3H7TA

Crystal structure of scabies mite inactivated protease paralogue s-d1 (smipp-s-d1)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
235
structure length
235
Chain Sequence
IIGGKKSDITKEPWAVGVLVDEKPFCGGSILTANFVITAAQCVDGTKPSDISIHYGSSYRTTKGTSVMAKKIYIVRYHPLTMQNNYAVIETEMPIKLDDKTTKKIELPSLLYDPEPDTSVLVSGWGSTNFKSLEYSGDLMEANFTVVDRKSCEEQYKQIEADKYIYDGVFCAGGEYDETYIGYGDAGDPAVQNGTLVGVASYISSMPSEFPSVFLRVGYYVLDIKDIISGKVKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Group 3 allergen SMIPP-S YvT004A06
publication title Structural mechanisms of inactivation in scabies mite serine protease paralogues.
pubmed doi rcsb
source organism Sarcoptes scabiei type hominis
total genus 59
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3h7tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3h7tA01
1LVBA 1UTNA 1TGCA 4IC6A 1F5KU 1VJAU 3DFJA 4MQAA 1P2OA 2LPRA 4MG3A 1PQ5A 1O2ZA 2GD4B 1YKTA 1TAWA 1YF4A 2ZCHP 4R8TB 4FU7A 2AGEX 1MKWH 2WYGA 4X1SU 4X0WU 3A82A 2NU1E 3ZZ7A 3M5OA 1NO9H 3ENSB 1EZUC 1TA2A 3MNXA 3I29A 2AMDA 3ATWA 4O3UA 1BTHH 1O2YA 4OS4A 6CHAB 2F9OA 1SGEE 1P3CA 1T8OA 5LPRA 3KHVA 3NK8A 1WYKA 3JZ2B 2OBQA 2SFAA 4WXVA 3RXBA 3BG8A 2W3IA 1ACBE 5LGOA 4KTCA 1PYTC 1O3GA 5IDKA 1JRSA 1YPHC 1HAIH 3AAVA 1GBCA 1S6FA 3MNSA 2H2ZA 3SNBA 2Y5GA 1QBNA 1SOTA 4MNWA 1PPBH 4KTSA 3S7KB 2ANWA 1QBVH 2Y5HA 1P9UA 5DG6A 3F9FA 1U6QA 3FP8E 2ZEBA 2TGPZ 4JK5A 3RXUA 2Z9JA 3LPRA 1E34B 3T27A 5C67A 1YC0A 1SFIA 1J8AA 1C5NH 3K2UA 1O2NA 3PV4A 4GLYA 6CHAC 4MPUA 1SGFG 1AE5A 1GVKB 1O3MA 4RSPA 4XBCA 2XC0A 1V2TT 5CE1A 1EXFA 1UMAH 2FX6A 1K1OA 4J2YB 1OSSA 1C5RA 1DPOA 1O2MA 2A45B 3SU1A 1ELDE 1VCQA 1GHWH 1QQUA 8ESTE 1O5EH 2VIWA 2Z3CA 1DWDH 5EXNA 4X6OA 4AGJA 1E36B 1XKAC 5GXPA 2F9BH 5T6DA 3DD2H 1O3LA 1ZTKA 1MAYA 4AN7A 1DVAH 1T8LA 3ZZDA 2AS9A 4E06H 5A09A 1TB6H 3V3MA 5FCKA 2PR3A 2BZAA 4MPXA 4TPYA 2OBOA 2H5CA 3RC6A 1AVWA 1W2KH 3KEEA 4ABJA 2ZPQA 3L33A 1GBFA 1GHXH 3O8DA 2O8UA 1TPSA 5GJ4B 3CS7A 1C1UH 2ALPA 1ZTJA 2VWNA 3A89A 3Q77A 1KXEA 1ZMNA 1NESE 5EQRA 1ZZZA 3QX5H 3QDZB 1AVXA 1HJAB 5DK1A 2C4FH 2HRVA 3QZQA 1NY22 1WBGB 1WOFA 3GCHB 4U30A 1G3DA 2FTMA 2J94A 2BD5A 4NWKA 4GAWA 2HVXA 3BEUA 3NPSA 2ZDAH 1HFDA 3RXCA 2FOCA 1UCYK 2WPIS 5GDSH 3ZZCA 2WUBA 4LOYH 2R0KA 1DY9A 1EZSC 1A3BH 1HIAA 2VIPA 3TH3H 2Q6DA 2GT7A 1H1BA 3RU4E 3UREA 3LH3A 4AGKA 1OWIA 3NWUA 2FOFA 1TGBA 1TPOA 2BD3A 1O5CB 1PPGE 2A5KA 1SGNE 1HJAC 1QR3E 4X2YA 3NUMA 4NG9H 2P93A 2BYAX 2VU8E 3GCHC 4AZ2B 3GCOA 2ZDNA 1GI5A 1KIGH 1GMHG 4Q7YA 4A1VA 2Y82A 1FMGA 1HNEE 4WMDA 2RA3A 1FONA 3T28A 2FI3E 3BN9A 3SUDA 1V2MT 1IQMA 1V2LT 1KXDA 3QGJA 2DE9A 1VCWA 1GMCG 2KAIA 5FBEA 6LPRA 1W11U 2ZI2H 3A81A 2OC1A 1FAKH 3BTDE 2XCFA 1MCTA 1AVGH 1IQIA 1SGCA 1OWEA 1GPZA 1TONA 4B76A 1CGIE 3HPTB 5C1XA 2F9UA 1XVMA 3SNCA 2ALVA 2BY9X 1MBQA 5FPSA 2JKHA 3ZZ9A 1WSSH 3ZV9A 4Y71A 2PKSB 1XMNB 5EXMA 1GBTA 1HAHH 1MZDA 3URCA 1IQJA 2A32A 1GI8B 2DUCA 1A0HB 4FVBA 2J34A 1QFKH 2CHAB 2UUJB 4DOQA 4I8KA 1UO6A 1KSNA 1IQGA 2Q6FA 4DGJA 2FOHA 2O8MA 3FVFB 3KL6A 5E0HA 1QY6A 1KLIH 1CBWB 1Y8TA 3Q3KA 5J4QA 1BTZA 1XUGA 2EEKA 1S5SA 4YESB 3TK6A 8LPRA 3BEIB 1K9OE 1O5GH 3ZZ3A 2O8TA 2ZGHA 1AQ7A 1C9PA 5L30H 3GY4A 2UUYA 3RC4A 1GHAG 3EAJA 3UQOA 1DT2A 4UD9H 3TGKE 4B71A 3H5CB 1ZOMA 2HOBA 3HKIB 5E8EH 2D8WA 3AVZA 4O9VA 2PHBA 5GCHF 3TGIE 4K1EA 3DFLA 4INHA 2VWMA 4X1NU 1WAYB 4OS7A 2SGFE 2CHAC 5E0JA 1ZLRA 2WV5A 5AVDA 1YCPH 1ZHRA 2ZGBH 3BTEE 3MU1A 2Z9LA 1SHHB 1SGYE 1VITF 5F03A 1GI6A 1FPCH 1BTPA 5F8ZA 2BLQA 3S7HB 1UTJA 1A61H 2F9NA 3SU3A 1HAGE 4ESTE 1NRSH 1CBWC 3S9CA 3LT3A 1O37A 2OXSA 2TIOA 2JH0D 3GY6A 3A86A 3A8BA 1E0FD 2F83A 1ZGIA 2NU0E 2PWXA 2GMTB 2XC5A 5C1UA 3ZV8A 4NZQA 1GVLA 1F5LA 2RCEA 1AE8H 1AD8H 4INKA 1GBKA 4M7GA 3RLYH 3F6UH 1O3FA 4D9RA 4CRAA 1C2HA 1HUTH 3SJIA 4NIXA 2WPJS 1TNGA 3EE0B 1MKXH 5FX6A 2BQ6B 4IN2A 1A1RA 1IQLA 1DICA 1ESBA 4CBOA 5JBTA 1HIAB 2IOTA 1L4ZA 1GJ7B 1O0DH 1CGHA 4Y6DA 2ZU2A 1AHTH 1FN6A 1V2VT 4ZROA 1SGTA 1K21H 1HCGA 1KXCA 3P8NA 2BX4A 3LGIA 3SNEA 1AWFH 1SGRE 1ELCA 1JWTA 1Y3XA 1G3EA 2A31A 4NWLA 3K6ZA 2BHGA 1NFUA 3UUZA 2GMTC 4U01A 2ESTE 4MPWA 1KXAA 4U2WA 1KDQA 1ZPZA 3FZZA 3BTHE 1RXPA 3SU6A 3QN7A 2HNTF 2IN2A 3A80A 2WYJA 3U1JB 1THPB 4GVUA 2BXTH 4UFGH 2FTLE 5F6MA 2C3SA 1DANH 1TALA 3SGBE 1GBJA 4RN6A 1SGIB 3LGWA 4IMQA 3M61U 2HWLB 3OU0A 2J92A 1SQOA 3R3GB 4ZHAA 4DY7B 3VB7A 1MD8A 2HNTE 1O2VA 3DT0H 3SU2A 4YLUA 1AKSA 1P06A 5EU8A 1GHBG 1OX1A 1MTSA 1D9IA 1C5YB 1VJ9U 1D3QB 3OTJE 4WVPE 3GYMA 3Q00A 1UTKA 2ZO3H 1HV7A 2EI7A 5FBIA 3M35A 4X1PU 3E1XB 1YPJH 3TVJB 8GCHF 2ZFFH 1A46H 1WQSA 2CXVA 2NU4E 1PQ8A 3E0PB 1ZYOA 2P8OB 4NA7A 3TITA 1EP6A 1L1NA 2TBSA 5FPTA 1GI9B 4X8SH 3MWIU 1O34A 1C1VH 1CHOG 3ZVFA 2I6QA 1CSOE 2ZF0H 1P57B 2FOEA 4NA9H 3LKWA 3VXFH 1L2EA 3MH6A 4K60A 1L1GA 1PPZA 4WXIA 1P2IA 2A5IA 1AUTC 1WCZA 2GCHG 2F91A 1TABE 4ZXXH 2G51A 1P12E 1MZAA 1EUFA 4D8NA 3OSYA 3BV9B 1OP2A 2F3CE 3ZYDA 2NWNA 3SZNA 2QXGA 1MMJN 1TNLA 3MMGA 3B8JA 4DG4A 1DLKB 3LDXH 2P8OC 1BA8B 4B2AA 2GKVE 1ORFA 4YZUA 1MTNB 1G3BA 2GV7A 2FODA 2XXLA 5BPEA 1LCYA 2VWOA 2G8TA 3FZDA 1TMUH 1BRAA 3BSQA 3SQHE 7GCHF 1H4WA 3G01A 2QC2A 3DHKH 5LPFA 2OCVB 1CGJE 1S85A 4Y8XA 4FUHA 1C5VA 4ISHH 3RXJA 4NA8A 5JYIA 3LH1A 1BIOA 5FX5A 4K69A 1JMOH 4ZKNU 2JETB 1WQVH 4ABEA 5DPAA 3KF2A 1ETTH 4XDEA 1H8IH 2QXHA 5C5OA 2BM2A 4AOQA 1BTUA 3SV7A 2AMQA 1EPTB 1HXEH 1V2UT 4BAHB 2VIDA 1O3JA 2Q6GA 1FN8A 1UVUH 3Q3XA 2UUFB 5EPYA 4ZKRU 4ABFA 1T4VH 1SPJA 1TRNA 1MTNC 2QAAA 1SQTA 3D49H 2A1DB 1W8BH 2AMPA 1TNIA 1KDQB 2FEQH 1O2KA 1SSXA 2BX3A 1CVWH 1SI5H 5DP6A 1BBRK 3TIUA 1O5BB 1BMNH 1BTYA 2XBXA 2ZGCA 3BTME 4U32A 2ZHQH 2QIQA 3BF6H 5A0AE 3ZZ6A 4ZH8A 4GHTA 1UK3A 4X6PA 2XCNA 2BLWA 5E2OA 4YOIA 2QCYA 2BD2A 3E91A 2FZZA 3PTBA 2ANKH 1QL8A 2ZHWH 2V3OH 1EPTC 1LTOA 2Z9IA 2Z9KA 3A7ZA 4B2CA 1GBDA 3FFGA 2P94A 5EGMA 2RG3A 3SW2B 3T26A 1A2CH 4UONA 2ZTYA 4YOJA 1SR5C 2ZFPH 4KELA 1EZXC 5HGGA 1THRH 4GCHF 3UOPA 4AFSA 4CR9A 4BAKB 1IQNA 4ZUHA 3F9GA 4D76A 3E6PH 1FPHH 1XUFA 1VITH 3S9AA 1TBZH 4A7IB 4CH8B 1BRBE 1GJDB 2ZHDA 4H42U 1INCA 3P8OA 2R2MB 3NZIA 1F0UA 1GG6B 1DX5M 1Z8RA 1V6DA 1EAUA 1C5UA 1KXFA 4UEHH 1GJCB 2F9PA 3VB6A 3U98H 1HAXB 2BD4A 1EOLA 2CV3A 3RXQA 3U69H 3Q76A 1CO7E 1MQ5A 2UUKB 5E2PA 1DDJA 1MU6B 4IN1A 2BOHB 3SJOA 1IHSH 3GCTG 1HYLA 2ZIQH 3M3VA 2Y81A 1K1MA 1O3EA 2BDGA 2VIOA 2B9LA 1YPMH 2CF9H 1GMDG 1TOMH 1UTMA 1HJ8A 1C5SA 4WH8A 4I8LA 2FOMB 3A7VA 4B75A 2BDCA 1QNJA 3TJVA 2ZNKH 1GG6C 4BXSA 5EQQA 3GCNA 5T6GA 1BCUH 1TMBH 3O8BA 5EW2H 1NZQH 3C27B 3U1IB 3BTGE 4NIYA 1C1QA 3PMJA 1FY4A 2GZ8A 1C2LA 1O2XA 5I46H 2AGIX 2VB0A 5DP5A 1D6RA 1UTLM 1QURH 3RXMA 4AG2A 3CS0A 1T7CA 2BQ7B 1OWKA 1O2LA 1GCTB 1EOJA 4Q2KA 1SLVB 1YGCH 1OOKB 1WU1A 2ASUB 2BOKA 1LHGH 4OS1A 2OC0A 3MYWA 2FESH 1Q31A 1ANDA 1LPZB 3IWMA 1TX8A 4LZ1H 2A2QH 5JBAS 3P6ZB 2BMGB 1P9SA 3B9FH 3ZZAA 5AFZH 3A88A 1CU1A 1C1TA 3EDXB 4KKDA 3ZZ8A 1TFXA 3TU7H 1S0RA 3PYHA 1GBLA 1O3OA 3HK6B 2VINA 4Q7XA 1RGQA 1FY1A 3UNSA 1MUEB 1F0TA 2ZZUH 2QF3A 3RXPA 2K1QA 5AHGH 1HAYB 1NFXA 2ZGJA 4NFEA 1NFWA 1G32B 4X8TH 3T25A 3TJUA 1DE7H 1MQ6A 2D1JA 3RXSA 3MO6A 4F49A 3MNCA 1A4WH 1GCTC 1ETRH 1O33A 3RXDA 2FOBA 4AB9A 1ZSJA 3ELAH 2ZU1A 4NSVA 4GHQA 1P03A 1D6WA 1SLUB 3UQVA 1DOJA 3A8AA 4AYYB 4NIVA 2GDEH 2VIQA 1YPGH 2ZDLA 1FLEE 1PPEE 5DGJA 3NXPA 4AFUA 1M9UA 1EJNA 1W12U 1AFQB 1QRWA 1PQAA 3HATH 1LQEA 1YPLH 1MH0A 3M5LA 1A3EH 1GJ8B 4GPGA 1G2MA 1F2SE 1O3BA 1K22H 3A7WA 2PSYA 1XM1A 1SFQB 3PMHB 2GX4A 1AB9B 3SI3H 1G30B 3SI4H 1IQEA 2W7UA 1QA0A 1AFEH 1PPCE 2PV9B 3F9EA 1TBQH 1HXFH 4FUCA 2HNTC 3LC3A 3PM3A 5K7RA 5AFYH 3O8RA 4A6LA 1C2JA 1BUIA 4A92A 2WUCA 5CHAB 5ETXA 4NZLA 5BRRE 1DWCH 1LHDH 1YCPM 1K28D 1O2QA 4HGCA 4KTUA 4B1TA 2G52A 1P2QA 4IS5A 3IITA 1FV9A 1LHEH 1AFQC 1EZQA 5ESTE 1SGPE 5FAHA 1ELFA 1OP8A 1QHRB 3PROA 5DO4H 2FI4E 3MU4A 7ESTE 1T31A 1C1NA 2G4TA 2Y5FA 4DURA 1Y5BT 4IMZA 1N6XA 1BTWA 1XUIA 4X2WA 1GMHF 3UFAA 3V12A 1AB9C 1TGSZ 4NIWA 4ZKOU 2XW9A 1VR1H 2ZKSA 2ZU5A 1C1WH 3PLKA 1QRZA 2R0LA 1GMCF 2Z9GA 5JB9S 1SOZA 1GL0E 1OYTH 1EKBB 5CHAC 1RS0A 2DE8A 2ZU4A 3ATMA 4JCNA 1KTTB 2FOAA 1CE5A 4JYVH 5DP4A 3FAOA 1ZPBA 3B23B 3RM2H 3UR9A 2EI8A 1YM0A 5A0BA 2BTCE 1AGJA 1SB1H 3RU4T 2FOGA 2AGGX 1C4V2 1D3TB 1NC6A 3M7UA 2BY5X 1DM4B 1ZSLA 1FI8A 1O31A 3SGQE 1OS8A 2BY7X 4Q80A 3LGUA 3RMLH 3RUOA 1GDQA 1ZMJA 1HJ9A 1UVOA 3NCLA 2AEIH 1ABJH 3GDSA 3M5MA 4CRCA 1P2KA 3E3TA 5A2MH 2IJOB 1RRKA 1JIRA 1FY3A 1Y3UA 1SGFA 4Y8YA 1SLXB 1GVZA 4TWWA 4TWYA 1TA6A 1SGDE 1HPGA 3RXGA 4ZMAH 1UVSH 2BB4A 1C5LH 4OS2A 1O30A 1NRNH 1P2NA 4WH6A 1GHAF 1ANCA 2XRCA 4QT8C 5C5NA 4XFQA 1IQKA 1FY8E 3UY9A 1O2PA 4X1QU 1P11E 4ABBA 4INLA 2AYWA 3WY8A 1UCYH 2PKSC 3W95A 2VVVA 5T3HA 1RTLA 1T32A 1JIMA 1N1LA 1KYNA 2OQ5A 4ZHLU 1BJVA 2OC7A 2P3UB 1TIOA 1V2OT 1C1OA 4Y79A 3MH7A 1QB6A 2R3UA 5F8XA 1IOEA 1T8NA 5GPIB 1JBUH 4JZDH 3CENA 8KME2 1UVTH 2CN0H 3S69A 3SOSA 1NS3A 1VGCB 2A4RA 1ELGA 1NFYA 1TNKA 2ZFRH 1TNHA 1W3CA 4X2XA 5TCAA 1PYTD 3QO6A 2FM2A 1GWAA 5SGAE 1W7XH 2G5VA 1P8VC 1UK2A 4RKOB 2TGTA 2PGBB 2HPQH 2BDIA 2J9NA 3F9HA 1GI2A 1QGFA 2CJIA 4I33A 1LKBA 3TNSA 4K8YA 1UTOA 2PFEA 3ATKA 2HALA 1EPTA 2XNIA 2W5EA 1V3XA 1Z6EA 3D23A 1CA0B 3SNDA 3P8FA 5AF9H 1P2MA 2PSXA 4IC5A 3V13A 2O9QA 5EQSA 3TJNA 1BB0B 5G4BA 2H1UA 1VGCC 1A0LA 4GSOA 1QJ7B 2ZDKA 2AFQB 2NU2E 4TYDA 1A5IA 1NTPA 1HGTH 5EPNA 3SJ9A 4XBDA 3SN8A 1XX9A 1C1MA 1O3AA 1N6YA 1AN1E 5A8ZA 2Z3EA 2A4OA 1ANBA 1DUEA 1BQYA 1OYQA 4DIHH 4Y0YE 5HYOA 4JK6A 1O2OA 1DXPA 1K2I1 1ZJDA 3RXHA 2GP9B 4JYUH 2OQUA 3RP2A 1K1PA 2ZCKP 4MNYA 1V2ST 3M3SA 4I32A 5DP8A 2EA3A 5JPMH 1GHBF 1O3NA 1XKBC 3TJOA 1MBMA 2ANMH 1ID5H 5DP9A 4YO9A 1PQ7A 4YOGA 1DXWA 4MNXA 4AFZA 2ZQ1A 2EC9H 3RXVA 2BD8A 2O8WA 4E7NA 1XUJA 2SGPE 4BTIB 2B0FA 4BAMB 2SNVA 1KLJH 2HPPH 1JRTA 4BAQB 1C2MA 1T4UH 1G37A 2BXUH 4JMYA 1V2WT 2YNBA 4B74A 3EYDA 4UE7H 2P16A 1O38A 4Y0ZE 1O3IA 2Z94A 3MH4A 1BRCE 2W7SA 1O2RA 1LHCH 3A83A 1C5OH 4CRGA 2FX4A 2OLGA 1CHOF 3TPIZ 4Y10E 1EAWA 1LPKB 2FLRH 2ZHFH 3IG6B 3SQEE 1DY8A 1LVOA 2H5DA 4AG1A 3C1KA 1ELEE 1CHGA 1GHZA 3FP7E 4SGBE 2XC4A 1P01A 3RXEA 1EB2A 2GCHF 1H9LB 3BIUH 1LVMA 5ABWA 1HAOH 3P70B 1NT1A 4K2YA 3PMBB 3SUEA 4Y7BA 5LH8A 2XYAA 1BMMH 3ZZBA 9ESTA 3MU5A 1B0FA 1TBRH 2RDLA 1QJ1B 4X6MA 1C5PA 2G5NA 1P3EA 1YBWA 1H9HE 2ZGXH 2GZ7A 3TGJE 3SHCH 2CF8H 1SVPA 1OPHB 3MTYA 2OTVA 1OP0A 1V2QT 3LGYA 3GY3A 1RTFB 1ARBA 3SJ8A 3OX7U 3LJJA 3ZVAA 4DCDA 3AW1A 1ESAA 1O3HA 3KNXA 4YTAA 5L2ZH 3QGNB 3QZRA 3GDVA 3MU0A 1TRYA 4SGAE 4AFQA 1TLDA 1FAXA 3T29A 2FWWA 1KTSB 5HM9A 1O2JA 1MTUA 2ZTXA 2ZDVH 2VVUA 3K9XB 1BHXF 3S0NA 2ODYB 2BDBA 3U8OH 1GGDB 5LPEA 2G00A 1LHFH 4CRFA 3GY8A 4CREA 1EX3A 1L4DA 1HAPH 2H9EH 3U8RH 1E38B 3RXRA 2ZTZA 1TE0A 2UWPA 2ZFQH 3ZZ4A 2OD3B 4OS5A 4WF8A 4ABIA 3SV9A 3M7TA 1MKWK 4WMEA 1SG8B 2GV6A 1A5GH 2H9HA 2OP9A 3D62A 4O03A 3SORA 3A87A 3RXIA 3VGCB 3I77A 2BQWB 4KP0A 1PPFE 1QA7A 3A7XA 1C2IA 1J15A 4I7YH 4OGYA 1C2DA 2VH0A 1PFXC 4THNH 2ZQ2A 3GY5A 1UK4A 3RXTA 2FDAA 1GCDA 1NU7B 1UHBA 4LK4A 2AH4X 5HM2A 2WPHS 1O2HA 1G36A 1GGDC 1LQDB 2JETC 2BZ6H 2FO9A 1L1JA 2R3YA 1RFNA 3D65E 3VB4A 1A7SA 3UIRA 3H7TA 4K5ZA 3A7YA 2VH6A 3P8GA 3CP7A 1QIXB 2VIVA 2FS8A 1O2SA 4CBNA 2J38A 1WUNH 2J4IA 4I8HA 1QRXA 2M5TA 3HKJB 2FYQA 4TPIZ 3VGCC 4K3JA 1C2GA 3M3TA 1MD7A 3P17H 1CT0E 3PMAB 4DT7B 1MU8B 1JOUB 2VJ1A 4AB8A 3UR6A 1K1LA 1ZR0A 5C1YA 4F4OC 2OC8A 1O2UA 2QV1A 1P10A 5JB8S 2UWLA 3QWCH 2FMJA 2A0QB 4ASHA 3KQBA 1GI0A 1GL1A 3LOXA 2A4QA 1O3PB 2ZP0H 5GWZA 3QUMP 2GGVB 3RXAA 2VVCA 3E90B 1ZRBA 1J9CH 1E35B 3ITIA 3MH5A 3S9BA 1SBWA 1AIXH 3A85A 1AY6H 3MI4A 1EP5A 2TGDA 4FU9A 1ANEA 1GBIA 1Z1JA 3T5FH 2JH6D 1KLTA 5CMXH 1QB1A 4MVNA 3MO3A 2Y7ZA 4MNVA 3GCTF 2H6MA 1UCYE 1EQ9A 3M5NA 4ZAEA 4DJZB 1L0ZA 2H9TH 2TGAA 2XBYA 2ZU3A 3A7TA 2PW8H 3BTQE 3L3TA 5PTPA 1EB1H 2SNWA 2A5AA 1TNJA 5JBCS 2P95A 4BTUB 3ZVGA 3PB1E 1C5QA 1GMDF 3VPKA 1ELBA 3GDUA 1HAVB 2A7JA 2XWBI 4H4FA 1IHTH 1Z7KA 1YP9A 4FUFA 3ZVDA 4YM9A 2FI5E 1HLTH 2VGCB 3K6YA 1VCPA 3F68H 4WY3A 1GJ5H 2C8WB 3UNRA 4HTCH 4OGXA 1BBRH 1QQ4A 3KQCA 4BTTB 1TX7A 1MTWA 1V2PT 4CHAB 2QY0B 3TH2H 1O3CA 1C4Y2 3VFEA 3W94A 1A5HA 1SC8U 4A1XA 1AU8A 2GVFA 5A0CA 3HGNA 1DSTA 1HRTH 2IPHA 3UPEA 4JZFH 3A8CA 3H7OA 5TJXA 2GDDA 3BTWE 1P09A 1AMHA 4I31A 2PKAB 3KN2A 3ZVEA 3OY6U 4UFEH 1QTFA 1K1NA 1C2KA 1C1RA 1PJPA 1TPPA 1P04A 1NRQH 4BANB 1DITH 2VGCC 3PWCA 2PTCE 3STIA 1MAXA 5I25A 4YT6H 3U8TH 1B7XB 1C5XB 3EA7A 1FXYA 1ZRKA 1VZQH 3OYPA 2W26A 4K1TA 1G3CA 5FHTA 1GBAA 4CHAC 5E0GA 2ZCLP 1C1SA 1AWHB 1UHBB 1T8MA 1OWHA 3GY7A 4ABAA 3MOCA 4X2VA 5DP3A 3ATIA 3GYLB 3V0XA 1EJAA 5JDUB 2A2XH 4O97A 5K0HA 1J17T 3UNQA 2ILNA 1LDTT 2R9PA 1BJUA 1CT2E 1XVOA 3BTKE 2GT8A 3GICB 2WPKS 4H6SB 5C2ZA 3E8LA 1XUHA 2C90B 1NRPH 1RJXB 3EQ0H 1Z6JH 9LPRA 1BDAA 5IYTA 1ELTA 4D9QA 1EASA 1QL9A 1LKAA 4UDWH 3TLOA 1TPAE 1GI7B 4FUBA 1S84A 1ZPCA 1FUJA 5C3NA 1Z8JB 4ZHMU 1O3DA 3QTOH 1EATA 1DLEA 3BTTE 5DKMA 4D7FA 5J4SA 1Z8IB 2QYIA 2BDHA 4DIIH 2FP7B 1A0JA 2A7HA 1YLDA 1KXBA 1HAZB 4E7RG 3O8CA 2QF0A 5L6NH 2C8ZB 1Y59T 1C4U2 3LONA 2ZC9H 1FNIA 5ESBA 2VNTA 1GJAB 1O2GH 4B73A 4ZKSU 4WJG2 2XBVA 4PROA 3LU9B 4AYVB 3ZVCA 2FPZA 4ABDA 2GZ9A 2BD7A 4IBLH 3M37A 2XBWA 4FUJA 2BD9A 2Z3DA 1LMWB 2PTNA 4X1RU 5JBBS 1C2FA 4ISNA 5HXFA 1AZZA 1S82A 1S81A 4LZ4B 3P92A 5FPYA 4Z6AH 2D26C 4O3TA 1GI4A 1YCPK 4X8VH 3TK9A 1UTPA 5A8XA 1CA8B 3GOVB 3BEFB 3PLPA 1ABIH 1P0SH 4NGAH 2Y6TA 1C5MD 1Y3VA 2HLCA 2QXJA 3LGTA 4XSKU 2C8YB 3UOUA 5DJ7A 2WPLS 1MCVA 2BVRH 1DSUA 3MFJA 4FUGA 2B5TB 4XE4A 1O36A 2Y80A 2VWLA 2I6SA 2V6NA 4MLFB 4WMFA 2C93B 4Y8ZA 2ODPA 3F1SB 3RU4D 1O5DH 1H8DH 3SU4A 1QBOA 3EA9A 2GCTB 4TY7A 1YPKH 2XTTB 1GI1A 1QB9A 3BG4B 1MKXK 3AAUA 4FUDA 6ESTA 3T62A 1J16A 4J1YA 4UFFH 1BHXB 4MPVA 1ZSKA 1ARCA 2NU3E 2B8OH 4I8GA 3PLBA 3AW0A 2LNCA 1K1IA 4A1TA 3RMNH 1H9IE 2RA0A 2V3HH 4CH2B 1KY9A 4LXBH 4K1SA 1FDPA 1GJ6A 2Z6BD 1RIWB 3SNAA 2ODQA 1K1JA 3PO1B 3M36A 1O32A 3KCGH 3ZZ5A 4GUXA 4FXGH 2XWAA 2ZECA 2WPMS 4HI3A 1O2WA 3VXEH 4NFFA 3PTNA 3SJKA 4HZHA 3DA9B 2GCTC 3QLPH 1EAXA 2J2UA 5FXLA 3RMMH 3BG4C 2STAE 1W0ZU 3SGAE 1C2EA 3VB5A 1JXPA 2ZFSA 5EW1H 2SGQE 1BMLA 1Z1IA 1ZJKA 3TK5A 2WV4A 4BOHA 2ZWLH 5F8TA 2Z7FE 2TPIZ 1NM6A 2C8XB 1UTQA 1YPHE 3SHAH 2OUAA 4D7GA 1OWDA 5GCHG 2THFB 1ESTA 1AI8H 3T2NA 1GHYH 1RIWC 4ABHA 3R0FA 3PO1C 1Y5AT 4R0IA 1ZHPA 1VITG 1F7ZA 3STJA 1FQ3A 3GY2A 4HFPB 2BY8X 1C9TA 1DFPA 2AERH 1TGTA 4DW2U 3OY5U 3UWJH 1BITA 2B7DH 3LIWA 3RXFA 3RM0H 1NRRH 1Y5UT 3A84A 5EXLA 4CRDA 1V2KT 1S83A 3N7OA 3QK1A 1GBHA 3UTUH 4YLQH 4BNRA 4A5TS 3ODFA 4Y7AA 1XXFA 1YLCA 2PUQH 2CMYA 1UJ1A 1WV7H 1ZMLA 2OINA 2CGAA 4FUEA 1AUJA 1HBTH 2Y7XA 4ZXYH 1GBBA 1TQ7B 1W10U 3E0NB 1O3KA 3URDA 1SLWB 4CR5A 4JZIA 1FY5A 4IGDA 3RC5A 4CRBA 2BDAA 2V35A 2P59A 3RLWH 1GBEA 3SV6A 3M7QA 4VGCB 1SHYA 1ZTLA 1G2LA 5TCCA 3LC5A 3NKKA 3RXLA 2P3TB 1BBRE 3FANA 3KGPA 1N8OB 3ESTA 2ULLA 3LJOA 5DP7A 1Z8GA 1CA0C 2KAIB 1O5AB 1W7GH 2AIQA 1F0SA 2FYRA 4IW4E 4I8JA 2HGTH 3SU0A 5FCRA 3JZ1B 1IQFA 2ZFTA 1TOCB 2D2DA 2G4UA 4YT7H 1J14A 3P95A 2YOLA 5HMAA 4FU8A 3SUFA 4AORA 1RD3B 2W3KA 2ZDMA 4RKJB 2O8LA 4B2BA 1QJ6B 4NSYA 4JZEH 4H6TA 5EOKA 4VGCC 4NCYA 1V2JT 4JZ1A 2BVXH 3SV2H 3SUGA 1YPEH 2A7CA 3SBKA 4MTBA 7KMEH 1Z71A 8GCHG 3L6PA 1D3PB 4XBBA 2V0BA 1Q3XA 1O2IA 1NPMA 3DUXH 1N8OC 1ELAA 2UWOA 1S6HA 3A8DA 1AZ8A 2AIPA 4DVAU 3K65B 1DUAA 2EI6A 2F9VA 2BLOA 1C5TA 4TY6A 1P05A 4Q7ZA 2QN5T 1GJ4H 1S0QA 1O35A 1GDUA 1V2RT 3TH4H 1BTXA 2QGRA 4FVDA 1GJBB 1PPHE 3SO3A 1TGNA 2G81E 1SGQE 1HAVA 3MO9A 1D4PB 1THSH 4E05H 1LO6A 2SGAA 2ZG0H 5A8YA 1B0EA 1SQAA 3HK3B 3VEQB 2ZHEH 1CQQA 1ETSH 1HDTH 1C1PA 1SL3A 3VB3A 2FLBH 1LPGB 1F92A 1BOQA 2PLXA 1F5RA 4MDSA 1OXGA 1NROH 1LVYA 2JH5D 3V7TA 1X7AC 2ZPRA 1WTGH 1DWEH 1E37B 2PGQB 1OKXA 2A4GA 1UVPA 1Y3YA 2SGDE 5GIBA 4Y76A 4BAOB 3EA8A 1Y3WA 4BXWA 1BRUP 6GCHG 3FP6E 5C20A 1NU9A 1TX6A 2G55A 6GCHF 1FIZA 5T6FA 4JYTA 1IAUA 7GCHG 2FXRA 4XOJA 1G9IE 4OS6A 3KQEA 1ZHMA 2P3FH 2PKAA 4X8UH 3BTFE 5EG4A 3SU5A 1XUKA 2TRMA 1ELVA 4FUIA 1O5FH 1C5ZB 1W13U 1B5GH 2BY6X 3KIDU 1CT4E 2ANYA 3QTVH 1WTHD 1BZXE 4ABGA 5B6OA 2J95A 1YYY1 1FZZA 3GISB 3UWIA 4UFDH 3TNTA 4K8BA 1TMTH 1DWBH 1TRMA 5H4IB 1GBMA 4WWYA 1ZGVA 2STBE 3AASA 1F0RA 2Q1JA 3RXOA 3HGPA 5L2YH 2FS9A 2QXIA 7LPRA 1EJMA 2ZPSA 4Z0KA 2R2WU 1BMAA 1O39A 3I78A 2FIRH 2WINI 2BDYA 2PUXB 3SV8A 1P2JA 2YNAA 1RTKA 3EGKH 1GHVH 3ODDA 1HB0B 5EODA 1FIWA 1MTVA 3Q3YA 2GTBA 2ZA5A 1DS2E 1OWJA 4X6NA 2SGEE 3ATLA 2BVSH 3U9AH 3BIVH 4AX9H 1Q2WA 4ISIH 1GI3A 1AO5A 3RDZA 1GDNA 1TQ0B 3E16B 1P02A 2QA9E 3MHWU 1V2NT 1XXDA 4ISLA 1AKSB 3KQDA 3MNBA 1TYNA 3RXKA 1TWXB 1SMFE 3LGVA 1NN6A 3ZYEA 1IQHA 2BLVA 4KGAA 1W14U 1QCPA 4GCHG 3ZVBA 1W0YH 3RMOH 1BT7A 4ISOA 4Y11E 1O2TA 1FJSA 3MU8A 1D3DB 1QL7A 1EAIA 3PWBA 1GJ9B 1C5WB
chains in the Genus database with same CATH superfamily
1LVBA 5KECA 1UTNA 1TGCA 4IC6A 1F5KU 1VJAU 3DFJA 4MQAA 1P2OA 2LPRA 4YXWD 4MG3A 5DN6D 1PQ5A 1O2ZA 2GD4B 1YKTA 1TAWA 1YF4A 2ZCHP 2JDID 4R8TB 4FU7A 2AGEX 1MKWH 2WYGA 4X1SU 4X0WU 3A82A 2NU1E 3ZZ7A 3M5OA 1NO9H 3ENSB 1EZUC 1TA2A 3MNXA 3I29A 2AMDA 3ATWA 4O3UA 2YMSC 1BTHH 1O2YA 4OS4A 3WW7A 6CHAB 2F9OA 1SGEE 1P3CA 1T8OA 5LPRA 3KHVA 3NK8A 1WYKA 3JZ2B 2OBQA 2SFAA 4WXVA 3RXBA 3BG8A 2W3IA 1ACBE 5EIYA 5LGOA 4KTCA 1PYTC 1O3GA 1OHHD 5IDKA 1JRSA 1YPHC 1HAIH 3AAVA 1GBCA 1S6FA 3MNSA 2H2ZA 3SNBA 2Y5GA 1QBNA 1SOTA 4MNWA 1PPBH 4KTSA 3S7KB 2ANWA 1QBVH 2Y5HA 1P9UA 5DG6A 3F9FA 1U6QA 3FP8E 2ZEBA 2TGPZ 4JK5A 3RXUA 2Z9JA 3LPRA 1E34B 3T27A 5C67A 1YC0A 1SFIA 1J8AA 1C5NH 3K2UA 1O2NA 3PV4A 4GLYA 1SQRA 6CHAC 4MPUA 1SGFG 2JJ2D 1AE5A 1K0HA 1GVKB 1O3MA 4RSPA 4XBCA 2XC0A 1V2TT 5CE1A 3FOAA 1EXFA 1UMAH 2FX6A 1K1OA 4J2YB 1OSSA 1C5RA 1DPOA 1O2MA 2A45B 3SU1A 1ELDE 1VCQA 1GHWH 1QQUA 8ESTE 1O5EH 2VIWA 2Z3CA 1DWDH 5EXNA 4X6OA 4AGJA 2VBCA 1E36B 1XKAC 5GXPA 2F9BH 5T6DA 2LP6A 3DD2H 1O3LA 1ZTKA 1MAYA 4AN7A 1DVAH 1T8LA 3ZZDA 2AS9A 4E06H 5A09A 1TB6H 3V3MA 5FCKA 2PR3A 2BZAA 4MPXA 4TPYA 2OBOA 2H5CA 3RC6A 1AVWA 1W2KH 3KEEA 4ABJA 2ZPQA 3L33A 1GBFA 1GHXH 3O8DA 2O8UA 1TPSA 2KZ4A 5GJ4B 3CS7A 1C1UH 2ALPA 1ZTJA 2VWNA 3A89A 3Q77A 1KXEA 1ZMNA 1NESE 5EQRA 1ZZZA 3QX5H 3QDZB 1AVXA 1HJAB 5DK1A 2C4FH 2EQNA 2HRVA 3QZQA 1NY22 1WBGB 1WOFA 3DSPA 3GCHB 4U30A 1G3DA 2FTMA 2J94A 2BD5A 4NWKA 4GAWA 2HVXA 3BEUA 3NPSA 2ZDAH 1HFDA 3RXCA 2FOCA 1UCYK 2WPIS 5GDSH 3ZZCA 2WUBA 4LOYH 2R0KA 1DY9A 1EZSC 1A3BH 1HIAA 3NRLA 2VIPA 3TH3H 2Q6DA 2GT7A 5T1VA 1H1BA 3RU4E 3UREA 3LH3A 3DSOA 4AGKA 1OWIA 3NWUA 2FOFA 1TGBA 1TPOA 2BD3A 1O5CB 1PPGE 2A5KA 1SGNE 1HJAC 1QR3E 4X2YA 3NUMA 4NG9H 2P93A 2BYAX 2VU8E 3GCHC 4AZ2B 3GCOA 2ZDNA 1GI5A 1KIGH 1GMHG 4Q7YA 4A1VA 2Y82A 1FMGA 1HNEE 4WMDA 2RA3A 1FONA 3T28A 2FI3E 3BN9A 3SUDA 1V2MT 1IQMA 1V2LT 1KXDA 3AK5A 3QGJA 2DE9A 1VCWA 1GMCG 2KAIA 5FBEA 6LPRA 1W11U 2ZI2H 3A81A 2OC1A 1FAKH 5HIYA 3BTDE 2XCFA 1MCTA 1AVGH 1IQIA 1SGCA 1OWEA 1GPZA 1TONA 4B76A 1CGIE 4DT4A 3HPTB 5C1XA 2F9UA 1XVMA 3SNCA 2ALVA 2BY9X 1MBQA 5FPSA 2JKHA 3ZZ9A 1WSSH 3ZV9A 4Y71A 2PKSB 1XMNB 5EXMA 1GBTA 1HAHH 1MZDA 3URCA 2IPQX 1IQJA 2A32A 1GI8B 2DUCA 1A0HB 4FVBA 2J34A 1QFKH 2CHAB 2UUJB 4DOQA 4I8KA 5EJZA 1UO6A 1KSNA 1IQGA 2Q6FA 5C0UA 2WHXA 4DGJA 2FOHA 2O8MA 3FVFB 3KL6A 5E0HA 1QY6A 1KLIH 1CBWB 1Y8TA 3Q3KA 5J4QA 1BTZA 1XUGA 2EEKA 1S5SA 4YESB 4RT0A 3TK6A 8LPRA 3BEIB 1K9OE 1O5GH 3ZZ3A 2O8TA 2ZGHA 2M2AA 1AQ7A 1C9PA 2HLDD 5L30H 3GY4A 2UUYA 3RC4A 1GHAG 3EAJA 3UQOA 1DT2A 4UD9H 3TGKE 4B71A 3H5CB 1ZOMA 2HOBA 3HKIB 3N7EA 5E8EH 2D8WA 3AVZA 4O9VA 2PHBA 5GCHF 3TGIE 4K1EA 3DFLA 4INHA 2VWMA 2JJ1D 4X1NU 1WAYB 4OS7A 2SGFE 2CHAC 5E0JA 3H09A 1ZLRA 2WV5A 5AVDA 1YCPH 1ZHRA 2ZGBH 3BTEE 3MU1A 2Z9LA 1SHHB 1SGYE 1VITF 5F03A 1GI6A 2RDEA 1FPCH 1BTPA 5F8ZA 2BLQA 3S7HB 1UTJA 1A61H 2F9NA 3SU3A 1HAGE 4ESTE 1NRSH 1CBWC 2LELA 3LT3A 1O37A 2OXSA 3S9CA 2TIOA 2JH0D 3GY6A 3A86A 3A8BA 1E0FD 2F83A 1ZGIA 2NU0E 2IJD1 2PWXA 2GMTB 2XC5A 5C1UA 3ZV8A 4NZQA 1GVLA 1F5LA 2RCEA 1AE8H 1AD8H 4INKA 1GBKA 4M7GA 3RLYH 3F6UH 1O3FA 4D9RA 4CRAA 1C2HA 1HUTH 3SJIA 4NIXA 2WPJS 1TNGA 3EE0B 1MKXH 5FX6A 2BQ6B 4IN2A 1A1RA 1IQLA 1DICA 1ESBA 4CBOA 5JBTA 1HIAB 2IOTA 1L4ZA 1GJ7B 1O0DH 4F55A 1CGHA 4Y6DA 5C94A 2ZU2A 1AHTH 1FN6A 1V2VT 4TT3D 5F53A 4ZROA 1SGTA 1K21H 1HCGA 1KXCA 3P8NA 2BX4A 3LGIA 3SNEA 1AWFH 1SGRE 1ELCA 1JWTA 1Y3XA 1G3EA 2A31A 5JYIA 4NWLA 3K6ZA 2BHGA 1NFUA 3UUZA 2GMTC 4U01A 2ESTE 4MPWA 1KXAA 4U2WA 1KDQA 1ZPZA 3FZZA 3BTHE 1RXPA 3SU6A 2F4LA 3QN7A 2HNTF 1YWUA 2IN2A 3A80A 2WYJA 3U1JB 1THPB 4GVUA 2BXTH 4UFGH 2FTLE 5F6MA 2C3SA 1DANH 1TALA 3SGBE 1GBJA 4RN6A 5IK2D 1SGIB 3F3BA 3LGWA 4IMQA 3M61U 2HWLB 3OU0A 2J92A 4B6EA 1SQOA 3R3GB 4ZHAA 4DY7B 3VB7A 1MD8A 2HNTE 1O2VA 3DT0H 3SU2A 5KEDA 4YLUA 1AKSA 1P06A 5EU8A 1GHBG 1OX1A 1MTSA 1D9IA 1C5YB 1VJ9U 1E79D 1D3QB 3OTJE 4WVPE 3GYMA 3KYFA 3Q00A 1UTKA 2ZO3H 1HV7A 2EI7A 5FBIA 3M35A 4X1PU 3E1XB 1YPJH 3TVJB 8GCHF 2ZFFH 1VKYA 1A46H 1WQSA 2CXVA 2NU4E 1PQ8A 3E0PB 1ZYOA 4ZCNA 2P8OB 4NA7A 3TITA 1EP6A 1L1NA 2TBSA 5FL7D 5FPTA 1GI9B 4X8SH 3MWIU 1O34A 1C1VH 1CHOG 3ZVFA 2I6QA 1CSOE 3F0PA 2ZF0H 1P57B 2FOEA 4NA9H 3LKWA 3VXFH 1L2EA 3MH6A 4K60A 1L1GA 1PPZA 4WXIA 1P2IA 2A5IA 1AUTC 1WCZA 2GCHG 2F91A 1TABE 3OAAD 4ZXXH 2G51A 1P12E 1MZAA 1EUFA 4D8NA 3OSYA 3BV9B 1OP2A 2F3CE 3ZYDA 2NWNA 3SZNA 2QXGA 1MMJN 1TNLA 3MMGA 3B8JA 4DG4A 1DLKB 3LDXH 2P8OC 3OEED 1BA8B 4B2AA 2GKVE 1ORFA 4YZUA 1MTNB 1G3BA 2GV7A 2FODA 2XXLA 5BPEA 1LCYA 2VWOA 2G8TA 3FZDA 1TMUH 1BRAA 3BSQA 3SQHE 7GCHF 1H4WA 3G01A 2QC2A 3DHKH 3F2GA 5LPFA 2OCVB 1CGJE 1S85A 4Y8XA 2PP6A 1C5VA 4FUHA 4ISHH 4NA8A 3RXJA 3LH1A 1BIOA 5FX5A 4K69A 1JMOH 3WWBA 4ZKNU 2JETB 1WQVH 4ABEA 5DPAA 2K8IA 3KF2A 1ETTH 4XDEA 1H8IH 2QXHA 5C5OA 2BM2A 4AOQA 1BTUA 3SV7A 2AMQA 1EPTB 1HXEH 1V2UT 4BAHB 2VIDA 1O3JA 2Q6GA 1FN8A 1UVUH 3Q3XA 2UUFB 5EPYA 4ZKRU 4ABFA 1T4VH 1SPJA 1TRNA 1MTNC 2QAAA 1SQTA 3D49H 2A1DB 1W8BH 2AMPA 1TNIA 1KDQB 4M9FA 2FEQH 1O2KA 1SSXA 2BX3A 1CVWH 1SI5H 5DP6A 1BBRK 3TIUA 1O5BB 1BMNH 1BTYA 2XBXA 2ZGCA 3BTME 4U32A 2ZHQH 2QIQA 3BF6H 5A0AE 3ZZ6A 4ZH8A 4GHTA 1UK3A 4X6PA 2XCNA 2BLWA 5E2OA 4YOIA 2QCYA 2BD2A 3E91A 2FZZA 3PTBA 2ANKH 1QL8A 2ZHWH 3U28C 2V3OH 1EPTC 1LTOA 4ACBA 2Z9IA 2Z9KA 3A7ZA 4B2CA 1GBDA 3FFGA 2P94A 5EGMA 2RG3A 3SW2B 3T26A 1A2CH 4F48B 2GJGA 4UONA 2ZTYA 4YOJA 1SR5C 2ZFPH 2QF5A 4KELA 1EZXC 5HGGA 1THRH 4GCHF 3UOPA 4AFSA 4CR9A 4BAKB 1IQNA 4ZUHA 3F9GA 2KX4A 4D76A 3E6PH 1FPHH 1XUFA 1VITH 3S9AA 1TBZH 4A7IB 4CH8B 1BRBE 1GJDB 2ZHDA 4H42U 1INCA 3P8OA 2R2MB 3NZIA 1F0UA 1GG6B 1DX5M 1Z8RA 1V6DA 1EAUA 1C5UA 1KXFA 4UEHH 1GJCB 2F9PA 3VB6A 3U98H 1HAXB 2BD4A 1EOLA 2CV3A 3RXQA 3U69H 3Q76A 1CO7E 1MQ5A 2UUKB 5E2PA 2F43B 1DDJA 1MU6B 4IN1A 2BOHB 3SJOA 1IHSH 3GCTG 1HYLA 2ZIQH 3M3VA 2Y81A 1K1MA 1O3EA 2BDGA 2VIOA 2B9LA 1YPMH 2CF9H 1GMDG 1TOMH 1UTMA 1HJ8A 1C5SA 4WH8A 4I8LA 2FOMB 3A7VA 4B75A 2BDCA 1QNJA 3TJVA 2ZNKH 1GG6C 4BXSA 5EQQA 3GCNA 5T6GA 1BCUH 1TMBH 3F2FA 3O8BA 5EW2H 1NZQH 3C27B 3U1IB 3BTGE 4NIYA 1C1QA 3PMJA 1FY4A 2GZ8A 1C2LA 1O2XA 5I46H 2AGIX 2VB0A 5DP5A 1D6RA 1UTLM 1QURH 3RXMA 2W6JD 3CS0A 4AG2A 1T7CA 2BQ7B 1OWKA 1O2LA 1GCTB 1EOJA 4Q2KA 1SLVB 1YGCH 1OOKB 1WU1A 2ASUB 2BOKA 1LHGH 4OS1A 2OC0A 3MYWA 2FESH 1Q31A 1ANDA 1LPZB 3OTPA 3IWMA 1TX8A 4LZ1H 2A2QH 5JBAS 3P6ZB 2BMGB 1P9SA 3B9FH 3ZZAA 5AFZH 3A88A 1CU1A 1C1TA 3EDXB 4KKDA 3ZZ8A 1TFXA 3TU7H 1S0RA 3PYHA 1GBLA 1O3OA 3HK6B 2VINA 4Q7XA 1RGQA 1FY1A 3UNSA 1MUEB 1F0TA 2ZZUH 2QF3A 3RXPA 2W6ID 3UB0A 2K1QA 5AHGH 1HAYB 1NFXA 2ZGJA 4NFEA 1NFWA 1G32B 4X8TH 3T25A 3TJUA 1DE7H 1H8HD 2V3MA 1MQ6A 2D1JA 3RXSA 3MO6A 4F49A 3MNCA 1A4WH 1GCTC 1ETRH 1O33A 3RXDA 1FX0B 2FOBA 4AB9A 1ZSJA 3ELAH 2ZU1A 4NSVA 4GHQA 1P03A 1D6WA 1SLUB 3UQVA 1DOJA 3A8AA 4AYYB 4NIVA 2GDEH 2VIQA 1YPGH 2ZDLA 1FLEE 1PPEE 5DGJA 3NXPA 4AFUA 1M9UA 1EJNA 1W12U 1AFQB 1QRWA 1PQAA 3KYGA 3HATH 1LQEA 1YPLH 1MH0A 3M5LA 1A3EH 1GJ8B 4GPGA 1G2MA 1F2SE 1O3BA 1K22H 3A7WA 2PSYA 1XM1A 1SFQB 3PMHB 2GX4A 1AB9B 5CHBA 3SI3H 2L6OA 1G30B 3SI4H 1IQEA 2W7UA 1QA0A 1AFEH 1PPCE 2PV9B 3F9EA 1TBQH 1HXFH 4FUCA 2HNTC 3LC3A 4OM9A 3PM3A 5K7RA 3MQKC 5AFYH 3O8RA 4A6LA 1C2JA 1BUIA 4A92A 2WUCA 5CHAB 5ETXA 4NZLA 5BRRE 1DWCH 1LHDH 1YCPM 1K28D 4P02A 1O2QA 4HGCA 4KTUA 4B1TA 2G52A 3PRBA 1P2QA 4IS5A 3IITA 1FV9A 1LHEH 1AFQC 1EZQA 5ESTE 1SGPE 5FAHA 1ELFA 1OP8A 1QHRB 3PROA 5DO4H 2FI4E 3MU4A 7ESTE 1T31A 1C1NA 2G4TA 2Y5FA 4DURA 1Y5BT 4IMZA 1N6XA 1BTWA 1XUIA 4X2WA 1GMHF 3UFAA 3V12A 1AB9C 1TGSZ 4NIWA 4ZKOU 2XW9A 1VR1H 1NBMD 1W0KD 2ZKSA 2ZU5A 1C1WH 3PLKA 1QRZA 2R0LA 1GMCF 2Z9GA 5JB9S 1SOZA 1GL0E 1OYTH 1H8ED 1EKBB 5CHAC 1RS0A 2DE8A 3PRDA 2KCAA 2ZU4A 3ATMA 4JCNA 1KTTB 2FOAA 1CE5A 4JYVH 5DP4A 3FAOA 1ZPBA 3B23B 3RM2H 3UR9A 2EI8A 1YM0A 5A0BA 2BTCE 1AGJA 1SB1H 3RU4T 2FOGA 2AGGX 1C4V2 1D3TB 1NC6A 3M7UA 2BY5X 1DM4B 1ZSLA 1FI8A 1O31A 3SGQE 1OS8A 2BY7X 4Q80A 3LGUA 3RMLH 3RUOA 1GDQA 1ZMJA 1HJ9A 1UVOA 3NCLA 2AEIH 1ABJH 3GDSA 3M5MA 4CRCA 1P2KA 3E3TA 5A2MH 2IJOB 1RRKA 1JIRA 1FY3A 1Y3UA 1SGFA 4Y8YA 1SLXB 1GVZA 4TWWA 4TWYA 1TA6A 1SGDE 1HPGA 3RXGA 4ZMAH 1UVSH 2BB4A 1C5LH 4OS2A 1O30A 4FETA 4AC9A 1NRNH 1P2NA 4WH6A 1GHAF 1ANCA 2XRCA 4QT8C 5C5NA 2HVYB 4XFQA 1IQKA 1FY8E 3UY9A 1O2PA 4X1QU 1P11E 4ABBA 4INLA 2AYWA 3WY8A 1UCYH 2PKSC 3W95A 2VVVA 5T3HA 1RTLA 1T32A 1JIMA 1N1LA 1KYNA 2OQ5A 4ZHLU 1BJVA 2OC7A 3OFND 2P3UB 1TIOA 1V2OT 1C1OA 4Y79A 3MH7A 1QB6A 2R3UA 5F8XA 1IOEA 1T8NA 2RFKC 5GPIB 1JBUH 4JZDH 3CENA 8KME2 1UVTH 2YMSD 3PV2A 2CN0H 3S69A 3SOSA 1NS3A 1VGCB 2KM0A 2A4RA 1ELGA 1NFYA 4TSFD 1TNKA 2ZFRH 1TNHA 1W3CA 4X2XA 5TCAA 1PYTD 5CDFE 3QO6A 2FM2A 1GWAA 5SGAE 1W7XH 2G5VA 1P8VC 1UK2A 4RKOB 2TGTA 2PGBB 2HPQH 2BDIA 2J9NA 3F9HA 1GI2A 1QGFA 2CJIA 2WV9A 4I33A 1LKBA 3TNSA 4K8YA 1UTOA 2PFEA 3ATKA 2HALA 1EPTA 2XNIA 3SZEA 2W5EA 1V3XA 1Z6EA 3D23A 1CA0B 3SNDA 3P8FA 5AF9H 1P2MA 2PSXA 4IC5A 3V13A 2O9QA 5EQSA 3TJNA 1BB0B 5G4BA 2H1UA 1VGCC 1A0LA 4GSOA 1QJ7B 2ZDKA 2AFQB 2NU2E 1KMHB 4TYDA 1A5IA 1NTPA 1HGTH 5EPNA 3SJ9A 4XBDA 3SN8A 1XX9A 1C1MA 1O3AA 1N6YA 1AN1E 5A8ZA 2Z3EA 2A4OA 1ANBA 1DUEA 1BQYA 1OYQA 4DIHH 4Y0YE 5HYOA 4JK6A 1O2OA 1SKYE 1DXPA 1K2I1 1ZJDA 3RXHA 1E1QD 2GP9B 4JYUH 2OQUA 3RP2A 1K1PA 2ZCKP 4MNYA 1V2ST 3M3SA 4I32A 5DP8A 2EA3A 5JPMH 1GHBF 1O3NA 1XKBC 3TJOA 1MBMA 2ANMH 1ID5H 5DP9A 4YO9A 1PQ7A 4YOGA 3F2HA 1DXWA 4MNXA 4AFZA 2ZQ1A 2EC9H 3RXVA 2BD8A 2O8WA 4E7NA 1XUJA 2SGPE 4BTIB 2B0FA 4BAMB 2SNVA 1KLJH 2HPPH 1JRTA 4BAQB 1C2MA 1T4UH 1G37A 2BXUH 4JMYA 1V2WT 2YNBA 4B74A 3EYDA 4UE7H 2P16A 1O38A 4Y0ZE 1O3IA 2Z94A 3MH4A 1BRCE 2W7SA 1O2RA 1LHCH 3A83A 1C5OH 4CRGA 2FX4A 1CHOF 2OLGA 3TPIZ 4Y10E 1EAWA 1LPKB 2FLRH 2ZHFH 2AHME 3IG6B 3SQEE 1DY8A 1LVOA 2H5DA 4AG1A 3C1KA 1ELEE 1CHGA 1GHZA 3FP7E 4SGBE 2XC4A 1P01A 3RXEA 1EB2A 2GCHF 1H9LB 3BIUH 1LVMA 3GS9A 5ABWA 1HAOH 3P70B 1NT1A 4K2YA 3PMBB 3SUEA 4Y7BA 5LH8A 2XYAA 1BMMH 3ZZBA 9ESTA 3MU5A 1B0FA 1TBRH 2RDLA 1QJ1B 4X6MA 1C5PA 2G5NA 1P3EA 1YBWA 1H9HE 2ZGXH 2GZ7A 3TGJE 3SHCH 2CF8H 1SVPA 1OPHB 3MTYA 2OTVA 1OP0A 1V2QT 3LGYA 3GY3A 1RTFB 1ARBA 4FOUC 3SJ8A 3OX7U 3LJJA 4Q4LA 3ZVAA 4DCDA 3AW1A 1ESAA 1O3HA 3KNXA 4YTAA 5L2ZH 3QGNB 3QZRA 3GDVA 3MU0A 1TRYA 4SGAE 4AFQA 1TLDA 1FAXA 3T29A 3UAIC 2FWWA 1KTSB 5HM9A 1O2JA 1MTUA 2ZTXA 2ZDVH 2VVUA 3K9XB 1BHXF 3S0NA 2ODYB 2BDBA 3U8OH 2OK5A 1GGDB 5LPEA 2G00A 2QE7D 1LHFH 4CRFA 3GY8A 4CREA 1EX3A 1L4DA 1HAPH 2H9EH 3U8RH 1E38B 3RXRA 2ZTZA 1TE0A 2UWPA 2ZFQH 3ZZ4A 2OD3B 2L74A 4OS5A 4WF8A 4ABIA 3SV9A 3M7TA 1MKWK 4WMEA 1SG8B 2GV6A 1A5GH 2H9HA 2OP9A 3D62A 4O03A 3SORA 2KFWA 3A87A 3RXIA 3VGCB 3I77A 2BQWB 4KP0A 1PPFE 5EJ1A 1QA7A 3A7XA 1C2IA 1J15A 4I7YH 4OGYA 1C2DA 2VH0A 1PFXC 4THNH 2ZQ2A 3GY5A 1UK4A 3RXTA 2FDAA 1GCDA 1NU7B 1UHBA 2J98A 4LK4A 2XOKD 2AH4X 5HM2A 1BMFD 2WPHS 1O2HA 1G36A 1GGDC 1LQDB 2JETC 2BZ6H 2FO9A 1L1JA 2R3YA 1RFNA 3D65E 3VB4A 1A7SA 3UIRA 3H7TA 4K5ZA 3A7YA 2VH6A 3P8GA 3OE7D 1COWD 1QIXB 2VIVA 3CP7A 2FS8A 1O2SA 4CBNA 2J38A 1WUNH 2J4IA 4I8HA 1QRXA 2M5TA 3HKJB 2FYQA 4TPIZ 3VGCC 4K3JA 1C2GA 3M3TA 1MD7A 3P17H 1CT0E 3PMAB 4DT7B 1MU8B 1JOUB 2VJ1A 4AB8A 3UR6A 1K1LA 1ZR0A 5C1YA 4F4OC 1W0JD 2OC8A 1O2UA 2QV1A 1P10A 5JB8S 2UWLA 3QWCH 2FMJA 2A0QB 4ASHA 3KQBA 1GI0A 1GL1A 3LOXA 3SYJA 2A4QA 1O3PB 2ZP0H 5GWZA 3QUMP 2GGVB 3RXAA 2VVCA 3E90B 1ZRBA 1J9CH 1E35B 3ITIA 3MH5A 3S9BA 1SBWA 1AIXH 3A85A 1AY6H 3MI4A 1EP5A 2TGDA 4FU9A 1ANEA 1GBIA 1Z1JA 3T5FH 2JH6D 1KLTA 5CMXH 1QB1A 4MVNA 3MO3A 2Y7ZA 4MNVA 3GCTF 2H6MA 1UCYE 1EQ9A 3M5NA 4ZAEA 4DJZB 1L0ZA 2H9TH 2TGAA 2XBYA 2ZU3A 3A7TA 2PW8H 3BTQE 3L3TA 5PTPA 1EB1H 2SNWA 2A5AA 1TNJA 5JBCS 2P95A 4BTUB 3ZVGA 3PB1E 1C5QA 1GMDF 3VPKA 1ELBA 3GDUA 1HAVB 2A7JA 2XWBI 4H4FA 1IHTH 1Z7KA 1YP9A 4FUFA 3ZVDA 4YM9A 2FI5E 1HLTH 2VGCB 3K6YA 1VCPA 3F68H 4WY3A 2XNDD 1GJ5H 2C8WB 3UNRA 4HTCH 4OGXA 1BBRH 5EJLA 1QQ4A 3KQCA 4BTTB 1TX7A 1MTWA 1V2PT 4CHAB 2QY0B 3TH2H 1O3CA 4Q63A 1C4Y2 4ASUD 3VFEA 3W94A 1A5HA 1SC8U 4A1XA 1AU8A 2GVFA 5A0CA 3HGNA 1DSTA 1HRTH 2IPHA 3UPEA 4JZFH 3A8CA 3EE7A 3H7OA 5TJXA 2GDDA 3BTWE 1P09A 1AMHA 4I31A 2QF4A 2PKAB 3KN2A 5GNDA 3OY6U 4UFEH 3ZVEA 1QTFA 1K1NA 1C2KA 1C1RA 1PJPA 1TPPA 1P04A 1NRQH 4BANB 1DITH 2VGCC 3PWCA 2PTCE 3W1EA 3STIA 1MAXA 5I25A 4YT6H 3U8TH 1B7XB 1C5XB 3EA7A 1FXYA 1ZRKA 1VZQH 3OYPA 2W26A 4K1TA 1G3CA 5FHTA 2K0QA 1GBAA 4CHAC 5E0GA 2ZCLP 1C1SA 1AWHB 2J98B 1UHBB 1T8MA 1OWHA 3GY7A 3PV5A 4ABAA 3MOCA 4X2VA 5DP3A 3ATIA 3GYLB 3V0XA 1EJAA 5JDUB 2A2XH 4O97A 5K0HA 1J17T 2KR7A 3UNQA 2ILNA 1LDTT 2R9PA 1BJUA 1CT2E 1XVOA 3BTKE 2GT8A 3GICB 2WPKS 4H6SB 5C2ZA 3E8LA 3DSGA 1XUHA 2C90B 1NRPH 1RJXB 3EQ0H 1Z6JH 9LPRA 1BDAA 5IYTA 1ELTA 4D9QA 1EASA 1QL9A 1LKAA 4UDWH 3TLOA 1TPAE 1GI7B 4FUBA 1S84A 1ZPCA 1FUJA 4P00A 5C3NA 1Z8JB 4ZHMU 1O3DA 3QTOH 1EATA 1DLEA 3BTTE 5DKMA 4D7FA 5J4SA 1Z8IB 2QYIA 2BDHA 4DIIH 2FP7B 1A0JA 2A7HA 1YLDA 1KXBA 1HAZB 4E7RG 3O8CA 2QF0A 5L6NH 2C8ZB 1Y59T 1C4U2 3LONA 2ZC9H 1FNIA 5ESBA 2VNTA 1GJAB 1O2GH 4B73A 4ZKSU 4WJG2 5HIZA 2XBVA 4PROA 1WDIA 3LU9B 4AYVB 3ZVCA 2FPZA 4ABDA 1NBME 2GZ9A 2BD7A 4IBLH 3M37A 2XBWA 4FUJA 2BD9A 2Z3DA 1LMWB 2PTNA 4X1RU 5JBBS 1C2FA 4ISNA 5HXFA 1AZZA 1S82A 1S81A 4LZ4B 3P92A 5FPYA 4Z6AH 2D26C 4O3TA 1GI4A 1YCPK 4X8VH 3TK9A 5C0TA 1UTPA 1S6LA 5A8XA 1CA8B 3GOVB 3BEFB 3PLPA 1ABIH 1P0SH 4NGAH 2Y6TA 1C5MD 1Y3VA 2HLCA 2QXJA 2WZQA 3LGTA 4XSKU 2C8YB 3UOUA 5DJ7A 2WPLS 1MCVA 2BVRH 1DSUA 3MFJA 4B6FA 4FUGA 2B5TB 4XE4A 1O36A 2Y80A 2VWLA 2I6SA 2V6NA 4MLFB 4WMFA 2KCPA 2C93B 4Y8ZA 2ODPA 3F1SB 3RU4D 1O5DH 1H8DH 3SU4A 1QBOA 3EA9A 2GCTB 4TY7A 1YPKH 2XTTB 1GI1A 1QB9A 3BG4B 1MKXK 3AAUA 4FUDA 6ESTA 3T62A 1J16A 4J1YA 4UFFH 1EFRD 4XRNA 1BHXB 4MPVA 1E1RD 1ZSKA 1ARCA 2NU3E 2B8OH 4I8GA 3PLBA 3AW0A 2LNCA 1K1IA 5C17A 4A1TA 3RMNH 1H9IE 2RA0A 2V3HH 4CH2B 1KY9A 3OEHD 4LXBH 4K1SA 1FDPA 1GJ6A 2Z6BD 1RIWB 3SNAA 2ODQA 1K1JA 3PO1B 4HG6A 3M36A 1O32A 3KCGH 3ZZ5A 4GUXA 4FXGH 2XWAA 2ZECA 2WPMS 4HI3A 1O2WA 3VXEH 4NFFA 3PTNA 3SJKA 4HZHA 3DA9B 2GCTC 3QLPH 1EAXA 2J2UA 5FXLA 3RMMH 3F0OA 3BG4C 2STAE 5DSFA 1W0ZU 3SGAE 1C2EA 3VB5A 1JXPA 2ZFSA 5EW1H 5B6LA 2SGQE 1BMLA 1Z1IA 1ZJKA 3TK5A 2WV4A 4BOHA 2ZWLH 5F8TA 2Z7FE 2TPIZ 1NM6A 2C8XB 1UTQA 1YPHE 3SHAH 2OUAA 4D7GA 1OWDA 5GCHG 2THFB 1ESTA 1AI8H 3T2NA 1GHYH 1RIWC 4ABHA 3R0FA 3PO1C 1Y5AT 4R0IA 1ZHPA 1VITG 1F7ZA 3STJA 1FQ3A 3GY2A 4HFPB 2BY8X 4XD7D 1C9TA 1DFPA 2AERH 1TGTA 3WWFA 4DW2U 3OY5U 3UWJH 1BITA 2B7DH 3LIWA 3RXFA 3RM0H 1NRRH 1Y5UT 3A84A 5EXLA 3N7DA 4CRDA 1V2KT 1S83A 3N7OA 3QK1A 1GBHA 3UTUH 4YLQH 4BNRA 4A5TS 3ODFA 4Y7AA 1XXFA 1YLCA 2PUQH 2CMYA 1UJ1A 1WV7H 1ZMLA 2OINA 2CGAA 4FUEA 4RT1A 1AUJA 1HBTH 2Y7XA 3CNRA 4ZXYH 1GBBA 1TQ7B 1W10U 3E0NB 3DCLA 1O3KA 3URDA 1SLWB 4CR5A 4JZIA 2KCYA 1FY5A 4IGDA 3RC5A 4CRBA 2BDAA 2V35A 2P59A 3RLWH 1GBEA 3SV6A 3M7QA 4VGCB 1SHYA 1ZTLA 1G2LA 2CK3D 5TCCA 3LC5A 3NKKA 3RXLA 2P3TB 1YLNA 1BBRE 3FANA 3KGPA 1N8OB 3ESTA 3VG8A 2ULLA 3LJOA 5DP7A 1Z8GA 1CA0C 2KAIB 1O5AB 1W7GH 1UW7A 2AIQA 1F0SA 2FYRA 4IW4E 4I8JA 2HGTH 3SU0A 5FCRA 3JZ1B 1IQFA 2ZFTA 1TOCB 2D2DA 2G4UA 4YT7H 1J14A 3P95A 2YOLA 5HMAA 4FU8A 3SUFA 4AORA 1RD3B 2W3KA 2ZDMA 4RKJB 2O8LA 4B2BA 1QJ6B 4NSYA 4JZEH 4H6TA 5EOKA 4I86A 2EY4C 4VGCC 4NCYA 1V2JT 4JZ1A 2BVXH 3SV2H 4Z1MD 5HKKD 3SUGA 1YPEH 2A7CA 1MABB 3SBKA 4MTBA 3ZIAD 7KMEH 1Z71A 8GCHG 3L6PA 1D3PB 4XBBA 2V0BA 4ACAA 1Q3XA 1O2IA 1NPMA 3DUXH 1N8OC 1ELAA 2UWOA 1S6HA 3A8DA 1AZ8A 2AIPA 4DVAU 3N99A 3K65B 1DUAA 2EI6A 2F9VA 2BLOA 1C5TA 4TY6A 1P05A 4Q7ZA 2QN5T 1GJ4H 1S0QA 1O35A 1GDUA 1V2RT 3TH4H 1BTXA 2QGRA 4FVDA 5KGOA 1GJBB 1PPHE 3SO3A 1TGNA 2J97A 2G81E 1SGQE 1HAVA 3MO9A 3FN8A 1D4PB 1THSH 4E05H 1LO6A 2SGAA 2ZG0H 5A8YA 1B0EA 1SQAA 3HK3B 3VEQB 2ZHEH 1CQQA 1ETSH 1HDTH 1C1PA 1SL3A 3VB3A 2FLBH 1LPGB 1F92A 1BOQA 2PLXA 1F5RA 4MDSA 1OXGA 1NROH 1LVYA 2JH5D 3V7TA 2V7QD 1X7AC 2ZPRA 2WSSD 1WTGH 1DWEH 1E37B 2PGQB 1OKXA 2A4GA 1UVPA 1Y3YA 2SGDE 5GIBA 4Y76A 4BAOB 3EA8A 1Y3WA 2WPDD 2KCOA 4BXWA 1BRUP 6GCHG 3FP6E 5C20A 1NU9A 1TX6A 2G55A 6GCHF 1FIZA 5T6FA 2JIZD 4JYTA 1IAUA 3FO8D 7GCHG 2FXRA 4XOJA 1G9IE 1WXRA 4OS6A 3KQEA 1ZHMA 2P3FH 2PKAA 4X8UH 3BTFE 5EG4A 3SU5A 1XUKA 2TRMA 1ELVA 4FUIA 1O5FH 1C5ZB 1W13U 1B5GH 2BY6X 1QZ8A 3KIDU 1CT4E 2ANYA 3QTVH 1WTHD 1BZXE 4ABGA 5B6OA 2J95A 1YYY1 1FZZA 3GISB 3UWIA 4UFDH 3TNTA 4K8BA 1TMTH 1DWBH 1TRMA 5H4IB 1GBMA 4WWYA 1ZGVA 2STBE 3AASA 1F0RA 2Q1JA 3RXOA 3HGPA 5L2YH 1YY3A 2FS9A 2QXIA 7LPRA 1EJMA 2ZPSA 4Z0KA 2R2WU 1BMAA 1O39A 3I78A 2FIRH 2WINI 2BDYA 2PUXB 3SV8A 1P2JA 2YNAA 1RTKA 3EGKH 1GHVH 3ODDA 1HB0B 5EODA 3FKSD 1FIWA 1MTVA 3Q3YA 2GTBA 2ZA5A 1DS2E 1OWJA 4X6NA 2SGEE 3ATLA 2BVSH 3U9AH 3BIVH 4AX9H 1Q2WA 4ISIH 1GI3A 1AO5A 3RDZA 1GDNA 1TQ0B 3E16B 1P02A 2QA9E 4RI0A 3MHWU 1V2NT 2J5UA 1XXDA 4ISLA 1AKSB 3KQDA 3MNBA 1TYNA 3RXKA 1TWXB 1SMFE 3LGVA 1NN6A 3ZYEA 1IQHA 2BLVA 4KGAA 1W14U 1QCPA 4GCHG 3ZVBA 1W0YH 3RMOH 1BT7A 4ISOA 4Y11E 3KQ5A 2YMSB 1O2TA 1FJSA 3MU8A 1D3DB 1QL7A 1EAIA 3PWBA 1GJ9B 1C5WB
chains in the Genus database with same CATH topology
1LVBA 1UTNA 1TGCA 4IC6A 1F5KU 1VJAU 3DFJA 4MQAA 1P2OA 2LPRA 4MG3A 1PQ5A 1O2ZA 2GD4B 1YKTA 1TAWA 1YF4A 2ZCHP 4R8TB 4FU7A 2AGEX 1MKWH 2WYGA 4X1SU 4X0WU 3A82A 2NU1E 3ZZ7A 3M5OA 1NO9H 3ENSB 1EZUC 1TA2A 3MNXA 3I29A 2AMDA 3ATWA 4O3UA 1BTHH 1O2YA 4OS4A 6CHAB 2F9OA 1SGEE 1P3CA 1T8OA 5LPRA 3KHVA 3NK8A 1WYKA 3JZ2B 2OBQA 2SFAA 4WXVA 3RXBA 3BG8A 2W3IA 1ACBE 5LGOA 4KTCA 1PYTC 1O3GA 5IDKA 1JRSA 1YPHC 1HAIH 3AAVA 1GBCA 1S6FA 3MNSA 2H2ZA 3SNBA 2Y5GA 1QBNA 1SOTA 4MNWA 1PPBH 4KTSA 3S7KB 2ANWA 1QBVH 2Y5HA 1P9UA 5DG6A 3F9FA 1U6QA 3FP8E 2ZEBA 2TGPZ 4JK5A 3RXUA 2Z9JA 3LPRA 1E34B 3T27A 5C67A 1YC0A 1SFIA 1J8AA 1C5NH 3K2UA 1O2NA 3PV4A 4GLYA 6CHAC 4MPUA 1SGFG 1AE5A 1GVKB 1O3MA 4RSPA 4XBCA 2XC0A 1V2TT 5CE1A 1EXFA 1UMAH 2FX6A 1K1OA 4J2YB 1OSSA 1C5RA 1DPOA 1O2MA 2A45B 3SU1A 1ELDE 1VCQA 1GHWH 1QQUA 8ESTE 1O5EH 2VIWA 2Z3CA 1DWDH 5EXNA 4X6OA 4AGJA 1E36B 1XKAC 5GXPA 2F9BH 5T6DA 3DD2H 1O3LA 1ZTKA 1MAYA 4AN7A 1DVAH 1T8LA 3ZZDA 2AS9A 4E06H 5A09A 1TB6H 3V3MA 5FCKA 2PR3A 2BZAA 4MPXA 4TPYA 2OBOA 2H5CA 3RC6A 1AVWA 1W2KH 3KEEA 4ABJA 2ZPQA 3L33A 1GBFA 1GHXH 3O8DA 2O8UA 1TPSA 5GJ4B 3CS7A 1C1UH 2ALPA 1ZTJA 2VWNA 3A89A 3Q77A 1KXEA 1ZMNA 1NESE 5EQRA 1ZZZA 3QX5H 3QDZB 1AVXA 1HJAB 5DK1A 2C4FH 2HRVA 3QZQA 1NY22 1WBGB 1WOFA 3GCHB 4U30A 1G3DA 2FTMA 2J94A 2BD5A 4NWKA 4GAWA 2HVXA 3BEUA 3NPSA 2ZDAH 1HFDA 3RXCA 2FOCA 1UCYK 2WPIS 5GDSH 3ZZCA 2WUBA 4LOYH 2R0KA 1DY9A 1EZSC 1A3BH 1HIAA 2VIPA 3TH3H 2Q6DA 2GT7A 1H1BA 3RU4E 3UREA 3LH3A 4AGKA 1OWIA 3NWUA 2FOFA 1TGBA 1TPOA 2BD3A 1O5CB 1PPGE 2A5KA 1SGNE 1HJAC 1QR3E 4X2YA 3NUMA 4NG9H 2P93A 2BYAX 2VU8E 3GCHC 4AZ2B 3GCOA 2ZDNA 1GI5A 1KIGH 1GMHG 4Q7YA 4A1VA 2Y82A 1FMGA 1HNEE 4WMDA 2RA3A 1FONA 3T28A 2FI3E 3BN9A 3SUDA 1V2MT 1IQMA 1V2LT 1KXDA 3QGJA 2DE9A 1VCWA 1GMCG 2KAIA 5FBEA 6LPRA 1W11U 2ZI2H 3A81A 2OC1A 1FAKH 3BTDE 2XCFA 1MCTA 1AVGH 1IQIA 1SGCA 1OWEA 1GPZA 1TONA 4B76A 1CGIE 3HPTB 5C1XA 2F9UA 1XVMA 3SNCA 2ALVA 2BY9X 1MBQA 5FPSA 2JKHA 3ZZ9A 1WSSH 3ZV9A 4Y71A 2PKSB 1XMNB 5EXMA 1GBTA 1HAHH 1MZDA 3URCA 1IQJA 2A32A 1GI8B 2DUCA 1A0HB 4FVBA 2J34A 1QFKH 2CHAB 2UUJB 4DOQA 4I8KA 1UO6A 1KSNA 1IQGA 2Q6FA 4DGJA 2FOHA 2O8MA 3FVFB 3KL6A 5E0HA 1QY6A 1KLIH 1CBWB 1Y8TA 3Q3KA 5J4QA 1BTZA 1XUGA 2EEKA 1S5SA 4YESB 3TK6A 8LPRA 3BEIB 1K9OE 1O5GH 3ZZ3A 2O8TA 2ZGHA 1AQ7A 1C9PA 5L30H 3GY4A 2UUYA 3RC4A 1GHAG 3EAJA 3UQOA 1DT2A 4UD9H 3TGKE 4B71A 3H5CB 1ZOMA 2HOBA 3HKIB 5E8EH 2D8WA 3AVZA 4O9VA 2PHBA 5GCHF 3TGIE 4K1EA 3DFLA 4INHA 2VWMA 4X1NU 1WAYB 4OS7A 2SGFE 2CHAC 5E0JA 1ZLRA 2WV5A 5AVDA 1YCPH 1ZHRA 2ZGBH 3BTEE 3MU1A 2Z9LA 1SHHB 1SGYE 1VITF 5F03A 1GI6A 1FPCH 1BTPA 5F8ZA 2BLQA 3S7HB 1UTJA 1A61H 2F9NA 3SU3A 1HAGE 4ESTE 1NRSH 1CBWC 3S9CA 3LT3A 1O37A 2OXSA 2TIOA 2JH0D 3GY6A 3A86A 3A8BA 1E0FD 2F83A 1ZGIA 2NU0E 2PWXA 2GMTB 2XC5A 5C1UA 3ZV8A 4NZQA 1GVLA 1F5LA 2RCEA 1AE8H 1AD8H 4INKA 1GBKA 4M7GA 3RLYH 3F6UH 1O3FA 4D9RA 4CRAA 1C2HA 1HUTH 3SJIA 4NIXA 2WPJS 1TNGA 3EE0B 1MKXH 5FX6A 2BQ6B 4IN2A 1A1RA 1IQLA 1DICA 1ESBA 4CBOA 5JBTA 1HIAB 2IOTA 1L4ZA 1GJ7B 1O0DH 1CGHA 4Y6DA 2ZU2A 1AHTH 1FN6A 1V2VT 4ZROA 1SGTA 1K21H 1HCGA 1KXCA 3P8NA 2BX4A 3LGIA 3SNEA 1AWFH 1SGRE 1ELCA 1JWTA 1Y3XA 1G3EA 2A31A 4NWLA 3K6ZA 2BHGA 1NFUA 3UUZA 2GMTC 4U01A 2ESTE 4MPWA 1KXAA 4U2WA 1KDQA 1ZPZA 3FZZA 3BTHE 1RXPA 3SU6A 3QN7A 2HNTF 2IN2A 3A80A 2WYJA 3U1JB 1THPB 4GVUA 2BXTH 4UFGH 2FTLE 5F6MA 2C3SA 1DANH 1TALA 3SGBE 1GBJA 4RN6A 1SGIB 3LGWA 4IMQA 3M61U 2HWLB 3OU0A 2J92A 1SQOA 3R3GB 4ZHAA 4DY7B 3VB7A 1MD8A 2HNTE 1O2VA 3DT0H 3SU2A 4YLUA 1AKSA 1P06A 5EU8A 1GHBG 1OX1A 1MTSA 1D9IA 1C5YB 1VJ9U 1D3QB 3OTJE 4WVPE 3GYMA 3Q00A 1UTKA 2ZO3H 1HV7A 2EI7A 5FBIA 3M35A 4X1PU 3E1XB 1YPJH 3TVJB 8GCHF 2ZFFH 1A46H 1WQSA 2CXVA 2NU4E 1PQ8A 3E0PB 1ZYOA 2P8OB 4NA7A 3TITA 1EP6A 1L1NA 2TBSA 5FPTA 1GI9B 4X8SH 3MWIU 1O34A 1C1VH 1CHOG 3ZVFA 2I6QA 1CSOE 2ZF0H 1P57B 2FOEA 4NA9H 3LKWA 3VXFH 1L2EA 3MH6A 4K60A 1L1GA 1PPZA 4WXIA 1P2IA 2A5IA 1AUTC 1WCZA 2GCHG 2F91A 1TABE 4ZXXH 2G51A 1P12E 1MZAA 1EUFA 4D8NA 3OSYA 3BV9B 1OP2A 2F3CE 3ZYDA 2NWNA 3SZNA 2QXGA 1MMJN 1TNLA 3MMGA 3B8JA 4DG4A 1DLKB 3LDXH 2P8OC 1BA8B 4B2AA 2GKVE 1ORFA 4YZUA 1MTNB 1G3BA 2GV7A 2FODA 2XXLA 5BPEA 1LCYA 2VWOA 2G8TA 3FZDA 1TMUH 1BRAA 3BSQA 3SQHE 7GCHF 1H4WA 3G01A 2QC2A 3DHKH 5LPFA 2OCVB 1CGJE 1S85A 4Y8XA 4FUHA 1C5VA 4ISHH 3RXJA 4NA8A 5JYIA 3LH1A 1BIOA 5FX5A 4K69A 1JMOH 4ZKNU 2JETB 1WQVH 4ABEA 5DPAA 3KF2A 1ETTH 4XDEA 1H8IH 2QXHA 5C5OA 2BM2A 4AOQA 1BTUA 3SV7A 2AMQA 1EPTB 1HXEH 1V2UT 4BAHB 2VIDA 1O3JA 2Q6GA 1FN8A 1UVUH 3Q3XA 2UUFB 5EPYA 4ZKRU 4ABFA 1T4VH 1SPJA 1TRNA 1MTNC 2QAAA 1SQTA 3D49H 2A1DB 1W8BH 2AMPA 1TNIA 1KDQB 2FEQH 1O2KA 1SSXA 2BX3A 1CVWH 1SI5H 5DP6A 1BBRK 3TIUA 1O5BB 1BMNH 1BTYA 2XBXA 2ZGCA 3BTME 4U32A 2ZHQH 2QIQA 3BF6H 5A0AE 3ZZ6A 4ZH8A 4GHTA 1UK3A 4X6PA 2XCNA 2BLWA 5E2OA 4YOIA 2QCYA 2BD2A 3E91A 2FZZA 3PTBA 2ANKH 1QL8A 2ZHWH 2V3OH 1EPTC 1LTOA 2Z9IA 2Z9KA 3A7ZA 4B2CA 1GBDA 3FFGA 2P94A 5EGMA 2RG3A 3SW2B 3T26A 1A2CH 4UONA 2ZTYA 4YOJA 1SR5C 2ZFPH 4KELA 1EZXC 5HGGA 1THRH 4GCHF 3UOPA 4AFSA 4CR9A 4BAKB 1IQNA 4ZUHA 3F9GA 4D76A 3E6PH 1FPHH 1XUFA 1VITH 3S9AA 1TBZH 4A7IB 4CH8B 1BRBE 1GJDB 2ZHDA 4H42U 1INCA 3P8OA 2R2MB 3NZIA 1F0UA 1GG6B 1DX5M 1Z8RA 1V6DA 1EAUA 1C5UA 1KXFA 4UEHH 1GJCB 2F9PA 3VB6A 3U98H 1HAXB 2BD4A 1EOLA 2CV3A 3RXQA 3U69H 3Q76A 1CO7E 1MQ5A 2UUKB 5E2PA 1DDJA 1MU6B 4IN1A 2BOHB 3SJOA 1IHSH 3GCTG 1HYLA 2ZIQH 3M3VA 2Y81A 1K1MA 1O3EA 2BDGA 2VIOA 2B9LA 1YPMH 2CF9H 1GMDG 1TOMH 1UTMA 1HJ8A 1C5SA 4WH8A 4I8LA 2FOMB 3A7VA 4B75A 2BDCA 1QNJA 3TJVA 2ZNKH 1GG6C 4BXSA 5EQQA 3GCNA 5T6GA 1BCUH 1TMBH 3O8BA 5EW2H 1NZQH 3C27B 3U1IB 3BTGE 4NIYA 1C1QA 3PMJA 1FY4A 2GZ8A 1C2LA 1O2XA 5I46H 2AGIX 2VB0A 5DP5A 1D6RA 1UTLM 1QURH 3RXMA 4AG2A 3CS0A 1T7CA 2BQ7B 1OWKA 1O2LA 1GCTB 1EOJA 4Q2KA 1SLVB 1YGCH 1OOKB 1WU1A 2ASUB 2BOKA 1LHGH 4OS1A 2OC0A 3MYWA 2FESH 1Q31A 1ANDA 1LPZB 3IWMA 1TX8A 4LZ1H 2A2QH 5JBAS 3P6ZB 2BMGB 1P9SA 3B9FH 3ZZAA 5AFZH 3A88A 1CU1A 1C1TA 3EDXB 4KKDA 3ZZ8A 1TFXA 3TU7H 1S0RA 3PYHA 1GBLA 1O3OA 3HK6B 2VINA 4Q7XA 1RGQA 1FY1A 3UNSA 1MUEB 1F0TA 2ZZUH 2QF3A 3RXPA 2K1QA 5AHGH 1HAYB 1NFXA 2ZGJA 4NFEA 1NFWA 1G32B 4X8TH 3T25A 3TJUA 1DE7H 1MQ6A 2D1JA 3RXSA 3MO6A 4F49A 3MNCA 1A4WH 1GCTC 1ETRH 1O33A 3RXDA 2FOBA 4AB9A 1ZSJA 3ELAH 2ZU1A 4NSVA 4GHQA 1P03A 1D6WA 1SLUB 3UQVA 1DOJA 3A8AA 4AYYB 4NIVA 2GDEH 2VIQA 1YPGH 2ZDLA 1FLEE 1PPEE 5DGJA 3NXPA 4AFUA 1M9UA 1EJNA 1W12U 1AFQB 1QRWA 1PQAA 3HATH 1LQEA 1YPLH 1MH0A 3M5LA 1A3EH 1GJ8B 4GPGA 1G2MA 1F2SE 1O3BA 1K22H 3A7WA 2PSYA 1XM1A 1SFQB 3PMHB 2GX4A 1AB9B 3SI3H 1G30B 3SI4H 1IQEA 2W7UA 1QA0A 1AFEH 1PPCE 2PV9B 3F9EA 1TBQH 1HXFH 4FUCA 2HNTC 3LC3A 3PM3A 5K7RA 5AFYH 3O8RA 4A6LA 1C2JA 1BUIA 4A92A 2WUCA 5CHAB 5ETXA 4NZLA 5BRRE 1DWCH 1LHDH 1YCPM 1K28D 1O2QA 4HGCA 4KTUA 4B1TA 2G52A 1P2QA 4IS5A 3IITA 1FV9A 1LHEH 1AFQC 1EZQA 5ESTE 1SGPE 5FAHA 1ELFA 1OP8A 1QHRB 3PROA 5DO4H 2FI4E 3MU4A 7ESTE 1T31A 1C1NA 2G4TA 2Y5FA 4DURA 1Y5BT 4IMZA 1N6XA 1BTWA 1XUIA 4X2WA 1GMHF 3UFAA 3V12A 1AB9C 1TGSZ 4NIWA 4ZKOU 2XW9A 1VR1H 2ZKSA 2ZU5A 1C1WH 3PLKA 1QRZA 2R0LA 1GMCF 2Z9GA 5JB9S 1SOZA 1GL0E 1OYTH 1EKBB 5CHAC 1RS0A 2DE8A 2ZU4A 3ATMA 4JCNA 1KTTB 2FOAA 1CE5A 4JYVH 5DP4A 3FAOA 1ZPBA 3B23B 3RM2H 3UR9A 2EI8A 1YM0A 5A0BA 2BTCE 1AGJA 1SB1H 3RU4T 2FOGA 2AGGX 1C4V2 1D3TB 1NC6A 3M7UA 2BY5X 1DM4B 1ZSLA 1FI8A 1O31A 3SGQE 1OS8A 2BY7X 4Q80A 3LGUA 3RMLH 3RUOA 1GDQA 1ZMJA 1HJ9A 1UVOA 3NCLA 2AEIH 1ABJH 3GDSA 3M5MA 4CRCA 1P2KA 3E3TA 5A2MH 2IJOB 1RRKA 1JIRA 1FY3A 1Y3UA 1SGFA 4Y8YA 1SLXB 1GVZA 4TWWA 4TWYA 1TA6A 1SGDE 1HPGA 3RXGA 4ZMAH 1UVSH 2BB4A 1C5LH 4OS2A 1O30A 1NRNH 1P2NA 4WH6A 1GHAF 1ANCA 2XRCA 4QT8C 5C5NA 4XFQA 1IQKA 1FY8E 3UY9A 1O2PA 4X1QU 1P11E 4ABBA 4INLA 2AYWA 3WY8A 1UCYH 2PKSC 3W95A 2VVVA 5T3HA 1RTLA 1T32A 1JIMA 1N1LA 1KYNA 2OQ5A 4ZHLU 1BJVA 2OC7A 2P3UB 1TIOA 1V2OT 1C1OA 4Y79A 3MH7A 1QB6A 2R3UA 5F8XA 1IOEA 1T8NA 5GPIB 1JBUH 4JZDH 3CENA 8KME2 1UVTH 2CN0H 3S69A 3SOSA 1NS3A 1VGCB 2A4RA 1ELGA 1NFYA 1TNKA 2ZFRH 1TNHA 1W3CA 4X2XA