3H7TA

Crystal structure of scabies mite inactivated protease paralogue s-d1 (smipp-s-d1)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
235
structure length
235
Chain Sequence
IIGGKKSDITKEPWAVGVLVDEKPFCGGSILTANFVITAAQCVDGTKPSDISIHYGSSYRTTKGTSVMAKKIYIVRYHPLTMQNNYAVIETEMPIKLDDKTTKKIELPSLLYDPEPDTSVLVSGWGSTNFKSLEYSGDLMEANFTVVDRKSCEEQYKQIEADKYIYDGVFCAGGEYDETYIGYGDAGDPAVQNGTLVGVASYISSMPSEFPSVFLRVGYYVLDIKDIISGKVKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Group 3 allergen SMIPP-S YvT004A06
publication title Structural mechanisms of inactivation in scabies mite serine protease paralogues.
pubmed doi rcsb
source organism Sarcoptes scabiei type hominis
molecule tags Hydrolase
total genus 59
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3h7tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3h7tA01
4MDSA 2J4IA 2ZQ1A 4DGJA 1D3TB 1BJVA 1E38B 1CBWB 2R2MB 4LZ4B 1NU7B 2NU1E 2IN2A 3GY4A 1BA8B 1CGHA 2TIOA 4J2YB 5E0JA 2OC8A 3BTDE 3MI4A 3M3VA 3RU4D 1OYTH 3W95A 1O3CA 4LK4A 2ZDMA 1GDUA 1TNJA 1NU9A 1NRPH 2FI5E 1YPJH 2PTNA 1GBKA 1J9CH 4CH8B 3U1JB 2BY8X 2A2QH 1PQAA 2HGTH 1ZSJA 1YPGH 1SB1H 1PQ5A 1WTHD 2V35A 4MQAA 1UTNA 3ATKA 2FM2A 4A7IB 1S82A 1AVGH 2BQ7B 4LOYH 1L4DA 2VWLA 3A8CA 1A5IA 5JBCS 4ZAEA 1V2ST 2Q6FA 2PGBB 3PWCA 3M5OA 1SFQB 1ZTLA 1F5RA 3DHKH 3GYLB 1TBQH 4ZKSU 2VIWA 3QN7A 4IC6A 3RP2A 2A1DB 1H8DH 2BZ6H 4MTBA 3TGKE 1O3MA 3VB5A 1SR5C 2BVSH 4ABFA 2PKSC 4TY7A 2BDHA 3RXFA 1QL9A 3CS0A 1E37B 4FVBA 5FBEA 1FPHH 1NFXA 1UTPA 1INCA 2BMGB 2XRCA 1GI9B 1AWHB 4X8UH 5C5NA 3LT3A 4AG1A 1CT4E 1OSSA 2F9VA 4BTTB 1LO6A 1TQ7B 1Y3XA 1NFYA 3OYPA 3ZVBA 1CU1A 1JXPA 2GV7A 3ZVCA 1T4VH 3PWBA 1BT7A 4AFSA 1BOQA 1TNLA 1JWTA 4J1YA 1XKAC 1A46H 4ZUHA 2G52A 2FLBH 5BRRE 2GT7A 4Y8ZA 1E36B 1KDQA 5GPIB 1HNEE 4XBDA 3EDXB 5JB8S 2W3IA 1P10A 3QUMP 1YPEH 2ZQ2A 4A1XA 4DCDA 3LONA 3S9BA 2GZ9A 1ETTH 1HJAB 5A8XA 4GSOA 4XE4A 5FPYA 2FS9A 2VWNA 2JH5D 4HI3A 1MTUA 2Z3CA 1ARBA 3Q3KA 3SV6A 2SGAA 3DFLA 3CENA 2O8LA 1CHGA 1IQNA 1XUHA 1RIWB 3TNSA 1SL3A 1F0SA 1AE8H 1GI6A 4Y79A 1K1JA 5LGOA 3IITA 3V13A 1YPLH 2ZPSA 1SQOA 5IDKA 1LTOA 4WWYA 1GJ8B 1BTUA 1C5MD 4JZIA 3ZYDA 3T29A 2A45B 5CMXH 1C1UH 1J16A 4NWLA 3TU7H 3PTBA 2OC0A 4MVNA 3JZ1B 4DT7B 1QNJA 1DVAH 3GCHC 1BBRE 3RXEA 4B2BA 3ZVDA 1B5GH 2XYAA 1BJUA 3TITA 4GLYA 4NSYA 3L3TA 5A8ZA 5EQRA 2ZF0H 3RXRA 1DLEA 1P2OA 1FN6A 5ESBA 1TPSA 3RXJA 3C1KA 5DG6A 4I8LA 1S0QA 5GCHF 2K1QA 1O3IA 1GVZA 1G30B 4YT7H 1TAWA 2ZCHP 2BDAA 1V2TT 1O37A 4YESB 4CRDA 2STBE 1AO5A 3M5LA 1FY4A 1SGFA 2QXJA 2NU3E 1GI5A 1MKWK 3GISB 3RXGA 2Y5FA 1RJXB 1F2SE 2BX3A 2A4GA 3LPRA 1TNKA 1TIOA 3S69A 2A31A 1GJDB 2ZZUH 2QIQA 1QQ4A 4WMEA 3SZNA 1C1SA 1Z6EA 1SQTA 1O2TA 1HPGA 3NKKA 2O8UA 3P95A 1TLDA 2A5AA 3A8DA 1AVWA 3QZRA 3I77A 3QO6A 1O2OA 2FI3E 3F9GA 4CRCA 1O3LA 1HV7A 2JH6D 2VWOA 3PLBA 4ABIA 4ABDA 5JB9S 4BAHB 1DITH 4GCHF 1AKSB 2F9NA 3GCTG 2VGCC 4Y7AA 5ETXA 1W3CA 2WYJA 1V2UT 4Y11E 1DDJA 2ZFSA 1DFPA 2BLVA 1TGTA 1BMAA 1SGPE 2VIOA 4ZXYH 3URCA 2P3FH 1IQEA 2ZU5A 1GBFA 4X8SH 1O2LA 1BDAA 3E0PB 4GHQA 5L2ZH 1C5QA 1C2DA 1O2YA 3T27A 1O3JA 2V3HH 4U2WA 2G5VA 3RLWH 2P94A 4YLQH 1ZMJA 6GCHF 1XVOA 4B75A 1V2VT 1Y5BT 1FJSA 2WPIS 4FUBA 3U8RH 1YCPH 1ESTA 3GOVB 3M3SA 4CR9A 1XUKA 2OC1A 3LU9B 4U01A 1GHWH 3VFEA 1V2RT 2WPJS 3M37A 2Z9GA 1TGSZ 1GCTB 1SGCA 1SVPA 3P8OA 3KIDU 1NRQH 2VVUA 4E06H 1VJAU 1QJ6B 2QF0A 4ABJA 5TCAA 1DSTA 4X6PA 1DY8A 4KTSA 3SI3H 1CO7E 1DUEA 2FOEA 1C5SA 2PKAB 1O2XA 5CHAB 4A6LA 2Y5GA 1MCTA 4K8BA 4U30A 3RXTA 1WSSH 2QXIA 5F6MA 1C2HA 2FODA 2F9OA 1IHSH 5A09A 1EJNA 1CQQA 2CN0H 3ZVEA 1K1PA 3NUMA 3UNRA 1O2JA 1GBCA 3O8BA 4XBCA 1BRUP 1EASA 2G4UA 4GCHG 4X1PU 1JRTA 1OP2A 3RMOH 1C5RA 1LHDH 2OTVA 1G3EA 3UFAA 4IC5A 1NN6A 1Z71A 2GTBA 1GBIA 4HTCH 5EW1H 1TBZH 2G5NA 3PMJA 2GX4A 4DIIH 3SUEA 4WH8A 1C4V2 1MU8B 1PPGE 4JZEH 1Y5AT 2FLRH 4X6MA 3UPEA 4BXSA 4AGJA 2B8OH 5FHTA 3TH3H 1A0HB 2ODYB 1J15A 3PO1C 4I8HA 1ZZZA 1MUEB 1THPB 4K1EA 4B73A 1XXFA 1MZAA 2PWXA 4ISHH 2B9LA 2Y7XA 2OINA 4AFQA 1S5SA 2BB4A 2WV5A 1G3BA 1T7CA 4NA7A 5EPNA 1C4U2 2ZPQA 1Q3XA 2D8WA 1FV9A 1JIMA 3SU4A 1KXAA 1DWDH 5HYOA 2ZDNA 5EOKA 3A89A 1TABE 4MNXA 1K22H 3A7YA 4Z6AH 1YPHC 1UHBA 3H7TA 3A7TA 2HWLB 1L4ZA 2C8WB 2UUKB 3UR9A 3FFGA 3QGNB 1IQJA 4FUGA 3MYWA 1GHVH 3EE0B 3MH7A 3M7TA 1CE5A 1EOLA 1SGDE 3DD2H 2FPZA 3E1XB 4Q7XA 1P2QA 2QF3A 1SGIB 1NM6A 3L33A 1HAZB 2VNTA 3SU5A 6ESTA 2PTCE 2B5TB 3QDZB 1SLXB 3ATLA 1P57B 1P8VC 2VU8E 2H6MA 5DP3A 3UWIA 1SLWB 2Z9JA 1Y3UA 4R8TB 1CT2E 3T5FH 1N8OC 4DW2U 4CHAC 2HRVA 4FUDA 2C93B 2UUJB 3RXUA 2C3SA 2CF9H 5HMAA 2TGAA 4ABGA 3ZV9A 5DPAA 1P01A 5I25A 3MNBA 4Y7BA 1AI8H 4YO9A 3NK8A 3Q3XA 2ZP0H 2QXGA 5LPRA 1S0RA 1QBVH 1Y3YA 3E0NB 1PQ8A 2EA3A 1AN1E 1T31A 1FY1A 1THRH 2QY0B 2FOGA 1V2MT 1JOUB 2C8ZB 8ESTE 2Y82A 3NZIA 3UQOA 4ZKOU 2F9BH 3ATWA 1MH0A 1HAIH 1SHYA 3QX5H 5GJ4B 2GT8A 2C8XB 3ZZ8A 1UCYK 4NIYA 3LH1A 3T26A 4ABBA 1VITF 1H1BA 1O2ZA 1EAIA 1ZSLA 1E34B 1O30A 4Y0ZE 3RXQA 3HPTB 4YOGA 1VCPA 1ZTKA 1GG6B 1BTPA 1UTMA 4I32A 4JK5A 5AHGH 5ESTE 4X0WU 4OS5A 1QBOA 1YPHE 1HXFH 2SGQE 1YCPK 2NU0E 4D7FA 8GCHG 3FVFB 2GMTB 2WPMS 2PW8H 3RXIA 1ABIH 1XM1A 4CR5A 3MU0A 5E2OA 5LPEA 1O38A 3KN2A 3SU3A 3SUDA 5FAHA 2F3CE 1AFQB 3S9AA 1PPHE 1KY9A 2PUXB 1ANDA 4M7GA 1U6QA 4VGCB 2JETB 3A81A 2ZIQH 1C9PA 4INHA 1QA7A 1TRNA 3SHAH 1HAYB 2DUCA 1ZRKA 1WUNH 2ZGHA 3SNDA 1FAKH 1UVSH 3SHCH 1N1LA 1L1GA 2ZHWH 1XUJA 3MWIU 5TCCA 1TOCB 1LPZB 1A0LA 5GIBA 1SC8U 3GCNA 4VGCC 2C4FH 1B7XB 1HDTH 2RA3A 1NY22 3TIUA 1PPFE 1QL7A 2XBYA 4I31A 5TJXA 1MMJN 1O3FA 1O2NA 3A87A 3GY3A 1DSUA 3LJJA 3QWCH 4TWYA 3RU4E 3V3MA 3PMAB 3Q77A 3PMHB 1EAXA 3ZZ5A 1K1LA 1C5PA 1O36A 2A5IA 1WCZA 3PMBB 7KMEH 3GY5A 3ESTA 4DY7B 4NA9H 5EGMA 1UTLM 1S83A 1TGBA 1GWAA 2G55A 2VIPA 2FOAA 1V2KT 1TYNA 2D1JA 1QCPA 1C5WB 3VB6A 2HLCA 1LHGH 4UONA 1UTJA 1NRRH 2Z7FE 1QRZA 1Z7KA 1IQLA 3UUZA 1VITG 2P8OB 4DG4A 1CSOE 2PHBA 2QV1A 1EAUA 2EEKA 2FYQA 2UWOA 1L1NA 2J92A 2F9PA 2ZHEH 1HAHH 2Q1JA 1KXEA 1H9HE 1YM0A 1GMCF 3B23B 3GY6A 1D6WA 2HOBA 3K9XB 1GGDC 1XUGA 4JZFH 4ZH8A 1AUJA 2BVRH 1GDNA 4FUEA 1QIXB 2XC5A 1C5TA 3LC5A 4B2CA 3MH6A 1MAYA 3BTEE 1O33A 2GCTC 1KXDA 3WY8A 2R2WU 1AMHA 3SV7A 3V0XA 1JMOH 3TH2H 3TNTA 3KEEA 3RXCA 1FIWA 1GI7B 1C2GA 1PFXC 2YOLA 1QB9A 2OC7A 5I46H 2OCVB 2BZAA 4H6TA 4IS5A 4UDWH 3OY6U 2FWWA 4XBBA 1YGCH 1TMBH 2SGPE 1CBWC 1BBRK 1ANCA 1O2PA 1UVTH 1AKSA 1PPBH 2OBQA 1BRAA 1ZPBA 3DFJA 1IQGA 3K2UA 4YZUA 1IQIA 1ANEA 1O2SA 1C5XB 1GL1A 3RC6A 1DICA 1ZHMA 1YCPM 1OYQA 1XX9A 2CMYA 2GZ7A 4JYVH 2AFQB 4O3UA 1LHCH 1O5FH 2AH4X 4ISOA 4F49A 5EXNA 2GCHG 5AF9H 3LOXA 1OX1A 1ZR0A 4E7RG 2PUQH 1CA0B 1GI1A 3F68H 1OPHB 3VB7A 1FY5A 2R3YA 1C5UA 1HYLA 1NT1A 1GBLA 2A5KA 2WINI 3BF6H 1CGIE 5SGAE 1GPZA 4X1SU 2BY9X 3KQEA 1EJAA 2NU2E 1TX6A 2BTCE 2ZU2A 4I8KA 3SBKA 2A4QA 3RXDA 2Z9KA 1TRMA 1UTKA 2FZZA 1O3GA 1VJ9U 3JZ2B 1LPGB 1NC6A 1FZZA 2A7JA 3LGVA 1ACBE 1Z8IB 2BD4A 1J14A 2CJIA 1ZYOA 1Z1JA 2V6NA 3RXOA 4HGCA 1QJ7B 4JYUH 5A2MH 1F7ZA 3RU4T 3TGJE 1AGJA 2ALPA 3M7UA 4UFEH 1DS2E 1O2RA 1OWHA 5FXLA 1HLTH 2NWNA 4Q7ZA 4FUHA 1DPOA 3KNXA 2HPPH 2QGRA 2UWLA 2XBXA 2FOMB 2PKAA 2G81E 1N6XA 4NCYA 4QT8C 3SNEA 3O8DA 2TGDA 3M5MA 5DP7A 5FCRA 5E0GA 1Y8TA 2Y5HA 2VIVA 1GJ5H 1HJAC 1S6HA 1A61H 2CHAB 5JYIA 2BQWB 5DP6A 1ELBA 2TGTA 3QTVH 3A8AA 3OY5U 1C1VH 1TA2A 2FOCA 3A86A 4UFFH 1GCDA 4NFFA 1EB2A 1B0FA 1RIWC 1LVYA 1O3OA 2Z3EA 3BV9B 1NESE 4K1SA 3SQEE 2RA0A 3ZVAA 3ZZ3A 1FIZA 1C1RA 1KXFA 2ZU1A 4CRBA 2WPKS 1P03A 4NIXA 3LIWA 1UK2A 1ZTJA 1YF4A 4OS7A 5DGJA 4I8GA 2ZTXA 1XUIA 1W12U 1SOZA 3FP7E 3LC3A 3U98H 2BDCA 2ANYA 3AAVA 1AU8A 1GBDA 1K21H 3UR6A 2WPHS 5L2YH 1IQMA 5AFZH 1H8IH 1GI8B 1ZGVA 1K1NA 3RXBA 1ABJH 3AASA 2W5EA 1GHZA 3QTOH 1D4PB 2ZDAH 3SQHE 4OS4A 2BD5A 1QB1A 1LKAA 2ILNA 4WXVA 4UE7H 1WTGH 5C1UA 3ATIA 1GI3A 1E35B 2ZFQH 1P09A 2SNVA 4DIHH 3A84A 3E6PH 1W11U 2XWBI 2ZKSA 3RXSA 1P2IA 1S6FA 5JBBS 2HVXA 3SNBA 3SUGA 5K7RA 1FUJA 5F8TA 1SLVB 2O8MA 4DVAU 4XDEA 1YC0A 2DE9A 1O2IA 3TJVA 3GY8A 3GY7A 2WUCA 1JBUH 5JBAS 2ZU3A 1RXPA 2STAE 2H5CA 2IJOB 4CH2B 3TJOA 3D62A 2EI8A 3S7HB 4FUCA 3U1IB 1UTQA 3M3TA 3A7VA 1MAXA 1EKBB 1W10U 1H4WA 1AZZA 2AERH 1IHTH 4RKOB 3SU6A 4AB9A 5GXPA 1QRWA 3M7QA 4Q80A 5C20A 4YTAA 2G51A 2Z3DA 1DE7H 3P8FA 1ETRH 4KTCA 4FUIA 1EUFA 1G32B 1DOJA 1DT2A 1RTFB 1GHAF 3G01A 4FXGH 3NXPA 4ESTE 4Z0KA 3IG6B 4AORA 1C5ZB 1DANH 3C27B 3PB1E 1TA6A 4ASHA 5GCHG 4AB8A 1D9IA 1K1IA 2ANWA 3D23A 4X2YA 2Q6GA 2P59A 1GVLA 2BLWA 4K2YA 1Z8RA 1EX3A 3PV4A 2ZA5A 1JIRA 3RLYH 3KGPA 1C5NH 4ZXXH 4Y6DA 1L1JA 4ABHA 1P11E 3F1SB 3BTFE 2BD8A 1GCTC 2RG3A 1LKBA 3LGIA 1FY8E 4SGAE 2QYIA 1G36A 3NCLA 2VIQA 1OP8A 3L6PA 5T6GA 1LQDB 2ZHQH 3UY9A 3HK6B 2BQ6B 1XXDA 3TJNA 3STIA 1NROH 1GHXH 1S85A 2TGPZ 1WQVH 4SGBE 1MTNB 3VGCB 2BD9A 1Z8JB 1P3EA 2FDAA 4OS2A 4NZQA 1GJAB 3ENSB 2BDGA 1T8LA 4XSKU 1RD3B 3MU8A 4GVUA 5CHAC 3TGIE 1UO6A 4GHTA 4K1TA 1NFUA 1ZMNA 4WH6A 1ID5H 3BIVH 4THNH 3KF2A 5H4IB 1FY3A 1BTHH 1EQ9A 2FESH 3KCGH 1TE0A 4NIWA 6CHAB 3DUXH 7GCHF 4U32A 2A7CA 2OUAA 4O3TA 1GI0A 4NIVA 2OP9A 1AB9B 6GCHG 1BB0B 5EODA 4UEHH 4BNRA 1LQEA 2HALA 1OKXA 2KAIB 2QXHA 3V7TA 5FCKA 2JKHA 2ALVA 2HNTC 4TY6A 1UVUH 2ODQA 4GUXA 5DK1A 1T4UH 1TNGA 1MZDA 1A2CH 1FXYA 3MNCA 3S9CA 1MU6B 3SGQE 1AHTH 1YLDA 1Y3VA 3RXVA 1EPTA 4MNWA 1TGNA 4RSPA 4HFPB 2FOHA 3MU5A 2VH6A 2F91A 2ANMH 2W7SA 3BTTE 1FPCH 2ZHDA 5JPMH 2SGEE 4ZMAH 1O5GH 4TPYA 3KHVA 3GICB 1TONA 1AUTC 2BY6X 2AMPA 4MG3A 3MTYA 3U8TH 3BG4B 3SV9A 3BN9A 3DA9B 7LPRA 1HAOH 2AGIX 4BAKB 3MH4A 1T8OA 1C2FA 1GMHF 1BTZA 4BAMB 2ZO3H 3SV2H 2AGEX 1LVMA 1V2JT 4PROA 4KELA 3RC5A 5C3NA 1CVWH 1P05A 2ZWLH 4X6NA 3V12A 1G3CA 1TBRH 2W3KA 3SNCA 1RFNA 1GBHA 3PLKA 3RC4A 1Z1IA 4FUFA 1NTPA 1X7AC 3ZZAA 2ZFFH 1OWDA 3UNSA 3ZVFA 1C4Y2 3F6UH 2AIPA 2F83A 1GBJA 4D7GA 4HZHA 5FX5A 2V3OH 3SN8A 1YPKH 1D6RA 2YNAA 4ZKRU 1O3NA 2AMDA 2UWPA 1ESBA 1G37A 1OP0A 3O8CA 1GL0E 4OS1A 7GCHG 1LVOA 2LPRA 1QQUA 5B6OA 1YPMH 4X2XA 4NA8A 4ZROA 1C2JA 2WV4A 2NU4E 3F9FA 3RXHA 1PPEE 1ZHPA 1BCUH 2XW9A 1DY9A 2HNTE 5L30H 1SGYE 3S0NA 2ZTYA 4MPWA 1RGQA 3HGNA 1NS3A 1O32A 3R3GB 4R0IA 2GDEH 5EXMA 1MD8A 3TPIZ 3VB4A 1DXPA 1BZXE 1FQ3A 3LGUA 1N6YA 1CT0E 1GJBB 5J4QA 1F5KU 1Z8GA 3IWMA 2WUBA 1DX5M 1NRNH 2J94A 4MLFB 2H9TH 1AQ7A 1EZUC 1PYTD 3ODFA 1QURH 2THFB 1ZHRA 1P2KA 1ZMLA 2DE8A 3K65B 1GG6C 1WV7H 2FIRH 3GDSA 2ANKH 3K6YA 1VR1H 1D3DB 3SJIA 2A4RA 1ZOMA 3SU2A 2ZDLA 3BTGE 3GDVA 5EQQA 4WMDA 4B1TA 1P12E 2GMTC 1EXFA 1GMHG 1TB6H 5HM2A 1O2KA 1BRBE 1S84A 4TWWA 1D3QB 1GBTA 1AE5A 1QB6A 3TLOA 3SJ9A 4B2AA 1A0JA 4Q2KA 5A0CA 3SGAE 9LPRA 4ZHMU 2Z9IA 1BHXF 4RN6A 1AFQC 3UQVA 2B7DH 4YLUA 2CF8H 1V2NT 1FMGA 4K3JA 2FYRA 1TALA 2BXTH 4X2VA 2JETC 1TPPA 4X8TH 1EZQA 5F03A 1L2EA 1NO9H 2XC0A 5IYTA 1F0TA 1GBMA 2RCEA 2IOTA 1KLTA 3TVJB 4K60A 1GMDF 3M35A 1OWKA 2PGQB 1EZXC 4A92A 4DJZB 4ZKNU 3GY2A 1EB1H 2VWMA 2Z94A 3MFJA 1FNIA 1VZQH 2J9NA 2A7HA 1O3BA 1Y3WA 1F92A 2BLQA 4CRGA 1EPTB 2A4OA 3ZZCA 3A82A 2P3TB 1TMUH 1V6DA 3S7KB 3EYDA 1IOEA 1HAVA 1MD7A 5DJ7A 4AG2A 4MNVA 2BY7X 2EI6A 1LHFH 1QY6A 2GKVE 2QA9E 3KL6A 1ZJDA 1GVKB 1C2KA 5C67A 1SLUB 4H42U 1EAWA 1AFEH 4AFUA 2XXLA 1O2VA 5FX6A 1BUIA 1SOTA 4NGAH 4AOQA 1DWEH 2GD4B 4CRAA 4BOHA 1AIXH 1KSNA 1ZJKA 3GYMA 3FP8E 1RRKA 1OWIA 3RXKA 1P2MA 2R0LA 3E91A 3FANA 1O2GH 2P8OC 2ESTE 1JRSA 3TJUA 4YOJA 1ELCA 2BY5X 3F9HA 4UFGH 3MO3A 2XWAA 3BG8A 2FTLE 3UIRA 1EP5A 1ELGA 5EQSA 4E05H 3UWJH 1O2WA 1XVMA 5GDSH 1C1OA 2OXSA 1O3AA 2H2ZA 2BM2A 1CGJE 1W2KH 2OBOA 3R0FA 4XFQA 1SSXA 1C1NA 2O9QA 3URDA 2ZU4A 1W7GH 3LDXH 1BTWA 1KXBA 4OGXA 1QGFA 1THSH 1BQYA 2BOKA 1LMWB 1PJPA 1A4WH 4AZ2B 5C1YA 4GPGA 4KP0A 4IN2A 1W8BH 4X6OA 1QHRB 2ZDVH 3M61U 5FPSA 2QN5T 1QA0A 8KME2 3ZYEA 2Y81A 1KTSB 2A2XH 4I8JA 5FBIA 3VXFH 1HFDA 1GMDG 3SW2B 1DWCH 1O3KA 5EPYA 2ZC9H 3FAOA 1G9IE 3EA7A 4H4FA 1MQ5A 2PKSB 1D3PB 2PR3A 1C9TA 2I6QA 1K28D 3BEUA 4LZ1H 5A0BA 2VIDA 2ZGBH 3TK6A 3KQBA 4B76A 5DO4H 1T32A 1C5OH 1TNHA 4WXIA 3SORA 1AWFH 1TRYA 1NZQH 4E7NA 5C5OA 3HKIB 1F0UA 3AVZA 4BTUB 1C2LA 1QL8A 2AMQA 1VCWA 3HK3B 2G4TA 1GHBF 3W94A 1BRCE 3P92A 2Z9LA 3RMMH 1CA0C 3H7OA 4X2WA 1TPOA 1C5LH 1MQ6A 1GMCG 4CREA 1MKXH 5C2ZA 1O2QA 2FO9A 1H9LB 1KTTB 4JYTA 1O3PB 1P2NA 3LGWA 4IW4E 1DM4B 3A7WA 1J17T 1WQSA 1W0ZU 3ELAH 4UFDH 1PPZA 3LKWA 4X1NU 1SGTA 1SGNE 4INLA 1C1WH 1O5DH 1O0DH 1O31A 3MHWU 1P04A 4NZLA 2J38A 2SGFE 3OSYA 4OGYA 2FX6A 2QC2A 1TPAE 1OOKB 5EW2H 2XBWA 3VXEH 1XUFA 4BAQB 1O34A 1A3EH 2FEQH 1SG8B 1C1TA 2PFEA 5HXFA 5AVDA 2H9HA 2FOFA 3QK1A 3UREA 4WMFA 4KTUA 3PM3A 1ELTA 3GCTF 1AVXA 2VH0A 4F4OC 4TPIZ 1HAVB 1YBWA 1GJ7B 2BDBA 2O8TA 4O03A 3SJOA 2GVFA 3P8GA 1W0YH 1OXGA 5ABWA 1O2UA 3QZQA 2PSXA 4FU9A 3SU1A 2ZCKP 3GCHB 1ELAA 2GZ8A 3U8OH 5EXLA 1F0RA 3N7OA 1O3EA 2UUYA 3BIUH 2CHAC 2YNBA 1LDTT 1HIAB 1LCYA 2XCFA 1G2MA 5T6FA 2FXRA 3NPSA 4K5ZA 3UOUA 2ZCLP 2M5TA 3RMNH 2PSYA 1W7XH 4AYYB 3K6ZA 5FPTA 1FN8A 2CV3A 1C5VA 2FOBA 2Z6BD 3ZVGA 1O5AB 3MO9A 2LNCA 3I29A 1T8NA 4X1RU 4WY3A 4YM9A 2KAIA 2P93A 3ZZ4A 1P9SA 2WYGA 1BMNH 3QLPH 5HGGA 1O5BB 1ELEE 1GHBG 2C90B 1FLEE 3ODDA 4CBNA 3A85A 1GJ4H 1VCQA 1TX8A 4A1VA 3EA9A 3ZV8A 2GGVB 4XOJA 2A0QB 1OWJA 4ISLA 1TGCA 1GBBA 1K2I1 3GCOA 4WJG2 1C1PA 3BTKE 3P6ZB 4NFEA 2FP7B 3BTQE 3LJOA 1P02A 1HUTH 2AYWA 4KGAA 2ZNKH 4Y76A 1ELDE 1LPKB 3A88A 2XTTB 5T3HA 1BTXA 3DT0H 1DLKB 2PLXA 3OX7U 5T6DA 2VINA 2VGCB 2VJ1A 4ISIH 3A7ZA 4JZ1A 1ELVA 2XC4A 4ISNA 1ELFA 1QRXA 2BLOA 4B71A 2GDDA 4H6SB 4BANB 1MBMA 1SHHB 2FS8A 5DP8A 1HJ8A 1V2WT 1HRTH 1F5LA 1O39A 1SI5H 1YKTA 2H9EH 1DWBH 4MNYA 3FP6E 2OQ5A 1KIGH 3P17H 3P8NA 2VVVA 1RTLA 2BDIA 1WU1A 1M9UA 4MPVA 4MPUA 4BTIB 1ZPZA 2J2UA 1CHOF 1BIOA 2QCYA 3OTJE 1AY6H 3U69H 1DUAA 2J34A 3BEFB 1L0ZA 1T8MA 4JCNA 4O9VA 1UCYH 4KKDA 1CA8B 4Y8YA 1FDPA 1Y5UT 2ZFPH 4D9RA 3RXPA 5J4SA 1ORFA 2BX4A 3B9FH 3FZZA 1ZRBA 3TK9A 3VEQB 4CBOA 2Y7ZA 1YLCA 3UTUH 1VITH 3UNQA 1QJ1B 2D26C 1O35A 1V2PT 1SBWA 1RTKA 2GP9B 2XCNA 4ZHAA 1AZ8A 3M36A 3STJA 1Z6JH 3T2NA 4I33A 3SI4H 1O3HA 1VGCB 4GAWA 2B0FA 5DP9A 3RMLH 1UTOA 1EP6A 1C1QA 3MOCA 1KDQB 1MTWA 3PTNA 1GJ6A 1FAXA 1DXWA 3E8LA 2BDYA 1TWXB 1UVPA 2PV9B 1UMAH 2GV6A 3PROA 1C2MA 3FZDA 2OD3B 3SGBE 1YP9A 2H5DA 1HAGE 1QBNA 2ZG0H 1Q31A 3MNSA 1VGCC 1KLJH 3HKJB 5BPEA 1O3DA 2BYAX 2SNWA 1PYTC 5CE1A 3VB3A 5L6NH 1GHYH 4JZDH 1MKXK 2ZFTA 2BD2A 5A8YA 2HNTF 5DKMA 1UVOA 3MU4A 1MTNC 2ZEBA 3VGCC 5E8EH 1ETSH 5E2PA 2R9PA 2ZGCA 1W14U 3Q3YA 5E0HA 5HM9A 2BD3A 3SNAA 3MH5A 3PO1B 1A3BH 4O97A 3KQCA 1GDQA 1LHEH 3ZZ9A 3D49H 2ASUB 3EQ0H 1V2QT 1SPJA 4JK6A 3GDUA 2ZGJA 1GJ9B 5JBTA 1GJCB 3VPKA 3RM2H 1CHOG 1HAXB 2XNIA 2VB0A 2AIQA 4OS6A 7ESTE 1O5CB 1A1RA 4D9QA 1WYKA 1C1MA 1GHAG 4YT6H 3H5CB 6CHAC 1EJMA 1SFIA 1IQHA 3ZZ7A 1FI8A 4IMQA 1SQAA 2EC9H 1AB9C 3RUOA 2CGAA 5EU8A 1IQFA 4NG9H 3Q76A 1S81A 4K69A 9ESTA 3LGTA 1K9OE 1ARCA 1WOFA 1TFXA 2Y80A 2UUFB 1E0FD 1MTSA 1WAYB 2TBSA 2IPHA 1TX7A 3M5NA 1KXCA 4NWKA 4X8VH 1EATA 5EG4A 5A0AE 2R0KA 2SFAA 3BEIB 1SGRE 4INKA 3BTHE 3BTWE 3QGJA 1O2MA 2P3UB 4X1QU 3CP7A 3E90B 1P3CA 1V2LT 2H1UA 2G8TA 2RDLA 8GCHF 1GI4A 2O8WA 3AW1A 3I78A 8LPRA 1XKBC 1QFKH 1XMNB 4I7YH 3HGPA 1PPCE 3O8RA 1TNIA 2BXUH 4RKJB 2P95A 4NSVA 1SGEE 3UOPA 1BMMH 4YOIA 3BG4C 1N8OB 3P70B 4CHAB 1BBRH 2C8YB 5DP5A 3OU0A 1SGQE 3E16B 3TH4H 2CXVA 2Q6DA 1OS8A 3B8JA 1ESAA 4LXBH 4DOQA 2ZPRA 4Y0YE 1ZPCA 1WBGB 1BTYA 1W13U 2AGGX 2G00A 5K0HA 1P0SH 1KYNA 3SJKA 3A8BA 4AX9H 1KLIH 2J95A 3RM0H 1YYY1 2ZFRH 4IBLH 1SGFG 4AYVB 1QTFA 1K1MA 4ABEA 4JMYA 3E3TA 4A1TA 3SO3A 3ZZBA 3SJ8A 1HJ9A 4BXWA 1PQ7A 2ZDKA 2W7UA 3MMGA 2OQUA 1ZSKA 3PYHA 3RDZA 2A32A 2W26A 3ZZ6A 5F8ZA 2ZGXH 3RXAA 4ZHLU 3AAUA 1B0EA 2F9UA 2BD7A 2FMJA 2ZTZA 3AW0A 3SV8A 3T28A 1Q2WA 4D8NA 4UD9H 3NWUA 3ITIA 1G3DA 3BTME 2R3UA 1V3XA 2QAAA 4FUJA 4AFZA 3LGYA 3SU0A 1G2LA 3ATMA 2HPQH 1QR3E 1MBQA 5PTPA 2FTMA 1NRSH 4TYDA 4B74A 4WF8A 2ZI2H 4AGKA 1AD8H 2TPIZ 5G4BA 3F9EA 3MO6A 1C2IA 2ZECA 4BAOB 1MTVA 3ZZDA 1HB0B 1TQ0B 3D65E 4A5TS 4IGDA 1HBTH 3A7XA 1LVBA 1HCGA 2ODPA 2AEIH 3EGKH 1FONA 1P06A 1ZGIA 3PLPA 1K1OA 1ANBA 3A80A 1P9UA 1GBAA 2OLGA 5F8XA 2VVCA 4WVPE 1BITA 1NFWA 1V2OT 2Y6TA 4FU7A 1GI2A 2BOHB 3CS7A 3RXLA 3MU1A 1UK4A 5GWZA 3KQDA 1J8AA 3HATH 4Y71A 3U9AH 1BHXB 1P2JA 1HGTH 6LPRA 5C1XA 3A83A 3BSQA 1OWEA 2FI4E 1HAPH 4DURA 1ZLRA 1MKWH 1A7SA 2SGDE 1H9IE 3T62A 4D76A 4CRFA 3Q00A 2GCHF 1EPTC 5AFYH 1C5YB 4K8YA 4IN1A 2XBVA 4MPXA 2TRMA 2P16A 5LH8A 1UHBB 1SMFE 3RXMA 1HIAA 2I6SA 1TMTH 1HXEH 4IMZA 1EZSC 2EI7A 1O2HA 1Y59T 3SOSA 2ZHFH 1GGDB 5JDUB 4Y10E 4Q7YA 2ULLA 1O5EH 2FX4A 2AS9A 2BVXH 1IAUA 5LPFA 2D2DA 3EA8A 1TOMH 1IQKA 3EAJA 1UK3A 1UJ1A 4Y8XA 5DP4A 1C2EA 2WPLS 1UCYE 2GCTB 1MCVA 2BHGA 4ABAA 3T25A 1RS0A 4FU8A 3SUFA 2V0BA 3MNXA 1NPMA 2JH0D 3LH3A 3TK5A 1A5HA 4FVDA 4AN7A 1BMLA 1EOJA 1GBEA 1A5GH
chains in the Genus database with same CATH superfamily
4MDSA 2J4IA 2ZQ1A 4DGJA 1D3TB 1BJVA 1E38B 1CBWB 2R2MB 4LZ4B 1NU7B 2NU1E 2IN2A 3GY4A 1BA8B 1CGHA 1COWD 2TIOA 4J2YB 2OC8A 3BTDE 3MI4A 5E0JA 5EIYA 3M3VA 3RU4D 1OYTH 3W95A 1O3CA 4LK4A 2ZDMA 1GDUA 1TNJA 2W6JD 1NU9A 1NRPH 2FI5E 1YPJH 2PTNA 3UB0A 1GBKA 1J9CH 4CH8B 3U1JB 2BY8X 2A2QH 1PQAA 2HGTH 1ZSJA 1YPGH 1SB1H 1PQ5A 1WTHD 2V35A 4MQAA 1UTNA 3ATKA 2FM2A 4A7IB 1S82A 1AVGH 2BQ7B 4LOYH 1L4DA 2WPDD 2VWLA 3A8CA 1A5IA 5JBCS 4ZAEA 1V2ST 2Q6FA 2PGBB 3PWCA 3M5OA 1SFQB 1ZTLA 4RI0A 1F5RA 3DHKH 2YMSB 3GYLB 1TBQH 4ZKSU 2VIWA 3QN7A 4IC6A 3RP2A 2A1DB 1H8DH 2BZ6H 4MTBA 3TGKE 1O3MA 3VB5A 1SR5C 2BVSH 4ABFA 3UAIC 2PKSC 4TY7A 2BDHA 3RXFA 1QL9A 3CS0A 1E37B 4FVBA 5FBEA 1FPHH 1NFXA 1UTPA 1INCA 2BMGB 2XRCA 1GI9B 1AWHB 4X8UH 5C5NA 3LT3A 4AG1A 1CT4E 1OSSA 2F9VA 4P00A 4BTTB 1LO6A 1TQ7B 4ACBA 1Y3XA 1NFYA 3VG8A 3OYPA 3ZVBA 1CU1A 4FETA 1JXPA 2GV7A 3ZVCA 1T4VH 3PWBA 1BT7A 4AFSA 1BOQA 1TNLA 2IJD1 1JWTA 4J1YA 1XKAC 1A46H 4ZUHA 2G52A 2FLBH 5BRRE 2GT7A 4Y8ZA 1E36B 1KDQA 3ZIAD 5GPIB 1HNEE 4XBDA 3EDXB 5JB8S 2W3IA 1P10A 3QUMP 1YPEH 2ZQ2A 2KX4A 4A1XA 4DCDA 4ACAA 3LONA 2J98B 3S9BA 2GZ9A 1ETTH 1HJAB 5A8XA 4GSOA 3GS9A 4XE4A 5FPYA 2FS9A 2VWNA 2JH5D 4HI3A 1MTUA 2Z3CA 1ARBA 3Q3KA 3SV6A 2SGAA 3DFLA 3CENA 2O8LA 1CHGA 1IQNA 1XUHA 1RIWB 3TNSA 1SL3A 1F0SA 1AE8H 1GI6A 4Y79A 1K1JA 5LGOA 3IITA 3V13A 1YPLH 2ZPSA 1SQOA 5IDKA 1LTOA 4WWYA 1GJ8B 1BTUA 1C5MD 4JZIA 3ZYDA 3T29A 2A45B 5CMXH 1C1UH 1J16A 4NWLA 5KECA 3TU7H 3PTBA 2OC0A 4MVNA 3PV2A 3JZ1B 4DT7B 1QNJA 1DVAH 3GCHC 1BBRE 3RXEA 4B2BA 3ZVDA 1B5GH 2XYAA 1BJUA 3TITA 4GLYA 4NSYA 2V3MA 3L3TA 5A8ZA 5EQRA 2ZF0H 3RXRA 1DLEA 1P2OA 1FN6A 5ESBA 1TPSA 3RXJA 3C1KA 5DG6A 4I8LA 1S0QA 5GCHF 2K1QA 1O3IA 2JJ1D 5CDFE 1GVZA 1G30B 4YT7H 1TAWA 2ZCHP 1E79D 2BDAA 1V2TT 1O37A 4YESB 4CRDA 2STBE 1AO5A 3M5LA 1FY4A 1SGFA 2QXJA 2NU3E 1GI5A 1MKWK 3GISB 3RXGA 2Y5FA 1RJXB 1F2SE 2BX3A 2A4GA 5IK2D 3LPRA 1TNKA 1TIOA 3S69A 5KEDA 2A31A 1GJDB 2QE7D 2ZZUH 2QIQA 1QQ4A 4WMEA 3SZNA 1C1SA 1Z6EA 1SQTA 1O2TA 1HPGA 3KQ5A 3NKKA 2O8UA 2RFKC 3P95A 1TLDA 2A5AA 3A8DA 1AVWA 3QZRA 3I77A 3QO6A 1O2OA 2FI3E 3F9GA 4CRCA 1O3LA 1HV7A 2JH6D 2VWOA 3PLBA 4ABIA 4ABDA 5JB9S 4BAHB 1DITH 4GCHF 1AKSB 2F9NA 3GCTG 2VGCC 4Y7AA 5ETXA 2AHME 1W3CA 2WYJA 1V2UT 4Y11E 1DDJA 2ZFSA 1DFPA 2BLVA 3F3BA 1TGTA 1VKYA 1BMAA 1SGPE 2VIOA 4ZXYH 3URCA 2P3FH 1IQEA 2ZU5A 1GBFA 4X8SH 1O2LA 1BDAA 3E0PB 4GHQA 2L6OA 5L2ZH 1C5QA 1C2DA 1O2YA 3T27A 1O3JA 2V3HH 4U2WA 2YMSD 2G5VA 3RLWH 2P94A 4YLQH 1ZMJA 6GCHF 1XVOA 4B75A 1V2VT 1Y5BT 1FJSA 2WPIS 4FUBA 3U8RH 1YCPH 1ESTA 2LELA 3GOVB 3M3SA 4CR9A 1XUKA 2OC1A 3LU9B 4U01A 1GHWH 3VFEA 1V2RT 2WPJS 3M37A 5HIZA 2Z9GA 1TGSZ 1GCTB 1SGCA 1SVPA 3P8OA 3KIDU 1NRQH 2VVUA 4E06H 1VJAU 1QJ6B 2QF0A 4ABJA 5TCAA 1DSTA 4X6PA 1DY8A 4KTSA 3SI3H 1CO7E 1DUEA 2FOEA 1C5SA 2PKAB 1O2XA 5CHAB 4A6LA 2Y5GA 1MCTA 4K8BA 4U30A 3RXTA 1WSSH 2QXIA 5F6MA 1C2HA 2FODA 2F9OA 1IHSH 5A09A 2QF5A 1EJNA 1CQQA 2CN0H 5GNDA 3ZVEA 1K1PA 3NUMA 3UNRA 1O2JA 1GBCA 3O8BA 4XBCA 1BRUP 1EASA 2G4UA 4GCHG 4X1PU 1JRTA 1OP2A 3RMOH 1C5RA 1LHDH 2OTVA 1G3EA 2V7QD 3UFAA 4IC5A 1NN6A 1Z71A 2GTBA 1GBIA 4HTCH 5EW1H 1TBZH 2G5NA 3PMJA 2GX4A 4DIIH 3SUEA 4WH8A 1C4V2 1MU8B 1PPGE 5HIYA 4JZEH 1Y5AT 2FLRH 4X6MA 3UPEA 4BXSA 4ZCNA 4AGJA 2B8OH 5FHTA 3TH3H 1A0HB 2ODYB 1J15A 3PO1C 4I8HA 1ZZZA 1MUEB 1THPB 4K1EA 4B73A 1XXFA 1MZAA 2PWXA 4ISHH 2B9LA 2Y7XA 2OINA 4AFQA 1S5SA 2BB4A 2WV5A 1G3BA 3KYGA 1T7CA 4NA7A 5EPNA 1C4U2 2ZPQA 1Q3XA 2D8WA 1FV9A 1JIMA 1UW7A 3SU4A 1KXAA 1DWDH 2WV9A 5HYOA 2ZDNA 3FOAA 5EOKA 3A89A 1TABE 4MNXA 1K22H 5HKKD 3A7YA 4Z6AH 1YPHC 1UHBA 3H7TA 3A7TA 2HWLB 1L4ZA 2C8WB 2UUKB 3UR9A 3FFGA 3QGNB 1IQJA 4FUGA 3MYWA 1GHVH 3EE0B 3MH7A 3M7TA 1CE5A 1EOLA 1SGDE 3DD2H 3AK5A 2FPZA 3E1XB 4Q7XA 1P2QA 2QF3A 1SGIB 1NM6A 3L33A 1HAZB 2JIZD 2VNTA 3SU5A 6ESTA 2PTCE 2B5TB 5C0UA 3QDZB 1SLXB 3ATLA 1P57B 1P8VC 2VU8E 2H6MA 5DP3A 3UWIA 1SLWB 2Z9JA 1Y3UA 4R8TB 1CT2E 3T5FH 1N8OC 4DW2U 4CHAC 2HRVA 4FUDA 2C93B 2UUJB 3RXUA 2C3SA 2CF9H 5HMAA 2TGAA 4ABGA 3ZV9A 5DPAA 1P01A 5I25A 3MNBA 4Y7BA 1AI8H 4YO9A 3NK8A 3Q3XA 2ZP0H 4B6FA 2QXGA 5LPRA 1S0RA 1QBVH 1Y3YA 3E0NB 1PQ8A 2EA3A 1AN1E 1T31A 1FY1A 1THRH 2QY0B 2FOGA 1V2MT 1JOUB 2C8ZB 8ESTE 2Y82A 3NZIA 3UQOA 4ZKOU 2F9BH 3ATWA 3F2HA 1MH0A 1HAIH 1SHYA 3QX5H 5GJ4B 2GT8A 2C8XB 3ZZ8A 1UCYK 4NIYA 3LH1A 3T26A 4ABBA 1VITF 1H1BA 1O2ZA 1EAIA 1ZSLA 1E34B 1O30A 4Y0ZE 3RXQA 3HPTB 4YOGA 1VCPA 1ZTKA 1GG6B 1BTPA 1UTMA 4I32A 4JK5A 5AHGH 3DSGA 5ESTE 4X0WU 4OS5A 1QBOA 3PV5A 1YPHE 1HXFH 2SGQE 1YCPK 2NU0E 4D7FA 8GCHG 3FVFB 2GMTB 2WPMS 2PW8H 3RXIA 1ABIH 1XM1A 4CR5A 3MU0A 5E2OA 5LPEA 1O38A 3KN2A 3SU3A 3SUDA 5FAHA 2F3CE 1AFQB 5F53A 3S9AA 1PPHE 1KY9A 2PUXB 1ANDA 4M7GA 1U6QA 4VGCB 2JETB 3A81A 2ZIQH 1C9PA 4INHA 1QA7A 1TRNA 3SHAH 3DSOA 1HAYB 2DUCA 1ZRKA 1WUNH 2ZGHA 3SNDA 4P02A 1FAKH 1UVSH 3SHCH 1N1LA 1FX0B 1SQRA 1L1GA 2ZHWH 1XUJA 3MWIU 5TCCA 1TOCB 1LPZB 2J98A 1A0LA 5GIBA 1SC8U 3GCNA 4VGCC 2C4FH 1B7XB 1HDTH 2RA3A 1NY22 3TIUA 1PPFE 1QL7A 2XBYA 4I31A 5TJXA 1MMJN 1O3FA 1O2NA 3A87A 3GY3A 1DSUA 3LJJA 3QWCH 4TWYA 3RU4E 3V3MA 3PMAB 3Q77A 3PMHB 1EAXA 3ZZ5A 1K1LA 1C5PA 1O36A 2A5IA 1WCZA 3PMBB 7KMEH 3GY5A 3ESTA 4DY7B 4NA9H 5EGMA 1UTLM 1S83A 1TGBA 1GWAA 2G55A 2VIPA 2FOAA 1V2KT 1TYNA 2D1JA 1QCPA 3PRDA 1C5WB 3VB6A 2HLCA 1LHGH 4UONA 1UTJA 1NRRH 2Z7FE 1QRZA 1Z7KA 1IQLA 3PRBA 1VITG 2P8OB 3UUZA 4DG4A 1CSOE 2PHBA 2QV1A 1EAUA 2EEKA 2FYQA 2UWOA 1L1NA 2J92A 2F9PA 2ZHEH 1HAHH 2Q1JA 1KXEA 1H9HE 2F4LA 1YM0A 1GMCF 3B23B 3GY6A 1D6WA 2HOBA 3K9XB 1GGDC 1XUGA 4JZFH 4ZH8A 1AUJA 2BVRH 1GDNA 4FUEA 1QIXB 2XC5A 1C5TA 3LC5A 4B2CA 3MH6A 1MAYA 3BTEE 1O33A 2GCTC 1KXDA 3WY8A 2R2WU 1AMHA 5FL7D 3SV7A 3V0XA 1JMOH 3TH2H 3TNTA 3KEEA 3RXCA 1FIWA 1GI7B 1C2GA 1PFXC 2YOLA 1QB9A 2OC7A 5I46H 2OCVB 2BZAA 4H6TA 4IS5A 4UDWH 3OY6U 2FWWA 4XBBA 1YGCH 1TMBH 2SGPE 1CBWC 1BBRK 1ANCA 1O2PA 1UVTH 1AKSA 1PPBH 2OBQA 1BRAA 3DCLA 1ZPBA 3DFJA 1IQGA 3K2UA 4YZUA 1IQIA 1ANEA 1O2SA 1C5XB 1GL1A 3RC6A 2XOKD 1DICA 1ZHMA 1QZ8A 1OYQA 1YCPM 1XX9A 2CMYA 2GZ7A 5EJLA 4JYVH 2AFQB 4O3UA 1YLNA 1LHCH 1O5FH 2AH4X 4ISOA 4F49A 5EXNA 2GCHG 5AF9H 3LOXA 1OX1A 1ZR0A 4E7RG 2PUQH 1CA0B 1GI1A 3F68H 1OPHB 3VB7A 1FY5A 2R3YA 1C5UA 1HYLA 1NT1A 1GBLA 2A5KA 3NRLA 2WINI 3BF6H 2YMSC 1CGIE 5SGAE 1GPZA 4X1SU 2BY9X 3KQEA 2K0QA 1EJAA 2NU2E 1TX6A 2BTCE 2ZU2A 4I8KA 3SBKA 2A4QA 3RXDA 2Z9KA 1TRMA 1UTKA 2FZZA 4XD7D 1O3GA 1VJ9U 3JZ2B 1LPGB 1NC6A 1W0KD 1FZZA 2A7JA 3LGVA 1ACBE 1Z8IB 2BD4A 1J14A 2CJIA 1ZYOA 1Z1JA 2V6NA 3RXOA 4HGCA 1QJ7B 2KCAA 4JYUH 5A2MH 1F7ZA 3RU4T 3TGJE 1AGJA 2ALPA 3M7UA 4UFEH 1DS2E 1O2RA 1OWHA 5FXLA 1HLTH 2NWNA 4Q7ZA 4FUHA 1DPOA 2KCOA 3KNXA 2HPPH 2QGRA 2UWLA 2XBXA 2FOMB 2PKAA 2G81E 1N6XA 4NCYA 2L74A 4QT8C 3SNEA 3O8DA 2TGDA 3M5MA 5DP7A 5FCRA 5E0GA 1Y8TA 2Y5HA 2KR7A 2VIVA 1GJ5H 1HJAC 1S6HA 1A61H 2CHAB 5JYIA 2BQWB 5DP6A 1ELBA 2TGTA 3QTVH 3A8AA 3OY5U 1C1VH 1TA2A 2FOCA 3A86A 4UFFH 1GCDA 4NFFA 1EB2A 1B0FA 1RIWC 1LVYA 1O3OA 2WHXA 2Z3EA 1NESE 3BV9B 4K1SA 2RA0A 3SQEE 3ZVAA 3ZZ3A 1FIZA 1C1RA 1KXFA 2ZU1A 4CRBA 2WPKS 1P03A 2F43B 4NIXA 3LIWA 1UK2A 1ZTJA 1YF4A 1S6LA 4OS7A 5DGJA 4I8GA 2ZTXA 1XUIA 1W12U 1SOZA 3FP7E 3LC3A 3U98H 2BDCA 2ANYA 3AAVA 1AU8A 1GBDA 1K21H 3UR6A 2WPHS 5L2YH 1IQMA 2OK5A 5AFZH 1H8IH 1GI8B 1ZGVA 1K1NA 3RXBA 1ABJH 3AASA 2W5EA 1GHZA 3QTOH 1D4PB 2ZDAH 3SQHE 4OS4A 2BD5A 1QB1A 1LKAA 2ILNA 4WXVA 4UE7H 1WTGH 5C1UA 3ATIA 4OM9A 1GI3A 1E1RD 1E35B 2EY4C 3F0PA 4I86A 2ZFQH 3H09A 1P09A 2SNVA 4DIHH 3A84A 3E6PH 1W11U 2XWBI 2ZKSA 3RXSA 4FOUC 1P2IA 1S6FA 5JBBS 2HVXA 3SNBA 3SUGA 5K7RA 1FUJA 5F8TA 1SLVB 2O8MA 4DVAU 4XDEA 1YC0A 2DE9A 1O2IA 3TJVA 3OTPA 3GY8A 3GY7A 2WUCA 1JBUH 5JBAS 2ZU3A 3OEED 1RXPA 2STAE 2H5CA 2IJOB 4CH2B 3TJOA 3D62A 2EI8A 3S7HB 4FUCA 3U1IB 1UTQA 3M3TA 3A7VA 1MAXA 1EKBB 3WWFA 1W10U 1H4WA 1AZZA 2AERH 1IHTH 4RKOB 3SU6A 4AB9A 5GXPA 1QRWA 4AC9A 3M7QA 4Q80A 1BMFD 5C20A 4YTAA 2G51A 2Z3DA 1DE7H 1H8HD 3P8FA 1ETRH 4KTCA 4FUIA 1EUFA 1G32B 1DOJA 1DT2A 1RTFB 1GHAF 3G01A 2KCPA 4FXGH 3NXPA 4ESTE 1E1QD 4Z0KA 3IG6B 4AORA 1EFRD 1C5ZB 1DANH 4B6EA 3C27B 3PB1E 1TA6A 4ASHA 5GCHG 4AB8A 1D9IA 1K1IA 2ANWA 3D23A 4X2YA 2Q6GA 2P59A 1GVLA 2BLWA 4K2YA 1Z8RA 1EX3A 3PV4A 2ZA5A 1JIRA 5T1VA 3RLYH 3KGPA 1C5NH 4ZXXH 4Y6DA 1L1JA 4ABHA 1P11E 3F1SB 3BTFE 2BD8A 1GCTC 2RG3A 1LKBA 3LGIA 1FY8E 4SGAE 2QYIA 1G36A 3NCLA 2VIQA 1OP8A 3L6PA 5T6GA 1LQDB 2ZHQH 3UY9A 3HK6B 2BQ6B 1XXDA 3TJNA 3STIA 1NROH 1GHXH 1S85A 2TGPZ 4ASUD 1WQVH 4SGBE 1MTNB 3VGCB 2BD9A 1Z8JB 1P3EA 2FDAA 4OS2A 4NZQA 1GJAB 3ENSB 2BDGA 1T8LA 4XSKU 1RD3B 3MU8A 4GVUA 5CHAC 3TGIE 1UO6A 4GHTA 4K1TA 1NFUA 1ZMNA 4WH6A 1ID5H 3BIVH 4THNH 3KF2A 5H4IB 1FY3A 2EQNA 1BTHH 1EQ9A 2FESH 3KCGH 1TE0A 4NIWA 6CHAB 3DUXH 7GCHF 4U32A 2A7CA 2OUAA 4O3TA 2VBCA 1GI0A 4NIVA 2OP9A 1AB9B 6GCHG 1BB0B 5EODA 4UEHH 4BNRA 1LQEA 2HALA 1OKXA 2KAIB 2QXHA 3V7TA 5FCKA 2JKHA 5EJ1A 2ALVA 2HNTC 4TY6A 1UVUH 2ODQA 4GUXA 5DK1A 1T4UH 1TNGA 1MZDA 1A2CH 1FXYA 3OAAD 3MNCA 3S9CA 1MU6B 3SGQE 1AHTH 1YLDA 1Y3VA 3RXVA 1EPTA 4MNWA 1TGNA 4RSPA 4HFPB 2FOHA 3MU5A 2VH6A 2F91A 3FO8D 2ANMH 2W7SA 3BTTE 1FPCH 2ZHDA 5JPMH 2SGEE 4ZMAH 1O5GH 4TPYA 3KHVA 3GICB 2KCYA 1TONA 1AUTC 5C94A 2BY6X 2AMPA 4MG3A 3MTYA 3U8TH 3BG4B 3SV9A 3BN9A 3DA9B 7LPRA 1HAOH 2AGIX 4BAKB 3MH4A 1T8OA 1C2FA 1GMHF 1BTZA 4BAMB 2ZO3H 3SV2H 4RT1A 2AGEX 1LVMA 1V2JT 4PROA 4KELA 3RC5A 5C3NA 1CVWH 1P05A 2ZWLH 4X6NA 3V12A 1G3CA 1TBRH 2W3KA 3SNCA 4DT4A 1RFNA 1GBHA 3PLKA 3RC4A 1Z1IA 4FUFA 1NTPA 1X7AC 3ZZAA 2ZFFH 2HLDD 1OWDA 3UNSA 3ZVFA 1C4Y2 3F6UH 2AIPA 2F83A 1GBJA 4D7GA 3FKSD 4HZHA 5FX5A 2V3OH 3SN8A 1YPKH 1D6RA 1NBME 2YNAA 4ZKRU 1O3NA 2AMDA 2UWPA 1ESBA 1G37A 1OP0A 3O8CA 1GL0E 4OS1A 7GCHG 1LVOA 2LPRA 1QQUA 3EE7A 5B6OA 1YPMH 3N7EA 4X2XA 4NA8A 4ZROA 1C2JA 2WV4A 2NU4E 3F9FA 3RXHA 1PPEE 1ZHPA 3MQKC 1BCUH 2XW9A 1DY9A 2HNTE 5L30H 1SGYE 3S0NA 2ZTYA 4MPWA 1RGQA 3HGNA 1NS3A 1O32A 3R3GB 4R0IA 2KZ4A 2GDEH 5EXMA 1MD8A 3TPIZ 3VB4A 1DXPA 1BZXE 1FQ3A 3LGUA 1N6YA 1CT0E 1GJBB 5J4QA 1F5KU 1Z8GA 3IWMA 1SKYE 2WUBA 1DX5M 1NRNH 2J94A 3FN8A 4MLFB 2H9TH 1AQ7A 1EZUC 3CNRA 1PYTD 3ODFA 1QURH 2THFB 1ZHRA 1P2KA 1ZMLA 2DE8A 3K65B 1GG6C 1WV7H 2FIRH 3GDSA 2ANKH 3K6YA 1VR1H 1MABB 1D3DB 3SJIA 2A4RA 1ZOMA 3SU2A 1W0JD 2ZDLA 3BTGE 3GDVA 5EQQA 4WMDA 4B1TA 1P12E 2GMTC 1EXFA 1GMHG 1TB6H 5HM2A 1O2KA 1NBMD 1BRBE 1S84A 4TWWA 1D3QB 1GBTA 1AE5A 1QB6A 5DN6D 3TLOA 3SJ9A 4B2AA 1A0JA 4Q2KA 5A0CA 3SGAE 9LPRA 4ZHMU 2Z9IA 1BHXF 4RN6A 1AFQC 3UQVA 2B7DH 4YLUA 2CF8H 1V2NT 1FMGA 4K3JA 2FYRA 1TALA 2BXTH 4X2VA 2JETC 1TPPA 4X8TH 1EZQA 2KFWA 5F03A 2GJGA 1L2EA 1NO9H 2XC0A 5IYTA 1F0TA 1GBMA 2RCEA 2IOTA 1KLTA 3TVJB 4K60A 1GMDF 3M35A 1OWKA 2PGQB 1EZXC 4A92A 4DJZB 4ZKNU 3GY2A 1EB1H 2VWMA 2Z94A 3MFJA 1FNIA 1VZQH 2J9NA 2A7HA 1O3BA 1Y3WA 1F92A 2BLQA 4CRGA 1EPTB 2A4OA 3ZZCA 3A82A 2P3TB 1TMUH 1V6DA 3S7KB 3EYDA 1IOEA 1HAVA 1MD7A 5DJ7A 4AG2A 4MNVA 2BY7X 2EI6A 1LHFH 1QY6A 2GKVE 2QA9E 3KL6A 1ZJDA 4F55A 1GVKB 1C2KA 5C67A 1SLUB 4H42U 1EAWA 1AFEH 4AFUA 4Q63A 2XXLA 1O2VA 5FX6A 4YXWD 1BUIA 1SOTA 4NGAH 4AOQA 1DWEH 2GD4B 4CRAA 3DSPA 4BOHA 1AIXH 1KSNA 1ZJKA 1WDIA 3GYMA 3FP8E 1RRKA 1OWIA 3RXKA 1P2MA 2R0LA 3E91A 3FANA 1O2GH 2P8OC 4F48B 2ESTE 1JRSA 3TJUA 4YOJA 1ELCA 2BY5X 2W6ID 3F9HA 4UFGH 3MO3A 2XWAA 3BG8A 2FTLE 3UIRA 1EP5A 1ELGA 5EQSA 4E05H 3UWJH 1O2WA 1XVMA 5GDSH 1C1OA 3F0OA 2OXSA 1O3AA 2H2ZA 2BM2A 1CGJE 1W2KH 2OBOA 3R0FA 4XFQA 1SSXA 1C1NA 4TT3D 2O9QA 3URDA 2ZU4A 1W7GH 3LDXH 1BTWA 1KXBA 4OGXA 1QGFA 1THSH 1BQYA 2BOKA 1LMWB 1PJPA 5C0TA 1A4WH 4AZ2B 5C1YA 4GPGA 4KP0A 4IN2A 1W8BH 4X6OA 1QHRB 2CK3D 4XRNA 2ZDVH 3M61U 5FPSA 2QN5T 1QA0A 8KME2 3ZYEA 2Y81A 1KTSB 2A2XH 4I8JA 5FBIA 3VXFH 1HFDA 1GMDG 3SW2B 1DWCH 1O3KA 5EPYA 2ZC9H 3FAOA 1G9IE 3EA7A 4H4FA 1MQ5A 2PKSB 1D3PB 2PR3A 1KMHB 1C9TA 2I6QA 1K28D 3BEUA 4LZ1H 5A0BA 2VIDA 2ZGBH 3TK6A 3KQBA 4B76A 5DO4H 1T32A 1C5OH 1TNHA 4WXIA 3SORA 1AWFH 1TRYA 1NZQH 3N7DA 4E7NA 5C5OA 3HKIB 1F0UA 3AVZA 4BTUB 1C2LA 1QL8A 2AMQA 1VCWA 3HK3B 2G4TA 1GHBF 3W94A 1BRCE 3P92A 2K8IA 2Z9LA 1CA0C 3RMMH 3H7OA 4X2WA 1TPOA 1C5LH 1MQ6A 1GMCG 4CREA 1MKXH 5C2ZA 1O2QA 2FO9A 1H9LB 1KTTB 4JYTA 1O3PB 1P2NA 3LGWA 4IW4E 1DM4B 3A7WA 1J17T 1WQSA 1W0ZU 3ELAH 4UFDH 1PPZA 3LKWA 4X1NU 1SGTA 1SGNE 4INLA 1C1WH 1O5DH 1O0DH 1O31A 3MHWU 1P04A 4NZLA 2J38A 2SGFE 2HVYB 3OSYA 4OGYA 2FX6A 2QC2A 1TPAE 1OOKB 5EW2H 2XBWA 3VXEH 1XUFA 4BAQB 1O34A 1A3EH 2FEQH 1SG8B 1C1TA 2PFEA 3WW7A 5HXFA 5AVDA 2H9HA 2FOFA 3QK1A 3UREA 1K0HA 4WMFA 4KTUA 3PM3A 1ELTA 1YY3A 3GCTF 1AVXA 2VH0A 4F4OC 4TPIZ 1HAVB 1YBWA 1GJ7B 2BDBA 2O8TA 4O03A 3SJOA 2GVFA 3P8GA 1W0YH 1OXGA 5ABWA 1O2UA 3QZQA 2PSXA 4FU9A 3SU1A 2ZCKP 2PP6A 3GCHB 1ELAA 2GZ8A 3U8OH 5EXLA 1F0RA 3N7OA 1O3EA 5DSFA 1OHHD 2UUYA 3BIUH 2CHAC 2YNBA 1LDTT 1HIAB 1LCYA 2XCFA 1G2MA 5T6FA 2QF4A 2FXRA 3NPSA 4K5ZA 3UOUA 2ZCLP 2M5TA 3RMNH 2PSYA 1W7XH 4AYYB 3K6ZA 5FPTA 1FN8A 2CV3A 1C5VA 2FOBA 4RT0A 2Z6BD 3ZVGA 1O5AB 3MO9A 2LNCA 2WSSD 3I29A 1T8NA 4X1RU 4WY3A 4YM9A 2KAIA 2P93A 3ZZ4A 1P9SA 2WYGA 1BMNH 3QLPH 1WXRA 5HGGA 1O5BB 2KM0A 1ELEE 1GHBG 2C90B 1FLEE 3ODDA 4CBNA 3A85A 1GJ4H 1VCQA 1TX8A 5B6LA 4A1VA 3EA9A 3N99A 3ZV8A 2GGVB 4XOJA 2A0QB 1OWJA 4ISLA 1TGCA 1GBBA 1K2I1 3GCOA 4WJG2 1C1PA 3BTKE 2M2AA 3P6ZB 3F2GA 4NFEA 5EJZA 2FP7B 3BTQE 3LJOA 1P02A 1HUTH 2AYWA 2WZQA 4KGAA 2ZNKH 4Y76A 1ELDE 1LPKB 3A88A 2XTTB 5T3HA 1BTXA 3DT0H 1DLKB 2PLXA 3OX7U 5T6DA 2VINA 2VGCB 2VJ1A 1H8ED 4ISIH 3A7ZA 4TSFD 4JZ1A 1ELVA 2XC4A 4ISNA 1ELFA 1QRXA 2BLOA 4B71A 2GDDA 4H6SB 4BANB 1MBMA 1SHHB 2FS8A 5DP8A 1HJ8A 1V2WT 1HRTH 1F5LA 1O39A 1SI5H 1YKTA 2H9EH 1DWBH 4MNYA 3FP6E 2OQ5A 1KIGH 3P17H 3P8NA 2VVVA 1RTLA 2BDIA 1WU1A 1M9UA 4MPVA 4MPUA 4BTIB 1ZPZA 2J2UA 1CHOF 1BIOA 2QCYA 3OTJE 1AY6H 3U69H 1DUAA 2J34A 3BEFB 1L0ZA 1T8MA 4JCNA 4O9VA 1UCYH 4KKDA 1CA8B 4Y8YA 1FDPA 1Y5UT 2ZFPH 4D9RA 3RXPA 5J4SA 1ORFA 2BX4A 3B9FH 3FZZA 1ZRBA 3TK9A 3VEQB 4CBOA 2Y7ZA 1YLCA 3UTUH 1VITH 3UNQA 1QJ1B 2D26C 1O35A 1V2PT 1SBWA 1RTKA 2GP9B 2XCNA 4ZHAA 1AZ8A 3M36A 3STJA 1Z6JH 3T2NA 4I33A 3SI4H 1O3HA 1VGCB 4GAWA 2B0FA 5DP9A 3RMLH 1UTOA 1EP6A 1C1QA 3MOCA 1KDQB 1MTWA 3PTNA 1GJ6A 1FAXA 1DXWA 3E8LA 2BDYA 1TWXB 1UVPA 2PV9B 1UMAH 2GV6A 3PROA 1C2MA 3FZDA 2OD3B 3SGBE 1YP9A 2H5DA 1HAGE 1QBNA 5KGOA 2ZG0H 1Q31A 3MNSA 1VGCC 1KLJH 3HKJB 5BPEA 1O3DA 2BYAX 2SNWA 1PYTC 5CE1A 3VB3A 5L6NH 1GHYH 4JZDH 1MKXK 2ZFTA 2BD2A 5A8YA 2HNTF 5DKMA 1UVOA 3MU4A 1MTNC 2ZEBA 3VGCC 5E8EH 1ETSH 5E2PA 2R9PA 2ZGCA 1W14U 3Q3YA 5E0HA 5HM9A 2BD3A 3SNAA 3MH5A 3PO1B 1A3BH 4O97A 3KQCA 1GDQA 1LHEH 3ZZ9A 3D49H 2ASUB 3EQ0H 1V2QT 1SPJA 4JK6A 3F2FA 3GDUA 2ZGJA 1GJ9B 5JBTA 1GJCB 3VPKA 3RM2H 1CHOG 1HAXB 2XNIA 2JDID 2VB0A 2AIQA 4OS6A 7ESTE 1O5CB 1A1RA 4D9QA 1WYKA 1C1MA 1GHAG 4YT6H 3H5CB 6CHAC 1EJMA 1SFIA 1IQHA 3ZZ7A 1FI8A 4IMQA 1SQAA 2EC9H 1AB9C 3RUOA 2CGAA 5EU8A 1IQFA 4NG9H 3Q76A 1S81A 4K69A 9ESTA 3LGTA 1K9OE 1ARCA 1WOFA 1TFXA 2Y80A 2UUFB 1E0FD 1MTSA 1WAYB 2TBSA 2IPHA 1TX7A 3M5NA 1KXCA 4NWKA 4X8VH 1EATA 5EG4A 5A0AE 2R0KA 2SFAA 3BEIB 1SGRE 4INKA 3BTHE 3BTWE 3QGJA 1O2MA 2P3UB 4X1QU 3CP7A 3E90B 1P3CA 1V2LT 2H1UA 2G8TA 2RDLA 3OE7D 4Q4LA 8GCHF 1GI4A 2O8WA 3AW1A 3I78A 8LPRA 1XKBC 1QFKH 1XMNB 4I7YH 3HGPA 1PPCE 3O8RA 1TNIA 2BXUH 4RKJB 2P95A 4NSVA 1SGEE 3UOPA 1BMMH 4YOIA 3BG4C 1N8OB 3P70B 4CHAB 1BBRH 2C8YB 5DP5A 3OU0A 1SGQE 3E16B 3TH4H 2CXVA 2Q6DA 3KYFA 1OS8A 3B8JA 1ESAA 4LXBH 4DOQA 2ZPRA 4Y0YE 1ZPCA 1WBGB 1BTYA 1W13U 2AGGX 2G00A 5K0HA 1P0SH 1KYNA 3SJKA 3A8BA 2J5UA 4AX9H 1KLIH 2J95A 3RM0H 1YYY1 2IPQX 2JJ2D 5CHBA 2ZFRH 3W1EA 4IBLH 1SGFG 4AYVB 1QTFA 1K1MA 4ABEA 4JMYA 3E3TA 4A1TA 3SO3A 3ZZBA 3SJ8A 1HJ9A 4BXWA 1PQ7A 1YWUA 2ZDKA 2W7UA 3MMGA 2OQUA 1ZSKA 3PYHA 3RDZA 2A32A 2W26A 3ZZ6A 5F8ZA 2ZGXH 3RXAA 4ZHLU 3AAUA 1B0EA 2F9UA 2BD7A 2LP6A 2FMJA 2ZTZA 3AW0A 3SV8A 3T28A 1Q2WA 4D8NA 4UD9H 3NWUA 3ITIA 1G3DA 3BTME 2R3UA 1V3XA 2QAAA 4FUJA 4AFZA 3LGYA 3SU0A 1G2LA 3ATMA 2HPQH 1QR3E 1MBQA 5PTPA 2FTMA 1NRSH 4TYDA 4B74A 4WF8A 2ZI2H 4AGKA 1AD8H 2TPIZ 5G4BA 3F9EA 3SYJA 3MO6A 1C2IA 2ZECA 4BAOB 1MTVA 3ZZDA 3WWBA 1HB0B 1TQ0B 3D65E 4A5TS 4IGDA 1HBTH 3OEHD 3A7XA 1LVBA 1HCGA 2ODPA 2AEIH 3EGKH 1FONA 1P06A 1ZGIA 3PLPA 1K1OA 1ANBA 3A80A 1P9UA 5C17A 1GBAA 2OLGA 2RDEA 5F8XA 2VVCA 4WVPE 1BITA 3SZEA 1NFWA 1V2OT 2Y6TA 4FU7A 1GI2A 2BOHB 3CS7A 3RXLA 3MU1A 1UK4A 5GWZA 3KQDA 1J8AA 3HATH 4Y71A 3U9AH 1BHXB 1P2JA 3OFND 1HGTH 6LPRA 5C1XA 3A83A 3BSQA 1OWEA 2FI4E 1HAPH 4DURA 1ZLRA 1MKWH 1A7SA 2SGDE 1H9IE 3T62A 4D76A 4CRFA 3Q00A 2GCHF 1EPTC 5AFYH 1C5YB 4K8YA 4IN1A 2XBVA 4MPXA 2TRMA 3U28C 2P16A 5LH8A 1UHBB 1SMFE 3RXMA 1HIAA 2I6SA 1TMTH 1HXEH 4IMZA 1EZSC 2EI7A 1O2HA 1Y59T 4HG6A 3SOSA 2ZHFH 1GGDB 5JDUB 2XNDD 4Y10E 4Q7YA 2ULLA 1O5EH 2FX4A 2AS9A 2BVXH 1IAUA 4Z1MD 5LPFA 4M9FA 2D2DA 3EA8A 1TOMH 1IQKA 3EAJA 1UK3A 1UJ1A 4Y8XA 5DP4A 1C2EA 2WPLS 1UCYE 2GCTB 1MCVA 2BHGA 4ABAA 3T25A 1RS0A 4FU8A 3SUFA 2J97A 2V0BA 3MNXA 1NPMA 2JH0D 3LH3A 3TK5A 1A5HA 4FVDA 4AN7A 1BMLA 1EOJA 1GBEA 1A5GH
chains in the Genus database with same CATH topology
4MDSA 2J4IA 2ZQ1A 4DGJA 1D3TB 1BJVA 1E38B 1CBWB 2R2MB 4LZ4B 1NU7B 2NU1E 2IN2A 3GY4A 1BA8B 1CGHA 2TIOA 4J2YB 5E0JA 2OC8A 3BTDE 3MI4A 3M3VA 3RU4D 1OYTH 3W95A 1O3CA 4LK4A 2ZDMA 1GDUA 1TNJA 1NU9A 1NRPH 2FI5E 1YPJH 2PTNA 1GBKA 1J9CH 4CH8B 3U1JB 2BY8X 2A2QH 1PQAA 2HGTH 1ZSJA 1YPGH 1SB1H 1PQ5A 1WTHD 2V35A 4MQAA 1UTNA 3ATKA 2FM2A 4A7IB 1S82A 1AVGH 2BQ7B 4LOYH 1L4DA 2VWLA 3A8CA 1A5IA 5JBCS 4ZAEA 1V2ST 2Q6FA 2PGBB 3PWCA 3M5OA 1SFQB 1ZTLA 1F5RA 3DHKH 3GYLB 1TBQH 4ZKSU 2VIWA 3QN7A 4IC6A 3RP2A 2A1DB 1H8DH 2BZ6H 4MTBA 3TGKE 1O3MA 3VB5A 1SR5C 2BVSH 4ABFA 2PKSC 4TY7A 2BDHA 3RXFA 1QL9A 3CS0A 1E37B 4FVBA 5FBEA 1FPHH 1NFXA 1UTPA 1INCA 2BMGB 2XRCA 1GI9B 1AWHB 4X8UH 5C5NA 3LT3A 4AG1A 1CT4E 1OSSA 2F9VA 4BTTB 1LO6A 1TQ7B 1Y3XA 1NFYA 3OYPA 3ZVBA 1CU1A 1JXPA 2GV7A 3ZVCA 1T4VH 3PWBA 1BT7A 4AFSA 1BOQA 1TNLA 1JWTA 4J1YA 1XKAC 1A46H 4ZUHA 2G52A 2FLBH 5BRRE 2GT7A 4Y8ZA 1E36B 1KDQA 5GPIB 1HNEE 4XBDA 3EDXB 5JB8S 2W3IA 1P10A 3QUMP 1YPEH 2ZQ2A 4A1XA 4DCDA 3LONA 3S9BA 2GZ9A 1ETTH 1HJAB 5A8XA 4GSOA 4XE4A 5FPYA 2FS9A 2VWNA 2JH5D 4HI3A 1MTUA 2Z3CA 1ARBA 3Q3KA 3SV6A 2SGAA 3DFLA 3CENA 2O8LA 1CHGA 1IQNA 1XUHA 1RIWB 3TNSA 1SL3A 1F0SA 1AE8H 1GI6A 4Y79A 1K1JA 5LGOA 3IITA 3V13A 1YPLH 2ZPSA 1SQOA 5IDKA 1LTOA 4WWYA 1GJ8B 1BTUA 1C5MD 4JZIA 3ZYDA 3T29A 2A45B 5CMXH 1C1UH 1J16A 4NWLA 3TU7H 3PTBA 2OC0A 4MVNA 3JZ1B 4DT7B 1QNJA 1DVAH 3GCHC 1BBRE 3RXEA 4B2BA 3ZVDA 1B5GH 2XYAA 1BJUA 3TITA 4GLYA 4NSYA 3L3TA 5A8ZA 5EQRA 2ZF0H 3RXRA 1DLEA 1P2OA 1FN6A 5ESBA 1TPSA 3RXJA 3C1KA 5DG6A 4I8LA 1S0QA 5GCHF 2K1QA 1O3IA 1GVZA 1G30B 4YT7H 1TAWA 2ZCHP 2BDAA 1V2TT 1O37A 4YESB 4CRDA 2STBE 1AO5A 3M5LA 1FY4A 1SGFA 2QXJA 2NU3E 1GI5A 1MKWK 3GISB 3RXGA 2Y5FA 1RJXB 1F2SE 2BX3A 2A4GA 3LPRA 1TNKA 1TIOA 3S69A 2A31A 1GJDB 2ZZUH 2QIQA 1QQ4A 4WMEA 3SZNA 1C1SA 1Z6EA 1SQTA 1O2TA 1HPGA 3NKKA 2O8UA 3P95A 1TLDA 2A5AA 3A8DA 1AVWA 3QZRA 3I77A 3QO6A 1O2OA 2FI3E 3F9GA 4CRCA 1O3LA 1HV7A 2JH6D 2VWOA 3PLBA 4ABIA 4ABDA 5JB9S 4BAHB 1DITH 4GCHF 1AKSB 2F9NA 3GCTG 2VGCC 4Y7AA 5ETXA 1W3CA 2WYJA 1V2UT 4Y11E 1DDJA 2ZFSA 1DFPA 2BLVA 1TGTA 1BMAA 1SGPE 2VIOA 4ZXYH 3URCA 2P3FH 1IQEA 2ZU5A 1GBFA 4X8SH 1O2LA 1BDAA 3E0PB 4GHQA 5L2ZH 1C5QA 1C2DA 1O2YA 3T27A 1O3JA 2V3HH 4U2WA 2G5VA 3RLWH 2P94A 4YLQH 1ZMJA 6GCHF 1XVOA 4B75A 1V2VT 1Y5BT 1FJSA 2WPIS 4FUBA 3U8RH 1YCPH 1ESTA 3GOVB 3M3SA 4CR9A 1XUKA 2OC1A 3LU9B 4U01A 1GHWH 3VFEA 1V2RT 2WPJS 3M37A 2Z9GA 1TGSZ 1GCTB 1SGCA 1SVPA 3P8OA 3KIDU 1NRQH 2VVUA 4E06H 1VJAU 1QJ6B 2QF0A 4ABJA 5TCAA 1DSTA 4X6PA 1DY8A 4KTSA 3SI3H 1CO7E 1DUEA 2FOEA 1C5SA 2PKAB 1O2XA 5CHAB 4A6LA 2Y5GA 1MCTA 4K8BA 4U30A 3RXTA 1WSSH 2QXIA 5F6MA 1C2HA 2FODA 2F9OA 1IHSH 5A09A 1EJNA 1CQQA 2CN0H 3ZVEA 1K1PA 3NUMA 3UNRA 1O2JA 1GBCA 3O8BA 4XBCA 1BRUP 1EASA 2G4UA 4GCHG 4X1PU 1JRTA 1OP2A 3RMOH 1C5RA 1LHDH 2OTVA 1G3EA 3UFAA 4IC5A 1NN6A 1Z71A 2GTBA 1GBIA 4HTCH 5EW1H 1TBZH 2G5NA 3PMJA 2GX4A 4DIIH 3SUEA 4WH8A 1C4V2 1MU8B 1PPGE 4JZEH 1Y5AT 2FLRH 4X6MA 3UPEA 4BXSA 4AGJA 2B8OH 5FHTA 3TH3H 1A0HB 2ODYB 1J15A 3PO1C 4I8HA 1ZZZA 1MUEB 1THPB 4K1EA 4B73A 1XXFA 1MZAA 2PWXA 4ISHH 2B9LA 2Y7XA 2OINA 4AFQA 1S5SA 2BB4A 2WV5A 1G3BA 1T7CA 4NA7A 5EPNA 1C4U2 2ZPQA 1Q3XA 2D8WA 1FV9A 1JIMA 3SU4A 1KXAA 1DWDH 5HYOA 2ZDNA 5EOKA 3A89A 1TABE 4MNXA 1K22H 3A7YA 4Z6AH 1YPHC 1UHBA 3H7TA 3A7TA 2HWLB 1L4ZA 2C8WB 2UUKB 3UR9A 3FFGA 3QGNB 1IQJA 4FUGA 3MYWA 1GHVH 3EE0B 3MH7A 3M7TA 1CE5A 1EOLA 1SGDE 3DD2H 2FPZA 3E1XB 4Q7XA 1P2QA 2QF3A 1SGIB 1NM6A 3L33A 1HAZB 2VNTA 3SU5A 6ESTA 2PTCE 2B5TB 3QDZB 1SLXB 3ATLA 1P57B 1P8VC 2VU8E 2H6MA 5DP3A 3UWIA 1SLWB 2Z9JA 1Y3UA 4R8TB 1CT2E 3T5FH 1N8OC 4DW2U 4CHAC 2HRVA 4FUDA 2C93B 2UUJB 3RXUA 2C3SA 2CF9H 5HMAA 2TGAA 4ABGA 3ZV9A 5DPAA 1P01A 5I25A 3MNBA 4Y7BA 1AI8H 4YO9A 3NK8A 3Q3XA 2ZP0H 2QXGA 5LPRA 1S0RA 1QBVH 1Y3YA 3E0NB 1PQ8A 2EA3A 1AN1E 1T31A 1FY1A 1THRH 2QY0B 2FOGA 1V2MT 1JOUB 2C8ZB 8ESTE 2Y82A 3NZIA 3UQOA 4ZKOU 2F9BH 3ATWA 1MH0A 1HAIH 1SHYA 3QX5H 5GJ4B 2GT8A 2C8XB 3ZZ8A 1UCYK 4NIYA 3LH1A 3T26A 4ABBA 1VITF 1H1BA 1O2ZA 1EAIA 1ZSLA 1E34B 1O30A 4Y0ZE 3RXQA 3HPTB 4YOGA 1VCPA 1ZTKA 1GG6B 1BTPA 1UTMA 4I32A 4JK5A 5AHGH 5ESTE 4X0WU 4OS5A 1QBOA 1YPHE 1HXFH 2SGQE 1YCPK 2NU0E 4D7FA 8GCHG 3FVFB 2GMTB 2WPMS 2PW8H 3RXIA 1ABIH 1XM1A 4CR5A 3MU0A 5E2OA 5LPEA 1O38A 3KN2A 3SU3A 3SUDA 5FAHA 2F3CE 1AFQB 3S9AA 1PPHE 1KY9A 2PUXB 1ANDA 4M7GA 1U6QA 4VGCB 2JETB 3A81A 2ZIQH 1C9PA 4INHA 1QA7A 1TRNA 3SHAH 1HAYB 2DUCA 1ZRKA 1WUNH 2ZGHA 3SNDA 1FAKH 1UVSH 3SHCH 1N1LA 1L1GA 2ZHWH 1XUJA 3MWIU 5TCCA 1TOCB 1LPZB 1A0LA 5GIBA 1SC8U 3GCNA 4VGCC 2C4FH 1B7XB 1HDTH 2RA3A 1NY22 3TIUA 1PPFE 1QL7A 2XBYA 4I31A 5TJXA 1MMJN 1O3FA 1O2NA 3A87A 3GY3A 1DSUA 3LJJA 3QWCH 4TWYA 3RU4E 3V3MA 3PMAB 3Q77A 3PMHB 1EAXA 3ZZ5A 1K1LA 1C5PA 1O36A 2A5IA 1WCZA 3PMBB 7KMEH 3GY5A 3ESTA 4DY7B 4NA9H 5EGMA 1UTLM 1S83A 1TGBA 1GWAA 2G55A 2VIPA 2FOAA 1V2KT 1TYNA 2D1JA 1QCPA 1C5WB 3VB6A 2HLCA 1LHGH 4UONA 1UTJA 1NRRH 2Z7FE 1QRZA 1Z7KA 1IQLA 3UUZA 1VITG 2P8OB 4DG4A 1CSOE 2PHBA 2QV1A 1EAUA 2EEKA 2FYQA 2UWOA 1L1NA 2J92A 2F9PA 2ZHEH 1HAHH 2Q1JA 1KXEA 1H9HE 1YM0A 1GMCF 3B23B 3GY6A 1D6WA 2HOBA 3K9XB 1GGDC 1XUGA 4JZFH 4ZH8A 1AUJA 2BVRH 1GDNA 4FUEA 1QIXB 2XC5A 1C5TA 3LC5A 4B2CA 3MH6A 1MAYA 3BTEE 1O33A 2GCTC 1KXDA 3WY8A 2R2WU 1AMHA 3SV7A 3V0XA 1JMOH 3TH2H 3TNTA 3KEEA 3RXCA 1FIWA 1GI7B 1C2GA 1PFXC 2YOLA 1QB9A 2OC7A 5I46H 2OCVB 2BZAA 4H6TA 4IS5A 4UDWH 3OY6U 2FWWA 4XBBA 1YGCH 1TMBH 2SGPE 1CBWC 1BBRK 1ANCA 1O2PA 1UVTH 1AKSA 1PPBH 2OBQA 1BRAA 1ZPBA 3DFJA 1IQGA 3K2UA 4YZUA 1IQIA 1ANEA 1O2SA 1C5XB 1GL1A 3RC6A 1DICA 1ZHMA 1YCPM 1OYQA 1XX9A 2CMYA 2GZ7A 4JYVH 2AFQB 4O3UA 1LHCH 1O5FH 2AH4X 4ISOA 4F49A 5EXNA 2GCHG 5AF9H 3LOXA 1OX1A 1ZR0A 4E7RG 2PUQH 1CA0B 1GI1A 3F68H 1OPHB 3VB7A 1FY5A 2R3YA 1C5UA 1HYLA 1NT1A 1GBLA 2A5KA 2WINI 3BF6H 1CGIE 5SGAE 1GPZA 4X1SU 2BY9X 3KQEA 1EJAA 2NU2E 1TX6A 2BTCE 2ZU2A 4I8KA 3SBKA 2A4QA 3RXDA 2Z9KA 1TRMA 1UTKA 2FZZA 1O3GA 1VJ9U 3JZ2B 1LPGB 1NC6A 1FZZA 2A7JA 3LGVA 1ACBE 1Z8IB 2BD4A 1J14A 2CJIA 1ZYOA 1Z1JA 2V6NA 3RXOA 4HGCA 1QJ7B 4JYUH 5A2MH 1F7ZA 3RU4T 3TGJE 1AGJA 2ALPA 3M7UA 4UFEH 1DS2E 1O2RA 1OWHA 5FXLA 1HLTH 2NWNA 4Q7ZA 4FUHA 1DPOA 3KNXA 2HPPH 2QGRA 2UWLA 2XBXA 2FOMB 2PKAA 2G81E 1N6XA 4NCYA 4QT8C 3SNEA 3O8DA 2TGDA 3M5MA 5DP7A 5FCRA 5E0GA 1Y8TA 2Y5HA 2VIVA 1GJ5H 1HJAC 1S6HA 1A61H 2CHAB 5JYIA 2BQWB 5DP6A 1ELBA 2TGTA 3QTVH 3A8AA 3OY5U 1C1VH 1TA2A 2FOCA 3A86A 4UFFH 1GCDA 4NFFA 1EB2A 1B0FA 1RIWC 1LVYA 1O3OA 2Z3EA 3BV9B 1NESE 4K1SA 3SQEE 2RA0A 3ZVAA 3ZZ3A 1FIZA 1C1RA 1KXFA 2ZU1A 4CRBA 2WPKS 1P03A 4NIXA 3LIWA 1UK2A 1ZTJA 1YF4A 4OS7A 5DGJA 4I8GA 2ZTXA 1XUIA 1W12U 1SOZA 3FP7E 3LC3A 3U98H 2BDCA 2ANYA 3AAVA 1AU8A 1GBDA 1K21H 3UR6A 2WPHS 5L2YH 1IQMA 5AFZH 1H8IH 1GI8B 1ZGVA 1K1NA 3RXBA 1ABJH 3AASA 2W5EA 1GHZA 3QTOH 1D4PB 2ZDAH 3SQHE 4OS4A 2BD5A 1QB1A 1LKAA 2ILNA 4WXVA 4UE7H 1WTGH 5C1UA 3ATIA 1GI3A 1E35B 2ZFQH 1P09A 2SNVA 4DIHH 3A84A 3E6PH 1W11U 2XWBI 2ZKSA 3RXSA 1P2IA 1S6FA 5JBBS 2HVXA 3SNBA 3SUGA 5K7RA 1FUJA 5F8TA 1SLVB 2O8MA 4DVAU 4XDEA 1YC0A 2DE9A 1O2IA 3TJVA 3GY8A 3GY7A 2WUCA 1JBUH 5JBAS 2ZU3A 1RXPA 2STAE 2H5CA 2IJOB 4CH2B 3TJOA 3D62A 2EI8A 3S7HB 4FUCA 3U1IB 1UTQA 3M3TA 3A7VA 1MAXA 1EKBB 1W10U 1H4WA 1AZZA 2AERH 1IHTH 4RKOB 3SU6A 4AB9A 5GXPA 1QRWA 3M7QA 4Q80A 5C20A 4YTAA 2G51A 2Z3DA 1DE7H 3P8FA 1ETRH 4KTCA 4FUIA 1EUFA 1G32B 1DOJA 1DT2A 1RTFB 1GHAF 3G01A 4FXGH 3NXPA 4ESTE 4Z0KA 3IG6B 4AORA 1C5ZB 1DANH 3C27B 3PB1E 1TA6A 4ASHA 5GCHG 4AB8A 1D9IA 1K1IA 2ANWA 3D23A 4X2YA 2Q6GA 2P59A 1GVLA 2BLWA 4K2YA 1Z8RA 1EX3A 3PV4A 2ZA5A 1JIRA 3RLYH 3KGPA 1C5NH 4ZXXH 4Y6DA 1L1JA 4ABHA 1P11E 3F1SB 3BTFE 2BD8A 1GCTC 2RG3A 1LKBA 3LGIA 1FY8E 4SGAE 2QYIA 1G36A 3NCLA 2VIQA 1OP8A 3L6PA 5T6GA 1LQDB 2ZHQH 3UY9A 3HK6B 2BQ6B 1XXDA 3TJNA 3STIA 1NROH 1GHXH 1S85A 2TGPZ 1WQVH 4SGBE 1MTNB 3VGCB 2BD9A 1Z8JB 1P3EA 2FDAA 4OS2A 4NZQA 1GJAB 3ENSB 2BDGA 1T8LA 4XSKU 1RD3B 3MU8A 4GVUA 5CHAC 3TGIE 1UO6A 4GHTA 4K1TA 1NFUA 1ZMNA 4WH6A 1ID5H 3BIVH 4THNH 3KF2A 5H4IB 1FY3A 1BTHH 1EQ9A