1EKBB

The serine protease domain of enteropeptidase bound to inhibitor val-asp-asp-asp-asp-lys-chloromethane
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
235
structure length
235
Chain Sequence
IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ENTEROPEPTIDASE
publication title Crystal structure of enteropeptidase light chain complexed with an analog of the trypsinogen activation peptide.
pubmed doi rcsb
source organism Bos taurus
total genus 48
structure length 235
sequence length 235
ec nomenclature ec 3.4.21.9: Enteropeptidase.
pdb deposition date 1999-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ekbB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ekbB01
1VITG 4AG2A 2PKSB 2W7SA 3P95A 1O37A 1MBQA 5EW1H 1A46H 3UR6A 1HXEH 2GX4A 3PMAB 4GCHG 1O3NA 1XXDA 1QY6A 2QF3A 2BD5A 1FY4A 1THPB 1GGDC 3KHVA 3LONA 4FVDA 1KDQB 5EPYA 1HAVB 3JZ1B 2G4TA 2XW9A 1YPGH 4DIIH 3PLBA 4NA7A 1SGEE 1Z1IA 2BDIA 1E37B 2ANKH 2O8MA 3BG8A 2VINA 3QWCH 2JH5D 1GPZA 3ZZBA 2JKHA 1FY1A 1FXYA 3RMMH 2RCEA 2V6NA 1YYY1 1ACBE 3U1IB 2DE8A 1MU6B 1XVMA 1MBMA 2ZG0H 3LDXH 4LZ4B 2W5EA 5DK1A 1P11E 2Z3CA 1TRMA 1V2MT 1GI3A 1RGQA 4WMDA 4WY3A 2TGAA 1HAPH 1LQEA 3KNXA 1SG8B 3LGTA 3LIWA 2AMDA 1HRTH 4GSOA 4B75A 1FPCH 1J16A 5ESBA 4DW2U 1H9LB 2G8TA 4OS7A 2FYQA 4U01A 2CJIA 3M5MA 4ABBA 3QTOH 2AGEX 1HJAB 1S0QA 1SGQE 5A8YA 1NRRH 4Y7BA 2FI3E 3A85A 3ZV8A 1MZAA 4BTUB 1JWTA 1AIXH 1GHBG 3ATWA 3Q3XA 1ELBA 1O5GH 1RFNA 2P8OC 1FAKH 2J38A 1MKXH 5GPIB 1ARBA 2G52A 1FONA 1TGBA 4ABIA 2BD3A 1P3CA 4AG1A 1HFDA 3FAOA 4ISOA 1C2KA 4KELA 1XMNB 3MU0A 3ATMA 2G4UA 5EU8A 3PWBA 1IQMA 2H9HA 4NZQA 1TX6A 4MDSA 1EOLA 5J4QA 3FANA 5DP8A 2ZCLP 2XYAA 4Y6DA 4CRCA 1P2MA 1OWHA 5FX6A 2GZ9A 3PTNA 2BX3A 2G51A 5JDUB 1P2OA 1NROH 2ZP0H 1A5IA 1FPHH 1LVBA 2BVRH 4K3JA 5LPFA 1DVAH 1OWKA 4K1SA 2V3HH 3EA9A 7ESTE 2BYAX 4MNYA 1SQAA 3K9XB 1AFQB 2ZU5A 1CGIE 1GHAG 1ELAA 2BB4A 1T31A 4BAKB 4K8YA 1NPMA 1O2SA 1QIXB 4AGJA 1C5WB 3LJOA 1WQVH 1EZUC 2FI4E 3U1JB 5JB9S 2WV5A 1W13U 1GMDF 3KEEA 1MKWK 1ETRH 1VCPA 3NZIA 1SLUB 1O30A 1EUFA 4NA9H 5DP7A 1GCDA 3F9EA 4K69A 1GBHA 1C2HA 1IQLA 1DY8A 2B0FA 4XSKU 4INLA 1NO9H 2FTMA 1P10A 2Q6DA 5GXPA 1ZMJA 4AB8A 1GDNA 1QBVH 3B8JA 1BBRH 3UNQA 1C2JA 2FESH 1SLXB 3K6ZA 4Y8YA 3H7OA 1V6DA 2Z9KA 4PROA 1FY5A 4WXIA 4ABJA 1OP0A 3MU1A 1HIAA 1V2VT 3RXAA 5E0GA 4TWYA 1DUAA 2ZHWH 5JYIA 4X8VH 1GJ7B 3TJNA 2QA9E 2P59A 3S7KB 4INKA 3B9FH 4CHAB 2FZZA 3EQ0H 2EA3A 2OQ5A 1YLCA 4GPGA 4DOQA 4JYUH 3L3TA 7KMEH 1KTTB 1GBJA 3RXHA 1ZGVA 1F2SE 4ABEA 1FZZA 5EOKA 4FUJA 3LJJA 5FCKA 1VGCC 1EPTB 3V13A 4HGCA 1A5HA 3QLPH 2J4IA 1S6HA 2VGCC 4Q7XA 3HPTB 2J94A 4VGCC 3PV4A 3DA9B 2XC5A 1CA0C 4NIWA 3NKKA 5SGAE 3MH7A 2TGDA 2F3CE 3T5FH 3ZVFA 1C5UA 2W7UA 1CBWC 3E3TA 1MCVA 1MTSA 3RC6A 1TGSZ 1V2UT 3SGQE 5DPAA 3SNBA 4SGBE 5B6OA 2BDYA 1DLKB 2ZFQH 4IBLH 1DSTA 1AUJA 1HGTH 2NU4E 2OC8A 2UUJB 3BTFE 4I8GA 3UQVA 1ZLRA 3ZYEA 1O3JA 2Y80A 3STIA 1BHXF 3AASA 1C1NA 1J14A 1ETSH 3GY7A 3QK1A 4ABFA 3SQEE 3SGBE 2C8XB 5PTPA 2ZDLA 2ZFPH 3MU8A 5DP5A 3SQHE 1C1SA 1FUJA 1TPOA 3BTKE 1AZ8A 1SQTA 2A7HA 3RLWH 1GJBB 5A0CA 1O2TA 4BXWA 2ANMH 5E0HA 2G55A 3GCNA 3MO3A 7GCHF 4UFFH 1O34A 1D9IA 1PQ8A 2EI6A 4WH6A 5DP6A 5ETXA 2WPJS 1F7ZA 1IOEA 3KF2A 3SU2A 1GBTA 1A2CH 1BTHH 1GJCB 3UUZA 2H6MA 1LKBA 2CGAA 3MH5A 8LPRA 4QT8C 2FODA 1O2UA 1O3IA 2WYGA 1ELVA 2GDDA 2EI8A 3A8CA 5LPEA 1S84A 2PTNA 3QO6A 1QRWA 4IC5A 3VXFH 2VNTA 3A80A 4IN2A 4AX9H 2CHAC 2GCTB 1K2I1 3VB6A 1F92A 2WINI 1O2OA 2ZF0H 3TJVA 2R0LA 1ZJKA 1XUIA 6ESTA 1XUGA 5E2PA 1IHTH 1C5TA 1ZRBA 1C9TA 5T6DA 2GGVB 1ARCA 2KAIB 2FOBA 2FX6A 3EYDA 4RSPA 4AORA 3V0XA 4MPXA 4ABDA 1GBCA 3QDZB 1QQ4A 5JB8S 1Z7KA 2FI5E 2J34A 3RXDA 1V2WT 1QTFA 1SGCA 2HPQH 1TE0A 2AFQB 3RXVA 5DO4H 4JYTA 1AI8H 1T32A 2AYWA 1GHYH 1TNJA 3C1KA 3F6UH 2Y7ZA 3SGAE 1DWCH 3OYPA 4JZ1A 4WXVA 1AVGH 3E8LA 4B73A 2NWNA 3PMJA 1C5VA 1V2KT 1IQKA 5LH8A 1NC6A 5GCHF 1ZMLA 3RXLA 1ZZZA 5F6MA 3A7ZA 1UTLM 2QCYA 4WH8A 2Z9GA 5C3NA 4FXGH 4OGXA 1A3BH 1P05A 3SU0A 1G3BA 1VCQA 1Z8RA 1NT1A 1PQAA 1UTMA 1IQGA 1C5XB 1P06A 6CHAC 1O3FA 2W3IA 3PYHA 1ZJDA 2PTCE 2XCNA 4NFFA 3ENSB 1GJ9B 9ESTA 3QGJA 4A1VA 3LT3A 1G3EA 1SGRE 1BT7A 2ALPA 2BD2A 3FZZA 3TU7H 1DDJA 2PKAA 4IS5A 1ELGA 2ZHFH 1C9PA 3BEFB 3PTBA 4JYVH 2AH4X 1HAIH 2HPPH 4IN1A 1S82A 1C5LH 3BIVH 2PUQH 2VIPA 4YOIA 1KXBA 1C1OA 1HJ8A 2GMTC 1BTYA 3UTUH 2R3UA 1EP5A 1IQIA 2ZU1A 2ZA5A 2BLVA 3K65B 2VIOA 3BIUH 3H7TA 1MAXA 2BD8A 1BTZA 4ZKRU 2RA3A 3UIRA 1AVXA 2ZFRH 1HBTH 3DFLA 4WMEA 1D6RA 1J9CH 2OP9A 1HAXB 1P9UA 3BTME 3CS7A 1GI2A 1O5BB 1YCPH 1L1GA 4H6SB 2D1JA 4Y0ZE 1EOJA 3T25A 3BSQA 2H5DA 1NN6A 3SU4A 1JRSA 2RDLA 3TVJB 2GVFA 2ZHEH 3LH3A 4NIVA 4R0IA 3M7UA 1LVOA 2R2WU 3Q76A 4E05H 1JRTA 1SLWB 2ILNA 1UTPA 2QV1A 1MTNC 1RRKA 3L33A 5JBAS 3SZNA 4MNVA 1T4UH 1VGCB 2P93A 1IQNA 2HNTF 5GJ4B 1VJ9U 2BLWA 3NK8A 1O2VA 2UUKB 2BMGB 2Y7XA 3A88A 4I31A 5C5OA 1IQFA 4VGCB 1C4V2 1CA0B 4ASHA 1BA8B 1C1VH 1D3DB 3RC5A 1N8OC 1CBWB 5T3HA 1GJ8B 1MD7A 1GBFA 4UEHH 1FN6A 1XKBC 5K0HA 1C2LA 3HGNA 2Z94A 4X1RU 1O2QA 2PLXA 4X6NA 2B5TB 4H42U 2ZGHA 4HZHA 4CRFA 4UFDH 2F9NA 1EKBB 1TOMH 3TIUA 3RUOA 1UTQA 2WPIS 1BMNH 2ASUB 3KCGH 1ZTKA 3W94A 1GHVH 1AZZA 3KL6A 1F0RA 2OC1A 3HKJB 3URDA 2BLQA 2SGDE 3U8OH 3LGUA 1TGNA 5EXLA 1S6FA 2VVVA 1ZTJA 4Y7AA 1P2QA 2NU2E 1KLIH 1O3PB 1WQSA 4CRDA 1V2OT 4A5TS 2BD7A 5CHAB 1DWEH 3O8CA 2GT8A 3SU5A 4JMYA 1L1JA 3F68H 4WWYA 1EJNA 1FY3A 3O8RA 1SFIA 1ZSJA 4ZROA 5EGMA 3SJOA 3MTYA 1GJDB 4B2AA 1TX7A 2UWOA 3BN9A 1AD8H 1EAUA 1K22H 5EXNA 2A32A 1QURH 4LOYH 1ZGIA 1QL7A 1LCYA 4FUHA 3SJKA 1IHSH 1GL1A 2AGIX 1OWJA 3ODFA 2A0QB 1F5LA 5A0BA 1CHOF 3A86A 1GBLA 5H4IB 1SHYA 1BMLA 4TY6A 3ZZ5A 2BM2A 2Z6BD 1QJ1B 1V2PT 2CHAB 3MOCA 2H2ZA 3SORA 4I32A 4BAHB 4CRAA 4GAWA 4ZH8A 1ELFA 3VB3A 1PYTC 3L6PA 1YPHC 4F49A 1TGCA 2FLBH 3RXSA 1CU1A 1L2EA 5F8ZA 4GUXA 1QNJA 2TBSA 4X8SH 1WCZA 3SHCH 3SU6A 1A0HB 2J95A 4NSYA 1JMOH 2WPKS 5F03A 2B9LA 1H8IH 2CXVA 4O03A 1IAUA 3VFEA 1O2XA 4D9RA 4GHTA 3DFJA 4Q7YA 2VIWA 1HIAB 2OQUA 3EDXB 3HATH 4GLYA 2FOFA 5HGGA 4U2WA 3SNDA 3ZZ8A 2ZGBH 1DITH 1BQYA 2FDAA 2BVSH 1YF4A 1CGJE 2Y82A 2FM2A 1F5RA 1ZOMA 1CE5A 1TLDA 1KY9A 3SN8A 3SBKA 2R3YA 2ZNKH 1XM1A 3ZZDA 1LVYA 2GV6A 2ZFSA 4Y76A 2XXLA 2UWLA 3KGPA 1UK3A 2ALVA 4D7FA 3LGVA 2BY6X 1AUTC 1PFXC 1VITH 3HKIB 5DP4A 2G81E 3GISB 4NG9H 4IGDA 3RXOA 1YP9A 2P16A 1C2IA 1VZQH 3PLKA 3UR9A 1BBRK 1UCYE 1YM0A 3GCTF 6CHAB 2A7JA 2ODQA 1TGTA 1UVTH 1P01A 1SHHB 1PPCE 1S5SA 2SGFE 4NIYA 2P3FH 1P3EA 1EZSC 1AU8A 2FOEA 4BTIB 1JOUB 1UK4A 3SNEA 2Z7FE 2FOAA 3MFJA 2ZDVH 1Y3YA 1PPFE 3EGKH 2WV4A 1S85A 1BMMH 4AFQA 1XUHA 3DHKH 1ELTA 1O2PA 3ITIA 3JZ2B 1C2FA 1GDUA 1YPLH 2P3TB 5DP3A 2XBWA 3ZVBA 2IPHA 1O2MA 2IOTA 1TNKA 1Y3UA 1TQ0B 1D3TB 1SPJA 2QN5T 1B0EA 3ZZ4A 2ZHDA 2G5VA 4X6MA 5HXFA 1EX3A 2GMTB 2GD4B 1K21H 4K1EA 3UWIA 2FYRA 4INHA 1FI8A 4MPWA 8GCHG 1O2ZA 2FLRH 1AGJA 2QXHA 2STBE 1TPSA 3SJ8A 1NFWA 1C5SA 4U30A 2F9PA 3RXQA 4DT7B 2NU3E 4A92A 3A83A 4ZAEA 1Y5AT 2LPRA 4X8UH 2AMPA 3TITA 3DUXH 4OS6A 4Y0YE 3TK6A 4A6LA 5DKMA 1SGIB 1KIGH 1QL9A 2WPLS 3A7YA 3TLOA 5A8ZA 5BRRE 1O2JA 4TYDA 4X2VA 5L30H 1C1QA 2P94A 4HI3A 2ZTYA 2ZQ1A 1VCWA 1XUKA 1SGFA 1QB6A 1PPHE 3RM2H 1E35B 2XCFA 4ISIH 5I25A 1K9OE 3M7QA 1X7AC 4A1TA 2FTLE 2HOBA 1G3CA 2BQ6B 3QN7A 2ZGJA 4O97A 3T62A 1MTNB 3FP6E 3R3GB 4B1TA 2ZHQH 1OWDA 2AERH 1GVKB 4MTBA 1F0TA 1IQJA 3QTVH 2A5KA 1GJ4H 3FVFB 2C8YB 5AHGH 2C8WB 1ESTA 1KLTA 2WYJA 4MQAA 1L4DA 1O35A 2ZDKA 2UUYA 1ZSKA 2O8WA 1XX9A 1N8OB 1DUEA 5JBBS 1G32B 1OXGA 2RA0A 1O2GH 2DE9A 1GI5A 3ZZCA 4TPYA 3UOUA 3SV8A 1CT2E 1SQOA 1N6XA 1V2RT 3D23A 3M35A 2PGQB 1DWBH 3I29A 2XBVA 1ABIH 4I33A 2IJOB 3KQDA 1UVOA 3OX7U 2UWPA 3ELAH 2ZTXA 1TMTH 5GIBA 3B23B 2UUFB 6GCHF 1EB2A 2XC4A 4X1PU 4DCDA 2SGEE 4K8BA 4Y8ZA 1XVOA 1DANH 5C20A 2PW8H 3RMLH 3K6YA 3ODDA 1P12E 3TGKE 2A4QA 2C90B 2JH0D 4TPIZ 1WBGB 3GYMA 5C1XA 3TNSA 1D6WA 1LPKB 1O5EH 1H1BA 1A0LA 1LHDH 1BRBE 1K1PA 1PPZA 1QHRB 3F9FA 1GMCF 1NFXA 5DG6A 3MI4A 1HCGA 1G3DA 3BEIB 1AWHB 3EA8A 4X0WU 2QY0B 5FPTA 2HLCA 4B74A 2PKAB 3AW0A 3RM0H 2F91A 2HGTH 4ABGA 2OC0A 5FPYA 4BOHA 3WY8A 4R8TB 4X6OA 2Z9IA 1H4WA 1ORFA 2DUCA 2PSXA 4JZIA 1QCPA 2VIQA 3RU4D 3SUFA 1P57B 2HWLB 2H5CA 3P92A 1OWEA 4KTUA 4I7YH 2A1DB 4ZXXH 3F9HA 5ESTE 4LZ1H 1C5NH 1Z8GA 1TBRH 3TH3H 1VITF 1Y59T 4I8KA 1G30B 1GHZA 1ZR0A 2NU0E 1A4WH 4GCHF 2CMYA 1NRPH 1J8AA 2QXGA 1NRNH 2Y6TA 1V2ST 1WTGH 1BITA 4FUGA 2BXTH 1P2IA 3RXCA 1GGDB 2FPZA 3OY5U 1O36A 3G01A 2HVXA 1O3DA 3F9GA 1PPGE 1DY9A 1QB9A 3LU9B 2P3UB 3P8OA 3U9AH 1GDQA 1C1PA 2OD3B 1Q3XA 4RN6A 1TQ7B 1XUFA 4NWLA 1AHTH 3IG6B 3BG4C 1CA8B 1GI0A 1P2JA 2ZIQH 3NPSA 2GCHF 3KQCA 4MVNA 5EQRA 3ZVAA 4X1NU 4A1XA 3ZVEA 1QB1A 2BOHB 2W3KA 5CE1A 3D49H 2XRCA 4JK5A 2AIPA 3MYWA 1OS8A 3URCA 4X2XA 3MO6A 5EQSA 3E90B 1DT2A 1O3EA 4RKJB 1GWAA 1K1OA 1N6YA 1THSH 1UVSH 3SUGA 4DJZB 1AY6H 3VEQB 4B76A 1Z8IB 2BY7X 5BPEA 5EG4A 1GHXH 3RLYH 5FAHA 4KGAA 1K1MA 5I46H 1W7GH 1G9IE 1U6QA 2W26A 1QJ7B 1TPPA 2H9EH 3SUDA 3SO3A 1BRUP 1GHBF 5TCCA 2BD4A 3ZZAA 2JETC 1YCPK 1OYTH 3TGIE 5CMXH 2M5TA 4FUEA 4IMQA 2P8OB 3UOPA 1SFQB 4MNXA 1EXFA 4UDWH 3MNSA 5GWZA 2V35A 2V3OH 3RXRA 1DM4B 4Y8XA 2SGPE 1BMAA 1O3MA 3VGCC 3E0NB 3TH4H 2P95A 2ZCKP 1H9IE 3P6ZB 6LPRA 1OSSA 1BCUH 1GG6C 2FX4A 4OGYA 3GY5A 1ELDE 2NU1E 2ZU3A 3CS0A 3A89A 3I77A 1EAWA 4FU9A 3MHWU 2R2MB 3UPEA 3Q3KA 4ABHA 1ESAA 2J2UA 1BTXA 2I6SA 1W7XH 3RXFA 4BANB 4NZLA 4WMFA 1GHAF 2ZI2H 3BTWE 1SGDE 1HV7A 2XBYA 2F9UA 4FUFA 4KKDA 1EAXA 1RJXB 4CR5A 1O2YA 5A09A 1SLVB 1UTJA 3O8DA 4RKOB 3VPKA 4UE7H 3RXGA 2EC9H 3HGPA 1HAGE 1V2NT 1O2WA 4ISHH 1F0SA 1SVPA 5F8TA 3PMBB 3V12A 2GZ8A 2A5IA 1HUTH 1C5OH 1C1WH 2FOGA 3ZZ6A 3LGYA 2Z9LA 1W0YH 2R9PA 1WU1A 2HNTE 1W0ZU 1SGNE 4KP0A 4HFPB 2FOMB 3MH6A 4YT7H 1THRH 4D7GA 3FP8E 1AB9C 3M5LA 4TWWA 4Z6AH 1T7CA 5L2YH 1LDTT 3VB4A 4ZHMU 4YOGA 1W14U 2BY9X 3A7VA 3SOSA 2XC0A 3U98H 2AS9A 5J4SA 1LKAA 4I8LA 2R0KA 4BNRA 1HAOH 4DVAU 5A2MH 3RC4A 2VWOA 1KYNA 1S83A 3TGJE 1G2LA 1TNLA 3NXPA 4YESB 1DFPA 3MMGA 3LC5A 1V2QT 1P8VC 4D76A 3GY3A 1CT4E 1Q31A 1P9SA 1AFEH 2GZ7A 1GBAA 1BTWA 1Q2WA 1W11U 1O32A 1SOTA 1FMGA 5AF9H 2PHBA 2FS9A 4ZKNU 1P2KA 2VVUA 3MU4A 1KLJH 4AFSA 2ZO3H 4UONA 1GCTC 1C2MA 1NFUA 2VGCB 2FXRA 1B7XB 1W8BH 2F9BH 2XNIA 3A7XA 3GICB 8ESTE 5HYOA 2A4GA 5JBTA 3PO1C 3LGIA 2AGGX 2XBXA 2BD9A 2YNBA 1UTOA 1KTSB 1ID5H 4HTCH 2OC7A 3TNTA 4MNWA 3IITA 1TA2A 1GHWH 4ZUHA 3ATIA 3E0PB 5K7RA 3OU0A 1MQ6A 3SJ9A 4XBDA 5C1UA 2TPIZ 1S0RA 2THFB 1AMHA 2QAAA 1GMDG 1NU7B 5TJXA 1RIWC 1T8OA 2IN2A 3SU3A 1O2NA 3E91A 4YZUA 4I8JA 3S9BA 1A61H 7LPRA 5DGJA 1JBUH 2PV9B 3EA7A 1W2KH 2D26C 1AWFH 1RTFB 3BTGE 4FUBA 1NU9A 2BX4A 5FBEA 2WUBA 3MNBA 1K1IA 3FP7E 1FY8E 1G2MA 1TRNA 1A3EH 4ZHLU 2BTCE 4X6PA 1LMWB 2WUCA 1QBOA 3VB7A 3TJOA 1ZRKA 3S9CA 1KXDA 1ZPZA 3P70B 2SGAA 2SNVA 1CSOE 4YOJA 3LC3A 1QRXA 4YTAA 5HMAA 3RXTA 2J92A 4BAQB 1T4VH 2JH6D 3BG4B 1BZXE 2YOLA 1C5PA 4Q80A 1QQUA 2ANYA 1K28D 2A2XH 1YGCH 5C67A 4Y11E 1CHGA 1SI5H 4JZEH 1D3QB 1KXFA 3RMOH 4B71A 1GMCG 2A31A 1AE8H 2QC2A 3A87A 4OS2A 3LGWA 2AEIH 2F9VA 1FQ3A 1TFXA 1O3AA 1KXAA 1XUJA 1DICA 2Y5GA 5FX5A 1UMAH 1TYNA 3NWUA 4KTSA 1Y3XA 1QFKH 1O5AB 3N7OA 5T6GA 1BIOA 1E38B 1ZHMA 2VB0A 3PM3A 1C5YB 2C93B 2BDBA 2OCVB 4X8TH 2ZGCA 2JETB 5IDKA 1MD8A 1SR5C 1A0JA 3RXUA 2Q6FA 1CQQA 2OUAA 1INCA 2QGRA 2ULLA 3GY4A 2Q6GA 3UQOA 1O5CB 1P0SH 3MWIU 1UJ1A 4X2YA 4JZFH 5C1YA 3CP7A 1ETTH 1MTVA 3F1SB 3RU4E 1O39A 1ZPCA 1ANEA 1ZYOA 4ZXYH 2ZECA 4Y71A 1DOJA 1WSSH 2ZC9H 1DSUA 3MNCA 3VGCB 4CBNA 3D65E 4UD9H 3E16B 4E7RG 1IQHA 1ZMNA 7GCHG 1GG6B 1O3LA 1H9HE 3RXJA 3GCHC 5E8EH 1Y3WA 2A4OA 2C4FH 3M5OA 1W12U 1HNEE 4O9VA 4AFZA 4AZ2B 1GI8B 4NCYA 3UREA 1C2GA 2SFAA 4OS5A 4XOJA 3V7TA 3E1XB 2TRMA 1Y3VA 3V3MA 2PGBB 4H6TA 1DS2E 1GBBA 1GI6A 1CVWH 2B7DH 3P8NA 3AAUA 4OS4A 2LNCA 3T28A 2FIRH 1TA6A 1DWDH 2GCHG 1MH0A 1QA0A 2GCTC 3M5NA 1YLDA 2ANWA 1GI7B 1O3BA 2WPHS 3GY6A 1O3KA 1TWXB 2VU8E 4LK4A 3M3SA 1VJAU 1C2EA 3RXKA 1RD3B 1EATA 3RXEA 1FV9A 2ZFFH 3LKWA 2XWBI 1WUNH 4Y79A 1HXFH 2GV7A 4XE4A 1M9UA 3BTEE 3U8RH 1A7SA 2GDEH 3K2UA 1JIRA 1HJ9A 3Q3YA 4XBCA 5L2ZH 1HLTH 1WV7H 2ZDMA 1MU8B 1JIMA 2O8TA 1QR3E 2VJ1A 2YNAA 2BOKA 1AB9B 2ZWLH 1EZQA 4IW4E 3ATLA 4O3TA 1RTLA 3SNAA 4MPVA 4YT6H 1XXFA 1TX8A 2BQ7B 3KIDU 4CR9A 4DY7B 2QXJA 1WYKA 3GYLB 1BDAA 3RXBA 3U8TH 1PYTD 5G4BA 3MH4A 5TCAA 1YKTA 4GHQA 3QUMP 4BXSA 3SHAH 1GJ5H 1UVUH 4E06H 3M7TA 1AKSB 3TK9A 5HM9A 1T8MA 1ANDA 1RS0A 5GCHG 1E34B 4M7GA 3LH1A 3RXPA 3ZZ3A 1LTOA 4DIHH 1SGTA 4NSVA 1Z8JB 4ZKSU 1AE5A 1AQ7A 5EW2H 2XWAA 3RXIA 1P04A 2ZPSA 1GJAB 2I6QA 2OBQA 1Z6EA 5EPNA 1GCTB 1NESE 2SGQE 3C27B 4FUIA 5L6NH 1KXEA 1MMJN 1LHFH 1KXCA 3RMNH 4WJG2 3RDZA 3PO1B 3M61U 4NFEA 3OTJE 5JPMH 2D2DA 4J1YA 4NGAH 1C4U2 1P09A 2OINA 2ZU2A 4NA8A 4SGAE 2FOHA 1C2DA 3P17H 3MU5A 3D62A 4ABAA 1OYQA 4CH8B 1LQDB 1MZDA 5DP9A 2GP9B 2GT7A 4CRBA 3PLPA 4Q7ZA 1DXWA 4JCNA 1UHBB 1RIWB 4X1QU 1O5DH 4O3UA 1OWIA 3S0NA 1GMHF 1O38A 1FIWA 5EQQA 1EQ9A 1TOCB 5EXMA 4ISLA 2A4RA 4DG4A 1GI1A 1BTUA 3BTDE 2ZPRA 3T29A 2TIOA 1HAHH 1O3HA 1BB0B 1O5FH 4K5ZA 4BAMB 4BTTB 1WOFA 4YM9A 1O3OA 1GBMA 4FU8A 1EB1H 1S81A 4FUDA 1ABJH 4YLUA 4D8NA 4ZMAH 1HAYB 3AAVA 3GDVA 3FZDA 5GDSH 1O2KA 3NCLA 4ZKOU 1C5ZB 1GBKA 1O3GA 1KDQA 3AVZA 1HAVA 4CH2B 5FXLA 1O33A 1Y5UT 3HK3B 1ANBA 2H9TH 3MO9A 1ANCA 1V2LT 1FJSA 3M36A 1AVWA 2OLGA 2QXIA 3KQBA 1TNHA 2G5NA 3A7TA 1O2LA 2CV3A 3SV6A 3VXEH 3A8DA 4TY7A 4UFGH 2ESTE 3GDUA 1F5KU 4FUCA 4A7IB 2ZU4A 1T8LA 1SC8U 2BDGA 2BQWB 3A8BA 1TRYA 3QGNB 1EAIA 1YPEH 2TGPZ 2A2QH 2HRVA 1FIZA 1H8DH 4Y10E 2F83A 1LHGH 2ZQ2A 2B8OH 2RG3A 2ZTZA 3GOVB 4THNH 1BOQA 2BZAA 1O0DH 5FPSA 1MCTA 1ZTLA 1MTUA 5AVDA 2OBOA 3T2NA 4CREA 1LHEH 2FWWA 3DD2H 2VWNA 4K60A 4IC6A 3MNXA 4K1TA 2STAE 1K1JA 1ZPBA 1Z71A 1MAYA 4B2CA 1PQ5A 5FBIA 1T8NA 4B2BA 4JK6A 1EASA 3KN2A 1MKWH 5CHAC 1WTHD 1GVLA 1G37A 2BVXH 2OTVA 1LPGB 1FN8A 1XKAC 1AKSA 3GCHB 3GCOA 2BXUH 2CN0H 1TNGA 1RTKA 2PR3A 3T27A 3ATKA 1D3PB 3EAJA 5JBCS 1OKXA 3A84A 4AOQA 2TGTA 3DT0H 3BEUA 3UNSA 1P2NA 2PUXB 3SV2H 1L1NA 1NFYA 3LOXA 3S69A 5C2ZA 4XFQA 3BTHE 4LXBH 3QZRA 1TIOA 1CHOG 2EEKA 2BLOA 1UTNA 1CGHA 1OX1A 1BBRE 2VH6A 3M3VA 4AYVB 1DX5M 1C5RA 2FOCA 1VR1H 4I8HA 1O3CA 1BUIA 2ZDNA 2GKVE 2QYIA 2PKSC 3R0FA 3SV7A 1GL0E 1EP6A 2C8ZB 1UHBA 1BRCE 1L0ZA 8GCHF 1E0FD 1YBWA 1TNIA 2O8UA 3ZVDA 1YPKH 1NM6A 3OSYA 3H5CB 4FU7A 1QL8A 1CO7E 2Z3DA 3Q77A 4K2YA 4D9QA 1L4ZA 2BDHA 4MG3A 3A82A 2BY8X 2AMQA 2ZPQA 4WVPE 1NY22 1GBDA 1BJVA 2J9NA 2C3SA 1GVZA 5C5NA 1UO6A 3PWCA 1NZQH 3EE0B 1UCYK 5IYTA 4XDEA 1GI4A 3TJUA 3A7WA 1UTKA 3SI3H 5A8XA 1N1LA 1W10U 1BTPA 1UK2A 5E0JA 5ABWA 1OP8A 2ZGXH 1FAXA 1O2RA 1P02A 1ZHRA 2VIDA 1EJMA 2BZ6H 9LPRA 4KTCA 4DGJA 5A0AE 1LPZB 1Y5BT 2BDCA 1DLEA 1P03A 3KQEA 3TK5A 1J15A 2ZZUH 1PPBH 3GCTG 1EPTA 3SI4H 1HJAC 3I78A 4U32A 1ELEE 3S9AA 3STJA 1QJ6B 2F9OA 2SNWA 4FVBA 4CBOA 1C4Y2 2ZCHP 2G00A 4X1SU 1YPJH 4IMZA 3PMHB 2PSYA 3SJIA 3OY6U 3W95A 1SB1H 3QX5H 3ZZ9A 1SL3A 3UNRA 1UVPA 2WPMS 2AIQA 3M3TA 3P8FA 3NUMA 1FDPA 2FEQH 2H1UA 2PFEA 4E7NA 3FFGA 2Y81A 1EZXC 2ZKSA 4H4FA 1SGYE 1QA7A 1HAZB 3LPRA 2V0BA 3RU4T 1C1UH 2ODPA 2A45B 4CRGA 4JZDH 1WAYB 2VIVA 3IWMA 2O8LA 1OOKB 2ZEBA 3SUEA 5EODA 1LHCH 3UWJH 1ZHPA 3BF6H 1TMUH 3U69H 1PQ7A 3M37A 1MQ5A 1GI9B 1MUEB 3Q00A 1MTWA 3E6PH 3PB1E 1TMBH 4Z0KA 3A81A 2ZDAH 2FMJA 5DJ7A 3TPIZ 3QZQA 3GY2A 8KME2 1AFQC 1HDTH 3SV9A 1YPHE 4MLFB 1V2JT 3RP2A 1ZSLA 2A7CA 2VH0A 4Q2KA 1Y8TA 1TALA 1TPAE 3HK6B 1C5QA 1D4PB 2XTTB 4DURA 2QF0A 1O2HA 2HALA 4XBBA 3ZVCA 4ESTE 1TB6H 1DPOA 1K1NA 3AW1A 1FNIA 1HYLA 1QRZA 3BTTE 1C1MA 3S7HB 1NRQH 5LPRA 2BDAA 1UCYH 1YCPM 1ESBA 1SSXA 1NRSH 1BRAA 1GBIA 2ZFTA 1EJAA 2Z3EA 3A8AA 4AFUA 4BAOB 1PJPA 1OPHB 1SOZA 1C1RA 2Y5HA 3ESTA 2D8WA 1E36B 4ZHAA 1RXPA 2KAIA 3ZV9A 3O8BA 4NIXA 5T6FA 5HM2A 1B0FA 3CENA 4OS1A 5FCRA 5LGOA 2BY5X 3ZVGA 1PPEE 1FLEE 4GVUA 3ZYDA 1V2TT 4X2WA 3VB5A 4YLQH 2K1QA 1SMFE 3PROA 1YC0A 1GJ6A 2BHGA 2VWMA 2HNTC 1O31A 5AFYH 1NTPA 1GMHG 1AN1E 4CHAC 3TH2H 6GCHG 4NWKA 1ELCA 4AGKA 3BV9B 1V3XA 3UFAA 2VVCA 1NS3A 2VWLA 2PWXA 2FP7B 3P8GA 1AO5A 1HB0B 2FO9A 4AB9A 1HPGA 1K1LA 2QIQA 1TABE 2Z9JA 1W3CA 1OP2A 2ODYB 4J2YB 1EPTC 1A1RA 2A5AA 4F4OC 2OXSA 3SU1A 1B5GH 5F8XA 4UFEH 1TONA 1DXPA 1SBWA 1BHXB 1LO6A 4MPUA 5E2OA 1MKXK 2FS8A 1LVMA 2CF9H 1J17T 1Z1JA 4YO9A 1JXPA 1KSNA 5AFZH 1CT0E 1TBQH 2EI7A 3BTQE 3RXMA 5FHTA 1C1TA 1QGFA 1Z6JH 4AN7A 4AYYB 1A5GH 1BJUA 1IQEA 3ZZ7A 2Y5FA 1QBNA 4WF8A 2CF8H 1GBEA 3GY8A 1G36A 3UY9A 3SNCA 1C5MD 1SGPE 3SW2B 1SGFG 3T26A 2O9QA 3GDSA 2Q1JA 1TAWA 1TBZH 1YPMH 2GTBA 4ISNA 1O2IA 1F0UA 1DE7H
chains in the Genus database with same CATH superfamily
1VITG 4AG2A 2PKSB 2W7SA 3P95A 1O37A 5CHBA 1MBQA 5EW1H 1A46H 3UR6A 1HXEH 2GX4A 3PMAB 4GCHG 1O3NA 1XXDA 1QY6A 2QF3A 2BD5A 1FY4A 1THPB 1GGDC 3KHVA 3LONA 4FVDA 1KDQB 5EPYA 1HAVB 3JZ1B 2G4TA 2XW9A 1YPGH 4DIIH 3PLBA 4NA7A 1E1RD 1SGEE 1Z1IA 2BDIA 1E37B 2ANKH 2O8MA 3BG8A 2VINA 3QWCH 2JH5D 3W1EA 1GPZA 3ZZBA 2JKHA 1FY1A 1FXYA 3RMMH 2RCEA 2V6NA 1YYY1 1ACBE 3U1IB 2DE8A 1MU6B 1XVMA 1MBMA 2ZG0H 3LDXH 4LZ4B 2W5EA 5DK1A 1P11E 2KCOA 2Z3CA 1TRMA 1V2MT 1GI3A 1RGQA 4WMDA 4WY3A 2TGAA 1HAPH 1LQEA 3KNXA 1SG8B 3LGTA 3LIWA 2AMDA 1HRTH 4GSOA 4B75A 1FPCH 1J16A 5ESBA 4DW2U 1H9LB 2G8TA 4OS7A 2FYQA 4U01A 2CJIA 3M5MA 4ABBA 3QTOH 2AGEX 1HJAB 1S0QA 1SGQE 5A8YA 1NRRH 4Y7BA 2FI3E 3A85A 3ZV8A 1MZAA 4BTUB 1JWTA 1AIXH 1GHBG 3ATWA 3Q3XA 1EFRD 1ELBA 1O5GH 1RFNA 2P8OC 1FAKH 2J38A 1MKXH 5GPIB 1ARBA 2G52A 1FONA 1TGBA 3WW7A 2BD3A 4ABIA 2LP6A 1P3CA 4AG1A 1HFDA 3FAOA 4ISOA 1C2KA 4KELA 1XMNB 3MU0A 3ATMA 2G4UA 5EU8A 3PWBA 1IQMA 2H9HA 4NZQA 1TX6A 4MDSA 1EOLA 5J4QA 3FANA 3OEHD 5DP8A 2ZCLP 2XYAA 4Y6DA 4CRCA 1P2MA 1OWHA 5FX6A 2GZ9A 3PTNA 2BX3A 2G51A 5B6LA 5JDUB 1P2OA 1NROH 2ZP0H 1A5IA 1FPHH 1LVBA 2BVRH 4K3JA 5LPFA 1DVAH 1OWKA 4K1SA 2V3HH 3EA9A 7ESTE 2BYAX 4MNYA 1SQAA 3K9XB 1AFQB 2ZU5A 1CGIE 1GHAG 1ELAA 2BB4A 5C0UA 1T31A 4BAKB 4K8YA 1NPMA 1O2SA 1QIXB 4AGJA 1C5WB 3LJOA 1WQVH 1EZUC 2FI4E 3U1JB 5JB9S 2WV5A 1W13U 1GMDF 3KEEA 1MKWK 1ETRH 1VCPA 3NZIA 1SLUB 1O30A 1EUFA 1W0JD 4NA9H 5DP7A 1GCDA 3F9EA 4K69A 1GBHA 5EJ1A 1C2HA 1IQLA 1DY8A 2B0FA 4XSKU 4INLA 1NO9H 2FTMA 1P10A 2Q6DA 5GXPA 4P00A 1ZMJA 4AB8A 1GDNA 1QBVH 3B8JA 1BBRH 3UNQA 1C2JA 2FESH 1SLXB 3K6ZA 4Y8YA 3H7OA 1V6DA 2Z9KA 4PROA 1FY5A 4WXIA 4ABJA 1OP0A 3MU1A 1HIAA 1V2VT 3RXAA 4FOUC 5E0GA 4TWYA 1DUAA 2ZHWH 5JYIA 3F2FA 4X8VH 1GJ7B 3TJNA 2QA9E 2P59A 3S7KB 4INKA 3B9FH 4CHAB 2FZZA 3EQ0H 2EA3A 2OQ5A 1YLCA 4GPGA 4DOQA 4JYUH 2XNDD 3L3TA 1KTTB 7KMEH 1GBJA 3RXHA 1ZGVA 1F2SE 5C17A 4ABEA 1FZZA 3H09A 5EOKA 4FUJA 3LJJA 2F4LA 5FCKA 1VGCC 1EPTB 3V13A 4HGCA 1A5HA 3QLPH 2J4IA 1S6HA 2VGCC 4Q7XA 3HPTB 2J94A 4VGCC 3PV4A 3DA9B 2XC5A 1CA0C 4NIWA 3NKKA 5SGAE 3MH7A 2TGDA 2F3CE 3T5FH 3ZVFA 1C5UA 2W7UA 1CBWC 3E3TA 1MCVA 1MTSA 3RC6A 1TGSZ 1V2UT 3SGQE 5DPAA 3SNBA 4SGBE 5B6OA 1E79D 2BDYA 1DLKB 2ZFQH 4IBLH 1DSTA 1AUJA 1HGTH 2NU4E 2OC8A 2UUJB 3BTFE 4I8GA 3UQVA 1ZLRA 3ZYEA 1O3JA 2Y80A 3STIA 1BHXF 3KQ5A 3AASA 1C1NA 1J14A 1ETSH 3GY7A 3QK1A 4ABFA 3SQEE 3F2HA 3SGBE 2C8XB 5PTPA 2ZDLA 2ZFPH 3MU8A 5DP5A 3SQHE 1C1SA 2QF4A 1FUJA 1TPOA 3BTKE 2RDEA 4F55A 2K0QA 3OE7D 1AZ8A 1SQTA 2A7HA 3RLWH 1GJBB 5A0CA 1O2TA 4BXWA 2ANMH 5E0HA 2G55A 3GCNA 3MO3A 3FKSD 7GCHF 4UFFH 1O34A 1D9IA 1PQ8A 2EI6A 4WH6A 5DP6A 5ETXA 2WPJS 1F7ZA 1IOEA 3KF2A 3SU2A 1GBTA 1A2CH 1BTHH 2J98A 1GJCB 4XRNA 3UUZA 2H6MA 1LKBA 2CGAA 3MH5A 8LPRA 4QT8C 2FODA 1O2UA 1O3IA 2WYGA 1ELVA 2GDDA 2EI8A 3A8CA 5LPEA 1S84A 2K8IA 2PTNA 1QRWA 3QO6A 4IC5A 3VXFH 2VNTA 3N7EA 3A80A 4IN2A 4AX9H 2CHAC 2GCTB 1K2I1 3VB6A 1F92A 3NRLA 2WINI 2KR7A 1O2OA 2ZF0H 3TJVA 2R0LA 1ZJKA 1XUIA 6ESTA 1XUGA 5E2PA 1IHTH 1C5TA 1ZRBA 1C9TA 5T6DA 2GGVB 1ARCA 2KAIB 2FOBA 2FX6A 3EYDA 4RSPA 2WSSD 4AORA 3V0XA 4MPXA 4ABDA 1GBCA 3QDZB 1QQ4A 5JB8S 1Z7KA 2FI5E 2J34A 3RXDA 1V2WT 5GNDA 1QTFA 1SGCA 2HPQH 1TE0A 2AFQB 3RXVA 5DO4H 4JYTA 1AI8H 1T32A 2AYWA 1GHYH 1TNJA 3C1KA 1NBMD 5KECA 3F6UH 2Y7ZA 3SGAE 1DWCH 3OYPA 4JZ1A 4WXVA 1AVGH 3E8LA 4B73A 2NWNA 3PMJA 1C5VA 1V2KT 1IQKA 5LH8A 1NC6A 5GCHF 1ZMLA 3RXLA 1ZZZA 5F6MA 3A7ZA 1UTLM 2QCYA 4WH8A 2Z9GA 5C3NA 4FXGH 1H8ED 4OGXA 1A3BH 3UB0A 1P05A 3SU0A 1G3BA 1VCQA 1Z8RA 1NT1A 1PQAA 1UTMA 1IQGA 1C5XB 1P06A 6CHAC 1O3FA 2W3IA 3PYHA 1ZJDA 2PTCE 2XCNA 4NFFA 3ENSB 1GJ9B 4Z1MD 9ESTA 3QGJA 4A1VA 3LT3A 1G3EA 1SGRE 1BT7A 2ALPA 2BD2A 3FZZA 3TU7H 1DDJA 2PKAA 4IS5A 1ELGA 2ZHFH 2JIZD 1C9PA 3BEFB 3PTBA 4JYVH 2AH4X 1HAIH 2HPPH 4IN1A 1S82A 3PRBA 1C5LH 3BIVH 2PUQH 2VIPA 4YOIA 1KXBA 1C1OA 1HJ8A 2GMTC 1BTYA 3UTUH 2R3UA 1EP5A 1IQIA 2ZU1A 2ZA5A 2BLVA 3K65B 2VIOA 2WPDD 3BIUH 3H7TA 1MAXA 2BD8A 1BTZA 4ZKRU 2RA3A 3UIRA 1AVXA 2ZFRH 1HBTH 3DFLA 3DSGA 1D6RA 1J9CH 4WMEA 2OP9A 1HAXB 5DSFA 1P9UA 3BTME 3CS7A 1GI2A 1O5BB 1YCPH 1L1GA 4H6SB 2V7QD 2D1JA 4Y0ZE 1EOJA 3T25A 3BSQA 2H5DA 1NN6A 3SU4A 1JRSA 2RDLA 2WV9A 3TVJB 2GVFA 2ZHEH 3LH3A 4NIVA 4R0IA 3M7UA 1LVOA 2R2WU 3Q76A 4E05H 1JRTA 1SLWB 2ILNA 1UTPA 2QV1A 1MTNC 1RRKA 3L33A 4F48B 5JBAS 3SZNA 4MNVA 1T4UH 1VGCB 2P93A 1IQNA 2HNTF 5GJ4B 1VJ9U 2BLWA 3NK8A 1O2VA 2UUKB 2BMGB 2Y7XA 3A88A 4I31A 1UW7A 5C5OA 1IQFA 4VGCB 1C4V2 1CA0B 5F53A 4ASHA 1BA8B 1C1VH 1D3DB 3RC5A 1N8OC 1CBWB 5T3HA 1GJ8B 1MD7A 1GBFA 4UEHH 1FN6A 1XKBC 5K0HA 1C2LA 3HGNA 2Z94A 4X1RU 1O2QA 2PLXA 4Q63A 4X6NA 2B5TB 4H42U 2ZGHA 4HZHA 4CRFA 4UFDH 2F9NA 1EKBB 1TOMH 3TIUA 3RUOA 1UTQA 2WPIS 1BMNH 2ASUB 3KCGH 1ZTKA 3W94A 1MABB 1GHVH 1AZZA 3KL6A 1F0RA 2OC1A 3HKJB 3URDA 2BLQA 2SGDE 3U8OH 3LGUA 1TGNA 5EXLA 1S6FA 2VVVA 1ZTJA 4Y7AA 1P2QA 2NU2E 1KLIH 1O3PB 1WQSA 4M9FA 4CRDA 5CDFE 1V2OT 4OM9A 4A5TS 2BD7A 5CHAB 1DWEH 3O8CA 2GT8A 3SU5A 4JMYA 1L1JA 3F68H 4WWYA 1EJNA 1FY3A 3O8RA 1SFIA 1ZSJA 4ZROA 5EGMA 3SJOA 3MTYA 1GJDB 4B2AA 1K0HA 1TX7A 2UWOA 3BN9A 1AD8H 1EAUA 1K22H 3PRDA 5EXNA 2A32A 1QURH 4LOYH 1ZGIA 1QL7A 1LCYA 4FUHA 3SJKA 5FL7D 1IHSH 1GL1A 2AGIX 1OWJA 3ODFA 2A0QB 1F5LA 5A0BA 1CHOF 3A86A 1GBLA 5H4IB 3U28C 1SHYA 1BMLA 4TY6A 3ZZ5A 2BM2A 3EE7A 2Z6BD 1QJ1B 1V2PT 2CHAB 3MOCA 2H2ZA 3SORA 4I32A 4BAHB 4CRAA 4GAWA 4ZH8A 1ELFA 3VB3A 1PYTC 3L6PA 1YPHC 4F49A 1TGCA 2FLBH 3RXSA 1CU1A 1L2EA 5F8ZA 4GUXA 1QNJA 2TBSA 4X8SH 1WCZA 3SHCH 3SU6A 1A0HB 2J95A 4NSYA 4DT4A 1JMOH 2WPKS 5F03A 2B9LA 1H8IH 2CXVA 4O03A 1IAUA 3VFEA 1O2XA 4D9RA 4GHTA 3DFJA 4Q7YA 2VIWA 1HIAB 2OQUA 3EDXB 3HATH 4GLYA 3VG8A 2FOFA 5HGGA 4U2WA 3SNDA 3ZZ8A 2ZGBH 1DITH 1BQYA 2FDAA 1E1QD 2BVSH 1YF4A 1CGJE 2Y82A 2FM2A 1F5RA 1ZOMA 3DCLA 1CE5A 1TLDA 1KY9A 3SN8A 3SBKA 2R3YA 4I86A 2ZNKH 1XM1A 3ZZDA 1LVYA 2GV6A 2ZFSA 4Y76A 2XXLA 2UWLA 3KGPA 1UK3A 2ALVA 4D7FA 3LGVA 2BY6X 1AUTC 1PFXC 1VITH 3HKIB 5DP4A 2G81E 3GISB 2W6JD 4NG9H 4IGDA 3RXOA 1YP9A 2P16A 1C2IA 1VZQH 3PLKA 1YY3A 1W0KD 3UR9A 1BBRK 1UCYE 1YM0A 3GCTF 6CHAB 2A7JA 2ODQA 1TGTA 1UVTH 1P01A 1SHHB 1PPCE 1S5SA 2SGFE 4NIYA 2P3FH 1P3EA 1EZSC 1AU8A 2FOEA 4BTIB 1JOUB 1UK4A 3SNEA 2Z7FE 2FOAA 3MFJA 2ZDVH 1Y3YA 1PPFE 3EGKH 2WV4A 1S85A 1BMMH 4AFQA 1XUHA 3DHKH 1ELTA 1O2PA 2HVYB 3ITIA 3JZ2B 1C2FA 1GDUA 1YPLH 2P3TB 5DP3A 2XBWA 3ZVBA 2IPHA 1O2MA 2IOTA 1TNKA 1Y3UA 1TQ0B 1D3TB 1SPJA 2QN5T 3PV2A 1B0EA 3ZZ4A 2ZHDA 2G5VA 4X6MA 5HXFA 1EX3A 2GMTB 2GD4B 1K21H 4K1EA 2J98B 3UWIA 2FYRA 4INHA 1FI8A 4MPWA 8GCHG 1O2ZA 2FLRH 1AGJA 2QXHA 2STBE 1TPSA 3SJ8A 1NFWA 1C5SA 4U30A 3AK5A 2F9PA 3RXQA 4DT7B 2NU3E 4A92A 3A83A 4ZAEA 1Y5AT 2LPRA 4X8UH 2AMPA 3TITA 3DUXH 4OS6A 4Y0YE 3TK6A 4A6LA 5DKMA 1SGIB 1KIGH 1QL9A 2WPLS 3A7YA 3TLOA 5A8ZA 5BRRE 1O2JA 1NBME 4TYDA 4X2VA 5L30H 1C1QA 2P94A 4HI3A 2ZTYA 2ZQ1A 5HIZA 1VCWA 1XUKA 1SGFA 1QB6A 1YLNA 1PPHE 3RM2H 1E35B 2XCFA 4ISIH 5I25A 1K9OE 3M7QA 1X7AC 4A1TA 2FTLE 2HOBA 1G3CA 2BQ6B 3QN7A 2ZGJA 4O97A 3T62A 1MTNB 3FP6E 3R3GB 2YMSB 5C0TA 4B1TA 2ZHQH 1OWDA 2AERH 1GVKB 4MTBA 1F0TA 1IQJA 3QTVH 2A5KA 1GJ4H 3FVFB 2C8YB 5AHGH 2C8WB 1ESTA 1KLTA 2WYJA 4MQAA 1L4DA 1O35A 2ZDKA 2UUYA 1ZSKA 2O8WA 2WZQA 1XX9A 1N8OB 1DUEA 5JBBS 1BMFD 1G32B 1OXGA 2RA0A 1O2GH 2DE9A 1GI5A 3ZZCA 4TPYA 3UOUA 3SV8A 1CT2E 1VKYA 1SQOA 1N6XA 1V2RT 3D23A 3M35A 2PGQB 1DWBH 3I29A 2XBVA 1ABIH 4I33A 2IJOB 3KQDA 1UVOA 3OX7U 2UWPA 3ELAH 2ZTXA 1TMTH 5GIBA 3B23B 2UUFB 6GCHF 1EB2A 2XC4A 4X1PU 4DCDA 2SGEE 4K8BA 4Y8ZA 1XVOA 1DANH 5C20A 2PW8H 2OK5A 3RMLH 3K6YA 3ODDA 1P12E 3TGKE 2A4QA 2C90B 2JH0D 4TPIZ 1WBGB 3GYMA 5C1XA 3TNSA 1D6WA 1LPKB 1O5EH 1H1BA 1A0LA 1LHDH 1BRBE 1K1PA 1PPZA 1QHRB 3F9FA 1GMCF 1NFXA 5DG6A 3PV5A 3MI4A 1HCGA 1G3DA 3BEIB 1AWHB 3EA8A 4X0WU 2QY0B 5FPTA 2HLCA 4B74A 2PKAB 4XD7D 3AW0A 3RM0H 2F91A 2HGTH 4ABGA 2OC0A 5FPYA 4BOHA 3WY8A 4R8TB 4X6OA 2Z9IA 1H4WA 1ORFA 2DUCA 2PSXA 4JZIA 1QCPA 2VIQA 3RU4D 3SUFA 1P57B 2HWLB 2H5CA 3P92A 1OWEA 4KTUA 4P02A 4I7YH 2A1DB 4ZXXH 3F9HA 5ESTE 4LZ1H 1C5NH 1Z8GA 1TBRH 3TH3H 1VITF 1Y59T 4I8KA 1G30B 1GHZA 1ZR0A 2NU0E 1A4WH 4GCHF 2CMYA 1NRPH 1J8AA 2QXGA 1NRNH 2Y6TA 1FX0B 1V2ST 1WTGH 1BITA 4FUGA 2BXTH 1P2IA 3RXCA 1GGDB 2FPZA 3OY5U 1O36A 3G01A 3DSOA 2HVXA 1O3DA 3F9GA 3N99A 1PPGE 1S6LA 1DY9A 1QB9A 3LU9B 2P3UB 3P8OA 3U9AH 1GDQA 1C1PA 2OD3B 1Q3XA 4RN6A 1TQ7B 5EIYA 1XUFA 4NWLA 1AHTH 3IG6B 3BG4C 1CA8B 1GI0A 1WDIA 1P2JA 2ZIQH 3NPSA 2GCHF 3KQCA 4MVNA 5EQRA 3ZVAA 4X1NU 4A1XA 3ZVEA 1QB1A 2BOHB 2W3KA 5CE1A 3D49H 2XRCA 4JK5A 2AIPA 3MYWA 1OS8A 3URCA 4X2XA 3MO6A 5EQSA 3E90B 1DT2A 1O3EA 4RKJB 1GWAA 1K1OA 3OFND 1N6YA 1THSH 1UVSH 3SUGA 4DJZB 1AY6H 3VEQB 4B76A 1Z8IB 2BY7X 5BPEA 5EG4A 1GHXH 3RLYH 5FAHA 4KGAA 1K1MA 5I46H 1W7GH 1G9IE 1U6QA 2W26A 1QJ7B 1TPPA 2H9EH 3SUDA 3F0OA 3SO3A 1BRUP 1GHBF 5TCCA 2BD4A 2XOKD 2JETC 3ZZAA 4YXWD 1YCPK 1OYTH 3TGIE 5CMXH 2M5TA 4FUEA 4IMQA 2P8OB 3UOPA 1SFQB 4MNXA 1EXFA 4UDWH 3MNSA 5GWZA 2V35A 2V3OH 2GJGA 3RXRA 1DM4B 4Y8XA 2SGPE 1BMAA 1O3MA 2KCYA 3VGCC 3E0NB 3TH4H 2P95A 2ZCKP 1H9IE 3P6ZB 6LPRA 1OSSA 1BCUH 1GG6C 2FX4A 4OGYA 2VBCA 3GY5A 1ELDE 2NU1E 2ZU3A 3CS0A 3A89A 3I77A 1EAWA 4FU9A 3MHWU 2R2MB 3UPEA 3Q3KA 4ABHA 1ESAA 2J2UA 1BTXA 2I6SA 1W7XH 3RXFA 3F3BA 4BANB 4NZLA 4WMFA 4ACAA 1GHAF 2ZI2H 3BTWE 1SGDE 1HV7A 2XBYA 2F9UA 4FUFA 4KKDA 1EAXA 1RJXB 4CR5A 1O2YA 5A09A 1SLVB 1UTJA 3O8DA 4RKOB 3VPKA 4UE7H 3RXGA 2EC9H 3HGPA 1HAGE 1V2NT 1O2WA 4ISHH 1F0SA 1SVPA 5F8TA 4RT0A 3PMBB 3V12A 2GZ8A 2A5IA 1HUTH 1C5OH 1C1WH 2FOGA 3ZZ6A 3LGYA 2Z9LA 1W0YH 2R9PA 1WU1A 2HNTE 1W0ZU 1SGNE 4KP0A 4HFPB 2FOMB 3MH6A 4YT7H 1THRH 4D7GA 3FP8E 1AB9C 3M5LA 4TWWA 4Z6AH 1T7CA 5L2YH 1LDTT 3VB4A 4ZHMU 4YOGA 1W14U 2BY9X 3A7VA 3SOSA 2KZ4A 2XC0A 3U98H 2AS9A 5J4SA 1LKAA 4HG6A 4I8LA 2R0KA 4BNRA 1HAOH 4DVAU 5A2MH 3RC4A 2VWOA 1KYNA 1S83A 3TGJE 1G2LA 1TNLA 3NXPA 4YESB 1DFPA 2PP6A 3MMGA 3DSPA 3LC5A 1V2QT 1P8VC 5C94A 4D76A 3GY3A 1CT4E 1Q31A 1P9SA 1AFEH 2GZ7A 1GBAA 1BTWA 1Q2WA 1W11U 1O32A 1SOTA 1FMGA 3CNRA 2KCAA 5AF9H 2PHBA 2FS9A 4ZKNU 1P2KA 2VVUA 3MU4A 1KLJH 4AFSA 2ZO3H 4UONA 1GCTC 1C2MA 1NFUA 2VGCB 2FXRA 2F43B 1B7XB 1W8BH 2F9BH 2XNIA 3A7XA 3GICB 8ESTE 5HYOA 2A4GA 5JBTA 3PO1C 3LGIA 2AGGX 2XBXA 2BD9A 2YNBA 1UTOA 1KTSB 1ID5H 4HTCH 3WWFA 2OC7A 3TNTA 4MNWA 3IITA 1TA2A 1GHWH 4ZUHA 3ATIA 3E0PB 5K7RA 3OU0A 1MQ6A 3SJ9A 4XBDA 5C1UA 2TPIZ 1S0RA 2THFB 1AMHA 3ZIAD 2QAAA 1GMDG 1NU7B 5TJXA 4B6EA 1RIWC 1T8OA 2IN2A 3SU3A 1O2NA 3E91A 4YZUA 4I8JA 3S9BA 1A61H 7LPRA 5DGJA 1JBUH 2PV9B 3EA7A 1W2KH 2D26C 1AWFH 1RTFB 2L6OA 3BTGE 4FUBA 1NU9A 2BX4A 5FBEA 2WUBA 3MNBA 1K1IA 3FP7E 1FY8E 5KEDA 1G2MA 1TRNA 1A3EH 4ZHLU 2BTCE 4X6PA 1LMWB 2WUCA 1QBOA 3VB7A 3TJOA 1ZRKA 3S9CA 1KXDA 1ZPZA 3P70B 2SGAA 2SNVA 1CSOE 4YOJA 3LC3A 1QRXA 4YTAA 5HMAA 3RXTA 2J92A 4BAQB 1T4VH 2JH6D 3BG4B 1BZXE 2YOLA 1C5PA 4Q80A 1QQUA 2ANYA 1K28D 2A2XH 1YGCH 5C67A 4Y11E 1CHGA 1SI5H 4JZEH 1D3QB 1KXFA 3RMOH 4B71A 1GMCG 2A31A 1AE8H 2QC2A 2J5UA 3A87A 4OS2A 3LGWA 2AEIH 2F9VA 1FQ3A 1TFXA 1O3AA 1KXAA 1XUJA 1DICA 2Y5GA 5FX5A 1UMAH 3F2GA 1TYNA 3NWUA 4KTSA 1Y3XA 1QFKH 1H8HD 1O5AB 3N7OA 5T6GA 1BIOA 1E38B 1ZHMA 2VB0A 3PM3A 1C5YB 2C93B 2BDBA 2OCVB 4X8TH 2ZGCA 2JETB 5IDKA 2J97A 1MD8A 1SR5C 1A0JA 3RXUA 2Q6FA 1CQQA 2OUAA 1INCA 2QGRA 2ULLA 3GY4A 2Q6GA 3UQOA 1O5CB 1P0SH 3MWIU 1UJ1A 4X2YA 2YMSD 2JDID 4JZFH 5C1YA 3CP7A 1ETTH 1MTVA 3F1SB 3RU4E 1O39A 1ZPCA 1ANEA 1ZYOA 4ZXYH 2ZECA 4Y71A 2CK3D 1DOJA 1WSSH 2ZC9H 1DSUA 3MNCA 3VGCB 4CBNA 3D65E 4UD9H 3E16B 4E7RG 1IQHA 4TT3D 1ZMNA 7GCHG 1GG6B 1O3LA 1H9HE 3RXJA 3GCHC 5E8EH 1Y3WA 2A4OA 2C4FH 3M5OA 1W12U 1HNEE 4O9VA 4B6FA 4AFZA 4AZ2B 1GI8B 4NCYA 3UREA 5IK2D 1C2GA 2SFAA 4OS5A 4XOJA 3V7TA 3E1XB 2TRMA 1Y3VA 3V3MA 2V3MA 2PGBB 4H6TA 1DS2E 1GBBA 1GI6A 5KGOA 1CVWH 2B7DH 3P8NA 3AAUA 4OS4A 2LNCA 3T28A 2FIRH 1TA6A 1DWDH 2GCHG 1MH0A 1QA0A 2GCTC 3M5NA 1YLDA 2ANWA 1GI7B 1O3BA 2WPHS 3GY6A 1O3KA 1TWXB 2VU8E 4LK4A 3M3SA 1VJAU 1C2EA 3RXKA 3MQKC 1RD3B 1EATA 4AC9A 3RXEA 5EJLA 1FV9A 2ZFFH 3LKWA 2XWBI 1WUNH 4Y79A 1HXFH 2GV7A 4XE4A 3OTPA 1M9UA 3BTEE 3U8RH 1A7SA 2IPQX 2GDEH 3K2UA 1JIRA 1HJ9A 3Q3YA 4XBCA 5L2ZH 1HLTH 1WV7H 2ZDMA 1MU8B 1JIMA 2O8TA 1QR3E 2VJ1A 2YNAA 2BOKA 1AB9B 2ZWLH 1EZQA 4IW4E 3ATLA 4O3TA 1RTLA 3SNAA 4MPVA 4YT6H 1XXFA 1TX8A 2BQ7B 3KIDU 4CR9A 4DY7B 2QXJA 1WYKA 3GYLB 1BDAA 3RXBA 3U8TH 1PYTD 5G4BA 3MH4A 5TCAA 1YKTA 4GHQA 3QUMP 4BXSA 3SHAH 1GJ5H 1UVUH 4E06H 3M7TA 1AKSB 3TK9A 5HM9A 1T8MA 1ANDA 1RS0A 2KM0A 5T1VA 2L74A 5GCHG 1E34B 4M7GA 3LH1A 3RXPA 3OEED 3ZZ3A 1LTOA 4DIHH 2EQNA 1SGTA 4NSVA 1Z8JB 4ZKSU 1AE5A 1AQ7A 5EW2H 2XWAA 3RXIA 1P04A 2ZPSA 1GJAB 2I6QA 2RFKC 2OBQA 1Z6EA 5EPNA 1GCTB 1NESE 2LELA 2SGQE 3C27B 4FUIA 5L6NH 1KXEA 1MMJN 1LHFH 1KXCA 3RMNH 4WJG2 3RDZA 3PO1B 3M61U 4NFEA 3OTJE 5JPMH 2D2DA 4J1YA 4NGAH 1C4U2 1P09A 2OINA 2ZU2A 4NA8A 4SGAE 2FOHA 1C2DA 3P17H 3MU5A 3D62A 4ABAA 1OYQA 4CH8B 1LQDB 1MZDA 5DP9A 2GP9B 2GT7A 4CRBA 3SYJA 3PLPA 4Q7ZA 1DXWA 4JCNA 3UAIC 1UHBB 1RIWB 4X1QU 1O5DH 4O3UA 1OWIA 3S0NA 1GMHF 1O38A 1FIWA 5EQQA 1EQ9A 1TOCB 5EXMA 4ISLA 2A4RA 4DG4A 1GI1A 1BTUA 3BTDE 2ZPRA 3T29A 2TIOA 1HAHH 1O3HA 1BB0B 1O5FH 4K5ZA 2KX4A 4BAMB 4BTTB 1WOFA 4YM9A 1O3OA 1GBMA 2KFWA 4FU8A 1EB1H 1S81A 3SZEA 4FUDA 1ABJH 4Q4LA 4YLUA 4D8NA 4ZMAH 1HAYB 3AAVA 3GDVA 3FZDA 5GDSH 1O2KA 3NCLA 4ZKOU 1C5ZB 1GBKA 1O3GA 1KDQA 3AVZA 1HAVA 4CH2B 5FXLA 1O33A 1Y5UT 3HK3B 1ANBA 2H9TH 3MO9A 1ANCA 1V2LT 1FJSA 3M36A 1AVWA 2OLGA 2QXIA 3KQBA 1TNHA 2G5NA 3A7TA 1WXRA 1O2LA 2CV3A 3SV6A 3VXEH 3A8DA 4TY7A 4UFGH 2ESTE 3GDUA 1F5KU 4FUCA 4A7IB 2ZU4A 1T8LA 1SC8U 2BDGA 2BQWB 3A8BA 1COWD 1TRYA 3QGNB 1EAIA 1YPEH 2TGPZ 2A2QH 2HRVA 1FIZA 1H8DH 4Y10E 2F83A 1LHGH 2ZQ2A 3FOAA 2B8OH 2RG3A 2ZTZA 3GOVB 4THNH 1BOQA 2BZAA 1O0DH 5FPSA 1MCTA 1ZTLA 1MTUA 5AVDA 2OBOA 3T2NA 4CREA 1LHEH 2FWWA 3DD2H 2VWNA 4K60A 4IC6A 3MNXA 4K1TA 2STAE 1K1JA 1ZPBA 1Z71A 1MAYA 4B2CA 1PQ5A 5FBIA 1T8NA 4B2BA 4JK6A 1EASA 3KN2A 1MKWH 5CHAC 1WTHD 1GVLA 1G37A 2BVXH 2OTVA 1LPGB 1FN8A 1XKAC 1AKSA 3GCHB 2JJ2D 3GCOA 3N7DA 2BXUH 2CN0H 1TNGA 1RTKA 2M2AA 2PR3A 3ATKA 3T27A 1D3PB 3EAJA 5JBCS 1OKXA 3A84A 2W6ID 4AOQA 2TGTA 3DT0H 3BEUA 3UNSA 1P2NA 2PUXB 3SV2H 1L1NA 1NFYA 3LOXA 3S69A 5C2ZA 4XFQA 3BTHE 4LXBH 3QZRA 1TIOA 1CHOG 2EEKA 2BLOA 1UTNA 1CGHA 1OX1A 1BBRE 2VH6A 3M3VA 1SQRA 4AYVB 1DX5M 4FETA 1C5RA 2FOCA 1VR1H 4I8HA 1O3CA 1BUIA 2ZDNA 2GKVE 2QYIA 2PKSC 3R0FA 3SV7A 1GL0E 1EP6A 1QZ8A 2C8ZB 4TSFD 1UHBA 1BRCE 1L0ZA 8GCHF 1E0FD 1YBWA 1TNIA 2O8UA 3ZVDA 1YPKH 1NM6A 3OSYA 3H5CB 4FU7A 1QL8A 1CO7E 3FO8D 2Z3DA 3Q77A 4K2YA 4D9QA 1L4ZA 2BDHA 4MG3A 3A82A 2BY8X 2AMQA 2ZPQA 4WVPE 1KMHB 1NY22 1GBDA 1BJVA 2J9NA 2C3SA 1GVZA 5C5NA 1UO6A 3PWCA 3F0PA 1NZQH 3EE0B 1UCYK 5IYTA 4XDEA 1GI4A 3TJUA 3A7WA 1UTKA 3SI3H 5A8XA 1N1LA 1W10U 1BTPA 1UK2A 5E0JA 5ABWA 1OP8A 2ZGXH 1FAXA 1O2RA 1P02A 1ZHRA 2VIDA 1EJMA 2BZ6H 9LPRA 4KTCA 4DGJA 5A0AE 1LPZB 1Y5BT 2BDCA 1DLEA 1P03A 3KQEA 3TK5A 1J15A 2ZZUH 1PPBH 3GCTG 1EPTA 3WWBA 3SI4H 1HJAC 3I78A 4U32A 1ELEE 3S9AA 3STJA 1QJ6B 2F9OA 2SNWA 4FVBA 4CBOA 1YWUA 5HIYA 1C4Y2 2ZCHP 2G00A 4X1SU 1YPJH 4IMZA 3PMHB 2PSYA 3SJIA 3OY6U 3W95A 1SB1H 3QX5H 3ZZ9A 1SL3A 3UNRA 1UVPA 2WPMS 2AIQA 3GS9A 3M3TA 3P8FA 3NUMA 1FDPA 2FEQH 2H1UA 2PFEA 4E7NA 3FFGA 2Y81A 1EZXC 2ZKSA 4H4FA 1SGYE 1QA7A 1HAZB 3LPRA 2V0BA 3RU4T 5EJZA 1C1UH 2ODPA 2HLDD 2A45B 4CRGA 4JZDH 1WAYB 2VIVA 3IWMA 4RT1A 2EY4C 2O8LA 1OOKB 2ZEBA 3SUEA 5EODA 1LHCH 3UWJH 1ZHPA 3BF6H 1TMUH 3U69H 1PQ7A 3M37A 1MQ5A 1GI9B 1MUEB 3Q00A 1MTWA 3E6PH 3PB1E 1TMBH 4Z0KA 3A81A 2ZDAH 2FMJA 5DJ7A 3TPIZ 3QZQA 3GY2A 2AHME 8KME2 1AFQC 1HDTH 3SV9A 1YPHE 4MLFB 1V2JT 3RP2A 1ZSLA 2A7CA 2VH0A 2KCPA 4Q2KA 5DN6D 1Y8TA 1TALA 1TPAE 3HK6B 1C5QA 1D4PB 2XTTB 4ASUD 4DURA 2YMSC 2QF0A 1O2HA 2HALA 2JJ1D 4XBBA 3ZVCA 4ESTE 1TB6H 1DPOA 1K1NA 3AW1A 1FNIA 1HYLA 1QRZA 3BTTE 1C1MA 3S7HB 1NRQH 5LPRA 2BDAA 1UCYH 1YCPM 1ESBA 1SSXA 1NRSH 1BRAA 1GBIA 2ZFTA 1EJAA 2Z3EA 3A8AA 4AFUA 4BAOB 4ZCNA 1PJPA 1OPHB 1SOZA 1C1RA 2Y5HA 3ESTA 2D8WA 1E36B 4ZHAA 1RXPA 2KAIA 3ZV9A 3O8BA 4NIXA 5T6FA 4RI0A 5HM2A 1B0FA 3CENA 4OS1A 5FCRA 5LGOA 2BY5X 3ZVGA 1PPEE 1FLEE 4GVUA 3ZYDA 1V2TT 4X2WA 3VB5A 4YLQH 2K1QA 1SMFE 3PROA 1YC0A 1GJ6A 2BHGA 2VWMA 2HNTC 1O31A 5AFYH 1NTPA 1GMHG 1AN1E 4CHAC 3TH2H 6GCHG 4NWKA 1ELCA 4AGKA 3BV9B 1V3XA 5HKKD 3UFAA 2VVCA 1NS3A 2VWLA 2PWXA 2FP7B 3KYFA 3P8GA 1AO5A 1HB0B 2FO9A 4AB9A 1HPGA 1K1LA 3FN8A 2QIQA 1TABE 2Z9JA 4ACBA 1W3CA 1OP2A 2ODYB 4J2YB 1EPTC 1A1RA 2A5AA 4F4OC 2OXSA 3SU1A 1B5GH 5F8XA 4UFEH 1TONA 1DXPA 1SBWA 1BHXB 1LO6A 4MPUA 5E2OA 1MKXK 2FS8A 1LVMA 1SKYE 2CF9H 1J17T 1Z1JA 4YO9A 1JXPA 1OHHD 1KSNA 5AFZH 1CT0E 1TBQH 2EI7A 3BTQE 3RXMA 3KYGA 5FHTA 1C1TA 1QGFA 1Z6JH 4AN7A 4AYYB 2QF5A 1A5GH 1BJUA 1IQEA 3ZZ7A 2IJD1 2Y5FA 1QBNA 4WF8A 2CF8H 1GBEA 3GY8A 1G36A 3UY9A 3SNCA 3OAAD 1C5MD 1SGPE 3SW2B 2WHXA 1SGFG 3T26A 2O9QA 3GDSA 2QE7D 2Q1JA 1TAWA 1TBZH 1YPMH 2GTBA 4ISNA 1O2IA 1F0UA 1DE7H
chains in the Genus database with same CATH topology
1VITG 4AG2A 2PKSB 2W7SA 3P95A 1O37A 1MBQA 5EW1H 1A46H 3UR6A 1HXEH 2GX4A 3PMAB 4GCHG 1O3NA 1XXDA 1QY6A 2QF3A 2BD5A 1FY4A 1THPB 1GGDC 3KHVA 3LONA 4FVDA 1KDQB 5EPYA 1HAVB 3JZ1B 2G4TA 2XW9A 1YPGH 4DIIH 3PLBA 4NA7A 1SGEE 1Z1IA 2BDIA 1E37B 2ANKH 2O8MA 3BG8A 2VINA 3QWCH 2JH5D 1GPZA 3ZZBA 2JKHA 1FY1A 1FXYA 3RMMH 2RCEA 2V6NA 1YYY1 1ACBE 3U1IB 2DE8A 1MU6B 1XVMA 1MBMA 2ZG0H 3LDXH 4LZ4B 2W5EA 5DK1A 1P11E 2Z3CA 1TRMA 1V2MT 1GI3A 1RGQA 4WMDA 4WY3A 2TGAA 1HAPH 1LQEA 3KNXA 1SG8B 3LGTA 3LIWA 2AMDA 1HRTH 4GSOA 4B75A 1FPCH 1J16A 5ESBA 4DW2U 1H9LB 2G8TA 4OS7A 2FYQA 4U01A 2CJIA 3M5MA 4ABBA 3QTOH 2AGEX 1HJAB 1S0QA 1SGQE 5A8YA 1NRRH 4Y7BA 2FI3E 3A85A 3ZV8A 1MZAA 4BTUB 1JWTA 1AIXH 1GHBG 3ATWA 3Q3XA 1ELBA 1O5GH 1RFNA 2P8OC 1FAKH 2J38A 1MKXH 5GPIB 1ARBA 2G52A 1FONA 1TGBA 4ABIA 2BD3A 1P3CA 4AG1A 1HFDA 3FAOA 4ISOA 1C2KA 4KELA 1XMNB 3MU0A 3ATMA 2G4UA 5EU8A 3PWBA 1IQMA 2H9HA 4NZQA 1TX6A 4MDSA 1EOLA 5J4QA 3FANA 5DP8A 2ZCLP 2XYAA 4Y6DA 4CRCA 1P2MA 1OWHA 5FX6A 2GZ9A 3PTNA 2BX3A 2G51A 5JDUB 1P2OA 1NROH 2ZP0H 1A5IA 1FPHH 1LVBA 2BVRH 4K3JA 5LPFA 1DVAH 1OWKA 4K1SA 2V3HH 3EA9A 7ESTE 2BYAX 4MNYA 1SQAA 3K9XB 1AFQB 2ZU5A 1CGIE 1GHAG 1ELAA 2BB4A 1T31A 4BAKB 4K8YA 1NPMA 1O2SA 1QIXB 4AGJA 1C5WB 3LJOA 1WQVH 1EZUC 2FI4E 3U1JB 5JB9S 2WV5A 1W13U 1GMDF 3KEEA 1MKWK 1ETRH 1VCPA 3NZIA 1SLUB 1O30A 1EUFA 4NA9H 5DP7A 1GCDA 3F9EA 4K69A 1GBHA 1C2HA 1IQLA 1DY8A 2B0FA 4XSKU 4INLA 1NO9H 2FTMA 1P10A 2Q6DA 5GXPA 1ZMJA 4AB8A 1GDNA 1QBVH 3B8JA 1BBRH 3UNQA 1C2JA 2FESH 1SLXB 3K6ZA 4Y8YA 3H7OA 1V6DA 2Z9KA 4PROA 1FY5A 4WXIA 4ABJA 1OP0A 3MU1A 1HIAA 1V2VT 3RXAA 5E0GA 4TWYA 1DUAA 2ZHWH 5JYIA 4X8VH 1GJ7B 3TJNA 2QA9E 2P59A 3S7KB 4INKA 3B9FH 4CHAB 2FZZA 3EQ0H 2EA3A 2OQ5A 1YLCA 4GPGA 4DOQA 4JYUH 3L3TA 7KMEH 1KTTB 1GBJA 3RXHA 1ZGVA 1F2SE 4ABEA 1FZZA 5EOKA 4FUJA 3LJJA 5FCKA 1VGCC 1EPTB 3V13A 4HGCA 1A5HA 3QLPH 2J4IA 1S6HA 2VGCC 4Q7XA 3HPTB 2J94A 4VGCC 3PV4A 3DA9B 2XC5A 1CA0C 4NIWA 3NKKA 5SGAE 3MH7A 2TGDA 2F3CE 3T5FH 3ZVFA 1C5UA 2W7UA 1CBWC 3E3TA 1MCVA 1MTSA 3RC6A 1TGSZ 1V2UT 3SGQE 5DPAA 3SNBA 4SGBE 5B6OA 2BDYA 1DLKB 2ZFQH 4IBLH 1DSTA 1AUJA 1HGTH 2NU4E 2OC8A 2UUJB 3BTFE 4I8GA 3UQVA 1ZLRA 3ZYEA 1O3JA 2Y80A 3STIA 1BHXF 3AASA 1C1NA 1J14A 1ETSH 3GY7A 3QK1A 4ABFA 3SQEE 3SGBE 2C8XB 5PTPA 2ZDLA 2ZFPH 3MU8A 5DP5A 3SQHE 1C1SA 1FUJA 1TPOA 3BTKE 1AZ8A 1SQTA 2A7HA 3RLWH 1GJBB 5A0CA 1O2TA 4BXWA 2ANMH 5E0HA 2G55A 3GCNA 3MO3A 7GCHF 4UFFH 1O34A 1D9IA 1PQ8A 2EI6A 4WH6A 5DP6A 5ETXA 2WPJS 1F7ZA 1IOEA 3KF2A 3SU2A 1GBTA 1A2CH 1BTHH 1GJCB 3UUZA 2H6MA 1LKBA 2CGAA 3MH5A 8LPRA 4QT8C 2FODA 1O2UA 1O3IA 2WYGA 1ELVA 2GDDA 2EI8A 3A8CA 5LPEA 1S84A 2PTNA 3QO6A 1QRWA 4IC5A 3VXFH 2VNTA 3A80A 4IN2A 4AX9H 2CHAC 2GCTB 1K2I1 3VB6A 1F92A 2WINI 1O2OA 2ZF0H 3TJVA 2R0LA 1ZJKA 1XUIA 6ESTA 1XUGA 5E2PA 1IHTH 1C5TA 1ZRBA 1C9TA 5T6DA 2GGVB 1ARCA 2KAIB 2FOBA 2FX6A 3EYDA 4RSPA 4AORA 3V0XA 4MPXA 4ABDA 1GBCA 3QDZB 1QQ4A 5JB8S 1Z7KA 2FI5E 2J34A 3RXDA 1V2WT 1QTFA 1SGCA 2HPQH 1TE0A 2AFQB 3RXVA 5DO4H 4JYTA 1AI8H 1T32A 2AYWA 1GHYH 1TNJA 3C1KA 3F6UH 2Y7ZA 3SGAE 1DWCH 3OYPA 4JZ1A 4WXVA 1AVGH 3E8LA 4B73A 2NWNA 3PMJA 1C5VA 1V2KT 1IQKA 5LH8A 1NC6A 5GCHF 1ZMLA 3RXLA 1ZZZA 5F6MA 3A7ZA 1UTLM 2QCYA 4WH8A 2Z9GA 5C3NA 4FXGH 4OGXA 1A3BH 1P05A 3SU0A 1G3BA 1VCQA 1Z8RA 1NT1A 1PQAA 1UTMA 1IQGA 1C5XB 1P06A 6CHAC 1O3FA 2W3IA 3PYHA 1ZJDA 2PTCE 2XCNA 4NFFA 3ENSB 1GJ9B 9ESTA 3QGJA 4A1VA 3LT3A 1G3EA 1SGRE 1BT7A 2ALPA 2BD2A 3FZZA 3TU7H 1DDJA 2PKAA 4IS5A 1ELGA 2ZHFH 1C9PA 3BEFB 3PTBA 4JYVH 2AH4X 1HAIH 2HPPH 4IN1A 1S82A 1C5LH 3BIVH 2PUQH 2VIPA 4YOIA 1KXBA 1C1OA 1HJ8A 2GMTC 1BTYA 3UTUH 2R3UA 1EP5A 1IQIA 2ZU1A 2ZA5A 2BLVA 3K65B 2VIOA 3BIUH 3H7TA 1MAXA 2BD8A 1BTZA 4ZKRU 2RA3A 3UIRA 1AVXA 2ZFRH 1HBTH 3DFLA 4WMEA 1D6RA 1J9CH 2OP9A 1HAXB 1P9UA 3BTME 3CS7A 1GI2A 1O5BB 1YCPH 1L1GA 4H6SB 2D1JA 4Y0ZE 1EOJA 3T25A 3BSQA 2H5DA 1NN6A 3SU4A 1JRSA 2RDLA 3TVJB 2GVFA 2ZHEH 3LH3A 4NIVA 4R0IA 3M7UA 1LVOA 2R2WU 3Q76A 4E05H 1JRTA 1SLWB 2ILNA 1UTPA 2QV1A 1MTNC 1RRKA 3L33A 5JBAS 3SZNA 4MNVA 1T4UH 1VGCB 2P93A 1IQNA 2HNTF 5GJ4B 1VJ9U 2BLWA 3NK8A 1O2VA 2UUKB 2BMGB 2Y7XA 3A88A 4I31A 5C5OA 1IQFA 4VGCB 1C4V2 1CA0B 4ASHA 1BA8B 1C1VH 1D3DB 3RC5A 1N8OC 1CBWB 5T3HA 1GJ8B 1MD7A 1GBFA 4UEHH 1FN6A 1XKBC 5K0HA 1C2LA 3HGNA 2Z94A 4X1RU 1O2QA 2PLXA 4X6NA 2B5TB 4H42U 2ZGHA 4HZHA 4CRFA 4UFDH 2F9NA 1EKBB 1TOMH 3TIUA 3RUOA 1UTQA 2WPIS 1BMNH 2ASUB 3KCGH 1ZTKA 3W94A 1GHVH 1AZZA 3KL6A 1F0RA 2OC1A 3HKJB 3URDA 2BLQA 2SGDE 3U8OH 3LGUA 1TGNA 5EXLA 1S6FA 2VVVA 1ZTJA 4Y7AA 1P2QA 2NU2E 1KLIH 1O3PB 1WQSA 4CRDA 1V2OT 4A5TS 2BD7A 5CHAB 1DWEH 3O8CA 2GT8A 3SU5A 4JMYA 1L1JA 3F68H 4WWYA 1EJNA 1FY3A 3O8RA 1SFIA 1ZSJA 4ZROA 5EGMA 3SJOA 3MTYA 1GJDB 4B2AA 1TX7A 2UWOA 3BN9A 1AD8H 1EAUA 1K22H 5EXNA 2A32A 1QURH 4LOYH 1ZGIA 1QL7A 1LCYA 4FUHA 3SJKA 1IHSH 1GL1A 2AGIX 1OWJA 3ODFA 2A0QB 1F5LA 5A0BA 1CHOF 3A86A 1GBLA 5H4IB 1SHYA 1BMLA 4TY6A 3ZZ5A 2BM2A 2Z6BD 1QJ1B 1V2PT 2CHAB 3MOCA 2H2ZA 3SORA 4I32A 4BAHB 4CRAA 4GAWA 4ZH8A 1ELFA 3VB3A 1PYTC 3L6PA 1YPHC 4F49A 1TGCA 2FLBH 3RXSA 1CU1A 1L2EA 5F8ZA 4GUXA 1QNJA 2TBSA 4X8SH 1WCZA 3SHCH 3SU6A 1A0HB 2J95A 4NSYA 1JMOH 2WPKS 5F03A 2B9LA 1H8IH 2CXVA 4O03A 1IAUA 3VFEA 1O2XA 4D9RA 4GHTA 3DFJA 4Q7YA 2VIWA 1HIAB 2OQUA 3EDXB 3HATH 4GLYA 2FOFA 5HGGA 4U2WA 3SNDA 3ZZ8A 2ZGBH 1DITH 1BQYA 2FDAA 2BVSH 1YF4A 1CGJE 2Y82A 2FM2A 1F5RA 1ZOMA 1CE5A 1TLDA 1KY9A 3SN8A 3SBKA 2R3YA 2ZNKH 1XM1A 3ZZDA 1LVYA 2GV6A 2ZFSA 4Y76A 2XXLA 2UWLA 3KGPA 1UK3A 2ALVA 4D7FA 3LGVA 2BY6X 1AUTC 1PFXC 1VITH 3HKIB 5DP4A 2G81E 3GISB 4NG9H 4IGDA 3RXOA 1YP9A 2P16A 1C2IA 1VZQH 3PLKA 3UR9A 1BBRK 1UCYE 1YM0A 3GCTF 6CHAB 2A7JA 2ODQA 1TGTA 1UVTH 1P01A 1SHHB 1PPCE 1S5SA 2SGFE 4NIYA 2P3FH 1P3EA 1EZSC 1AU8A 2FOEA 4BTIB 1JOUB 1UK4A 3SNEA 2Z7FE 2FOAA 3MFJA 2ZDVH 1Y3YA 1PPFE 3EGKH 2WV4A 1S85A 1BMMH 4AFQA 1XUHA 3DHKH 1ELTA 1O2PA 3ITIA 3JZ2B 1C2FA 1GDUA 1YPLH 2P3TB 5DP3A 2XBWA 3ZVBA 2IPHA 1O2MA 2IOTA 1TNKA 1Y3UA 1TQ0B 1D3TB 1SPJA 2QN5T 1B0EA 3ZZ4A 2ZHDA 2G5VA 4X6MA 5HXFA 1EX3A 2GMTB 2GD4B 1K21H 4K1EA 3UWIA 2FYRA 4INHA 1FI8A 4MPWA 8GCHG 1O2ZA 2FLRH 1AGJA 2QXHA 2STBE 1TPSA 3SJ8A 1NFWA 1C5SA 4U30A 2F9PA 3RXQA 4DT7B 2NU3E 4A92A 3A83A 4ZAEA 1Y5AT 2LPRA 4X8UH 2AMPA 3TITA 3DUXH 4OS6A 4Y0YE 3TK6A 4A6LA 5DKMA 1SGIB 1KIGH 1QL9A 2WPLS 3A7YA 3TLOA 5A8ZA 5BRRE 1O2JA 4TYDA 4X2VA 5L30H 1C1QA 2P94A 4HI3A 2ZTYA 2ZQ1A 1VCWA 1XUKA 1SGFA 1QB6A 1PPHE 3RM2H 1E35B 2XCFA 4ISIH 5I25A 1K9OE 3M7QA 1X7AC 4A1TA 2FTLE 2HOBA 1G3CA 2BQ6B 3QN7A 2ZGJA 4O97A 3T62A 1MTNB 3FP6E 3R3GB 4B1TA 2ZHQH 1OWDA 2AERH 1GVKB 4MTBA 1F0TA 1IQJA 3QTVH 2A5KA 1GJ4H 3FVFB 2C8YB 5AHGH 2C8WB 1ESTA 1KLTA 2WYJA 4MQAA 1L4DA 1O35A 2ZDKA 2UUYA 1ZSKA 2O8WA 1XX9A 1N8OB 1DUEA 5JBBS 1G32B 1OXGA 2RA0A 1O2GH 2DE9A 1GI5A 3ZZCA 4TPYA 3UOUA 3SV8A 1CT2E 1SQOA 1N6XA 1V2RT 3D23A 3M35A 2PGQB 1DWBH 3I29A 2XBVA 1ABIH 4I33A 2IJOB 3KQDA 1UVOA 3OX7U 2UWPA 3ELAH 2ZTXA 1TMTH 5GIBA 3B23B 2UUFB 6GCHF 1EB2A 2XC4A 4X1PU 4DCDA 2SGEE 4K8BA 4Y8ZA 1XVOA 1DANH 5C20A 2PW8H 3RMLH 3K6YA 3ODDA 1P12E 3TGKE 2A4QA 2C90B 2JH0D 4TPIZ 1WBGB 3GYMA 5C1XA 3TNSA 1D6WA 1LPKB 1O5EH 1H1BA 1A0LA 1LHDH 1BRBE 1K1PA 1PPZA 1QHRB 3F9FA 1GMCF 1NFXA 5DG6A 3MI4A 1HCGA 1G3DA 3BEIB 1AWHB 3EA8A 4X0WU 2QY0B 5FPTA 2HLCA 4B74A 2PKAB 3AW0A 3RM0H 2F91A 2HGTH 4ABGA 2OC0A 5FPYA 4BOHA 3WY8A 4R8TB 4X6OA 2Z9IA 1H4WA 1ORFA 2DUCA 2PSXA 4JZIA 1QCPA 2VIQA 3RU4D 3SUFA 1P57B 2HWLB 2H5CA 3P92A 1OWEA 4KTUA 4I7YH 2A1DB 4ZXXH 3F9HA 5ESTE 4LZ1H 1C5NH 1Z8GA 1TBRH 3TH3H 1VITF 1Y59T 4I8KA 1G30B 1GHZA 1ZR0A 2NU0E 1A4WH 4GCHF 2CMYA 1NRPH 1J8AA 2QXGA 1NRNH 2Y6TA 1V2ST 1WTGH 1BITA 4FUGA 2BXTH 1P2IA 3RXCA 1GGDB 2FPZA 3OY5U 1O36A 3G01A 2HVXA 1O3DA 3F9GA 1PPGE 1DY9A 1QB9A 3LU9B 2P3UB 3P8OA 3U9AH 1GDQA 1C1PA 2OD3B 1Q3XA 4RN6A 1TQ7B 1XUFA 4NWLA 1AHTH 3IG6B 3BG4C 1CA8B 1GI0A 1P2JA 2ZIQH 3NPSA 2GCHF 3KQCA 4MVNA 5EQRA 3ZVAA 4X1NU 4A1XA 3ZVEA 1QB1A 2BOHB 2W3KA 5CE1A 3D49H 2XRCA 4JK5A 2AIPA 3MYWA 1OS8A 3URCA 4X2XA 3MO6A 5EQSA 3E90B 1DT2A 1O3EA 4RKJB