1EKBB

The serine protease domain of enteropeptidase bound to inhibitor val-asp-asp-asp-asp-lys-chloromethane
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
235
structure length
235
Chain Sequence
b'IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROPEPTIDASE
molecule tags Hydrolase/hydrolase inhibitor
source organism Bos taurus
publication title Crystal structure of enteropeptidase light chain complexed with an analog of the trypsinogen activation peptide.
pubmed doi rcsb
total genus 48
structure length 235
sequence length 235
ec nomenclature ec 3.4.21.9: Enteropeptidase.
pdb deposition date 1999-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ekbB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ekbB01
3MH6A 1RIWC 1UHBB 1SR5C 3OYPA 1SMFE 1P3EA 3SUEA 2VU8E 5AFZH 4JYTA 3SGBE 1ZLRA 4Y79A 3RXCA 1GDQA 4MVNA 2FYRA 2PKSB 4WJG2 4LZ1H 4FUHA 5LPRA 5DP8A 4UEHH 4MQAA 4FXGH 1G3BA 4JK5A 2FX6A 1ZHPA 1C5LH 2A4OA 4R0IA 5EQQA 1SGTA 2THFB 3CENA 1S81A 4YO9A 1CHOG 1IQFA 1XVOA 1O2SA 3SU0A 2R0LA 1T31A 1Z7KA 1GJ9B 1GJDB 1FY4A 3SJOA 1HIAB 1V2RT 3LJJA 1BTPA 4IS5A 1UTKA 3GDVA 3A8AA 1ZTJA 1GBLA 1Y3VA 4KTSA 3Q3XA 5FCKA 3KIDU 2JKHA 2G81E 1FI8A 2TGDA 4ZH8A 2XBYA 4AGKA 1S6HA 1TPPA 3MNSA 1K28D 3GISB 1B5GH 1BMMH 1V2TT 3AAUA 3UOPA 1GG6B 3SUFA 1ZMLA 1EQ9A 4OS2A 5B6OA 1EP6A 2ZDVH 3ZZDA 1YPEH 3A7VA 3SGAE 3QWCH 3ODDA 1J16A 3M61U 4MPXA 4ZHAA 4I32A 1BJVA 1BMLA 1FY3A 1C1UH 1P2JA 1E38B 1AKSB 1HXEH 1C1NA 3RXQA 3P70B 2GGVB 2BOKA 3O8RA 5C2ZA 3HKJB 4NFEA 2QC2A 1NM6A 4BANB 6CHAB 1PQAA 5C5NA 5E0HA 1TGCA 2QA9E 3MHWU 1HJAB 4Y6DA 4CHAB 2HNTF 3RXIA 1BRAA 3R0FA 2GVFA 4DIHH 4B76A 1EOLA 2O8UA 3TPIZ 3A87A 3SBKA 4NGAH 3F9FA 1DITH 4BAMB 2H9EH 3LKWA 4YOGA 1SLWB 3DA9B 3RU4D 1ELAA 1WTGH 3IWMA 1O2GH 3RXDA 4ISHH 3LGIA 2I6QA 3RXAA 1RTFB 1QBNA 2PKAB 1FJSA 3CP7A 3RC4A 1XUFA 1LHEH 1Y5AT 2PKSC 1PQ5A 4Z6AH 3S7KB 3BIVH 1QY6A 4J2YB 2AFQB 1CE5A 1GBEA 1C1VH 2FLBH 1Z8IB 4IGDA 1Q31A 5JBAS 5LH8A 1BCUH 2J95A 1DSTA 4DURA 1AO5A 1CHGA 1GBBA 3NK8A 3RXHA 1SHHB 1E0FD 5EPYA 4JZFH 1H9HE 2RA3A 1HPGA 2ZZUH 1GBJA 4LK4A 1GJAB 4ZKNU 5L6NH 3RMLH 2Y82A 1O2WA 2P3UB 4ZXXH 2C93B 2QGRA 4ASHA 1UTMA 2NU3E 3RC5A 2DE9A 4KELA 2V3OH 5AHGH 3BTKE 2ILNA 4RN6A 2LNCA 1TGNA 2GCTB 2ANWA 3KGPA 1BA8B 2O8WA 2XXLA 1GJ6A 5I46H 2QY0B 2XRCA 4DOQA 3O8BA 1GMDF 1BTYA 2ZDKA 4IMZA 5C20A 1PPFE 2HPPH 3LH3A 1PPBH 6GCHF 3L6PA 1TMBH 1XXDA 1NRQH 3NKKA 3P8NA 1TB6H 2H2ZA 2QN5T 1DOJA 1ELCA 1HIAA 1HCGA 3SV9A 3PB1E 3SO3A 1C5YB 1TGBA 4VGCC 3PMHB 2J92A 4SGBE 4DG4A 5C1YA 1V2OT 2AIPA 1EJMA 1FMGA 1ZPZA 1DLKB 1GVLA 1Q3XA 2AEIH 1SI5H 1ZRBA 1TFXA 5J4SA 3V3MA 1G30B 1GMDG 2ZFTA 3M36A 2BLOA 2QAAA 1WOFA 1ZRKA 2SGQE 3GY5A 4X2WA 4X0WU 1THSH 1YPHE 1HAZB 4FUIA 1JXPA 5DP6A 5FCRA 1SL3A 3BTGE 4JZDH 1UTNA 1TNIA 8GCHF 2FOGA 1PJPA 3HPTB 2WPLS 3P8GA 4AFUA 1GI0A 1UHBA 1PPCE 1GMCG 1GMHF 3E0PB 1CGHA 2FOMB 1FY1A 1JIMA 1HAPH 4NG9H 3DFLA 2VIOA 2WUCA 3PTBA 1BOQA 2FOHA 1MU6B 1O3CA 4AG2A 1Z8RA 2ZCHP 1BRBE 2ZIQH 1PYTD 1AVWA 2UUFB 3FVFB 1AB9C 1P2MA 4XFQA 1Y3UA 1A5IA 2FOEA 2G55A 5HM2A 1A5HA 2XBVA 1ETSH 1TALA 3KQCA 2OC7A 5FBIA 4CH8B 5T6DA 3GYLB 3D65E 4WMFA 2BY5X 5GPIB 3GCTF 1V2LT 1XXFA 7KMEH 1RD3B 1O2PA 3MTYA 4K69A 1MMJN 1EKBB 1O2QA 2BVRH 2F9BH 4K3JA 2Q6FA 1O3FA 1MCVA 2ZPQA 2R2MB 3ZVFA 3E0NB 1K1NA 3GY3A 2H9HA 4FUBA 2ZDAH 5LPEA 2F9OA 3MO3A 2ZTYA 1VJAU 4HGCA 2VVVA 2BTCE 3ZVCA 1HNEE 2F9UA 3QZRA 1TE0A 4DCDA 5FPYA 4MDSA 1NY22 4A5TS 1VITF 4H6TA 1TMUH 1MU8B 3A8CA 3VB5A 3RXVA 5BRRE 5GJ4B 1K22H 4AN7A 1ZYOA 3UR6A 1BIOA 5L2ZH 1C4Y2 1PFXC 1G32B 1GCTB 2ZGBH 3SV8A 2GMTC 4FUEA 1WCZA 1MZDA 2FS9A 3FP6E 2VGCC 5GCHF 4ZUHA 1YP9A 3LGUA 3RXEA 1TIOA 3SU4A 1NRPH 4K8YA 2BX4A 1DLEA 2BD4A 3NZIA 4AB9A 4FUCA 2OINA 3MNXA 6ESTA 1V2PT 3UY9A 1ELVA 1MD8A 2JH0D 3QGJA 5DP3A 3RXBA 1GJ7B 2LPRA 2RA0A 3ZVBA 3EAJA 3JZ1B 3SN8A 5G4BA 2AMQA 2VINA 1HUTH 1Y5BT 4K5ZA 4OGXA 3SJ9A 3LPRA 5GIBA 3FANA 3SV7A 2WPMS 1GI9B 5A0BA 1HLTH 1IAUA 1FNIA 2J34A 5LPFA 3QX5H 2P94A 1TABE 1TOCB 1BRCE 4E06H 1SQTA 1O5AB 1DWEH 4FU9A 1BBRE 1NN6A 3HK6B 3ATKA 3LGWA 1O2OA 2ODPA 1GG6C 4UFFH 1DS2E 2ZF0H 1ABIH 2BDIA 1VCQA 1EUFA 4GCHF 3UPEA 1MTNB 1UK4A 5I25A 4IBLH 3S9AA 2ZFFH 4WMEA 1SQAA 2O8MA 4ABBA 1AY6H 1T8MA 1AD8H 3FP8E 3M7QA 3SHCH 2QXHA 3URCA 4AFZA 1QNJA 2BYAX 1EB1H 1P09A 1ZHRA 1H1BA 1BJUA 1SGRE 3OY6U 4YT7H 1AIXH 1QBOA 4CR9A 1VGCC 2H5DA 1DWBH 1GBDA 1EAIA 1QRXA 5FXLA 2VIQA 9LPRA 3DFJA 4HZHA 1GBCA 2O9QA 3BEIB 1P2QA 4TWYA 1GDNA 3QZQA 1O2RA 3MO6A 1GHZA 1RTLA 1QB1A 3A88A 1WV7H 1W8BH 2J9NA 3A85A 5DJ7A 1NU7B 2HRVA 2A5AA 2O8TA 3T5FH 4YLUA 1D6WA 4MNVA 1SGDE 2FI4E 1N8OB 2Z94A 1OWDA 5IYTA 3RU4T 3MU1A 1UMAH 4YOIA 3TNSA 6CHAC 1H8DH 1V2KT 1BB0B 3NCLA 3TH4H 1O30A 1TA2A 2F91A 3F9GA 3RM0H 1TWXB 3UNRA 1KXBA 2STAE 1K1IA 4Y8YA 5A8ZA 4O3TA 3SI4H 2AGIX 3ZZ7A 4AYVB 4ZKSU 1KYNA 3S9BA 1HBTH 1F0TA 1ZMJA 2ZQ2A 5C1XA 4E7RG 5ESBA 1YPJH 2NU2E 5JBTA 1CT0E 1TLDA 4NZLA 1ZMNA 4NIWA 1LPGB 1SPJA 2PR3A 3FP7E 8ESTE 2OXSA 2G4UA 1Z1IA 1O3HA 2TPIZ 5DPAA 3ZYDA 3BTDE 3WY8A 2Z9JA 1SGQE 1TPAE 3SNCA 3T27A 1F0UA 1LPKB 3GOVB 2DUCA 3GY2A 4GSOA 1DE7H 3A83A 1CA0B 2A7JA 1ORFA 3RXLA 1ANEA 1GBMA 2ZU5A 4BAOB 5AFYH 3GY8A 4ZAEA 2H6MA 1PPEE 1FUJA 2GZ9A 1VITG 3AASA 1GJ5H 3RXRA 1XUIA 1Z6JH 4K1SA 2EC9H 2J94A 1UK2A 4A92A 2NU4E 1ZPBA 1FXYA 4I8JA 1VCWA 4H4FA 2ZU1A 4AFQA 1MQ5A 4MPVA 4PROA 3ITIA 2BD2A 3P92A 1ETRH 1N8OC 4DJZB 3R3GB 2W3KA 1P9SA 1RRKA 3EGKH 4NIXA 2BLVA 1QJ7B 2HVXA 4UDWH 3RXTA 1EPTA 4B73A 1W10U 1LDTT 1EAXA 3FAOA 3U69H 2C8WB 3V7TA 3GICB 1D3QB 1SGPE 3QTVH 4X2XA 3A80A 1GJ4H 1S0RA 2XWAA 2BOHB 1SGYE 2VJ1A 1MTWA 4GHTA 5GXPA 1LQEA 2ZEBA 3VXEH 2P16A 4WY3A 5FHTA 2FOFA 1NFYA 1HYLA 1MZAA 3SORA 1UCYK 1FY8E 1G3CA 2ZECA 4HTCH 1JWTA 3FZDA 1O2TA 2BD3A 4LXBH 3UREA 2VH0A 1GGDC 4MLFB 3BTEE 1HXFH 1LTOA 3M5LA 1UVTH 1QL7A 2HWLB 1YPLH 4HFPB 1FQ3A 2A45B 3KL6A 1J15A 2AS9A 1EAUA 1V2MT 1WAYB 2VB0A 1CT4E 1D3PB 1ANCA 3QN7A 2WPKS 1D9IA 1A3BH 2Z7FE 3BTHE 4K2YA 2G51A 1A0LA 1THRH 1C5WB 2ANMH 2I6SA 4U2WA 4Y0YE 4AFSA 2VWOA 1XUJA 5GCHG 4DY7B 3EE0B 1FAKH 2RG3A 1GHYH 3I78A 1ZOMA 2FODA 1QRWA 2R9PA 1GBFA 2ZHQH 4FUFA 2ZFSA 2AMDA 3HKIB 3A7ZA 4KTCA 4WH8A 5EGMA 2VWLA 5A0CA 2BMGB 2FI5E 1ZJDA 3K6YA 3SV6A 6GCHG 5AF9H 1AGJA 1QGFA 1T4UH 1TX8A 1JBUH 1OKXA 3T25A 2BLWA 2A31A 3VXFH 1PPZA 3TK5A 2C8XB 5E2PA 1ACBE 2P8OC 3K65B 1GI2A 3LDXH 1DM4B 1SLVB 1A5GH 1HAXB 1YPGH 3MH4A 1YYY1 2NWNA 1LCYA 3T26A 3S0NA 2Z9LA 1K1PA 3MMGA 4O9VA 3VFEA 2AERH 1DVAH 3H7TA 1ELFA 1RXPA 1OWKA 3M3SA 1DFPA 1LVYA 1MH0A 1QFKH 2EI7A 1NRSH 1G37A 1K1LA 1AZ8A 2Z3DA 3VB4A 1E34B 1S6FA 1GMHG 1IQEA 1C1TA 2BQWB 1TRMA 2CN0H 1CHOF 4CREA 2ZKSA 1L4DA 1YCPM 2B9LA 4FVBA 2WPIS 1A0JA 1O35A 1TRYA 4JYUH 1SGCA 1GHWH 4THNH 4NZQA 1CA0C 1P3CA 5DO4H 3BV9B 1MKXH 2PSXA 1GI6A 1HJ8A 1P2IA 4E7NA 1SB1H 1P8VC 1QJ1B 2SGPE 4Q80A 1AFQC 1Z8JB 2OTVA 2ZDLA 5FX6A 1GBKA 2FXRA 2GTBA 4AZ2B 1C5VA 4O03A 1EP5A 2BD8A 1V3XA 1OYQA 3STJA 3LOXA 1O5FH 1WTHD 3QO6A 1BQYA 1S83A 3G01A 3U1IB 1VGCB 2ZC9H 2ZU2A 2D26C 2XTTB 2G5VA 3PWBA 1JRTA 1FN8A 2VVCA 3AW1A 4B2AA 1B0EA 1FAXA 1ZR0A 2FWWA 4SGAE 4I8LA 3W94A 1SG8B 3KEEA 1TPOA 7LPRA 2VWNA 4XE4A 5JBBS 4GUXA 1O2JA 1DY8A 2CJIA 1JMOH 3Q00A 1L1JA 4CRAA 3TIUA 1O2LA 3H5CB 3PLKA 1IOEA 1GI4A 2VIVA 3KCGH 2A7HA 2G8TA 4WVPE 3S69A 1DANH 4NA7A 4I31A 2V0BA 3E6PH 1P02A 1MQ6A 1HRTH 2SGDE 4BXSA 2CHAB 1K2I1 1OP0A 1GI7B 1AMHA 1BTWA 1CO7E 1C5TA 3P6ZB 2FO9A 1NO9H 2PFEA 3GCOA 1THPB 3DD2H 1C5UA 3BF6H 1GHVH 2YNBA 3RMNH 1EX3A 3SV2H 1QB9A 1QA7A 3RMOH 2ZU4A 2BLQA 2FESH 2PGBB 3T29A 4CHAC 1NFUA 1GL1A 1D3TB 4IC6A 3M3TA 1V2NT 1W12U 4ZXYH 1TQ7B 1F5RA 3VB3A 3TNTA 5JPMH 2ZG0H 1UTJA 1LKBA 2XCNA 2Y81A 1GBAA 2GDEH 4OS7A 4FVDA 1YGCH 2A2QH 4DT7B 4UFGH 3DUXH 1QCPA 4BTUB 1SQOA 3Q3YA 4X1NU 3BSQA 3SHAH 3ZZ6A 3D49H 3ATWA 5JDUB 4OS4A 1O2ZA 2FPZA 2WV5A 1HDTH 2H1UA 1LHGH 3CS7A 1AKSA 1W0ZU 1O31A 4WXVA 1GI1A 2AH4X 3F1SB 2GZ8A 2EI8A 4CH2B 1S0QA 1F7ZA 1KLIH 1QL8A 4O3UA 1W2KH 4AX9H 3NWUA 1F0RA 1TX7A 3UNSA 3KQDA 3LONA 1VR1H 3RXSA 2ZPRA 1O2IA 4NSYA 2XW9A 3A82A 2CV3A 1SGEE 2BY7X 2ZGCA 2JETB 1L1GA 2OLGA 1TYNA 1RTKA 1W14U 1P2KA 1AWFH 1DXPA 4RSPA 2BY6X 3LC3A 3DT0H 1LMWB 2F3CE 2BDYA 4X1SU 3ZVGA 1WU1A 2PUXB 2Y7ZA 3MO9A 4BXWA 2ZWLH 1OWHA 1QHRB 3I29A 1UK3A 1N1LA 4X1QU 2UUJB 3SNEA 1O5GH 3JZ2B 4U01A 2BXTH 1W7GH 4JZEH 2ZHFH 2C4FH 1O3JA 1MCTA 3SUGA 3I77A 1MTVA 1C5QA 1C1SA 2BD5A 5FBEA 3GCTG 2JH6D 4NSVA 2ZTXA 1P10A 2Z9IA 3PM3A 1ZPCA 3P8OA 1IQHA 2BVSH 2Z9GA 3TH3H 1AFQB 1Y3WA 2O8LA 3MU8A 2FDAA 1C5PA 3KN2A 3UUZA 1SGIB 1T8OA 2GDDA 2OQUA 1C5XB 4ESTE 2WPHS 1ZZZA 1GJCB 4X6MA 3TK6A 1Y5UT 2OBQA 1OP2A 3Q3KA 1GI8B 3RXUA 3ZZ4A 4BNRA 1NZQH 2FMJA 2UWPA 1YLDA 3QGNB 3SW2B 2OC8A 1F0SA 5F6MA 5EODA 3RXFA 2XNIA 1BITA 1KTSB 2Z9KA 2H9TH 1KLJH 4YOJA 4MPWA 4NFFA 4NWKA 4A7IB 2IN2A 1Y8TA 4UONA 1H9IE 4ABJA 1C2IA 3SNDA 5FAHA 5FX5A 2BDCA 1KXDA 3P95A 1DWDH 1BT7A 2GCTC 3GY4A 1CQQA 3EQ0H 2UWOA 4MNYA 1MTSA 3KHVA 1MBMA 2ZFPH 3ESTA 1OYTH 3KNXA 2FEQH 2HNTE 2PLXA 1C4U2 5AVDA 3MYWA 2FOCA 1F5KU 1ABJH 1YPHC 2WYGA 2W7UA 1AN1E 3EDXB 1BBRH 2P93A 4I8HA 1CBWB 1W7XH 4FUJA 1ANBA 4K60A 3LU9B 1AUTC 1DXWA 3Q76A 1A46H 4Y7AA 3FFGA 1ELTA 1QURH 1VJ9U 1TNGA 3LGVA 1WUNH 1AB9B 2ZFQH 2FIRH 5JBCS 2FOAA 4NIYA 1O33A 4HI3A 1KY9A 5T6GA 1C4V2 1XX9A 4MG3A 1O3EA 4FUGA 2SNWA 3M35A 4MPUA 2XYAA 2GZ7A 1P11E 4KKDA 1SLXB 2FLRH 1G36A 1YLCA 2GX4A 2OC1A 1LKAA 4IW4E 1JOUB 1WYKA 3TGIE 2G52A 7ESTE 1MAXA 3LIWA 2HGTH 1XMNB 1K1MA 1S5SA 3RXOA 1AQ7A 4CR5A 2R3UA 5L30H 2TGTA 4U30A 1KDQA 3LH1A 2HALA 1SGNE 3ZVEA 1P2OA 3ELAH 1HV7A 1C5MD 4I8KA 3SNBA 1E37B 2ZHWH 5DP7A 3QUMP 1O3AA 1PPHE 1P03A 1IHSH 2BD9A 4NCYA 3K6ZA 1TBQH 2ZPSA 1NS3A 2JETC 3GCNA 2P59A 3S9CA 4ISOA 2BVXH 3D23A 1DX5M 2PV9B 4K1EA 4Y0ZE 1WQVH 1TA6A 3E3TA 1XM1A 1RIWB 3RP2A 3UNQA 1E36B 3T62A 3E16B 2A5KA 2YNAA 1SSXA 1C2MA 2ZU3A 2C8ZB 3HK3B 3KQBA 4WWYA 5A0AE 5A8XA 2A5IA 4FU7A 2PGQB 3U98H 3SQHE 1N6YA 3A7TA 2GCHF 1MKWH 1QQUA 1RGQA 1SOZA 1TGSZ 1V2JT 3M5OA 1GMCF 1X7AC 1ANDA 2CF9H 5HYOA 5E2OA 3AW0A 1SOTA 2IOTA 1UO6A 1TMTH 3B9FH 3UR9A 4D7GA 5HGGA 3QTOH 3RXKA 5LGOA 2TIOA 3PV4A 3TVJB 1ZGVA 2P3TB 3V12A 1XUGA 1GBIA 1QBVH 3OU0A 1FPHH 4XSKU 4TPYA 1AVXA 1O2VA 1WQSA 1FLEE 1TNKA 3A86A 1O2KA 3LJOA 2AYWA 1Y3YA 3MU5A 3F9HA 3A7YA 3PMAB 4ISNA 3MI4A 4AOQA 2BDGA 2OC0A 2D2DA 1O38A 2Q6DA 4GHQA 4X8UH 3SNAA 3UWIA 4H42U 3M7TA 4Z0KA 1DY9A 2FTMA 2RDLA 4CBOA 4Y8ZA 3VGCC 5FPTA 1NT1A 1O32A 3SJIA 4X8SH 1DWCH 2WUBA 5CMXH 2PHBA 4X6NA 5C67A 1TNHA 1ETTH 2BDHA 1TX6A 1N6XA 1OPHB 2G5NA 1V2WT 1HJ9A 1K1OA 4Q2KA 4RKOB 1O3IA 2BX3A 1P57B 2BQ7B 4IMQA 4E05H 2GKVE 4X1RU 1GBTA 5CE1A 1OXGA 3RLYH 3C27B 3ZVAA 2B8OH 3P17H 2AIQA 2P8OB 1AUJA 1ELBA 1SFQB 2STBE 1GL0E 5F03A 1KIGH 5E0JA 3UQOA 3ZZAA 2ZNKH 5DK1A 5EXLA 4YZUA 1K1JA 1O5BB 1KXAA 3PMBB 2HNTC 3PLPA 1SLUB 3PLBA 4CBNA 8GCHG 1HAIH 5TCAA 1BBRK 3CS0A 4ABFA 3QLPH 1P12E 1HB0B 8LPRA 1YC0A 1MKXK 3D62A 3DHKH 3RXGA 1MTNC 3GYMA 1KXCA 1O3GA 1P06A 4ABIA 3RXMA 1NRRH 1KSNA 3AAVA 1C9PA 2R2WU 3HGPA 1AU8A 8KME2 1HAGE 2OP9A 3GDSA 4ABDA 1GI3A 1FDPA 1GJ8B 5ETXA 3RU4E 1IQGA 4MNXA 2Z3EA 1G2LA 1PPGE 1GHAG 2QXGA 3NXPA 5A2MH 1IHTH 3OSYA 1C1WH 1LQDB 3PMJA 2PTCE 4K8BA 1L1NA 4F49A 3STIA 5F8XA 2QF0A 1ELGA 5A09A 4CRCA 4ZKOU 2ESTE 1O3NA 2BXUH 4TY6A 2Y5FA 2C90B 5EW1H 1BRUP 1U6QA 1NFWA 1A61H 1GWAA 1QA0A 4INKA 3PO1C 4K1TA 1S84A 1TBZH 3SZNA 4YM9A 1Z8GA 1CVWH 3SU5A 4ZKRU 1C2EA 4RKJB 1W0YH 2A0QB 2ZHDA 2RCEA 2FOBA 4YT6H 5EXNA 1INCA 3E1XB 2ZHEH 4JCNA 1EZUC 1GHXH 2TBSA 1C2JA 1HJAC 2ALVA 3OX7U 3SU6A 1LHFH 4Y10E 5F8ZA 1LVBA 4DVAU 1ZSJA 2F9VA 2ZO3H 2FS8A 1WBGB 3A7WA 4X6OA 1TOMH 3M3VA 5EPNA 3HGNA 1HAVA 1YF4A 3EYDA 1C5NH 5ESTE 2Y6TA 1SGFG 3VB7A 3RXPA 1C2GA 1OWEA 2EEKA 1V2VT 1W3CA 5ABWA 5SGAE 1BTHH 1FV9A 1MAYA 3HATH 3NUMA 1C5SA 3O8DA 2A4RA 1O2MA 1MKWK 1W13U 1ESAA 2QF3A 1HAVB 1BHXB 4OS1A 3L33A 2Q6GA 6LPRA 1V2UT 1H9LB 1IQMA 1O34A 3ATIA 3BEFB 3RDZA 1Q2WA 2QXIA 4CRBA 1UVSH 2QXJA 4X8TH 1TAWA 1YCPK 2BQ6B 4GAWA 1TNLA 2VNTA 3F68H 4GLYA 1SHYA 3FZZA 4JYVH 1FIZA 4X1PU 4ABAA 1F2SE 2SNVA 2HOBA 4JK6A 1RFNA 1BTXA 4X6PA 3SJ8A 2BY9X 3LT3A 1GVKB 3BG4B 3GY7A 2BY8X 2FI3E 5DP4A 2SFAA 1QJ6B 1ESBA 1GVZA 1UTPA 1J17T 4WXIA 1UCYH 4H6SB 3MOCA 1A0HB 2WINI 3KF2A 4JZIA 3RUOA 3GDUA 2GMTB 3MH7A 1AHTH 4DW2U 1ZSLA 5TJXA 1MTUA 4BAHB 1PQ7A 1S82A 1Z1JA 4IN2A 1L0ZA 1G2MA 4LZ4B 1CSOE 3E8LA 2IPHA 1T4VH 5JYIA 1IQJA 1ID5H 5PTPA 7GCHG 2F9NA 3QDZB 1ELDE 2M5TA 2SGAA 3PYHA 1QQ4A 1M9UA 3A81A 5DP5A 2NU1E 3U1JB 4KTUA 1P05A 3VB6A 1GBHA 2ODYB 1AVGH 1IQKA 5GDSH 4NA8A 1TRNA 3MNCA 1BMAA 2ZGXH 2QYIA 2ANKH 2W3IA 2VWMA 2VIDA 3ZZ9A 1V2ST 3ATLA 1QIXB 1QR3E 1HGTH 1ELEE 2HLCA 3Q77A 3RC6A 2Z6BD 2WYJA 3U8OH 4TPIZ 5JB8S 3ZZBA 2TRMA 2VH6A 1T8LA 3A8DA 3A7XA 4ZHMU 1O3MA 5DGJA 3BTWE 1A3EH 3V0XA 1NFXA 3AVZA 3SU2A 1CGJE 1RS0A 2ODQA 3A84A 4FUDA 1K21H 3BG8A 5E8EH 2PKAA 3TGKE 5A8YA 2OUAA 4BAQB 4D76A 2Y5GA 2G00A 2GP9B 1O2YA 4XBDA 1AFEH 1ZTKA 1F92A 1KXFA 2ZCKP 2W26A 4BTTB 1XVMA 1Y59T 1AE8H 1AZZA 1KLTA 1BTZA 4ZHLU 1EXFA 1QTFA 1B0FA 5T6FA 2VIWA 4B75A 4Y7BA 5GWZA 5C3NA 2JH5D 2VIPA 1C2HA 3P8FA 2GD4B 1O2NA 1OSSA 1EPTC 2PTNA 3C1KA 4ISIH 4ABEA 1TNJA 2D8WA 1KXEA 3UFAA 3RLWH 4CRDA 1D4PB 1W11U 3E90B 3VGCB 2R0KA 3TLOA 3VPKA 1J8AA 3SQEE 5FPSA 3T2NA 2XC5A 1LVOA 1DT2A 2GV7A 3BG4C 1AE5A 1NROH 1GCTC 3MH5A 1CT2E 5F8TA 1Z6EA 3ZYEA 3TGJE 2P3FH 4AB8A 4IN1A 3RMMH 4NIVA 4BOHA 2BDBA 2B5TB 4Y71A 1C5OH 3U9AH 1XKBC 2ZGHA 2OBOA 3BN9A 2BM2A 3E91A 1C2LA 1RJXB 2A2XH 2ZI2H 1DICA 2ANYA 1G3DA 1GJBB 1UVOA 1SVPA 3TK9A 1O3PB 3H7OA 1GDUA 4LOYH 4I33A 2CGAA 4ABHA 2BD7A 3MU0A 4A1VA 2PWXA 1IQLA 5IDKA 5EU8A 3BTQE 2AGGX 2IJOB 4X2VA 4O97A 3URDA 3PWCA 3M37A 5T3HA 4NWLA 2GT8A 3ATMA 1A4WH 4NA9H 1OWIA 5CHAC 3MWIU 4I7YH 1O2XA 1O2UA 3B8JA 4Y76A 3S7HB 2G4TA 2UUKB 3ZZCA 2C8YB 1GCDA 1NRNH 1C1QA 2Y80A 1QB6A 2CMYA 2FZZA 1J14A 2UUYA 1YPKH 3V13A 1DSUA 1YBWA 3IITA 1BMNH 3F6UH 5EQSA 1DDJA 4UE7H 1UJ1A 1NPMA 1OX1A 2YOLA 4TY7A 1P01A 1TBRH 2FP7B 5EQRA 4ZROA 1MBQA 2OD3B 4AORA 4XOJA 2CHAC 2B7DH 3PROA 4FU8A 4IC5A 2AGEX 1T7CA 5K7RA 4B2BA 1UCYE 1SC8U 2FTLE 2KAIB 1GPZA 4JZ1A 1ARBA 3B23B 3MU4A 1C1PA 3GCHC 5EG4A 2V6NA 5BPEA 2PUQH 2QCYA 1TPSA 1E35B 3MFJA 5HMAA 1TGTA 1O3DA 4VGCB 4Q7ZA 2H5CA 1SBWA 3EA8A 2ZA5A 1LHDH 2GT7A 5DG6A 3UIRA 9ESTA 3UOUA 2KAIA 5JB9S 3ZVDA 1BZXE 1FIWA 5J4QA 3TJVA 2Y7XA 2A4QA 3U8TH 1T32A 2XWBI 4AYYB 3ZZ5A 1EATA 2CF8H 2ZGJA 2TGAA 3SOSA 3TJOA 4MTBA 1CU1A 3ZZ8A 4QT8C 3M5MA 2V35A 1O3KA 1C2KA 2XBWA 2W5EA 2ZQ1A 4TWWA 2OQ5A 4CRGA 2A7CA 4AGJA 3O8CA 1HAYB 1ZJKA 1D3DB 2FX4A 1FN6A 3BTME 3UQVA 1EZQA 3ZV9A 4A1XA 1FPCH 3UTUH 4ZMAH 4Y11E 1OP8A 3PO1B 3M5NA 5DKMA 2ZDMA 2AMPA 2VVUA 2WPJS 1YCPH 3L3TA 4DIIH 1C5ZB 1UTQA 3A89A 4I8GA 1FZZA 1EASA 3BEUA 4UFEH 1GI5A 1GHBF 2ZP0H 4A1TA 2ZTZA 2GV6A 4B71A 4INLA 1V2QT 1D6RA 3ODFA 5EOKA 4WMDA 4GPGA 4B2CA 1H8IH 1LVMA 5C5OA 1UVUH 2XC4A 1ZSKA 1A2CH 1OWJA 2J4IA 2V3HH 1P9UA 3OY5U 1C2DA 1DUEA 1EZXC 1P04A 2XC0A 4XBBA 2ZFRH 2W7SA 1G9IE 2BZ6H 2QV1A 1IQNA 1G3EA 3OTJE 2Q1JA 5E0GA 3SI3H 1KDQB 1UTOA 1O5DH 2B0FA 4OGYA 2ASUB 1GGDB 3BTTE 1S85A 4MNWA 2Z3CA 1F5LA 2TGPZ 4B1TA 1MD7A 1QL9A 1C1RA 3EA7A 1DPOA 1NU9A 5EW2H 2C3SA 2A1DB 2ALPA 2XCFA 4YTAA 4KGAA 4Q7XA 2OCVB 4GCHG 2ZCLP 4GVUA 1OS8A 1CGIE 3K9XB 1SGFA 5DP9A 1K9OE 3NPSA 2UWLA 3LC5A 1T8NA 4KP0A 4XBCA 3SU1A 1OOKB 3K2UA 1B7XB 1ZHMA 1ZTLA 4AG1A 1PQ8A 2EI6A 1UVPA 2J2UA 1NC6A 1EPTB 4YESB 5L2YH 4BTIB 1NESE 1GHAF 4B74A 1XUKA 1EAWA 5EXMA 1C1OA 1VITH 3TU7H 1LO6A 1UTLM 2ZDNA 3PTNA 1Z71A 4J1YA 3U8RH 1TQ0B 4D9QA 2BDAA 4INHA 3GY6A 1EZSC 4U32A 3RM2H 1ARCA 1A7SA 3BIUH 1WSSH 4D8NA 1BUIA 1C1MA 3SGQE 3SJKA 1HAHH 2DE8A 2SGEE 1IQIA 3M7UA 1H4WA 7GCHF 1EJNA 3SU3A 1VCPA 1HAOH 1EJAA 2R3YA 3BTFE 1CA8B 2GCHG 1Y3XA 4BAKB 3UWJH 2J38A 4R8TB 3TJUA 4D7FA 2PSYA 1O5CB 1P2NA 3SUDA 1LPZB 3ENSB 1FONA 2F9PA 1EB2A 1O37A 3VEQB 3IG6B 1ESTA 1V6DA 3F9EA 3EA9A 3T28A 4Y8XA 2SGFE 1LHCH 1EOJA 4WH6A 3ZV8A 1C9TA 2QIQA 1O36A 1MUEB 1XUHA 1DUAA 1L4ZA 2WV4A 1ZGIA 1BHXF 3TH2H 5HXFA 2BB4A 1HFDA 2NU0E 3MNBA 4TYDA 2D1JA 4XDEA 1O39A 4JMYA 1QRZA 3A8BA 2HPQH 1J9CH 1JIRA 2FM2A 4UFDH 4CRFA 2ULLA 1SFIA 1YPMH 4A6LA 1FY5A 3KQEA 3W95A 1KTTB 1XKAC 1O0DH 4YLQH 3LGTA 2Y5HA 1CBWC 2BHGA 1NTPA 1JRSA 1YM0A 3RXJA 3ZZ3A 4UD9H 1PYTC 5H4IB 1YKTA 3LGYA 2CXVA 5HM9A 4D9RA 3TJNA 1O3LA 2XBXA 1A1RA 1O3BA 2P95A 1C5RA 3GCHB 1P0SH 4F4OC 1C2FA 1O2HA 2K1QA 1BDAA 4DGJA 1BTUA 2VGCB 1AI8H 3TITA 4X8VH 3QK1A 2BZAA 4OS5A 2A32A 2F83A 4X2YA 1GHBG 5TCCA 2FYQA 1VZQH 4Q7YA 4WF8A 5C1UA 2EA3A 5K0HA 1L2EA 1O5EH 2PW8H 5CHAB 4ISLA 1O3OA 3N7OA 4M7GA 4ABGA 1AWHB 4OS6A 1TONA 2A4GA
chains in the Genus database with same CATH superfamily
3MH6A 1RIWC 1UHBB 1SR5C 3OYPA 1SMFE 1P3EA 3SUEA 2VU8E 5AFZH 4JYTA 3SGBE 1ZLRA 4Y79A 3RXCA 1GDQA 4MVNA 2FYRA 2PKSB 4WJG2 4LZ1H 4FUHA 5LPRA 4FETA 4UEHH 4MQAA 5DP8A 4FXGH 1G3BA 4JK5A 2FX6A 1ZHPA 1C5LH 2A4OA 4R0IA 5EQQA 1NBME 1SGTA 3OTPA 2THFB 3CENA 1S81A 4YO9A 1CHOG 1IQFA 1XVOA 1O2SA 3SU0A 2R0LA 1T31A 1Z7KA 1GJ9B 1GJDB 1FY4A 3SJOA 1HIAB 1V2RT 3LJJA 1BTPA 4IS5A 1UTKA 3GDVA 3A8AA 1ZTJA 1GBLA 1Y3VA 4KTSA 3Q3XA 5FCKA 3KIDU 2JKHA 2G81E 1FI8A 2TGDA 4ZH8A 2XBYA 4AGKA 1S6HA 1TPPA 3MNSA 1K28D 3GISB 1B5GH 1BMMH 1V2TT 3AAUA 3UOPA 1GG6B 3SUFA 1ZMLA 1EQ9A 4OS2A 5B6OA 1EP6A 2ZDVH 3ZZDA 1YPEH 3A7VA 3SGAE 3QWCH 3ODDA 1J16A 3M61U 4MPXA 4ZHAA 4I32A 1BJVA 1BMLA 1FY3A 1C1UH 1P2JA 1E38B 1AKSB 1HXEH 1C1NA 3RXQA 3P70B 2GGVB 2BOKA 3O8RA 4ACAA 5C2ZA 3HKJB 4NFEA 2QC2A 1NM6A 4BANB 6CHAB 1PQAA 5C5NA 5E0HA 1TGCA 2QA9E 3MHWU 1HJAB 4Y6DA 4CHAB 2HNTF 3FO8D 3RXIA 1BRAA 3R0FA 2GVFA 4DIHH 4B76A 1EOLA 2O8UA 3TPIZ 3A87A 3SBKA 4NGAH 3F9FA 1DITH 4BAMB 2H9EH 3LKWA 4YOGA 1SLWB 3DA9B 3RU4D 1ELAA 1WTGH 3IWMA 1O2GH 3RXDA 4ISHH 3LGIA 2I6QA 3RXAA 1RTFB 1QBNA 2PKAB 1FJSA 3CP7A 3RC4A 1XUFA 1LHEH 1Y5AT 2PKSC 1PQ5A 4Z6AH 3S7KB 3BIVH 1QY6A 4J2YB 2AFQB 1CE5A 1GBEA 1C1VH 2FLBH 1Z8IB 4IGDA 1Q31A 5JBAS 5LH8A 1BCUH 2J95A 1DSTA 4DURA 1AO5A 1CHGA 1GBBA 4M9FA 3NK8A 3RXHA 3OEED 1SHHB 1E0FD 5EPYA 4JZFH 1H9HE 2RA3A 1HPGA 2ZZUH 1GBJA 4LK4A 1GJAB 4ZKNU 5L6NH 3RMLH 2Y82A 1EFRD 1O2WA 2P3UB 4ZXXH 2C93B 2QGRA 4ASHA 1UTMA 2NU3E 3RC5A 2DE9A 4KELA 2V3OH 5AHGH 3BTKE 2ILNA 4RN6A 2LNCA 1TGNA 2GCTB 2ANWA 3KGPA 1BA8B 2O8WA 2XXLA 1GJ6A 5I46H 2RDEA 2QY0B 2XRCA 4DOQA 3O8BA 1GMDF 1BTYA 2ZDKA 4IMZA 5C20A 4I86A 1PPFE 2HPPH 3LH3A 1PPBH 6GCHF 3L6PA 1TMBH 1XXDA 1NRQH 3NKKA 4XD7D 3P8NA 1TB6H 2H2ZA 2QN5T 1DOJA 1ELCA 1HIAA 1HCGA 3SV9A 3PB1E 3SO3A 1YY3A 1C5YB 1TGBA 4VGCC 3PMHB 2J92A 4SGBE 4DG4A 5C1YA 1V2OT 2AIPA 1EJMA 1FMGA 1ZPZA 1DLKB 1GVLA 1Q3XA 2AEIH 1SI5H 1ZRBA 2K8IA 2YMSB 1TFXA 5J4SA 3V3MA 1G30B 1GMDG 2ZFTA 3M36A 2BLOA 2QAAA 1WOFA 1ZRKA 2SGQE 3GY5A 4X2WA 4X0WU 1THSH 1YPHE 1HAZB 4FUIA 1JXPA 5DP6A 5FCRA 1SL3A 3BTGE 4JZDH 4ACBA 1UTNA 1TNIA 8GCHF 2FOGA 1PJPA 3HPTB 2WPLS 3P8GA 4AFUA 5EJZA 1GI0A 1UHBA 1PPCE 1GMCG 1GMHF 2LP6A 3E0PB 1CGHA 2FOMB 1FY1A 1JIMA 1HAPH 4NG9H 3DFLA 2VIOA 2WUCA 3PTBA 1BOQA 2FOHA 1MU6B 1O3CA 4AG2A 1Z8RA 2ZCHP 1BRBE 2ZIQH 1PYTD 2KCPA 1AVWA 2UUFB 3FVFB 1AB9C 1P2MA 4XFQA 1Y3UA 1A5IA 2FOEA 2G55A 3FOAA 1A5HA 5HM2A 2XBVA 1ETSH 1TALA 3KQCA 2OC7A 5FBIA 4CH8B 5T6DA 3GYLB 3D65E 4WMFA 2BY5X 5GPIB 3GCTF 1V2LT 1XXFA 7KMEH 1RD3B 1O2PA 3MTYA 4K69A 1MMJN 1EKBB 1O2QA 2BVRH 2F9BH 4K3JA 2Q6FA 1O3FA 1MCVA 2ZPQA 2R2MB 3ZVFA 3E0NB 1K1NA 3GY3A 2H9HA 3OFND 2ZDAH 4FUBA 2WSSD 5LPEA 2F9OA 3MO3A 2ZTYA 1VJAU 3F3BA 2VVVA 4HGCA 2BTCE 3ZVCA 1HNEE 2F9UA 3QZRA 1TE0A 4DCDA 5FPYA 4MDSA 4TT3D 1NY22 4A5TS 1VITF 4H6TA 1TMUH 1MU8B 3A8CA 3VB5A 3RXVA 5BRRE 5GJ4B 1K22H 4AN7A 1ZYOA 3UR6A 1BIOA 5L2ZH 1C4Y2 1PFXC 1G32B 1GCTB 2ZGBH 3SV8A 2GMTC 4FUEA 1WCZA 1MZDA 2FS9A 3FP6E 2VGCC 5GCHF 4ZUHA 1YP9A 3LGUA 3RXEA 1TIOA 3SU4A 1NRPH 4K8YA 2BX4A 1DLEA 2BD4A 3NZIA 4AB9A 4FUCA 2OINA 3MNXA 6ESTA 2KZ4A 1V2PT 3UY9A 1ELVA 1MD8A 2JH0D 3QGJA 5DP3A 3RXBA 1GJ7B 2LPRA 2RA0A 3N7EA 3ZVBA 3EAJA 3JZ1B 3SN8A 5G4BA 2AMQA 2VINA 1HUTH 1Y5BT 4K5ZA 4OGXA 3SJ9A 3LPRA 5GIBA 3FANA 3SV7A 4YXWD 2WPMS 1GI9B 5A0BA 1HLTH 1IAUA 1FNIA 2J34A 5LPFA 3QX5H 2P94A 1TABE 1TOCB 1BRCE 4E06H 1SQTA 1O5AB 1DWEH 4FU9A 1BBRE 1NN6A 3HK6B 3ATKA 3LGWA 1O2OA 2ODPA 1GG6C 4UFFH 1DS2E 2ZF0H 1ABIH 2BDIA 1VCQA 1EUFA 4GCHF 3UPEA 1MTNB 1UK4A 5I25A 4IBLH 3S9AA 2ZFFH 4WMEA 1SQAA 2O8MA 4ABBA 1AY6H 1T8MA 1AD8H 3FP8E 3M7QA 3SHCH 2QXHA 3URCA 4AFZA 1QNJA 2BYAX 1EB1H 1P09A 1ZHRA 1H1BA 1BJUA 1SGRE 3OY6U 4YT7H 1AIXH 1QBOA 4CR9A 1VGCC 2H5DA 1DWBH 1GBDA 2EQNA 1EAIA 1QRXA 5FXLA 2VIQA 9LPRA 3DFJA 4HZHA 1GBCA 2O9QA 3BEIB 1P2QA 4TWYA 1GDNA 3QZQA 1O2RA 3MO6A 1GHZA 1RTLA 1QB1A 3A88A 1WV7H 1W8BH 2J9NA 3A85A 5DJ7A 1NU7B 2HRVA 2A5AA 2O8TA 2PP6A 3T5FH 4YLUA 1D6WA 4MNVA 1SGDE 2FI4E 1N8OB 2Z94A 1OWDA 5IYTA 3RU4T 3MU1A 1UMAH 4YOIA 3TNSA 6CHAC 1H8DH 1V2KT 4P02A 1BB0B 3NCLA 3TH4H 3DSPA 1O30A 1TA2A 2F91A 3F9GA 3RM0H 1TWXB 3UNRA 1KXBA 2STAE 1K1IA 4Y8YA 5A8ZA 4O3TA 3SI4H 2AGIX 3ZZ7A 4AYVB 4ZKSU 1KYNA 3S9BA 1HBTH 1F0TA 1ZMJA 2ZQ2A 5C1XA 4E7RG 5ESBA 1YPJH 2NU2E 5JBTA 1CT0E 1TLDA 4NZLA 1ZMNA 4NIWA 1LPGB 1SPJA 2PR3A 3FP7E 8ESTE 1H8HD 2OXSA 2G4UA 3PRDA 1Z1IA 1O3HA 2TPIZ 5DPAA 3ZYDA 3BTDE 3WY8A 2Z9JA 1SGQE 1TPAE 3SNCA 3T27A 1F0UA 1LPKB 3GOVB 2DUCA 3GY2A 5KGOA 4GSOA 1DE7H 3A83A 1CA0B 2A7JA 1ORFA 3RXLA 1ANEA 1GBMA 2ZU5A 4BAOB 5AFYH 3GY8A 4ZAEA 2H6MA 1PPEE 1FUJA 2GZ9A 2KM0A 1VITG 3AASA 1GJ5H 3RXRA 1XUIA 1Z6JH 4K1SA 2EC9H 2J94A 1UK2A 4A92A 2NU4E 1ZPBA 1FXYA 4I8JA 1VCWA 4H4FA 2ZU1A 4AFQA 1MQ5A 4MPVA 4PROA 3ITIA 2BD2A 3P92A 1ETRH 1N8OC 4OM9A 4DJZB 3R3GB 2W3KA 1P9SA 1RRKA 3EGKH 4NIXA 2BLVA 1QJ7B 4TSFD 2HVXA 4UDWH 3RXTA 1EPTA 4B73A 1W10U 1LDTT 1EAXA 3FAOA 3U69H 2C8WB 3V7TA 3GICB 1D3QB 1SGPE 3QTVH 4X2XA 3A80A 1GJ4H 2JDID 1S0RA 2XWAA 2BOHB 1SGYE 2VJ1A 1MTWA 1QZ8A 4GHTA 5GXPA 1LQEA 2ZEBA 3VXEH 2P16A 4WY3A 5FHTA 2FOFA 1NFYA 1HYLA 1MZAA 3SORA 1UCYK 5HKKD 1FY8E 1G3CA 2ZECA 4HTCH 1JWTA 3FZDA 1O2TA 2BD3A 4LXBH 3UREA 2VH0A 1GGDC 4MLFB 3BTEE 1HXFH 2LELA 1LTOA 3M5LA 1UVTH 1QL7A 2HWLB 1YPLH 4HFPB 1FQ3A 2A45B 3KL6A 2RFKC 1J15A 2AS9A 1EAUA 1V2MT 1WAYB 2VB0A 1CT4E 1D3PB 1ANCA 3QN7A 3OE7D 2WPKS 1D9IA 1A3BH 2Z7FE 2J98B 3BTHE 4K2YA 2G51A 3KQ5A 1A0LA 1THRH 2F4LA 1C5WB 2ANMH 2I6SA 4U2WA 4Y0YE 4AFSA 2VWOA 1XUJA 5GCHG 4DY7B 3EE0B 1FAKH 2RG3A 2J5UA 3EE7A 1GHYH 3I78A 1ZOMA 2FODA 1QRWA 2R9PA 1GBFA 2ZHQH 4FUFA 2ZFSA 2AMDA 3HKIB 2WV9A 3A7ZA 4KTCA 4WH8A 5EGMA 2VWLA 1VKYA 5A0CA 2BMGB 2FI5E 1ZJDA 3K6YA 3SV6A 6GCHG 3U28C 5AF9H 1AGJA 1QGFA 1T4UH 1E1QD 1TX8A 1JBUH 1OKXA 3T25A 2BLWA 2A31A 3VXFH 1PPZA 3TK5A 2C8XB 5E2PA 1ACBE 4XRNA 2P8OC 3K65B 1GI2A 3LDXH 1DM4B 1SLVB 1A5GH 1HAXB 1YPGH 3MH4A 1YYY1 2NWNA 1LCYA 3T26A 5F53A 3S0NA 2Z9LA 1K1PA 1KMHB 2F43B 3MMGA 4O9VA 2WZQA 3VFEA 2AERH 1DVAH 3H7TA 1ELFA 2W6ID 1RXPA 1OWKA 3M3SA 1DFPA 1LVYA 1MH0A 1QFKH 2EI7A 1NRSH 1G37A 1K1LA 1AZ8A 2Z3DA 3VB4A 1E34B 1S6FA 1GMHG 1IQEA 1C1TA 2BQWB 1TRMA 2CN0H 1CHOF 4CREA 2ZKSA 2YMSC 1L4DA 1YCPM 2B9LA 4FVBA 2WPIS 3GS9A 3VG8A 1A0JA 1O35A 1TRYA 4JYUH 1SGCA 1GHWH 4THNH 4NZQA 1CA0C 1P3CA 5DO4H 3DCLA 3BV9B 1MKXH 2PSXA 1GI6A 1HJ8A 1P2IA 4E7NA 1SB1H 1P8VC 1QJ1B 5C17A 2SGPE 4Q80A 1AFQC 1Z8JB 5EJ1A 2OTVA 2ZDLA 4B6EA 5FX6A 1GBKA 2FXRA 2GTBA 4AZ2B 1C5VA 4O03A 1EP5A 2BD8A 5B6LA 1V3XA 1OYQA 3STJA 3LOXA 1O5FH 1WTHD 3QO6A 1BQYA 1S83A 3G01A 3U1IB 2L6OA 1VGCB 1WDIA 2ZC9H 2ZU2A 2D26C 2XTTB 2G5VA 3PWBA 1JRTA 1FN8A 2VVCA 4Q63A 3AW1A 4B2AA 1B0EA 1FAXA 1ZR0A 1H8ED 2FWWA 4SGAE 4I8LA 3W94A 1SG8B 3KEEA 1TPOA 7LPRA 2VWNA 5DSFA 4XE4A 5JBBS 4GUXA 5CHBA 1O2JA 1DY8A 2CJIA 1JMOH 3Q00A 1L1JA 4CRAA 3TIUA 1O2LA 3H5CB 3PLKA 1IOEA 1GI4A 2VIVA 3KCGH 2A7HA 2G8TA 4WVPE 3S69A 1DANH 4NA7A 4I31A 2V0BA 3E6PH 1P02A 1MQ6A 1HRTH 2SGDE 4BXSA 2CHAB 1K2I1 1OP0A 1GI7B 1AMHA 1BTWA 1CO7E 1C5TA 3P6ZB 2FO9A 1NO9H 2PFEA 3GCOA 1THPB 3DD2H 1C5UA 3BF6H 1GHVH 2YNBA 3RMNH 1EX3A 3SV2H 1QB9A 1QA7A 3RMOH 2ZU4A 2BLQA 2FESH 1S6LA 2PGBB 3T29A 4CHAC 1NFUA 1GL1A 1D3TB 4IC6A 3M3TA 1V2NT 1W12U 4ZXYH 1TQ7B 1F5RA 3VB3A 3TNTA 5JPMH 2ZG0H 1UTJA 1LKBA 2XCNA 2Y81A 1GBAA 2GDEH 3PRBA 4OS7A 4FVDA 1YGCH 2A2QH 4DT7B 4UFGH 3DUXH 1QCPA 4BTUB 1SQOA 3Q3YA 4X1NU 3BSQA 3SHAH 3ZZ6A 3D49H 3F2GA 3ATWA 5JDUB 4OS4A 1O2ZA 2FPZA 2WV5A 3FN8A 1HDTH 2H1UA 1LHGH 3CS7A 1AKSA 1W0ZU 1O31A 4WXVA 1GI1A 2AH4X 3F1SB 2GZ8A 2EI8A 4CH2B 1S0QA 1F7ZA 1KLIH 1QL8A 4O3UA 1W2KH 4AX9H 3NWUA 1F0RA 1TX7A 3UNSA 3KQDA 4B6FA 3LONA 1VR1H 3RXSA 2V7QD 2ZPRA 1O2IA 4F55A 4NSYA 2XW9A 3A82A 2CV3A 1SGEE 2BY7X 2ZGCA 2JETB 1L1GA 2OLGA 1TYNA 1RTKA 1W14U 1P2KA 1AWFH 1DXPA 4RSPA 2BY6X 3LC3A 3DT0H 1LMWB 2F3CE 2BDYA 4X1SU 3ZVGA 1WU1A 2PUXB 2Y7ZA 3MO9A 4BXWA 2ZWLH 1OWHA 1QHRB 3I29A 1UK3A 1N1LA 4X1QU 2UUJB 3SNEA 1O5GH 3JZ2B 4U01A 2BXTH 1W7GH 4JZEH 2ZHFH 2C4FH 1O3JA 1MCTA 3SUGA 3I77A 1MTVA 1C5QA 1C1SA 2BD5A 5FBEA 3N7DA 3GCTG 2JH6D 4NSVA 2ZTXA 1P10A 4P00A 2Z9IA 3PM3A 1ZPCA 3P8OA 1IQHA 2BVSH 2Z9GA 3TH3H 1AFQB 1Y3WA 2O8LA 3MU8A 2FDAA 1C5PA 3KN2A 3UUZA 4FOUC 1SGIB 1T8OA 2HVYB 2GDDA 2OQUA 1C5XB 4ESTE 1ZZZA 2WPHS 1GJCB 4X6MA 3TK6A 1Y5UT 2OBQA 1OP2A 3Q3KA 1GI8B 2KFWA 3RXUA 3ZZ4A 4BNRA 1NZQH 2FMJA 2QF5A 2UWPA 1YLDA 3QGNB 3SW2B 2OC8A 1F0SA 5F6MA 5EODA 3RXFA 2XNIA 1BITA 1KTSB 2Z9KA 2H9TH 1KLJH 4YOJA 4MPWA 2L74A 4NFFA 4NWKA 3PV2A 4A7IB 2IN2A 1Y8TA 4UONA 1H9IE 4ABJA 1C2IA 3SNDA 5FAHA 5FX5A 2BDCA 1KXDA 3OAAD 3P95A 5C0UA 1DWDH 5FL7D 1BT7A 2GCTC 3GY4A 1CQQA 3EQ0H 2UWOA 4MNYA 1MTSA 3KHVA 1MBMA 2ZFPH 3ESTA 1OYTH 3KNXA 2FEQH 2HNTE 2PLXA 1C4U2 5AVDA 3MYWA 2FOCA 1F5KU 1ABJH 1YPHC 2WYGA 2W7UA 3UAIC 1AN1E 3EDXB 1BBRH 2P93A 4I8HA 1CBWB 1W7XH 4FUJA 1ANBA 4K60A 3DSGA 1AUTC 3LU9B 1DXWA 3Q76A 1A46H 4Y7AA 3FFGA 1ELTA 1QURH 1VJ9U 1TNGA 5KEDA 2HLDD 3LGVA 1WUNH 5EIYA 1AB9B 2ZFQH 2FIRH 5JBCS 3KYGA 2FOAA 4NIYA 1O33A 4HI3A 1KY9A 5T6GA 1C4V2 1XX9A 4MG3A 1O3EA 4FUGA 2SNWA 3M35A 4MPUA 2XYAA 2GZ7A 1P11E 4KKDA 1SLXB 2FLRH 1G36A 1YLCA 2GX4A 2OC1A 1LKAA 4IW4E 1JOUB 1WYKA 3TGIE 2G52A 7ESTE 1MAXA 3LIWA 2HGTH 1XMNB 1K1MA 1S5SA 3RXOA 1AQ7A 4CR5A 2R3UA 5L30H 2TGTA 4U30A 1KDQA 3LH1A 2HALA 1SGNE 3ZVEA 1P2OA 3ELAH 1HV7A 1C5MD 4I8KA 3SNBA 1E37B 3H09A 2ZHWH 5DP7A 3QUMP 1O3AA 1PPHE 1P03A 1IHSH 2BD9A 4NCYA 3K6ZA 3NRLA 1TBQH 2ZPSA 1NS3A 2JETC 3GCNA 2P59A 3S9CA 4ISOA 2BVXH 3D23A 1DX5M 2PV9B 4K1EA 4Y0ZE 1WQVH 1TA6A 3E3TA 1XM1A 1RIWB 3RP2A 3UNQA 1BMFD 1E36B 3T62A 3E16B 2A5KA 2YNAA 1SSXA 1C2MA 2ZU3A 2C8ZB 3HK3B 3KQBA 4WWYA 5A0AE 1SQRA 5A8XA 2A5IA 4FU7A 2PGQB 3U98H 3SQHE 2W6JD 1N6YA 3A7TA 2GCHF 1MKWH 1QQUA 1RGQA 1SOZA 1TGSZ 1V2JT 3M5OA 1GMCF 1X7AC 1ANDA 2CF9H 5HYOA 5E2OA 3AW0A 1SOTA 2IOTA 1UO6A 1TMTH 3B9FH 3UR9A 4D7GA 5HGGA 3QTOH 3RXKA 5LGOA 2TIOA 3PV4A 3TVJB 1ZGVA 2P3TB 3V12A 1XUGA 1GBIA 2EY4C 1QBVH 3OU0A 1FPHH 4XSKU 4TPYA 1AVXA 1O2VA 1WQSA 1FLEE 1TNKA 3A86A 1O2KA 3LJOA 2AYWA 1Y3YA 3MU5A 3F9HA 3A7YA 3PMAB 4ISNA 3MI4A 4AOQA 2BDGA 2OC0A 2D2DA 1O38A 2Q6DA 4GHQA 4X8UH 3SNAA 3UWIA 4H42U 3M7TA 4Z0KA 1DY9A 2FTMA 2RDLA 4CBOA 4Y8ZA 3VGCC 5FPTA 1NT1A 1O32A 3SJIA 4X8SH 1DWCH 2XOKD 2WUBA 5CMXH 2PHBA 4X6NA 5C67A 1TNHA 2J98A 1ETTH 2BDHA 1TX6A 1N6XA 1OPHB 2G5NA 1V2WT 1HJ9A 1K1OA 4Q2KA 4RKOB 1O3IA 2BX3A 5C0TA 1P57B 2BQ7B 4IMQA 2IJD1 4E05H 2GKVE 4X1RU 1GBTA 5CE1A 1OXGA 3RLYH 3C27B 3ZVAA 2B8OH 3P17H 2AIQA 2P8OB 1AUJA 1ELBA 1SFQB 2STBE 1GL0E 5F03A 1KIGH 5E0JA 3UQOA 4RI0A 3ZZAA 2ZNKH 5DK1A 5EXLA 4YZUA 1K1JA 1O5BB 1KXAA 3PMBB 2HNTC 3PLPA 1SLUB 3PLBA 4CBNA 8GCHG 1HAIH 5TCAA 1BBRK 3CS0A 4ABFA 5C94A 1P12E 3QLPH 1HB0B 8LPRA 1YC0A 1MKXK 3D62A 3DHKH 3RXGA 1MTNC 3GYMA 1KXCA 1O3GA 1NBMD 1P06A 2K0QA 3RXMA 4ABIA 1NRRH 1KSNA 3AAVA 1C9PA 2R2WU 1OHHD 3HGPA 1AU8A 8KME2 1HAGE 2OP9A 3GDSA 4ABDA 1GI3A 1FDPA 1GJ8B 5ETXA 3RU4E 1IQGA 3N99A 4MNXA 2Z3EA 1G2LA 1PPGE 1GHAG 2QXGA 3NXPA 5A2MH 1IHTH 3OSYA 1C1WH 1LQDB 3PMJA 2PTCE 2WHXA 4K8BA 1L1NA 4F49A 3STIA 5F8XA 2QF0A 1ELGA 5A09A 4CRCA 4ZKOU 2ESTE 1O3NA 2BXUH 4TY6A 2Y5FA 2C90B 5EW1H 1BRUP 1U6QA 1NFWA 1A61H 1GWAA 1QA0A 4INKA 3PO1C 4K1TA 1S84A 1TBZH 3SZNA 3MQKC 4YM9A 1Z8GA 1CVWH 3SU5A 4ZKRU 1C2EA 4RKJB 1W0YH 2A0QB 2ZHDA 2RCEA 2WPDD 2FOBA 4YT6H 5EXNA 1INCA 3E1XB 3F2HA 2ZHEH 4JCNA 1EZUC 1GHXH 3DSOA 2TBSA 1C2JA 1HJAC 2ALVA 3OX7U 3SU6A 1LHFH 4Y10E 5F8ZA 1LVBA 4DVAU 1ZSJA 2F9VA 2ZO3H 2FS8A 1WBGB 3A7WA 4X6OA 1TOMH 3M3VA 5EPNA 3HGNA 1HAVA 1YF4A 3EYDA 1C5NH 5ESTE 2Y6TA 1SGFG 3VB7A 3RXPA 1C2GA 1OWEA 2EEKA 1YLNA 1V2VT 2KCOA 1W3CA 5ABWA 5SGAE 1BTHH 1FV9A 1MAYA 3HATH 3NUMA 1C5SA 3O8DA 2A4RA 1O2MA 1MKWK 1W13U 1ESAA 2QF3A 1HAVB 1BHXB 4OS1A 3L33A 2Q6GA 6LPRA 1V2UT 1H9LB 1IQMA 2JIZD 1O34A 3ATIA 3BEFB 3F0OA 3RDZA 1Q2WA 2QXIA 4CRBA 1UVSH 2XNDD 2QXJA 4X8TH 1TAWA 1YCPK 2BQ6B 2CK3D 1TNLA 4GAWA 2VNTA 3F68H 4GLYA 1SHYA 3FZZA 4JYVH 1FIZA 4X1PU 4ABAA 1F2SE 2SNVA 2HOBA 4JK6A 1RFNA 5GNDA 1BTXA 4X6PA 3SJ8A 2BY9X 3LT3A 1GVKB 4DT4A 3BG4B 4RT1A 3GY7A 1E79D 2BY8X 2FI3E 5DP4A 2SFAA 1QJ6B 1ESBA 1GVZA 1UTPA 1J17T 4WXIA 1UCYH 4H6SB 3MOCA 1A0HB 5IK2D 2WINI 3KF2A 4JZIA 3RUOA 3GDUA 2GMTB 3MH7A 1AHTH 4DW2U 1ZSLA 5TJXA 1MTUA 4BAHB 1PQ7A 1S82A 1Z1JA 4IN2A 1L0ZA 1G2MA 4LZ4B 1CSOE 3E8LA 2IPHA 1T4VH 5JYIA 1IQJA 4Z1MD 2KCYA 1ID5H 5PTPA 7GCHG 2F9NA 3QDZB 1ELDE 2M5TA 2SGAA 3PYHA 1QQ4A 1M9UA 3A81A 5DP5A 2NU1E 3U1JB 1YWUA 4KTUA 1P05A 3VB6A 3W1EA 1GBHA 2ODYB 1AVGH 1IQKA 5GDSH 4NA8A 1TRNA 3MNCA 1BMAA 2ZGXH 2QYIA 2ANKH 2W3IA 2VWMA 2KR7A 2VIDA 3ZZ9A 1V2ST 3ATLA 1QIXB 1QR3E 1HGTH 1ELEE 1W0KD 2HLCA 3ZIAD 3Q77A 3RC6A 2Z6BD 2WYJA 3U8OH 4TPIZ 5JB8S 3ZZBA 2TRMA 2VH6A 1T8LA 3A8DA 3A7XA 4ZHMU 1O3MA 5DGJA 3BTWE 1A3EH 3V0XA 1NFXA 3AVZA 3SU2A 1CGJE 1RS0A 2ODQA 3A84A 4FUDA 1K21H 3BG8A 5E8EH 2PKAA 3TGKE 5A8YA 2OUAA 4BAQB 4D76A 2Y5GA 2G00A 2GP9B 1O2YA 4XBDA 1AFEH 1ZTKA 1F92A 1KXFA 2ZCKP 2W26A 4BTTB 1XVMA 1Y59T 1AE8H 1AZZA 1KLTA 1BTZA 4ZHLU 1EXFA 1QTFA 1B0FA 5T6FA 2VIWA 4B75A 4Y7BA 5GWZA 5C3NA 2JH5D 2VIPA 1C2HA 3P8FA 2GD4B 1O2NA 1OSSA 5HIYA 1EPTC 2PTNA 3C1KA 4ISIH 4ABEA 1TNJA 2D8WA 1KXEA 3UFAA 3RLWH 4CRDA 1D4PB 1W11U 1COWD 3E90B 3VGCB 4AC9A 2R0KA 3TLOA 3VPKA 1J8AA 3SQEE 5FPSA 3T2NA 2XC5A 1LVOA 1DT2A 2GV7A 3BG4C 1AE5A 1NROH 1GCTC 3MH5A 1CT2E 5HIZA 5F8TA 1Z6EA 3ZYEA 3TGJE 2P3FH 4AB8A 4IN1A 3RMMH 4NIVA 4BOHA 5CDFE 2BDBA 2B5TB 4Y71A 5T1VA 1C5OH 3U9AH 3SYJA 1XKBC 2ZGHA 2OBOA 3BN9A 2BM2A 3E91A 1C2LA 1RJXB 2A2XH 2ZI2H 1DICA 2ANYA 1G3DA 1GJBB 1UVOA 1SVPA 3TK9A 1O3PB 3H7OA 1GDUA 4LOYH 4I33A 2CGAA 4ABHA 2M2AA 2BD7A 3MU0A 4A1VA 2PWXA 1IQLA 2IPQX 3WW7A 5IDKA 5EU8A 3BTQE 2AGGX 2IJOB 4X2VA 4O97A 3URDA 3KYFA 3PWCA 3M37A 5T3HA 4NWLA 2GT8A 3ATMA 1A4WH 4NA9H 1OWIA 5CHAC 3MWIU 4I7YH 1O2XA 1O2UA 2JJ1D 3B8JA 4Y76A 3S7HB 2G4TA 2UUKB 3ZZCA 2C8YB 1GCDA 1NRNH 1C1QA 2Y80A 1QB6A 2CMYA 2FZZA 1J14A 2V3MA 2UUYA 1YPKH 3V13A 1DSUA 1YBWA 3IITA 1BMNH 3F6UH 5EQSA 1DDJA 4UE7H 1UJ1A 1NPMA 1OX1A 2YOLA 4TY7A 1P01A 1TBRH 3WWBA 2FP7B 3SZEA 5EQRA 4ZROA 4ASUD 1MBQA 2OD3B 4AORA 4XOJA 2CHAC 2B7DH 3PROA 4FU8A 4IC5A 2AGEX 1T7CA 2YMSD 1K0HA 5K7RA 4B2BA 1UCYE 1SC8U 2FTLE 2KAIB 1GPZA 4JZ1A 1ARBA 3B23B 3MU4A 1C1PA 2KCAA 3GCHC 5EG4A 2V6NA 5BPEA 2PUQH 2QCYA 1TPSA 1E35B 3MFJA 5HMAA 1TGTA 3F0PA 1O3DA 4VGCB 4Q7ZA 2H5CA 1SBWA 3EA8A 2ZA5A 1LHDH 2GT7A 5DG6A 3UIRA 9ESTA 3UOUA 2KAIA 5JB9S 3ZVDA 1BZXE 1FIWA 5J4QA 3TJVA 2Y7XA 2A4QA 3U8TH 1T32A 2XWBI 4AYYB 3ZZ5A 1EATA 2QE7D 2CF8H 1MABB 2ZGJA 2TGAA 3SOSA 3TJOA 4MTBA 1CU1A 3ZZ8A 2GJGA 4QT8C 3M5MA 2V35A 1O3KA 1C2KA 1UW7A 2W5EA 2XBWA 2ZQ1A 4TWWA 2OQ5A 4CRGA 2A7CA 4AGJA 3O8CA 1HAYB 1ZJKA 1D3DB 2FX4A 1FN6A 3BTME 3UQVA 1EZQA 3ZV9A 4A1XA 1FPCH 3UTUH 3F2FA 4ZMAH 4Y11E 1OP8A 3PO1B 3M5NA 5DKMA 2ZDMA 2AMPA 2VVUA 2WPJS 1YCPH 3L3TA 4DIIH 1C5ZB 1UTQA 3A89A 4I8GA 1FZZA 1EASA 3BEUA 4UFEH 1GI5A 1GHBF 2ZP0H 4A1TA 3AK5A 2ZTZA 2GV6A 4B71A 4INLA 1V2QT 1D6RA 3ODFA 5EOKA 4WMDA 4GPGA 4B2CA 1H8IH 1LVMA 5C5OA 1UVUH 3PV5A 2XC4A 1ZSKA 1A2CH 1OWJA 2J4IA 2V3HH 1P9UA 3CNRA 4F48B 3OY5U 1C2DA 1DUEA 1EZXC 1P04A 2XC0A 4XBBA 2ZFRH 2W7SA 1G9IE 2BZ6H 2QV1A 5KECA 1IQNA 1G3EA 3OTJE 2Q1JA 5E0GA 3SI3H 3FKSD 1KDQB 1UTOA 1O5DH 2B0FA 4OGYA 2ASUB 1GGDB 3BTTE 1S85A 4MNWA 2VBCA 2Z3CA 1F5LA 2TGPZ 4B1TA 1MD7A 1QL9A 1C1RA 3EA7A 2J97A 1DPOA 1NU9A 5EW2H 2C3SA 2A1DB 2ALPA 5EJLA 2XCFA 4YTAA 4KGAA 4Q7XA 2OCVB 4GCHG 2ZCLP 4GVUA 1OS8A 1CGIE 3K9XB 1SGFA 5DP9A 1K9OE 3NPSA 2UWLA 3LC5A 1T8NA 4KP0A 1E1RD 4XBCA 3SU1A 1OOKB 3K2UA 1B7XB 1ZHMA 1ZTLA 4AG1A 1PQ8A 2EI6A 1UVPA 2J2UA 1NC6A 1EPTB 4YESB 5L2YH 4BTIB 1NESE 1GHAF 4B74A 1XUKA 1EAWA 5EXMA 1C1OA 1VITH 3TU7H 1LO6A 1UTLM 2ZDNA 3PTNA 1Z71A 4J1YA 4Q4LA 3U8RH 1TQ0B 4D9QA 2BDAA 4INHA 3GY6A 1EZSC 4U32A 3RM2H 2QF4A 1ARCA 1A7SA 3BIUH 1WSSH 4D8NA 1BUIA 1C1MA 3SGQE 3SJKA 1HAHH 2DE8A 2SGEE 1IQIA 3M7UA 1H4WA 7GCHF 1EJNA 3SU3A 1VCPA 1HAOH 1EJAA 2R3YA 3BTFE 1CA8B 2GCHG 1Y3XA 4BAKB 3UWJH 2J38A 4R8TB 3TJUA 4RT0A 4D7FA 2PSYA 2KX4A 1O5CB 1P2NA 3SUDA 3UB0A 1SKYE 1LPZB 3ENSB 1FONA 2F9PA 1EB2A 1O37A 5DN6D 3VEQB 3IG6B 1ESTA 1FX0B 1V6DA 3EA9A 3F9EA 3T28A 4Y8XA 3WWFA 2SGFE 1LHCH 1EOJA 4WH6A 3ZV8A 1C9TA 2QIQA 1O36A 2JJ2D 1MUEB 1XUHA 1DUAA 1L4ZA 2WV4A 1ZGIA 1BHXF 3TH2H 5HXFA 2BB4A 1HFDA 2NU0E 3MNBA 4TYDA 2OK5A 2D1JA 4XDEA 1WXRA 1O39A 4JMYA 1QRZA 3A8BA 2HPQH 1J9CH 1JIRA 2FM2A 4HG6A 4UFDH 4CRFA 2ULLA 1SFIA 1YPMH 4A6LA 1FY5A 3KQEA 3W95A 1KTTB 1XKAC 1O0DH 4YLQH 4ZCNA 3LGTA 2Y5HA 1CBWC 2BHGA 1NTPA 2AHME 1JRSA 1YM0A 3RXJA 3ZZ3A 4UD9H 1PYTC 5H4IB 1YKTA 3LGYA 2CXVA 5HM9A 4D9RA 3TJNA 1O3LA 2XBXA 1A1RA 1O3BA 2P95A 1C5RA 3GCHB 1P0SH 4F4OC 1C2FA 1O2HA 2K1QA 1BDAA 4DGJA 1BTUA 2VGCB 1AI8H 3TITA 4X8VH 3QK1A 2BZAA 4OS5A 2A32A 2F83A 4X2YA 1GHBG 5TCCA 2FYQA 1VZQH 1W0JD 4Q7YA 4WF8A 5C1UA 2EA3A 5K0HA 1L2EA 1O5EH 2PW8H 3OEHD 5CHAB 4ISLA 1O3OA 3N7OA 4M7GA 4ABGA 1AWHB 4OS6A 1TONA 2A4GA
chains in the Genus database with same CATH topology
3MH6A 1RIWC 1UHBB 1SR5C 3OYPA 1SMFE 1P3EA 3SUEA 2VU8E 5AFZH 4JYTA 3SGBE 1ZLRA 4Y79A 3RXCA 1GDQA 4MVNA 2FYRA 2PKSB 4WJG2 4LZ1H 4FUHA 5LPRA 5DP8A 4UEHH 4MQAA 4FXGH 1G3BA 4JK5A 2FX6A 1ZHPA 1C5LH 2A4OA 4R0IA 5EQQA 1SGTA 2THFB 3CENA 1S81A 4YO9A 1CHOG 1IQFA 1XVOA 1O2SA 3SU0A 2R0LA 1T31A 1Z7KA 1GJ9B 1GJDB 1FY4A 3SJOA 1HIAB 1V2RT 3LJJA 1BTPA 4IS5A 1UTKA 3GDVA 3A8AA 1ZTJA 1GBLA 1Y3VA 4KTSA 3Q3XA 5FCKA 3KIDU 2JKHA 2G81E 1FI8A 2TGDA 4ZH8A 2XBYA 4AGKA 1S6HA 1TPPA 3MNSA 1K28D 3GISB 1B5GH 1BMMH 1V2TT 3AAUA 3UOPA 1GG6B 3SUFA 1ZMLA 1EQ9A 4OS2A 5B6OA 1EP6A 2ZDVH 3ZZDA 1YPEH 3A7VA 3SGAE 3QWCH 3ODDA 1J16A 3M61U 4MPXA 4ZHAA 4I32A 1BJVA 1BMLA 1FY3A 1C1UH 1P2JA 1E38B 1AKSB 1HXEH 1C1NA 3RXQA 3P70B 2GGVB 2BOKA 3O8RA 5C2ZA 3HKJB 4NFEA 2QC2A 1NM6A 4BANB 6CHAB 1PQAA 5C5NA 5E0HA 1TGCA 2QA9E 3MHWU 1HJAB 4Y6DA 4CHAB 2HNTF 3RXIA 1BRAA 3R0FA 2GVFA 4DIHH 4B76A 1EOLA 2O8UA 3TPIZ 3A87A 3SBKA 4NGAH 3F9FA 1DITH 4BAMB 2H9EH 3LKWA 4YOGA 1SLWB 3DA9B 3RU4D 1ELAA 1WTGH 3IWMA 1O2GH 3RXDA 4ISHH 3LGIA 2I6QA 3RXAA 1RTFB 1QBNA 2PKAB 1FJSA 3CP7A 3RC4A 1XUFA 1LHEH 1Y5AT 2PKSC 1PQ5A 4Z6AH 3S7KB 3BIVH 1QY6A 4J2YB 2AFQB 1CE5A 1GBEA 1C1VH 2FLBH 1Z8IB 4IGDA 1Q31A 5JBAS 5LH8A 1BCUH 2J95A 1DSTA 4DURA 1AO5A 1CHGA 1GBBA 3NK8A 3RXHA 1SHHB 1E0FD 5EPYA 4JZFH 1H9HE 2RA3A 1HPGA 2ZZUH 1GBJA 4LK4A 1GJAB 4ZKNU 5L6NH 3RMLH 2Y82A 1O2WA 2P3UB 4ZXXH 2C93B 2QGRA 4ASHA 1UTMA 2NU3E 3RC5A 2DE9A 4KELA 2V3OH 5AHGH 3BTKE 2ILNA 4RN6A 2LNCA 1TGNA 2GCTB 2ANWA 3KGPA 1BA8B 2O8WA 2XXLA 1GJ6A 5I46H 2QY0B 2XRCA 4DOQA 3O8BA 1GMDF 1BTYA 2ZDKA 4IMZA 5C20A 1PPFE 2HPPH 3LH3A 1PPBH 6GCHF 3L6PA 1TMBH 1XXDA 1NRQH 3NKKA 3P8NA 1TB6H 2H2ZA 2QN5T 1DOJA 1ELCA 1HIAA 1HCGA 3SV9A 3PB1E 3SO3A 1C5YB 1TGBA 4VGCC 3PMHB 2J92A 4SGBE 4DG4A 5C1YA 1V2OT 2AIPA 1EJMA 1FMGA 1ZPZA 1DLKB 1GVLA 1Q3XA 2AEIH 1SI5H 1ZRBA 1TFXA 5J4SA 3V3MA 1G30B 1GMDG 2ZFTA 3M36A 2BLOA 2QAAA 1WOFA 1ZRKA 2SGQE 3GY5A 4X2WA 4X0WU 1THSH 1YPHE 1HAZB 4FUIA 1JXPA 5DP6A 5FCRA 1SL3A 3BTGE 4JZDH 1UTNA 1TNIA 8GCHF 2FOGA 1PJPA 3HPTB 2WPLS 3P8GA 4AFUA 1GI0A 1UHBA 1PPCE 1GMCG 1GMHF 3E0PB 1CGHA 2FOMB 1FY1A 1JIMA 1HAPH 4NG9H 3DFLA 2VIOA 2WUCA 3PTBA 1BOQA 2FOHA 1MU6B 1O3CA 4AG2A 1Z8RA 2ZCHP 1BRBE 2ZIQH 1PYTD 1AVWA 2UUFB 3FVFB 1AB9C 1P2MA 4XFQA 1Y3UA 1A5IA 2FOEA 2G55A 5HM2A 1A5HA 2XBVA 1ETSH 1TALA 3KQCA 2OC7A 5FBIA 4CH8B 5T6DA 3GYLB 3D65E 4WMFA 2BY5X 5GPIB 3GCTF 1V2LT 1XXFA 7KMEH 1RD3B 1O2PA 3MTYA 4K69A 1MMJN 1EKBB 1O2QA 2BVRH 2F9BH 4K3JA 2Q6FA 1O3FA 1MCVA 2ZPQA 2R2MB 3ZVFA 3E0NB 1K1NA 3GY3A 2H9HA 4FUBA 2ZDAH 5LPEA 2F9OA 3MO3A 2ZTYA 1VJAU 4HGCA 2VVVA 2BTCE 3ZVCA 1HNEE 2F9UA 3QZRA 1TE0A 4DCDA 5FPYA 4MDSA 1NY22 4A5TS 1VITF 4H6TA 1TMUH 1MU8B 3A8CA 3VB5A 3RXVA 5BRRE 5GJ4B 1K22H 4AN7A 1ZYOA 3UR6A 1BIOA 5L2ZH 1C4Y2 1PFXC 1G32B 1GCTB 2ZGBH 3SV8A 2GMTC 4FUEA 1WCZA 1MZDA 2FS9A 3FP6E 2VGCC 5GCHF 4ZUHA 1YP9A 3LGUA 3RXEA 1TIOA 3SU4A 1NRPH 4K8YA 2BX4A 1DLEA 2BD4A 3NZIA 4AB9A 4FUCA 2OINA 3MNXA 6ESTA 1V2PT 3UY9A 1ELVA 1MD8A 2JH0D 3QGJA 5DP3A 3RXBA 1GJ7B 2LPRA 2RA0A 3ZVBA 3EAJA 3JZ1B 3SN8A 5G4BA 2AMQA 2VINA 1HUTH 1Y5BT 4K5ZA 4OGXA 3SJ9A 3LPRA 5GIBA 3FANA 3SV7A 2WPMS 1GI9B 5A0BA 1HLTH 1IAUA 1FNIA 2J34A 5LPFA 3QX5H 2P94A 1TABE 1TOCB 1BRCE 4E06H 1SQTA 1O5AB 1DWEH 4FU9A 1BBRE 1NN6A 3HK6B 3ATKA 3LGWA 1O2OA 2ODPA 1GG6C 4UFFH 1DS2E 2ZF0H 1ABIH 2BDIA 1VCQA 1EUFA 4GCHF 3UPEA 1MTNB 1UK4A 5I25A 4IBLH 3S9AA 2ZFFH 4WMEA 1SQAA 2O8MA 4ABBA 1AY6H 1T8MA 1AD8H 3FP8E 3M7QA 3SHCH 2QXHA 3URCA 4AFZA 1QNJA 2BYAX 1EB1H 1P09A 1ZHRA 1H1BA 1BJUA 1SGRE 3OY6U 4YT7H 1AIXH 1QBOA 4CR9A 1VGCC 2H5DA 1DWBH 1GBDA 1EAIA 1QRXA 5FXLA 2VIQA 9LPRA 3DFJA 4HZHA 1GBCA 2O9QA 3BEIB 1P2QA 4TWYA 1GDNA 3QZQA 1O2RA 3MO6A 1GHZA 1RTLA 1QB1A 3A88A 1WV7H 1W8BH 2J9NA 3A85A 5DJ7A 1NU7B 2HRVA 2A5AA 2O8TA 3T5FH 4YLUA 1D6WA 4MNVA 1SGDE 2FI4E 1N8OB 2Z94A 1OWDA 5IYTA 3RU4T 3MU1A 1UMAH 4YOIA 3TNSA 6CHAC 1H8DH 1V2KT 1BB0B 3NCLA 3TH4H 1O30A 1TA2A 2F91A 3F9GA 3RM0H 1TWXB 3UNRA 1KXBA 2STAE 1K1IA 4Y8YA 5A8ZA 4O3TA 3SI4H 2AGIX 3ZZ7A 4AYVB 4ZKSU 1KYNA 3S9BA 1HBTH 1F0TA 1ZMJA 2ZQ2A 5C1XA 4E7RG 5ESBA 1YPJH 2NU2E 5JBTA 1CT0E 1TLDA 4NZLA 1ZMNA 4NIWA 1LPGB 1SPJA 2PR3A 3FP7E 8ESTE 2OXSA 2G4UA 1Z1IA 1O3HA 2TPIZ 5DPAA 3ZYDA 3BTDE 3WY8A 2Z9JA 1SGQE 1TPAE 3SNCA 3T27A 1F0UA 1LPKB 3GOVB 2DUCA 3GY2A 4GSOA 1DE7H 3A83A 1CA0B 2A7JA 1ORFA 3RXLA 1ANEA 1GBMA 2ZU5A 4BAOB 5AFYH 3GY8A 4ZAEA 2H6MA 1PPEE 1FUJA 2GZ9A 1VITG 3AASA 1GJ5H 3RXRA 1XUIA 1Z6JH 4K1SA 2EC9H 2J94A 1UK2A 4A92A 2NU4E 1ZPBA 1FXYA 4I8JA 1VCWA 4H4FA 2ZU1A 4AFQA 1MQ5A 4MPVA 4PROA 3ITIA 2BD2A 3P92A 1ETRH 1N8OC 4DJZB 3R3GB 2W3KA 1P9SA 1RRKA 3EGKH 4NIXA 2BLVA 1QJ7B 2HVXA 4UDWH 3RXTA 1EPTA 4B73A 1W10U 1LDTT 1EAXA 3FAOA 3U69H 2C8WB 3V7TA 3GICB 1D3QB 1SGPE 3QTVH 4X2XA 3A80A 1GJ4H 1S0RA 2XWAA 2BOHB 1SGYE 2VJ1A 1MTWA 4GHTA 5GXPA 1LQEA 2ZEBA 3VXEH 2P16A 4WY3A 5FHTA 2FOFA 1NFYA 1HYLA 1MZAA 3SORA 1UCYK 1FY8E 1G3CA 2ZECA 4HTCH 1JWTA 3FZDA 1O2TA 2BD3A 4LXBH 3UREA 2VH0A 1GGDC 4MLFB 3BTEE 1HXFH 1LTOA 3M5LA 1UVTH 1QL7A 2HWLB 1YPLH 4HFPB 1FQ3A 2A45B 3KL6A 1J15A 2AS9A 1EAUA 1V2MT 1WAYB 2VB0A 1CT4E 1D3PB 1ANCA 3QN7A 2WPKS 1D9IA 1A3BH 2Z7FE 3BTHE 4K2YA 2G51A 1A0LA 1THRH 1C5WB 2ANMH 2I6SA 4U2WA 4Y0YE 4AFSA 2VWOA 1XUJA 5GCHG 4DY7B 3EE0B 1FAKH 2RG3A 1GHYH 3I78A 1ZOMA 2FODA 1QRWA 2R9PA 1GBFA 2ZHQH 4FUFA 2ZFSA 2AMDA 3HKIB 3A7ZA 4KTCA 4WH8A 5EGMA 2VWLA 5A0CA 2BMGB 2FI5E 1ZJDA 3K6YA 3SV6A 6GCHG 5AF9H 1AGJA 1QGFA 1T4UH 1TX8A 1JBUH 1OKXA 3T25A 2BLWA 2A31A 3VXFH 1PPZA 3TK5A 2C8XB 5E2PA 1ACBE 2P8OC 3K65B 1GI2A 3LDXH 1DM4B 1SLVB 1A5GH 1HAXB 1YPGH 3MH4A 1YYY1 2NWNA 1LCYA 3T26A 3S0NA 2Z9LA 1K1PA 3MMGA 4O9VA 3VFEA 2AERH 1DVAH 3H7TA 1ELFA 1RXPA 1OWKA 3M3SA 1DFPA 1LVYA 1MH0A 1QFKH 2EI7A 1NRSH 1G37A 1K1LA 1AZ8A 2Z3DA 3VB4A 1E34B 1S6FA 1GMHG 1IQEA 1C1TA 2BQWB 1TRMA 2CN0H 1CHOF 4CREA 2ZKSA 1L4DA 1YCPM 2B9LA 4FVBA 2WPIS 1A0JA 1O35A 1TRYA 4JYUH 1SGCA 1GHWH 4THNH 4NZQA 1CA0C 1P3CA 5DO4H 3BV9B 1MKXH 2PSXA 1GI6A 1HJ8A 1P2IA 4E7NA 1SB1H 1P8VC 1QJ1B 2SGPE 4Q80A 1AFQC 1Z8JB 2OTVA 2ZDLA 5FX6A 1GBKA 2FXRA 2GTBA 4AZ2B 1C5VA 4O03A 1EP5A 2BD8A 1V3XA 1OYQA 3STJA 3LOXA 1O5FH 1WTHD 3QO6A 1BQYA 1S83A 3G01A 3U1IB 1VGCB 2ZC9H 2ZU2A 2D26C 2XTTB 2G5VA 3PWBA 1JRTA 1FN8A 2VVCA 3AW1A 4B2AA 1B0EA 1FAXA 1ZR0A 2FWWA 4SGAE 4I8LA 3W94A 1SG8B 3KEEA 1TPOA 7LPRA 2VWNA 4XE4A 5JBBS 4GUXA 1O2JA 1DY8A 2CJIA 1JMOH 3Q00A 1L1JA 4CRAA 3TIUA 1O2LA 3H5CB 3PLKA 1IOEA 1GI4A 2VIVA 3KCGH 2A7HA 2G8TA 4WVPE 3S69A 1DANH 4NA7A 4I31A 2V0BA 3E6PH 1P02A 1MQ6A 1HRTH 2SGDE 4BXSA 2CHAB 1K2I1 1OP0A 1GI7B 1AMHA 1BTWA 1CO7E 1C5TA 3P6ZB 2FO9A 1NO9H 2PFEA 3GCOA 1THPB 3DD2H 1C5UA 3BF6H 1GHVH 2YNBA 3RMNH 1EX3A 3SV2H 1QB9A 1QA7A 3RMOH 2ZU4A 2BLQA 2FESH 2PGBB 3T29A 4CHAC 1NFUA 1GL1A 1D3TB 4IC6A 3M3TA 1V2NT 1W12U 4ZXYH 1TQ7B 1F5RA 3VB3A 3TNTA 5JPMH 2ZG0H 1UTJA 1LKBA 2XCNA 2Y81A 1GBAA 2GDEH 4OS7A 4FVDA 1YGCH 2A2QH 4DT7B 4UFGH 3DUXH 1QCPA 4BTUB 1SQOA 3Q3YA 4X1NU 3BSQA 3SHAH 3ZZ6A 3D49H 3ATWA 5JDUB 4OS4A 1O2ZA 2FPZA 2WV5A 1HDTH 2H1UA 1LHGH 3CS7A 1AKSA 1W0ZU 1O31A 4WXVA 1GI1A 2AH4X 3F1SB 2GZ8A 2EI8A 4CH2B 1S0QA 1F7ZA 1KLIH 1QL8A 4O3UA 1W2KH 4AX9H 3NWUA 1F0RA 1TX7A 3UNSA 3KQDA 3LONA 1VR1H 3RXSA 2ZPRA 1O2IA 4NSYA 2XW9A 3A82A 2CV3A 1SGEE 2BY7X 2ZGCA 2JETB 1L1GA 2OLGA 1TYNA 1RTKA 1W14U 1P2KA 1AWFH 1DXPA 4RSPA 2BY6X 3LC3A 3DT0H 1LMWB 2F3CE 2BDYA 4X1SU 3ZVGA 1WU1A 2PUXB 2Y7ZA 3MO9A 4BXWA 2ZWLH 1OWHA 1QHRB 3I29A 1UK3A 1N1LA 4X1QU 2UUJB 3SNEA 1O5GH 3JZ2B 4U01A 2BXTH 1W7GH 4JZEH 2ZHFH 2C4FH 1O3JA 1MCTA 3SUGA 3I77A 1MTVA 1C5QA 1C1SA 2BD5A 5FBEA 3GCTG 2JH6D 4NSVA 2ZTXA 1P10A 2Z9IA 3PM3A 1ZPCA 3P8OA 1IQHA 2BVSH 2Z9GA 3TH3H 1AFQB 1Y3WA 2O8LA 3MU8A 2FDAA 1C5PA 3KN2A 3UUZA 1SGIB 1T8OA 2GDDA 2OQUA 1C5XB 4ESTE 2WPHS 1ZZZA 1GJCB 4X6MA 3TK6A 1Y5UT 2OBQA 1OP2A 3Q3KA 1GI8B 3RXUA 3ZZ4A 4BNRA 1NZQH 2FMJA 2UWPA 1YLDA 3QGNB 3SW2B 2OC8A 1F0SA 5F6MA 5EODA 3RXFA 2XNIA 1BITA 1KTSB 2Z9KA 2H9TH 1KLJH 4YOJA 4MPWA 4NFFA 4NWKA 4A7IB 2IN2A 1Y8TA 4UONA 1H9IE 4ABJA 1C2IA 3SNDA 5FAHA