3SGAE

Structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE A (SGPA)
publication title Structures of product and inhibitor complexes of Streptomyces griseus protease A at 1.8 A resolution. A model for serine protease catalysis.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 53
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1990-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgaE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgaE01
5B6OA 4R0IA 2OINA 1EAXA 2WV4A 1A3EH 2Y7ZA 4I8LA 2ODQA 4OS1A 2NU1E 4ISOA 1ZYOA 4MTBA 1AVXA 2HPPH 3LONA 5EXLA 3BTFE 3RXSA 3DD2H 2KAIA 1GMDG 1LVBA 4NA8A 1OP2A 1KSNA 1P2MA 2BD8A 5DP9A 1D6RA 2IPHA 4GLYA 4D7FA 1MQ5A 5PTPA 2DUCA 5LPRA 4H6SB 1CA8B 2OC7A 2XBYA 3LIWA 1GVLA 1SGYE 2CHAC 4UFGH 3KQCA 1ANDA 1UMAH 1LO6A 1XKBC 3ESTA 1WV7H 2A5IA 1O34A 1C1PA 1DXWA 1XX9A 4U32A 1ESAA 1G2MA 3M5MA 4WJG2 2Y5GA 3ZZ6A 2JETC 3SU5A 1DUAA 3A8AA 1O3OA 3UIRA 1A5GH 3UR9A 2QXIA 5GCHF 3OY5U 4H6TA 5GJ4B 1OXGA 2B9LA 3A7TA 1VGCC 3NKKA 1CHGA 2O8UA 5EQQA 2ZFRH 4UONA 1C2DA 4MNYA 4E05H 1DWCH 3IG6B 3SGAE 3MO3A 2BD2A 4CRBA 4INHA 1V2KT 2ZP0H 4WF8A 1UCYH 2AMPA 1ZZZA 4X1PU 1ETRH 4TY6A 2ZFFH 4BAHB 1RTLA 1ELFA 4FUCA 1DUEA 2CF9H 3LH1A 2PW8H 1BRUP 1ZPBA 1C2EA 1FY3A 5HM9A 3UY9A 3AASA 3K6ZA 3LGUA 1RTKA 2V3OH 3STIA 4YO9A 2GCHG 3GYLB 3BEUA 2ZA5A 3PYHA 1LCYA 1MTSA 3RXPA 2ZCKP 2RDLA 1ZSKA 4K8YA 2OC0A 2P59A 2ULLA 1K1IA 2ZG0H 3PB1E 3U1JB 4RKOB 3BTGE 4FUHA 1BTZA 3K2UA 1F92A 3QN7A 1GHWH 1NRPH 1IOEA 1QRZA 1NPMA 2FTMA 1Y5BT 3GCTG 1C2MA 2BDAA 4UEHH 1T8MA 1P8VC 1G32B 3UPEA 4I8KA 2LNCA 1SGFG 3ZVDA 3PMBB 4MLFB 1H8DH 2I6QA 1ARCA 1MAXA 2G5NA 2K1QA 2O8TA 4AGKA 3ATKA 2WPHS 2F9UA 4FUDA 1JOUB 4MG3A 7GCHG 4CRGA 1Z7KA 2PKAB 1S84A 3D62A 2XCFA 1YCPM 5E8EH 1VCQA 2BD7A 1CGIE 3VB4A 1YPGH 3UOPA 1THRH 4JK6A 4CBOA 1ZLRA 3VEQB 1EPTC 3D49H 2VVCA 1CE5A 1SMFE 1C2FA 2OXSA 3F9GA 2VH6A 3WY8A 4MNVA 4FU8A 3KN2A 1HFDA 1TYNA 4IN2A 2VIPA 3M3TA 1CO7E 1TPOA 3T26A 1MD8A 3LPRA 1A1RA 3QO6A 1MTNB 1TGSZ 5DP7A 5GIBA 3T5FH 1HRTH 4KTCA 1NRSH 3EYDA 2VWMA 1BDAA 1F2SE 2H9TH 1GDUA 2PWXA 1O2RA 1E37B 2Z94A 4GCHG 4D7GA 3Q76A 2C8WB 1IQJA 3UFAA 1P2OA 3GCTF 1FLEE 1S83A 5ESBA 3BEIB 2F91A 2H6MA 2HRVA 4YM9A 1O5GH 2BVRH 4IGDA 1F5RA 3M5NA 4INLA 5TCCA 4NIXA 4JYVH 1YPLH 1NN6A 1C1NA 4FUIA 2R2MB 4U2WA 1TA2A 2D8WA 2PKSC 1P9UA 2W26A 2Z9KA 4OGYA 2M5TA 1DLKB 1DOJA 1C5YB 2ZHEH 1VZQH 1JRSA 1VITG 2I6SA 2SGFE 1AD8H 1LKBA 4BNRA 1IAUA 7GCHF 1G36A 2FYRA 1GBHA 3RC6A 5CHAC 4MPXA 4Y7BA 9ESTA 2Z9LA 4A1TA 1BTYA 1G3DA 2OP9A 4XBCA 5J4QA 1GI7B 3RXQA 2QIQA 5C1UA 1BMMH 1HNEE 2BXTH 2QXHA 1ABIH 1GBTA 1GJ9B 1O3BA 1KDQB 4BANB 2Q6FA 5J4SA 1LPZB 2ZU2A 4ZH8A 1J9CH 1H9LB 1JXPA 5HM2A 1T8NA 4BAOB 1DY8A 4JMYA 3UQVA 1JIRA 4X2XA 2P8OC 5TCAA 1KXDA 1ZHPA 1QURH 2WPMS 2ZNKH 1UTLM 2PFEA 3M3SA 4GCHF 2ZGJA 3UWJH 3BG4B 1TONA 1A0JA 2QV1A 2Z9JA 3TH2H 4QT8C 1SGIB 2F3CE 2PLXA 4MNXA 3RXUA 1SOZA 3V7TA 1C4V2 4X8SH 4UFEH 1GHVH 3LGTA 1HXEH 3TGKE 1MTVA 1JRTA 1BUIA 1FY4A 1O5BB 3ZYDA 1S82A 2WPLS 1VITF 1BHXF 3M36A 1G9IE 3RU4E 1W2KH 1BRBE 2FOBA 1MKXK 3ZZ8A 1INCA 3U9AH 1MBMA 2YNAA 4ABGA 4XBBA 4LZ1H 4NA7A 5IYTA 1FPHH 2FEQH 4X6NA 3PLPA 3FZDA 1OWJA 1OWEA 1HCGA 1IQIA 1C1RA 3ZVGA 1GBDA 1OP0A 4WY3A 1V2VT 1ANBA 3P8NA 2D26C 1NFUA 4NCYA 1QFKH 1TBRH 2Z3CA 1C2KA 1HBTH 3VB3A 1ID5H 2B0FA 2ODYB 1P2IA 2GX4A 1HLTH 2EA3A 1FIWA 1GJ8B 3RXHA 1HJ9A 3OSYA 1C5SA 1PQ8A 2ASUB 2BQ7B 1GBFA 1OWIA 1E35B 1KXEA 2ZPSA 3HGPA 1PPCE 1O3KA 4A6LA 4ASHA 1AIXH 1BJUA 1WQSA 1MKWH 3AAUA 3MWIU 3ATLA 1DVAH 1NM6A 3SHCH 3TNTA 3SU0A 3TU7H 4BAMB 3KNXA 4Q7ZA 1E0FD 2PUQH 1ANCA 1Z6EA 2EI8A 5F8XA 1GBEA 2FP7B 3V3MA 1HIAB 3BTME 5HXFA 1C4Y2 1F0TA 4VGCB 1FPCH 4X1SU 1AU8A 2BY7X 3RXBA 2VIWA 1HJAB 2HLCA 2FIRH 3N7OA 3M7QA 4X1RU 5GPIB 1UK3A 1C2HA 3ZZDA 1P05A 1WTGH 4NIVA 1C1SA 1TNKA 2CJIA 1XUHA 1DM4B 2ZDLA 1C2LA 4FUFA 3LGWA 3LGVA 1BCUH 1VR1H 1ZMLA 1ZHMA 1DX5M 3FP6E 4OS6A 1NFXA 2A4QA 3M35A 1KY9A 1NU7B 1O5DH 2BLWA 1EKBB 1SB1H 3OY6U 3RXJA 1EAIA 3DFLA 2UUFB 1SLVB 1ESTA 1EB1H 1LHDH 1W14U 1ELAA 1YPHC 1FUJA 3NCLA 7KMEH 1RJXB 4PROA 2XC4A 8LPRA 3FVFB 2BDIA 1C1OA 4JZDH 1QQ4A 3SNBA 5A0AE 3G01A 5HMAA 5JBTA 3ATMA 4B73A 2O8WA 3JZ2B 1A5IA 1MAYA 2W3KA 4ISHH 1IQMA 1MTWA 4AX9H 8GCHG 3HK3B 3QLPH 1CGHA 1C5WB 2ZF0H 2OD3B 1TMBH 2XBVA 1F0SA 1P9SA 1GHAG 1S0RA 1Y3VA 1NROH 2F9OA 3SU3A 4M7GA 3NXPA 2UWPA 1MTNC 5JYIA 1P2JA 4RN6A 4YLUA 4J1YA 3TPIZ 1A5HA 1A7SA 3QDZB 3SV2H 3L6PA 2SGPE 4I8HA 4ABDA 1PPGE 3NK8A 3D23A 4DGJA 1MBQA 2C93B 1HAIH 1G3CA 1H9HE 1CBWB 1P03A 1OSSA 2FO9A 1HV7A 4WVPE 5JBBS 3A82A 1DLEA 4WMDA 4HI3A 3TK6A 2BHGA 1EZXC 1LHEH 1JIMA 4NG9H 5DGJA 3ZYEA 1HAVB 1HAVA 3P6ZB 2SGQE 2ANMH 2JH5D 1O3MA 1UVSH 2W7UA 2Z9GA 1W10U 1XVOA 3VB6A 3VXFH 1GBAA 1QNJA 2HALA 2C90B 2F9NA 5CMXH 2Y6TA 4I33A 3NUMA 2BYAX 2J92A 2OTVA 4X2WA 1HUTH 1EJMA 1G3EA 5F8TA 3EQ0H 4DY7B 1TWXB 1OWKA 4K69A 1EUFA 1TNGA 1AI8H 1GBJA 2UUYA 2Z7FE 8GCHF 1FDPA 1C5RA 2BD4A 2QXGA 4R8TB 4WH8A 2FTLE 1O32A 4BTTB 2FX4A 3MH5A 1YBWA 1E38B 1GHAF 1UCYE 1UTOA 1D3TB 1DWDH 3ITIA 3GICB 4K5ZA 4LXBH 2GD4B 1AKSA 3QTVH 4SGAE 3A85A 1P02A 3KEEA 1AUJA 2AERH 1FY1A 1TX8A 2WUCA 1MU8B 3ENSB 1ELVA 1P57B 4RSPA 3T62A 3RMMH 2H9HA 5GXPA 3H7TA 6GCHG 3ZVFA 2AMQA 2XRCA 1AE5A 1BOQA 1OYQA 3E8LA 3BG4C 1O3JA 4TPYA 1SOTA 1O2GH 1Q31A 4X2VA 3SI4H 4ZMAH 2O9QA 2XBWA 3A7XA 2GKVE 2C8ZB 2W3IA 5BRRE 3GISB 1T8LA 3RXLA 1BTHH 2A2QH 1AO5A 3SU1A 3KQBA 5DO4H 4K1EA 4CH8B 4JCNA 2HPQH 5E2OA 1GHBG 1GCTB 3TH3H 1BBRK 4KTUA 1PQAA 1TB6H 5C5OA 4MPVA 1WQVH 3SJ9A 4D76A 1V2WT 3UWIA 1RFNA 3SJOA 3A89A 2Y5FA 3GYMA 3UUZA 2OCVB 4YLQH 2Z3DA 1C1MA 3DUXH 4MQAA 5JB9S 3JZ1B 3SJKA 3W95A 2ZFQH 3EE0B 1D4PB 2OBQA 3VFEA 1IQFA 1TNHA 3Q3KA 1TMUH 3LC3A 1PPEE 2Z9IA 1NO9H 2ZO3H 4FU7A 3PWBA 5AFZH 1ELTA 2V6NA 4X2YA 3TJOA 1ELEE 3DHKH 3I78A 2CN0H 1TQ0B 3RUOA 4AFQA 4BAQB 1SGDE 2ZDAH 3UNRA 2THFB 1Z8GA 1WOFA 2TRMA 5A2MH 2XCNA 4CRCA 1P12E 2OLGA 6GCHF 4IS5A 4ZKSU 4NFEA 3SGQE 1L1JA 1GBBA 1O5CB 2XWAA 5AHGH 2FOFA 3TH4H 4TY7A 4MPUA 2R3UA 2XTTB 3GY2A 1J14A 4D8NA 3PLKA 6LPRA 3GY4A 1ZJKA 1KIGH 3RLWH 1A0LA 1G3BA 4VGCC 3MNSA 3BV9B 4ABHA 3S7HB 4IN1A 3O8DA 1HJAC 1O2TA 5FX5A 1C5ZB 2ZU1A 1CSOE 3HATH 3S9CA 4B75A 3RM2H 1GHBF 3IWMA 1BTPA 1NY22 3UTUH 5E0HA 4JZEH 1DDJA 1UVPA 1OX1A 5IDKA 3Q3YA 1O2HA 3H7OA 1O5EH 3KGPA 3SUDA 1NC6A 4Q7XA 1GI6A 3EGKH 5EOKA 1P2NA 2BVXH 1C2IA 1C5QA 2UUJB 4B71A 2UUKB 1BTWA 1TAWA 5EPNA 1AUTC 1GMDF 1QB9A 1C5OH 1QB6A 3E90B 4B2CA 1GI9B 4K60A 2G55A 1Z71A 4XDEA 1O2SA 5JPMH 4E06H 2FYQA 1ZOMA 2H2ZA 4GSOA 1AQ7A 8ESTE 1ZMNA 3HK6B 3MTYA 4Q2KA 4IBLH 3SI3H 1UVTH 3GDSA 4YT6H 3ZZ7A 1TNIA 3SQEE 1AY6H 1V2JT 1KYNA 2H5DA 1W7GH 4GAWA 1V2PT 1SHYA 4CR9A 2FOGA 1L4ZA 1O2ZA 1H9IE 2EI6A 2AH4X 1CT0E 3RXDA 2G51A 4H42U 2OC8A 1L0ZA 1GHZA 1UTPA 2A5AA 3LU9B 1JWTA 4B1TA 2PUXB 4AN7A 1H8IH 1WU1A 2PKAA 2BQWB 4KTSA 1PYTC 1C4U2 1ZGIA 1W3CA 3GCOA 2QA9E 3FZZA 6ESTA 2ANKH 1XUKA 3GY6A 1HPGA 2PHBA 1TGTA 1CBWC 4CBNA 2DE8A 2BD5A 2ZFPH 4IC6A 2UWOA 1P01A 1BA8B 1FXYA 1HGTH 3TIUA 4A1XA 1SGCA 3BN9A 1P3EA 3K9XB 2BB4A 1XMNB 2B8OH 2GCHF 2ZPRA 2GMTB 2PSXA 2R0KA 2BD3A 1SQAA 4O03A 1K1LA 4MNWA 3TK9A 1QJ6B 4YZUA 2GZ8A 2Z6BD 1BHXB 2IN2A 7LPRA 1K22H 1WTHD 2FLBH 2OQUA 2P93A 3RDZA 2PTCE 2ZIQH 4INKA 1EXFA 1TGBA 4X6MA 2FS9A 4MDSA 3MH4A 2AIPA 3QZRA 1MCVA 5JBCS 1UTJA 1T32A 1TPAE 3SORA 3E1XB 3M5OA 1ETTH 1ELGA 1Y5UT 1YPJH 5EQSA 5DP4A 1W13U 4ZXYH 1KXFA 4AFZA 1GG6B 2G8TA 3OTJE 3C27B 1ANEA 1PJPA 1FI8A 2ZU3A 4UDWH 1ZTLA 2AIQA 3A80A 3TGIE 1EZSC 1CT2E 3DT0H 5C1YA 1UO6A 2VIDA 2Y82A 1W11U 2ALVA 2AGIX 3UREA 4FU9A 2A1DB 3TNSA 1MKWK 3P92A 2AS9A 4B2AA 2ZGCA 2HGTH 2ZECA 1V6DA 3BTHE 3F1SB 5C2ZA 1SGPE 1T4UH 2QAAA 4GPGA 1SGRE 3ODDA 5I25A 3STJA 1P3CA 1O5FH 3W94A 5JB8S 1V3XA 4O97A 2ZPQA 1IQKA 2AYWA 3SNDA 5FCKA 1KDQA 2BD9A 1NU9A 2G5VA 5G4BA 2FOAA 3P95A 2ZGXH 1G37A 3M7UA 2QC2A 3RMNH 1P2KA 5C3NA 3L33A 1GI3A 4CRDA 3MU0A 1NRNH 3SJIA 2NU0E 1ABJH 1OS8A 1C5VA 2F83A 1BMNH 1T8OA 3V13A 1EP5A 3Q00A 2XC0A 1GCTC 5C1XA 3SU4A 1GPZA 3FANA 1O2QA 2J9NA 1EX3A 1TA6A 2VJ1A 2C4FH 4HTCH 2R9PA 1GWAA 2RA0A 2XWBI 1H4WA 4WWYA 2ESTE 1YCPH 2PV9B 4IW4E 4AOQA 1DICA 1GBLA 2FDAA 5FPSA 3CS7A 4OS4A 3RXRA 1DITH 2FXRA 3MO9A 3A8DA 4TPIZ 4JZIA 1C9TA 2GDEH 2HNTE 1V2LT 1PQ5A 4XFQA 3O8RA 2OQ5A 3T27A 2C3SA 3S9AA 1QQUA 2QGRA 1PYTD 2A32A 4UD9H 1OP8A 3LT3A 1FV9A 2HVXA 1C5LH 3FP7E 4ISIH 1A3BH 2BDBA 3NWUA 4U01A 1O2OA 2YNBA 3MOCA 4MPWA 1WUNH 1X7AC 3EAJA 1CGJE 1SL3A 1WYKA 3M7TA 1AWHB 1K2I1 3BTKE 5DKMA 1B5GH 5SGAE 1ELBA 2NWNA 1D6WA 1GI0A 2FWWA 2CMYA 3MH7A 4J2YB 1VCWA 3U1IB 5C20A 4X8TH 3BTDE 1MZDA 1LPGB 2ZU5A 3HPTB 1LPKB 4DVAU 3E16B 1J15A 1N6XA 1AVWA 1BJVA 1ZTKA 2FI5E 1GBMA 1HJ8A 3UNQA 4BXSA 3ZZAA 4K1SA 4ABBA 2ZFSA 5JDUB 4FVDA 2ANYA 5LPFA 2SFAA 1GI5A 1GBKA 5FXLA 3SJ8A 1QGFA 3GDUA 4ZAEA 1O5AB 1DSUA 3LH3A 5A8XA 1RXPA 3BTTE 4I8GA 1AE8H 2A5KA 3QX5H 5TJXA 3GOVB 4Y7AA 1V2OT 2ZKSA 1S5SA 3M37A 4CHAB 4JZFH 1FMGA 1UTKA 5JBAS 2J34A 1HIAA 2GZ7A 4AGJA 3K65B 4Z6AH 4NZLA 2FI3E 2OBOA 3MFJA 1O2IA 5F6MA 2Q6DA 1GMCG 1HAOH 3VB5A 4WXVA 1EQ9A 1P0SH 1M9UA 2A4GA 1QBNA 1D3QB 3P8FA 2V3HH 3E0PB 3Q3XA 1A61H 1C5XB 2R2WU 1RGQA 3QTOH 2R0LA 2CV3A 1P2QA 1S81A 1NRQH 1UK4A 1XUIA 1TABE 2YOLA 3OX7U 2B7DH 1BZXE 3A88A 3TVJB 2P3TB 4KGAA 2XXLA 2J94A 5ETXA 1HAYB 2BZ6H 2ZTYA 3ZZ3A 3MH6A 1GL1A 1UTQA 1IQEA 2ZTXA 4WMFA 3SUGA 5F03A 3T29A 1D3DB 1HAHH 1SVPA 3P17H 4ISNA 5A0BA 3GCHB 3E0NB 1TALA 1TMTH 2BMGB 3ZZ4A 2QF3A 5EXMA 1BT7A 1Y59T 3M61U 1O38A 2Y80A 2XBXA 3BTWE 4E7RG 1V2MT 4X8VH 1LKAA 1RD3B 1ESBA 4ZHAA 2ZI2H 1LQDB 2WYGA 1O2UA 4YOJA 5T3HA 1V2TT 1K21H 4O3UA 2ZCHP 2ZQ1A 2P95A 1K1NA 4I8JA 4I7YH 3T25A 4F49A 2D1JA 3R3GB 1GMHG 4YESB 2GMTC 5EODA 1A2CH 2QF0A 3MHWU 1N6YA 1S6HA 2BDYA 3SW2B 2BTCE 2EEKA 4XE4A 1FIZA 3VXEH 1GMCF 1SR5C 2GV7A 2QYIA 1KXBA 1NT1A 1V2RT 2ZWLH 1XXDA 3I29A 2VB0A 1GI4A 3RP2A 1K28D 1YYY1 2R3YA 1OYTH 2SGEE 2ZDMA 1TLDA 1KLIH 1NZQH 2VGCB 2GZ9A 1QBVH 1Q2WA 4Y76A 1A0HB 5CE1A 2H5CA 1GG6C 1S85A 1F5KU 3AVZA 5DG6A 2BLQA 3U8RH 3BSQA 3SU2A 2WPJS 4AORA 4NA9H 1Y3YA 1SGTA 4HFPB 1E36B 4Y0YE 2ALPA 2ZC9H 4FXGH 1GJ7B 3MI4A 1TNJA 3KL6A 2P3UB 1IQNA 4B74A 1A4WH 1QA0A 1TOCB 1FN8A 3AW1A 3OU0A 2PGBB 4ZHLU 1CQQA 2FS8A 3SUFA 4JYUH 1MH0A 6CHAB 5EQRA 1EJNA 4MVNA 1AFEH 2BLVA 2CGAA 1EP6A 1MQ6A 2A31A 1DXPA 4ABIA 1YLDA 5GWZA 1UCYK 1IHTH 1PPZA 1Z1IA 2ZTZA 1GMHF 1S0QA 1YP9A 2BLOA 1DY9A 2BVSH 2H9EH 2BY5X 1AB9B 2G4UA 1ZRBA 2FESH 1GVZA 2LPRA 1SFQB 4OS7A 2P94A 2BX3A 1K1OA 3ZVCA 1O2XA 1ZTJA 3A8CA 4ABFA 2ZDVH 2WPKS 1ZPCA 3U98H 4FUJA 2BY9X 3GY3A 1D3PB 2J38A 1V2NT 2GP9B 1ZSJA 2GT7A 3PMHB 4KELA 1TRNA 2Y81A 1OWHA 2HOBA 3RU4T 3URCA 2GDDA 3ATIA 1YPHE 2H1UA 5C67A 1TFXA 2GV6A 2VIVA 4ESTE 3SNAA 1BTXA 1VJ9U 3S0NA 1TRYA 2BZAA 1GHXH 1YC0A 3NZIA 1TOMH 1WSSH 2ZDKA 2AGGX 1QL9A 3ZZ5A 5AFYH 1GDQA 1B0FA 2GGVB 1K1JA 2A4RA 4F4OC 1O0DH 4ZKOU 2CF8H 1XUJA 3DFJA 3S69A 2Q6GA 4BXWA 2O8LA 2VNTA 5EW1H 1GI8B 5E0GA 1PQ7A 1QBOA 4GVUA 1C2GA 2ZCLP 1CA0B 2RG3A 4IMZA 2GCTB 5EU8A 4LK4A 3E3TA 1Z8RA 3T28A 3UOUA 1RS0A 5ESTE 1EATA 2HNTF 5DP8A 2QCYA 1MCTA 1O3HA 1KXAA 1AHTH 1QJ7B 1GVKB 5A8ZA 3EA8A 3TJUA 5FX6A 5DP5A 1P10A 4K1TA 4H4FA 2FZZA 2JH6D 2G4TA 1O2YA 3AW0A 5T6GA 2WYJA 1DE7H 3A87A 3LC5A 2ZHWH 1FNIA 3B9FH 1EZQA 1ETSH 2KAIB 3P70B 4Q80A 4YOGA 1C2JA 4DIHH 1O3PB 3ZZBA 1DSTA 1KTTB 3ZVAA 2BDCA 2XW9A 2F9VA 3MU5A 2BDHA 3QUMP 3E6PH 1AFQB 4A5TS 1TBQH 1T4VH 2CXVA 3QK1A 2TBSA 5T6DA 1YLCA 4FUGA 1BTUA 3B8JA 4CHAC 3CS0A 4XBDA 2BY8X 1UVUH 2A4OA 3SGBE 3ZVBA 8KME2 5HGGA 1XKAC 2ZHQH 3QGNB 5EW2H 2ZGBH 2PR3A 5H4IB 1GL0E 1QA7A 1L1GA 2ZFTA 3LKWA 1W0ZU 3PTBA 3QZQA 4JZ1A 1GJDB 1ZGVA 1FN6A 2ZDNA 1Z8IB 1QL8A 5FBEA 1DWEH 4DIIH 1NTPA 1NESE 2TGDA 4JK5A 2BXUH 3A83A 3B23B 3HKIB 2GT8A 1THPB 3MU1A 5DP6A 3MO6A 1SQTA 1SGFA 1WAYB 5C5NA 2F9PA 7ESTE 1YGCH 1ELDE 3A86A 3O8CA 3RMOH 3LGIA 1O2WA 3SBKA 4O9VA 4RKJB 2Z3EA 1ZMJA 4Y79A 3T2NA 1BMAA 5A0CA 3A81A 3ZZ9A 1F0UA 4X6PA 2ILNA 4LOYH 3GCHC 1YPEH 1LVOA 2W7SA 4NIYA 2AGEX 1IQGA 1DWBH 3VGCB 4AG1A 4AYVB 3L3TA 2XC5A 1A46H 2J4IA 2UWLA 1O3DA 4TWYA 5FHTA 1L1NA 1TQ7B 2PGQB 3RXCA 1GGDB 1O39A 3RXFA 2A7JA 4DJZB 2BM2A 1ZHRA 3A7YA 1C5TA 3SU6A 1TX6A 3PO1B 4Y6DA 3PROA 4CH2B 1B7XB 1T7CA 1GJ5H 4NFFA 4NSYA 4E7NA 3CP7A 3ZVEA 1F0RA 1F5LA 2V0BA 3RXKA 1ELCA 1BBRH 1VITH 1YCPK 4FUBA 3LJOA 5LPEA 1LDTT 3RXGA 1XUGA 1U6QA 5ABWA 1B0EA 1SG8B 1FAXA 5L2YH 3F68H 1PPHE 1MMJN 1Z6JH 3U8TH 2BY6X 1EAWA 1QB1A 2P3FH 3RXIA 2BX4A 1P06A 2TIOA 2VGCC 2Y7XA 2J2UA 2HNTC 1UTMA 3MU8A 1O3NA 1F7ZA 2FX6A 1TE0A 4Y11E 4K8BA 3R0FA 1TIOA 3TK5A 1V2ST 1GJ6A 1T31A 3Q77A 3LJJA 5FAHA 4A92A 1L2EA 2FOCA 2GVFA 3BG8A 1KXCA 3PMJA 1SQOA 1J16A 3UNSA 2VINA 2FM2A 4CREA 1ACBE 1P11E 1IHSH 2ZU4A 3KCGH 3TITA 1QJ1B 1SI5H 3RXAA 1GBCA 1OWDA 5AVDA 3ZZCA 3AAVA 1O35A 1GJ4H 4KP0A 1PFXC 1QRXA 2STAE 1K1PA 6CHAC 2D2DA 1HB0B 3RC5A 1LTOA 5DP3A 4X1NU 3KHVA 1O3CA 1AWFH 2TGTA 1QR3E 1C1QA 1YPKH 1FY8E 3P8GA 2A0QB 5A8YA 4LZ4B 1AGJA 2AMDA 4GHQA 1E34B 4I31A 1HAXB 3LOXA 5DPAA 1C5NH 1H1BA 4NZQA 4DT7B 4Q7YA 1NS3A 3FAOA 1FZZA 2PTNA 2XNIA 3E91A 5E0JA 1LQEA 4ZKNU 3QGJA 1CU1A 4X1QU 1AB9C 1ZSLA 2A2XH 1W7XH 2EI7A 2ZQ2A 5A09A 1RIWB 1SHHB 3MU4A 3IITA 3GY8A 2B5TB 2A7HA 1PPBH 4ZHMU 2BOHB 1EOLA 3BTEE 2RA3A 2SNWA 2J95A 3RMLH 2NU3E 1UJ1A 1NFWA 1QHRB 3KQEA 1ZRKA 4WMEA 1GJBB 1BRCE 1TBZH 3TGJE 1UTNA 1TNLA 1ZR0A 3V0XA 5I46H 1EAUA 1DT2A 1AMHA 1BITA 4XOJA 3SV9A 1O2JA 1O3GA 1QL7A 1TGCA 4AFSA 3P8OA 1KLTA 1FJSA 1BIOA 5GDSH 3C1KA 1AVGH 3DA9B 3MNCA 3CENA 3RXTA 2TGAA 1AN1E 3QWCH 1IQLA 1TPPA 2WPIS 4Y10E 1SFIA 2STBE 1UVOA 4AZ2B 1VCPA 4NGAH 3O8BA 1GJAB 1KLJH 4FUEA 4Y8XA 3UQOA 1MU6B 3GY5A 3RXEA 1EASA 1HXFH 1LHCH 1SPJA 4TWWA 3I77A 5E2PA 3RLYH 1YPMH 2WV5A 1CA0C 1SSXA 2GCTC 3A7ZA 2VU8E 4IC5A 2AFQB 2HWLB 4YOIA 2QY0B 1P04A 1Y3UA 4THNH 1SLUB 1FONA 1N8OB 5AF9H 5L6NH 3SV6A 3ELAH 2JH0D 3EA7A 2BOKA 4ABJA 5L30H 3BIVH 4ISLA 1HDTH 4X0WU 3SQHE 1HYLA 2XYAA 2F9BH 4WXIA 2TPIZ 1SGNE 3A7VA 4AFUA 4UFFH 1G30B 1FY5A 4AG2A 4NSVA 3PTNA 2W5EA 4U30A 1O37A 1WBGB 1FQ3A 2WINI 1LVMA 3S7KB 1AFQC 1Q3XA 1Y8TA 4AYYB 1RTFB 2TGPZ 1DFPA 1ARBA 1BMLA 2AEIH 3ZV8A 1QCPA 2ZHDA 3RU4D 4NWLA 1PPFE 5LGOA 2VWOA 3SV7A 1D9IA 1O2LA 4UE7H 1ORFA 4DURA 3SOSA 1GHYH 1EOJA 1EB2A 2PSYA 2A7CA 4D9QA 1O2KA 1GJCB 1KTSB 1LMWB 2ZHFH 4YTAA 3SNEA 2QN5T 5DJ7A 4Y71A 1SLXB 3RXVA 4DG4A 1TRMA 3D65E 4O3TA 1NFYA 1OKXA 3MNBA 2ODPA 1G2LA 1HAGE 3V12A 5HYOA 2CHAB 2VWLA 3LGYA 3VB7A 1OPHB 2ZZUH 1O30A 5FPTA 4A7IB 2Y5HA 3MYWA 3BEFB 4AB8A 1MUEB 3MMGA 1O2NA 4I32A 3RM0H 1QIXB 2JETB 2WUBA 2ZGHA 1LHGH 2G00A 1V2UT 2Q1JA 5BPEA 3H5CB 1TGNA 2G81E 1OOKB 3GY7A 4TYDA 3VGCC 3ZV9A 1VGCB 1K1MA 3ATWA 4ZROA 3RC4A 4BAKB 3RXMA 3M3VA 1BRAA 1MZAA 1J17T 3FP8E 3ODFA 1GGDC 1AZ8A 4YT7H 2NU4E 4ZUHA 4K2YA 4DW2U 1LVYA 1CT4E 5FCRA 3PO1C 4AB9A 1N1LA 1XM1A 3PWCA 1C5UA 1O2PA 2C8YB 1HAPH 1O3AA 1GCDA 3RXOA 3TLOA 4X6OA 4Y0ZE 2EC9H 1QY6A 1O33A 3KIDU 2ANWA 1MTUA 4B76A 1ZPZA 1O2VA 1C5PA 1GI2A 3BTQE 5EXNA 1QTFA 1BQYA 4ABAA 2NU2E 2FI4E 4XSKU 3VPKA 4IMQA 1C5MD 3KF2A 4Y8YA 3GDVA 2C8XB 2VWNA 1XXFA 2P16A 1YKTA 5FPYA 1W12U 1O2MA 2OC1A 2OUAA 1LHFH 4HGCA 2SNVA 1XUFA 4CR5A 2FOMB 4NWKA 5EPYA 5K0HA 1ZJDA 2QXJA 2FOHA 5EGMA 3SO3A 4HZHA 1IQHA 1AZZA 1GDNA 4BTUB 1XVMA 1YF4A 1MKXH 2FODA 4BOHA 2FPZA 2A45B 3F9HA 3TJVA 1UK2A 1P09A 1SLWB 2G52A 4B2BA 1DPOA 3A84A 4Y8ZA 3F9EA 1EZUC 2GTBA 3SZNA 2RCEA 4ZXXH 2SGDE 2FMJA 4OGXA 1RRKA 4OS5A 2BQ6B 2ZEBA 1FAKH 1DANH 1EPTB 1JBUH 4OS2A 1EPTA 4GUXA 3PMAB 2V35A 1S6FA 5T6FA 1O31A 1GBIA 1CHOG 5F8ZA 4D9RA 3TJNA 1QRWA 1C9PA 3SN8A 5K7RA 1Z1JA 5LH8A 3HGNA 4SGBE 1RIWC 3U8OH 1Y3XA 1TPSA 3SHAH 3S9BA 1EJAA 1SGEE 1NRRH 1SGQE 1Y3WA 2BDGA 2VVUA 3EDXB 4FVBA 1O3IA 3F9FA 3NPSA 4UFDH 5L2ZH 1O3FA 2JKHA 4BTIB 1CVWH 1Z8JB 4WH6A 3A8BA 1SC8U 1WCZA 2VIQA 3K6YA 1UHBB 4ZKRU 1UHBA 5EG4A 4KKDA 3BF6H 1DS2E 1MD7A 3UR6A 3URDA 4JYTA 2PKSB 1J8AA 4Z0KA 3MNXA 1TX7A 1AKSB 1C1TA 4X8UH 3SV8A 4CRAA 3U69H 5CHAB 2SGAA 1K9OE 3PLBA 2DE9A 2IJOB 1BB0B 2IOTA 2VVVA 4ABEA 1O3LA 1Y5AT 5DK1A 3M5LA 3PM3A 1C1WH 3SUEA 1N8OC 1O3EA 3F6UH 1VJAU 3FFGA 1L4DA 1CHOF 1YM0A 3BIUH 3GCNA 4A1VA 3PV4A 3SNCA 3KQDA 3OYPA 1SBWA 5GCHG 9LPRA 4NIWA 4GHTA 1THSH 2VH0A 3HKJB 2O8MA 1C1UH 1C1VH 1W8BH 2VIOA 3A7WA 1JMOH 1HAZB 2P8OB 4DOQA 1GI1A 3LDXH 1V2QT 1W0YH 2FOEA 4DCDA 4CRFA 1O36A 4K3JA 3EA9A 5FBIA 1BBRE 2FLRH
chains in the Genus database with same CATH superfamily
5B6OA 4R0IA 2OINA 1EAXA 2WV4A 1A3EH 2Y7ZA 4I8LA 2ODQA 4OS1A 2NU1E 4ISOA 1ZYOA 4MTBA 1AVXA 2HPPH 3LONA 5EXLA 3BTFE 3RXSA 3DD2H 2KAIA 1GMDG 1LVBA 4NA8A 1OP2A 1KSNA 1P2MA 2BD8A 5DP9A 1D6RA 2IPHA 4GLYA 4D7FA 1MQ5A 5PTPA 2DUCA 5LPRA 4H6SB 1CA8B 2OC7A 2XBYA 3LIWA 1GVLA 1SGYE 2CHAC 4UFGH 3KQCA 1ANDA 1UMAH 1LO6A 1XKBC 3ESTA 1WV7H 2A5IA 1O34A 3MQKC 1C1PA 1DXWA 1XX9A 4U32A 1ESAA 1G2MA 3M5MA 4WJG2 2Y5GA 3ZZ6A 2JDID 2JETC 3SU5A 1DUAA 3A8AA 1O3OA 3UIRA 1A5GH 3UR9A 2QXIA 3UAIC 5GCHF 3OY5U 4H6TA 5GJ4B 3SYJA 1OXGA 2B9LA 3A7TA 1VGCC 3NKKA 1CHGA 2O8UA 5EQQA 2ZFRH 4UONA 1C2DA 4MNYA 3U28C 4E05H 1DWCH 3IG6B 3SGAE 3MO3A 2BD2A 4CRBA 4INHA 2K8IA 1V2KT 2ZP0H 4WF8A 1UCYH 2AMPA 1ZZZA 4X1PU 1ETRH 4TY6A 2ZFFH 4BAHB 1RTLA 3F3BA 1ELFA 4FUCA 1DUEA 5KECA 2CF9H 3LH1A 2PW8H 1BRUP 1ZPBA 1C2EA 1FY3A 5HM9A 3UY9A 3AASA 3K6ZA 3LGUA 1RTKA 2KCPA 2V3OH 3STIA 4YO9A 2GCHG 3GYLB 3BEUA 2ZA5A 3PYHA 1LCYA 1MTSA 3RXPA 2ZCKP 2RDLA 4TSFD 1ZSKA 4K8YA 2OC0A 2P59A 2ULLA 4FOUC 1K1IA 2ZG0H 3PB1E 3U1JB 4RKOB 3BTGE 4FUHA 1BTZA 3K2UA 1F92A 3QN7A 1GHWH 5HKKD 1NRPH 1IOEA 1QRZA 1NPMA 2FTMA 3OTPA 3OEHD 1Y5BT 3GCTG 1C2MA 2BDAA 4UEHH 1T8MA 1P8VC 1G32B 3UPEA 4I8KA 2LNCA 1SGFG 3ZVDA 2LELA 3PMBB 4MLFB 1H8DH 2I6QA 1ARCA 1MAXA 2G5NA 2K1QA 2O8TA 4AGKA 3ATKA 2WPHS 2F9UA 4FUDA 1JOUB 4MG3A 7GCHG 4CRGA 1Z7KA 2PKAB 1S84A 3D62A 2XCFA 1YCPM 5E8EH 1VCQA 2BD7A 1CGIE 3VB4A 1YPGH 3UOPA 1THRH 4JK6A 4CBOA 1ZLRA 3VEQB 1EPTC 3D49H 2VVCA 1CE5A 1SMFE 1C2FA 2OXSA 3F9GA 2VH6A 3WY8A 4MNVA 4FU8A 3KN2A 1HFDA 4F55A 1TYNA 4IN2A 2VIPA 3M3TA 1CO7E 1TPOA 3T26A 1MD8A 3LPRA 1A1RA 5EJZA 3QO6A 1MTNB 1TGSZ 5DP7A 5GIBA 3T5FH 1HRTH 4KTCA 1NRSH 3EYDA 2VWMA 1BDAA 1F2SE 2H9TH 1GDUA 2PWXA 4RT1A 1E1QD 1O2RA 1E37B 2Z94A 4GCHG 4D7GA 3Q76A 3CNRA 2C8WB 1IQJA 3UFAA 1P2OA 2LP6A 3GCTF 1FLEE 1S83A 5ESBA 3BEIB 2F91A 2H6MA 2HRVA 4YM9A 4Q63A 1O5GH 2BVRH 4IGDA 1F5RA 3M5NA 4INLA 5TCCA 4NIXA 4JYVH 1YPLH 1NN6A 1C1NA 4FUIA 2R2MB 4U2WA 1TA2A 2D8WA 2PKSC 1P9UA 2W26A 2Z9KA 4OGYA 2M5TA 1DLKB 1DOJA 1C5YB 2ZHEH 1VZQH 1JRSA 1VITG 2I6SA 2SGFE 1AD8H 1LKBA 4BNRA 1IAUA 7GCHF 1KMHB 1G36A 3FO8D 2FYRA 1GBHA 3RC6A 5CHAC 4MPXA 4Y7BA 9ESTA 2Z9LA 4A1TA 1BTYA 1G3DA 2OP9A 4XBCA 5J4QA 5HIZA 1GI7B 3RXQA 1S6LA 2QIQA 5C1UA 1BMMH 1HNEE 2BXTH 2QXHA 3OFND 1ABIH 1GBTA 5FL7D 1GJ9B 1O3BA 1KDQB 4BANB 2Q6FA 5J4SA 1LPZB 2ZU2A 4ZH8A 1J9CH 1H9LB 1JXPA 5HM2A 1T8NA 2J98B 4BAOB 1DY8A 4JMYA 3UQVA 1JIRA 4X2XA 2P8OC 5TCAA 1KXDA 1ZHPA 1QURH 2WPMS 2ZNKH 1UTLM 2EQNA 2PFEA 3M3SA 4GCHF 2ZGJA 4YXWD 4HG6A 3UWJH 3BG4B 1TONA 5IK2D 1A0JA 2QV1A 2Z9JA 3TH2H 4QT8C 2F43B 1SGIB 2F3CE 2PLXA 4MNXA 3RXUA 1SOZA 3V7TA 4ACBA 1C4V2 4X8SH 4UFEH 1GHVH 3LGTA 1HXEH 3TGKE 1MTVA 1JRTA 1BUIA 1FY4A 1O5BB 3ZYDA 1S82A 2WPLS 1VITF 1BHXF 3M36A 1G9IE 3RU4E 1W2KH 1BRBE 2FOBA 1MKXK 3ZZ8A 1INCA 3U9AH 1MBMA 2YNAA 4ABGA 4XBBA 4LZ1H 4NA7A 5IYTA 1FPHH 2FEQH 4X6NA 3PLPA 3FZDA 1OWJA 1OWEA 1HCGA 4B6FA 1IQIA 1C1RA 3ZVGA 1GBDA 1OP0A 4WY3A 1V2VT 1ANBA 3P8NA 2D26C 1NFUA 4NCYA 1QFKH 1TBRH 2Z3CA 1C2KA 1HBTH 3VB3A 1ID5H 2B0FA 2ODYB 1P2IA 2GX4A 1HLTH 2EA3A 1FIWA 1GJ8B 3RXHA 1HJ9A 3OSYA 1C5SA 1PQ8A 2ASUB 2BQ7B 1GBFA 1OWIA 1E35B 1KXEA 2ZPSA 3HGPA 1PPCE 1O3KA 4A6LA 4ASHA 1AIXH 1BJUA 1WQSA 1MKWH 3AAUA 3MWIU 3ATLA 1DVAH 1NM6A 3SHCH 3TNTA 3SU0A 3TU7H 4BAMB 3KNXA 4Q7ZA 1E0FD 2PUQH 1ANCA 1Z6EA 2EI8A 5F8XA 1GBEA 2FP7B 3V3MA 1HIAB 3BTME 5HXFA 1C4Y2 1F0TA 4VGCB 1FPCH 4X1SU 5KGOA 1AU8A 2BY7X 3RXBA 2VIWA 4TT3D 1HJAB 2HLCA 2FIRH 3N7OA 3M7QA 4X1RU 5GPIB 1UK3A 1C2HA 3ZZDA 1P05A 1WTGH 4NIVA 1C1SA 1TNKA 2CJIA 1XUHA 1DM4B 2ZDLA 1C2LA 4FUFA 3LGWA 3LGVA 2KM0A 1BCUH 1VR1H 1ZMLA 1ZHMA 1DX5M 3FP6E 4OS6A 1NFXA 2A4QA 3M35A 1KY9A 1NU7B 1O5DH 2BLWA 1EKBB 1SB1H 3OY6U 3RXJA 1EAIA 3DFLA 2W6ID 2UUFB 1SLVB 1ESTA 1EB1H 1LHDH 3N7DA 1W14U 1ELAA 1YPHC 3DSPA 2KFWA 1FUJA 3NCLA 7KMEH 1RJXB 4PROA 2XC4A 8LPRA 3FVFB 2BDIA 1C1OA 4JZDH 3OAAD 1QQ4A 3SNBA 5A0AE 3G01A 5HMAA 5JBTA 3ATMA 4B73A 2O8WA 3JZ2B 3UB0A 1A5IA 1K0HA 1MAYA 2W3KA 4ISHH 1WXRA 1IQMA 1MTWA 3H09A 4AX9H 8GCHG 3HK3B 3QLPH 1CGHA 1C5WB 2ZF0H 2OD3B 1TMBH 2XBVA 1F0SA 1P9SA 1GHAG 4F48B 1S0RA 1Y3VA 1NROH 2YMSB 4P00A 2F9OA 3SU3A 4M7GA 3NXPA 2UWPA 1MTNC 3WWFA 5JYIA 1P2JA 4RN6A 4YLUA 4J1YA 3TPIZ 1A5HA 1A7SA 3QDZB 3SV2H 3L6PA 2SGPE 4I8HA 4ABDA 1PPGE 3NK8A 3D23A 4DGJA 1MBQA 2C93B 1HAIH 1G3CA 1H9HE 1CBWB 1P03A 1OSSA 2FO9A 1HV7A 4WVPE 5JBBS 3A82A 1DLEA 4WMDA 4HI3A 3TK6A 2BHGA 1EZXC 1LHEH 1JIMA 4NG9H 5DGJA 3ZYEA 1HAVB 1HAVA 3P6ZB 2SGQE 2ANMH 2JH5D 1O3MA 1UVSH 2W7UA 2Z9GA 1W10U 1XVOA 2QE7D 3VB6A 3VXFH 1GBAA 1QNJA 2HALA 2C90B 2F9NA 5CMXH 1YY3A 2Y6TA 4I33A 3NUMA 2BYAX 2J92A 2OTVA 4X2WA 1HUTH 1EJMA 1G3EA 5F8TA 3EQ0H 4DY7B 1TWXB 1OWKA 4K69A 1EUFA 1TNGA 1AI8H 1GBJA 2UUYA 2Z7FE 8GCHF 4XRNA 1FDPA 1C5RA 2BD4A 2QXGA 4R8TB 4WH8A 2FTLE 1O32A 4BTTB 2FX4A 3MH5A 1YBWA 1E38B 1GHAF 1UCYE 1UTOA 1D3TB 1DWDH 3ITIA 3GICB 4K5ZA 4LXBH 2GD4B 1AKSA 3EE7A 3QTVH 2CK3D 4SGAE 3A85A 1P02A 3KEEA 1AUJA 2AERH 1FY1A 1TX8A 2WUCA 1MU8B 3ENSB 1ELVA 1P57B 4RSPA 3T62A 3RMMH 2H9HA 5GXPA 2KR7A 3H7TA 6GCHG 3ZVFA 2AMQA 2XRCA 1AE5A 1BOQA 1OYQA 3E8LA 3BG4C 1O3JA 4TPYA 1SOTA 1O2GH 1Q31A 4X2VA 3SI4H 4ZMAH 2O9QA 2XBWA 3A7XA 2GKVE 2C8ZB 2W3IA 5BRRE 3GISB 1T8LA 3RXLA 1BTHH 2A2QH 1AO5A 3SU1A 3KQBA 5DO4H 4K1EA 1EFRD 4CH8B 4JCNA 2HPQH 5E2OA 1GHBG 1GCTB 3TH3H 1BBRK 4KTUA 1PQAA 1TB6H 5C5OA 4MPVA 1WQVH 3SJ9A 4D76A 1V2WT 3UWIA 4XD7D 1RFNA 3SJOA 3A89A 2Y5FA 3GYMA 3UUZA 2OCVB 4YLQH 2HLDD 2Z3DA 1C1MA 3DUXH 4MQAA 5JB9S 3JZ1B 3SJKA 3W95A 2ZFQH 3EE0B 1D4PB 2OBQA 3VFEA 1IQFA 1TNHA 3Q3KA 1TMUH 3LC3A 1PPEE 2Z9IA 1NO9H 2ZO3H 4FU7A 3PWBA 5AFZH 1ELTA 2V6NA 2IJD1 4X2YA 3TJOA 1ELEE 3DHKH 3I78A 2CN0H 1TQ0B 3RUOA 4AFQA 4BAQB 1SGDE 2ZDAH 3UNRA 2THFB 1Z8GA 1WOFA 2TRMA 5A2MH 2XCNA 4CRCA 1P12E 2OLGA 6GCHF 4IS5A 4ZKSU 4NFEA 3SGQE 1L1JA 1GBBA 1O5CB 2XWAA 5AHGH 2FOFA 3TH4H 4TY7A 4MPUA 2IPQX 2R3UA 2XTTB 3GY2A 1J14A 4ASUD 4D8NA 3PLKA 6LPRA 3GY4A 1ZJKA 1KIGH 3RLWH 1A0LA 1G3BA 2KX4A 4VGCC 3MNSA 3BV9B 4ABHA 3S7HB 4IN1A 3O8DA 1HJAC 1O2TA 5FX5A 1C5ZB 2ZU1A 1CSOE 3HATH 3S9CA 4B75A 3RM2H 1GHBF 3IWMA 1BTPA 1NY22 3UTUH 5E0HA 4JZEH 1DDJA 1UVPA 1OX1A 5IDKA 3Q3YA 1O2HA 3H7OA 1O5EH 3KGPA 3PRBA 3SUDA 1NC6A 4Q7XA 1GI6A 3EGKH 5EOKA 1P2NA 2BVXH 1C2IA 1C5QA 2KCYA 2UUJB 4B71A 1WDIA 2UUKB 1BTWA 1TAWA 5EPNA 1AUTC 1GMDF 1QB9A 1C5OH 1QB6A 3E90B 4B2CA 1GI9B 4K60A 2G55A 1Z71A 4XDEA 1O2SA 5JPMH 4E06H 2FYQA 1ZOMA 2H2ZA 4GSOA 1AQ7A 8ESTE 1ZMNA 3HK6B 3MTYA 4Q2KA 4IBLH 3SI3H 1UVTH 3GDSA 4YT6H 3ZZ7A 5EIYA 3OE7D 1TNIA 3SQEE 1AY6H 1V2JT 1KYNA 2H5DA 1W7GH 4GAWA 1V2PT 5C0TA 1SHYA 4CR9A 2FOGA 1L4ZA 1O2ZA 1H9IE 2EI6A 2AH4X 1CT0E 3RXDA 2G51A 4H42U 2OC8A 1L0ZA 1GHZA 1UTPA 2A5AA 3LU9B 1JWTA 4B1TA 2PUXB 2YMSC 2XOKD 4AN7A 1H8IH 1WU1A 1SKYE 2PKAA 2BQWB 4KTSA 1PYTC 3W1EA 1C4U2 1ZGIA 1W3CA 3GCOA 2QA9E 3FZZA 6ESTA 2ANKH 1XUKA 3GY6A 1HPGA 2PHBA 1TGTA 1CBWC 4CBNA 2DE8A 2BD5A 2ZFPH 4IC6A 2UWOA 1P01A 1BA8B 1FXYA 1HGTH 3TIUA 4A1XA 1SGCA 3BN9A 1P3EA 3K9XB 2BB4A 1XMNB 2B8OH 2GCHF 2ZPRA 2GMTB 2PSXA 2R0KA 2BD3A 1SQAA 4O03A 3F2FA 1K1LA 4MNWA 1MABB 3TK9A 1QJ6B 4YZUA 2GZ8A 2Z6BD 1BHXB 2IN2A 7LPRA 1K22H 1WTHD 2FLBH 2OQUA 2P93A 3RDZA 2PTCE 2ZIQH 4INKA 1EXFA 1TGBA 4X6MA 2FS9A 4MDSA 3MH4A 2AIPA 3QZRA 1MCVA 5JBCS 1UTJA 1T32A 1TPAE 3SORA 3E1XB 3M5OA 1ETTH 1ELGA 1Y5UT 1YPJH 5EQSA 5DP4A 1W13U 4ZXYH 1KXFA 4AFZA 1GG6B 2G8TA 3OTJE 3C27B 3ZIAD 1ANEA 1PJPA 1FI8A 2ZU3A 4UDWH 1ZTLA 2AIQA 3A80A 3TGIE 1EZSC 1CT2E 3DT0H 5C1YA 1UO6A 2VIDA 2Y82A 1W11U 2ALVA 2AGIX 3UREA 2RFKC 4FU9A 2A1DB 3TNSA 1MKWK 3P92A 2AS9A 4B2AA 2ZGCA 2HGTH 2ZECA 1V6DA 3BTHE 3F1SB 5C2ZA 1SGPE 1T4UH 2QAAA 4GPGA 1SGRE 3ODDA 5I25A 3STJA 1P3CA 1O5FH 3W94A 5JB8S 1V3XA 4O97A 2ZPQA 1IQKA 2AYWA 3SNDA 2V7QD 5FCKA 2RDEA 1KDQA 2BD9A 1NU9A 2G5VA 5G4BA 2FOAA 3P95A 2ZGXH 1G37A 3M7UA 2QC2A 3RMNH 1P2KA 5C3NA 3L33A 1GI3A 2J98A 4CRDA 3MU0A 1NRNH 3SJIA 2NU0E 1ABJH 1OS8A 1C5VA 2F83A 1BMNH 1BMFD 1T8OA 3V13A 1EP5A 3Q00A 2XC0A 1GCTC 5C1XA 3SU4A 1GPZA 3FANA 1O2QA 2J9NA 1EX3A 1TA6A 2F4LA 2VJ1A 2C4FH 4HTCH 2R9PA 1GWAA 2RA0A 2XWBI 1H4WA 4WWYA 2ESTE 2JJ2D 1YCPH 2PV9B 4IW4E 4AOQA 1H8ED 1DICA 1GBLA 2FDAA 5FPSA 3CS7A 4OS4A 3RXRA 1DITH 2FXRA 3MO9A 3A8DA 4TPIZ 3N7EA 4JZIA 1C9TA 2GDEH 2YMSD 2HNTE 1V2LT 1PQ5A 4XFQA 3O8RA 2OQ5A 3T27A 2C3SA 3S9AA 1QQUA 2GJGA 2QGRA 1PYTD 2XNDD 2A32A 4UD9H 1OP8A 3LT3A 1FV9A 2HVXA 1C5LH 3FP7E 4ISIH 1A3BH 2BDBA 3NWUA 4U01A 1O2OA 2YNBA 3MOCA 4MPWA 1WUNH 1FX0B 1X7AC 2VBCA 3EAJA 1CGJE 1SL3A 1WYKA 3M7TA 1AWHB 1K2I1 1OHHD 2AHME 3BTKE 5DKMA 3FKSD 1B5GH 5SGAE 1ELBA 2NWNA 4ACAA 1D6WA 1GI0A 2FWWA 2CMYA 3MH7A 3OEED 1VCWA 4J2YB 3U1IB 5C20A 4X8TH 3BTDE 1MZDA 1LPGB 2ZU5A 3HPTB 1LPKB 4DVAU 3E16B 1J15A 1N6XA 1AVWA 1BJVA 5C94A 1ZTKA 2FI5E 1GBMA 1HJ8A 3UNQA 4BXSA 3ZZAA 4K1SA 4ABBA 2ZFSA 2V3MA 5JDUB 4FVDA 2ANYA 5LPFA 2SFAA 1GI5A 1GBKA 5FXLA 3SJ8A 1QGFA 3GDUA 4ZAEA 1O5AB 1DSUA 3LH3A 5A8XA 1RXPA 3BTTE 4I8GA 1AE8H 2A5KA 2WSSD 3QX5H 3GOVB 4Y7AA 5TJXA 1V2OT 2ZKSA 1S5SA 3M37A 4CHAB 4JZFH 1FMGA 1UTKA 3PV5A 5JBAS 2J34A 4DT4A 1HIAA 2GZ7A 4AGJA 3K65B 4Z6AH 4NZLA 2FI3E 2OBOA 4OM9A 3MFJA 1O2IA 5F6MA 2Q6DA 1GMCG 1HAOH 3VB5A 4WXVA 3F0PA 1EQ9A 1P0SH 1M9UA 2A4GA 1W0JD 1QBNA 1D3QB 3P8FA 2V3HH 3E0PB 3Q3XA 1A61H 1C5XB 2R2WU 1RGQA 3QTOH 2R0LA 2CV3A 1P2QA 1S81A 1NRQH 1UK4A 1XUIA 1TABE 2YOLA 3OX7U 5DSFA 2B7DH 1BZXE 3A88A 3TVJB 2P3TB 4KGAA 2XXLA 2J94A 5ETXA 1HAYB 2BZ6H 2ZTYA 3GS9A 3ZZ3A 3MH6A 1GL1A 1UTQA 1IQEA 2ZTXA 4WMFA 3SUGA 5F03A 3T29A 1D3DB 1HAHH 1SVPA 3P17H 4ISNA 5A0BA 3GCHB 3E0NB 1TALA 1TMTH 2BMGB 3ZZ4A 2QF3A 5EXMA 1BT7A 1Y59T 3M61U 1O38A 2Y80A 2XBXA 3BTWE 1YWUA 4E7RG 1V2MT 4X8VH 1LKAA 1RD3B 1ESBA 4ZHAA 2ZI2H 1LQDB 2WYGA 1O2UA 4YOJA 5T3HA 1V2TT 1K21H 4O3UA 2ZCHP 2ZQ1A 2P95A 1K1NA 4I8JA 4I7YH 3T25A 4F49A 1E79D 2D1JA 3R3GB 3AK5A 1GMHG 2KCOA 4YESB 2GMTC 5EODA 1A2CH 2QF0A 3MHWU 2L6OA 1N6YA 1S6HA 2BDYA 3SW2B 2BTCE 2EEKA 4XE4A 1FIZA 3VXEH 1GMCF 1SR5C 2GV7A 2QYIA 1KXBA 1NT1A 1V2RT 2ZWLH 5EJLA 1XXDA 4Q4LA 3I29A 2VB0A 1GI4A 3RP2A 1K28D 1YYY1 2R3YA 1OYTH 2SGEE 2ZDMA 1TLDA 1KLIH 1NZQH 2VGCB 2GZ9A 1QBVH 1Q2WA 4Y76A 1A0HB 5CE1A 2H5CA 1GG6C 1S85A 1F5KU 5CHBA 3AVZA 5DG6A 2BLQA 3U8RH 3BSQA 2JIZD 3SU2A 5HIYA 2WPJS 4AORA 4NA9H 1Y3YA 1SGTA 4HFPB 1E36B 4Y0YE 2ALPA 2ZC9H 4FXGH 1GJ7B 3MI4A 1TNJA 3KL6A 2P3UB 1IQNA 4B74A 1A4WH 1QA0A 1TOCB 1FN8A 3AW1A 3OU0A 2PGBB 4ZHLU 1CQQA 2FS8A 2WHXA 3SUFA 4JYUH 1MH0A 6CHAB 5EQRA 1EJNA 4MVNA 1AFEH 2BLVA 2L74A 2CGAA 1EP6A 1MQ6A 2A31A 1DXPA 3VG8A 4ABIA 1YLDA 5GWZA 1UCYK 1IHTH 1PPZA 2J97A 1Z1IA 2ZTZA 1GMHF 1S0QA 1YP9A 2BLOA 1DY9A 2BVSH 5KEDA 2H9EH 2BY5X 1AB9B 2G4UA 1ZRBA 2FESH 1GVZA 2LPRA 1SFQB 4OS7A 2P94A 2BX3A 1K1OA 3ZVCA 1O2XA 1ZTJA 3A8CA 4ABFA 2ZDVH 2WPKS 1ZPCA 3U98H 4FUJA 2BY9X 3GY3A 1D3PB 2J38A 1V2NT 2GP9B 1ZSJA 2GT7A 3DSGA 3PMHB 2M2AA 4KELA 1TRNA 3KYFA 2Y81A 1OWHA 2HOBA 3RU4T 3URCA 2GDDA 3ATIA 1YPHE 2H1UA 5C67A 1TFXA 2GV6A 2VIVA 4ESTE 3SNAA 1BTXA 1VJ9U 3S0NA 1TRYA 2BZAA 1E1RD 1GHXH 1YC0A 3NZIA 1TOMH 1WSSH 2ZDKA 2AGGX 1QL9A 3ZZ5A 5AFYH 1GDQA 1B0FA 2GGVB 2K0QA 4RT0A 1K1JA 2A4RA 4F4OC 1O0DH 4ZKOU 2CF8H 1XUJA 3DFJA 3S69A 2Q6GA 4BXWA 2O8LA 2VNTA 5EW1H 5EJ1A 1GI8B 5E0GA 1PQ7A 1QBOA 4GVUA 1C2GA 2ZCLP 3DCLA 1CA0B 2RG3A 4IMZA 5GNDA 2GCTB 5EU8A 4LK4A 1NBMD 3E3TA 1Z8RA 3T28A 3UOUA 1RS0A 5ESTE 1EATA 2HNTF 5DP8A 2QCYA 1MCTA 1O3HA 1KXAA 1AHTH 1SQRA 1QJ7B 3F2GA 1GVKB 5A8ZA 3EA8A 3TJUA 5FX6A 5DP5A 1P10A 4K1TA 4H4FA 2FZZA 2JH6D 2G4TA 1O2YA 3AW0A 5T6GA 2WYJA 1DE7H 3A87A 3LC5A 2ZHWH 1FNIA 3B9FH 1EZQA 1ETSH 2KAIB 3P70B 4Q80A 4YOGA 1C2JA 4DIHH 2QF4A 1O3PB 3ZZBA 1DSTA 1KTTB 3ZVAA 2BDCA 2XW9A 2F9VA 3MU5A 2BDHA 3QUMP 3E6PH 1AFQB 4A5TS 1TBQH 1T4VH 2CXVA 3QK1A 2TBSA 5T6DA 1YLCA 4FUGA 1BTUA 1YLNA 3B8JA 4CHAC 3CS0A 4XBDA 2BY8X 1UVUH 2A4OA 3SGBE 3ZVBA 8KME2 5HGGA 1XKAC 2ZHQH 3QGNB 5EW2H 2ZGBH 2KCAA 2PR3A 5H4IB 1GL0E 2W6JD 1QA7A 1L1GA 2ZFTA 3LKWA 1W0ZU 3PTBA 3QZQA 4JZ1A 4Z1MD 1GJDB 1ZGVA 1FN6A 2ZDNA 1Z8IB 1QL8A 5FBEA 1DWEH 4DIIH 1NTPA 1NESE 2TGDA 4JK5A 2BXUH 3A83A 3B23B 3HKIB 2GT8A 1THPB 3MU1A 5DP6A 3MO6A 1SQTA 1SGFA 1WAYB 5C5NA 2F9PA 7ESTE 1YGCH 3F2HA 1ELDE 3A86A 3O8CA 3RMOH 3LGIA 1O2WA 3SBKA 4O9VA 4RKJB 2Z3EA 1ZMJA 4Y79A 3T2NA 1BMAA 5A0CA 3A81A 3ZZ9A 1F0UA 4X6PA 2ILNA 4LOYH 3FN8A 3GCHC 1YPEH 1LVOA 2W7SA 4NIYA 2AGEX 1IQGA 1DWBH 3VGCB 4AG1A 4AYVB 3L3TA 2XC5A 4M9FA 1A46H 4RI0A 2J4IA 2UWLA 1O3DA 4TWYA 5FHTA 1L1NA 1TQ7B 2PGQB 3RXCA 1GGDB 1O39A 3RXFA 2A7JA 4DJZB 2BM2A 2WZQA 1ZHRA 3A7YA 1UW7A 3SZEA 1C5TA 3SU6A 1H8HD 1TX6A 3PO1B 4Y6DA 3PROA 4CH2B 1B7XB 1T7CA 1GJ5H 4NFFA 4NSYA 4E7NA 3CP7A 3ZVEA 1F0RA 1F5LA 4I86A 2V0BA 3RXKA 1ELCA 3KYGA 1BBRH 1VITH 1YCPK 4FUBA 3LJOA 5LPEA 1LDTT 3RXGA 1XUGA 1U6QA 5ABWA 1B0EA 1SG8B 1FAXA 5F53A 3F68H 1PPHE 1MMJN 1Z6JH 3U8TH 5L2YH 2BY6X 1EAWA 1QB1A 2P3FH 3RXIA 2BX4A 1P06A 2TIOA 2VGCC 2Y7XA 2J2UA 2HNTC 1UTMA 3MU8A 2KZ4A 1O3NA 1F7ZA 2FX6A 1TE0A 4Y11E 4K8BA 3R0FA 1TIOA 3TK5A 1V2ST 5DN6D 1GJ6A 1T31A 3Q77A 3LJJA 5FAHA 4A92A 1L2EA 2FOCA 2GVFA 3BG8A 1KXCA 3PMJA 1SQOA 1J16A 3UNSA 2VINA 2FM2A 4CREA 1ACBE 1P11E 1IHSH 2ZU4A 3KCGH 3TITA 1QJ1B 1SI5H 3RXAA 1GBCA 1OWDA 5AVDA 3ZZCA 3AAVA 1O35A 1GJ4H 4KP0A 1PFXC 1QRXA 2STAE 1K1PA 6CHAC 2D2DA 1HB0B 3RC5A 1LTOA 5DP3A 4X1NU 3KHVA 1O3CA 1AWFH 2TGTA 1QR3E 1C1QA 1YPKH 1FY8E 3P8GA 2A0QB 5A8YA 4B6EA 4LZ4B 3FOAA 1AGJA 2AMDA 4GHQA 1E34B 4I31A 1HAXB 3LOXA 5DPAA 1C5NH 1H1BA 4NZQA 4DT7B 4Q7YA 1NS3A 3FAOA 1FZZA 2PTNA 2XNIA 3E91A 5E0JA 1LQEA 4ZKNU 3QGJA 1CU1A 4X1QU 5C0UA 1AB9C 1ZSLA 2A2XH 1W7XH 2EI7A 2ZQ2A 5A09A 1RIWB 1SHHB 3MU4A 3IITA 3GY8A 2B5TB 2A7HA 1PPBH 4ZHMU 2BOHB 1EOLA 3BTEE 2RA3A 2SNWA 2J95A 3RMLH 2NU3E 1UJ1A 1NFWA 1QHRB 3KQEA 1ZRKA 2EY4C 4WMEA 1GJBB 1BRCE 1TBZH 3TGJE 1UTNA 1TNLA 1ZR0A 3V0XA 5I46H 1EAUA 1DT2A 1AMHA 1BITA 4XOJA 3SV9A 1O2JA 5B6LA 5C17A 1O3GA 1QL7A 1TGCA 4AFSA 3P8OA 1KLTA 1FJSA 1BIOA 4ZCNA 5GDSH 3C1KA 2PP6A 1AVGH 3DA9B 3MNCA 3CENA 3RXTA 2TGAA 1AN1E 3QWCH 1IQLA 1TPPA 2WPIS 4Y10E 1SFIA 2STBE 1UVOA 4AZ2B 1VCPA 4NGAH 3O8BA 1GJAB 1KLJH 3NRLA 4FUEA 4Y8XA 3UQOA 1MU6B 3GY5A 3RXEA 1EASA 1HXFH 1LHCH 1SPJA 4TWWA 3I77A 5E2PA 3RLYH 1YPMH 2WV5A 1CA0C 1SSXA 2GCTC 3A7ZA 2VU8E 4IC5A 2AFQB 1VKYA 2HWLB 4YOIA 2QY0B 1P04A 1Y3UA 4THNH 1SLUB 1FONA 1N8OB 5AF9H 5L6NH 3SV6A 3ELAH 2JH0D 3EA7A 2BOKA 4ABJA 2QF5A 5L30H 3BIVH 4ISLA 1HDTH 4X0WU 3SQHE 1HYLA 2XYAA 2F9BH 4WXIA 2TPIZ 1SGNE 3A7VA 4AFUA 4UFFH 1G30B 1FY5A 4AG2A 4NSVA 3PTNA 2W5EA 4U30A 1O37A 1WBGB 1FQ3A 2WINI 1LVMA 3S7KB 1AFQC 1Q3XA 1Y8TA 4AYYB 1RTFB 2TGPZ 1DFPA 3PV2A 1ARBA 1BMLA 2AEIH 2JJ1D 3ZV8A 1QCPA 2ZHDA 3RU4D 4NWLA 1PPFE 5LGOA 2VWOA 3SV7A 1D9IA 1O2LA 4UE7H 1ORFA 2HVYB 4DURA 3SOSA 1GHYH 1EOJA 1EB2A 2PSYA 2A7CA 4D9QA 1O2KA 1GJCB 1KTSB 1LMWB 2ZHFH 4YTAA 3WWBA 3SNEA 2QN5T 5DJ7A 4Y71A 1SLXB 3RXVA 4DG4A 1TRMA 3D65E 4O3TA 1NFYA 1OKXA 3MNBA 2ODPA 1G2LA 1HAGE 3V12A 5HYOA 2CHAB 2VWLA 3LGYA 3VB7A 1OPHB 2ZZUH 1O30A 5FPTA 4A7IB 2Y5HA 3MYWA 3BEFB 4AB8A 1MUEB 3MMGA 1O2NA 4I32A 3RM0H 1QIXB 2JETB 2WUBA 2ZGHA 1LHGH 2G00A 1V2UT 2Q1JA 3WW7A 5BPEA 3H5CB 1TGNA 2G81E 1OOKB 3GY7A 4TYDA 3VGCC 3ZV9A 1VGCB 1K1MA 3ATWA 4ZROA 3RC4A 4BAKB 3RXMA 3M3VA 1BRAA 1MZAA 1J17T 3FP8E 1W0KD 3ODFA 1GGDC 1AZ8A 4YT7H 2NU4E 4ZUHA 4K2YA 4DW2U 1LVYA 1CT4E 5FCRA 3PO1C 4FETA 3DSOA 4AB9A 1N1LA 1XM1A 3PWCA 1C5UA 1O2PA 2C8YB 1HAPH 1O3AA 1GCDA 3RXOA 3TLOA 4X6OA 4Y0ZE 2EC9H 1QY6A 1O33A 3KIDU 2ANWA 1MTUA 4B76A 1ZPZA 1O2VA 1C5PA 1GI2A 3BTQE 5EXNA 1QTFA 1BQYA 4ABAA 2NU2E 2FI4E 4XSKU 3VPKA 4IMQA 1C5MD 3KF2A 4Y8YA 3GDVA 2C8XB 2VWNA 1XXFA 2P16A 1YKTA 5FPYA 2WPDD 1W12U 1O2MA 2OC1A 2OUAA 4P02A 1LHFH 4HGCA 2SNVA 1XUFA 4CR5A 2FOMB 4NWKA 5EPYA 5K0HA 1ZJDA 2QXJA 2FOHA 5EGMA 3SO3A 4HZHA 5T1VA 1IQHA 1AZZA 1GDNA 4BTUB 1XVMA 1YF4A 1MKXH 2FODA 3KQ5A 4BOHA 2FPZA 2A45B 3F9HA 3TJVA 1UK2A 1P09A 1SLWB 2G52A 4B2BA 1DPOA 3A84A 4Y8ZA 3F9EA 1EZUC 2GTBA 3SZNA 2RCEA 4ZXXH 2SGDE 2FMJA 4OGXA 1RRKA 4OS5A 2BQ6B 2ZEBA 1FAKH 1DANH 1EPTB 1JBUH 4OS2A 1EPTA 4GUXA 3PMAB 2V35A 1S6FA 3N99A 5T6FA 1O31A 1GBIA 1CHOG 5F8ZA 4D9RA 3TJNA 1QRWA 1C9PA 3SN8A 5K7RA 1Z1JA 5LH8A 3HGNA 4SGBE 1RIWC 3U8OH 1Y3XA 1TPSA 3SHAH 3S9BA 1EJAA 1SGEE 3PRDA 1NRRH 1SGQE 1Y3WA 2BDGA 2VVUA 3EDXB 4FVBA 1O3IA 3F9FA 3NPSA 2OK5A 4UFDH 5L2ZH 1O3FA 2JKHA 4BTIB 1CVWH 1Z8JB 4WH6A 3A8BA 1SC8U 1WCZA 2VIQA 3K6YA 1UHBB 4ZKRU 1UHBA 5EG4A 4KKDA 3BF6H 3F0OA 1DS2E 1MD7A 3UR6A 3URDA 4JYTA 2PKSB 1J8AA 4Z0KA 2J5UA 1QZ8A 3MNXA 1TX7A 1AKSB 1C1TA 4X8UH 3SV8A 4CRAA 3U69H 5CHAB 2SGAA 1K9OE 3PLBA 2DE9A 2IJOB 1BB0B 2IOTA 2VVVA 4ABEA 1O3LA 1Y5AT 5DK1A 5CDFE 3M5LA 3PM3A 1C1WH 3SUEA 1N8OC 1O3EA 3F6UH 1VJAU 3FFGA 1L4DA 1CHOF 1YM0A 3BIUH 2WV9A 3GCNA 4A1VA 3PV4A 3SNCA 3KQDA 3OYPA 1SBWA 5GCHG 9LPRA 4NIWA 4GHTA 1THSH 2VH0A 3HKJB 2O8MA 1C1UH 1C1VH 1COWD 1W8BH 2VIOA 1NBME 3A7WA 1JMOH 1HAZB 2P8OB 4DOQA 1GI1A 3LDXH 1V2QT 1W0YH 4AC9A 2FOEA 4DCDA 4CRFA 1O36A 4K3JA 3EA9A 5FBIA 1BBRE 2FLRH
chains in the Genus database with same CATH topology
5B6OA 4R0IA 2OINA 1EAXA 2WV4A 1A3EH 2Y7ZA 4I8LA 2ODQA 4OS1A 2NU1E 4ISOA 1ZYOA 4MTBA 1AVXA 2HPPH 3LONA 5EXLA 3BTFE 3RXSA 3DD2H 2KAIA 1GMDG 1LVBA 4NA8A 1OP2A 1KSNA 1P2MA 2BD8A 5DP9A 1D6RA 2IPHA 4GLYA 4D7FA 1MQ5A 5PTPA 2DUCA 5LPRA 4H6SB 1CA8B 2OC7A 2XBYA 3LIWA 1GVLA 1SGYE 2CHAC 4UFGH 3KQCA 1ANDA 1UMAH 1LO6A 1XKBC 3ESTA 1WV7H 2A5IA 1O34A 1C1PA 1DXWA 1XX9A 4U32A 1ESAA 1G2MA 3M5MA 4WJG2 2Y5GA 3ZZ6A 2JETC 3SU5A 1DUAA 3A8AA 1O3OA 3UIRA 1A5GH 3UR9A 2QXIA 5GCHF 3OY5U 4H6TA 5GJ4B 1OXGA 2B9LA 3A7TA 1VGCC 3NKKA 1CHGA 2O8UA 5EQQA 2ZFRH 4UONA 1C2DA 4MNYA 4E05H 1DWCH 3IG6B 3SGAE 3MO3A 2BD2A 4CRBA 4INHA 1V2KT 2ZP0H 4WF8A 1UCYH 2AMPA 1ZZZA 4X1PU 1ETRH 4TY6A 2ZFFH 4BAHB 1RTLA 1ELFA 4FUCA 1DUEA 2CF9H 3LH1A 2PW8H 1BRUP 1ZPBA 1C2EA 1FY3A 5HM9A 3UY9A 3AASA 3K6ZA 3LGUA 1RTKA 2V3OH 3STIA 4YO9A 2GCHG 3GYLB 3BEUA 2ZA5A 3PYHA 1LCYA 1MTSA 3RXPA 2ZCKP 2RDLA 1ZSKA 4K8YA 2OC0A 2P59A 2ULLA 1K1IA 2ZG0H 3PB1E 3U1JB 4RKOB 3BTGE 4FUHA 1BTZA 3K2UA 1F92A 3QN7A 1GHWH 1NRPH 1IOEA 1QRZA 1NPMA 2FTMA 1Y5BT 3GCTG 1C2MA 2BDAA 4UEHH 1T8MA 1P8VC 1G32B 3UPEA 4I8KA 2LNCA 1SGFG 3ZVDA 3PMBB 4MLFB 1H8DH 2I6QA 1ARCA 1MAXA 2G5NA 2K1QA 2O8TA 4AGKA 3ATKA 2WPHS 2F9UA 4FUDA 1JOUB 4MG3A 7GCHG 4CRGA 1Z7KA 2PKAB 1S84A 3D62A 2XCFA 1YCPM 5E8EH 1VCQA 2BD7A 1CGIE 3VB4A 1YPGH 3UOPA 1THRH 4JK6A 4CBOA 1ZLRA 3VEQB 1EPTC 3D49H 2VVCA 1CE5A 1SMFE 1C2FA 2OXSA 3F9GA 2VH6A 3WY8A 4MNVA 4FU8A 3KN2A 1HFDA 1TYNA 4IN2A 2VIPA 3M3TA 1CO7E 1TPOA 3T26A 1MD8A 3LPRA 1A1RA 3QO6A 1MTNB 1TGSZ 5DP7A 5GIBA 3T5FH 1HRTH 4KTCA 1NRSH 3EYDA 2VWMA 1BDAA 1F2SE 2H9TH 1GDUA 2PWXA 1O2RA 1E37B 2Z94A 4GCHG 4D7GA 3Q76A 2C8WB 1IQJA 3UFAA 1P2OA 3GCTF 1FLEE 1S83A 5ESBA 3BEIB 2F91A 2H6MA 2HRVA 4YM9A 1O5GH 2BVRH 4IGDA 1F5RA 3M5NA 4INLA 5TCCA 4NIXA 4JYVH 1YPLH 1NN6A 1C1NA 4FUIA 2R2MB 4U2WA 1TA2A 2D8WA 2PKSC 1P9UA 2W26A 2Z9KA 4OGYA 2M5TA 1DLKB 1DOJA 1C5YB 2ZHEH 1VZQH 1JRSA 1VITG 2I6SA 2SGFE 1AD8H 1LKBA 4BNRA 1IAUA 7GCHF 1G36A 2FYRA 1GBHA 3RC6A 5CHAC 4MPXA 4Y7BA 9ESTA 2Z9LA 4A1TA 1BTYA 1G3DA 2OP9A 4XBCA 5J4QA 1GI7B 3RXQA 2QIQA 5C1UA 1BMMH 1HNEE 2BXTH 2QXHA 1ABIH 1GBTA 1GJ9B 1O3BA 1KDQB 4BANB 2Q6FA 5J4SA 1LPZB 2ZU2A 4ZH8A 1J9CH 1H9LB 1JXPA 5HM2A 1T8NA 4BAOB 1DY8A 4JMYA 3UQVA 1JIRA 4X2XA 2P8OC 5TCAA 1KXDA 1ZHPA 1QURH 2WPMS 2ZNKH 1UTLM 2PFEA 3M3SA 4GCHF 2ZGJA 3UWJH 3BG4B 1TONA 1A0JA 2QV1A 2Z9JA 3TH2H 4QT8C 1SGIB 2F3CE 2PLXA 4MNXA 3RXUA 1SOZA 3V7TA 1C4V2 4X8SH 4UFEH 1GHVH 3LGTA 1HXEH 3TGKE 1MTVA 1JRTA 1BUIA 1FY4A 1O5BB 3ZYDA 1S82A 2WPLS 1VITF 1BHXF 3M36A 1G9IE 3RU4E 1W2KH 1BRBE 2FOBA 1MKXK 3ZZ8A 1INCA 3U9AH 1MBMA 2YNAA 4ABGA 4XBBA 4LZ1H 4NA7A 5IYTA 1FPHH 2FEQH 4X6NA 3PLPA 3FZDA 1OWJA 1OWEA 1HCGA 1IQIA 1C1RA 3ZVGA 1GBDA 1OP0A 4WY3A 1V2VT 1ANBA 3P8NA 2D26C 1NFUA 4NCYA 1QFKH 1TBRH 2Z3CA 1C2KA 1HBTH 3VB3A 1ID5H 2B0FA 2ODYB 1P2IA 2GX4A 1HLTH 2EA3A 1FIWA 1GJ8B 3RXHA 1HJ9A 3OSYA 1C5SA 1PQ8A 2ASUB 2BQ7B 1GBFA 1OWIA 1E35B 1KXEA 2ZPSA 3HGPA 1PPCE 1O3KA 4A6LA 4ASHA 1AIXH 1BJUA 1WQSA 1MKWH 3AAUA 3MWIU 3ATLA 1DVAH 1NM6A 3SHCH 3TNTA 3SU0A 3TU7H 4BAMB 3KNXA 4Q7ZA 1E0FD 2PUQH 1ANCA 1Z6EA 2EI8A 5F8XA 1GBEA 2FP7B 3V3MA 1HIAB 3BTME 5HXFA 1C4Y2 1F0TA 4VGCB 1FPCH 4X1SU 1AU8A 2BY7X 3RXBA 2VIWA 1HJAB 2HLCA 2FIRH 3N7OA 3M7QA 4X1RU 5GPIB 1UK3A 1C2HA 3ZZDA 1P05A 1WTGH 4NIVA 1C1SA 1TNKA 2CJIA 1XUHA 1DM4B 2ZDLA 1C2LA 4FUFA 3LGWA 3LGVA 1BCUH 1VR1H 1ZMLA 1ZHMA 1DX5M 3FP6E 4OS6A 1NFXA 2A4QA 3M35A 1KY9A 1NU7B 1O5DH 2BLWA 1EKBB 1SB1H 3OY6U 3RXJA 1EAIA 3DFLA 2UUFB 1SLVB 1ESTA 1EB1H 1LHDH 1W14U 1ELAA 1YPHC 1FUJA 3NCLA 7KMEH 1RJXB 4PROA 2XC4A 8LPRA 3FVFB 2BDIA 1C1OA 4JZDH 1QQ4A 3SNBA 5A0AE 3G01A 5HMAA 5JBTA 3ATMA 4B73A 2O8WA 3JZ2B 1A5IA 1MAYA 2W3KA 4ISHH 1IQMA 1MTWA 4AX9H 8GCHG 3HK3B 3QLPH 1CGHA 1C5WB 2ZF0H 2OD3B 1TMBH 2XBVA 1F0SA 1P9SA 1GHAG 1S0RA 1Y3VA 1NROH 2F9OA 3SU3A 4M7GA 3NXPA 2UWPA 1MTNC 5JYIA 1P2JA 4RN6A 4YLUA 4J1YA 3TPIZ 1A5HA 1A7SA 3QDZB 3SV2H 3L6PA 2SGPE 4I8HA 4ABDA 1PPGE 3NK8A 3D23A 4DGJA 1MBQA 2C93B 1HAIH 1G3CA 1H9HE 1CBWB 1P03A 1OSSA 2FO9A 1HV7A 4WVPE 5JBBS 3A82A 1DLEA 4WMDA 4HI3A 3TK6A 2BHGA 1EZXC 1LHEH 1JIMA 4NG9H 5DGJA 3ZYEA 1HAVB 1HAVA 3P6ZB 2SGQE 2ANMH 2JH5D 1O3MA 1UVSH 2W7UA 2Z9GA 1W10U 1XVOA 3VB6A 3VXFH 1GBAA 1QNJA 2HALA 2C90B 2F9NA 5CMXH 2Y6TA 4I33A 3NUMA 2BYAX 2J92A 2OTVA 4X2WA 1HUTH 1EJMA 1G3EA 5F8TA 3EQ0H 4DY7B 1TWXB 1OWKA 4K69A 1EUFA 1TNGA 1AI8H 1GBJA 2UUYA 2Z7FE 8GCHF 1FDPA 1C5RA 2BD4A 2QXGA 4R8TB 4WH8A 2FTLE 1O32A 4BTTB 2FX4A 3MH5A 1YBWA 1E38B 1GHAF 1UCYE 1UTOA 1D3TB 1DWDH 3ITIA 3GICB 4K5ZA 4LXBH 2GD4B 1AKSA 3QTVH 4SGAE 3A85A 1P02A 3KEEA 1AUJA 2AERH 1FY1A 1TX8A 2WUCA 1MU8B 3ENSB 1ELVA 1P57B 4RSPA 3T62A 3RMMH 2H9HA 5GXPA 3H7TA 6GCHG 3ZVFA 2AMQA 2XRCA 1AE5A 1BOQA 1OYQA 3E8LA 3BG4C 1O3JA 4TPYA 1SOTA 1O2GH 1Q31A 4X2VA 3SI4H 4ZMAH 2O9QA 2XBWA 3A7XA 2GKVE 2C8ZB 2W3IA 5BRRE 3GISB 1T8LA 3RXLA 1BTHH 2A2QH 1AO5A 3SU1A 3KQBA 5DO4H 4K1EA 4CH8B 4JCNA 2HPQH 5E2OA 1GHBG 1GCTB 3TH3H 1BBRK 4KTUA 1PQAA 1TB6H 5C5OA 4MPVA 1WQVH 3SJ9A 4D76A 1V2WT 3UWIA 1RFNA 3SJOA 3A89A 2Y5FA 3GYMA 3UUZA 2OCVB 4YLQH 2Z3DA 1C1MA 3DUXH 4MQAA 5JB9S 3JZ1B 3SJKA 3W95A 2ZFQH 3EE0B 1D4PB 2OBQA 3VFEA 1IQFA 1TNHA 3Q3KA 1TMUH 3LC3A 1PPEE 2Z9IA 1NO9H 2ZO3H 4FU7A 3PWBA 5AFZH 1ELTA 2V6NA 4X2YA 3TJOA 1ELEE 3DHKH 3I78A 2CN0H 1TQ0B 3RUOA 4AFQA 4BAQB 1SGDE 2ZDAH 3UNRA 2THFB 1Z8GA 1WOFA 2TRMA 5A2MH 2XCNA 4CRCA 1P12E 2OLGA 6GCHF 4IS5A 4ZKSU 4NFEA 3SGQE 1L1JA 1GBBA 1O5CB 2XWAA 5AHGH 2FOFA 3TH4H 4TY7A 4MPUA 2R3UA 2XTTB 3GY2A 1J14A 4D8NA 3PLKA 6LPRA 3GY4A 1ZJKA 1KIGH 3RLWH 1A0LA 1G3BA 4VGCC 3MNSA 3BV9B 4ABHA 3S7HB 4IN1A 3O8DA 1HJAC 1O2TA 5FX5A 1C5ZB 2ZU1A 1CSOE 3HATH 3S9CA 4B75A 3RM2H 1GHBF 3IWMA 1BTPA 1NY22 3UTUH 5E0HA 4JZEH 1DDJA 1UVPA 1OX1A 5IDKA 3Q3YA 1O2HA 3H7OA 1O5EH 3KGPA 3SUDA 1NC6A 4Q7XA 1GI6A 3EGKH 5EOKA 1P2NA 2BVXH 1C2IA 1C5QA 2UUJB 4B71A 2UUKB 1BTWA 1TAWA 5EPNA 1AUTC 1GMDF 1QB9A 1C5OH 1QB6A 3E90B 4B2CA 1GI9B 4K60A 2G55A 1Z71A 4XDEA 1O2SA 5JPMH 4E06H 2FYQA 1ZOMA 2H2ZA 4GSOA 1AQ7A 8ESTE 1ZMNA 3HK6B 3MTYA 4Q2KA 4IBLH 3SI3H 1UVTH 3GDSA 4YT6H 3ZZ7A 1TNIA 3SQEE 1AY6H 1V2JT 1KYNA 2H5DA 1W7GH 4GAWA 1V2PT 1SHYA 4CR9A 2FOGA 1L4ZA 1O2ZA 1H9IE 2EI6A 2AH4X 1CT0E 3RXDA 2G51A 4H42U 2OC8A 1L0ZA 1GHZA 1UTPA 2A5AA 3LU9B 1JWTA 4B1TA 2PUXB 4AN7A 1H8IH 1WU1A 2PKAA 2BQWB 4KTSA 1PYTC 1C4U2 1ZGIA 1W3CA 3GCOA 2QA9E 3FZZA 6ESTA 2ANKH 1XUKA 3GY6A 1HPGA 2PHBA 1TGTA 1CBWC 4CBNA 2DE8A 2BD5A 2ZFPH 4IC6A 2UWOA 1P01A 1BA8B 1FXYA 1HGTH 3TIUA 4A1XA 1SGCA 3BN9A 1P3EA 3K9XB 2BB4A 1XMNB 2B8OH 2GCHF 2ZPRA 2GMTB 2PSXA 2R0KA 2BD3A 1SQAA 4O03A 1K1LA 4MNWA 3TK9A 1QJ6B 4YZUA 2GZ8A 2Z6BD 1BHXB 2IN2A 7LPRA 1K22H 1WTHD 2FLBH 2OQUA 2P93A 3RDZA 2PTCE 2ZIQH 4INKA 1EXFA 1TGBA 4X6MA 2FS9A 4MDSA 3MH4A 2AIPA 3QZRA 1MCVA 5JBCS 1UTJA 1T32A 1TPAE 3SORA 3E1XB 3M5OA 1ETTH 1ELGA 1Y5UT 1YPJH 5EQSA 5DP4A 1W13U 4ZXYH 1KXFA 4AFZA 1GG6B 2G8TA 3OTJE 3C27B 1ANEA 1PJPA 1FI8A 2ZU3A 4UDWH 1ZTLA 2AIQA 3A80A 3TGIE 1EZSC 1CT2E 3DT0H 5C1YA 1UO6A 2VIDA 2Y82A 1W11U 2ALVA 2AGIX 3UREA 4FU9A 2A1DB 3TNSA 1MKWK 3P92A 2AS9A 4B2AA 2ZGCA 2HGTH 2ZECA 1V6DA 3BTHE 3F1SB 5C2ZA 1SGPE 1T4UH 2QAAA 4GPGA 1SGRE 3ODDA 5I25A 3STJA 1P3CA 1O5FH 3W94A 5JB8S 1V3XA 4O97A 2ZPQA 1IQKA 2AYWA 3SNDA 5FCKA 1KDQA 2BD9A 1NU9A 2G5VA 5G4BA 2FOAA 3P95A 2ZGXH 1G37A 3M7UA 2QC2A 3RMNH 1P2KA 5C3NA 3L33A 1GI3A 4CRDA 3MU0A 1NRNH 3SJIA 2NU0E 1ABJH 1OS8A 1C5VA 2F83A 1BMNH 1T8OA 3V13A 1EP5A 3Q00A 2XC0A 1GCTC 5C1XA 3SU4A 1GPZA 3FANA 1O2QA 2J9NA 1EX3A 1TA6A 2VJ1A 2C4FH 4HTCH 2R9PA 1GWAA 2RA0A 2XWBI 1H4WA 4WWYA 2ESTE 1YCPH 2PV9B 4IW4E 4AOQA 1DICA 1GBLA 2FDAA 5FPSA 3CS7A 4OS4A 3RXRA 1DITH 2FXRA 3MO9A 3A8DA 4TPIZ 4JZIA 1C9TA 2GDEH 2HNTE 1V2LT 1PQ5A 4XFQA 3O8RA 2OQ5A 3T27A 2C3SA 3S9AA 1QQUA 2QGRA 1PYTD 2A32A 4UD9H 1OP8A 3LT3A 1FV9A 2HVXA 1C5LH 3FP7E 4ISIH 1A3BH 2BDBA 3NWUA 4U01A 1O2OA 2YNBA 3MOCA 4MPWA 1WUNH 1X7AC 3EAJA 1CGJE 1SL3A 1WYKA 3M7TA 1AWHB 1K2I1 3BTKE 5DKMA 1B5GH 5SGAE 1ELBA 2NWNA 1D6WA 1GI0A 2FWWA 2CMYA 3MH7A 4J2YB 1VCWA 3U1IB