1EKBB

The serine protease domain of enteropeptidase bound to inhibitor val-asp-asp-asp-asp-lys-chloromethane
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
235
structure length
235
Chain Sequence
IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROPEPTIDASE
publication title Crystal structure of enteropeptidase light chain complexed with an analog of the trypsinogen activation peptide.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 235
sequence length 235
ec nomenclature ec 3.4.21.9: Enteropeptidase.
pdb deposition date 1999-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ekbB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ekbB01
2ZF0H 3ODFA 1LCYA 2O8MA 1Y3VA 2VH6A 3TGIE 4BTIB 1CU1A 3GDSA 1IQJA 5GPIB 4D7GA 2XTTB 2FOHA 2G4UA 3A87A 3QUMP 2CF9H 6CHAC 3K6ZA 1ELGA 3TK6A 2Z9IA 3MH6A 1GJ7B 1QA7A 3BTQE 1TAWA 3SW2B 3BSQA 1HV7A 1WAYB 3MH5A 1WU1A 1Z1JA 3KQBA 1CBWB 2Z3EA 2A4GA 1AN1E 3D62A 3QTOH 4U30A 4UFEH 3M3VA 1KLTA 1VJ9U 5TCAA 4TWWA 3BTME 4XSKU 4MPWA 1DFPA 1GJDB 2OTVA 2CHAC 2F9VA 1HAYB 1H8DH 2STAE 3GOVB 4WWYA 2C93B 2GCTB 1D6WA 4AX9H 1LHEH 3HATH 4KKDA 1O3OA 1YGCH 1ZSLA 4A92A 1CA8B 2F83A 4NFEA 1UO6A 4TYDA 3L33A 4JZIA 1UHBA 1GI0A 1ZHPA 2FOFA 2QXIA 1TBRH 4B71A 1Z1IA 4GAWA 3LJJA 3LGYA 1O2NA 1O3KA 4Y71A 3K6YA 3RXRA 4WH6A 1F0TA 2WUBA 1CHOG 1L2EA 3JZ1B 4Y0ZE 3A7WA 1AIXH 1FLEE 4NGAH 4CRFA 1DPOA 1DY8A 5A2MH 1W14U 4SGAE 4DT7B 1BTHH 3M5OA 1BA8B 2VWNA 4KGAA 2FS9A 5JYIA 1RFNA 2SGPE 1SGYE 3G01A 1B7XB 2W5EA 1WOFA 4E7RG 1F0UA 1AFQC 4K8BA 3DA9B 1XX9A 4F49A 3HKIB 3Q3YA 1IHSH 1ZGVA 3PTBA 3EA8A 1XUJA 2AIPA 1DDJA 1V2NT 1JBUH 3SJKA 1J14A 4ZXXH 2AYWA 4FUBA 1TA2A 1PPBH 2FLRH 1YBWA 2OXSA 2PHBA 5C5NA 4ZKSU 3SJ8A 1HB0B 3SUGA 3QK1A 5AVDA 4GLYA 1SI5H 1EJMA 5EG4A 2I6QA 1XUGA 2FOEA 3SQEE 2PTNA 2YNAA 2OCVB 1K9OE 3P8NA 2C8XB 4A1XA 2H9TH 2WUCA 1ETTH 3M36A 2GCHF 5L2ZH 1GBAA 4B1TA 3SU3A 2AS9A 3RLWH 1YPGH 1AY6H 2NU2E 4H42U 4NIYA 1AFQB 3ZZ7A 1A2CH 4IC5A 2GKVE 3MNXA 4Q7ZA 4AB8A 4X8SH 2ZECA 1A5IA 1P57B 1UTLM 3OX7U 4JZEH 2R0LA 1HJ8A 4ASHA 2QF3A 3RXDA 1AU8A 1JIMA 3A8DA 4WF8A 2BZ6H 1Z8GA 1QL7A 2A5IA 1GBHA 1V2VT 1O3DA 2PR3A 3RXUA 2SGFE 4ISNA 1C9PA 4YOIA 2YOLA 3PWCA 3M3SA 2ZDMA 2P94A 4AG2A 1O3JA 3H5CB 4ISHH 4FVBA 3CP7A 3OY5U 1G3BA 2BXUH 4A1TA 2G52A 1O3MA 4NZQA 1ZJKA 4D7FA 2BLVA 1NU7B 1LHDH 3GCTG 1IQEA 1TOCB 1ABJH 2BZAA 2OQUA 4HGCA 1H1BA 1MCTA 3F1SB 1O5DH 1QQ4A 1YPJH 1GCTB 1GJ8B 1TWXB 2QIQA 1ZPZA 1BTPA 1C5OH 1SC8U 1Z6EA 2BY5X 2ZG0H 3QZRA 5LH8A 5A8YA 1C1MA 5DKMA 1YPKH 1SPJA 8ESTE 1O0DH 3A7TA 1YC0A 1FIWA 4XE4A 3SORA 3SU1A 5JPMH 2UUJB 1UK2A 3TJVA 1ZJDA 3SQHE 2FTMA 4FVDA 4ABHA 1JXPA 1HAOH 4X8TH 3R0FA 1ELEE 2ZPQA 3KCGH 3TGJE 2ZGXH 2W7SA 1PPEE 2QAAA 1CT0E 3E0NB 3ZZDA 5E0HA 2C8WB 1GBKA 1C2FA 4Q80A 1GBDA 2PV9B 3NK8A 5DP5A 1FAKH 1C2DA 2P3UB 1THPB 1FZZA 3S7HB 1C1RA 1GJ4H 1EKBB 3MU8A 4JMYA 4WH8A 3HK6B 2WPIS 1MTVA 1O5FH 4MNYA 2FOCA 1BRCE 1O2IA 4Y8YA 3F9EA 4NIXA 1C5SA 1YCPK 1GHBG 1G2LA 1HAGE 1THSH 2OC1A 1ZRKA 1CA0B 1EJAA 2VWMA 5J4QA 2ODPA 2A5KA 1EB1H 3HGNA 1O2TA 1KXDA 3ZV9A 2ILNA 2PGBB 1AD8H 2ZU1A 3P8OA 5GXPA 3UREA 4ABEA 4ABJA 1FXYA 4OS6A 1HAIH 2ZHDA 2XBXA 3SU2A 1C1QA 2A4OA 2VB0A 1O33A 1GMCF 1HJAC 1SFQB 4FXGH 1XXFA 3CS0A 1C1PA 3V12A 4XDEA 1EPTA 1QJ6B 2H5CA 3FANA 4NWKA 1NPMA 1ZLRA 4DOQA 4WJG2 3LC3A 1YP9A 2Z9JA 3TNTA 4BTTB 1YF4A 2ULLA 3MO9A 3GDVA 3NWUA 1T8NA 3PMAB 1CQQA 2JH0D 4CRGA 3S0NA 3F9HA 4MLFB 4ZH8A 3E8LA 3RU4D 1BBRE 3UY9A 1L4DA 1AB9C 2W3IA 5EQRA 1XVMA 3UWJH 3BEFB 1GVZA 2QXJA 3PWBA 1UTKA 1HRTH 4YZUA 2Y80A 4CR9A 4GCHG 5K7RA 2PGQB 1C2KA 3TJNA 1A46H 3UNRA 4GHQA 4ZHMU 1NFYA 4Y76A 2ASUB 1UTMA 4Q2KA 5C67A 5F6MA 1L0ZA 3SV6A 4TY6A 1TIOA 2SGAA 3QX5H 4WMDA 2ZDVH 3VB4A 5FX5A 1NRPH 1MMJN 1GHAF 1C5NH 1TMBH 1RGQA 1TPPA 1YPEH 1ELFA 1O2UA 1WSSH 1S81A 3BTKE 2FTLE 3LH1A 1EJNA 4GVUA 1P11E 4CH8B 1K1OA 3RXPA 5LPEA 4U2WA 2KAIB 2UWLA 3V13A 1FONA 1O38A 1VGCC 2I6SA 1UVTH 5EU8A 1CO7E 2Y5FA 2HPQH 1TX8A 2F91A 5ESTE 4RKOB 2ZQ1A 1WUNH 1H9IE 1G9IE 2BB4A 1W10U 3SOSA 2H5DA 3LJOA 2VVVA 1WV7H 2BHGA 1UK3A 3SBKA 4CREA 1KYNA 3P95A 2G51A 2QA9E 2GV6A 1LQDB 1ZPBA 2PUQH 2O8LA 2G00A 5F03A 4X2WA 2C8YB 1O5AB 2CN0H 1XUKA 2GV7A 1H9HE 4FU7A 4MQAA 4NA7A 1ZYOA 3MNBA 2G55A 3SGQE 5E0GA 2D8WA 1AZZA 4I32A 5BRRE 1NN6A 1QRZA 2STBE 3A80A 2VU8E 7KMEH 1HJ9A 1VGCB 2PW8H 1CHGA 1G32B 1YLCA 1C5ZB 3DFJA 4IMQA 4YO9A 5FX6A 1EATA 1ELDE 1KXFA 1MKWH 5BPEA 2EI8A 3HK3B 3K9XB 3SU4A 3UOUA 1OX1A 1SQOA 2VGCB 3EDXB 1NRSH 1YKTA 3Q3XA 1T32A 2F9UA 5HXFA 3MH4A 1P2JA 1TRNA 3B9FH 4YLQH 2NU3E 1SOZA 4JYTA 1MUEB 1SGDE 4X1NU 1O3GA 4OS2A 2BX4A 2TGAA 2XNIA 5A8XA 2A31A 1C2JA 4TPYA 3MWIU 1BB0B 1TPAE 5HM2A 3SNDA 2BDGA 4FUCA 1O2OA 1QB9A 1XUHA 2FESH 5A8ZA 2FODA 4H6SB 2XBVA 3ZZBA 1DUEA 3W95A 1C1NA 1J15A 1WYKA 5CE1A 4HFPB 5AF9H 3M7QA 1C4V2 3ZZ6A 3EGKH 2Z9GA 5TJXA 3MU4A 3PMJA 2P3FH 4IN2A 3D65E 2FDAA 3M35A 2Z7FE 5DO4H 3GY3A 3TNSA 2SNWA 3KF2A 1BJUA 4GHTA 3PV4A 3Q77A 1S83A 1TNJA 2Y7ZA 2HGTH 3NCLA 2ZCKP 4X0WU 3ATLA 2PKSC 4YOGA 1BT7A 1GBCA 4NIWA 4CRBA 5E8EH 5DP8A 1QA0A 3RXEA 3A85A 2BDIA 1GJBB 2JH6D 1XM1A 2ZQ2A 2YNBA 4MNXA 3RMLH 3LT3A 3KEEA 1K28D 3WY8A 1KXBA 3CENA 1BRUP 1P2MA 3MU5A 1QHRB 1P2KA 1ZOMA 1EX3A 1C2MA 1CGIE 4GUXA 1GGDB 3SNAA 3RP2A 1AI8H 1GMHG 2Q1JA 3M5LA 1ZSKA 1ELTA 1LHCH 2QY0B 1XXDA 1GCDA 1AHTH 2CMYA 2F9OA 5L2YH 2B5TB 3UQOA 2AFQB 3BTHE 2QXGA 1TX7A 4NZLA 4DGJA 1WTHD 2P95A 2HVXA 2V6NA 1PQ8A 3GY4A 3OU0A 4K69A 4I8LA 3KIDU 1T31A 2ZIQH 2ZFRH 2FEQH 4I8JA 3U9AH 1WQVH 1FMGA 1FPCH 3O8DA 1SGTA 2V0BA 1GDNA 1AKSA 1MH0A 2HALA 4MPXA 4Y7BA 1OWIA 4F4OC 5EPNA 2FYQA 1AFEH 3HKJB 1KSNA 3P8FA 1IQIA 4RKJB 3RU4T 1DXPA 1CT2E 2O8UA 5G4BA 1CBWC 1LKBA 3PLBA 2G4TA 4BOHA 4I33A 2ALVA 2ANWA 1SFIA 1NO9H 4DURA 7GCHG 1K21H 1O3LA 4ZAEA 1YCPH 2OLGA 1QBOA 1A0LA 1IAUA 3T29A 4DCDA 2Y6TA 1N6XA 1P0SH 4VGCC 2GCTC 1KDQB 1TX6A 2Q6GA 4LZ4B 2V35A 4JYUH 4Y6DA 1O2RA 3SJOA 2ZTYA 1NTPA 2OC0A 1F5KU 2BVSH 3STIA 8GCHF 4ABBA 1HAPH 3RXKA 2VWOA 3ENSB 4H6TA 4WMFA 2ZU5A 1GI4A 1GPZA 2BLQA 4NSVA 4XFQA 2F3CE 1QRWA 2GX4A 3SHAH 1N1LA 3GY2A 3TH2H 1GJ6A 8KME2 1TRYA 2XC4A 1UTJA 1GBEA 1V2JT 1A7SA 2A2XH 2H2ZA 1DUAA 3VXEH 2C3SA 4LXBH 1AVGH 1ETSH 4WXVA 1DWEH 2ODQA 2GP9B 1H4WA 4VGCB 3L6PA 1BMMH 3GICB 1ZRBA 1C2IA 3A8CA 3O8CA 2ALPA 3QGJA 1BMLA 1EP6A 3UOPA 5DGJA 2ZHEH 3A7XA 1TQ0B 4ISOA 3GYLB 5GCHG 1GMCG 2A45B 4MPUA 1PQ5A 5T6GA 1O2QA 2ANKH 2FS8A 2GT8A 1ESBA 1BZXE 4AYYB 2FLBH 1DX5M 2GDEH 1UJ1A 1L1GA 3KHVA 3QWCH 2H1UA 3VB3A 4H4FA 1A0JA 1DLKB 4JK6A 1EAXA 1QJ1B 1K1LA 1SBWA 4ZKNU 2JETC 4SGBE 2XWBI 3ZZCA 1GI8B 2B0FA 2RA0A 1QB6A 1MU8B 1UCYK 1FY4A 4AN7A 3BIUH 4CBNA 4YOJA 6ESTA 4CRCA 1BUIA 4Y79A 4UFGH 4CRDA 4YT7H 3GCHB 4MPVA 1ELCA 3GY6A 1SGIB 2THFB 3LGWA 1SGCA 1O2LA 1UCYE 1B0FA 1YYY1 1QL8A 1HAVB 1O3PB 1F7ZA 4BTUB 2BDYA 3EAJA 2W26A 1S5SA 2BQ7B 2FMJA 1E35B 4OS4A 1EP5A 1O2SA 3I77A 3PROA 1LTOA 5DJ7A 4ISLA 4ZMAH 1C4Y2 1LQEA 1HUTH 2AEIH 1BRBE 4LZ1H 5GWZA 1B5GH 1TNHA 2A32A 3ZZ3A 1F5LA 3RXQA 2BD4A 1EZSC 1S0QA 2JETB 1P3EA 2VIQA 2H9EH 1ETRH 1KXCA 3LGTA 3DUXH 4OGYA 3S9BA 3E6PH 3PB1E 4E7NA 2UWOA 4D76A 3FAOA 2AIQA 4I8HA 1GVLA 2Z9LA 4OS5A 3UNQA 5JBAS 3VXFH 3LPRA 1BIOA 4X1QU 5PTPA 1O2JA 1RIWB 1UVOA 4B2BA 1D3QB 1GCTC 1P2QA 3A89A 5LPFA 4I8KA 4NIVA 2HRVA 1MU6B 3AASA 3VPKA 5JBCS 1TMUH 1GJ5H 1FI8A 4ZHLU 4LOYH 1FY1A 3OYPA 6GCHG 9ESTA 2UWPA 3M5MA 1AQ7A 3TLOA 3ATKA 2VWLA 3B8JA 2PWXA 1UTQA 4D9RA 5FBIA 1RXPA 3SGAE 1P01A 1NRQH 2G81E 1FV9A 2ZZUH 1T4UH 3RXFA 2RG3A 3VB7A 1T7CA 1WCZA 4CHAB 1LPZB 2VVCA 2BD8A 1NFUA 3BN9A 2ZO3H 1HIAB 5JB9S 4NSYA 1Y59T 4YTAA 3RXOA 5HYOA 1A4WH 3RXVA 3QTVH 1SL3A 1SLXB 3UNSA 1BHXB 1DSUA 2FWWA 1V3XA 1EQ9A 5EPYA 2EC9H 1IQGA 3E0PB 4OGXA 4X1SU 2VVUA 4MG3A 1WQSA 2NU4E 1NRNH 1SMFE 1HPGA 2F9PA 1YLDA 4CBOA 1W13U 1AWFH 3GDUA 3ODDA 2A0QB 1CA0C 3SV7A 1BTZA 4CR5A 1CVWH 4ABAA 1WBGB 1A5HA 4OS7A 1OOKB 4X2YA 1MKXK 3SZNA 4AGJA 3EQ0H 2P8OB 1DT2A 2D26C 3SI4H 3ATMA 1RTFB 2ZPSA 3TVJB 4M7GA 1WTGH 4INKA 2PKAB 3AW1A 5T6DA 1Y5BT 5C1UA 1O3BA 4BANB 1ELVA 1FAXA 1EAUA 2PUXB 2VIOA 4KP0A 1P09A 1DICA 4FUDA 3ZZ5A 1ANEA 1W0ZU 3P6ZB 5EW2H 4A6LA 3TH3H 2ZTXA 4I7YH 1Y3XA 1ELAA 2WPKS 2PFEA 1HAHH 4X6NA 1PYTC 3MNCA 1AE5A 2BX3A 1H8IH 2R2MB 2M5TA 2VINA 2XC5A 1VITF 1O3AA 4J1YA 4THNH 3H7OA 5EQSA 1TALA 4FUFA 1UTPA 4B2AA 2A7HA 1GI6A 3T28A 5JB8S 4B74A 2A5AA 4KELA 1EZXC 4FU8A 4KTCA 4OS1A 3ZYEA 1GMDF 5GJ4B 1QR3E 1FIZA 1BBRK 2EA3A 1YPHC 1Y5AT 5ESBA 3DHKH 3P92A 4GSOA 5FPTA 2TRMA 2GMTB 2J92A 1TGTA 5J4SA 3A8AA 1G3EA 4NFFA 3MO3A 4BNRA 2HNTC 4Y11E 2ZGHA 2Z94A 3PYHA 6LPRA 1QFKH 1CHOF 1P8VC 3KN2A 5EW1H 3F6UH 4FUJA 1FN8A 1QQUA 1TONA 4NA9H 4NWLA 1KDQA 2BOKA 2ZDLA 1IHTH 1C1VH 5DP7A 2FOAA 2BD2A 5FPYA 2J4IA 3VFEA 2ZC9H 3DT0H 1ARCA 5DP6A 1O2YA 1JRTA 3T26A 3LGUA 3LIWA 2XC0A 1NM6A 2BD7A 1TBZH 1A1RA 2DE8A 1P12E 3IG6B 1O39A 2QV1A 1LVYA 3U1JB 1RTLA 2FPZA 5T6FA 3SJIA 1UHBB 2QGRA 1INCA 3K65B 3Q3KA 5DP4A 1TOMH 2UUYA 3BTDE 3BTEE 2BOHB 3LC5A 1QGFA 1UMAH 5A0BA 5HGGA 1O30A 2ZWLH 1LVMA 1E0FD 2XW9A 3LGIA 1GHXH 2FXRA 1SLWB 2ZU2A 3UTUH 4KTUA 2P16A 2ZEBA 2BLWA 2HNTF 4UFDH 2BYAX 1NESE 1NC6A 1T4VH 2BY7X 1K2I1 2VGCC 1JOUB 3W94A 3RC5A 1EASA 3RUOA 2BD9A 3QGNB 1GVKB 1V2RT 2C4FH 2OBOA 3BG8A 1W8BH 2ZDNA 1GHZA 1GBMA 2FM2A 2WYJA 4Y8ZA 5GIBA 2PTCE 1M9UA 1P2NA 1LVBA 4BXWA 4I31A 3RLYH 1PPFE 5FAHA 3ZVCA 2HLCA 2WINI 2FI5E 1OXGA 3SU5A 3SO3A 4HTCH 1SHHB 1Y8TA 3ELAH 3P17H 1FNIA 3RM0H 1O3HA 3LONA 2WV5A 2TGTA 1DITH 2ZCHP 1HXFH 1K1IA 1DWBH 5FXLA 3MOCA 3MNSA 1Z7KA 1KY9A 5F8XA 4UD9H 1A3BH 1XUFA 3T62A 1L1JA 4TY7A 3MO6A 1CT4E 3T25A 3AVZA 4GPGA 3BTWE 2LNCA 3UPEA 1GBIA 4WMEA 5F8TA 3NXPA 4MVNA 1O2PA 1ACBE 1OP8A 1C9TA 3UQVA 1TNKA 1VZQH 1AO5A 5JDUB 1QURH 1W11U 1Y3YA 2BY6X 2BXTH 2FIRH 2WPMS 2XCFA 3UFAA 1F0SA 2EI7A 1E38B 4YESB 4MNWA 2RCEA 1C5RA 3LGVA 4B73A 5JBTA 4O9VA 1OWHA 2Z3CA 1TBQH 5GDSH 3LH3A 1AZ8A 4BAMB 3ATWA 2G8TA 4AFZA 2R3YA 1NFWA 1OPHB 1O2XA 3QN7A 1G37A 2Y82A 3OY6U 2G5VA 4YM9A 1OYQA 2VIVA 1S82A 2RA3A 1F5RA 1Z8JB 3BV9B 2IPHA 3M7TA 4K1TA 1GGDC 1Q3XA 1O2HA 5DP9A 2XWAA 4R8TB 5EXLA 3RXIA 4NA8A 2UUFB 1O2ZA 2ZDKA 1TGSZ 1V2OT 4IW4E 1JWTA 1O37A 2Q6FA 1KIGH 1GBJA 1C5PA 3U98H 4IS5A 2GCHG 1YPMH 3A88A 1OWDA 1VCQA 2ANYA 1DE7H 4QT8C 4JZ1A 4D9QA 2J34A 1L4ZA 1VR1H 1HYLA 1O34A 2SNVA 1FJSA 1Y3WA 3MU1A 4JZFH 1P06A 8LPRA 5SGAE 1QBVH 4JCNA 1P02A 3HPTB 5AHGH 1UTOA 3BG4C 1IQFA 1H9LB 3AAVA 7ESTE 2P59A 4X6OA 3U8OH 1IQKA 1SGPE 1ELBA 3ESTA 1D6RA 2GZ8A 1QRXA 1O5CB 4FUIA 2VJ1A 4O03A 1HAXB 1ANBA 2FP7B 2G5NA 1ZHRA 4A1VA 3LKWA 3ZVGA 4FU9A 4Y10E 1DWDH 1GJAB 1TRMA 2GT7A 3SI3H 1W3CA 1D9IA 1MD7A 5HMAA 1ZTKA 3C27B 3M5NA 1ANDA 1HAZB 2B8OH 5E0JA 3AAUA 1EOJA 1FN6A 3UUZA 1C1OA 3KGPA 2D1JA 3UR6A 1OYTH 3A84A 2BLOA 5AFYH 1O36A 1O5BB 1Y5UT 1MKXH 2ZGJA 4E05H 1Z8RA 2OP9A 1D3PB 5IDKA 1TYNA 4AFQA 1RJXB 4NG9H 3BG4B 4Y8XA 5EODA 2VNTA 1O2GH 1ZHMA 3NPSA 5H4IB 2A7CA 2IOTA 1FDPA 1FY5A 1A61H 1EXFA 3SUDA 1MZDA 4K1SA 1EOLA 3URCA 1ZGIA 3SV8A 4MTBA 1DLEA 5C1XA 4PROA 4BAQB 2GD4B 4O97A 4RSPA 1C1SA 4CH2B 4AZ2B 5L6NH 1P9SA 1KLIH 3I29A 3EYDA 1C2LA 2ZA5A 3STJA 4AOQA 1O2WA 1NT1A 4Y7AA 4UDWH 3MMGA 1C1UH 2WPJS 2VH0A 1IQLA 1FPHH 1PYTD 3URDA 1EB2A 1ZR0A 1KXAA 1F92A 5C20A 2IJOB 1KTSB 1LDTT 3L3TA 2QXHA 4KTSA 1LPKB 1S6FA 3E1XB 5A0AE 5LGOA 3GYMA 1CGHA 3TITA 3U8RH 2BY8X 4X6MA 3SU6A 4NCYA 4ZROA 3FZZA 1BBRH 2CV3A 1MQ6A 1P05A 2WPHS 2VIDA 1GHYH 4ISIH 1SLVB 1TGNA 3M37A 3RXTA 1EZQA 1W7XH 4CRAA 1P3CA 1BQYA 1HFDA 1MZAA 3V3MA 3GCHC 1SOTA 1T8OA 2NU0E 2ZDAH 5K0HA 4DIIH 3BIVH 4Q7YA 2A4QA 3ITIA 1BTWA 1Z71A 3FZDA 3EA9A 4IN1A 1O31A 3QZQA 2XYAA 2R2WU 1HDTH 1VITG 5C3NA 4AB9A 1GI7B 3N7OA 1QY6A 1BTUA 1TE0A 1UTNA 1LHFH 1MD8A 1V2TT 4K3JA 1P2OA 1N8OC 1GMDG 1MQ5A 1U6QA 3QDZB 1NZQH 1O3IA 1K1MA 1QCPA 2AERH 1PJPA 2XRCA 1O5GH 6CHAB 1GI3A 3IWMA 1PPCE 1C5MD 1K22H 2NWNA 3ZVFA 3E91A 2WV4A 5E2PA 3SUFA 5C2ZA 4YT6H 1ZPCA 3P70B 3RMOH 3U8TH 2BD3A 4ZXYH 1K1JA 2OC7A 1RIWC 2KAIA 2J2UA 2A7JA 1HXEH 3RC4A 3FP8E 3MFJA 1G3DA 1TLDA 1P2IA 3FVFB 4D8NA 2DUCA 2Z6BD 2CHAB 2A2QH 1MKWK 1ESTA 1N6YA 1RTKA 5B6OA 3ZV8A 3SV9A 1N8OB 1UVUH 1C1TA 1CSOE 1TA6A 1IQHA 1SGEE 2HOBA 4U01A 5FHTA 2AMQA 1C1WH 1EZUC 1GHAG 1MAXA 1BTXA 3H7TA 3F68H 1BJVA 3FP6E 1SGFA 1GJCB 2VIWA 1YPLH 1C2GA 3GY8A 4XOJA 4JZDH 3SGBE 2GDDA 1C5VA 4CHAC 1PQ7A 1GBTA 2SFAA 2GZ9A 3SNBA 1OSSA 3BTGE 1SB1H 3GY7A 1FY8E 2TGPZ 4B75A 4JYVH 1V2WT 1RD3B 1TMTH 3V7TA 2ZPRA 4A7IB 4X8UH 2BQWB 2FX4A 2BY9X 2EI6A 3SNEA 1MTUA 2XXLA 1ZMJA 2TIOA 1CE5A 3IITA 1TQ7B 3PM3A 3LDXH 2W7UA 4E06H 5FPSA 3RXHA 1K1PA 2QYIA 3TJUA 4LK4A 1E36B 4X2VA 3JZ2B 3ZZ4A 3F9FA 1GMHF 3LU9B 1BRAA 1AMHA 1AUJA 1Z8IB 4DIHH 2FOGA 1DOJA 3K2UA 1S0RA 1IOEA 2FI3E 1DM4B 4JK5A 4XBDA 2ZU4A 4ESTE 3U69H 3BTFE 4UFFH 3U1IB 2ZP0H 1SGFG 2B9LA 2J94A 2P8OC 1PFXC 2ESTE 2O9QA 3RC6A 5L30H 2V3OH 4IMZA 3RXJA 3T5FH 5DPAA 1D3DB 2F9NA 1GBFA 3PLKA 5I25A 2UUKB 1OKXA 3ZVEA 1QB1A 1MCVA 3A86A 4U32A 4K5ZA 3TK5A 2Q6DA 2ZGBH 1C5YB 4UEHH 2AH4X 3BTTE 2CGAA 2ZFPH 4YLUA 4X1RU 3VGCC 2P3TB 1BCUH 4INLA 1A3EH 1SQAA 5EXMA 2ZI2H 1BHXF 1VCWA 1TPOA 1Y3UA 3NZIA 5F8ZA 1V2KT 3SNCA 2OBQA 1XMNB 1GHWH 1V2ST 1J16A 3GY5A 2W3KA 5FCKA 1ID5H 2QF0A 1C4U2 1ZMLA 3F9GA 1P04A 5AFZH 4ZUHA 1HBTH 2O8WA 1HLTH 3GCOA 2ZU3A 4MNVA 7GCHF 2Z9KA 1XKBC 1E37B 3RMNH 1C5XB 3VB6A 1JMOH 3ATIA 5FBEA 1TNGA 3I78A 1YPHE 4HI3A 1AKSB 3VGCB 4ZHAA 3O8BA 2ZFFH 3A8BA 2ZTZA 3FFGA 1ARBA 4K60A 1Z6JH 2P93A 3ZVBA 2HWLB 3RM2H 2GMTC 7LPRA 2HNTE 1BTYA 3QO6A 2FOMB 1LHGH 1G36A 1DXWA 4BAHB 2XBWA 3P8GA 2H6MA 2R9PA 2BDAA 3OSYA 3UR9A 2ZFSA 2QN5T 1VJAU 1J9CH 3TU7H 2F9BH 3Q00A 1GHVH 1F0RA 3GISB 1BDAA 1W7GH 1YM0A 2ODYB 4AFUA 1ORFA 1SQTA 3KNXA 4DVAU 1DVAH 2K1QA 2C90B 1MTNC 4ZKOU 1Q2WA 1AVWA 1F2SE 1XUIA 3TPIZ 2ZNKH 1E34B 1UVSH 2WYGA 4DG4A 5I46H 1NRRH 3BEIB 3E90B 1XVOA 1ZTLA 3S7KB 1J17T 5GCHF 2ZHQH 3GCNA 1QIXB 1T8MA 1LVOA 1QBNA 1DSTA 2O8TA 4ABDA 3A7ZA 3TH4H 3T2NA 2FI4E 4ABIA 2TBSA 3B23B 1PPHE 1SR5C 2ZFQH 2BDBA 1C5LH 1V2UT 1GDQA 3RDZA 3DD2H 1VCPA 1MTSA 2R3UA 1LO6A 2Y5GA 3S9AA 2J38A 4RN6A 1G30B 2FOBA 4DW2U 3A81A 2ZGCA 1AE8H 2OD3B 3ZZAA 1MTNB 4I8GA 3SV2H 4Q7XA 4X1PU 1LKAA 5EGMA 3ZYDA 3RXMA 1YCPM 4Z6AH 4TWYA 2RDLA 4BAKB 2GTBA 2HPPH 3S69A 3PMBB 9LPRA 1ZMNA 1RS0A 4XBCA 2FX6A 1BMAA 1TB6H 4K2YA 1HJAB 3MH7A 2BVXH 3NUMA 1OP0A 5DP3A 1C5UA 1DWCH 1QJ7B 1ZTJA 1ZSJA 4UONA 2SGEE 4DY7B 4A5TS 1JIRA 2Y7XA 1IQNA 2LPRA 3T27A 3KQEA 1DANH 4ZKRU 3E16B 4DJZB 1NY22 1SGNE 2BQ6B 2CF8H 1MBMA 3A7YA 1DS2E 2A4RA 8GCHG 1SHYA 3ZVDA 1S84A 2ZFTA 1AB9B 1ESAA 4WVPE 2BM2A 2QCYA 1MTWA 2ZHWH 1AWHB 1A5GH 4K8YA 1SGRE 3PLPA 4K1EA 1GDUA 1RRKA 3ZVAA 3TGKE 3SU0A 5LPRA 1TPSA 3KL6A 4IGDA 3S9CA 3NKKA 3R3GB 1BOQA 1SVPA 3SUEA 1QL9A 2CXVA 1SG8B 4X2XA 1UCYH 1O32A 2BMGB 1C5TA 2XCNA 6GCHF 2C8ZB 5A09A 1UVPA 3D49H 2GVFA 4X6PA 2QC2A 1FY3A 3M61U 3VEQB 3RXLA 5C1YA 2BTCE 3RXAA 1HAVA 3A7VA 1O2VA 1T8LA 3GCTF 2PSYA 1TGCA 1ANCA 2J95A 2CJIA 3PTNA 1PPZA 1TNIA 2XBYA 4B2CA 2FYRA 2AMDA 1TFXA 2AGEX 1OP2A 4J2YB 4AFSA 3TJOA 2BD5A 1ABIH 1GG6C 3VB5A 2BDCA 3PMHB 1O5EH 4TPIZ 4Z0KA 5TCCA 4AG1A 1SLUB 1NFXA 5EOKA 1IQMA 1LMWB 2OC8A 1TGBA 1V2MT 1O3NA 3MTYA 1NS3A 1OWKA 1MAYA 2D2DA 1W0YH 4IC6A 1O3EA 4WY3A 1HNEE 4WXIA 5A0CA 4X8VH 2TGDA 3QLPH 4O3TA 2AGGX 3SN8A 3AW0A 4FUEA 1G3CA 1TABE 2ZCLP 3MHWU 2AMPA 4ABFA 1GI5A 1GJ9B 5JBBS 4B76A 2EEKA 1PQAA 3SJ9A 1O35A 4IBLH 3FP7E 4Y0YE 3PO1C 4FUHA 5FCRA 1C5QA 3MI4A 1VITH 1L1NA 1V2QT 1B0EA 3RXBA 1DY9A 1QNJA 2A1DB 3CS7A 1O2KA 4ABGA 1CGJE 1EAWA 1GG6B 1C2HA 1KXEA 1S85A 3HGPA 1GI2A 1KLJH 1S6HA 1FQ3A 1O2MA 3KQCA 3UIRA 4AGKA 3OTJE 1EAIA 1V2LT 5CMXH 1UK4A 1D3TB 1KTTB 1O3FA 2JH5D 2H9HA 3UWIA 3D23A 2NU1E 1GHBF 2ZKSA 1P10A 3A83A 3TK9A 3ZZ8A 3TIUA 1C2EA 2B7DH 1HIAA 3LOXA 1AUTC 1J8AA 4INHA 5EXNA 3RMMH 3EE0B 2VIPA 5HM9A 5EQQA 3BF6H 1P9UA 1G2MA 1BMNH 2OUAA 2Y5HA 3Q76A 2TPIZ 1Q31A 1OWEA 1GL0E 3PO1B 1OS8A 1W2KH 1HCGA 3C1KA 1PPGE 3M7UA 5CHAC 1GWAA 1C5WB 1LPGB 1QTFA 2BDHA 2SGDE 3MYWA 3MU0A 1NU9A 1SGQE 2FO9A 4BAOB 3RU4E 1EPTC 3SHCH 1AGJA 1D4PB 1SSXA 3BEUA 2PLXA 1HGTH 3A82A 2J9NA 5DK1A 4BXSA 4HZHA 1JRSA 2R0KA 2DE9A 1THRH 3RXSA 1EUFA 1O3CA 2JKHA 2GGVB 3ZZ9A 2FZZA 1X7AC 2PKSB 3RXGA 4XBBA 3V0XA 1GBBA 5DG6A 3O8RA 3M3TA 2GZ7A 5C5OA 1AVXA 1K1NA 2PKAA 3KQDA 2Z3DA 1TNLA 4MDSA 2OQ5A 1FUJA 1P03A 1GI9B 4GCHF 5CHAB 3RXCA 2AGIX 4AORA 2OINA 3DFLA 1NROH 2Y81A 1W12U 1XKAC 1EPTB 1MBQA 1V6DA 1ZZZA 1V2PT 5ABWA 3EA7A 1GL1A 2ANMH 5ETXA 1GBLA 4R0IA 5E2OA 2PSXA 4AYVB 4FUGA 1A0HB 2WPLS 3E3TA 4O3UA 5IYTA 5T3HA 2SGQE 1BITA 1GI1A 2V3HH 2BVRH 2ZHFH 2IN2A 4UE7H 1OWJA
chains in the Genus database with same CATH superfamily
2ZF0H 3ODFA 1LCYA 2O8MA 1Y3VA 2VH6A 3TGIE 1W0KD 1VKYA 4BTIB 1CU1A 3GDSA 2WV9A 1IQJA 5GPIB 4D7GA 2XTTB 2FOHA 2G4UA 3A87A 3QUMP 2CF9H 6CHAC 3K6ZA 1ELGA 3TK6A 2Z9IA 3MH6A 1GJ7B 3OE7D 1QA7A 3BTQE 1TAWA 3SW2B 3BSQA 1HV7A 1WAYB 3MH5A 4M9FA 1WU1A 1Z1JA 3KQBA 1CBWB 3KYGA 2Z3EA 2A4GA 1AN1E 3D62A 3QTOH 4U30A 4UFEH 3M3VA 1KLTA 1VJ9U 5TCAA 4TWWA 3BTME 4XSKU 4MPWA 1DFPA 1GJDB 2OTVA 2CHAC 5KEDA 2F9VA 4RI0A 1HAYB 1H8DH 2STAE 3GOVB 4WWYA 2C93B 2GCTB 1D6WA 2L74A 4AX9H 1LHEH 3HATH 4KKDA 1O3OA 1YGCH 1ZSLA 4A92A 5EIYA 1CA8B 2F83A 4NFEA 1UO6A 4TYDA 3L33A 4JZIA 2LELA 1UHBA 1GI0A 1ZHPA 3UAIC 5FL7D 2FOFA 2QXIA 1TBRH 4B71A 1Z1IA 4GAWA 3LJJA 3LGYA 1O2NA 1O3KA 4Y71A 3K6YA 3RXRA 4WH6A 1F0TA 2WUBA 1CHOG 1L2EA 2KCYA 3JZ1B 4Y0ZE 3A7WA 1AIXH 1FLEE 4NGAH 4CRFA 1DPOA 1DY8A 4B6EA 5A2MH 1W14U 4SGAE 4DT7B 1BTHH 3M5OA 1BA8B 2VWNA 4KGAA 2FS9A 5JYIA 1RFNA 2SGPE 1YLNA 1SGYE 3G01A 1B7XB 2W5EA 2YMSD 1WOFA 4E7RG 1H8ED 1F0UA 1AFQC 4K8BA 3DA9B 3PV5A 1XX9A 4F49A 1UW7A 3HKIB 3Q3YA 1IHSH 1ZGVA 3PTBA 3EA8A 1XUJA 2AIPA 1DDJA 1V2NT 1JBUH 3SJKA 1J14A 4ZXXH 2AYWA 4FUBA 1TA2A 1PPBH 2FLRH 1YBWA 2OXSA 2PHBA 5C5NA 4ZKSU 3SJ8A 1HB0B 3SUGA 3QK1A 5AVDA 4GLYA 1SI5H 1EJMA 5EG4A 2I6QA 1XUGA 2FOEA 3SQEE 2PTNA 2YNAA 2OCVB 1K9OE 3P8NA 2C8XB 4A1XA 2H9TH 2WUCA 1ETTH 3M36A 2GCHF 4YXWD 5L2ZH 1GBAA 4B1TA 3SU3A 2AS9A 3RLWH 1YPGH 1AY6H 2NU2E 4H42U 4NIYA 1AFQB 3ZZ7A 1A2CH 4IC5A 2GKVE 3MNXA 4Q7ZA 4AB8A 4X8SH 2ZECA 1A5IA 1P57B 1UTLM 3OX7U 4JZEH 2R0LA 1HJ8A 4ASHA 2QF3A 3RXDA 1AU8A 1JIMA 3A8DA 4WF8A 2BZ6H 1Z8GA 1QL7A 2A5IA 1GBHA 1V2VT 1O3DA 2PR3A 3RXUA 2SGFE 4ISNA 1C9PA 4YOIA 2YOLA 3PWCA 3M3SA 2ZDMA 2P94A 4AG2A 1O3JA 1WXRA 3H5CB 4ISHH 4FVBA 3CP7A 3OY5U 1G3BA 2BXUH 4A1TA 2F43B 2G52A 1O3MA 4NZQA 1ZJKA 4D7FA 2BLVA 1NU7B 1LHDH 1MABB 3GCTG 1IQEA 1TOCB 1ABJH 2BZAA 2OQUA 4HGCA 1H1BA 1MCTA 5CDFE 3F1SB 1O5DH 1QQ4A 1YPJH 1GCTB 1GJ8B 1TWXB 2QIQA 1ZPZA 1BTPA 1WDIA 1C5OH 1SC8U 2BY5X 1Z6EA 2ZG0H 3QZRA 5LH8A 5A8YA 1C1MA 5DKMA 1YPKH 1SPJA 8ESTE 1O0DH 3A7TA 1YC0A 4FETA 1FIWA 4XE4A 3SORA 3SU1A 5JPMH 2UUJB 1UK2A 3TJVA 1ZJDA 3SQHE 2FTMA 4FVDA 4ABHA 2J98A 1JXPA 1HAOH 4X8TH 3R0FA 1ELEE 2ZPQA 3KCGH 3TGJE 2ZGXH 3GS9A 2W7SA 1PPEE 2QAAA 1CT0E 3E0NB 3ZZDA 5E0HA 2C8WB 1GBKA 1C2FA 4Q80A 1GBDA 2PV9B 3NK8A 5DP5A 1FAKH 1C2DA 2P3UB 1THPB 1FZZA 3S7HB 1C1RA 1GJ4H 1EKBB 3MU8A 4JMYA 4WH8A 3HK6B 2WPIS 3FOAA 1MTVA 1O5FH 4MNYA 2FOCA 1BRCE 1O2IA 4Y8YA 3F9EA 4NIXA 1C5SA 1YCPK 1GHBG 2OK5A 1G2LA 1HAGE 5IK2D 1THSH 3DSGA 2OC1A 1ZRKA 1CA0B 1EJAA 2VWMA 2KCAA 4TSFD 2JJ2D 5J4QA 2ODPA 2A5KA 1EB1H 3HGNA 1O2TA 1KXDA 3ZV9A 2ILNA 2PGBB 1AD8H 2ZU1A 3P8OA 5GXPA 2HVYB 3UREA 4ABEA 4ABJA 1FXYA 4OS6A 1HAIH 2ZHDA 2XBXA 3SU2A 1C1QA 1QZ8A 2A4OA 2VB0A 4I86A 1O33A 1GMCF 1HJAC 1SFQB 4FXGH 1XXFA 3CS0A 1C1PA 3V12A 4XDEA 1EPTA 1QJ6B 2H5CA 3FANA 4NWKA 1NPMA 1ZLRA 4DOQA 4WJG2 3LC3A 1YP9A 2Z9JA 3TNTA 4BTTB 1YF4A 2ULLA 3MO9A 3GDVA 3NWUA 1T8NA 3PMAB 1CQQA 2JH0D 4CRGA 2EY4C 3S0NA 3F9HA 4MLFB 4ZH8A 3E8LA 3RU4D 1BBRE 3UY9A 1L4DA 1AB9C 2W3IA 5EQRA 1XVMA 3UWJH 3BEFB 1GVZA 2QXJA 3PWBA 1UTKA 1HRTH 4YZUA 2Y80A 4CR9A 4GCHG 5K7RA 1H8HD 2PGQB 1C2KA 3TJNA 1A46H 3UNRA 4GHQA 4ZHMU 1NFYA 4Y76A 2ASUB 1UTMA 4Q2KA 5C67A 5F6MA 1L0ZA 3SV6A 4TY6A 5HIZA 1TIOA 3N7EA 2SGAA 3QX5H 4WMDA 2ZDVH 3VB4A 5FX5A 1NRPH 1MMJN 1GHAF 1C5NH 1EFRD 1RGQA 1TMBH 1TPPA 1YPEH 1ELFA 1O2UA 1WSSH 1S81A 3BTKE 2FTLE 3LH1A 1EJNA 4GVUA 1P11E 4CH8B 1K1OA 3RXPA 5LPEA 4U2WA 2KAIB 5C17A 2UWLA 3V13A 1FONA 1O38A 1VGCC 2I6SA 1UVTH 5EU8A 1CO7E 2Y5FA 2HPQH 1TX8A 2F91A 5ESTE 4ACAA 4RKOB 2ZQ1A 1WUNH 1H9IE 1G9IE 2BB4A 1W10U 4FOUC 3SOSA 2H5DA 3LJOA 2VVVA 1WV7H 2BHGA 1UK3A 3SBKA 3DCLA 4CREA 1KYNA 3P95A 2G51A 2QA9E 2GV6A 5GNDA 1LQDB 1ZPBA 2PUQH 1KMHB 2O8LA 4Q63A 2G00A 5F03A 4X2WA 2C8YB 1O5AB 2CN0H 1XUKA 2GV7A 1H9HE 4FU7A 4MQAA 4NA7A 1ZYOA 1YY3A 3MNBA 2G55A 3SGQE 5E0GA 2D8WA 1AZZA 4I32A 5BRRE 1NN6A 1QRZA 2STBE 3A80A 2VU8E 7KMEH 1HJ9A 1VGCB 2PW8H 1CHGA 1G32B 1YLCA 1C5ZB 3DFJA 4IMQA 4YO9A 5FX6A 1EATA 1ELDE 1KXFA 1MKWH 5BPEA 2EI8A 3HK3B 3K9XB 4RT0A 3SU4A 3UOUA 1OX1A 1SQOA 5EJ1A 2VGCB 3EDXB 1NRSH 1YKTA 3Q3XA 1T32A 2F9UA 5HXFA 4ZCNA 3MH4A 1P2JA 1TRNA 3B9FH 4YLQH 2NU3E 1SOZA 4JYTA 1MUEB 1SGDE 4X1NU 1O3GA 4OS2A 2BX4A 2TGAA 5HKKD 2XNIA 5A8XA 2A31A 1E79D 1C2JA 4TPYA 3MWIU 1BB0B 1TPAE 5HM2A 3SNDA 5CHBA 2BDGA 4FUCA 4TT3D 1O2OA 1QB9A 1XUHA 3NRLA 4XD7D 2GJGA 2KCPA 2FESH 4Q4LA 5A8ZA 2FODA 4H6SB 2XBVA 3ZZBA 1DUEA 3W95A 1C1NA 1J15A 1WYKA 5CE1A 4HFPB 5AF9H 3M7QA 1C4V2 3ZZ6A 3EGKH 2Z9GA 5TJXA 3MU4A 3PMJA 2P3FH 4IN2A 2KCOA 2FDAA 3D65E 3M35A 2Z7FE 5DO4H 3GY3A 3TNSA 2SNWA 3KF2A 1BJUA 4GHTA 3PRDA 3PV4A 3Q77A 1S83A 1TNJA 2Y7ZA 2HGTH 3NCLA 2ZCKP 2J97A 4X0WU 3ATLA 2PKSC 4YOGA 1BT7A 1GBCA 4NIWA 4CRBA 5E8EH 5DP8A 1QA0A 3RXEA 3A85A 2BDIA 1GJBB 2JH6D 1XM1A 2ZQ2A 2YNBA 4MNXA 3RMLH 3F3BA 3LT3A 2QF5A 3KEEA 1K28D 3WY8A 1KXBA 3ZIAD 3CENA 1BRUP 1P2MA 3MU5A 1QHRB 1P2KA 1ZOMA 1EX3A 1C2MA 1CGIE 4GUXA 1GGDB 3SNAA 3RP2A 1AI8H 1GMHG 2Q1JA 3M5LA 1ZSKA 1ELTA 1LHCH 2QY0B 1XXDA 1GCDA 1AHTH 2CMYA 2F9OA 5L2YH 2B5TB 3UQOA 2AFQB 3BTHE 2QXGA 1TX7A 4NZLA 4DGJA 1WTHD 2P95A 2HVXA 1S6LA 2V6NA 1PQ8A 3GY4A 3OU0A 4K69A 4I8LA 3KIDU 1T31A 5KECA 2ZIQH 4P02A 2ZFRH 2FEQH 4I8JA 3U9AH 1WQVH 1FMGA 1FPCH 3O8DA 1SGTA 2V0BA 1GDNA 1AKSA 1MH0A 2HALA 4MPXA 4Y7BA 1OWIA 4F4OC 5EPNA 2FYQA 1AFEH 3HKJB 1KSNA 3P8FA 1IQIA 4RKJB 3RU4T 1DXPA 1CT2E 2O8UA 4F48B 5G4BA 1CBWC 1LKBA 3PLBA 2G4TA 4BOHA 4I33A 2ALVA 2ANWA 1SFIA 1NO9H 4DURA 7GCHG 1K21H 1O3LA 4ZAEA 1YCPH 2OLGA 1QBOA 1A0LA 1IAUA 3T29A 4DCDA 2Y6TA 1N6XA 1P0SH 3FO8D 4VGCC 2GCTC 1KDQB 1TX6A 2Q6GA 3SYJA 4LZ4B 2V35A 4JYUH 4Y6DA 1O2RA 3SJOA 2ZTYA 1NTPA 2OC0A 1F5KU 2BVSH 3STIA 8GCHF 4ABBA 1HAPH 3RXKA 2VWOA 3ENSB 4H6TA 4WMFA 2ZU5A 1GI4A 1GPZA 2BLQA 4NSVA 2J5UA 4XFQA 2F3CE 3OEED 1QRWA 2GX4A 3SHAH 1N1LA 3GY2A 3TH2H 1BMFD 1GJ6A 8KME2 1TRYA 2XC4A 1UTJA 1GBEA 1V2JT 1A7SA 2A2XH 2H2ZA 1DUAA 3VXEH 2C3SA 4LXBH 1AVGH 1ETSH 4WXVA 1DWEH 2ODQA 2GP9B 1H4WA 4VGCB 3L6PA 1BMMH 3GICB 1ZRBA 1C2IA 3A8CA 3O8CA 2ALPA 3QGJA 1BMLA 1EP6A 3UOPA 5DGJA 2ZHEH 3A7XA 1TQ0B 4ISOA 3GYLB 5GCHG 1GMCG 2A45B 4MPUA 1PQ5A 5T6GA 1O2QA 2ANKH 2FS8A 2GT8A 1ESBA 1BZXE 4AYYB 2FLBH 1DX5M 2GDEH 1UJ1A 1L1GA 3KHVA 3QWCH 2H1UA 3VB3A 4H4FA 5C94A 1A0JA 3F2HA 1DLKB 4JK6A 1EAXA 1QJ1B 1K1LA 1SBWA 4ZKNU 2JETC 4SGBE 2XWBI 3VG8A 1GI8B 3ZZCA 2B0FA 2RA0A 1QB6A 1MU8B 4OM9A 1UCYK 1FY4A 4AN7A 3BIUH 4CBNA 4YOJA 6ESTA 4CRCA 1BUIA 4Y79A 4UFGH 5F53A 4CRDA 4YT7H 3GCHB 4MPVA 1ELCA 3GY6A 1SGIB 2THFB 3LGWA 1SGCA 1O2LA 2WPDD 1UCYE 1B0FA 1YYY1 1QL8A 1HAVB 1O3PB 1F7ZA 4BTUB 2BDYA 3EAJA 2W26A 1S5SA 2BQ7B 2FMJA 1E35B 4OS4A 1EP5A 1O2SA 3I77A 3PROA 1LTOA 5DJ7A 4ISLA 4ZMAH 1C4Y2 1LQEA 1HUTH 2AEIH 1BRBE 4LZ1H 5GWZA 1B5GH 1TNHA 2A32A 3ZZ3A 1F5LA 2IJD1 3OEHD 3RXQA 2BD4A 1EZSC 1S0QA 2JETB 1P3EA 2VIQA 2H9EH 1ETRH 1KXCA 3LGTA 3DUXH 4OGYA 3S9BA 3E6PH 3F2GA 2QE7D 3PB1E 4E7NA 2UWOA 4D76A 3FAOA 2AIQA 4I8HA 1GVLA 2Z9LA 4F55A 4OS5A 3UNQA 5JBAS 3VXFH 3LPRA 1BIOA 4X1QU 5PTPA 1O2JA 1RIWB 1UVOA 4B2BA 1D3QB 1GCTC 1P2QA 3A89A 5LPFA 4I8KA 4NIVA 2HRVA 1MU6B 3AASA 3VPKA 5JBCS 1TMUH 1GJ5H 1FI8A 4ZHLU 4LOYH 4ACBA 3AK5A 1FY1A 2KFWA 3OYPA 3F0OA 6GCHG 9ESTA 2UWPA 3M5MA 1AQ7A 3TLOA 3ATKA 2VWLA 3B8JA 2PWXA 1UTQA 4D9RA 5FBIA 1RXPA 3SGAE 1P01A 1NRQH 2G81E 2V3MA 1FV9A 2ZZUH 1T4UH 3RXFA 2RDEA 2RG3A 3VB7A 1T7CA 1WCZA 3OAAD 1LPZB 4CHAB 2VVCA 2BD8A 1NFUA 3BN9A 2ZO3H 1HIAB 5JB9S 4NSYA 1Y59T 4YTAA 3RXOA 5HYOA 1A4WH 3RXVA 3QTVH 1SL3A 1SLXB 3FKSD 3SZEA 3UNSA 1BHXB 1DSUA 2FWWA 1V3XA 1EQ9A 5EPYA 2EC9H 1IQGA 3E0PB 4OGXA 4X1SU 2VVUA 4MG3A 1WQSA 2NU4E 1NRNH 1SMFE 1E1QD 1HPGA 2F9PA 1YLDA 4CBOA 1W13U 1AWFH 3GDUA 3ODDA 2A0QB 1CA0C 3SV7A 1BTZA 4CR5A 1CVWH 4ABAA 1WBGB 1A5HA 4OS7A 1OOKB 4X2YA 1MKXK 3SZNA 4AGJA 3EQ0H 2P8OB 1DT2A 2D26C 3SI4H 3ATMA 1RTFB 2ZPSA 2JJ1D 3TVJB 4M7GA 1WTGH 4INKA 2PKAB 3AW1A 5T6DA 1Y5BT 5C1UA 1O3BA 3KYFA 3F0PA 4BANB 1ELVA 1FAXA 1EAUA 2PUXB 2VIOA 4KP0A 1P09A 1DICA 4FUDA 3ZZ5A 1ANEA 1W0ZU 3P6ZB 5EW2H 4A6LA 3TH3H 2ZTXA 2K8IA 4I7YH 1Y3XA 1ELAA 2WPKS 2PFEA 2IPQX 1HAHH 4X6NA 1PYTC 3MNCA 1AE5A 2BX3A 2CK3D 1H8IH 2R2MB 2M5TA 2VINA 2XC5A 1VITF 1O3AA 5EJZA 4J1YA 4THNH 3H7OA 5EQSA 1TALA 4FUFA 1UTPA 4B2AA 2A7HA 1GI6A 3T28A 5JB8S 4B74A 2A5AA 4KELA 1EZXC 4FU8A 4KTCA 4OS1A 3ZYEA 1GMDF 5GJ4B 1QR3E 1FIZA 1BBRK 2EA3A 1YPHC 1Y5AT 5ESBA 3DHKH 3P92A 4GSOA 5FPTA 2TRMA 2GMTB 2J92A 1TGTA 5J4SA 3A8AA 1G3EA 4NFFA 3MO3A 4BNRA 2HNTC 4Y11E 2ZGHA 2Z94A 3PYHA 6LPRA 1QFKH 1CHOF 1P8VC 3KN2A 5EW1H 3F6UH 4FUJA 1FN8A 4DT4A 1QQUA 1TONA 4NA9H 4NWLA 1KDQA 2BOKA 2ZDLA 1IHTH 1C1VH 5DP7A 2FOAA 2BD2A 5FPYA 2J4IA 3VFEA 2ZC9H 3DT0H 1ARCA 5DP6A 1O2YA 1JRTA 3T26A 3LGUA 3LIWA 2XC0A 1NM6A 2BD7A 1TBZH 1A1RA 2DE8A 1P12E 3IG6B 1O39A 2QV1A 1LVYA 3U1JB 1RTLA 2FPZA 5T6FA 3SJIA 1UHBB 2QGRA 1INCA 3K65B 2PP6A 3Q3KA 5DP4A 1TOMH 2UUYA 3BTDE 3BTEE 2BOHB 3LC5A 1QGFA 1UMAH 5A0BA 5HGGA 1O30A 2ZWLH 1LVMA 1E0FD 2XW9A 3LGIA 1GHXH 3U28C 2FXRA 1SLWB 2ZU2A 3N7DA 3UTUH 4KTUA 2P16A 2ZEBA 2BLWA 2HNTF 4UFDH 2BYAX 1NESE 1NC6A 1T4VH 2BY7X 1K2I1 2VGCC 1JOUB 3W94A 3RC5A 1EASA 3RUOA 2BD9A 3QGNB 1GVKB 1FX0B 1V2RT 2C4FH 1W0JD 2OBOA 3BG8A 1W8BH 2ZDNA 2QF4A 1GHZA 1GBMA 2FM2A 2WYJA 4Y8ZA 5GIBA 2PTCE 1M9UA 1P2NA 1LVBA 4BXWA 4I31A 3RLYH 1PPFE 5FAHA 3ZVCA 2HLCA 2WINI 2FI5E 1OXGA 3SU5A 3SO3A 4HTCH 1SHHB 1Y8TA 3ELAH 3P17H 1FNIA 3RM0H 1O3HA 3LONA 2WV5A 2TGTA 1DITH 2ZCHP 1HXFH 2RFKC 2YMSB 1K1IA 1DWBH 5FXLA 3MOCA 3MNSA 1Z7KA 1KY9A 5F8XA 4UD9H 1A3BH 1XUFA 3T62A 1L1JA 4TY7A 3MO6A 1CT4E 3T25A 3AVZA 4GPGA 3BTWE 2LNCA 3UPEA 1GBIA 4WMEA 5F8TA 3NXPA 5DSFA 4MVNA 1O2PA 1ACBE 1OP8A 1C9TA 3UQVA 1TNKA 1VZQH 1AO5A 5JDUB 2W6JD 1QURH 1W11U 1Y3YA 2BY6X 2BXTH 2FIRH 2WPMS 2XCFA 3UFAA 1F0SA 2XNDD 2EI7A 1E38B 4YESB 4MNWA 2RCEA 1C5RA 3LGVA 2W6ID 4B73A 5JBTA 4O9VA 1OWHA 2Z3CA 1TBQH 5GDSH 3LH3A 1AZ8A 4BAMB 3ATWA 2G8TA 4AFZA 2R3YA 1NFWA 1OPHB 2XOKD 1O2XA 3QN7A 1G37A 2KX4A 2Y82A 3OY6U 2G5VA 4YM9A 1OYQA 2VIVA 1S82A 2RA3A 1F5RA 1Z8JB 3BV9B 2IPHA 3M7TA 4K1TA 1GGDC 1Q3XA 1O2HA 5DP9A 2XWAA 4R8TB 5EXLA 3RXIA 4NA8A 2UUFB 1O2ZA 2ZDKA 1TGSZ 1V2OT 4IW4E 1JWTA 1O37A 2Q6FA 1KIGH 1GBJA 1C5PA 3U98H 4IS5A 2GCHG 4P00A 1YPMH 3A88A 1OWDA 1VCQA 5C0TA 2ANYA 1DE7H 4QT8C 4JZ1A 4D9QA 2KZ4A 2J34A 1L4ZA 1VR1H 1HYLA 1O34A 4Z1MD 2SNVA 1FJSA 1Y3WA 3MU1A 4JZFH 1P06A 8LPRA 5SGAE 1QBVH 2LP6A 4JCNA 1P02A 3HPTB 5AHGH 1UTOA 3BG4C 1IQFA 1H9LB 3AAVA 7ESTE 2P59A 4X6OA 3U8OH 1IQKA 1SGPE 1ELBA 3ESTA 1D6RA 2GZ8A 1QRXA 1O5CB 4FUIA 2VJ1A 4O03A 1HAXB 1ANBA 2FP7B 2G5NA 1ZHRA 4A1VA 3LKWA 3ZVGA 4FU9A 4Y10E 1DWDH 1GJAB 1TRMA 2GT7A 3SI3H 1W3CA 1D9IA 1MD7A 5HMAA 1ZTKA 3C27B 3M5NA 1ANDA 1HAZB 2B8OH 5E0JA 3N99A 3AAUA 1EOJA 5B6LA 1FN6A 3UUZA 1C1OA 3KGPA 2D1JA 3UR6A 1OYTH 3A84A 2BLOA 5AFYH 1O36A 1O5BB 1Y5UT 1MKXH 2ZGJA 4E05H 1NBME 1Z8RA 2OP9A 1D3PB 5IDKA 1TYNA 4AFQA 1RJXB 4NG9H 3BG4B 4Y8XA 5EODA 2VNTA 1O2GH 1ZHMA 3NPSA 5H4IB 2A7CA 2IOTA 1FDPA 1FY5A 1A61H 1EXFA 3SUDA 1MZDA 4K1SA 1EOLA 3URCA 1ZGIA 3SV8A 4MTBA 1DLEA 5C1XA 4PROA 4BAQB 2GD4B 4O97A 4RSPA 1C1SA 4CH2B 4AZ2B 3PRBA 5L6NH 1P9SA 1KLIH 3I29A 3EYDA 1C2LA 2ZA5A 3STJA 4AOQA 1O2WA 1NT1A 4Y7AA 4UDWH 3MMGA 1C1UH 2WPJS 2VH0A 1IQLA 1FPHH 1PYTD 3URDA 1EB2A 1ZR0A 1KXAA 1F92A 5C20A 2IJOB 1KTSB 1LDTT 3L3TA 2QXHA 4KTSA 1LPKB 1S6FA 3E1XB 5A0AE 5LGOA 3GYMA 1CGHA 3TITA 3UB0A 3U8RH 2BY8X 1YWUA 4X6MA 3SU6A 4NCYA 4ZROA 3FZZA 1BBRH 2CV3A 1MQ6A 1P05A 2WPHS 2VIDA 1GHYH 4ISIH 1SLVB 1TGNA 3M37A 3RXTA 1SQRA 1EZQA 1W7XH 4CRAA 1P3CA 1BQYA 1HFDA 1MZAA 2L6OA 3V3MA 3GCHC 1SOTA 1T8OA 2NU0E 2ZDAH 5K0HA 4DIIH 3BIVH 4Q7YA 2A4QA 3ITIA 1BTWA 2AHME 1Z71A 3FZDA 3EA9A 4IN1A 1O31A 3QZQA 2XYAA 2R2WU 1HDTH 1VITG 5C3NA 4AB9A 1GI7B 3N7OA 3WWBA 1QY6A 1BTUA 1TE0A 1UTNA 1LHFH 1MD8A 1V2TT 4K3JA 1P2OA 1N8OC 1GMDG 1MQ5A 1U6QA 3QDZB 1NZQH 1O3IA 1K1MA 1QCPA 2AERH 1PJPA 2XRCA 1O5GH 6CHAB 3EE7A 1GI3A 3IWMA 1PPCE 1C5MD 1K22H 2WHXA 2NWNA 3ZVFA 3E91A 2WV4A 5E2PA 3SUFA 5C2ZA 4YT6H 1ZPCA 3P70B 3RMOH 3U8TH 2BD3A 4ZXYH 1K1JA 2OC7A 1RIWC 2KAIA 2J2UA 2JIZD 2A7JA 1HXEH 3RC4A 3FP8E 3MFJA 1G3DA 1TLDA 1P2IA 3FVFB 4D8NA 2DUCA 2F4LA 3OTPA 2Z6BD 2CHAB 2A2QH 1MKWK 1ESTA 1N6YA 1RTKA 5B6OA 3ZV8A 3SV9A 1N8OB 1UVUH 1C1TA 1CSOE 1TA6A 1IQHA 1SGEE 2HOBA 4U01A 5FHTA 2AMQA 1C1WH 1EZUC 1GHAG 1MAXA 1BTXA 3H7TA 1E1RD 3F68H 1BJVA 3FP6E 1SGFA 1GJCB 2VIWA 1SKYE 1YPLH 1C2GA 3GY8A 4XOJA 4JZDH 3SGBE 2GDDA 1C5VA 4CHAC 1PQ7A 1GBTA 2SFAA 2GZ9A 3SNBA 1OSSA 3BTGE 1SB1H 3GY7A 1FY8E 2TGPZ 4B75A 4JYVH 1V2WT 1RD3B 1TMTH 3V7TA 2ZPRA 4A7IB 4X8UH 2BQWB 2FX4A 2BY9X 2EI6A 3SNEA 1MTUA 2XXLA 1ZMJA 4XRNA 2TIOA 1CE5A 3IITA 1TQ7B 3PM3A 3LDXH 2W7UA 4E06H 5FPSA 3RXHA 1K1PA 2QYIA 3TJUA 4LK4A 1E36B 4X2VA 3JZ2B 3ZZ4A 3F9FA 1GMHF 3LU9B 1BRAA 1AMHA 1AUJA 1Z8IB 4DIHH 2FOGA 1DOJA 3MQKC 3K2UA 1S0RA 1IOEA 2FI3E 1DM4B 3FN8A 4JK5A 4XBDA 2ZU4A 4ESTE 3U69H 3BTFE 4UFFH 3U1IB 2ZP0H 1SGFG 2B9LA 2J94A 2P8OC 1PFXC 2ESTE 2O9QA 3RC6A 5L30H 2V3OH 4IMZA 3RXJA 3T5FH 5DPAA 1D3DB 2F9NA 1GBFA 3PLKA 5I25A 2UUKB 1OKXA 3ZVEA 1QB1A 1MCVA 3A86A 4U32A 4K5ZA 3TK5A 2Q6DA 2ZGBH 1C5YB 4UEHH 2AH4X 3BTTE 2CGAA 2ZFPH 4YLUA 4X1RU 3VGCC 2P3TB 1BCUH 4INLA 1A3EH 1SQAA 5EXMA 2ZI2H 1BHXF 1VCWA 1TPOA 1Y3UA 3NZIA 5F8ZA 1V2KT 3SNCA 2OBQA 1XMNB 1GHWH 1V2ST 1J16A 3GY5A 2W3KA 5FCKA 1ID5H 2QF0A 1C4U2 5DN6D 1ZMLA 3F9GA 1P04A 5AFZH 4ZUHA 1HBTH 2KR7A 2O8WA 2JDID 1HLTH 3GCOA 2ZU3A 4MNVA 7GCHF 2Z9KA 1XKBC 1E37B 3RMNH 1C5XB 3VB6A 1JMOH 3ATIA 5FBEA 1TNGA 3I78A 1YPHE 4HI3A 1AKSB 3VGCB 4ZHAA 3O8BA 2ZFFH 3A8BA 5EJLA 2ZTZA 3FFGA 1ARBA 4K60A 1Z6JH 2P93A 3ZVBA 2HWLB 3RM2H 2GMTC 7LPRA 2HNTE 1BTYA 3QO6A 2FOMB 1LHGH 1G36A 1DXWA 4BAHB 2XBWA 3P8GA 2H6MA 2R9PA 2BDAA 3WW7A 3OSYA 3UR9A 2ZFSA 2QN5T 1VJAU 1J9CH 3TU7H 2F9BH 3Q00A 1GHVH 1F0RA 3GISB 1BDAA 1W7GH 1YM0A 2ODYB 4AFUA 1ORFA 1SQTA 3KNXA 4AC9A 4ASUD 4DVAU 1DVAH 2K1QA 2C90B 1MTNC 3KQ5A 4ZKOU 1Q2WA 1AVWA 1F2SE 1XUIA 3TPIZ 2ZNKH 1E34B 1UVSH 2WYGA 4DG4A 5I46H 1NRRH 3BEIB 3E90B 1XVOA 1ZTLA 3S7KB 1J17T 5GCHF 2ZHQH 3GCNA 1QIXB 1T8MA 1LVOA 1QBNA 1DSTA 2O8TA 4ABDA 3A7ZA 3TH4H 3T2NA 2FI4E 4ABIA 2TBSA 3B23B 1PPHE 1SR5C 2ZFQH 2BDBA 1C5LH 1V2UT 1GDQA 3CNRA 3RDZA 3DD2H 1VCPA 1MTSA 2KM0A 2R3UA 1LO6A 3W1EA 2Y5GA 3S9AA 2J38A 4RN6A 1G30B 2FOBA 4DW2U 3A81A 2WZQA 2ZGCA 1AE8H 2OD3B 3ZZAA 1MTNB 4I8GA 3SV2H 4Q7XA 4X1PU 1LKAA 5EGMA 3ZYDA 3RXMA 1YCPM 4Z6AH 4TWYA 2RDLA 4BAKB 2GTBA 2HPPH 3S69A 3PMBB 9LPRA 1ZMNA 1RS0A 4XBCA 2FX6A 1BMAA 1TB6H 4K2YA 1HJAB 3MH7A 2BVXH 3NUMA 1OP0A 5DP3A 1C5UA 1DWCH 1NBMD 1QJ7B 1ZTJA 1ZSJA 4UONA 2SGEE 4DY7B 4A5TS 1JIRA 2Y7XA 1IQNA 2LPRA 3T27A 3KQEA 1DANH 3H09A 4ZKRU 2YMSC 3E16B 4DJZB 1NY22 1SGNE 2BQ6B 5HIYA 2CF8H 1MBMA 3DSPA 3A7YA 1DS2E 2A4RA 8GCHG 1SHYA 3ZVDA 1S84A 2ZFTA 1AB9B 1ESAA 4WVPE 2BM2A 2QCYA 1MTWA 2ZHWH 1AWHB 1A5GH 4K8YA 1SGRE 3PLPA 4K1EA 1GDUA 1RRKA 3ZVAA 3TGKE 3SU0A 1COWD 5LPRA 1TPSA 3KL6A 4IGDA 3S9CA 3NKKA 3R3GB 1BOQA 1SVPA 3SUEA 1QL9A 2CXVA 1SG8B 4X2XA 1UCYH 3F2FA 1O32A 2BMGB 1C5TA 2XCNA 6GCHF 2C8ZB 5A09A 1UVPA 3D49H 2GVFA 4X6PA 2QC2A 4B6FA 1FY3A 3M61U 3VEQB 3RXLA 5C1YA 2BTCE 3RXAA 1HAVA 1OHHD 3A7VA 1O2VA 1T8LA 3DSOA 3GCTF 2PSYA 1TGCA 1ANCA 2J95A 2CJIA 3PTNA 1PPZA 1TNIA 2XBYA 4B2CA 2FYRA 2AMDA 1TFXA 2AGEX 2V7QD 1OP2A 4J2YB 4AFSA 3TJOA 2BD5A 1ABIH 1GG6C 5KGOA 3VB5A 2BDCA 3PMHB 1O5EH 4TPIZ 4Z0KA 5TCCA 4AG1A 1SLUB 1NFXA 5EOKA 1IQMA 1LMWB 2OC8A 1TGBA 1V2MT 1O3NA 3MTYA 1NS3A 1OWKA 1MAYA 2D2DA 1W0YH 4IC6A 1O3EA 4WY3A 1HNEE 4WXIA 5A0CA 4X8VH 2TGDA 3QLPH 4O3TA 2AGGX 3SN8A 4RT1A 3AW0A 4FUEA 1G3CA 1TABE 2EQNA 2ZCLP 3MHWU 2AMPA 4ABFA 1GI5A 1GJ9B 5JBBS 4B76A 2EEKA 1PQAA 3SJ9A 1O35A 4IBLH 3FP7E 4Y0YE 3PO1C 4FUHA 5FCRA 1C5QA 3MI4A 1VITH 1L1NA 1V2QT 1B0EA 3RXBA 1DY9A 1QNJA 2A1DB 3CS7A 1O2KA 4ABGA 1CGJE 1EAWA 1GG6B 1C2HA 1KXEA 1S85A 3HGPA 1GI2A 1K0HA 1KLJH 1S6HA 1FQ3A 1O2MA 3KQCA 3UIRA 4AGKA 3OTJE 1EAIA 1V2LT 5CMXH 1UK4A 1D3TB 1KTTB 1O3FA 2JH5D 2H9HA 3UWIA 3D23A 2J98B 1GHBF 2NU1E 2ZKSA 1P10A 3A83A 3TK9A 3ZZ8A 3TIUA 1C2EA 2B7DH 1HIAA 3LOXA 1AUTC 1J8AA 4INHA 5EXNA 3RMMH 3EE0B 2VIPA 5HM9A 5EQQA 3BF6H 1P9UA 1G2MA 2HLDD 1BMNH 2OUAA 2Y5HA 3Q76A 2TPIZ 1Q31A 1OWEA 1GL0E 3PO1B 1OS8A 1W2KH 1HCGA 3C1KA 1PPGE 3M7UA 5CHAC 1GWAA 1C5WB 1LPGB 1QTFA 2BDHA 2K0QA 2SGDE 3MYWA 3MU0A 1NU9A 1SGQE 2FO9A 4BAOB 3RU4E 1EPTC 2VBCA 3SHCH 1AGJA 1D4PB 2WSSD 1SSXA 3BEUA 2PLXA 1HGTH 3A82A 2J9NA 5DK1A 4BXSA 4HZHA 1JRSA 2R0KA 2DE9A 1THRH 3RXSA 1EUFA 1O3CA 2JKHA 2GGVB 3ZZ9A 2FZZA 1X7AC 2PKSB 3RXGA 4XBBA 3V0XA 1GBBA 5DG6A 3O8RA 3OFND 3M3TA 2GZ7A 5C5OA 3PV2A 1AVXA 1K1NA 2PKAA 3KQDA 2Z3DA 1TNLA 4MDSA 2OQ5A 1FUJA 1P03A 1GI9B 4GCHF 5CHAB 3RXCA 2AGIX 4AORA 2OINA 3DFLA 1NROH 2Y81A 1W12U 1XKAC 1EPTB 1MBQA 1V6DA 1ZZZA 1V2PT 5ABWA 3EA7A 1GL1A 2ANMH 2M2AA 5ETXA 1GBLA 4R0IA 3WWFA 5E2OA 2PSXA 4AYVB 4FUGA 1A0HB 2WPLS 3E3TA 4O3UA 5IYTA 5T3HA 4HG6A 2SGQE 1BITA 5T1VA 5C0UA 1GI1A 2V3HH 2BVRH 2ZHFH 2IN2A 4UE7H 1OWJA
chains in the Genus database with same CATH topology
2ZF0H 3ODFA 1LCYA 2O8MA 1Y3VA 2VH6A 3TGIE 4BTIB 1CU1A 3GDSA 1IQJA 5GPIB 4D7GA 2XTTB 2FOHA 2G4UA 3A87A 3QUMP 2CF9H 6CHAC 3K6ZA 1ELGA 3TK6A 2Z9IA 3MH6A 1GJ7B 1QA7A 3BTQE 1TAWA 3SW2B 3BSQA 1HV7A 1WAYB 3MH5A 1WU1A 1Z1JA 3KQBA 1CBWB 2Z3EA 2A4GA 1AN1E 3D62A 3QTOH 4U30A 4UFEH 3M3VA 1KLTA 1VJ9U 5TCAA 4TWWA 3BTME 4XSKU 4MPWA 1DFPA 1GJDB 2OTVA 2CHAC 2F9VA 1HAYB 1H8DH 2STAE 3GOVB 4WWYA 2C93B 2GCTB 1D6WA 4AX9H 1LHEH 3HATH 4KKDA 1O3OA 1YGCH 1ZSLA 4A92A 1CA8B 2F83A 4NFEA 1UO6A 4TYDA 3L33A 4JZIA 1UHBA 1GI0A 1ZHPA 2FOFA 2QXIA 1TBRH 4B71A 1Z1IA 4GAWA 3LJJA 3LGYA 1O2NA 1O3KA 4Y71A 3K6YA 3RXRA 4WH6A 1F0TA 2WUBA 1CHOG 1L2EA 3JZ1B 4Y0ZE 3A7WA 1AIXH 1FLEE 4NGAH 4CRFA 1DPOA 1DY8A 5A2MH 1W14U 4SGAE 4DT7B 1BTHH 3M5OA 1BA8B 2VWNA 4KGAA 2FS9A 5JYIA 1RFNA 2SGPE 1SGYE 3G01A 1B7XB 2W5EA 1WOFA 4E7RG 1F0UA 1AFQC 4K8BA 3DA9B 1XX9A 4F49A 3HKIB 3Q3YA 1IHSH 1ZGVA 3PTBA 3EA8A 1XUJA 2AIPA 1DDJA 1V2NT 1JBUH 3SJKA 1J14A 4ZXXH 2AYWA 4FUBA 1TA2A 1PPBH 2FLRH 1YBWA 2OXSA 2PHBA 5C5NA 4ZKSU 3SJ8A 1HB0B 3SUGA 3QK1A 5AVDA 4GLYA 1SI5H 1EJMA 5EG4A 2I6QA 1XUGA 2FOEA 3SQEE 2PTNA 2YNAA 2OCVB 1K9OE 3P8NA 2C8XB 4A1XA 2H9TH 2WUCA 1ETTH 3M36A 2GCHF 5L2ZH 1GBAA 4B1TA 3SU3A 2AS9A 3RLWH 1YPGH 1AY6H 2NU2E 4H42U 4NIYA 1AFQB 3ZZ7A 1A2CH 4IC5A 2GKVE 3MNXA 4Q7ZA 4AB8A 4X8SH 2ZECA 1A5IA 1P57B 1UTLM 3OX7U 4JZEH 2R0LA 1HJ8A 4ASHA 2QF3A 3RXDA 1AU8A 1JIMA 3A8DA 4WF8A 2BZ6H 1Z8GA 1QL7A 2A5IA 1GBHA 1V2VT 1O3DA 2PR3A 3RXUA 2SGFE 4ISNA 1C9PA 4YOIA 2YOLA 3PWCA 3M3SA 2ZDMA 2P94A 4AG2A 1O3JA 3H5CB 4ISHH 4FVBA 3CP7A 3OY5U 1G3BA 2BXUH 4A1TA 2G52A 1O3MA 4NZQA 1ZJKA 4D7FA 2BLVA 1NU7B 1LHDH 3GCTG 1IQEA 1TOCB 1ABJH 2BZAA 2OQUA 4HGCA 1H1BA 1MCTA 3F1SB 1O5DH 1QQ4A 1YPJH 1GCTB 1GJ8B 1TWXB 2QIQA 1ZPZA 1BTPA 1C5OH 1SC8U 1Z6EA 2BY5X 2ZG0H 3QZRA 5LH8A 5A8YA 1C1MA 5DKMA 1YPKH 1SPJA 8ESTE 1O0DH 3A7TA 1YC0A 1FIWA 4XE4A 3SORA 3SU1A 5JPMH 2UUJB 1UK2A 3TJVA 1ZJDA 3SQHE 2FTMA 4FVDA 4ABHA 1JXPA 1HAOH 4X8TH 3R0FA 1ELEE 2ZPQA 3KCGH 3TGJE 2ZGXH 2W7SA 1PPEE 2QAAA 1CT0E 3E0NB 3ZZDA 5E0HA 2C8WB 1GBKA 1C2FA 4Q80A 1GBDA 2PV9B 3NK8A 5DP5A 1FAKH 1C2DA 2P3UB 1THPB 1FZZA 3S7HB 1C1RA 1GJ4H 1EKBB 3MU8A 4JMYA 4WH8A 3HK6B 2WPIS 1MTVA 1O5FH 4MNYA 2FOCA 1BRCE 1O2IA 4Y8YA 3F9EA 4NIXA 1C5SA 1YCPK 1GHBG 1G2LA 1HAGE 1THSH 2OC1A 1ZRKA 1CA0B 1EJAA 2VWMA 5J4QA 2ODPA 2A5KA 1EB1H 3HGNA 1O2TA 1KXDA 3ZV9A 2ILNA 2PGBB 1AD8H 2ZU1A 3P8OA 5GXPA 3UREA 4ABEA 4ABJA 1FXYA 4OS6A 1HAIH 2ZHDA 2XBXA 3SU2A 1C1QA 2A4OA 2VB0A 1O33A 1GMCF 1HJAC 1SFQB 4FXGH 1XXFA 3CS0A 1C1PA 3V12A 4XDEA 1EPTA 1QJ6B 2H5CA 3FANA 4NWKA 1NPMA 1ZLRA 4DOQA 4WJG2 3LC3A 1YP9A 2Z9JA 3TNTA 4BTTB 1YF4A 2ULLA 3MO9A 3GDVA 3NWUA 1T8NA 3PMAB 1CQQA 2JH0D 4CRGA 3S0NA 3F9HA 4MLFB 4ZH8A 3E8LA 3RU4D 1BBRE 3UY9A 1L4DA 1AB9C 2W3IA 5EQRA 1XVMA 3UWJH 3BEFB 1GVZA 2QXJA 3PWBA 1UTKA 1HRTH 4YZUA 2Y80A 4CR9A 4GCHG 5K7RA 2PGQB 1C2KA 3TJNA 1A46H 3UNRA 4GHQA 4ZHMU 1NFYA 4Y76A 2ASUB 1UTMA 4Q2KA 5C67A 5F6MA 1L0ZA 3SV6A 4TY6A 1TIOA 2SGAA 3QX5H 4WMDA 2ZDVH 3VB4A 5FX5A 1NRPH 1MMJN 1GHAF 1C5NH 1TMBH 1RGQA 1TPPA 1YPEH 1ELFA 1O2UA 1WSSH 1S81A 3BTKE 2FTLE 3LH1A 1EJNA 4GVUA 1P11E 4CH8B 1K1OA 3RXPA 5LPEA 4U2WA 2KAIB 2UWLA 3V13A 1FONA 1O38A 1VGCC 2I6SA 1UVTH 5EU8A 1CO7E 2Y5FA 2HPQH 1TX8A 2F91A 5ESTE 4RKOB 2ZQ1A 1WUNH 1H9IE 1G9IE 2BB4A 1W10U 3SOSA 2H5DA 3LJOA 2VVVA 1WV7H 2BHGA 1UK3A 3SBKA 4CREA 1KYNA 3P95A 2G51A 2QA9E 2GV6A 1LQDB 1ZPBA 2PUQH 2O8LA 2G00A 5F03A 4X2WA 2C8YB 1O5AB 2CN0H 1XUKA 2GV7A 1H9HE 4FU7A 4MQAA 4NA7A 1ZYOA 3MNBA 2G55A 3SGQE 5E0GA 2D8WA 1AZZA 4I32A 5BRRE 1NN6A 1QRZA 2STBE 3A80A 2VU8E 7KMEH 1HJ9A 1VGCB 2PW8H 1CHGA 1G32B 1YLCA 1C5ZB 3DFJA 4IMQA 4YO9A 5FX6A 1EATA 1ELDE 1KXFA 1MKWH 5BPEA 2EI8A 3HK3B 3K9XB 3SU4A 3UOUA 1OX1A 1SQOA 2VGCB 3EDXB 1NRSH 1YKTA 3Q3XA 1T32A 2F9UA 5HXFA 3MH4A 1P2JA 1TRNA 3B9FH 4YLQH 2NU3E 1SOZA 4JYTA 1MUEB 1SGDE 4X1NU 1O3GA 4OS2A 2BX4A 2TGAA 2XNIA 5A8XA 2A31A 1C2JA 4TPYA 3MWIU 1BB0B 1TPAE 5HM2A 3SNDA 2BDGA 4FUCA 1O2OA 1QB9A 1XUHA 2FESH 5A8ZA 2FODA 4H6SB 2XBVA 3ZZBA 1DUEA 3W95A 1C1NA 1J15A 1WYKA 5CE1A 4HFPB 5AF9H 3M7QA 1C4V2 3ZZ6A 3EGKH 2Z9GA 5TJXA 3MU4A 3PMJA 2P3FH 4IN2A 3D65E 2FDAA 3M35A 2Z7FE 5DO4H 3GY3A 3TNSA 2SNWA 3KF2A 1BJUA 4GHTA 3PV4A 3Q77A 1S83A 1TNJA 2Y7ZA 2HGTH 3NCLA 2ZCKP 4X0WU 3ATLA 2PKSC 4YOGA 1BT7A 1GBCA 4NIWA 4CRBA 5E8EH 5DP8A 1QA0A 3RXEA 3A85A 2BDIA 1GJBB 2JH6D 1XM1A 2ZQ2A 2YNBA 4MNXA 3RMLH 3LT3A 3KEEA 1K28D 3WY8A 1KXBA 3CENA 1BRUP 1P2MA 3MU5A 1QHRB 1P2KA 1ZOMA 1EX3A 1C2MA 1CGIE 4GUXA 1GGDB 3SNAA 3RP2A 1AI8H 1GMHG 2Q1JA 3M5LA 1ZSKA 1ELTA 1LHCH 2QY0B 1XXDA 1GCDA 1AHTH 2CMYA 2F9OA 5L2YH 2B5TB 3UQOA 2AFQB 3BTHE 2QXGA 1TX7A 4NZLA 4DGJA 1WTHD 2P95A 2HVXA 2V6NA 1PQ8A 3GY4A 3OU0A 4K69A 4I8LA 3KIDU 1T31A 2ZIQH 2ZFRH 2FEQH 4I8JA 3U9AH 1WQVH 1FMGA 1FPCH 3O8DA 1SGTA 2V0BA 1GDNA 1AKSA 1MH0A 2HALA 4MPXA 4Y7BA 1OWIA 4F4OC 5EPNA 2FYQA 1AFEH 3HKJB 1KSNA 3P8FA 1IQIA 4RKJB 3RU4T 1DXPA 1CT2E 2O8UA 5G4BA 1CBWC 1LKBA 3PLBA 2G4TA 4BOHA 4I33A 2ALVA 2ANWA 1SFIA 1NO9H 4DURA 7GCHG 1K21H 1O3LA 4ZAEA 1YCPH 2OLGA 1QBOA 1A0LA 1IAUA 3T29A 4DCDA 2Y6TA 1N6XA 1P0SH 4VGCC 2GCTC 1KDQB 1TX6A 2Q6GA 4LZ4B 2V35A 4JYUH 4Y6DA 1O2RA 3SJOA 2ZTYA 1NTPA 2OC0A 1F5KU 2BVSH 3STIA 8GCHF 4ABBA 1HAPH 3RXKA 2VWOA 3ENSB 4H6TA 4WMFA 2ZU5A 1GI4A 1GPZA 2BLQA 4NSVA 4XFQA 2F3CE 1QRWA 2GX4A 3SHAH 1N1LA 3GY2A 3TH2H 1GJ6A 8KME2 1TRYA 2XC4A 1UTJA 1GBEA 1V2JT 1A7SA 2A2XH 2H2ZA 1DUAA 3VXEH 2C3SA 4LXBH 1AVGH 1ETSH 4WXVA 1DWEH 2ODQA 2GP9B 1H4WA 4VGCB 3L6PA 1BMMH 3GICB 1ZRBA 1C2IA 3A8CA 3O8CA 2ALPA 3QGJA 1BMLA 1EP6A 3UOPA 5DGJA 2ZHEH 3A7XA 1TQ0B 4ISOA 3GYLB 5GCHG 1GMCG 2A45B 4MPUA 1PQ5A 5T6GA 1O2QA 2ANKH 2FS8A 2GT8A 1ESBA 1BZXE 4AYYB 2FLBH 1DX5M 2GDEH 1UJ1A 1L1GA 3KHVA 3QWCH 2H1UA 3VB3A 4H4FA 1A0JA 1DLKB 4JK6A 1EAXA 1QJ1B 1K1LA 1SBWA 4ZKNU 2JETC 4SGBE 2XWBI 3ZZCA 1GI8B 2B0FA 2RA0A 1QB6A 1MU8B 1UCYK 1FY4A 4AN7A 3BIUH 4CBNA 4YOJA 6ESTA 4CRCA 1BUIA 4Y79A 4UFGH 4CRDA 4YT7H 3GCHB 4MPVA 1ELCA 3GY6A 1SGIB 2THFB 3LGWA 1SGCA 1O2LA 1UCYE 1B0FA 1YYY1 1QL8A 1HAVB 1O3PB 1F7ZA 4BTUB 2BDYA 3EAJA 2W26A 1S5SA 2BQ7B 2FMJA 1E35B 4OS4A 1EP5A 1O2SA 3I77A 3PROA 1LTOA 5DJ7A 4ISLA 4ZMAH 1C4Y2 1LQEA 1HUTH 2AEIH 1BRBE 4LZ1H 5GWZA 1B5GH 1TNHA 2A32A 3ZZ3A 1F5LA 3RXQA 2BD4A 1EZSC 1S0QA 2JETB 1P3EA 2VIQA 2H9EH 1ETRH 1KXCA 3LGTA 3DUXH 4OGYA 3S9BA 3E6PH 3PB1E 4E7NA 2UWOA 4D76A 3FAOA 2AIQA 4I8HA 1GVLA 2Z9LA 4OS5A 3UNQA 5JBAS 3VXFH 3LPRA 1BIOA 4X1QU 5PTPA 1O2JA 1RIWB 1UVOA 4B2BA 1D3QB 1GCTC 1P2QA 3A89A 5LPFA 4I8KA 4NIVA 2HRVA 1MU6B 3AASA 3VPKA 5JBCS 1TMUH 1GJ5H 1FI8A 4ZHLU 4LOYH 1FY1A 3OYPA 6GCHG 9ESTA 2UWPA 3M5MA 1AQ7A 3TLOA 3ATKA 2VWLA 3B8JA 2PWXA 1UTQA 4D9RA 5FBIA 1RXPA 3SGAE 1P01A 1NRQH 2G81E 1FV9A 2ZZUH 1T4UH 3RXFA 2RG3A 3VB7A 1T7CA 1WCZA 4CHAB 1LPZB 2VVCA 2BD8A 1NFUA 3BN9A 2ZO3H 1HIAB 5JB9S 4NSYA 1Y59T 4YTAA 3RXOA 5HYOA 1A4WH 3RXVA 3QTVH 1SL3A 1SLXB 3UNSA 1BHXB 1DSUA 2FWWA 1V3XA 1EQ9A 5EPYA 2EC9H 1IQGA 3E0PB 4OGXA 4X1SU 2VVUA 4MG3A 1WQSA 2NU4E 1NRNH 1SMFE 1HPGA 2F9PA 1YLDA 4CBOA 1W13U 1AWFH 3GDUA 3ODDA 2A0QB 1CA0C 3SV7A 1BTZA 4CR5A 1CVWH 4ABAA 1WBGB 1A5HA 4OS7A 1OOKB 4X2YA 1MKXK 3SZNA 4AGJA 3EQ0H 2P8OB 1DT2A 2D26C 3SI4H 3ATMA 1RTFB 2ZPSA 3TVJB 4M7GA 1WTGH 4INKA 2PKAB 3AW1A 5T6DA 1Y5BT 5C1UA 1O3BA 4BANB 1ELVA 1FAXA 1EAUA 2PUXB 2VIOA 4KP0A 1P09A 1DICA 4FUDA 3ZZ5A 1ANEA 1W0ZU 3P6ZB 5EW2H 4A6LA 3TH3H 2ZTXA 4I7YH 1Y3XA 1ELAA 2WPKS 2PFEA 1HAHH 4X6NA 1PYTC 3MNCA 1AE5A 2BX3A 1H8IH 2R2MB 2M5TA 2VINA 2XC5A 1VITF 1O3AA 4J1YA 4THNH 3H7OA 5EQSA 1TALA 4FUFA 1UTPA 4B2AA 2A7HA 1GI6A 3T28A 5JB8S 4B74A 2A5AA 4KELA 1EZXC 4FU8A 4KTCA 4OS1A 3ZYEA 1GMDF 5GJ4B 1QR3E 1FIZA 1BBRK 2EA3A 1YPHC 1Y5AT 5ESBA 3DHKH 3P92A 4GSOA 5FPTA 2TRMA 2GMTB 2J92A 1TGTA 5J4SA 3A8AA 1G3EA 4NFFA 3MO3A 4BNRA 2HNTC 4Y11E 2ZGHA 2Z94A 3PYHA 6LPRA 1QFKH 1CHOF 1P8VC 3KN2A 5EW1H 3F6UH 4FUJA 1FN8A 1QQUA 1TONA 4NA9H 4NWLA 1KDQA 2BOKA 2ZDLA 1IHTH 1C1VH 5DP7A 2FOAA 2BD2A 5FPYA 2J4IA 3VFEA 2ZC9H 3DT0H 1ARCA 5DP6A 1O2YA 1JRTA 3T26A 3LGUA 3LIWA 2XC0A