1EKBB

The serine protease domain of enteropeptidase bound to inhibitor val-asp-asp-asp-asp-lys-chloromethane
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
235
structure length
235
Chain Sequence
IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of enteropeptidase light chain complexed with an analog of the trypsinogen activation peptide.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ENTEROPEPTIDASE
total genus 48
structure length 235
sequence length 235
ec nomenclature ec 3.4.21.9: Enteropeptidase.
pdb deposition date 1999-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ekbB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ekbB01
1JOUB 4Y6DA 3E16B 2ALPA 1F92A 1XX9A 5IDKA 3MMGA 1C5LH 1P2IA 3FZZA 1WU1A 3RLWH 3LONA 1GBMA 3S7HB 1C2IA 1K28D 1PYTD 1A2CH 5EXLA 4XBDA 1CBWC 4I32A 1UTMA 1ESBA 4CR9A 1BRUP 2B9LA 2A1DB 4B2CA 1BMNH 1ZPZA 2GMTC 4AFQA 4BAOB 1LPZB 3MWIU 1D6WA 1OWHA 1LMWB 2HRVA 1N1LA 1UVTH 4NGAH 2QF3A 3E0NB 1E38B 2GTBA 2QGRA 5GCHG 5J4QA 3NKKA 4Y7AA 1THPB 1NN6A 1WCZA 4YESB 2BDAA 2RG3A 2BD3A 1XXDA 4O97A 3LGVA 3U1JB 3SU6A 4GHQA 3QTOH 2PKAB 5FCRA 1C2HA 2W5EA 1YP9A 3ZZ9A 1FV9A 1CHOG 1AVGH 1P04A 3AASA 4O9VA 1EPTB 5DKMA 3EE0B 5AF9H 1Z6EA 3RMLH 2J9NA 4HI3A 4FU7A 1QQUA 2BDCA 1AMHA 1HJ9A 1HAPH 2OP9A 3SGQE 1GJAB 5FCKA 1THRH 6ESTA 1SOTA 4LZ4B 4DIIH 2ZPRA 3SI4H 1Z1IA 1UMAH 2Z9KA 1T8NA 3M3TA 4IW4E 4MPVA 1OWDA 1IQMA 3BTTE 4WY3A 6CHAB 4JZ1A 5LGOA 1AQ7A 5C1XA 2GMTB 1VZQH 3AW0A 1RD3B 1XKAC 4WH6A 2GT7A 2QV1A 1CSOE 2FOGA 1YKTA 1AVWA 2IPHA 3K65B 2PKSC 1ZSKA 4MTBA 5I46H 2OINA 2ZU4A 3EA8A 3B9FH 1SBWA 1A5GH 2STAE 4ISOA 1F0UA 1F5KU 1PQ8A 3BIVH 1C5WB 1BB0B 1NRSH 4CBNA 1UK4A 1B0EA 2GD4B 5LPFA 2XC5A 2HOBA 4ZMAH 5EQQA 1HIAB 5A2MH 3RXAA 2HNTE 1O2UA 2EA3A 4O3UA 2GCTC 3VGCC 3SHCH 4DG4A 1ZSLA 3UNSA 1GBIA 1O2QA 1A5IA 2ZHFH 3MU5A 3LH3A 1O3CA 3O8BA 2EI6A 4X6PA 3A88A 1E0FD 1ZHRA 1XUIA 1Z8RA 5L2ZH 3ZV8A 1OYTH 4AORA 2PKSB 4KTSA 3LDXH 3V0XA 3FZDA 3ODFA 2G81E 5SGAE 2G4UA 3BN9A 4GCHG 2FTMA 4FUHA 4ABEA 4KP0A 2ZC9H 4MPUA 3SI3H 2VJ1A 1Q2WA 1BMMH 1PQAA 4I33A 1EZXC 1O2PA 2FM2A 3E91A 2F9OA 1WTHD 1O38A 9ESTA 2UWPA 1GL1A 1QY6A 2NU1E 2PTCE 3SU1A 3V3MA 2DUCA 2THFB 3UNQA 2AS9A 3A83A 2Q6FA 1C5XB 1GBKA 5EGMA 1GBHA 4CRAA 4UONA 2CGAA 1Y3UA 3PTNA 1C5OH 1V2KT 3RU4D 1ANBA 2ZECA 3F1SB 3ATKA 2GVFA 1HJ8A 3GYMA 1UTQA 3RXFA 1TABE 2Q1JA 4KTCA 4X2VA 2G55A 1OWKA 1SFQB 1FAXA 4AYVB 4CBOA 1UTKA 2WINI 1GJ5H 3BTQE 4RSPA 2GZ9A 2Z94A 1L2EA 2H9HA 3L6PA 4IC6A 5TCAA 3U98H 2BXUH 1FY1A 4GCHF 2FEQH 1ELAA 1FJSA 1MAYA 1W11U 2QA9E 3RXJA 4Q2KA 5EOKA 3F68H 1O2SA 2SGAA 5CMXH 4YLQH 1XKBC 3SJ8A 1V2VT 3BTME 2WPMS 3SU3A 2ZPQA 2Y7ZA 1A46H 2VH6A 3GYLB 5GJ4B 1SHYA 1QL9A 5BRRE 1QA7A 3UR6A 3UWIA 3O8CA 2NU3E 4UEHH 3MYWA 3C27B 1DSTA 1SC8U 3STJA 2BD7A 1IQEA 1GI6A 3MH5A 4GHTA 1IQJA 1B7XB 1C1MA 2ZNKH 4BANB 2FOMB 4ZKRU 5J4SA 1AWFH 1K2I1 1O2YA 2J38A 2WPHS 2XBWA 4BAQB 1SSXA 1WOFA 2B7DH 1J8AA 3Q77A 1AIXH 1CQQA 4I8JA 2UUFB 3MTYA 5DP8A 4K8BA 4AX9H 1DUAA 1OWEA 5EQSA 1C5UA 1CT2E 1O5FH 2HGTH 4O03A 5DGJA 3ZYEA 2HLCA 3LPRA 4AYYB 1UTLM 4AGKA 5DJ7A 1A7SA 1BTXA 3EGKH 2FS9A 2P95A 3Q3KA 3L3TA 2F91A 1QQ4A 1KLJH 1YPLH 4NA8A 3HGNA 4TWYA 5AFYH 4D8NA 5FX5A 1V6DA 1NFYA 2Z3CA 4FVBA 4X6OA 5PTPA 3RXGA 4YOGA 1ZMJA 1G30B 2QN5T 3S9AA 1O3JA 2EC9H 4Q7XA 1C2JA 3N7OA 3S7KB 1J17T 1TPSA 1K9OE 1ZYOA 1LHFH 1UHBA 2G5NA 2BD8A 5GDSH 1K1JA 1ZGIA 3UREA 5HXFA 1VCWA 4X8VH 1SVPA 2BQWB 4B1TA 3GY7A 1EP6A 5GWZA 1O5AB 3TJVA 2ZDNA 1F0TA 1FPCH 1BRAA 2XBYA 3OY5U 4R8TB 3GY5A 3VB7A 4R0IA 1DWEH 1IQKA 5E0JA 1VCPA 1ZLRA 8KME2 2OLGA 1RTKA 1O2IA 1H4WA 1KXCA 1QBOA 2ZF0H 4AFUA 4ZAEA 1SMFE 1ZHMA 2A7JA 4BNRA 2SGDE 4ABDA 1O2HA 3P8GA 3QO6A 4AB8A 1V2WT 1X7AC 1NRNH 2QAAA 3U69H 1DS2E 5A8YA 4WF8A 3ZVAA 3IG6B 1UCYH 1KTTB 1SLUB 1EAXA 1HJAB 1T4VH 4D7GA 3M61U 4I8GA 4X0WU 4E05H 1W7GH 1TFXA 3MI4A 5E8EH 5DP5A 2B0FA 1HNEE 1WSSH 3SV8A 1GDQA 1YPHC 4WMEA 1HYLA 2AIPA 3RU4T 3P17H 3NXPA 1GG6C 1BTWA 1GMCG 4JZDH 3PM3A 1FN8A 1UVPA 1C1NA 1AB9C 4JK6A 1ZPBA 2G8TA 5FPTA 1BBRE 1G3DA 3SO3A 3V7TA 2KAIA 1GL0E 4K2YA 2QC2A 1BTUA 3G01A 5FX6A 4THNH 4NFFA 1ELFA 3H7OA 3T62A 3TITA 1SG8B 1TOCB 1OOKB 4YT7H 1W3CA 4LZ1H 1MQ6A 2I6SA 1C1TA 1P10A 3M7QA 2Z3DA 1BT7A 1JRSA 4HGCA 1FQ3A 3GDSA 3LH1A 3SUGA 1EAWA 1LQEA 1Y5UT 1TMUH 1OX1A 2D2DA 1G37A 1S6HA 3RC4A 1C2LA 3HKJB 2GKVE 5TJXA 1H9IE 4ZH8A 2FZZA 2ZCLP 2JKHA 4ISIH 1UVSH 4MVNA 1DWBH 4D9RA 1OXGA 2QF0A 1CHOF 1EATA 1YC0A 1GMDG 2FDAA 1J14A 1O3FA 4NWLA 1MKXH 3KHVA 3PLPA 1MTVA 4U01A 4B75A 2AIQA 3A81A 3C1KA 3RC5A 4TYDA 3VGCB 4Y7BA 4E7NA 3SNEA 2PTNA 1XUKA 3GCNA 3VB6A 4NCYA 2BTCE 3VB5A 1NU7B 3VXFH 1V2MT 2ZTXA 2VIPA 1TGNA 3F9GA 3BTEE 4ZHAA 4WMFA 2TPIZ 1GPZA 1S6FA 1LPGB 1OP2A 1ANDA 2ZHDA 3TJOA 1KIGH 1SI5H 4X2YA 5T6DA 4OS5A 4OS7A 2AFQB 2BZAA 1NPMA 4BTIB 1FY5A 2SGPE 3EYDA 2NU4E 3QX5H 5EXNA 1NTPA 2Z9IA 1AE8H 6GCHF 2O8UA 3W95A 3RC6A 1NS3A 1BTYA 1Z7KA 4Z6AH 1V2ST 1EJMA 1T8MA 1A5HA 1QJ6B 4ABHA 5JDUB 1NZQH 2PHBA 1QR3E 3TK9A 4OS6A 1DSUA 1YCPH 3RXTA 1BCUH 1BIOA 1ZJKA 3F9EA 3KL6A 2ODPA 1O3LA 4LOYH 1O3DA 1V2UT 3RM2H 5EW2H 2UUJB 1MTSA 3E6PH 5L6NH 1AY6H 1ZZZA 1DOJA 4JYTA 4A7IB 1LVMA 5IYTA 3GY8A 1P2JA 2BOKA 2LNCA 1GBLA 3RXVA 1L0ZA 3D62A 4NZLA 2PGQB 5DP9A 4DT7B 2ZG0H 2JH0D 1ZTLA 4NA9H 3RMMH 4NZQA 4BAKB 2Z7FE 3OU0A 2XCFA 4YM9A 1GI0A 2ESTE 2XWBI 3MO6A 2ZA5A 3GCTF 3BEFB 4OS2A 3BG4B 2BDHA 4B74A 1YPGH 1JIMA 9LPRA 2V6NA 3QDZB 1ZHPA 1V2JT 2Y80A 3UNRA 1GI2A 2CF8H 2Y82A 1VITH 1ACBE 1SLVB 1GI3A 1NESE 1VJ9U 3T26A 1L1JA 1SLWB 2STBE 1QJ7B 1Y3VA 3KCGH 3TVJB 1FONA 1TQ0B 4YTAA 1MH0A 2BQ6B 5F8TA 4ZKOU 5EQRA 1TNHA 4MPXA 3CS0A 4Y11E 2SNVA 4A5TS 2ZCKP 1BQYA 1THSH 3QLPH 1Q31A 1KXEA 5LH8A 4NIWA 3Q3XA 3Q76A 2BY8X 1ZMLA 2YNAA 1AD8H 2F3CE 2ZU1A 3ZZ3A 3TK5A 4ZHLU 1GVLA 2FOEA 2W3KA 1C1QA 3RXPA 1P09A 2TRMA 1P05A 4U30A 3T25A 4K69A 4FU9A 4ZKSU 2GCTB 3B23B 1OWJA 4UFFH 4UD9H 4ZUHA 3RXCA 1TPPA 3GCTG 4SGBE 2GDDA 1TMTH 1TX6A 2PSYA 1UTJA 4FVDA 1T7CA 1F5LA 3WY8A 4NG9H 1DLEA 2ODQA 1RTLA 2BY5X 1O30A 1B0FA 2YOLA 3P92A 1VGCB 5DG6A 2FTLE 2VB0A 2ANKH 8GCHF 2A4OA 2JETB 2OBQA 5DP3A 4X2WA 4K1TA 2Q6DA 2FI5E 1WQSA 4VGCC 1P8VC 3GY4A 4U2WA 6CHAC 3K2UA 2AEIH 1C5ZB 3EA7A 3RXDA 2BLQA 5JBCS 1PJPA 5T6GA 3CP7A 1Y3XA 2QXIA 1QGFA 1W10U 1LHDH 1O2NA 1KTSB 1C2DA 1LVOA 2D1JA 1ZRBA 4YO9A 2BX4A 2G52A 2GZ7A 2GT8A 1OSSA 1ELDE 2ZWLH 2W7SA 1P02A 3TGIE 2OBOA 2OC7A 2F9PA 3JZ1B 1SGNE 1D6RA 1QRZA 5L2YH 4GLYA 2XBXA 5A0CA 1F7ZA 3OYPA 1O3PB 5C67A 1MAXA 1TLDA 2ZFRH 3UQVA 1HLTH 2FP7B 4ABJA 1BRCE 2V3OH 2WPKS 1T32A 5C3NA 1PQ5A 1P06A 2FOAA 4TY7A 4X8UH 3S0NA 3BSQA 4I8KA 1IQLA 2GCHF 2Z3EA 4O3TA 5E0HA 4INLA 1TE0A 3AVZA 1BDAA 2C3SA 4ABBA 2C8YB 2C90B 2FYRA 1GDNA 1L4ZA 1NC6A 1YM0A 2ZGCA 3TJNA 3A7XA 3SV2H 4RKOB 5HYOA 3HPTB 1DM4B 3MO9A 1N6XA 1GCTB 4CRBA 1O2ZA 4KGAA 1HUTH 1C1SA 2BM2A 1C2KA 1TGSZ 4U32A 1YPKH 2BDBA 1AFQC 1DUEA 4XE4A 1NFUA 1IQFA 1IQHA 2BDGA 3SV7A 4B76A 2FLBH 1BOQA 4Q7YA 1W2KH 4J2YB 2TGTA 2VVCA 1TMBH 4IN1A 1HFDA 5C20A 1BRBE 1AN1E 1O3KA 2R3YA 3T29A 1FY8E 3ATWA 1C5QA 1C2FA 3M5MA 2Y5GA 1NRRH 3DD2H 4BAHB 4MPWA 4D9QA 3GCHB 1TNGA 2XTTB 1CE5A 2TGPZ 4WXVA 5DP6A 4D76A 1QL8A 2SFAA 1K1OA 1N8OB 1SGYE 3TLOA 3F9FA 1CT4E 1EOLA 3RM0H 1ZRKA 2PKAA 3ZVDA 1AFQB 1IQIA 1C2GA 5FBIA 4DY7B 4DCDA 1C5SA 4IN2A 1LVBA 1INCA 3HATH 2BX3A 2I6QA 4PROA 1S83A 3ZV9A 1YF4A 1P57B 1GI1A 4ZXXH 1ARCA 2A45B 1DWDH 2VWNA 1PPHE 1K1MA 2LPRA 1TRNA 4B73A 2VWLA 4Q80A 1A3EH 1GHBF 2TIOA 3F9HA 1Z6JH 3ZZAA 1GJDB 2XNIA 1H1BA 1GBJA 1QRXA 4X2XA 4Q7ZA 1C5RA 1BBRH 4ABIA 3BTGE 4JYVH 1D3QB 1RTFB 1D9IA 2ZGBH 4JZIA 3S9CA 7ESTE 1WV7H 2OCVB 2KAIB 3PV4A 4XBBA 4IS5A 3HGPA 2ZDLA 3SW2B 3A82A 2Z6BD 2VIQA 3BIUH 1KXFA 1KXBA 3RXSA 2GV7A 4BXWA 3CENA 7KMEH 4Y10E 1A1RA 1N6YA 2Z9GA 3TH2H 1TBQH 1EXFA 1N8OC 1GMHG 1O2KA 1YPJH 4CHAC 1BJVA 2J94A 3UOPA 3OTJE 2IJOB 3M7TA 4AGJA 1W13U 2OXSA 3SNBA 4TY6A 2FOHA 1O5DH 3JZ2B 1C1VH 1DITH 3PO1B 1ANEA 3MOCA 3GCOA 3SOSA 2ZHQH 2PLXA 2FXRA 1ESTA 1UVUH 1QHRB 1S81A 2QXGA 2TBSA 3AW1A 3EAJA 2A4RA 2CHAC 1KXDA 5GCHF 2GDEH 1BITA 3SJKA 3LJJA 2RA0A 2AMPA 4K60A 3A7VA 1GI5A 1HV7A 3R3GB 1SGFG 2BQ7B 1QL7A 3GDVA 3UY9A 3FANA 3E0PB 4ZKNU 2BVSH 3VPKA 1DPOA 1DXPA 1O3NA 3LIWA 2ZFFH 2H9EH 2ZU5A 4XSKU 1P2QA 3QTVH 1FY3A 2AMDA 1O2JA 2QYIA 2DE8A 2VWOA 1KSNA 1GVZA 3H7TA 1FIZA 1SGCA 3EDXB 5B6OA 1GHAG 3SUFA 1C4U2 5JPMH 3SV9A 4BTUB 2PUQH 1KLTA 4Y76A 1P9SA 1P11E 3VXEH 4KELA 2A5IA 1MD8A 1ABIH 5HM9A 2CF9H 3NWUA 2ALVA 4DURA 2A5AA 3AAVA 1ARBA 1DFPA 2C8ZB 3BTHE 2ZP0H 1JXPA 1K1NA 2Y5FA 2F9UA 1RXPA 2H5CA 2A31A 1K21H 4MLFB 1Z8JB 1LKBA 1BA8B 3S9BA 1HGTH 3MO3A 1UCYK 3LC3A 2VGCB 2ZQ1A 2R9PA 2UWLA 1LQDB 3BEIB 3OY6U 1SGFA 2XYAA 2GP9B 2BD5A 1BTHH 3VFEA 1GMHF 3MU1A 4B71A 1DE7H 2VIDA 4ABAA 2G51A 2F9NA 1W0ZU 1FI8A 1O3OA 5JB8S 3MFJA 2AERH 2IOTA 1Y5AT 3FP8E 1SB1H 1KLIH 1TONA 2ZHEH 4BAMB 6GCHG 4CH8B 1HXEH 4ZHMU 1UK3A 1O39A 1SGQE 1WAYB 3A86A 3LGWA 2PFEA 4YZUA 1P03A 2XRCA 1F5RA 4UDWH 3U9AH 3CS7A 2VVUA 1NY22 3HKIB 2VIVA 3SNAA 3RXOA 2ZGXH 1TALA 1E35B 2FI3E 5FHTA 1QBNA 1Y5BT 5K7RA 1BJUA 3QK1A 3RXLA 3DA9B 2ZFTA 1OS8A 1LDTT 1YBWA 2G4TA 1Z1JA 3U1IB 4ZXYH 1AZ8A 1O34A 3FFGA 1UTNA 4E7RG 1S0RA 3RP2A 1S82A 1UK2A 3BTWE 2PUXB 2RDLA 1C5VA 1P2NA 1HB0B 4GVUA 2OC8A 1K1LA 2ILNA 2V0BA 3SU2A 3SGBE 1O3EA 3KIDU 4BTTB 3Q3YA 3ATMA 1KXAA 1SGRE 1NRQH 2VIWA 2GZ8A 1LVYA 1AVXA 1DLKB 1LKAA 1TQ7B 3PROA 1Y3WA 3SN8A 4CRGA 1FUJA 1VJAU 2FYQA 3R0FA 1UO6A 4ASHA 2CN0H 3SUEA 3ZZ8A 2H2ZA 1NRPH 1RIWC 2WV5A 1WBGB 3M3VA 4H4FA 2OUAA 1H9HE 2BD2A 3QWCH 3M5NA 3KF2A 1BMLA 1O0DH 3DHKH 1CA0B 3NCLA 3UIRA 2A4GA 3MNXA 4NFEA 1D3TB 4X1SU 1LHGH 1UTPA 2TGDA 2Z9LA 2A32A 4A92A 1O2MA 3MNCA 1HBTH 2WYJA 1A0HB 1DT2A 3TJUA 1G32B 3M7UA 1XVOA 1O2OA 2HVXA 3URDA 1FIWA 1O2WA 1SLXB 1SGPE 1RGQA 4OS4A 3ZZCA 2Z9JA 5JBBS 1UHBB 3BF6H 4NSYA 5CHAB 1M9UA 3SNCA 3ATIA 2CMYA 2O9QA 1C5TA 1ELBA 1EQ9A 1TX8A 3VB3A 1TNJA 2P8OC 1T4UH 2RCEA 2WUCA 2Y5HA 1YPMH 3W94A 1G3EA 5F8ZA 3ODDA 1GHAF 3QGNB 5JBTA 5EXMA 5HMAA 1EZQA 1XUFA 3QZRA 3FAOA 2CJIA 2PW8H 4NIXA 1C1UH 1PPGE 1MU8B 5LPRA 1TGCA 3A7TA 5A8XA 3SGAE 2EI7A 2D26C 5EG4A 3M36A 2VH0A 1YPEH 2ZU3A 1GJCB 1AI8H 3RXEA 1MZDA 1MZAA 3SNDA 1NFXA 1ESAA 5DP4A 1GG6B 4FUEA 1GWAA 3NPSA 1XMNB 1P2KA 3GOVB 2P8OB 4UFGH 3D49H 2P93A 3LGUA 2XCNA 3OX7U 1GGDB 2AGIX 1ETTH 1B5GH 3M5LA 1MCVA 1NO9H 1ETSH 3RU4E 5F6MA 1WTGH 1AB9B 3OSYA 3SZNA 1HRTH 1NM6A 1L1NA 2XWAA 1SOZA 4OS1A 2WPJS 3NZIA 3ZZ5A 1C4V2 4OGYA 4GAWA 1GBDA 1TPOA 2BZ6H 1GHVH 2W26A 4CRFA 1MU6B 1V2NT 3TPIZ 1SHHB 1D4PB 1GBEA 1EPTA 4A1VA 3A8DA 2Y6TA 3RMNH 3GY6A 1LCYA 3PLKA 2B8OH 1TX7A 5GIBA 1JRTA 5TCCA 1GHBG 1VCQA 3EA9A 2ZTYA 1EP5A 1GMCF 3ZVBA 3BTKE 4MG3A 3A85A 2BXTH 2DE9A 4MDSA 1XXFA 2TGAA 1NT1A 5E2PA 3QGJA 3LKWA 2ODYB 2A0QB 4E06H 1HAOH 2OQUA 1CVWH 3LGIA 1P9UA 1C1RA 1GJ9B 1MTNC 1QB1A 1F0RA 3MNBA 3ENSB 2WYGA 4IBLH 5FAHA 1KY9A 1D3PB 3MU0A 3TK6A 4YOIA 1GHXH 4MQAA 1GHZA 1J16A 1EZUC 1OP8A 3MH7A 4HTCH 2FOFA 1ZJDA 2JETC 4J1YA 1NFWA 2CV3A 2QXJA 5C2ZA 2BLOA 3GCHC 2R3UA 1SPJA 1EOJA 4RN6A 2NU0E 1O3BA 4CHAB 3RXKA 1ZPCA 4HZHA 2PR3A 1KYNA 4VGCB 1ZTKA 3RLYH 1SGIB 1T31A 2WPIS 1TGTA 2SGQE 4UFDH 1O5GH 1ZOMA 1C5YB 5CE1A 1TGBA 3BG4C 1J15A 1FNIA 4F4OC 1S0QA 1TOMH 1C5PA 1O37A 2ZHWH 3M35A 5C1UA 1MKWH 3UPEA 1EX3A 3KQBA 1DX5M 2P3FH 1WUNH 5DP7A 3T5FH 2BOHB 1BBRK 3I29A 4FUFA 1FN6A 2FODA 3ESTA 4IC5A 2WUBA 1MTUA 3SHAH 1MTNB 1Z71A 3TGKE 1V2TT 5AHGH 4AN7A 1GI9B 1IQNA 3MHWU 3P8FA 1HIAA 5FPYA 2J34A 4WH8A 3RDZA 3SBKA 3I78A 3SUDA 1O3IA 1Q3XA 3KQEA 4DW2U 1Y59T 1LTOA 1YLDA 1SQTA 3A87A 2P3TB 3BV9B 1DVAH 1GI4A 4ABFA 3A8CA 1OYQA 2ULLA 4H6TA 4XDEA 1BHXB 1CA0C 1C5MD 3ZVCA 4DVAU 1AZZA 1RS0A 3A84A 2D8WA 1O36A 4WXIA 2A2XH 2HNTF 2UUYA 1HAVB 2EEKA 2GGVB 4ISNA 1FAKH 2BVRH 4AOQA 2XC0A 2A4QA 1XUHA 4JZFH 3URCA 3IITA 1YYY1 5DK1A 1F2SE 1G36A 1T8LA 3SQEE 1G3CA 1UVOA 1HAZB 3ZZ4A 1C1WH 1TB6H 5EW1H 5DPAA 1O3MA 4Y71A 1O2RA 1O3GA 2HWLB 1LHEH 1GI8B 3PO1C 2ZDAH 1QB9A 1UCYE 1QURH 3LGTA 3MH6A 1QJ1B 1P2MA 4CRCA 3RXUA 1GBCA 3GISB 1F0SA 1RFNA 4Y0YE 1K1PA 1TNIA 1W7XH 2OQ5A 3T28A 1EPTC 1HAYB 3UWJH 3PWCA 3SJOA 4X1QU 3A8AA 3GY2A 1O33A 3V12A 1FZZA 1VITF 1TBZH 1ELEE 1HCGA 2FWWA 1Y3YA 1WQVH 1A0JA 2XC4A 4DIHH 1MBMA 2H5DA 2SGFE 2W7UA 4I8HA 1T8OA 3D23A 3BTFE 4OGXA 3UTUH 1MMJN 4FUDA 2P94A 1ETRH 1Y8TA 1DY8A 3P70B 4NWKA 1PPCE 1UTOA 2ASUB 2P59A 1QFKH 2HPQH 1CGHA 1AUJA 1RRKA 2GX4A 2R2WU 1EZSC 1UJ1A 1TNKA 1HAVA 1RJXB 5A8ZA 1P3CA 4JK5A 1Z8IB 2ANWA 4FUBA 3A7YA 8LPRA 1PPBH 4I31A 3SU5A 5A0BA 3UFAA 4X1PU 4X6NA 3SQHE 1P12E 3PMJA 1XUGA 3QZQA 3ZYDA 2BMGB 4DJZB 3H5CB 1GDUA 4AB9A 5EPYA 3FVFB 1DY9A 4UE7H 1S85A 2JH6D 4K8YA 5GPIB 1MQ5A 4NIVA 7GCHG 3PMHB 4ABGA 1EJAA 1V2RT 3UQOA 3BG8A 5F8XA 1ZTJA 2O8TA 4ISLA 2A7CA 1GCTC 2IN2A 1VITG 4AZ2B 1ELVA 4B2BA 4XFQA 2OD3B 2QY0B 4JMYA 1FY4A 3PYHA 1CU1A 1ANCA 2XW9A 1V2OT 3LC5A 3DFLA 1BHXF 1CHGA 4DGJA 1SGDE 2ZEBA 1AHTH 1EAIA 1PYTC 3GY3A 2P3UB 1ELGA 3HK3B 3UOUA 4AG1A 1W0YH 1QTFA 3Q00A 1G3BA 1MBQA 2NWNA 4Y79A 5E2OA 3U8OH 5HGGA 3I77A 3KQDA 1QBVH 1TBRH 2C4FH 4TWWA 4UFEH 2ZTZA 1GBTA 2M5TA 2ZI2H 2O8LA 1J9CH 1IHTH 2AGGX 3E8LA 3FP7E 4FUGA 2FOBA 1AU8A 2P16A 1PPEE 2UWOA 3VB4A 4NSVA 2VINA 4ZROA 1S84A 2C93B 3MU4A 5CHAC 2BB4A 4XOJA 4H6SB 1GBFA 3D65E 4INHA 5HM2A 1FLEE 1KDQA 1E37B 5AFZH 1MKXK 1ZMNA 1G9IE 2O8WA 1LO6A 2BY9X 1H8DH 3T27A 1H9LB 1ZR0A 2ZDKA 5A0AE 1SFIA 4TPYA 3UR9A 1SGTA 1IQGA 4MNXA 3LU9B 2BDYA 2OTVA 3M3SA 2QXHA 3K9XB 4FXGH 4YT6H 1O5BB 2A2QH 2ZGJA 1K1IA 2GV6A 5JBAS 2ZFSA 5JB9S 1A4WH 1V3XA 3K6ZA 3RXHA 1AE5A 1IHSH 2SGEE 1VGCC 3KN2A 4GUXA 4IMZA 1BZXE 3RXMA 1HXFH 3TU7H 1TIOA 4HFPB 1P01A 4X1RU 2YNBA 4K5ZA 1ABJH 1JIRA 1RIWB 3A80A 4GPGA 2A7HA 4MNWA 3ZZ6A 1A3BH 3VEQB 3NK8A 2RA3A 1ELCA 1GGDC 2G5VA 1PFXC 2ZFQH 5K0HA 1O2XA 1SR5C 1SL3A 4FUIA 1ZSJA 1IOEA 4Y8XA 4AG2A 4FUJA 3LGYA 2ZDMA 4TPIZ 1GHWH 2ANMH 3TNSA 2R0KA 1C1OA 1GCDA 1JWTA 1O3AA 1O2VA 2R2MB 2ZPSA 1D3DB 1FPHH 5DO4H 5EODA 4Y0ZE 2PV9B 1QIXB 4LXBH 1AKSA 1GVKB 1MUEB 2PWXA 2ZU2A 1G2LA 2EI8A 4Y8ZA 2Q6GA 1ORFA 1CO7E 5H4IB 2Y81A 1FXYA 3BTDE 1A61H 2ZGHA 2ZCHP 3RXBA 1C9TA 3TH4H 3AAUA 1FDPA 3TIUA 2PGBB 4MNYA 2QIQA 1O2TA 3P95A 1QB6A 2ANYA 5LPEA 1TPAE 3SU4A 1HAGE 3RUOA 4INKA 2F9BH 3KNXA 3U8RH 3HK6B 7LPRA 3MNSA 1P0SH 2ZKSA 1XM1A 2AH4X 3QUMP 3M5OA 1GJ8B 2FX4A 3UUZA 8GCHG 1E34B 2ZDVH 3ELAH 2W3IA 3RMOH 4YLUA 5A09A 2VIOA 2XBVA 1HPGA 2ZQ2A 2R0LA 4X8TH 2OC1A 1V2PT 2BY6X 3SU0A 1LPKB 3T2NA 4LK4A 4M7GA 4X8SH 2BHGA 4I8LA 2BD4A 1QNJA 5ETXA 3RXRA 1JMOH 1C2MA 2BLVA 4X6MA 1TA2A 2QCYA 3SORA 1EKBB 1EASA 3PMAB 1S5SA 1TRYA 1E36B 3ZZ7A 1EJNA 2J4IA 1KDQB 1MCTA 1MTWA 7GCHF 3P8NA 4D7FA 3P8OA 5C5NA 3E3TA 4CREA 1O2GH 3IWMA 1YPHE 3RXIA 4B2AA 1O32A 4ESTE 1P3EA 1GJBB 3STIA 4NA7A 2VVVA 1XUJA 1HJAC 2OC0A 1CGJE 4CRDA 1VR1H 2SNWA 4K1EA 1OKXA 5T6FA 2BY7X 1EAUA 2J92A 4XBCA 3ZZBA 3DFJA 4WMDA 3GICB 2B5TB 2GCHG 1TAWA 1O3HA 3EQ0H 4KTUA 4A6LA 1ID5H 4SGAE 5BPEA 1EB2A 1HDTH 4JZEH 1AWHB 1TRMA 4K1SA 5ESBA 2H6MA 3ZVEA 4AFSA 2ZO3H 1C4Y2 3BEUA 1C1PA 2HNTC 4YOJA 2VWMA 5FBEA 2NU2E 2K1QA 3S69A 1C2EA 5EU8A 1GBBA 2XXLA 1CA8B 3ITIA 1JBUH 3NUMA 3KQCA 1BUIA 2BDIA 5ESTE 5I25A 1OP0A 5L30H 2WV4A 2J95A 1QRWA 2AYWA 3L33A 1YCPK 3E90B 3TH3H 1GJ6A 1ELTA 3LJOA 3PB1E 3ATLA 1TYNA 3ZVFA 5FPSA 1HAHH 4NIYA 2AGEX 2J2UA 3ZVGA 4AFZA 5ABWA 4MNVA 3ZZDA 1DICA 2BD9A 3PLBA 4WVPE 1O31A 6LPRA 2FX6A 2F9VA 3SJIA 1CBWB 1U6QA 1AKSB 3A89A 1DWCH 4QT8C 4F49A 1L1GA 2VU8E 1H8IH 4I7YH 2ZIQH 2FI4E 5C1YA 5GXPA 1DDJA 1OPHB 3KEEA 4H42U 1IAUA 3DT0H 1YCPM 4CR5A 3KGPA 1DXWA 1AUTC 2JH5D 3MU8A 4K3JA 5E0GA 1C9PA 2ZZUH 3K6YA 2ZFPH 1TWXB 1O5CB 1O2LA 1AGJA 1P2OA 1AO5A 1LHCH 1W12U 2WPLS 4Z0KA 1O35A 4ISHH 1HAXB 1O5EH 4FUCA 1SGEE 1V2LT 1NROH 3MH4A 4BOHA 1YGCH 1ZGVA 2UUKB 3P6ZB 1YLCA 2C8XB 2O8MA 1PQ7A 1PPFE 3PTBA 5EPNA 2FMJA 4RKJB 3B8JA 3TGJE 1L4DA 4WJG2 3V13A 3DUXH 1BMAA 1K22H 4CH2B 4A1XA 2CHAB 2A5KA 2F83A 1BTPA 2FO9A 2FPZA 1SQOA 1FMGA 1QCPA 3PMBB 3SV6A 1CGIE 1GMDF 2Y7XA 4IMQA 1QA0A 2H9TH 1WYKA 3A8BA 3E1XB 4BXSA 2HPPH 1DANH 2BYAX 8ESTE 1PPZA 5F03A 3RXQA 5FXLA 5G4BA 1HAIH 3PWBA 1A0LA 3LT3A 4GSOA 3FP6E 1MKWK 5T3HA 3A7ZA 3U8TH 1GHYH 1Z8GA 1G2MA 4JYUH 2VNTA 2G00A 1W14U 2BLWA 1SQAA 2HALA 1GJ7B 2V3HH 1BTZA 1TA6A 4JCNA 3F6UH 3LOXA 2CXVA 3O8RA 2FS8A 4Y8YA 5JYIA 1AFEH 3TNTA 1MD7A 3GDUA 5C5OA 1EUFA 1OWIA 2C8WB 1GI7B 1XVMA 1V2QT 2FOCA 2FIRH 3A7WA 1NU9A 3QN7A 1TNLA 4IGDA 4A1TA 1EB1H 1GBAA 2FESH 4FU8A 4KKDA 1C5NH 4WWYA 2PSXA 4X1NU 2H1UA 2FLRH 4DOQA 3SJ9A 5AVDA 1W8BH 2BVXH 1GJ4H 2V35A 3O8DA 2VGCC 1CT0E 2AMQA 3M37A
chains in the Genus database with same CATH superfamily
1JOUB 4Y6DA 3E16B 3FO8D 2ALPA 1F92A 1XX9A 5IDKA 3MMGA 1C5LH 1P2IA 3FZZA 1WU1A 3RLWH 3LONA 1GBMA 3S7HB 1C2IA 1K28D 1PYTD 1A2CH 5EXLA 4XBDA 1CBWC 4I32A 1UTMA 1ESBA 4CR9A 1BRUP 2B9LA 2A1DB 4B2CA 1BMNH 1ZPZA 2GMTC 4AFQA 4BAOB 1LPZB 3MWIU 1D6WA 1OWHA 1LMWB 4Z1MD 2HRVA 1N1LA 1UVTH 4NGAH 2J97A 2QF3A 3E0NB 1E38B 2GTBA 2QGRA 5GCHG 5J4QA 3NKKA 4Y7AA 1THPB 1NN6A 1WCZA 4YESB 2BDAA 2RG3A 2BD3A 1XXDA 4O97A 4M9FA 3LGVA 3U1JB 3SU6A 4GHQA 3QTOH 2PKAB 5FCRA 1C2HA 2W5EA 1YP9A 3ZZ9A 1FV9A 1CHOG 1AVGH 1P04A 3AASA 4O9VA 1EPTB 5DKMA 3EE0B 5AF9H 1Z6EA 5IK2D 1BMFD 3RMLH 2J9NA 4HI3A 2JJ2D 4FU7A 1QQUA 2BDCA 1AMHA 1HJ9A 1HAPH 2OP9A 3SGQE 1GJAB 4XD7D 5FCKA 1THRH 6ESTA 1SOTA 4LZ4B 4DIIH 2ZPRA 3SI4H 1Z1IA 1UMAH 2Z9KA 1T8NA 3M3TA 4IW4E 4MPVA 1OWDA 1IQMA 3BTTE 4WY3A 6CHAB 4JZ1A 5LGOA 1AQ7A 5C1XA 2GMTB 1VZQH 3AW0A 1RD3B 1XKAC 4WH6A 2GT7A 2QV1A 1CSOE 2FOGA 1YKTA 1AVWA 2IPHA 3K65B 2PKSC 1ZSKA 4MTBA 2JJ1D 5I46H 2XOKD 2OINA 2ZU4A 3EA8A 3B9FH 2L74A 1SBWA 1A5GH 2STAE 4ISOA 1F0UA 1F5KU 1PQ8A 3BIVH 1C5WB 1BB0B 1NRSH 4CBNA 1UK4A 1B0EA 2GD4B 5LPFA 2XC5A 2HOBA 3F2GA 4ZMAH 5EQQA 1HIAB 5A2MH 3RXAA 2HNTE 1O2UA 2EA3A 4O3UA 2GCTC 3SZEA 3VGCC 3SHCH 4DG4A 1ZSLA 3UNSA 1GBIA 3F0PA 1O2QA 1A5IA 2ZHFH 3MU5A 3LH3A 1O3CA 3O8BA 2EI6A 4X6PA 3A88A 1E0FD 1ZHRA 1XUIA 1Z8RA 5L2ZH 3ZV8A 1OYTH 4AORA 3EE7A 2PKSB 4KTSA 3LDXH 3V0XA 3FZDA 3ODFA 2G81E 5SGAE 2G4UA 3BN9A 4P00A 4GCHG 2FTMA 3CNRA 4FUHA 4ABEA 4KP0A 2ZC9H 4MPUA 3SI3H 2VJ1A 1Q2WA 1BMMH 1PQAA 4I33A 1EZXC 1O2PA 2FM2A 3E91A 2F9OA 1WTHD 1O38A 9ESTA 2UWPA 1GL1A 1QY6A 2NU1E 2PTCE 3SU1A 3V3MA 2DUCA 2THFB 3UNQA 2AS9A 3A83A 2Q6FA 1C5XB 1GBKA 5EGMA 1GBHA 4CRAA 4UONA 2CGAA 1Y3UA 3PTNA 1C5OH 1V2KT 3RU4D 3DSOA 2W6ID 1ANBA 2ZECA 3F1SB 3ATKA 2GVFA 1HJ8A 3GYMA 1UTQA 3RXFA 1TABE 2Q1JA 1OHHD 4KTCA 4X2VA 2G55A 1OWKA 1SFQB 1FAXA 4AYVB 4CBOA 1UTKA 2WINI 1GJ5H 3BTQE 4RSPA 3ZIAD 2GZ9A 2Z94A 1L2EA 2H9HA 3L6PA 4IC6A 5TCAA 3U98H 2BXUH 1FY1A 4GCHF 2FEQH 1ELAA 1FJSA 1MAYA 1W11U 2QA9E 3RXJA 4Q2KA 5EOKA 3F68H 1O2SA 2SGAA 5CMXH 4YLQH 1XKBC 3SJ8A 1V2VT 5DN6D 3BTME 2WPMS 3SU3A 2ZPQA 2Y7ZA 1A46H 2VH6A 3GYLB 5GJ4B 1SHYA 1QL9A 5BRRE 1QA7A 3UR6A 3UWIA 3O8CA 2NU3E 4UEHH 3MYWA 3C27B 1DSTA 1SC8U 3STJA 2BD7A 1IQEA 1GI6A 3MH5A 4GHTA 3OTPA 1IQJA 1B7XB 1C1MA 2ZNKH 4BANB 2FOMB 4ZKRU 3AK5A 5J4SA 1AWFH 1K2I1 1O2YA 2J38A 2WPHS 2XBWA 4BAQB 1SSXA 1WOFA 2B7DH 1J8AA 3Q77A 1AIXH 1CQQA 4I8JA 2UUFB 3MTYA 5DP8A 4K8BA 4AX9H 1DUAA 1OWEA 5EQSA 1C5UA 1CT2E 1O5FH 2HGTH 4O03A 5DGJA 3ZYEA 2HLCA 3LPRA 4AYYB 1UTLM 4AGKA 5DJ7A 1A7SA 1BTXA 3EGKH 2FS9A 2P95A 3Q3KA 3L3TA 2F91A 1QQ4A 1KLJH 1YPLH 4NA8A 3HGNA 4TWYA 5AFYH 4D8NA 1K0HA 5FX5A 1V6DA 1NFYA 2Z3CA 4FVBA 4X6OA 5PTPA 3RXGA 4YOGA 1ZMJA 1G30B 2QN5T 3S9AA 1O3JA 2EC9H 4Q7XA 1C2JA 3N7OA 3S7KB 1J17T 1TPSA 1K9OE 1ZYOA 1LHFH 1UHBA 2G5NA 2BD8A 2PP6A 5GDSH 2RFKC 1K1JA 1ZGIA 3UREA 5HXFA 1VCWA 4X8VH 1SVPA 2BQWB 4B1TA 3GY7A 1EP6A 5GWZA 1O5AB 3TJVA 2KCYA 2ZDNA 1F0TA 1FPCH 1BRAA 2XBYA 3OY5U 4R8TB 3SYJA 3GY5A 3VB7A 4R0IA 1DWEH 1IQKA 5E0JA 1VCPA 1ZLRA 8KME2 2OLGA 1RTKA 1O2IA 1H4WA 1KXCA 1QBOA 2ZF0H 4AFUA 4ZAEA 1SMFE 1ZHMA 2A7JA 4BNRA 2SGDE 4ABDA 1O2HA 3P8GA 3QO6A 4AB8A 1V2WT 1X7AC 1NRNH 2QAAA 3U69H 1DS2E 5A8YA 4WF8A 3ZVAA 3IG6B 1UCYH 1KTTB 1SLUB 1EAXA 1HJAB 1T4VH 4D7GA 3M61U 4I8GA 4X0WU 4E05H 1W7GH 1TFXA 3MI4A 5E8EH 5DP5A 2B0FA 1HNEE 1WSSH 3SV8A 1GDQA 1YPHC 4WMEA 1HYLA 2AIPA 3RU4T 3P17H 3NXPA 1GG6C 1BTWA 1GMCG 4JZDH 3PM3A 1FN8A 1UVPA 1C1NA 1AB9C 4JK6A 1ZPBA 2YMSB 4RI0A 2G8TA 5FPTA 1BBRE 1G3DA 3SO3A 3V7TA 2KAIA 1GL0E 4K2YA 2QC2A 1BTUA 3G01A 5FX6A 4THNH 4NFFA 1ELFA 3H7OA 3T62A 3TITA 1SG8B 1TOCB 1OOKB 4YT7H 1W3CA 4LZ1H 1MQ6A 2IJD1 2I6SA 1C1TA 1P10A 3M7QA 2Z3DA 1BT7A 1JRSA 4HGCA 1FQ3A 3GDSA 3LH1A 3SUGA 1EAWA 1LQEA 1Y5UT 2KR7A 1TMUH 1OX1A 2D2DA 1G37A 1S6HA 3RC4A 1C2LA 3HKJB 4FOUC 2GKVE 5TJXA 1H9IE 4ZH8A 2FZZA 2ZCLP 2JKHA 4ISIH 1UVSH 4MVNA 1DWBH 4D9RA 1OXGA 2QF0A 1CHOF 1EATA 1YC0A 1GMDG 2FDAA 1J14A 1O3FA 4NWLA 1MKXH 3KHVA 3PLPA 1MTVA 4U01A 4B75A 2AIQA 3A81A 3C1KA 3RC5A 4TYDA 3VGCB 4Y7BA 4E7NA 3SNEA 2PTNA 1XUKA 3GCNA 3VB6A 4NCYA 2BTCE 3VB5A 1NU7B 3VXFH 1V2MT 2ZTXA 2VIPA 1TGNA 3F9GA 3BTEE 4ZHAA 4WMFA 2TPIZ 1GPZA 1S6FA 1LPGB 1OP2A 1ANDA 2ZHDA 3TJOA 1KIGH 1SI5H 4X2YA 5T6DA 4OS5A 4OS7A 2AFQB 2BZAA 1NPMA 4BTIB 1FY5A 2SGPE 3EYDA 2NU4E 3QX5H 5EXNA 1NTPA 2Z9IA 1AE8H 6GCHF 2O8UA 3W95A 3RC6A 1NS3A 1BTYA 1Z7KA 4Z6AH 1V2ST 1EJMA 1T8MA 1A5HA 1QJ6B 4ABHA 5JDUB 1NZQH 2PHBA 1QR3E 3TK9A 4OS6A 1DSUA 1YCPH 3RXTA 1BCUH 1BIOA 2OK5A 1ZJKA 3F9EA 3KL6A 2ODPA 2LP6A 1O3LA 4LOYH 1O3DA 1V2UT 3RM2H 5EW2H 2UUJB 1MTSA 3E6PH 5L6NH 1AY6H 1ZZZA 3DSPA 1DOJA 4JYTA 4A7IB 1LVMA 5IYTA 3GY8A 1P2JA 2BOKA 2LNCA 1GBLA 3RXVA 1L0ZA 3D62A 4NZLA 2PGQB 5DP9A 4DT7B 2ZG0H 2JH0D 1ZTLA 4NA9H 3RMMH 4NZQA 4BAKB 2Z7FE 3OU0A 2XCFA 4YM9A 1GI0A 2ESTE 2XWBI 3MO6A 2ZA5A 3GCTF 3BEFB 4OS2A 3BG4B 2BDHA 4B74A 1YPGH 1JIMA 9LPRA 2V6NA 3QDZB 1ZHPA 1V2JT 2Y80A 3UNRA 1GI2A 2CF8H 2Y82A 1VITH 1ACBE 1SLVB 1GI3A 1NESE 1VJ9U 3T26A 3KQ5A 1L1JA 1SLWB 2STBE 1QJ7B 1Y3VA 3KCGH 3TVJB 1FONA 1TQ0B 4YTAA 1MH0A 2BQ6B 5F8TA 4ZKOU 5EQRA 1TNHA 4MPXA 3CS0A 4Y11E 2SNVA 4A5TS 2KFWA 2ZCKP 1BQYA 1THSH 3QLPH 1Q31A 1KXEA 5LH8A 4NIWA 3Q3XA 3Q76A 2BY8X 1ZMLA 2YNAA 1AD8H 2F3CE 2ZU1A 3ZZ3A 3TK5A 4ZHLU 1GVLA 2FOEA 2W3KA 1C1QA 3RXPA 1P09A 2TRMA 1P05A 4U30A 3T25A 4K69A 4FU9A 4ZKSU 2GCTB 3B23B 1OWJA 4UFFH 4UD9H 4ZUHA 3RXCA 1TPPA 3GCTG 4SGBE 2GDDA 1TMTH 1TX6A 2PSYA 1UTJA 4FVDA 1YWUA 1T7CA 1YLNA 1F5LA 3WY8A 4NG9H 1DLEA 2ODQA 1RTLA 2BY5X 1O30A 1B0FA 2YOLA 3P92A 1VGCB 5DG6A 2FTLE 2K8IA 2VB0A 3DCLA 2ANKH 8GCHF 2A4OA 2JETB 2OBQA 5DP3A 4X2WA 4K1TA 2Q6DA 2FI5E 1WQSA 4VGCC 1P8VC 3GY4A 4U2WA 6CHAC 3K2UA 2AEIH 1C5ZB 3EA7A 3RXDA 2BLQA 5JBCS 1PJPA 5T6GA 3CP7A 1Y3XA 2QF5A 2QXIA 1QGFA 1W10U 1LHDH 1O2NA 1KTSB 1C2DA 1LVOA 2D1JA 1ZRBA 4YO9A 2BX4A 2G52A 2GZ7A 2GT8A 4ACBA 1OSSA 4HG6A 5GNDA 1ELDE 2ZWLH 2W7SA 1P02A 3TGIE 2OBOA 2OC7A 2F9PA 3JZ1B 1SGNE 1D6RA 1QRZA 5L2YH 3OAAD 2XBXA 4GLYA 5A0CA 1F7ZA 3OYPA 1O3PB 5C67A 2KZ4A 1MAXA 1TLDA 2ZFRH 3UQVA 3NRLA 1HLTH 2FP7B 4ABJA 1BRCE 4OM9A 2V3OH 2WPKS 1T32A 5C3NA 1PQ5A 1P06A 2FOAA 4TY7A 4X8UH 3S0NA 3BSQA 4I8KA 1IQLA 2GCHF 2Z3EA 4O3TA 5E0HA 4INLA 1TE0A 4YXWD 4I86A 3AVZA 1BDAA 2C3SA 4ABBA 2C8YB 2C90B 2FYRA 1GDNA 1L4ZA 1NC6A 1YM0A 2ZGCA 3TJNA 3A7XA 3SV2H 4RKOB 5HYOA 3HPTB 1DM4B 3MO9A 1N6XA 1GCTB 4CRBA 1O2ZA 3U28C 4KGAA 1HUTH 4ZCNA 1C1SA 2BM2A 2XNDD 5C94A 1C2KA 1TGSZ 3KYFA 4U32A 1YPKH 2BDBA 1AFQC 1DUEA 4XE4A 1NFUA 3PV2A 1IQFA 1IQHA 2BDGA 3SV7A 4B76A 2FLBH 1BOQA 4Q7YA 1W2KH 4J2YB 2TGTA 2VVCA 1TMBH 4IN1A 1HFDA 4TT3D 1BRBE 5C20A 1AN1E 1O3KA 2R3YA 3T29A 1FY8E 3ATWA 1C5QA 1C2FA 3M5MA 2Y5GA 1NRRH 3DD2H 2QF4A 4BAHB 4MPWA 4D9QA 3GCHB 1TNGA 2XTTB 1CE5A 2TGPZ 4WXVA 5DP6A 4B6EA 4D76A 1QL8A 2SFAA 1K1OA 1N8OB 1SGYE 3TLOA 3F9FA 1CT4E 1EOLA 3RM0H 1ZRKA 2PKAA 3ZVDA 1AFQB 1IQIA 1C2GA 5FBIA 3PRDA 4DY7B 4DCDA 1C5SA 2KCAA 4IN2A 1LVBA 1INCA 3HATH 2BX3A 2I6QA 4PROA 1S83A 3ZV9A 1YF4A 5F53A 1P57B 1GI1A 4ZXXH 1ARCA 2A45B 2CK3D 1DWDH 2VWNA 1PPHE 1K1MA 2LPRA 1TRNA 4B73A 2VWLA 4Q80A 1A3EH 1GHBF 2TIOA 3F9HA 1Z6JH 3ZZAA 1GJDB 2XNIA 1H1BA 1GBJA 1QRXA 4X2XA 4Q7ZA 1C5RA 1BBRH 4ABIA 3BTGE 3OEHD 4JYVH 1D3QB 1RTFB 1D9IA 2ZGBH 4JZIA 3S9CA 7ESTE 1VKYA 1WV7H 2OCVB 5EJLA 2KAIB 3PRBA 4AC9A 3PV4A 4XBBA 4IS5A 3HGPA 2ZDLA 3SW2B 3A82A 2Z6BD 5HKKD 2VIQA 3BIUH 1KXFA 1KXBA 3RXSA 2GV7A 4BXWA 3CENA 7KMEH 4Y10E 1A1RA 1N6YA 2Z9GA 3TH2H 1TBQH 1EXFA 1N8OC 1QZ8A 1GMHG 1O2KA 1YPJH 4CHAC 1BJVA 2J94A 3UOPA 3OTJE 2IJOB 3M7TA 4AGJA 1W13U 2OXSA 3MQKC 3SNBA 4TY6A 2FOHA 1O5DH 3JZ2B 1C1VH 1DITH 3PO1B 2KCOA 5C17A 1ANEA 3MOCA 3GCOA 3SOSA 2ZHQH 2PLXA 2FXRA 1ESTA 1UVUH 1QHRB 1S81A 2QXGA 2TBSA 3AW1A 3EAJA 2A4RA 2CHAC 1KXDA 5GCHF 2GDEH 1BITA 3SJKA 3LJJA 2RA0A 2AMPA 4K60A 3A7VA 1GI5A 1HV7A 3R3GB 1SGFG 2BQ7B 1QL7A 3GDVA 3UY9A 3FANA 3E0PB 4ZKNU 2BVSH 3VPKA 1DPOA 1DXPA 1O3NA 3LIWA 2ZFFH 2H9EH 2ZU5A 4XSKU 1P2QA 3QTVH 1FY3A 2AMDA 1O2JA 2QYIA 2DE8A 2VWOA 1KSNA 1GVZA 1S6LA 3H7TA 1FIZA 1SGCA 3EDXB 5B6OA 1GHAG 3SUFA 1C4U2 5JPMH 3SV9A 4BTUB 2PUQH 1KLTA 4Y76A 2JIZD 1P9SA 1P11E 3VXEH 4KELA 2A5IA 3FOAA 1MD8A 1ABIH 5HM9A 2CF9H 3NWUA 2ALVA 4DURA 2A5AA 3AAVA 1ARBA 1DFPA 2C8ZB 3BTHE 2ZP0H 1JXPA 1K1NA 2Y5FA 2F9UA 1RXPA 2H5CA 2A31A 1K21H 4MLFB 1Z8JB 1LKBA 1BA8B 3S9BA 1HGTH 3MO3A 1UCYK 5C0TA 3LC3A 2VGCB 2ZQ1A 2R9PA 2UWLA 1LQDB 4RT1A 3BEIB 3OY6U 1SGFA 2XYAA 2GP9B 2BD5A 1BTHH 3VFEA 1GMHF 3MU1A 4DT4A 4B71A 1DE7H 2VIDA 4ABAA 2G51A 1WDIA 2F9NA 1W0ZU 1FI8A 1O3OA 5JB8S 3MFJA 2AERH 2IOTA 1Y5AT 3FP8E 1UW7A 1SB1H 1KLIH 1TONA 2ZHEH 4BAMB 6GCHG 2WSSD 1W0KD 4CH8B 1HXEH 4ZHMU 1UK3A 1O39A 1SGQE 1WAYB 2WPDD 3A86A 3LGWA 2PFEA 5KGOA 4YZUA 1P03A 2XRCA 1F5RA 4UDWH 3U9AH 3CS7A 2VVUA 3WW7A 1NY22 3HKIB 2VIVA 3SNAA 3RXOA 2ZGXH 1TALA 1COWD 1E35B 2FI3E 5FHTA 1QBNA 1Y5BT 5K7RA 1BJUA 3QK1A 3RXLA 3DA9B 2ZFTA 1OS8A 1LDTT 1YBWA 2G4TA 1Z1JA 3UB0A 3U1IB 5KEDA 4ZXYH 1AZ8A 1O34A 3FFGA 1UTNA 4E7RG 1S0RA 3RP2A 1S82A 1UK2A 3BTWE 2PUXB 2RDLA 1C5VA 1P2NA 1HB0B 4GVUA 2OC8A 1K1LA 2ILNA 2V0BA 3SU2A 3SGBE 1O3EA 3KIDU 4BTTB 3Q3YA 3ATMA 1KXAA 2V3MA 1SGRE 1NRQH 2VIWA 2GZ8A 1LVYA 1AVXA 1DLKB 1LKAA 1TQ7B 3PROA 1Y3WA 3SN8A 4CRGA 1MABB 1FUJA 1VJAU 2FYQA 3R0FA 1UO6A 4ASHA 2CN0H 3SUEA 3ZZ8A 2H2ZA 1NRPH 1RIWC 2WV5A 1NBMD 1WBGB 1YY3A 3M3VA 4H4FA 2OUAA 2W6JD 1H9HE 2BD2A 3QWCH 3M5NA 3KF2A 1BMLA 1O0DH 3DHKH 1CA0B 3NCLA 3UIRA 2A4GA 3MNXA 4NFEA 5DSFA 1D3TB 4X1SU 1LHGH 1UTPA 2TGDA 2Z9LA 2A32A 4A92A 1O2MA 3MNCA 1HBTH 2WYJA 1A0HB 1DT2A 3TJUA 1G32B 3M7UA 1XVOA 1O2OA 2HVXA 3URDA 1FIWA 1O2WA 1SLXB 1SGPE 1RGQA 4OS4A 5HIYA 3ZZCA 2Z9JA 5JBBS 1UHBB 3BF6H 4NSYA 2QE7D 1M9UA 5CHAB 3SNCA 3ATIA 2CMYA 2O9QA 1C5TA 1ELBA 1EQ9A 1TX8A 3VB3A 1TNJA 2KX4A 2P8OC 1T4UH 2RCEA 2WUCA 2Y5HA 1YPMH 3W94A 1G3EA 5F8ZA 5FL7D 3ODDA 3H09A 3OEED 1GHAF 3QGNB 5JBTA 5EXMA 5HMAA 1EZQA 1XUFA 3QZRA 3FAOA 2CJIA 2PW8H 4NIXA 1C1UH 1PPGE 1MU8B 5LPRA 1TGCA 3A7TA 5A8XA 3SGAE 2EI7A 2D26C 1NBME 5EG4A 3M36A 2VH0A 1YPEH 2ZU3A 1GJCB 1AI8H 3RXEA 1MZDA 1MZAA 3SNDA 1NFXA 1ESAA 5DP4A 3F2FA 1GG6B 4FUEA 1GWAA 3NPSA 1XMNB 1P2KA 3GOVB 2P8OB 4UFGH 3D49H 2P93A 3LGUA 2XCNA 3OX7U 1GGDB 2AGIX 1ETTH 1B5GH 3M5LA 1MCVA 1NO9H 1ETSH 3RU4E 5F6MA 1WTGH 1AB9B 3OSYA 3SZNA 1HRTH 1NM6A 1L1NA 1SOZA 2XWAA 4OS1A 2WPJS 3NZIA 3ZZ5A 1C4V2 4OGYA 2HVYB 4GAWA 1GBDA 1TPOA 2BZ6H 1GHVH 2W26A 4CRFA 1MU6B 1V2NT 3TPIZ 1SHHB 1D4PB 1GBEA 1EPTA 4A1VA 3A8DA 2Y6TA 3RMNH 3GY6A 1LCYA 4B6FA 3PLKA 2B8OH 1TX7A 5GIBA 1JRTA 5TCCA 1GHBG 1VCQA 3EA9A 2ZTYA 1EP5A 1GMCF 3ZVBA 3BTKE 4MG3A 3A85A 2BXTH 2DE9A 4MDSA 1XXFA 2TGAA 1NT1A 5E2PA 3QGJA 3LKWA 2ODYB 2A0QB 4E06H 1HAOH 2OQUA 1CVWH 3LGIA 3WWBA 1P9UA 1C1RA 1GJ9B 1MTNC 1QB1A 1F0RA 3MNBA 3ENSB 2WYGA 4IBLH 5FAHA 1KY9A 1D3PB 3MU0A 3TK6A 4YOIA 1GHXH 4MQAA 1GHZA 1J16A 1EZUC 1OP8A 3MH7A 1SKYE 4HTCH 2FOFA 1ZJDA 2JETC 4J1YA 1NFWA 2CV3A 2QXJA 5C2ZA 2BLOA 3GCHC 2R3UA 4F48B 1SPJA 1EOJA 4RN6A 2NU0E 1O3BA 4CHAB 3RXKA 1ZPCA 4HZHA 2PR3A 2AHME 1KYNA 4VGCB 1ZTKA 3RLYH 1SGIB 1T31A 2WPIS 3F2HA 1TGTA 2SGQE 4UFDH 1O5GH 1ZOMA 4ASUD 1C5YB 5CE1A 1TGBA 3BG4C 1J15A 1FNIA 4F4OC 1S0QA 1TOMH 2YMSD 1C5PA 1O37A 2ZHWH 3M35A 5C1UA 1MKWH 5B6LA 3UPEA 2VBCA 1EX3A 3KQBA 1DX5M 2P3FH 3DSGA 1WUNH 5DP7A 3T5FH 2BOHB 1BBRK 3I29A 4FUFA 1FN6A 2FODA 3ESTA 4IC5A 2WUBA 1MTUA 3SHAH 1MTNB 1Z71A 5HIZA 1V2TT 3TGKE 5AHGH 4AN7A 1GI9B 1IQNA 3MHWU 3P8FA 1HIAA 5FPYA 2J34A 4WH8A 3RDZA 3SBKA 3I78A 3SUDA 1O3IA 1Q3XA 5KECA 3KQEA 4DW2U 1EFRD 1Y59T 1LTOA 1YLDA 1SQTA 3A87A 3GS9A 2P3TB 3VG8A 3BV9B 1DVAH 1GI4A 4ABFA 3A8CA 1OYQA 2ULLA 4H6TA 4XDEA 1BHXB 1CA0C 1C5MD 3ZVCA 4DVAU 1AZZA 1RS0A 3A84A 2D8WA 1O36A 4WXIA 2A2XH 2HNTF 2UUYA 1HAVB 2EEKA 2GGVB 4ISNA 1FAKH 2BVRH 4AOQA 2XC0A 2A4QA 1XUHA 4JZFH 3URCA 3WWFA 3IITA 1YYY1 5DK1A 1F2SE 1G36A 1T8LA 3SQEE 1G3CA 1UVOA 2KCPA 3PV5A 1HAZB 3ZZ4A 1C1WH 1TB6H 5EW1H 5DPAA 1O3MA 4Y71A 1O2RA 1O3GA 2HWLB 1LHEH 1GI8B 3PO1C 2ZDAH 1QB9A 1UCYE 1QURH 3LGTA 3MH6A 4XRNA 1QJ1B 4TSFD 2YMSC 1P2MA 4CRCA 3RXUA 1GBCA 3GISB 1F0SA 1RFNA 4Y0YE 1K1PA 1TNIA 1W7XH 2OQ5A 3T28A 1EPTC 1HAYB 3UWJH 3PWCA 3SJOA 4X1QU 3A8AA 3GY2A 1O33A 3V12A 1FZZA 1VITF 1TBZH 1ELEE 1HCGA 2FWWA 1Y3YA 1WQVH 1A0JA 3F0OA 2XC4A 3OE7D 4DIHH 1MBMA 2H5DA 2SGFE 2W7UA 4I8HA 1T8OA 3D23A 3BTFE 4OGXA 3UTUH 1MMJN 2J5UA 4FUDA 2P94A 1ETRH 1Y8TA 1DY8A 3P70B 4NWKA 1PPCE 1UTOA 2ASUB 2P59A 1QFKH 2HPQH 2V7QD 1CGHA 5CDFE 1AUJA 1RRKA 2GX4A 2R2WU 1EZSC 1UJ1A 1TNKA 1HAVA 1RJXB 5A8ZA 1P3CA 4JK5A 1Z8IB 2ANWA 4FUBA 3A7YA 8LPRA 1PPBH 4I31A 3SU5A 5A0BA 3UFAA 4X1PU 4X6NA 3SQHE 1P12E 3PMJA 1XUGA 3QZQA 3ZYDA 2IPQX 2BMGB 4DJZB 3H5CB 1GDUA 4AB9A 5EPYA 3FVFB 1DY9A 3N99A 4UE7H 1S85A 2JH6D 4K8YA 5GPIB 1MQ5A 2K0QA 4NIVA 7GCHG 3PMHB 4ABGA 1EJAA 1V2RT 3UQOA 3BG8A 5F8XA 1ZTJA 2O8TA 4ISLA 2A7CA 1GCTC 2IN2A 1VITG 4AZ2B 1ELVA 4B2BA 4XFQA 2OD3B 2QY0B 1H8HD 4JMYA 1FY4A 3PYHA 1CU1A 1ANCA 2XW9A 1V2OT 3LC5A 4F55A 3DFLA 1BHXF 1CHGA 4DGJA 1SGDE 1W0JD 2ZEBA 1AHTH 1EAIA 1PYTC 3GY3A 2P3UB 1ELGA 4FETA 3HK3B 3UOUA 4AG1A 1W0YH 1QTFA 3Q00A 1G3BA 1SQRA 1MBQA 2NWNA 4Y79A 5E2OA 3U8OH 5HGGA 3I77A 3KQDA 1QBVH 1TBRH 2C4FH 4TWWA 4UFEH 2ZTZA 2EY4C 1GBTA 2M5TA 2ZI2H 2O8LA 1J9CH 1IHTH 2AGGX 3E8LA 3FP7E 4FUGA 2FOBA 1AU8A 2P16A 1PPEE 2UWOA 3VB4A 4NSVA 2VINA 4ZROA 1S84A 2C93B 3MU4A 5CHAC 2BB4A 4XOJA 4H6SB 1GBFA 3D65E 4INHA 5HM2A 1FLEE 1KDQA 1E37B 5AFZH 1MKXK 1ZMNA 1G9IE 2O8WA 1LO6A 2BY9X 1H8DH 3T27A 5C0UA 1H9LB 1ZR0A 2ZDKA 5A0AE 1SFIA 4TPYA 3UR9A 3F3BA 1SGTA 1IQGA 4MNXA 3LU9B 2BDYA 2WV9A 2OTVA 3M3SA 2QXHA 3K9XB 4FXGH 3UAIC 4YT6H 1O5BB 2A2QH 2ZGJA 1K1IA 2GV6A 5JBAS 2ZFSA 5JB9S 1A4WH 1V3XA 3W1EA 3K6ZA 3RXHA 1AE5A 1IHSH 2SGEE 1VGCC 3KN2A 4GUXA 4IMZA 1BZXE 3RXMA 1HXFH 3TU7H 1TIOA 2J98B 4HFPB 1P01A 4X1RU 2YNBA 4K5ZA 1ABJH 1JIRA 1RIWB 2WZQA 3A80A 4GPGA 2A7HA 4MNWA 3ZZ6A 1A3BH 3VEQB 3NK8A 2RA3A 1ELCA 1GGDC 2G5VA 1PFXC 2ZFQH 5K0HA 1O2XA 1SR5C 1SL3A 4FUIA 1ZSJA 1IOEA 4Y8XA 4AG2A 4FUJA 3LGYA 2ZDMA 4TPIZ 1GHWH 2ANMH 3TNSA 2R0KA 3FN8A 1C1OA 1GCDA 1JWTA 1O3AA 1O2VA 2R2MB 2ZPSA 1D3DB 1FPHH 5DO4H 5EODA 4Y0ZE 2PV9B 1QIXB 4LXBH 1AKSA 1GVKB 1MUEB 2PWXA 2ZU2A 1G2LA 2EI8A 4Y8ZA 2Q6GA 1ORFA 1CO7E 5H4IB 2Y81A 1FXYA 3BTDE 1A61H 2ZGHA 2ZCHP 3RXBA 1C9TA 3TH4H 2RDEA 3AAUA 1FDPA 3TIUA 1H8ED 2PGBB 4MNYA 2QIQA 1KMHB 1O2TA 3P95A 1QB6A 2ANYA 5LPEA 1TPAE 3SU4A 1HAGE 3RUOA 4INKA 2F9BH 3KNXA 3U8RH 1E1RD 3HK6B 7LPRA 3MNSA 1P0SH 2ZKSA 1XM1A 2AH4X 3QUMP 3M5OA 1GJ8B 2FX4A 3UUZA 8GCHG 1E34B 2ZDVH 3ELAH 2W3IA 3RMOH 4YLUA 5A09A 2VIOA 2XBVA 1HPGA 2ZQ2A 2R0LA 4X8TH 2OC1A 1V2PT 2BY6X 3SU0A 1LPKB 3T2NA 2F4LA 4Q4LA 4LK4A 4M7GA 4X8SH 2BHGA 4I8LA 2BD4A 1QNJA 5ETXA 3RXRA 1JMOH 1C2MA 2BLVA 2J98A 4X6MA 1TA2A 2QCYA 3SORA 1EKBB 1EASA 1E1QD 3PMAB 5EIYA 1S5SA 2GJGA 1TRYA 1E36B 3ZZ7A 1EJNA 2J4IA 1KDQB 1MCTA 2WHXA 1MTWA 3N7EA 7GCHF 2L6OA 3P8NA 4D7FA 3P8OA 1WXRA 5C5NA 3E3TA 4CREA 1O2GH 3IWMA 1YPHE 3RXIA 4B2AA 1O32A 4ESTE 3FKSD 1P3EA 1GJBB 3STIA 5CHBA 4NA7A 2VVVA 1XUJA 1HJAC 2OC0A 1CGJE 4CRDA 2KM0A 1VR1H 2SNWA 4K1EA 1OKXA 5T1VA 5T6FA 2BY7X 1EAUA 2J92A 4XBCA 3ZZBA 3DFJA 4WMDA 3GICB 2B5TB 2GCHG 2EQNA 1TAWA 1O3HA 3EQ0H 4KTUA 4A6LA 1ID5H 4SGAE 5BPEA 1EB2A 1HDTH 4JZEH 1AWHB 1TRMA 4K1SA 5ESBA 2H6MA 3ZVEA 4AFSA 4ACAA 2ZO3H 1C4Y2 3BEUA 1C1PA 2HNTC 4YOJA 2VWMA 5FBEA 2NU2E 2K1QA 3S69A 1C2EA 5EU8A 1GBBA 2XXLA 1CA8B 3ITIA 1JBUH 3NUMA 3KQCA 1BUIA 2BDIA 5ESTE 5I25A 1OP0A 5L30H 2WV4A 2J95A 1QRWA 2AYWA 3L33A 1YCPK 3E90B 3TH3H 4RT0A 1GJ6A 1ELTA 3LJOA 3PB1E 3ATLA 1TYNA 3ZVFA 5FPSA 1HAHH 4NIYA 3OFND 2AGEX 2J2UA 3ZVGA 4AFZA 5ABWA 4MNVA 3ZZDA 1DICA 2BD9A 3PLBA 4WVPE 1O31A 6LPRA 5EJ1A 2FX6A 2F9VA 4Q63A 3SJIA 1CBWB 1U6QA 1AKSB 3A89A 1DWCH 4QT8C 2HLDD 4F49A 1L1GA 2VU8E 1H8IH 2M2AA 4I7YH 2ZIQH 2FI4E 5C1YA 5GXPA 1DDJA 1OPHB 3KEEA 4H42U 1IAUA 3DT0H 1YCPM 4CR5A 3KGPA 1DXWA 1AUTC 2JH5D 3MU8A 4K3JA 5E0GA 1C9PA 2ZZUH 3K6YA 2ZFPH 1E79D 1TWXB 1O5CB 1O2LA 1AGJA 1P2OA 1AO5A 1LHCH 1W12U 2WPLS 4Z0KA 1O35A 4ISHH 1HAXB 1O5EH 4FUCA 1SGEE 1V2LT 1NROH 3MH4A 4BOHA 1YGCH 1ZGVA 2UUKB 3P6ZB 1YLCA 2C8XB 2O8MA 1PQ7A 1PPFE 3PTBA 5EPNA 2FMJA 4RKJB 3B8JA 3TGJE 1L4DA 4WJG2 3V13A 3DUXH 1BMAA 1K22H 4CH2B 4A1XA 2CHAB 2A5KA 2F83A 1BTPA 2FO9A 2FPZA 1SQOA 1FMGA 1QCPA 3PMBB 3SV6A 1CGIE 1GMDF 2Y7XA 4IMQA 1QA0A 2H9TH 3N7DA 1WYKA 3A8BA 3E1XB 4BXSA 2HPPH 1DANH 2BYAX 8ESTE 1PPZA 5F03A 3RXQA 5FXLA 5G4BA 1HAIH 3PWBA 1A0LA 3LT3A 4GSOA 3FP6E 1MKWK 5T3HA 3A7ZA 3U8TH 1GHYH 1Z8GA 1G2MA 4JYUH 2VNTA 2G00A 1W14U 2BLWA 4P02A 1SQAA 2HALA 1GJ7B 1BTZA 2V3HH 1TA6A 4JCNA 3F6UH 3LOXA 2CXVA 3O8RA 2FS8A 4Y8YA 5JYIA 1AFEH 3TNTA 1MD7A 3GDUA 5C5OA 1EUFA 1OWIA 2C8WB 1GI7B 1XVMA 1V2QT 2FOCA 2FIRH 3A7WA 1NU9A 5EJZA 1FX0B 3QN7A 1TNLA 4IGDA 4A1TA 1EB1H 1GBAA 2FESH 4FU8A 4KKDA 1C5NH 4WWYA 2PSXA 4X1NU 2H1UA 2F43B 2FLRH 4DOQA 3SJ9A 5AVDA 1W8BH 2BVXH 1GJ4H 2V35A 2JDID 3O8DA 2LELA 2VGCC 1CT0E 2AMQA 3M37A 3KYGA
chains in the Genus database with same CATH topology
1JOUB 4Y6DA 3E16B 2ALPA 1F92A 1XX9A 5IDKA 3MMGA 1C5LH 1P2IA 3FZZA 1WU1A 3RLWH 3LONA 1GBMA 3S7HB 1C2IA 1K28D 1PYTD 1A2CH 5EXLA 4XBDA 1CBWC 4I32A 1UTMA 1ESBA 4CR9A 1BRUP 2B9LA 2A1DB 4B2CA 1BMNH 1ZPZA 2GMTC 4AFQA 4BAOB 1LPZB 3MWIU 1D6WA 1OWHA 1LMWB 2HRVA 1N1LA 1UVTH 4NGAH 2QF3A 3E0NB 1E38B 2GTBA 2QGRA 5GCHG 5J4QA 3NKKA 4Y7AA 1THPB 1NN6A 1WCZA 4YESB 2BDAA 2RG3A 2BD3A 1XXDA 4O97A 3LGVA 3U1JB 3SU6A 4GHQA 3QTOH 2PKAB 5FCRA 1C2HA 2W5EA 1YP9A 3ZZ9A 1FV9A 1CHOG 1AVGH 1P04A 3AASA 4O9VA 1EPTB 5DKMA 3EE0B 5AF9H 1Z6EA 3RMLH 2J9NA 4HI3A 4FU7A 1QQUA 2BDCA 1AMHA 1HJ9A 1HAPH 2OP9A 3SGQE 1GJAB 5FCKA 1THRH 6ESTA 1SOTA 4LZ4B 4DIIH 2ZPRA 3SI4H 1Z1IA 1UMAH 2Z9KA 1T8NA 3M3TA 4IW4E 4MPVA 1OWDA 1IQMA 3BTTE 4WY3A 6CHAB 4JZ1A 5LGOA 1AQ7A 5C1XA 2GMTB 1VZQH 3AW0A 1RD3B 1XKAC 4WH6A 2GT7A 2QV1A 1CSOE 2FOGA 1YKTA 1AVWA 2IPHA 3K65B 2PKSC 1ZSKA 4MTBA 5I46H 2OINA 2ZU4A 3EA8A 3B9FH 1SBWA 1A5GH 2STAE 4ISOA 1F0UA 1F5KU 1PQ8A 3BIVH 1C5WB 1BB0B 1NRSH 4CBNA 1UK4A 1B0EA 2GD4B 5LPFA 2XC5A 2HOBA 4ZMAH 5EQQA 1HIAB 5A2MH 3RXAA 2HNTE 1O2UA 2EA3A 4O3UA 2GCTC 3VGCC 3SHCH 4DG4A 1ZSLA 3UNSA 1GBIA 1O2QA 1A5IA 2ZHFH 3MU5A 3LH3A 1O3CA 3O8BA 2EI6A 4X6PA 3A88A 1E0FD 1ZHRA 1XUIA 1Z8RA 5L2ZH 3ZV8A 1OYTH 4AORA 2PKSB 4KTSA 3LDXH 3V0XA 3FZDA 3ODFA 2G81E 5SGAE 2G4UA 3BN9A 4GCHG 2FTMA 4FUHA 4ABEA 4KP0A 2ZC9H 4MPUA 3SI3H 2VJ1A 1Q2WA 1BMMH 1PQAA 4I33A 1EZXC 1O2PA 2FM2A 3E91A 2F9OA 1WTHD 1O38A 9ESTA 2UWPA 1GL1A 1QY6A 2NU1E 2PTCE 3SU1A 3V3MA 2DUCA 2THFB 3UNQA 2AS9A 3A83A 2Q6FA 1C5XB 1GBKA 5EGMA 1GBHA 4CRAA 4UONA 2CGAA 1Y3UA 3PTNA 1C5OH 1V2KT 3RU4D 1ANBA 2ZECA 3F1SB 3ATKA 2GVFA 1HJ8A 3GYMA 1UTQA 3RXFA 1TABE 2Q1JA 4KTCA 4X2VA 2G55A 1OWKA 1SFQB 1FAXA 4AYVB 4CBOA 1UTKA 2WINI 1GJ5H 3BTQE 4RSPA 2GZ9A 2Z94A 1L2EA 2H9HA 3L6PA 4IC6A 5TCAA 3U98H 2BXUH 1FY1A 4GCHF 2FEQH 1ELAA 1FJSA 1MAYA 1W11U 2QA9E 3RXJA 4Q2KA 5EOKA 3F68H 1O2SA 2SGAA 5CMXH 4YLQH 1XKBC 3SJ8A 1V2VT 3BTME 2WPMS 3SU3A 2ZPQA 2Y7ZA 1A46H 2VH6A 3GYLB 5GJ4B 1SHYA 1QL9A 5BRRE 1QA7A 3UR6A 3UWIA 3O8CA 2NU3E 4UEHH 3MYWA 3C27B 1DSTA 1SC8U 3STJA 2BD7A 1IQEA 1GI6A 3MH5A 4GHTA 1IQJA 1B7XB 1C1MA 2ZNKH 4BANB 2FOMB 4ZKRU 5J4SA 1AWFH 1K2I1 1O2YA 2J38A 2WPHS 2XBWA 4BAQB 1SSXA 1WOFA 2B7DH 1J8AA 3Q77A 1AIXH 1CQQA 4I8JA 2UUFB 3MTYA 5DP8A 4K8BA 4AX9H 1DUAA 1OWEA 5EQSA 1C5UA 1CT2E 1O5FH 2HGTH 4O03A 5DGJA 3ZYEA 2HLCA 3LPRA 4AYYB 1UTLM 4AGKA 5DJ7A 1A7SA 1BTXA 3EGKH 2FS9A 2P95A 3Q3KA 3L3TA 2F91A 1QQ4A 1KLJH 1YPLH 4NA8A 3HGNA 4TWYA 5AFYH 4D8NA 5FX5A 1V6DA 1NFYA 2Z3CA 4FVBA 4X6OA 5PTPA 3RXGA 4YOGA 1ZMJA 1G30B 2QN5T 3S9AA 1O3JA 2EC9H 4Q7XA 1C2JA 3N7OA 3S7KB 1J17T 1TPSA 1K9OE 1ZYOA 1LHFH 1UHBA 2G5NA 2BD8A 5GDSH 1K1JA 1ZGIA 3UREA 5HXFA 1VCWA 4X8VH 1SVPA 2BQWB 4B1TA 3GY7A 1EP6A 5GWZA 1O5AB 3TJVA 2ZDNA 1F0TA 1FPCH 1BRAA 2XBYA 3OY5U 4R8TB 3GY5A 3VB7A 4R0IA 1DWEH 1IQKA 5E0JA 1VCPA 1ZLRA 8KME2 2OLGA 1RTKA 1O2IA 1H4WA 1KXCA 1QBOA 2ZF0H 4AFUA 4ZAEA 1SMFE 1ZHMA 2A7JA 4BNRA 2SGDE 4ABDA 1O2HA 3P8GA 3QO6A 4AB8A 1V2WT 1X7AC 1NRNH 2QAAA 3U69H 1DS2E 5A8YA 4WF8A 3ZVAA 3IG6B 1UCYH 1KTTB 1SLUB 1EAXA 1HJAB 1T4VH 4D7GA 3M61U 4I8GA 4X0WU 4E05H 1W7GH 1TFXA 3MI4A 5E8EH 5DP5A 2B0FA 1HNEE 1WSSH 3SV8A 1GDQA 1YPHC 4WMEA 1HYLA 2AIPA 3RU4T 3P17H 3NXPA 1GG6C 1BTWA 1GMCG 4JZDH 3PM3A 1FN8A 1UVPA 1C1NA 1AB9C 4JK6A 1ZPBA 2G8TA 5FPTA 1BBRE 1G3DA 3SO3A 3V7TA 2KAIA 1GL0E 4K2YA 2QC2A 1BTUA 3G01A 5FX6A 4THNH 4NFFA 1ELFA 3H7OA 3T62A 3TITA 1SG8B 1TOCB 1OOKB 4YT7H 1W3CA 4LZ1H 1MQ6A 2I6SA 1C1TA 1P10A 3M7QA 2Z3DA 1BT7A 1JRSA 4HGCA 1FQ3A 3GDSA 3LH1A 3SUGA 1EAWA 1LQEA 1Y5UT 1TMUH 1OX1A 2D2DA 1G37A 1S6HA 3RC4A 1C2LA 3HKJB 2GKVE 5TJXA 1H9IE 4ZH8A 2FZZA 2ZCLP 2JKHA 4ISIH 1UVSH 4MVNA 1DWBH 4D9RA 1OXGA 2QF0A 1CHOF 1EATA 1YC0A 1GMDG 2FDAA 1J14A 1O3FA 4NWLA 1MKXH 3KHVA 3PLPA 1MTVA 4U01A 4B75A 2AIQA 3A81A 3C1KA 3RC5A 4TYDA 3VGCB 4Y7BA 4E7NA 3SNEA 2PTNA 1XUKA 3GCNA 3VB6A 4NCYA 2BTCE 3VB5A 1NU7B 3VXFH 1V2MT 2ZTXA 2VIPA 1TGNA 3F9GA 3BTEE 4ZHAA 4WMFA 2TPIZ 1GPZA 1S6FA 1LPGB 1OP2A 1ANDA 2ZHDA 3TJOA 1KIGH 1SI5H 4X2YA 5T6DA 4OS5A 4OS7A 2AFQB 2BZAA 1NPMA 4BTIB 1FY5A 2SGPE 3EYDA 2NU4E 3QX5H 5EXNA 1NTPA 2Z9IA 1AE8H 6GCHF 2O8UA 3W95A 3RC6A 1NS3A 1BTYA 1Z7KA 4Z6AH 1V2ST 1EJMA 1T8MA 1A5HA 1QJ6B 4ABHA 5JDUB 1NZQH 2PHBA 1QR3E 3TK9A 4OS6A 1DSUA 1YCPH 3RXTA 1BCUH 1BIOA 1ZJKA 3F9EA 3KL6A 2ODPA 1O3LA 4LOYH 1O3DA 1V2UT 3RM2H 5EW2H 2UUJB 1MTSA 3E6PH 5L6NH 1AY6H 1ZZZA 1DOJA 4JYTA 4A7IB 1LVMA 5IYTA 3GY8A 1P2JA 2BOKA 2LNCA 1GBLA 3RXVA 1L0ZA 3D62A 4NZLA 2PGQB 5DP9A 4DT7B 2ZG0H 2JH0D 1ZTLA 4NA9H 3RMMH 4NZQA 4BAKB 2Z7FE 3OU0A 2XCFA 4YM9A 1GI0A 2ESTE 2XWBI 3MO6A 2ZA5A 3GCTF 3BEFB 4OS2A 3BG4B 2BDHA 4B74A 1YPGH 1JIMA 9LPRA 2V6NA 3QDZB 1ZHPA 1V2JT 2Y80A 3UNRA 1GI2A 2CF8H 2Y82A 1VITH 1ACBE 1SLVB 1GI3A 1NESE 1VJ9U 3T26A 1L1JA 1SLWB 2STBE 1QJ7B 1Y3VA 3KCGH 3TVJB 1FONA 1TQ0B 4YTAA 1MH0A 2BQ6B 5F8TA 4ZKOU 5EQRA 1TNHA 4MPXA 3CS0A 4Y11E 2SNVA 4A5TS 2ZCKP 1BQYA 1THSH 3QLPH 1Q31A 1KXEA 5LH8A 4NIWA 3Q3XA 3Q76A 2BY8X 1ZMLA 2YNAA 1AD8H 2F3CE 2ZU1A 3ZZ3A 3TK5A 4ZHLU 1GVLA 2FOEA 2W3KA 1C1QA 3RXPA 1P09A 2TRMA 1P05A 4U30A 3T25A 4K69A 4FU9A 4ZKSU 2GCTB 3B23B 1OWJA 4UFFH 4UD9H 4ZUHA 3RXCA 1TPPA 3GCTG 4SGBE 2GDDA 1TMTH 1TX6A 2PSYA 1UTJA 4FVDA 1T7CA 1F5LA 3WY8A 4NG9H 1DLEA 2ODQA 1RTLA 2BY5X 1O30A 1B0FA 2YOLA 3P92A 1VGCB 5DG6A 2FTLE 2VB0A 2ANKH 8GCHF 2A4OA 2JETB 2OBQA 5DP3A 4X2WA 4K1TA 2Q6DA 2FI5E 1WQSA 4VGCC 1P8VC 3GY4A 4U2WA 6CHAC 3K2UA 2AEIH 1C5ZB 3EA7A 3RXDA 2BLQA 5JBCS 1PJPA 5T6GA 3CP7A 1Y3XA 2QXIA 1QGFA 1W10U 1LHDH 1O2NA 1KTSB 1C2DA 1LVOA 2D1JA 1ZRBA 4YO9A 2BX4A 2G52A 2GZ7A 2GT8A 1OSSA 1ELDE 2ZWLH 2W7SA 1P02A 3TGIE 2OBOA 2OC7A 2F9PA 3JZ1B 1SGNE 1D6RA 1QRZA 5L2YH 4GLYA 2XBXA 5A0CA 1F7ZA 3OYPA 1O3PB 5C67A 1MAXA 1TLDA 2ZFRH 3UQVA 1HLTH 2FP7B 4ABJA 1BRCE 2V3OH 2WPKS 1T32A 5C3NA 1PQ5A 1P06A 2FOAA 4TY7A 4X8UH 3S0NA 3BSQA 4I8KA 1IQLA 2GCHF 2Z3EA 4O3TA 5E0HA 4INLA 1TE0A 3AVZA 1BDAA 2C3SA 4ABBA 2C8YB 2C90B 2FYRA 1GDNA 1L4ZA 1NC6A 1YM0A 2ZGCA 3TJNA 3A7XA 3SV2H 4RKOB 5HYOA 3HPTB 1DM4B 3MO9A 1N6XA 1GCTB 4CRBA 1O2ZA 4KGAA 1HUTH 1C1SA 2BM2A 1C2KA 1TGSZ 4U32A 1YPKH 2BDBA 1AFQC 1DUEA 4XE4A 1NFUA 1IQFA 1IQHA 2BDGA 3SV7A 4B76A 2FLBH 1BOQA 4Q7YA 1W2KH 4J2YB 2TGTA 2VVCA 1TMBH 4IN1A 1HFDA 5C20A 1BRBE 1AN1E 1O3KA 2R3YA 3T29A 1FY8E 3ATWA 1C5QA 1C2FA 3M5MA 2Y5GA 1NRRH 3DD2H 4BAHB 4MPWA 4D9QA 3GCHB 1TNGA 2XTTB 1CE5A 2TGPZ 4WXVA 5DP6A 4D76A 1QL8A 2SFAA 1K1OA 1N8OB 1SGYE 3TLOA 3F9FA 1CT4E 1EOLA 3RM0H 1ZRKA 2PKAA 3ZVDA 1AFQB 1IQIA 1C2GA 5FBIA 4DY7B 4DCDA 1C5SA 4IN2A 1LVBA 1INCA 3HATH 2BX3A 2I6QA 4PROA 1S83A 3ZV9A 1YF4A 1P57B 1GI1A 4ZXXH 1ARCA 2A45B 1DWDH 2VWNA 1PPHE 1K1MA 2LPRA 1TRNA 4B73A 2VWLA 4Q80A 1A3EH 1GHBF 2TIOA 3F9HA 1Z6JH 3ZZAA 1GJDB 2XNIA 1H1BA 1GBJA 1QRXA 4X2XA 4Q7ZA 1C5RA 1BBRH 4ABIA 3BTGE 4JYVH 1D3QB 1RTFB 1D9IA 2ZGBH 4JZIA 3S9CA 7ESTE 1WV7H 2OCVB 2KAIB 3PV4A 4XBBA 4IS5A 3HGPA 2ZDLA 3SW2B 3A82A 2Z6BD 2VIQA 3BIUH 1KXFA 1KXBA 3RXSA 2GV7A 4BXWA 3CENA 7KMEH 4Y10E 1A1RA 1N6YA 2Z9GA 3TH2H 1TBQH 1EXFA 1N8OC 1GMHG 1O2KA 1YPJH 4CHAC 1BJVA 2J94A 3UOPA 3OTJE 2IJOB 3M7TA 4AGJA 1W13U 2OXSA 3SNBA 4TY6A 2FOHA 1O5DH 3JZ2B 1C1VH 1DITH 3PO1B 1ANEA 3MOCA 3GCOA 3SOSA 2ZHQH 2PLXA 2FXRA 1ESTA 1UVUH 1QHRB 1S81A 2QXGA 2TBSA 3AW1A 3EAJA 2A4RA 2CHAC 1KXDA 5GCHF 2GDEH 1BITA 3SJKA 3LJJA 2RA0A 2AMPA 4K60A 3A7VA 1GI5A 1HV7A 3R3GB 1SGFG 2BQ7B 1QL7A 3GDVA 3UY9A 3FANA 3E0PB 4ZKNU 2BVSH 3VPKA 1DPOA 1DXPA 1O3NA 3LIWA 2ZFFH 2H9EH 2ZU5A 4XSKU 1P2QA 3QTVH 1FY3A 2AMDA 1O2JA 2QYIA 2DE8A 2VWOA 1KSNA 1GVZA 3H7TA 1FIZA 1SGCA 3EDXB 5B6OA 1GHAG 3SUFA 1C4U2 5JPMH 3SV9A 4BTUB 2PUQH 1KLTA 4Y76A 1P9SA 1P11E 3VXEH 4KELA 2A5IA 1MD8A 1ABIH 5HM9A 2CF9H 3NWUA 2ALVA 4DURA 2A5AA 3AAVA 1ARBA 1DFPA 2C8ZB 3BTHE 2ZP0H 1JXPA 1K1NA 2Y5FA 2F9UA 1RXPA 2H5CA 2A31A 1K21H 4MLFB 1Z8JB 1LKBA 1BA8B 3S9BA 1HGTH 3MO3A 1UCYK 3LC3A 2VGCB 2ZQ1A 2R9PA 2UWLA 1LQDB 3BEIB 3OY6U 1SGFA 2XYAA 2GP9B 2BD5A 1BTHH 3VFEA 1GMHF 3MU1A 4B71A 1DE7H 2VIDA 4ABAA 2G51A 2F9NA 1W0ZU 1FI8A 1O3OA