1EKBB

The serine protease domain of enteropeptidase bound to inhibitor val-asp-asp-asp-asp-lys-chloromethane
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
235
structure length
235
Chain Sequence
b'IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROPEPTIDASE
publication title Crystal structure of enteropeptidase light chain complexed with an analog of the trypsinogen activation peptide.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 235
sequence length 235
ec nomenclature ec 3.4.21.9: Enteropeptidase.
pdb deposition date 1999-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ekbB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ekbB01
3L33A 2BD7A 1OXGA 1UO6A 4BAOB 5C3NA 1A5HA 2VH6A 3M3SA 4ZXXH 4FUFA 1HXEH 3A7VA 1FY1A 4TYDA 4HI3A 4A1VA 1PQ5A 1P2IA 2VINA 1TMTH 4KTSA 1WTGH 3RXBA 4DT7B 1GJDB 3E1XB 1Y3WA 1ZTKA 2RDLA 5F8XA 1ZGIA 3RXTA 4DJZB 3MMGA 1SLVB 3PM3A 2P3TB 2PTNA 3UNSA 1UVPA 2FI5E 2ZFSA 3K65B 4NCYA 3HKJB 2C90B 2BD9A 1LKBA 2BZ6H 3KQEA 3P17H 4Y8ZA 2BY7X 1BHXB 3OX7U 4TPYA 1BTUA 1D3TB 1AGJA 1FMGA 1VCWA 5C1XA 1O2LA 4K1EA 2H1UA 3VGCC 1WBGB 1L1NA 2OP9A 2GCHG 1CT4E 1Z8IB 1Z1IA 1BMLA 4YLUA 2W7UA 3VB4A 1AB9B 1MAYA 1UVOA 1ZGVA 5A09A 2ZGCA 3RM2H 3GCHC 3LONA 1AUJA 4Y10E 2ZIQH 3A7YA 3RXOA 2Y82A 1S0RA 3MO3A 1AQ7A 1UK4A 1HBTH 2B7DH 4X2WA 1GI5A 1YCPM 2BLQA 2QY0B 1EKBB 1EASA 1NTPA 3CP7A 3KQBA 1P8VC 1ZSKA 2V3HH 3PB1E 3RXKA 5JDUB 3IG6B 3FZDA 5EXNA 3NK8A 1V2UT 1C1NA 1CBWB 1UVTH 1TQ7B 1RJXB 2ZU4A 4K8BA 2VWMA 2CF9H 2IJOB 1DT2A 3Q77A 1O3JA 3RU4E 1LKAA 2BTCE 2BXUH 3SV9A 1XUJA 4HTCH 1PPBH 5DP8A 4K60A 1DLEA 4BXSA 2ZHEH 4YOIA 2I6SA 3RXPA 5GWZA 1GBFA 2NU3E 1GI7B 2FOCA 2G4TA 1PQ8A 3KNXA 5H4IB 2O8UA 3SGQE 1P2OA 1HAVB 1HAVA 1YKTA 4NIXA 1F2SE 3GICB 1N1LA 1WQVH 3TJUA 1X7AC 1IQIA 1P2MA 5FPTA 4OS1A 1UHBB 1EB2A 1DVAH 1OWDA 1C2IA 4HFPB 1W12U 2HNTE 2JETC 3URCA 3M5MA 1GCTC 1GPZA 1MKXH 3OYPA 1SOTA 1O2QA 2OD3B 4CBOA 3O8CA 1GDNA 2Y7ZA 3LU9B 2SFAA 4BTIB 5JBBS 5I46H 1C9TA 1SFQB 3B9FH 3T62A 3AVZA 1H8IH 3QO6A 4KELA 4X1NU 2VVVA 3T29A 1ZSJA 4CHAC 1TPPA 2FIRH 1CGIE 3CS7A 1O3CA 2F9UA 3RXEA 2A32A 4I8HA 2ZDKA 2CV3A 1NRRH 1Y3VA 1BTHH 2TGTA 7LPRA 1INCA 3S0NA 1F5RA 4FVDA 1AKSA 3ZVAA 3EE0B 4BAKB 4OGXA 1FAXA 3M7QA 1WAYB 4OS2A 1BBRE 4CBNA 7GCHF 1A3BH 2PHBA 2V35A 3E6PH 4OS6A 3SUFA 2QXHA 1ANEA 3OU0A 1QHRB 3PWCA 2B8OH 3BEIB 5DP5A 3I77A 4XE4A 1MD8A 3M3VA 1GL0E 2IPHA 2SGEE 1MTUA 1TPOA 3PO1B 4Y76A 2BX4A 5E0JA 2FESH 1ACBE 4AB8A 1P03A 1JRSA 2G81E 3BG8A 4FUEA 4IC5A 1AD8H 4HGCA 4I8JA 1A5GH 2TGPZ 5FX5A 5DP3A 2SNWA 2ODPA 3BEFB 5F03A 1KY9A 4IMZA 3WY8A 4AN7A 4ISOA 1DY8A 2WINI 4DG4A 3UNRA 1CE5A 1Y5BT 1YPHC 3MOCA 1K1LA 1GHVH 3K2UA 4BAQB 5DP7A 1D4PB 1O3PB 1XMNB 2HPPH 2TBSA 3NCLA 4LZ4B 4JYVH 1TNJA 4H4FA 4BOHA 1VITH 1FY8E 4ABEA 4WWYA 1JRTA 1GHXH 3ZVFA 1XKBC 2QCYA 3VB5A 3IWMA 5E0HA 4JCNA 3ZV8A 4D76A 4AZ2B 1S84A 2R9PA 2FX4A 3BG4C 1W8BH 1PYTC 2Y5GA 3ATLA 2FS9A 3T27A 3TITA 5J4QA 1ID5H 2ZG0H 4CR9A 2Y5HA 2IN2A 3D62A 1GHYH 3SGBE 4ASHA 1C5SA 3UQVA 1RTLA 3PLKA 1TWXB 1GHAG 3V12A 1KXBA 4B2CA 2KAIA 1ZHRA 5HXFA 1SGYE 3KL6A 4UD9H 3UR6A 4Q7YA 2Y5FA 1FI8A 1AI8H 3A8DA 4GAWA 4A6LA 2BVXH 1O3GA 1CGHA 3ELAH 1G36A 1GJ6A 1BRBE 2FI3E 3Q3XA 5C1UA 4B2BA 3DD2H 4KP0A 4BAHB 3LH3A 1EOJA 2F9NA 3PWBA 1QRZA 4XDEA 4H42U 1SGQE 2ZO3H 4ABBA 1IQLA 1KDQB 1C5UA 1KDQA 1SBWA 4XBBA 4DURA 5C20A 2G00A 4OGYA 2THFB 2OXSA 1GBDA 3HGNA 3K6ZA 4NFFA 5CHAC 2IOTA 5A8XA 1SFIA 3MNBA 1LHDH 5EQRA 1A0LA 2C3SA 3AAVA 1Z8JB 3A84A 3UOPA 3ODDA 2XBVA 3ZZ7A 3MU5A 2YOLA 1V2JT 5FHTA 1VITG 4INKA 2OBQA 2XCFA 2M5TA 2AGGX 4DVAU 1MBMA 4ABIA 1GBAA 1F0RA 1UTOA 1AFEH 4X6NA 3ITIA 1YF4A 1W0YH 3SI4H 1FY5A 4OS4A 3ZZ3A 4YESB 1P2NA 5JYIA 3RXCA 1K1PA 4E06H 1BA8B 3LJJA 1DX5M 2GCTC 2BY9X 2OC0A 3KF2A 1C5NH 3T2NA 1YLCA 1GGDC 4DOQA 1ELGA 2VB0A 1AY6H 4Q7XA 1S85A 2EEKA 2ZFRH 2QC2A 4FUBA 3EA7A 4AFUA 1O2GH 2WUBA 2ZDMA 4CH8B 1G3EA 4WMFA 3U1JB 1TRMA 1AIXH 3VXEH 2A7HA 3D23A 1P9SA 5AFZH 3RXIA 2CMYA 2OLGA 1V3XA 3E0NB 3U1IB 3P70B 4CRGA 3S69A 5EPNA 1EZSC 1IQNA 2OC7A 4DIHH 1T4UH 1GI0A 5LPEA 2C93B 3HPTB 1GBMA 4FUGA 3RXGA 3MWIU 1CA0B 4ZHLU 1A46H 3KQDA 3Q3KA 1N6YA 1HAGE 4JK6A 3QN7A 5FCRA 1UVUH 1C9PA 5EXMA 3DFJA 1KYNA 1TX8A 3RXFA 2BQ6B 1AN1E 1QQ4A 3T25A 4FUIA 4THNH 1O2XA 1BDAA 3TK6A 3E0PB 5C1YA 1P06A 2BMGB 3MU1A 4X0WU 3E91A 2ZTXA 1BBRH 1PYTD 1LO6A 2P3UB 1HAIH 2V3OH 1GHBF 4FU9A 1C2FA 1K1NA 1Y3YA 2A4QA 1C5OH 2HGTH 1QRWA 1MCVA 5JBTA 3M3TA 1O2IA 3GCOA 3RMMH 1DUEA 1G2LA 1NFUA 1OOKB 1MQ5A 3P8OA 1SGDE 3FP6E 3LGYA 3TH4H 1YPHE 1ANDA 2WV5A 1ZMLA 4LXBH 1CT2E 1EATA 1YGCH 1GDQA 1GMHF 2O8LA 3MO6A 2FDAA 2STBE 5TJXA 4AG2A 2Z94A 3V0XA 6CHAC 1ZOMA 1RGQA 1UK2A 2F83A 1OWHA 3A80A 1SI5H 3LDXH 1BCUH 2PKAA 3SHAH 1V2WT 2ALVA 3F6UH 3UTUH 4E7RG 5I25A 1ZJKA 4BNRA 1B5GH 3UQOA 1ELVA 3TNSA 1O3BA 2WUCA 5L2ZH 4TY6A 4D7GA 2QGRA 4F49A 2FODA 3PMAB 1QQUA 2BYAX 1GVLA 4B75A 3PYHA 1EOLA 4I33A 4RKJB 1QBOA 1P12E 2W5EA 3MH6A 2AGIX 1EQ9A 5HM9A 1QCPA 1LHFH 1GMCF 1MTVA 2ZF0H 5F8ZA 2OINA 3ZZ8A 1TABE 2OC1A 4IC6A 1O33A 1DXWA 4ESTE 1IQEA 1AFQC 3F9GA 4WVPE 1E38B 2ZEBA 2QXJA 4IN2A 2AGEX 4ISLA 3T5FH 4U32A 3SZNA 1JIRA 1UK3A 1KXEA 1P3EA 2P16A 1GG6B 3M37A 1QL9A 2ZTZA 2C8ZB 3ATIA 3CENA 3QTVH 1RD3B 4IBLH 1MTSA 3F68H 4OS5A 5L6NH 1C5ZB 1A1RA 1N6XA 4X8TH 3BF6H 3BN9A 3D65E 2ZQ1A 1D3PB 1O5EH 3SV8A 3MYWA 3DT0H 1SGIB 5C2ZA 1JXPA 1BOQA 1EX3A 4MNWA 4NA7A 3HGPA 1ABIH 1TA2A 2ZDLA 5FCKA 1BJVA 1ZMJA 1GMDG 1RFNA 1EAUA 1N8OB 1CQQA 1YPJH 4JYUH 1TMBH 1RS0A 4ZUHA 2ALPA 3ZVCA 4CRFA 1O3AA 2FX6A 5K0HA 2G4UA 8ESTE 2XC5A 1T8NA 2XWAA 1TNLA 3LH1A 4YM9A 3SHCH 3K9XB 1CT0E 1QL8A 3E3TA 1TB6H 3SORA 2QXIA 1GGDB 4WXIA 1YPLH 2FEQH 4JZ1A 1SGNE 3E90B 3QDZB 1VCPA 5GPIB 3SI3H 3TVJB 1C5WB 3UWJH 4NA9H 1NY22 1L4ZA 3VFEA 1DWDH 3ZZ6A 2CXVA 3W95A 2A0QB 2VGCC 3ZV9A 1TYNA 1L2EA 1SGFA 2ZI2H 1GJ4H 1NFXA 2WPJS 1GBIA 1XXFA 3EA8A 1C4U2 4I8KA 2P8OC 1QBVH 2ZCLP 1UTLM 2DUCA 2XC4A 4BANB 1OP2A 1C5PA 1EAWA 1EJAA 4QT8C 2B9LA 1FN8A 1Z7KA 1L0ZA 3IITA 3A7WA 2VIQA 1FPHH 4CR5A 5A0AE 1H9LB 4TWYA 2GMTC 4M7GA 1LPZB 5T3HA 3UWIA 2TIOA 1VJ9U 1OWIA 2ZC9H 1MD7A 1DXPA 1S6FA 1W11U 4D9QA 5HYOA 3A85A 1LMWB 3M36A 2C8WB 4MNYA 1T4VH 1AZZA 1AVXA 1S0QA 3RC4A 1OX1A 2G51A 4B71A 2BY5X 2BQWB 2F9OA 1O3HA 4FUHA 5DKMA 1F0TA 5TCAA 1BITA 3SUDA 1O2RA 1LHCH 2B0FA 2VH0A 1G3DA 1O3MA 2ZHFH 4O03A 3EAJA 3UUZA 3M35A 1H8DH 1JWTA 2BY8X 2WPKS 3B23B 1RIWC 3SW2B 4KTCA 3F9FA 2BM2A 4NWLA 1IQGA 3P6ZB 3PMJA 4X6MA 2AS9A 3A88A 4GPGA 2BDYA 2CJIA 1WV7H 4PROA 2BVRH 4CRDA 1MU8B 1PQAA 1GJ8B 3ATKA 1AMHA 1CHOG 1K28D 4Y7AA 1HJ9A 5GCHF 1HNEE 3A7ZA 2O8WA 1JIMA 1W2KH 1HAZB 2ZCKP 2NU4E 1H1BA 3GDSA 1W3CA 5EW1H 1HJAB 4YTAA 2RA3A 1LHGH 1FPCH 1NRQH 3MH4A 2NU1E 4GCHG 4AORA 1LVBA 3RC6A 2BD3A 1V2PT 2G8TA 3O8DA 1C5TA 2O9QA 4YOJA 4NA8A 4Q80A 5DG6A 1O31A 1ZRKA 4K2YA 1VGCC 3SGAE 3LC5A 3FAOA 2FLRH 4A1XA 3GYLB 3FZZA 1MTNC 2BD8A 2FOAA 4FUJA 3RMLH 4X8VH 1A0JA 2QA9E 1NO9H 4NZLA 1B7XB 2YNBA 2J92A 1GWAA 1TNKA 2HVXA 1ORFA 2XBWA 8GCHF 1BTPA 1O5FH 3SJ9A 2GCHF 2QAAA 3Q00A 1ELFA 1YPKH 3TJNA 2ZHWH 4GHTA 1UHBA 1XUIA 1Y3XA 1O3LA 2ZHDA 1QJ7B 1P2KA 1ZPCA 2AIQA 1Y59T 5DJ7A 1CO7E 3QGNB 3RXVA 1GI8B 3A82A 3VB3A 1GBBA 2Q1JA 1BTYA 1HAHH 4AYYB 3ZYDA 1H4WA 4TPIZ 4YT6H 2AFQB 1DOJA 1SHYA 1F7ZA 1ABJH 1BJUA 3JZ2B 1Q31A 4ZKOU 3OTJE 2P59A 2GDDA 1TPSA 2CHAB 1O5AB 3G01A 2EI8A 3A81A 1T32A 2FM2A 1ZTJA 1KXCA 2R3YA 1Y5UT 1HV7A 1SGTA 4VGCC 3SJKA 3KQCA 2G5NA 2WPIS 1RRKA 3MNXA 4AB9A 2XWBI 4IMQA 3CS0A 1B0FA 1P57B 1BTWA 2ZFFH 6GCHG 1C2MA 3S9AA 4ISIH 1T7CA 3LOXA 1EUFA 1IQJA 3A83A 8KME2 1S5SA 1XXDA 3RUOA 3STIA 3RXMA 1TIOA 1E37B 5A8ZA 3U8RH 2XBYA 1QNJA 1DLKB 4UE7H 1FNIA 2ZTYA 3TH3H 3M5NA 1LHEH 2A4RA 1BMAA 5LGOA 3SV7A 1T8LA 2BDCA 2W26A 1SGRE 2XBXA 1C4Y2 2NU2E 1IAUA 5EOKA 1HAPH 1MMJN 5FBEA 1O2PA 2ODQA 2AMQA 1UTJA 4RSPA 2A5AA 3TK9A 3ZZCA 1O2OA 4ZHMU 2UUFB 1DPOA 1GI2A 3T28A 1HUTH 1C2HA 3MU4A 4LK4A 3RXQA 1GBCA 2FWWA 2GT7A 1KSNA 3TJVA 2Y6TA 3LJOA 3M61U 2ANWA 2ZGHA 4MG3A 3MU8A 1SQOA 1O5CB 1W7XH 3UIRA 2WV4A 4A5TS 4CH2B 1J14A 3UY9A 5BRRE 5DGJA 2D2DA 3TLOA 1TGCA 2GKVE 3LGVA 2ZECA 4GUXA 1OP0A 2QF3A 1O35A 5EU8A 1D9IA 3SUEA 4YLQH 4ABAA 1LVYA 4O3TA 3RLYH 1SMFE 1O38A 4HZHA 1P05A 1KLJH 1O3NA 3DA9B 3VGCB 6LPRA 2ASUB 4Y6DA 3RXSA 1TAWA 4X6OA 4ABJA 3SNAA 1C1OA 1FQ3A 2A2QH 1S82A 1QGFA 1WOFA 3TK5A 4KGAA 3GCHB 2FYQA 5TCCA 1P2JA 3H5CB 1LVMA 5CMXH 1BIOA 4SGAE 1Y8TA 2GZ7A 2VU8E 3QZRA 3RXJA 3UREA 4AGJA 5JB8S 3SU5A 4I8GA 1O2JA 1DSUA 1YM0A 3QWCH 1NT1A 1YC0A 3S7HB 1GI1A 1V2VT 2Y7XA 1Z8GA 1ANBA 5EXLA 4K69A 3RXUA 3C27B 3GY7A 1TOCB 2J34A 1MQ6A 1CSOE 1GJ9B 1S81A 2WPHS 1XX9A 1L1GA 2FTMA 4O3UA 2BVSH 1HJ8A 3VXFH 3LKWA 1ELDE 3R3GB 4BXWA 1P02A 1GBTA 2A1DB 2GD4B 2GGVB 3A7XA 1A3EH 1GHAF 1A7SA 4BAMB 1QB1A 4WF8A 5GXPA 1Z71A 3SU4A 4ZXYH 3MU0A 4MPXA 1BRUP 1MKWK 1MUEB 4ZH8A 4RN6A 2JETB 2TGDA 5IDKA 1GCTB 2ZZUH 4U2WA 1O3DA 2W3KA 1CU1A 1TGTA 2J2UA 2OBOA 3MO9A 1SLWB 2C8XB 3SOSA 2XC0A 3TH2H 2OTVA 5JBCS 1ARBA 5E2PA 5K7RA 4FU7A 1GHBG 1QIXB 1SGCA 2H9TH 4MLFB 2J95A 3QZQA 2BLVA 1BB0B 1Y3UA 2UUYA 3V13A 2VIVA 1SL3A 4DCDA 2BDHA 2C8YB 3BSQA 4CHAB 1KLTA 5FPYA 5CE1A 1O39A 2G55A 2BD5A 1NESE 1UVSH 1AVGH 1BUIA 5DK1A 1XKAC 1BRAA 4AFQA 3GY3A 1GMHG 1O2MA 4UONA 1C5RA 1SPJA 1VITF 1W0ZU 1LPKB 3ZVDA 5F8TA 2AH4X 5BPEA 4AX9H 4ZMAH 4B2AA 3TGIE 1O5BB 1IQHA 1SQAA 3SU3A 1ETTH 1BHXF 2A2XH 3I29A 1A5IA 1V2OT 1E34B 2F91A 4JMYA 1BT7A 3SN8A 2NWNA 1EPTC 1PPHE 1HYLA 3URDA 4ZKSU 3NKKA 1IHTH 2ZFPH 4X1PU 2VJ1A 1Y5AT 1O5GH 3U8TH 1MKXK 4X1RU 1K1IA 1EXFA 1ZHPA 3EQ0H 3KGPA 1QB9A 2HLCA 1A4WH 2FOBA 2TGAA 2JH0D 2PGQB 1QA7A 1QURH 2VIOA 1TNHA 1ZMNA 2H9EH 2PGBB 3T26A 1MU6B 1G32B 4JK5A 1NM6A 2A45B 4UFDH 2PLXA 1T31A 1BMNH 1ZYOA 1NU7B 5EODA 4ABHA 1DWCH 1PPZA 1PJPA 3BTTE 4YZUA 1QL7A 3BTGE 3SBKA 1C1UH 1TMUH 1DSTA 3GDVA 2D1JA 1LDTT 1WU1A 2PKSC 1C1TA 1V2MT 3UFAA 1QFKH 4WH6A 4XBDA 2TRMA 1VCQA 2R2WU 3QTOH 1WCZA 1AB9C 1CVWH 2AMPA 3BG4B 1EAXA 1WYKA 2BQ7B 3SUGA 3LGWA 2A5KA 3ZZ9A 4X8SH 2TPIZ 2SGFE 2BDAA 5HM2A 3SJIA 1GBEA 1FV9A 1V2KT 5C67A 2BB4A 1ZHMA 4JZDH 4ZAEA 5LH8A 2BHGA 3MI4A 1OYQA 1SLUB 2BDGA 2PSYA 1CBWC 1RXPA 4UFGH 1F5KU 4DIIH 1PFXC 3GOVB 1ZPBA 3S7KB 2HALA 4IGDA 1FY4A 1ELAA 1CHGA 2HNTF 2ZGBH 2B5TB 1FY3A 3GY8A 1TBZH 1TBRH 3ODFA 1XVMA 4MQAA 1NS3A 1FUJA 2ZNKH 1J15A 4R8TB 3E16B 2GV6A 1LQEA 2SGDE 3ZYEA 2G5VA 1WSSH 1G9IE 2F9BH 4NSYA 1BMMH 3SV6A 2BY6X 3BTKE 1ZR0A 5AHGH 3F1SB 2V6NA 2W3IA 1MH0A 1NZQH 1FAKH 5CHAB 4AFZA 3FVFB 1SGPE 1SR5C 4Y11E 1J16A 2ZHQH 3PMBB 4MDSA 1HXFH 1JBUH 1QJ6B 1AHTH 4ISNA 1GI4A 2Y80A 4K8YA 2O8MA 3MH7A 4YOGA 1AUTC 1ARCA 3BV9B 2BDIA 2AEIH 9ESTA 2C4FH 1T8OA 3P92A 1THSH 3EYDA 4AG1A 1JMOH 1KTSB 1OPHB 1UTQA 2EI7A 2UWOA 5A8YA 3M7UA 4X2VA 4B73A 2GCTB 3BTME 1EJMA 3AW1A 1H9IE 2LNCA 2ZDAH 1HDTH 1E0FD 1OKXA 2UWPA 3ZZ5A 2FO9A 2RCEA 1KXDA 3GCTF 1KLIH 3QLPH 1V2TT 4J1YA 1HAOH 2H5DA 2BOKA 1J9CH 5B6OA 1BZXE 3SJ8A 2WPMS 4I32A 3FANA 1SVPA 5DPAA 2Z9JA 1XVOA 1ELTA 2H5CA 1V2RT 1L1JA 1K1JA 1NFYA 4A7IB 2ZPSA 1QB6A 5T6GA 1XM1A 2FOFA 1GI6A 3RMOH 3SV2H 1WUNH 2WYJA 4MNVA 3RLWH 1MCTA 1O3KA 1OSSA 5E0GA 5JB9S 1SOZA 1L4DA 2FXRA 4UEHH 1P0SH 3BIUH 5T6DA 2ANKH 1DY9A 1FONA 1GMDF 2FI4E 2EA3A 4Y0YE 4BTTB 2BD2A 3HKIB 3U98H 2PSXA 1TA6A 5G4BA 1C2DA 1YPGH 3SNBA 1QR3E 3PMHB 3LGTA 3ATMA 3ZZDA 4NIYA 1XUHA 5GCHG 1TGNA 1BTXA 2A7CA 1LPGB 1GBLA 3P8NA 2A31A 2P95A 4Y71A 1GDUA 2ZWLH 4WMEA 3QK1A 4XSKU 3LIWA 5A0BA 3RDZA 4IS5A 8LPRA 2HWLB 1J8AA 2ZFQH 5EQQA 1C5QA 3VB7A 2NU0E 3DUXH 3PTNA 2GP9B 7ESTE 1NFWA 1CA8B 2DE9A 2PW8H 3D49H 5E8EH 2OC8A 5IYTA 1GHWH 1K2I1 2AMDA 6CHAB 2Z9IA 4MTBA 9LPRA 3GY6A 2WPLS 2CF8H 3RU4D 4MPUA 1C1MA 1Z1JA 1ESAA 1OWKA 3M5OA 3HK6B 6ESTA 4BTUB 4I7YH 5DP9A 4UDWH 2JH5D 1VR1H 1XUGA 2PKSB 3ZVGA 2Q6FA 1H9HE 5ESTE 8GCHG 1W7GH 1GJ7B 4E7NA 1MKWH 3HATH 3F9EA 2A4OA 1GVZA 1G30B 3FP8E 4SGBE 5L2YH 2Z9LA 4CREA 1AE8H 2ZPQA 1FIZA 2Z9GA 4Y8XA 1A0HB 3DHKH 1F5LA 1TNIA 1BBRK 4DW2U 1S83A 2ZGJA 1EZUC 2EC9H 2ZU2A 1UCYK 4GLYA 5PTPA 2Z9KA 3LC3A 3VPKA 3OY6U 5T6FA 1G3BA 1D3DB 3TNTA 4U01A 1O2WA 1AU8A 1EZXC 1ESTA 3N7OA 2BDBA 3K6YA 3VEQB 1LQDB 1PQ7A 3SJOA 5GJ4B 2AERH 4GHQA 1IHSH 4B76A 1LTOA 1SGEE 1QA0A 1AFQB 3FP7E 1C2LA 3V7TA 1HLTH 1FJSA 3MNSA 4NSVA 4DY7B 1ZPZA 2K1QA 2GZ8A 4ISHH 1V6DA 2YNAA 5AVDA 4MPVA 1CHOF 1KTTB 4Z6AH 2O8TA 7GCHG 1O3OA 3S9CA 2R0LA 3BEUA 1TE0A 2J38A 3GY2A 1ELBA 4KKDA 1GBHA 3M5LA 4K1TA 1UTPA 1TQ0B 2J9NA 5J4SA 2ZKSA 4JZFH 1F92A 3RC5A 3Q3YA 3BTWE 4GCHF 4GSOA 1BRCE 1C5YB 1P09A 1O2HA 2BXTH 1LCYA 4XOJA 5JBAS 2XRCA 1FDPA 4K3JA 2BLWA 4A1TA 1NU9A 1K22H 4ABFA 4INLA 2Z3CA 3MFJA 3AAUA 2XW9A 4Y0ZE 3RP2A 1TLDA 3BTHE 3U69H 1AO5A 1TOMH 2ZP0H 4NIWA 2OQUA 1YCPK 2F3CE 2ZDVH 1ZRBA 1C5XB 1O34A 2ZQ2A 1TRYA 3V3MA 3AW0A 4ABGA 1CA0C 2QXGA 5DP6A 3KCGH 5ABWA 1C2JA 1BTZA 3TU7H 2ZU3A 1MBQA 1IQMA 2FTLE 1GJAB 2ZFTA 2H2ZA 3H7OA 4JYTA 1C4V2 1AKSB 5AF9H 3GCNA 4FVBA 1O37A 1QTFA 5FX6A 2QIQA 1UCYE 3ATWA 1P9UA 2QF0A 2VGCB 1E35B 1UTNA 2J94A 5HMAA 3GY5A 1AE5A 1PPEE 1GHZA 2Z3DA 1NRPH 3AASA 2STAE 3PV4A 1TX7A 1UJ1A 2P8OB 5LPFA 2SGAA 1C5VA 3PTBA 3A7TA 5EQSA 2VNTA 3ZZ4A 1RTFB 1C1SA 1D3QB 1GI9B 4NZQA 3Q76A 1QY6A 3H7TA 1ANCA 4INHA 2GMTB 2PFEA 4DGJA 1TALA 4TWWA 2P3FH 1TBQH 1KXAA 4XBCA 3R0FA 3LT3A 1PPCE 3JZ1B 6GCHF 1ETRH 2ZU5A 5DO4H 1HGTH 1Z6JH 1PPGE 2EI6A 1F0UA 4ZKNU 2FS8A 3NUMA 1SG8B 2AYWA 4IN1A 2PWXA 1O2VA 2Q6GA 5EG4A 3BTFE 4YO9A 1EP6A 3RXDA 1RIWB 2VVUA 2GDEH 3P95A 5A2MH 1ELCA 1TPAE 3LGUA 2J4IA 3RXAA 2ZPRA 2R0KA 2CGAA 2ZDNA 1HCGA 2H9HA 2VIWA 2ODYB 1VZQH 3VB6A 1A2CH 2XTTB 1PPFE 2FMJA 4Y7BA 1NPMA 1SLXB 4UFFH 3PLPA 4MNXA 3FFGA 2ZGXH 3C1KA 5JPMH 3UNQA 1ETSH 1DITH 3EA9A 1DFPA 3A87A 1O0DH 1SB1H 4GVUA 2PTCE 1SGFG 2KAIB 1UMAH 5E2OA 1TONA 5GDSH 3U8OH 1SQTA 1KIGH 2ULLA 4WY3A 5EGMA 3KIDU 3TPIZ 5C5NA 3A8CA 1GG6C 1RTKA 1AWFH 3TGJE 1VGCB 3ZVEA 1K1MA 1QRXA 2VIPA 1ZJDA 1YP9A 3OY5U 2A5IA 3ESTA 1MTNB 2FOGA 4FUDA 1GI3A 1P01A 3RM0H 1HRTH 1SSXA 1WQSA 3I78A 4AGKA 3SU2A 3MNCA 4I8LA 2PUQH 4FXGH 1VJAU 1F0SA 5AFYH 4KTUA 1E36B 4YT7H 4ZKRU 1G37A 4CRBA 5A0CA 3O8BA 1O32A 2BX3A 3RXLA 1P10A 1N8OC 1O3EA 3ZVBA 3A86A 3NZIA 3SQHE 4WXVA 4AYVB 1LVOA 4ZHAA 1AWHB 3LPRA 1C1PA 2VWNA 1O2NA 4X2XA 4F4OC 1ZTLA 2VWOA 3UR9A 2GX4A 1HIAB 1GBKA 1HIAA 1IOEA 4WJG2 4Y8YA 1YPEH 1DUAA 2OQ5A 1UTKA 3BIVH 4VGCB 1OP8A 3ENSB 4WH8A 4Q7ZA 1UTMA 1Q3XA 3S9BA 3TGKE 2VWLA 1TNGA 3EGKH 2H6MA 3A8AA 5EPYA 3BTEE 3NXPA 3ZZBA 2OUAA 4B1TA 1EP5A 4I31A 2ZA5A 3A8BA 4X8UH 3RXRA 1MZDA 3KHVA 4D7FA 1GBJA 4TY7A 3SU1A 4NG9H 4X6PA 1BQYA 2CN0H 2ANMH 3M7TA 1O30A 3EDXB 1O2KA 1Z6EA 3LGIA 4MPWA 3O8RA 1ESBA 1O36A 1IQKA 5FAHA 2A7JA 4UFEH 1P04A 3BTDE 1YYY1 2Z3EA 5F6MA 3NPSA 5SGAE 3RXHA 3SO3A 1DANH 1UCYH 2R3UA 4IW4E 2OCVB 3UOUA 3SQEE 1GVKB 4CRCA 4ZROA 3SNDA 3TJOA 5EW2H 4OS7A 2HRVA 3F9HA 3RMNH 4K5ZA 1THPB 3PLBA 4LOYH 3P8FA 1NRNH 3GDUA 1TGBA 4RKOB 3DFLA 1IQFA 1Q2WA 5ESBA 1GMCG 3QX5H 1O2UA 1DS2E 4NGAH 5C5OA 2FOEA 1KXFA 1SC8U 2I6QA 4O97A 4MVNA 1FIWA 1EZQA 1OS8A 4X1QU 2RG3A 3SU0A 1O2ZA 4K1SA 1M9UA 3L3TA 2LPRA 2ANYA 2QYIA 3MTYA 1HB0B 1FN6A 1V2NT 2PUXB 1JOUB 1T8MA 2ESTE 4U30A 2BD4A 4AFSA 2QV1A 3BTQE 2FPZA 1HAXB 2FP7B 2PKAB 4NIVA 1C1VH 1O5DH 1P2QA 4X1SU 7KMEH 2DE8A 5LPRA 1YLDA 2BLOA 2XNIA 3W94A 1QBNA 1G2MA 2BOHB 1D6RA 1O2TA 1HJAC 3QUMP 4Q2KA 1B0EA 1ZSLA 2ILNA 1C2KA 3PROA 3HK3B 1GJBB 1MZAA 2R2MB 1MTWA 3L6PA 3SNEA 1YBWA 2WYGA 2FOMB 1C5MD 4JZIA 1U6QA 2ZCHP 1V2LT 1C1WH 2HPQH 3A89A 4E05H 1ZZZA 2VIDA 1HFDA 2G52A 1NROH 1YCPH 5FBIA 4Z0KA 5L30H 3GYMA 5GIBA 2D26C 1MAXA 1O2YA 1EJNA 1QJ1B 2RA0A 1TFXA 2HOBA 4NFEA 3TIUA 2XCNA 2GT8A 3SU6A 1C2EA 1EB1H 2Q6DA 4FUCA 2FYRA 1C2GA 1C1RA 1SHHB 1GL1A 1O3IA 1P3CA 1Z8RA 2F9VA 3GCTG 1W10U 2A4GA 3NWUA 4D8NA 1O2SA 1ZLRA 3UPEA 3MHWU 2ZU1A 1A61H 2GVFA 2UWLA 4FU8A 1J17T 3B8JA 3ZZAA 1AZ8A 1AVWA 2FOHA 1NC6A 2HNTC 1WTHD 1FLEE 4O9VA 1CGJE 1DICA 1ELEE 3GISB 2VVCA 2CHAC 4Y79A 2UUKB 1DWEH 4NWKA 1DE7H 4LZ1H 1TGSZ 2SNVA 5ETXA 4J2YB 4H6TA 1EAIA 2FZZA 2XYAA 3STJA 1K21H 3E8LA 3MH5A 4WMDA 2GTBA 2JH6D 2UUJB 1NN6A 1TX6A 2P94A 1OYTH 1W13U 2PV9B 4X2YA 1TRNA 5FXLA 2GV7A 1XUKA 1DDJA 2AIPA 2SGQE 1THRH 4ABDA 1DWBH 1K1OA 1GJ5H 4D9RA 5HGGA 4AOQA 4H6SB 3OSYA 4A92A 2QN5T 3PO1C 2XXLA 4R0IA 2JKHA 4XFQA 1V2ST 3KN2A 1P11E 3SNCA 1YPMH 2F9PA 2FLBH 5DP4A 3P8GA 1GJCB 1FZZA 3QGJA 2GZ9A 1XUFA 1C1QA 1V2QT 1FXYA 3RU4T 1NRSH 1HAYB 2Y81A 4JZEH 2SGPE 2W7SA 1OWJA 1HPGA 1W14U 2Z6BD 1S6HA 1D6WA 1C5LH 2BZAA 2V0BA 2Z7FE 3GY4A 2D8WA 3U9AH 1O3FA 1DM4B 4CRAA 1GCDA 1K9OE 1G3CA 1EPTB 3KEEA 5FPSA 1EPTA 2P93A 4B74A 1OWEA 2PR3A
chains in the Genus database with same CATH superfamily
3L33A 2BD7A 1OXGA 1UO6A 4BAOB 5C3NA 1A5HA 2VH6A 3M3SA 4ZXXH 4FUFA 1HXEH 3A7VA 1FY1A 4TYDA 4HI3A 4A1VA 1PQ5A 1P2IA 2VINA 1TMTH 4KTSA 1WTGH 3RXBA 4DT7B 1GJDB 3E1XB 1Y3WA 1ZTKA 2RDLA 5F8XA 1ZGIA 3RXTA 4DJZB 3MMGA 1SLVB 3PM3A 2P3TB 2PTNA 3UNSA 1UVPA 2FI5E 1BMFD 2ZFSA 3K65B 4NCYA 3HKJB 2C90B 2BD9A 1LKBA 2BZ6H 3KQEA 3P17H 4Y8ZA 2BY7X 1BHXB 3KQ5A 3OX7U 1BTUA 1D3TB 1AGJA 1FMGA 1VCWA 4TPYA 5C1XA 1O2LA 4K1EA 4TSFD 2H1UA 3VGCC 1WBGB 1L1NA 2OP9A 2GCHG 1CT4E 1Z8IB 1Z1IA 3FO8D 1BMLA 4YLUA 2W7UA 3VB4A 1AB9B 1MAYA 1UVOA 3F0PA 1ZGVA 5A09A 2WSSD 2ZGCA 3RM2H 5C0UA 3GCHC 5IK2D 3LONA 2JJ2D 1AUJA 4Y10E 2ZIQH 3A7YA 3RXOA 2Y82A 1S0RA 3OFND 3MO3A 1AQ7A 1UK4A 1HBTH 2B7DH 4X2WA 1GI5A 1YCPM 2BLQA 2QY0B 1EKBB 1EASA 1NTPA 3CP7A 3KQBA 1P8VC 1ZSKA 2V3HH 5HIYA 3PB1E 3RXKA 5JDUB 3IG6B 3FZDA 5EXNA 3NK8A 1V2UT 1C1NA 1CBWB 1UVTH 2L6OA 1TQ7B 1RJXB 2ZU4A 4K8BA 2VWMA 2CF9H 2LELA 2IJOB 1DT2A 3Q77A 1O3JA 3RU4E 1LKAA 2BTCE 2BXUH 3SV9A 1XUJA 4HTCH 1PPBH 5DP8A 4K60A 1DLEA 4BXSA 2ZHEH 4YOIA 2I6SA 3RXPA 5GWZA 1GBFA 2NU3E 1GI7B 2FOCA 2G4TA 1PQ8A 3KNXA 5H4IB 2O8UA 3VG8A 3SGQE 1P2OA 1HAVB 1HAVA 1YKTA 4NIXA 1F2SE 3GICB 3OEED 1N1LA 1WQVH 3TJUA 1X7AC 1IQIA 1P2MA 5FPTA 2WV9A 4OS1A 1UHBB 1EB2A 1DVAH 1OWDA 1C2IA 4HFPB 1W12U 2F4LA 2HNTE 2JETC 3URCA 3M5MA 1GCTC 1GPZA 3PV2A 1MKXH 3OYPA 1SOTA 1O2QA 2OD3B 4CBOA 3O8CA 1OHHD 1GDNA 2Y7ZA 3LU9B 5EJZA 2SFAA 4BTIB 3DCLA 5JBBS 5I46H 1C9TA 1SFQB 3B9FH 3T62A 3AVZA 1H8IH 3QO6A 4KELA 4X1NU 2VVVA 3T29A 1ZSJA 4CHAC 1TPPA 2FIRH 1CGIE 3CS7A 1O3CA 2F9UA 3RXEA 2A32A 4I8HA 2ZDKA 2CV3A 1NRRH 1Y3VA 1BTHH 2TGTA 3ZIAD 7LPRA 1INCA 4Q63A 3S0NA 1F5RA 4ASUD 4FVDA 1AKSA 3ZVAA 3EE0B 4BAKB 4OGXA 1FAXA 3M7QA 1WAYB 4OS2A 1BBRE 4CBNA 7GCHF 1A3BH 2PHBA 2V35A 3E6PH 4OS6A 3SUFA 2QXHA 2W6ID 1ANEA 3OU0A 4FETA 2QF5A 1QHRB 3PWCA 2B8OH 3BEIB 5DP5A 3I77A 4XE4A 1MD8A 3M3VA 4ACAA 1GL0E 2IPHA 2M2AA 2SGEE 1MTUA 1TPOA 3PO1B 4Y76A 2BX4A 5E0JA 2FESH 1ACBE 4AB8A 1P03A 1JRSA 2G81E 3BG8A 4FUEA 1E1QD 4IC5A 1H8HD 1AD8H 4HGCA 4I8JA 4P02A 1A5GH 2TGPZ 5FX5A 5DP3A 2SNWA 2ODPA 3BEFB 5F03A 1KY9A 4IMZA 3WY8A 4AN7A 4ISOA 1DY8A 2WINI 4DG4A 3DSPA 3UNRA 1CE5A 1Y5BT 1YPHC 3MOCA 1K1LA 1GHVH 3K2UA 4BAQB 5DP7A 5T1VA 1D4PB 1O3PB 1XMNB 2HPPH 2TBSA 3NCLA 1NBMD 4LZ4B 4JYVH 1TNJA 4H4FA 4BOHA 1VITH 1FY8E 4ABEA 4WWYA 1JRTA 1GHXH 3ZVFA 1XKBC 2QCYA 3VB5A 3IWMA 5E0HA 4JCNA 3ZV8A 4D76A 4AZ2B 1S84A 1QZ8A 2R9PA 2FX4A 3BG4C 1W8BH 1PYTC 2Y5GA 3ATLA 2FS9A 3T27A 3TITA 5J4QA 1ID5H 2ZG0H 1KMHB 2Y5HA 2IN2A 4CR9A 3D62A 1GHYH 3SGBE 4ASHA 1C5SA 3UQVA 1RTLA 3PLKA 1TWXB 1GHAG 3V12A 1KXBA 3KYFA 4B2CA 2KAIA 1ZHRA 5HXFA 1SGYE 3KL6A 4UD9H 3UR6A 4Q7YA 2Y5FA 1FI8A 1AI8H 3A8DA 4GAWA 4A6LA 4Z1MD 2BVXH 1O3GA 1CGHA 1NBME 3ELAH 1G36A 1GJ6A 1BRBE 2FI3E 3Q3XA 5C1UA 4B2BA 3DD2H 4KP0A 4BAHB 3LH3A 1EOJA 2F9NA 3PWBA 1QRZA 4XDEA 4H42U 1SGQE 2ZO3H 1W0JD 4ABBA 1IQLA 1KDQB 2HVYB 1C5UA 1KDQA 1SBWA 3F2HA 1W0KD 4XBBA 4DURA 2G00A 5C20A 4OGYA 2THFB 2OXSA 1GBDA 3HGNA 3K6ZA 4NFFA 5CHAC 2IOTA 5A8XA 1SFIA 3MNBA 1LHDH 5EQRA 1A0LA 2C3SA 3AAVA 1Z8JB 3A84A 3UOPA 3ODDA 2XBVA 3ZZ7A 4I86A 3MU5A 2YOLA 1V2JT 5FHTA 1VITG 4INKA 2OBQA 2XCFA 2M5TA 2AGGX 4DVAU 1MBMA 4ABIA 1GBAA 1F0RA 1UTOA 1AFEH 4X6NA 3ITIA 1YF4A 1W0YH 3SI4H 1FY5A 2JJ1D 4OS4A 3ZZ3A 4YESB 1P2NA 5JYIA 3RXCA 1K1PA 4E06H 1BA8B 3LJJA 1DX5M 2GCTC 2BY9X 2OC0A 3KF2A 1C5NH 3T2NA 1YLCA 1GGDC 4DOQA 1ELGA 2VB0A 3W1EA 1AY6H 5EJLA 4Q7XA 1S85A 2EEKA 2ZFRH 2QC2A 4FUBA 3EA7A 4AFUA 1O2GH 2WUBA 2ZDMA 4CH8B 1G3EA 4WMFA 3U1JB 1TRMA 1AIXH 3VXEH 2A7HA 3D23A 1P9SA 5AFZH 3RXIA 2CMYA 2OLGA 1V3XA 3E0NB 3U1IB 3P70B 4CRGA 3S69A 5EPNA 1EZSC 1IQNA 2OC7A 4DIHH 1T4UH 1GI0A 5LPEA 2C93B 3HPTB 1GBMA 4FUGA 3RXGA 3MWIU 1CA0B 1E1RD 4ZHLU 5C0TA 1A46H 3KQDA 3Q3KA 1N6YA 1HAGE 4JK6A 2K0QA 3QN7A 5FCRA 1UVUH 1C9PA 4FOUC 3DFJA 1KYNA 5EXMA 1TX8A 3RXFA 2BQ6B 1AN1E 1QQ4A 3T25A 4FUIA 4THNH 1O2XA 1BDAA 3TK6A 3E0PB 5C1YA 1P06A 2BMGB 3MU1A 4X0WU 3E91A 2ZTXA 1BBRH 1PYTD 1LO6A 2P3UB 1HAIH 2KCAA 2V3OH 3FKSD 1GHBF 4FU9A 1C2FA 1K1NA 1Y3YA 2A4QA 1C5OH 2HGTH 1QRWA 1MCVA 5JBTA 3M3TA 1O2IA 3GCOA 3RMMH 1DUEA 1G2LA 1NFUA 1OOKB 1MQ5A 3P8OA 1SGDE 3FP6E 3LGYA 3TH4H 1YPHE 1ANDA 2WV5A 1E79D 1ZMLA 4LXBH 1CT2E 1EATA 1YGCH 1GDQA 1GMHF 2O8LA 3MO6A 5F53A 2FDAA 2IJD1 2STBE 5TJXA 4AG2A 2Z94A 3V0XA 6CHAC 1ZOMA 1RGQA 1UK2A 2F83A 1OWHA 3A80A 1SI5H 1YY3A 3LDXH 1BCUH 2PKAA 3SHAH 1V2WT 2ALVA 3F6UH 3UTUH 2WHXA 4E7RG 5DSFA 5I25A 1ZJKA 4BNRA 1B5GH 3UQOA 1ELVA 3TNSA 1O3BA 2WUCA 5L2ZH 4TY6A 4D7GA 3UB0A 2QGRA 4F49A 2FODA 3PMAB 1QQUA 2BYAX 2V3MA 1GVLA 4B75A 3PYHA 1EOLA 4I33A 4RKJB 1QBOA 1P12E 2W5EA 3MH6A 2AGIX 1EQ9A 5HM9A 1QCPA 1LHFH 2KZ4A 1GMCF 1MTVA 2ZF0H 5F8ZA 2OINA 3ZZ8A 4B6FA 2J5UA 1TABE 2OC1A 4IC6A 1O33A 1DXWA 4ESTE 1IQEA 1AFQC 3F9GA 4WVPE 5KGOA 1E38B 2ZEBA 2QXJA 4IN2A 2AGEX 4ISLA 3T5FH 4U32A 3SZNA 1JIRA 1UK3A 1KXEA 1P3EA 2P16A 1GG6B 3M37A 1QL9A 2ZTZA 2C8ZB 3ATIA 3CENA 3QTVH 1RD3B 4IBLH 1MTSA 1SKYE 3F68H 4OS5A 5L6NH 1C5ZB 1A1RA 1N6XA 4X8TH 5GNDA 3BF6H 3BN9A 3D65E 2OK5A 4F55A 2ZQ1A 1D3PB 1O5EH 3SV8A 3MYWA 3DT0H 1SGIB 5C2ZA 1JXPA 1BOQA 1EX3A 4MNWA 4NA7A 3HGPA 1ABIH 1TA2A 2ZDLA 5FCKA 1BJVA 1ZMJA 1GMDG 1RFNA 1EAUA 1N8OB 1CQQA 1YPJH 4JYUH 1TMBH 1RS0A 4RI0A 4ZUHA 2ALPA 3ZVCA 4CRFA 3WWBA 1O3AA 2F43B 2FX6A 5K0HA 5FL7D 2G4UA 3N7DA 8ESTE 2XC5A 1T8NA 2XWAA 1TNLA 3LH1A 3OAAD 4YM9A 3SHCH 3K9XB 1CT0E 1QL8A 4OM9A 3E3TA 1TB6H 3SORA 2QXIA 1GGDB 4WXIA 4ZCNA 1YPLH 2FEQH 4JZ1A 1SGNE 3E90B 2KFWA 3QDZB 1VCPA 5GPIB 3SI3H 3TVJB 1C5WB 3UWJH 4NA9H 1NY22 1L4ZA 3VFEA 1DWDH 3ZZ6A 2CXVA 3W95A 2A0QB 2VGCC 3ZV9A 1TYNA 1L2EA 1SGFA 2EY4C 2ZI2H 1GJ4H 1NFXA 2WPJS 1GBIA 1XXFA 3EA8A 1C4U2 4I8KA 2P8OC 1QBVH 2ZCLP 1UTLM 2DUCA 2XC4A 4BANB 1OP2A 1C5PA 1EAWA 1EJAA 4QT8C 2B9LA 1FN8A 1Z7KA 2PP6A 3H09A 1L0ZA 3IITA 3A7WA 2VIQA 1FPHH 4CR5A 5A0AE 1H9LB 4TWYA 2GMTC 4M7GA 1LPZB 5T3HA 3UWIA 2WPDD 2TIOA 1VJ9U 3AK5A 1OWIA 2ZC9H 1MD7A 1DXPA 1S6FA 1W11U 4D9QA 5HYOA 3A85A 1LMWB 3M36A 2C8WB 4MNYA 1T4VH 1AZZA 1AVXA 1S0QA 3RC4A 1OX1A 2G51A 4B71A 2BY5X 2BQWB 2F9OA 1O3HA 4FUHA 5DKMA 1F0TA 5TCAA 1BITA 1H8ED 3SUDA 1O2RA 1LHCH 1UW7A 2B0FA 2VH0A 1G3DA 1O3MA 2ZHFH 4O03A 3EAJA 3UUZA 3M35A 1H8DH 1JWTA 2BY8X 2WPKS 3B23B 1RIWC 3SW2B 4KTCA 3F9FA 2BM2A 4NWLA 1IQGA 3P6ZB 3PMJA 4X6MA 2AS9A 3A88A 4GPGA 2BDYA 2CJIA 1WV7H 4PROA 2BVRH 4CRDA 1MU8B 1PQAA 2AHME 1GJ8B 3ATKA 1AMHA 1CHOG 1K28D 4Y7AA 1HJ9A 5GCHF 1HNEE 3PRBA 3A7ZA 3NRLA 2O8WA 1JIMA 1W2KH 1HAZB 2ZCKP 2NU4E 1H1BA 3GDSA 1W3CA 5EW1H 1HJAB 4YTAA 2RA3A 1LHGH 1FPCH 1NRQH 3MH4A 2NU1E 4GCHG 4AORA 1LVBA 3RC6A 2BD3A 1V2PT 2G8TA 3O8DA 1C5TA 2CK3D 2O9QA 4YOJA 4NA8A 4Q80A 5DG6A 4RT1A 1O31A 1ZRKA 4K2YA 1VGCC 3SGAE 3LC5A 3FAOA 2FLRH 4A1XA 3GYLB 3FZZA 1MTNC 2BD8A 2FOAA 4FUJA 3RMLH 4X8VH 1A0JA 2QA9E 1NO9H 4NZLA 1B7XB 2YNBA 2J92A 1GWAA 1TNKA 2HVXA 1ORFA 2XBWA 8GCHF 1BTPA 1O5FH 3SJ9A 2GCHF 2QAAA 3Q00A 2J98B 1ELFA 1YPKH 1COWD 3TJNA 2ZHWH 4GHTA 1UHBA 1XUIA 1Y3XA 1O3LA 2ZHDA 1QJ7B 1P2KA 1ZPCA 2AIQA 1Y59T 5DJ7A 1CO7E 3QGNB 3RXVA 1GI8B 3A82A 3VB3A 2EQNA 1GBBA 2Q1JA 1BTYA 1HAHH 4AYYB 3ZYDA 1H4WA 4TPIZ 4YT6H 2AFQB 1DOJA 1SHYA 1F7ZA 1ABJH 1BJUA 3JZ2B 1Q31A 4YXWD 4ZKOU 3OTJE 2P59A 2GDDA 1TPSA 2CHAB 1O5AB 3G01A 2EI8A 3A81A 1T32A 2FM2A 1ZTJA 1KXCA 2R3YA 3OEHD 1Y5UT 1HV7A 1SGTA 4VGCC 3SJKA 3KQCA 2G5NA 2WPIS 1RRKA 3MNXA 4AB9A 2XWBI 4IMQA 3CS0A 1B0FA 1P57B 1BTWA 2ZFFH 6GCHG 1C2MA 3S9AA 4ISIH 1T7CA 3LOXA 1EUFA 3F2GA 5C17A 1IQJA 2J97A 3A83A 8KME2 1S5SA 1XXDA 3RUOA 3STIA 3RXMA 1TIOA 1E37B 5A8ZA 3U8RH 2XBYA 1QNJA 1DLKB 4UE7H 1FNIA 2ZTYA 3TH3H 3M5NA 1LHEH 2A4RA 1BMAA 5LGOA 3SV7A 1T8LA 2BDCA 2W26A 1SGRE 2XBXA 1C4Y2 2NU2E 1IAUA 5EOKA 1HAPH 1MMJN 5FBEA 1O2PA 2ODQA 2AMQA 1UTJA 4RSPA 2A5AA 3TK9A 3ZZCA 1O2OA 4ZHMU 2UUFB 1DPOA 1GI2A 3T28A 1HUTH 1C2HA 3MU4A 4LK4A 3RXQA 1GBCA 3U28C 2FWWA 2GT7A 1KSNA 3TJVA 2Y6TA 3LJOA 3M61U 2ANWA 2ZGHA 2HLDD 4MG3A 3MU8A 1SQOA 3PRDA 1O5CB 1W7XH 3UIRA 3DSOA 2WV4A 4A5TS 4CH2B 1J14A 4ACBA 3UY9A 5BRRE 5DGJA 2D2DA 3TLOA 1TGCA 2GKVE 3LGVA 2ZECA 4GUXA 1OP0A 2QF3A 2WZQA 1O35A 3WW7A 5EU8A 1D9IA 3SUEA 2IPQX 4YLQH 4ABAA 1LVYA 4O3TA 3RLYH 1SMFE 1O38A 2KM0A 4HZHA 1P05A 1KLJH 1O3NA 3DA9B 3VGCB 6LPRA 2ASUB 4Y6DA 3RXSA 1TAWA 4X6OA 1FX0B 2XNDD 4ABJA 3SNAA 1C1OA 1FQ3A 2A2QH 1S82A 1QGFA 1WOFA 3TK5A 1MABB 4KGAA 3GCHB 2FYQA 5TCCA 1P2JA 3H5CB 1LVMA 5CMXH 1BIOA 4SGAE 1Y8TA 2GZ7A 2VU8E 3QZRA 3RXJA 3UREA 4AGJA 5JB8S 3SU5A 4I8GA 1O2JA 1DSUA 1YM0A 3QWCH 1NT1A 1YC0A 3S7HB 1GI1A 1V2VT 2Y7XA 1Z8GA 1ANBA 5EXLA 4K69A 3RXUA 3C27B 3GY7A 1TOCB 2J34A 1MQ6A 1CSOE 1GJ9B 1S81A 2WPHS 1XX9A 2YMSC 1L1GA 2FTMA 2KCYA 4O3UA 2BVSH 1HJ8A 3VXFH 3LKWA 1ELDE 3R3GB 4BXWA 1P02A 1GBTA 2A1DB 2GD4B 2GGVB 3A7XA 1A3EH 1GHAF 1A7SA 4BAMB 1QB1A 4WF8A 5GXPA 1Z71A 3SU4A 4ZXYH 3MU0A 4MPXA 1BRUP 1MKWK 1MUEB 4ZH8A 4RN6A 3PV5A 2JETB 2TGDA 5IDKA 1GCTB 2ZZUH 4U2WA 1O3DA 2W3KA 1CU1A 1TGTA 2J2UA 2OBOA 3MO9A 1SLWB 2C8XB 3SOSA 2XC0A 3TH2H 2OTVA 5JBCS 1ARBA 5E2PA 5K7RA 4FU7A 1GHBG 1QIXB 2RFKC 1SGCA 2H9TH 4MLFB 2J95A 3QZQA 2BLVA 1BB0B 1Y3UA 2UUYA 3V13A 2VIVA 3FN8A 1SL3A 4DCDA 2BDHA 2C8YB 3BSQA 4CHAB 1KLTA 5FPYA 5CE1A 1O39A 2KX4A 2G55A 2BD5A 1NESE 1UVSH 1AVGH 1BUIA 5DK1A 1XKAC 1BRAA 4AFQA 3GY3A 1GMHG 1O2MA 4UONA 1C5RA 1SPJA 1VITF 1W0ZU 1LPKB 3ZVDA 5HKKD 5F8TA 2AH4X 5BPEA 4AX9H 4ZMAH 4B2AA 3TGIE 1O5BB 1IQHA 1SQAA 3SU3A 1ETTH 1BHXF 2A2XH 3I29A 1A5IA 1V2OT 1E34B 2F91A 4JMYA 1BT7A 3SN8A 1K0HA 2NWNA 1EPTC 1PPHE 3F2FA 1HYLA 3URDA 4ZKSU 3NKKA 1WDIA 1IHTH 2ZFPH 4X1PU 2VJ1A 1Y5AT 1O5GH 3U8TH 1MKXK 4X1RU 1K1IA 1EXFA 1ZHPA 2XOKD 3EQ0H 3KGPA 1QB9A 2HLCA 1A4WH 2FOBA 2JIZD 2TGAA 2JH0D 2PGQB 1QA7A 1QURH 2VIOA 1TNHA 1ZMNA 2H9EH 2PGBB 3T26A 1MU6B 1G32B 4JK5A 1NM6A 2A45B 4UFDH 2PLXA 3EE7A 1T31A 1BMNH 1ZYOA 2QE7D 1NU7B 5EODA 4ABHA 1DWCH 1PPZA 1PJPA 3BTTE 4YZUA 1QL7A 3BTGE 3SBKA 1C1UH 1TMUH 1DSTA 3GDVA 2D1JA 1LDTT 1WU1A 2PKSC 1C1TA 1V2MT 3UFAA 1QFKH 4WH6A 4XBDA 2TRMA 1VCQA 2YMSD 2R2WU 3QTOH 1WCZA 1AB9C 1CVWH 2AMPA 3BG4B 1EAXA 1WYKA 2BQ7B 3SUGA 3LGWA 2A5KA 3ZZ9A 4X8SH 2TPIZ 2SGFE 2BDAA 5HM2A 3SJIA 1GBEA 1FV9A 1V2KT 5C67A 2JDID 2BB4A 1ZHMA 4JZDH 4ZAEA 5LH8A 2BHGA 3MI4A 1OYQA 1SLUB 2BDGA 2PSYA 4DT4A 1CBWC 1RXPA 4UFGH 1F5KU 4DIIH 1PFXC 3GOVB 1ZPBA 3S7KB 2HALA 4IGDA 1FY4A 1ELAA 1CHGA 2HNTF 2ZGBH 2B5TB 1FY3A 1VKYA 3GY8A 1TBZH 1TBRH 3ODFA 1XVMA 4MQAA 1NS3A 1FUJA 2ZNKH 1J15A 4R8TB 3E16B 2GV6A 3F0OA 1LQEA 2SGDE 3ZYEA 2G5VA 1WSSH 1G9IE 2F9BH 4NSYA 1BMMH 3SV6A 2BY6X 3BTKE 1ZR0A 5AHGH 3F1SB 2V6NA 2W3IA 1MH0A 1NZQH 1FAKH 5CHAB 4AFZA 3FVFB 1SGPE 1SR5C 4Y11E 1J16A 2ZHQH 3PMBB 4MDSA 1HXFH 1JBUH 1QJ6B 1AHTH 4ISNA 1GI4A 2Y80A 4K8YA 2O8MA 3MH7A 4YOGA 1AUTC 1ARCA 3BV9B 2BDIA 2AEIH 9ESTA 2C4FH 1T8OA 3P92A 1THSH 3EYDA 4AG1A 1JMOH 1KTSB 1OPHB 1UTQA 2EI7A 2KCOA 2UWOA 5A8YA 3M7UA 4X2VA 4B73A 2GCTB 3BTME 5B6LA 1EJMA 3AW1A 1H9IE 2LNCA 1EFRD 2ZDAH 1HDTH 1E0FD 1OKXA 2UWPA 3ZZ5A 2FO9A 2RCEA 1KXDA 3GCTF 1KLIH 3QLPH 1V2TT 4J1YA 1HAOH 4AC9A 2H5DA 2BOKA 3OTPA 1J9CH 5B6OA 1BZXE 3SJ8A 5CDFE 2WPMS 4I32A 3FANA 1SVPA 5DPAA 2Z9JA 1XVOA 1ELTA 2H5CA 1V2RT 1L1JA 4F48B 1K1JA 1NFYA 4A7IB 2ZPSA 1QB6A 5T6GA 2LP6A 1XM1A 2FOFA 1GI6A 3RMOH 3SV2H 1WUNH 2WYJA 4MNVA 3RLWH 1MCTA 1O3KA 1OSSA 2VBCA 5E0GA 5JB9S 1SOZA 1L4DA 2FXRA 4UEHH 1P0SH 2K8IA 3BIUH 5T6DA 2ANKH 1DY9A 1FONA 1GMDF 2FI4E 2EA3A 4Y0YE 4BTTB 2BD2A 3HKIB 3U98H 2PSXA 1TA6A 5G4BA 1C2DA 1YPGH 3SNBA 1QR3E 3PMHB 3LGTA 2KCPA 3ATMA 3ZZDA 4NIYA 1XUHA 5GCHG 1TGNA 1BTXA 2A7CA 1LPGB 1GBLA 3P8NA 2A31A 2P95A 4Y71A 1GDUA 2ZWLH 4WMEA 3QK1A 4XSKU 3LIWA 5A0BA 3RDZA 4IS5A 8LPRA 2HWLB 1J8AA 2ZFQH 5EQQA 1C5QA 3VB7A 2NU0E 3DUXH 3PTNA 2GP9B 7ESTE 1NFWA 1CA8B 2DE9A 2PW8H 3D49H 5E8EH 2OC8A 5IYTA 1GHWH 1K2I1 2AMDA 5EIYA 6CHAB 2Z9IA 4MTBA 9LPRA 3GY6A 2WPLS 2CF8H 3RU4D 4MPUA 1C1MA 1Z1JA 1ESAA 1OWKA 3M5OA 3HK6B 6ESTA 4BTUB 4I7YH 5DP9A 4UDWH 2JH5D 1VR1H 1XUGA 2PKSB 3ZVGA 2Q6FA 1H9HE 5ESTE 8GCHG 1W7GH 1GJ7B 1S6LA 4E7NA 1MKWH 3HATH 3F9EA 2A4OA 1GVZA 1G30B 3FP8E 4SGBE 5L2YH 2Z9LA 4CREA 1AE8H 2ZPQA 1FIZA 2Z9GA 4Y8XA 1A0HB 3DHKH 1F5LA 1TNIA 1BBRK 4DW2U 1S83A 2ZGJA 1EZUC 2EC9H 2ZU2A 1UCYK 4GLYA 5PTPA 2Z9KA 3LC3A 3VPKA 4XD7D 3OY6U 5T6FA 1G3BA 1D3DB 3TNTA 2L74A 4U01A 1O2WA 1AU8A 1EZXC 4XRNA 1ESTA 1WXRA 3N7OA 2BDBA 3K6YA 3VEQB 1LQDB 1PQ7A 3SJOA 1YWUA 5GJ4B 2AERH 4GHQA 1IHSH 4B76A 1LTOA 1SGEE 1QA0A 1AFQB 3FP7E 1C2LA 3V7TA 1HLTH 1FJSA 3MNSA 4NSVA 2J98A 4DY7B 1ZPZA 2K1QA 2GZ8A 4ISHH 1V6DA 2YNAA 5AVDA 4MPVA 1CHOF 1KTTB 4Z6AH 2O8TA 7GCHG 1O3OA 3S9CA 2R0LA 3BEUA 1TE0A 2J38A 3GY2A 1ELBA 4KKDA 1GBHA 3M5LA 4K1TA 1UTPA 1TQ0B 2J9NA 5J4SA 2ZKSA 4JZFH 1F92A 3RC5A 3Q3YA 3BTWE 4GCHF 4GSOA 1BRCE 1C5YB 1P09A 1O2HA 2BXTH 1LCYA 4XOJA 5JBAS 2GJGA 2XRCA 2RDEA 1FDPA 4K3JA 2BLWA 4A1TA 1NU9A 1K22H 4ABFA 4INLA 2Z3CA 3MFJA 3AAUA 2XW9A 4Y0ZE 3RP2A 1TLDA 3BTHE 3U69H 1AO5A 1TOMH 2ZP0H 4NIWA 2OQUA 1YCPK 2W6JD 2F3CE 2ZDVH 1ZRBA 1C5XB 1O34A 2ZQ2A 1TRYA 3V3MA 3AW0A 4ABGA 1CA0C 2QXGA 5DP6A 3MQKC 3KCGH 5ABWA 1C2JA 1BTZA 3TU7H 2ZU3A 1MBQA 1IQMA 2FTLE 1GJAB 2ZFTA 2H2ZA 1SQRA 3H7OA 4JYTA 1C4V2 1AKSB 5AF9H 3GCNA 4FVBA 1O37A 4RT0A 1QTFA 5FX6A 2QIQA 1UCYE 3ATWA 1P9UA 2QF0A 2VGCB 1E35B 1UTNA 2J94A 3CNRA 5HMAA 3GY5A 3WWFA 1AE5A 1PPEE 1GHZA 2Z3DA 1NRPH 3AASA 2STAE 3PV4A 1TX7A 5KECA 1UJ1A 2P8OB 4Q4LA 5LPFA 2SGAA 1C5VA 3PTBA 3A7TA 5EQSA 2VNTA 3ZZ4A 1RTFB 1C1SA 1D3QB 1GI9B 3DSGA 4NZQA 3Q76A 1QY6A 3H7TA 1ANCA 4INHA 2GMTB 2PFEA 4DGJA 1TALA 4TWWA 2P3FH 5CHBA 1TBQH 1KXAA 4XBCA 3R0FA 3LT3A 1PPCE 3JZ1B 6GCHF 1ETRH 2ZU5A 5DO4H 1HGTH 1Z6JH 1PPGE 2EI6A 1F0UA 4ZKNU 2FS8A 3NUMA 1SG8B 2AYWA 4HG6A 4IN1A 2PWXA 1O2VA 2Q6GA 5EG4A 3BTFE 4YO9A 1EP6A 3RXDA 1RIWB 2VVUA 2GDEH 3P95A 5A2MH 3UAIC 1ELCA 1TPAE 3LGUA 2J4IA 3RXAA 2ZPRA 2R0KA 2CGAA 2ZDNA 1HCGA 2H9HA 2VIWA 2ODYB 1VZQH 3VB6A 1A2CH 2XTTB 1PPFE 2FMJA 4Y7BA 1NPMA 1SLXB 4UFFH 3PLPA 3FOAA 4MNXA 5HIZA 3FFGA 2ZGXH 3C1KA 5JPMH 3UNQA 1ETSH 1DITH 3EA9A 1DFPA 2V7QD 3A87A 1O0DH 1SB1H 5C94A 4GVUA 2PTCE 1SGFG 2KAIB 1UMAH 5E2OA 1TONA 5GDSH 3U8OH 1SQTA 1KIGH 2ULLA 4WY3A 5EGMA 3KIDU 3TPIZ 5C5NA 3A8CA 1GG6C 1RTKA 1AWFH 3TGJE 1VGCB 3ZVEA 1K1MA 1QRXA 2VIPA 1ZJDA 1YP9A 3OY5U 2A5IA 3ESTA 1MTNB 2FOGA 4FUDA 1GI3A 1P01A 3RM0H 1HRTH 1SSXA 1WQSA 3I78A 4AGKA 3SU2A 3MNCA 4I8LA 2PUQH 4FXGH 1VJAU 1F0SA 5AFYH 4KTUA 1E36B 5EJ1A 4YT7H 4ZKRU 1G37A 4CRBA 5A0CA 3O8BA 1O32A 2BX3A 3RXLA 1P10A 1N8OC 1O3EA 3ZVBA 3A86A 3NZIA 3SQHE 4WXVA 4AYVB 1LVOA 4ZHAA 1AWHB 3LPRA 1C1PA 2VWNA 1O2NA 4X2XA 4F4OC 1ZTLA 2VWOA 3UR9A 2GX4A 4P00A 1HIAB 1GBKA 1HIAA 1IOEA 4WJG2 4Y8YA 1YPEH 1DUAA 2OQ5A 1UTKA 3BIVH 4VGCB 1OP8A 3ENSB 5DN6D 4WH8A 4Q7ZA 1UTMA 1Q3XA 3S9BA 3TGKE 2VWLA 1TNGA 3EGKH 2H6MA 3A8AA 5EPYA 3BTEE 3NXPA 3ZZBA 2OUAA 4B1TA 4M9FA 1EP5A 4I31A 2ZA5A 3A8BA 4X8UH 3RXRA 1MZDA 3KHVA 4D7FA 1GBJA 4TY7A 3SU1A 4NG9H 4X6PA 1BQYA 2CN0H 2ANMH 3M7TA 1O30A 3EDXB 1O2KA 1Z6EA 3LGIA 4MPWA 3O8RA 1ESBA 1O36A 1IQKA 5FAHA 2A7JA 4UFEH 1P04A 3BTDE 3GS9A 1YYY1 2Z3EA 5F6MA 3NPSA 5SGAE 3RXHA 3SO3A 1DANH 1UCYH 2R3UA 4IW4E 2OCVB 3UOUA 3SQEE 1GVKB 4CRCA 4ZROA 3SNDA 3TJOA 5EW2H 4OS7A 2HRVA 3F9HA 3RMNH 4K5ZA 1THPB 3PLBA 4LOYH 3P8FA 1NRNH 3GDUA 1TGBA 4RKOB 3DFLA 1IQFA 5KEDA 1Q2WA 5ESBA 1GMCG 3QX5H 1O2UA 1DS2E 4NGAH 5C5OA 2FOEA 1KXFA 1SC8U 2I6QA 4O97A 4MVNA 4B6EA 1FIWA 1EZQA 1OS8A 4X1QU 2RG3A 3SU0A 1O2ZA 4K1SA 1M9UA 3L3TA 2LPRA 2ANYA 2QYIA 3KYGA 1HB0B 3MTYA 1FN6A 1V2NT 2PUXB 1JOUB 1T8MA 2ESTE 4U30A 2BD4A 4AFSA 2QV1A 3BTQE 2FPZA 1HAXB 2FP7B 2PKAB 4NIVA 1C1VH 1O5DH 1P2QA 4TT3D 4X1SU 7KMEH 2DE8A 5LPRA 1YLDA 2BLOA 2XNIA 3W94A 1QBNA 1G2MA 2BOHB 1D6RA 1O2TA 1HJAC 3QUMP 4Q2KA 1B0EA 1ZSLA 2ILNA 1C2KA 3PROA 3HK3B 1GJBB 1MZAA 2R2MB 1MTWA 3L6PA 3SNEA 1YBWA 1YLNA 2WYGA 2FOMB 1C5MD 4JZIA 1U6QA 2ZCHP 1V2LT 1C1WH 2HPQH 3A89A 4E05H 1ZZZA 2VIDA 1HFDA 2G52A 1NROH 1YCPH 5FBIA 4Z0KA 5L30H 3GYMA 5GIBA 2D26C 1MAXA 1O2YA 1EJNA 1QJ1B 2RA0A 1TFXA 2HOBA 4NFEA 3TIUA 2XCNA 2GT8A 3SU6A 1C2EA 1EB1H 2Q6DA 4FUCA 2FYRA 1C2GA 1C1RA 1SHHB 1GL1A 1O3IA 1P3CA 1Z8RA 2F9VA 3GCTG 1W10U 2A4GA 3NWUA 4D8NA 1O2SA 1ZLRA 3UPEA 3N99A 3SZEA 3MHWU 2ZU1A 1A61H 2GVFA 2UWLA 4FU8A 2YMSB 1J17T 3B8JA 3ZZAA 1AZ8A 1AVWA 2FOHA 1NC6A 2HNTC 3OE7D 1WTHD 1FLEE 4O9VA 1CGJE 1DICA 1ELEE 3GISB 2KR7A 2VVCA 3SYJA 2CHAC 4Y79A 2UUKB 1DWEH 4NWKA 1DE7H 4LZ1H 1TGSZ 2SNVA 5ETXA 4J2YB 4H6TA 1EAIA 2FZZA 2XYAA 3STJA 1K21H 3E8LA 3MH5A 4WMDA 2GTBA 2JH6D 2UUJB 1NN6A 1TX6A 2P94A 1OYTH 3N7EA 1W13U 2PV9B 4X2YA 1TRNA 5FXLA 2GV7A 1XUKA 1DDJA 2AIPA 2SGQE 1THRH 4ABDA 1DWBH 1K1OA 1GJ5H 4D9RA 5HGGA 4AOQA 3F3BA 4H6SB 3OSYA 4A92A 2QN5T 3PO1C 2XXLA 4R0IA 2JKHA 4XFQA 1V2ST 3KN2A 1P11E 3SNCA 1YPMH 2F9PA 2FLBH 5DP4A 3P8GA 1GJCB 1FZZA 3QGJA 2GZ9A 1XUFA 1C1QA 1V2QT 2QF4A 1FXYA 3RU4T 1NRSH 1HAYB 2Y81A 4JZEH 2SGPE 2W7SA 1OWJA 1HPGA 1W14U 2Z6BD 1S6HA 1D6WA 1C5LH 2BZAA 2V0BA 2Z7FE 3GY4A 2D8WA 3U9AH 1O3FA 1DM4B 4CRAA 1GCDA 1K9OE 1G3CA 1EPTB 3KEEA 5FPSA 1EPTA 2P93A 4B74A 1OWEA 2PR3A
chains in the Genus database with same CATH topology
3L33A 2BD7A 1OXGA 1UO6A 4BAOB 5C3NA 1A5HA 2VH6A 3M3SA 4ZXXH 4FUFA 1HXEH 3A7VA 1FY1A 4TYDA 4HI3A 4A1VA 1PQ5A 1P2IA 2VINA 1TMTH 4KTSA 1WTGH 3RXBA 4DT7B 1GJDB 3E1XB 1Y3WA 1ZTKA 2RDLA 5F8XA 1ZGIA 3RXTA 4DJZB 3MMGA 1SLVB 3PM3A 2P3TB 2PTNA 3UNSA 1UVPA 2FI5E 2ZFSA 3K65B 4NCYA 3HKJB 2C90B 2BD9A 1LKBA 2BZ6H 3KQEA 3P17H 4Y8ZA 2BY7X 1BHXB 3OX7U 4TPYA 1BTUA 1D3TB 1AGJA 1FMGA 1VCWA 5C1XA 1O2LA 4K1EA 2H1UA 3VGCC 1WBGB 1L1NA 2OP9A 2GCHG 1CT4E 1Z8IB 1Z1IA 1BMLA 4YLUA 2W7UA 3VB4A 1AB9B 1MAYA 1UVOA 1ZGVA 5A09A 2ZGCA 3RM2H 3GCHC 3LONA 1AUJA 4Y10E 2ZIQH 3A7YA 3RXOA 2Y82A 1S0RA 3MO3A 1AQ7A 1UK4A 1HBTH 2B7DH 4X2WA 1GI5A 1YCPM 2BLQA 2QY0B 1EKBB 1EASA 1NTPA 3CP7A 3KQBA 1P8VC 1ZSKA 2V3HH 3PB1E 3RXKA 5JDUB 3IG6B 3FZDA 5EXNA 3NK8A 1V2UT 1C1NA 1CBWB 1UVTH 1TQ7B 1RJXB 2ZU4A 4K8BA 2VWMA 2CF9H 2IJOB 1DT2A 3Q77A 1O3JA 3RU4E 1LKAA 2BTCE 2BXUH 3SV9A 1XUJA 4HTCH 1PPBH 5DP8A 4K60A 1DLEA 4BXSA 2ZHEH 4YOIA 2I6SA 3RXPA 5GWZA 1GBFA 2NU3E 1GI7B 2FOCA 2G4TA 1PQ8A 3KNXA 5H4IB 2O8UA 3SGQE 1P2OA 1HAVB 1HAVA 1YKTA 4NIXA 1F2SE 3GICB 1N1LA 1WQVH 3TJUA 1X7AC 1IQIA 1P2MA 5FPTA 4OS1A 1UHBB 1EB2A 1DVAH 1OWDA 1C2IA 4HFPB 1W12U 2HNTE 2JETC 3URCA 3M5MA 1GCTC 1GPZA 1MKXH 3OYPA 1SOTA 1O2QA 2OD3B 4CBOA 3O8CA 1GDNA 2Y7ZA 3LU9B 2SFAA 4BTIB 5JBBS 5I46H 1C9TA 1SFQB 3B9FH 3T62A 3AVZA 1H8IH 3QO6A 4KELA 4X1NU 2VVVA 3T29A 1ZSJA 4CHAC 1TPPA 2FIRH 1CGIE 3CS7A 1O3CA 2F9UA 3RXEA 2A32A 4I8HA 2ZDKA 2CV3A 1NRRH 1Y3VA 1BTHH 2TGTA 7LPRA 1INCA 3S0NA 1F5RA 4FVDA 1AKSA 3ZVAA 3EE0B 4BAKB 4OGXA 1FAXA 3M7QA 1WAYB 4OS2A 1BBRE 4CBNA 7GCHF 1A3BH 2PHBA 2V35A 3E6PH 4OS6A 3SUFA 2QXHA 1ANEA 3OU0A 1QHRB 3PWCA 2B8OH 3BEIB 5DP5A 3I77A 4XE4A 1MD8A 3M3VA 1GL0E 2IPHA 2SGEE 1MTUA 1TPOA 3PO1B 4Y76A 2BX4A 5E0JA 2FESH 1ACBE 4AB8A 1P03A 1JRSA 2G81E 3BG8A 4FUEA 4IC5A 1AD8H 4HGCA 4I8JA 1A5GH 2TGPZ 5FX5A 5DP3A 2SNWA 2ODPA 3BEFB 5F03A 1KY9A 4IMZA 3WY8A 4AN7A 4ISOA 1DY8A 2WINI 4DG4A 3UNRA 1CE5A 1Y5BT 1YPHC 3MOCA 1K1LA 1GHVH 3K2UA 4BAQB 5DP7A 1D4PB 1O3PB 1XMNB 2HPPH 2TBSA 3NCLA 4LZ4B 4JYVH 1TNJA 4H4FA 4BOHA 1VITH 1FY8E 4ABEA 4WWYA 1JRTA 1GHXH 3ZVFA 1XKBC 2QCYA 3VB5A 3IWMA 5E0HA 4JCNA 3ZV8A 4D76A 4AZ2B 1S84A 2R9PA 2FX4A 3BG4C 1W8BH 1PYTC 2Y5GA 3ATLA 2FS9A 3T27A 3TITA 5J4QA 1ID5H 2ZG0H 4CR9A 2Y5HA 2IN2A 3D62A 1GHYH 3SGBE 4ASHA 1C5SA 3UQVA 1RTLA 3PLKA 1TWXB 1GHAG 3V12A 1KXBA 4B2CA 2KAIA 1ZHRA 5HXFA 1SGYE 3KL6A 4UD9H 3UR6A 4Q7YA 2Y5FA 1FI8A 1AI8H 3A8DA 4GAWA 4A6LA 2BVXH 1O3GA 1CGHA 3ELAH 1G36A 1GJ6A 1BRBE 2FI3E 3Q3XA 5C1UA 4B2BA 3DD2H 4KP0A 4BAHB 3LH3A 1EOJA 2F9NA 3PWBA 1QRZA 4XDEA 4H42U 1SGQE 2ZO3H 4ABBA 1IQLA 1KDQB 1C5UA 1KDQA 1SBWA 4XBBA 4DURA 5C20A 2G00A 4OGYA 2THFB 2OXSA 1GBDA 3HGNA 3K6ZA 4NFFA 5CHAC 2IOTA 5A8XA 1SFIA 3MNBA 1LHDH 5EQRA 1A0LA 2C3SA 3AAVA 1Z8JB 3A84A 3UOPA 3ODDA 2XBVA 3ZZ7A 3MU5A 2YOLA 1V2JT 5FHTA 1VITG 4INKA 2OBQA 2XCFA 2M5TA 2AGGX 4DVAU 1MBMA 4ABIA 1GBAA 1F0RA 1UTOA 1AFEH 4X6NA 3ITIA 1YF4A 1W0YH 3SI4H 1FY5A 4OS4A 3ZZ3A 4YESB 1P2NA 5JYIA 3RXCA 1K1PA 4E06H 1BA8B 3LJJA 1DX5M 2GCTC 2BY9X 2OC0A 3KF2A 1C5NH 3T2NA 1YLCA 1GGDC 4DOQA 1ELGA 2VB0A 1AY6H 4Q7XA 1S85A 2EEKA 2ZFRH 2QC2A 4FUBA 3EA7A 4AFUA 1O2GH 2WUBA 2ZDMA 4CH8B 1G3EA 4WMFA 3U1JB 1TRMA 1AIXH 3VXEH 2A7HA 3D23A 1P9SA 5AFZH 3RXIA 2CMYA 2OLGA 1V3XA 3E0NB 3U1IB 3P70B 4CRGA 3S69A 5EPNA 1EZSC 1IQNA 2OC7A 4DIHH 1T4UH 1GI0A 5LPEA 2C93B 3HPTB 1GBMA 4FUGA 3RXGA 3MWIU 1CA0B 4ZHLU 1A46H 3KQDA 3Q3KA 1N6YA 1HAGE 4JK6A 3QN7A 5FCRA 1UVUH 1C9PA 5EXMA 3DFJA 1KYNA 1TX8A 3RXFA 2BQ6B 1AN1E 1QQ4A 3T25A 4FUIA 4THNH 1O2XA 1BDAA 3TK6A 3E0PB 5C1YA 1P06A 2BMGB 3MU1A 4X0WU 3E91A 2ZTXA 1BBRH 1PYTD 1LO6A 2P3UB 1HAIH 2V3OH 1GHBF 4FU9A 1C2FA 1K1NA 1Y3YA 2A4QA 1C5OH 2HGTH 1QRWA 1MCVA 5JBTA 3M3TA 1O2IA 3GCOA 3RMMH 1DUEA 1G2LA 1NFUA 1OOKB 1MQ5A 3P8OA 1SGDE 3FP6E 3LGYA 3TH4H 1YPHE 1ANDA 2WV5A 1ZMLA 4LXBH 1CT2E 1EATA 1YGCH 1GDQA 1GMHF 2O8LA 3MO6A 2FDAA 2STBE 5TJXA 4AG2A 2Z94A 3V0XA 6CHAC 1ZOMA 1RGQA 1UK2A 2F83A 1OWHA 3A80A 1SI5H 3LDXH 1BCUH 2PKAA 3SHAH 1V2WT 2ALVA 3F6UH 3UTUH 4E7RG 5I25A 1ZJKA 4BNRA 1B5GH 3UQOA 1ELVA 3TNSA 1O3BA 2WUCA 5L2ZH 4TY6A 4D7GA 2QGRA 4F49A 2FODA 3PMAB 1QQUA 2BYAX 1GVLA 4B75A 3PYHA 1EOLA 4I33A 4RKJB 1QBOA 1P12E 2W5EA 3MH6A 2AGIX 1EQ9A 5HM9A 1QCPA 1LHFH 1GMCF 1MTVA 2ZF0H 5F8ZA 2OINA 3ZZ8A 1TABE 2OC1A 4IC6A 1O33A 1DXWA 4ESTE 1IQEA 1AFQC 3F9GA 4WVPE 1E38B 2ZEBA 2QXJA 4IN2A 2AGEX 4ISLA 3T5FH 4U32A 3SZNA 1JIRA 1UK3A 1KXEA 1P3EA 2P16A 1GG6B 3M37A 1QL9A 2ZTZA 2C8ZB 3ATIA 3CENA 3QTVH 1RD3B 4IBLH 1MTSA 3F68H 4OS5A 5L6NH 1C5ZB 1A1RA 1N6XA 4X8TH 3BF6H 3BN9A 3D65E 2ZQ1A 1D3PB 1O5EH 3SV8A 3MYWA 3DT0H 1SGIB 5C2ZA 1JXPA 1BOQA 1EX3A 4MNWA 4NA7A 3HGPA 1ABIH 1TA2A 2ZDLA 5FCKA 1BJVA 1ZMJA 1GMDG 1RFNA 1EAUA 1N8OB 1CQQA 1YPJH 4JYUH 1TMBH 1RS0A 4ZUHA 2ALPA 3ZVCA 4CRFA 1O3AA 2FX6A 5K0HA 2G4UA 8ESTE 2XC5A 1T8NA 2XWAA 1TNLA 3LH1A 4YM9A 3SHCH 3K9XB 1CT0E 1QL8A 3E3TA 1TB6H 3SORA 2QXIA 1GGDB 4WXIA 1YPLH 2FEQH 4JZ1A 1SGNE 3E90B 3QDZB 1VCPA 5GPIB 3SI3H 3TVJB 1C5WB 3UWJH 4NA9H 1NY22 1L4ZA 3VFEA 1DWDH 3ZZ6A 2CXVA 3W95A 2A0QB 2VGCC 3ZV9A 1TYNA 1L2EA 1SGFA 2ZI2H 1GJ4H 1NFXA 2WPJS 1GBIA 1XXFA 3EA8A 1C4U2 4I8KA 2P8OC 1QBVH 2ZCLP 1UTLM 2DUCA 2XC4A 4BANB 1OP2A 1C5PA 1EAWA 1EJAA 4QT8C 2B9LA 1FN8A 1Z7KA 1L0ZA 3IITA 3A7WA 2VIQA 1FPHH 4CR5A 5A0AE 1H9LB 4TWYA 2GMTC 4M7GA 1LPZB 5T3HA 3UWIA 2TIOA 1VJ9U 1OWIA 2ZC9H 1MD7A 1DXPA 1S6FA 1W11U 4D9QA 5HYOA 3A85A 1LMWB 3M36A 2C8WB 4MNYA 1T4VH 1AZZA 1AVXA 1S0QA 3RC4A 1OX1A 2G51A 4B71A 2BY5X 2BQWB 2F9OA 1O3HA 4FUHA 5DKMA 1F0TA 5TCAA 1BITA 3SUDA 1O2RA 1LHCH 2B0FA 2VH0A 1G3DA 1O3MA 2ZHFH 4O03A 3EAJA 3UUZA 3M35A 1H8DH 1JWTA 2BY8X 2WPKS 3B23B 1RIWC 3SW2B 4KTCA 3F9FA 2BM2A 4NWLA 1IQGA 3P6ZB 3PMJA 4X6MA 2AS9A 3A88A 4GPGA 2BDYA 2CJIA 1WV7H 4PROA 2BVRH 4CRDA 1MU8B 1PQAA 1GJ8B 3ATKA 1AMHA 1CHOG 1K28D 4Y7AA 1HJ9A 5GCHF 1HNEE 3A7ZA 2O8WA 1JIMA 1W2KH 1HAZB 2ZCKP 2NU4E 1H1BA 3GDSA 1W3CA 5EW1H 1HJAB 4YTAA 2RA3A 1LHGH 1FPCH 1NRQH 3MH4A 2NU1E 4GCHG 4AORA 1LVBA 3RC6A 2BD3A 1V2PT 2G8TA 3O8DA 1C5TA 2O9QA 4YOJA 4NA8A 4Q80A 5DG6A 1O31A 1ZRKA 4K2YA 1VGCC 3SGAE 3LC5A 3FAOA 2FLRH 4A1XA 3GYLB 3FZZA 1MTNC 2BD8A 2FOAA 4FUJA 3RMLH 4X8VH 1A0JA 2QA9E 1NO9H 4NZLA 1B7XB 2YNBA 2J92A 1GWAA 1TNKA 2HVXA 1ORFA 2XBWA 8GCHF 1BTPA 1O5FH 3SJ9A 2GCHF 2QAAA 3Q00A 1ELFA 1YPKH 3TJNA 2ZHWH 4GHTA 1UHBA 1XUIA 1Y3XA 1O3LA 2ZHDA 1QJ7B 1P2KA 1ZPCA 2AIQA 1Y59T 5DJ7A 1CO7E 3QGNB 3RXVA 1GI8B 3A82A 3VB3A 1GBBA 2Q1JA 1BTYA 1HAHH 4AYYB 3ZYDA 1H4WA 4TPIZ 4YT6H 2AFQB 1DOJA 1SHYA 1F7ZA 1ABJH 1BJUA 3JZ2B 1Q31A 4ZKOU 3OTJE 2P59A 2GDDA 1TPSA 2CHAB 1O5AB 3G01A 2EI8A 3A81A 1T32A 2FM2A 1ZTJA 1KXCA 2R3YA 1Y5UT 1HV7A 1SGTA 4VGCC 3SJKA 3KQCA 2G5NA 2WPIS 1RRKA 3MNXA 4AB9A 2XWBI 4IMQA 3CS0A 1B0FA 1P57B 1BTWA 2ZFFH 6GCHG 1C2MA 3S9AA 4ISIH 1T7CA 3LOXA 1EUFA 1IQJA 3A83A 8KME2 1S5SA 1XXDA 3RUOA 3STIA 3RXMA 1TIOA 1E37B 5A8ZA 3U8RH 2XBYA 1QNJA 1DLKB 4UE7H 1FNIA 2ZTYA 3TH3H 3M5NA 1LHEH 2A4RA 1BMAA 5LGOA 3SV7A 1T8LA 2BDCA 2W26A 1SGRE 2XBXA 1C4Y2 2NU2E 1IAUA 5EOKA 1HAPH 1MMJN 5FBEA 1O2PA 2ODQA 2AMQA 1UTJA 4RSPA 2A5AA 3TK9A 3ZZCA 1O2OA 4ZHMU 2UUFB 1DPOA 1GI2A 3T28A 1HUTH 1C2HA 3MU4A 4LK4A 3RXQA 1GBCA 2FWWA 2GT7A 1KSNA 3TJVA 2Y6TA 3LJOA 3M61U 2ANWA 2ZGHA 4MG3A 3MU8A 1SQOA 1O5CB 1W7XH 3UIRA 2WV4A 4A5TS 4CH2B 1J14A 3UY9A 5BRRE 5DGJA 2D2DA 3TLOA 1TGCA 2GKVE 3LGVA 2ZECA 4GUXA 1OP0A 2QF3A 1O35A 5EU8A 1D9IA 3SUEA 4YLQH 4ABAA 1LVYA 4O3TA 3RLYH 1SMFE 1O38A 4HZHA 1P05A 1KLJH 1O3NA 3DA9B 3VGCB 6LPRA 2ASUB 4Y6DA 3RXSA 1TAWA 4X6OA 4ABJA 3SNAA 1C1OA 1FQ3A 2A2QH 1S82A 1QGFA 1WOFA 3TK5A 4KGAA 3GCHB 2FYQA 5TCCA 1P2JA 3H5CB 1LVMA 5CMXH 1BIOA 4SGAE 1Y8TA 2GZ7A 2VU8E 3QZRA 3RXJA 3UREA 4AGJA 5JB8S 3SU5A 4I8GA 1O2JA 1DSUA 1YM0A 3QWCH 1NT1A 1YC0A 3S7HB 1GI1A 1V2VT 2Y7XA 1Z8GA 1ANBA 5EXLA 4K69A 3RXUA 3C27B 3GY7A 1TOCB 2J34A 1MQ6A 1CSOE 1GJ9B 1S81A 2WPHS 1XX9A 1L1GA 2FTMA 4O3UA 2BVSH 1HJ8A 3VXFH 3LKWA 1ELDE 3R3GB 4BXWA 1P02A 1GBTA 2A1DB 2GD4B 2GGVB 3A7XA 1A3EH 1GHAF 1A7SA 4BAMB 1QB1A 4WF8A 5GXPA 1Z71A