QJ7B 2P95A 3EA7A 1VCWA 2AERH 4WH6A 2XRCA 4I33A 2Z9GA 3TH3H 5EQRA 3MTYA 2BLQA 4HI3A 4K2YA 4WY3A 3LOXA 3A8DA 3TNTA 3QGJA 1T8LA 5E2OA 2J94A 5A09A 1KTSB 4MG3A 2CF8H 2EC9H 3QLPH 4A6LA 3T28A 1W10U 3V0XA 2HPQH 3HPTB 1LHDH 5CHAB 2HGTH 2BDYA 3HGNA 1DXPA 2PSXA 4ISIH 4A92A 4FVDA 3TK5A 1OX1A 2A2XH 2OUAA 3H5CB 3P17H 3A7TA 2FEQH 3U1IB 5ABWA 4AFSA 1EP5A 1S85A 3BTWE 2JKHA 3VB5A 2K1QA 1FNIA 1S0RA 1ZTLA 3UR9A 3ATWA 1XXDA 5DP9A 3BTHE 3CS7A 1MU6B 1O5GH 4FUCA 1KLIH 3UNRA 6GCHG 1BITA 2PKAB 3M7QA 1AVXA 1ORFA 1QHRB 2VVVA 4IMQA 4X6NA 2ZP0H 1BOQA 1UHBB 4ABEA 2OXSA 2PGBB 4JZFH 5DPAA 3Q3YA 1D3PB 1AI8H 4TWYA 1DWEH 2H5DA 2SNWA 4O03A 1P02A 1SQTA 3ZVDA 3AW1A 1EPTA 2G8TA 2QYIA 1FN8A 1SOZA 3MOCA 5FCRA 1YPEH 3CS0A 1VITF 3SN8A 1L0ZA 1C5QA 1TOMH 1OWHA 2ODQA 2XXLA 4Y79A 3M35A 1P2JA 1QR3E 9ESTA 2QXIA 2FX6A 3RXRA 3UQOA 5C5OA 4SGAE 3GYLB 1V2JT 1O5AB 2ZQ2A 4XSKU 3R3GB 2LPRA 3HK6B 3PMAB 4MVNA 1ANCA 4DT7B 3OU0A 4HTCH 3L6PA 2ZHWH 3RXUA 1ZGIA 1EASA 1TBZH 1OKXA 1GBIA 1BCUH 1KXEA 1RTKA 2BM2A 1ZHMA 4LOYH 4ZKRU 2FOEA 7ESTE 3ATLA 4GPGA 3ZVBA 2TGAA 2VIPA 2Y7XA 5GCHG 1AD8H 3R0FA 4DW2U 1SGYE 1GDNA 1NFYA 1EQ9A 2Z3CA 3MNCA 1DUAA 5DG6A 1IQGA 1EB1H 3KGPA 3QZQA 4KTCA 1O3EA 1GCTC 1DICA 1V2RT 2G5VA 4E05H 3SUEA 3RDZA 1ARBA 1HAIH 1O2PA 3EA8A 1TX8A 3SO3A 4FUEA 4NZQA 1O3OA 5FXLA 1BMMH 3GCOA 4Y0ZE 2PW8H 4BTTB 1MAXA 2ALPA 3BEFB 4MPXA 2ZFPH 1TWXB 1ETSH 4MLFB 5A0AE 2CF9H 2B8OH 1UCYK 2F9VA 4MNWA 3SNAA 5F8ZA 3SOSA 1YC0A 2XBVA 2R2WU 1BMAA 1O31A 4BAOB 1LHEH 2GDDA 1D3QB 1TGCA 2ZU1A 1P2IA 1Z7KA 4K3JA 5EPNA 2O8MA 1GJ5H 7GCHG 3M5MA 5JDUB 2UUFB 4AB9A 3DHKH 1T32A 4WMFA 4GLYA 1ELFA 1QB6A 1LHGH 1T7CA 2BD4A 4WVPE 4Y71A 1H4WA 2IOTA 2XBWA 1ELAA 3MH6A 2BD9A 1G3DA 2BMGB 5T6FA 2TGTA 2ZGCA 3AAUA 5JBAS 1SGRE 4INHA 2ZU3A 1S81A 2XWBI 2AIQA 1O2ZA 1IHTH 2JETB 3RU4T 1TMTH 1DWDH 4XBBA 4WH8A 3ZV9A 4CBOA 4NZLA 1JRSA 3UOUA 2AMQA 4AB8A 3FFGA 3RXKA 2GTBA 1O3FA 2XBYA 2AGIX 2EI6A 4ZROA 3ZZ4A 5A0BA 1NTPA 4ZAEA 4X6PA 1WSSH 3LPRA 1A5HA 2JH0D 1QBOA 5DP4A 5GPIB 3SZNA 4KTUA 3URDA 3EA9A 2O8LA 1FONA 4YTAA 1GPZA 1O3IA 3FANA 1FIZA 3A86A 1UTOA 1O2NA 1NESE 5HM9A 1G3BA 2HLCA 1V2PT 5AVDA 1ABJH 3PMHB 3UFAA 3ZZ6A 5EW2H 4YT7H 1YGCH 4IC6A 1TRYA 1Q31A 3AASA 5AF9H 3GCTG 1O2LA 4XOJA 3QK1A 3SUGA 1MCTA 3LJJA 3PTBA 4Q7YA 3BTME 1O2TA 1SL3A 3SNCA 1KXCA 3F9HA 2PUXB 4I8JA 4ISLA 1MKWH 1FIWA 1BB0B 2FOAA 5B6OA 2J34A 1BRCE 1ZHPA 3GY7A 1SI5H 5E0HA 1Z8JB 3O8DA 3SV6A 1IQKA 4AGKA 1JWTA 2C93B 3BF6H 1ZPBA 1MKWK 3PROA 1DVAH 4AG1A 3PLKA 1PPHE 1N1LA 4HFPB 3SV8A