1DXWA

Structure of hetero complex of non structural protein (ns) of hepatitis c virus (hcv) and synthetic peptidic compound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
TGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRASKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor Binding Induces Active Site Stabilisation of the Hcv Ns3 Protein Serine Protease Domain
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SERINE PROTEASE
total genus 22
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2000-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dxwA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1dxwA01
1SQTA 2BLOA 3EQ0H 3STIA 1O3JA 4Y0ZE 3CP7A 1HAXB 1VZQH 2JETB 2Y6TA 1HXFH 1YPHC 1EZQA 2B0FA 1G3DA 1HDTH 3JZ2B 4TPYA 4GHQA 2BMGB 3PTNA 2AMQA 3BTFE 1DUAA 2BTCE 1TQ0B 1AVWA 1YCPH 1NC6A 1O3FA 2Z9LA 1UTOA 3PM3A 4DCDA 3ODDA 2P3FH 2Z7FE 2QYIA 5AHGH 1U6QA 3TITA 4FUJA 1W8BH 1OP2A 2DUCA 1THPB 2VJ1A 3ZVGA 1WXRA 4TYDA 2DE8A 3RM2H 4R0IA 3SHAH 1QBNA 3A8BA 4NIWA 4ABFA 4RI0A 1GDUA 4Y7AA 1SFIA 5EQSA 1CO7E 3VXEH 1UK2A 4CRDA 1UVSH 3UWIA 5C3NA 1J15A 1FIWA 1XUJA 1A4WH 1H8IH 1ELGA 1P2NA 1TAWA 1A2CH 2XBXA 3GYMA 5IDKA 4MPUA 2OLGA 4ABIA 1P04A 1QL8A 2A2XH 3SU0A 2EI7A 5ETXA 1QRZA 2FOBA 1SOZA 3GCHB 3S7HB 2ASUB 3LPRA 1WUNH 2UUKB 4K2YA 1O5CB 3RXVA 3F9GA 2V3HH 1FY3A 2ZHQH 2OUAA 3MU1A 2BZ6H 1D9IA 2Y7ZA 3QTOH 1B7XB 4K8BA 4B71A 2WV4A 1G2LA 4DIIH 5T3HA 1NESE 1Y3WA 3SJOA 2F4LA 2F9VA 1K1MA 3A87A 4XOJA 4KGAA 7LPRA 4DT7B 1Q31A 3SJ8A 2XCNA 1CHOG 1O2UA 1IOEA 1VITH 2AMPA 3MU4A 4JK6A 3P6ZB 1MAYA 1S6HA 5DJ7A 1BTPA 5FPTA 4NSVA 1GBBA 1GBCA 5A0AE 3SBKA 3VFEA 1O3LA 1VGCC 2W3KA 4Y8YA 1AVGH 3A83A 2GMTC 1C2MA 3A8DA 2D2DA 1C2FA 1O34A 2D8WA 5F8ZA 2P95A 4CR5A 3PMAB 2XBWA 4WF8A 2PUXB 1ELBA 1PFXC 2XWBI 2VIOA 1WTHD 1CHGA 1O2XA 4Q7XA 2R0LA 5JBAS 1IQMA 1NU7B 8LPRA 1C1VH 2B7DH 2JH5D 2BVSH 1ZMLA 3MYWA 3SU3A 2C8XB 2FI5E 2SGEE 3A84A 3PO1C 1Y3XA 3PWBA 1FV9A 1BMLA 2FOFA 3TH3H 3KIDU 2W7SA 1D6WA 1MTVA 1UCYH 5EXLA 1FJSA 1EAXA 1IQFA 1P03A 3UTUH 1ELEE 3A82A 3A7TA 4D7FA 1ABJH 1G9IE 2ZWLH 3TK9A 4J2YB 1Y3UA 4YT6H 2A4QA 2BHGA 2UUFB 4Q2KA 5T1VA 1YPKH 4BOHA 4MG3A 1H1BA 1C1OA 3PTBA 1IQGA 3P8NA 1D3DB 1HAHH 1NRNH 2ZGBH 3D49H 1MTNC 1TA2A 5E0GA 3RMOH 1SGFG 1UHBA 3DFJA 2VNTA 3TIUA 2ZFSA 3GDVA 3M5MA 4K5ZA 1QB9A 1AUTC 2JKHA 4NIYA 1EPTA 4AB9A 1XVOA 3LGYA 1C2IA 1A5IA 5GCHF 4NA7A 4MNVA 1V6DA 1YLCA 4SGAE 1UK4A 4YT7H 4XBCA 4U01A 2XBYA 4K3JA 1V2UT 2ZFFH 1QIXB 4ISIH 3VB6A 2BD2A 2BDYA 2JETC 4O3UA 1GBAA 4I33A 1O36A 1ZZZA 1HAYB 1GL1A 3AK5A 1ESBA 5J4QA 1D6RA 4DVAU 2UWLA 2ULLA 2BX3A 2BXTH 3VEQB 1RTKA 4GCHG 1HJ9A 1Y5BT 1C5UA 2BLVA 1O3BA 1AD8H 2GCHF 3TNTA 1NFXA 1GBMA 5C20A 5EOKA 1GL0E 1QL9A 1W11U 4BAMB 1ZPZA 2IN2A 2F9OA 3T27A 1LHFH 1AB9C 1BTZA 1MUEB 5DO4H 1DPOA 4GUXA 1TX6A 5C1YA 1C2LA 1WU1A 3URCA 1LVMA 3RMLH 2P59A 2QV1A 4H4FA 1MU8B 1YP9A 2R3YA 1GCTC 2ZA5A 1P01A 2Z3DA 2G52A 1O3KA 1GMDF 2BDAA 2R9PA 1Z6JH 1C2GA 1HUTH 4B6EA 1AI8H 1TQ7B 1HGTH 2V3OH 1EJAA 4Z6AH 4WH6A 4AX9H 1UTNA 1O35A 3GCHC 1TRNA 1D3QB 4IC6A 4ABAA 1OSSA 3BTEE 4K69A 4CHAB 1OOKB 1TPPA 4FUIA 4BAKB 4E05H 1IQJA 1CQQA 3SYJA 3KHVA 1ESTA 1S84A 4AG1A 1UO6A 4A1TA 4LOYH 1O39A 3E3TA 2G51A 2HPQH 3MNCA 1O3NA 2XC0A 1YF4A 2ZIQH 2Z9KA 1ANBA 1SQAA 4ZHLU 3KQBA 1LQDB 4DW2U 4WJG2 1C5NH 4DGJA 3RM0H 2Q6DA 1C4V2 2BVXH 3VB3A 1J14A 1UVPA 1GI6A 4GSOA 1FPHH 4CRFA 1QNJA 2XBVA 3LGIA 3ZZ4A 2V0BA 2JH6D 1A0JA 5J4SA 5E2OA 1TWXB 3MHWU 3QZQA 1OWJA 1SGQE 4OS5A 1FAKH 1GMDG 3RXBA 1A7SA 1QHRB 2GZ9A 1E0FD 2Q1JA 2ZHDA 2P94A 4Q80A 1KXBA 2GMTB 2A5KA 3PWCA 3KF2A 3M3TA 4ABDA 3U69H 3SV8A 5DK1A 1V2NT 3NWUA 3JZ1B 3SOSA 3GCTG 3PLKA 1HJAB 4X6NA 1O3CA 3LJOA 1ZHMA 3A7WA 1LHGH 1F92A 2F91A 1TLDA 2FI4E 2Y7XA 1FLEE 1TABE 1AU8A 4YOIA 1GHAF 5AFYH 3HGPA 2G5NA 5TCCA 5FAHA 1F7ZA 4KELA 1K1JA 1AZ8A 1BQYA 4Y8XA 5F03A 3ZZ7A 5LPEA 1W7XH 3O8CA 1QCPA 2P8OC 2B9LA 2OK5A 1GJ9B 5FX5A 2H9HA 3TH4H 1GMCF 1CBWB 2O8TA 4HGCA 1P9UA 2ZHFH 4CBOA 2UUYA 1UVOA 1GCDA 3C1KA 3ZVEA 1HLTH 1KXCA 5CHAC 2FO9A 3SU2A 3MOCA 1O5BB 2VIPA 1QBVH 4XFQA 3M61U 1O2QA 4IBLH 4UFEH 1ZMNA 2SFAA 1TOMH 2VIDA 3SI4H 1EAWA 1GWAA 2J94A 1GBIA 1P8VC 3C27B 1MTNB 1P9SA 1DFPA 3PO1B 5FCRA 4DJZB 1EXFA 4YESB 1NRSH 2ZFQH 1AWFH 1MMJN 1N6XA 3E8LA 4OGXA 3F9FA 1TGTA 1MCTA 1GVLA 1S82A 1P2KA 2ZHEH 4MNYA 2BM2A 5DP8A 3P8GA 1T4VH 3F68H 4NA8A 5GXPA 4A5TS 1CA0C 1V2KT 2M5TA 2PV9B 4RSPA 4I8HA 3Q3XA 3QGJA 4HTCH 2XC5A 1RIWB 3KGPA 3DA9B 2SNWA 1JWTA 5LPRA 2CN0H 3HK6B 3GY3A 4X1QU 5EQRA 2FOMB 1T8OA 4GLYA 1C5ZB 1NU9A 1DWCH 1NZQH 1PPCE 1C2JA 4ABJA 5JBBS 3I78A 3OSYA 1P57B 1ZGIA 1GJ7B 2XYAA 4WMEA 1BTUA 1MD7A 3EGKH 1SPJA 4NWLA 2GZ8A 2C4FH 3PB1E 1MTSA 3MH6A 4FUCA 1ELDE 2GCTB 3RXGA 4FUFA 1UTQA 2AGIX 3MWIU 3ZVCA 4JZ1A 1UHBB 3S9AA 2CMYA 2PSYA 5EQQA 1FN8A 2ESTE 2FM2A 1O3EA 4CRCA 4F4OC 4WXIA 4YM9A 5FPYA 1KIGH 1W7GH 2OC0A 3FZZA 1F0TA 1E34B 4JYVH 2Y5GA 4DOQA 3ATLA 1OWDA 1TNIA 1ZPBA 2Z94A 2R3UA 3I29A 4D9QA 1W0ZU 2ZFPH 1ZPCA 1C5WB 3U8RH 1VR1H 2WPHS 4CHAC 1QRXA 3PMJA 2FTLE 3O8DA 1QURH 1BBRE 1DX5M 5LPFA 1EATA 4D7GA 5HGGA 1WQVH 1S0QA 1UCYK 2C93B 3UNSA 1AFEH 1C2EA 2G81E 2CV3A 3BTME 4OS1A 2A7JA 1YKTA 1NY22 1PPEE 2AIPA 2FS9A 4D76A 4E7NA 4FU7A 3KQCA 2BDGA 2WHXA 3SUGA 3ZZ9A 4AFZA 2BZAA 3MTYA 1GGDB 1GBLA 1YBWA 1C4Y2 5AFZH 4X1RU 3LT3A 5E0JA 3QDZB 4B75A 3V3MA 5BRRE 1HPGA 1NT1A 2DE9A 3KNXA 3L6PA 4ISHH 4KP0A 2GT7A 4LK4A 4JYUH 1TGBA 3CS7A 3GDSA 3L3TA 1SGDE 2BB4A 2F9NA 1GHWH 4WY3A 1BMAA 1F5KU 1O31A 3RXUA 2GZ7A 1TOCB 1HJAC 4X2WA 3PLPA 3UR9A 5C1UA 1P06A 1SSXA 5K7RA 5T6GA 1AB9B 3D65E 3LC5A 1NRQH 4GHTA 2A2QH 1LPZB 3QK1A 4FXGH 1B5GH 3UREA 4PROA 1EJNA 2ODYB 5EXNA 1O3MA 2H9EH 3NCLA 1YPGH 4X6PA 1GHYH 2EEKA 1S6FA 1YPEH 2AYWA 3S69A 1HBTH 4I32A 3P8FA 1QB1A 4RKJB 3SGQE 2AGEX 2C8ZB 1SBWA 1WYKA 3KCGH 4O97A 4ZXXH 2H6MA 1SHYA 5CHAB 2FX4A 2BD5A 1P09A 3E16B 3U9AH 3ATMA 4OM9A 1GBKA 2G8TA 1DUEA 3MH5A 5LH8A 1T8MA 4A6LA 2CXVA 3GCOA 4Q7YA 1P12E 2ZU4A 5SGAE 2FS8A 5A0CA 1SGTA 4B1TA 1CBWC 3BTKE 1DY9A 4X1PU 1K1PA 1KDQA 4OS7A 4JZIA 1C5YB 1TNHA 1CGJE 4Y76A 5A8YA 2CF8H 2LNCA 1AHTH 4ZKOU 2F9PA 1GHBG 1AKSA 2ZFTA 2SGDE 1CGIE 3MI4A 8KME2 2C90B 2PW8H 1ZOMA 4AORA 2ZCKP 3ZZ5A 1CA0B 7GCHG 1FQ3A 1T31A 4K8YA 5PTPA 1C1NA 1GBDA 1TNKA 2Y5FA 4KKDA 4NFEA 4Y7BA 1GJ4H 3LC3A 4VGCC 1SGRE 1S85A 2ZFRH 1LVBA 3MO6A 2R0KA 3RMNH 4TY7A 1HFDA 1C1PA 1NFWA 4K1EA 5GWZA 1A5HA 1T32A 4UEHH 3ZYEA 2PKAB 2TIOA 5FXLA 3ZZ6A 3V12A 4ZHAA 1Q3XA 2ZECA 3T25A 2UWPA 1FY4A 1FIZA 3RXRA 1FY8E 1TYNA 2CHAB 2ZC9H 1RTFB 2ANYA 3SQEE 2P16A 1EUFA 2HVXA 1Z7KA 5GIBA 3ITIA 1AZZA 4NA9H 3N7OA 2WPLS 1XXDA 2ZPRA 1WSSH 3A7XA 1RIWC 3FP7E 1BHXF 1MBQA 2ZTXA 3TLOA 4ZHMU 5F6MA 1A1RA 3RC4A 3SNEA 2A1DB 4B2BA 1MZDA 3EA7A 4Z0KA 3FZDA 2G55A 2G4UA 2ZU2A 3EYDA 4JYTA 1QRWA 1F0SA 1O37A 4FVBA 4OS6A 4ISLA 4Y11E 8ESTE 1P3EA 3TK6A 3RXAA 4UDWH 3V13A 3F9HA 1XXFA 2ZI2H 1OS8A 4ZKNU 1GVKB 2PGQB 2BLQA 4FUBA 2Z9IA 1A0HB 3W95A 3UNQA 1LCYA 3MNXA 1TX8A 1UJ1A 1MKXH 5H4IB 2OQ5A 4OS4A 3RXCA 3UQOA 5BPEA 1AQ7A 2VBCA 2Z9JA 7ESTE 1AE5A 1MZAA 3MNBA 3QO6A 3D23A 4MPVA 5ABWA 3UOUA 4CRGA 2HWLB 2TRMA 3BSQA 1AVXA 2A45B 1BZXE 3LOXA 1JBUH 1SGIB 2AEIH 3RXTA 4ABEA 1JIMA 4IS5A 3SJ9A 1P2JA 3EDXB 1GHVH 1J8AA 2H2ZA 3AAVA 1SG8B 2P3TB 4AGKA 2FOGA 1LDTT 1GDNA 3HK3B 1FAXA 3RXJA 3RXQA 1SB1H 3MNSA 3F9EA 5FX6A 2VU8E 1PPZA 1O3OA 1QB6A 1IHTH 2A5AA 3TNSA 2OINA 5A0BA 4HI3A 1W3CA 3B23B 1MQ5A 2BXUH 3ZV8A 5GNDA 4SGBE 1AMHA 1GJ6A 2STAE 1LHCH 1PQ7A 1TBQH 1YM0A 8GCHG 3G01A 3W94A 1ANEA 3TVJB 2NWNA 3M3SA 2OBQA 4FUHA 4KTSA 3FAOA 1GI4A 2FOCA 3Q76A 1C9TA 1NM6A 5L2YH 4THNH 1ZJKA 1ZRKA 4A1XA 5DP5A 5EODA 1LVYA 2ZHWH 1AE8H 2NU0E 3LU9B 1V2PT 2GCTC 1GI7B 1LHEH 2OBOA 1YPLH 5GCHG 3GY7A 1K1LA 1MBMA 2HPPH 1P2MA 3RXLA 1O2YA 4JCNA 1K1OA 2BLWA 4LZ1H 4YOGA 2HRVA 4MVNA 1GBFA 1P2QA 1SMFE 2OP9A 1SL3A 1C5PA 2XTTB 2D1JA 1RJXB 2V35A 5E2PA 2WZQA 1MH0A 1V2OT 4IN2A 1EQ9A 3IITA 3UNRA 3BTTE 2ZGJA 4DURA 3SW2B 2BDBA 2ZU1A 1QJ6B 2XW9A 3A80A 3BIUH 4INLA 4UFGH 4GCHF 2PKSC 2YNAA 4ZXYH 1V2TT 1AWHB 4UD9H 5FHTA 1O2GH 1O2VA 4M9FA 4BXSA 4AFUA 1L1GA 3ESTA 1W10U 1C5VA 1O3HA 1LTOA 4AOQA 3F1SB 1HAPH 5C5NA 1QJ1B 4ZROA 1NFYA 2PTNA 3A88A 4DG4A 2GV7A 1GI1A 1M9UA 1CE5A 1SC8U 3SZEA 4DIHH 4CBNA 1O2TA 1A46H 2OQUA 3LDXH 3BEIB 1VITG 3U8TH 3ZVDA 3V7TA 3PV2A 4LZ4B 2VWNA 1AGJA 1GHAG 5C67A 4X1NU 2BD7A 1TPSA 1JOUB 3T2NA 1KTSB 4FUEA 1C5RA 3NUMA 4NZQA 1DLKB 1C1QA 1BCUH 1SGNE 5JB9S 3BTQE 1YGCH 1OP0A 1TGCA 1SGFA 5EGMA 3EE0B 2GD4B 5FCKA 3ZZBA 5LGOA 4AB8A 1J9CH 1VITF 1A3BH 1TGSZ 1AFQC 5FPSA 2VVCA 4ZUHA 3LH3A 1EX3A 1PPFE 3FP6E 1H9LB 5AVDA 4YLQH 4ZMAH 2BY7X 2QGRA 1Z8GA 3OX7U 5HMAA 1HAVA 3QLPH 2J95A 1V2WT 2FDAA 4OGYA 3SNAA 5DP7A 3BEFB 2ZU3A 1AN1E 3S0NA 2EI6A 2ZDMA 1HAVB 1O5EH 1IQKA 1GBEA 4D8NA 3Q00A 4AGJA 2Y81A 1MAXA 1ZGVA 1ELFA 1BRBE 3ENSB 2C8YB 4YZUA 2FYQA 1AY6H 2GV6A 1Z6EA 1L2EA 1PPGE 1JRTA 3UQVA 1WTGH 2ZP0H 1C5MD 1Y5AT 3ZZAA 2VWLA 1SLVB 3BTWE 4ASHA 3M7TA 2ZZUH 4X2VA 3A8AA 1P10A 1TIOA 2YOLA 3A7VA 1E37B 5DG6A 1EJMA 4D9RA 3ZVAA 1MU6B 4Y10E 3DUXH 4X8SH 1CA8B 2FOHA 1KLJH 4GPGA 1N6YA 2RCEA 1FPCH 1DVAH 1GBJA 1ZMJA 3FFGA 4TWYA 5E8EH 1C5QA 2VINA 1CHOF 1O3IA 4LXBH 3VPKA 1C1MA 1BMMH 3TJOA 1D3PB 1KXAA 4UONA 1ZTJA 4FU8A 2KAIB 3SORA 1F5LA 1XUGA 1FXYA 5DP3A 1L1JA 1UVUH 2PGBB 2UWOA 3S9CA 2QA9E 5C1XA 3TJUA 2TGAA 1Z8IB 1OPHB 1BIOA 1EP6A 3RLYH 5B6OA 1J17T 2WV9A 1DSUA 1C4U2 1TRYA 3GY5A 2VVVA 3O8BA 3Q3YA 3IG6B 5L30H 3I77A 4BAQB 1H9HE 1LQEA 1HAZB 1O3GA 1K9OE 1EZUC 2BY6X 1XUHA 1ESAA 1W2KH 3M7QA 1C1SA 5TCAA 1B0EA 2ZU5A 3K6ZA 2QF0A 3LGTA 5JDUB 2ZDAH 2ZG0H 3FP8E 1O2KA 2SGPE 1FI8A 2PUQH 1F0UA 1NFUA 1S5SA 1FMGA 3E0PB 4GAWA 4ZKSU 1O3DA 1HYLA 1DANH 3PMHB 1SVPA 1LPKB 1QA7A 2QXGA 3M37A 2Z6BD 1NO9H 3QZRA 2OCVB 1MKWK 2AIQA 1GCTB 2O8UA 4X8VH 1W0YH 1UTJA 1GI9B 1IQEA 1J16A 1KXEA 3VXFH 2BD3A 2HGTH 5DKMA 3SGBE 2PR3A 5EW1H 2OC8A 1BITA 1XMNB 2D26C 1K1NA 4Y8ZA 4CH8B 2KAIA 2GCHG 1UTLM 3SHCH 4NSYA 4I31A 3U98H 1XVMA 4YLUA 1HJ8A 1GJAB 1C5LH 1O38A 2BOKA 1QY6A 3KQEA 1G3BA 2BOHB 1DWBH 3NKKA 2FEQH 2FESH 1GJBB 1V3XA 3GY4A 3LGVA 5F8TA 3SZNA 2VWOA 2ZGXH 1ZHRA 1NROH 2J9NA 3SNDA 2A4OA 2J92A 3TK5A 2PFEA 3EA9A 3A89A 1ABIH 1C9PA 5A8XA 3MU8A 4CRBA 1RFNA 2C3SA 3RXDA 1P05A 1O2OA 4FU9A 1CT4E 3A7YA 3EAJA 3RC6A 1O0DH 3NZIA 1SFQB 2K1QA 1C5XB 4NZLA 1XUIA 2F9UA 5HYOA 3HPTB 1OKXA 4YOJA 1LO6A 2H5CA 2BDIA 1OP8A 1H9IE 2GDEH 3UUZA 1OYQA 3QGNB 4WMDA 3SJIA 3H7OA 4MTBA 2ZPQA 3OU0A 1KY9A 1Y3YA 2W7UA 6CHAB 1QR3E 1ZSKA 4BNRA 1DWDH 1V2ST 3SN8A 2A32A 2ZNKH 2A4GA 3ZZDA 1UK3A 4MQAA 1K22H 3F6UH 2WUBA 1KLIH 2QN5T 3M5NA 2FLRH 2IOTA 1O2ZA 2R2WU 1ETTH 2P8OB 1YPMH 1LKBA 2O9QA 2G4TA 1JMOH 1DXPA 1IHSH 1QFKH 1FY5A 3AASA 2CGAA 3H5CB 1BBRK 1AO5A 4ZKRU 4XE4A 3ZYDA 1ZTKA 3ATKA 1UCYE 3TJNA 1G3EA 1MKXK 5E0HA 2I6SA 4XBDA 1O3PB 3E1XB 5EG4A 4CRAA 4AN7A 1S81A 3UWJH 4I8GA 1EB2A 2ZDNA 4X6MA 2HNTF 1CVWH 4Y79A 1MTUA 4A1VA 3BG8A 1O5AB 4KTCA 4IN1A 1C1RA 3RU4T 2NU3E 4NIXA 2PKAA 1UTPA 3ZZ3A 1EASA 4B76A 1ZJDA 2QC2A 3Q3KA 3P70B 5DPAA 3BV9B 3GDUA 1WV7H 3LH1A 1NPMA 2QAAA 1EKBB 4RKOB 1ETRH 4B2CA 4WXVA 1V2JT 1EAUA 1BOQA 2SNVA 1L4ZA 3KQDA 4UFDH 1DITH 6LPRA 1K28D 2HNTC 4AYYB 3ZVBA 1W13U 1B0FA 2C8WB 1DT2A 2BQWB 1A0LA 1ZYOA 3LGUA 5G4BA 3A86A 1VCWA 2QCYA 1V2QT 5K0HA 3RXFA 1O2RA 3SV9A 1SLUB 1F2SE 2ZQ2A 3CENA 2GVFA 3GCTF 2XCFA 3OY5U 3M36A 1ELAA 1C1WH 2Z3CA 4FVDA 4XSKU 5T6FA 2AMDA 1FN6A 1C1UH 2PSXA 2XXLA 4X2XA 1ZTLA 3AVZA 1GI8B 4WVPE 2ZPSA 1NS3A 3VGCC 3SU6A 1DSTA 1NRPH 1TNLA 3NPSA 3RXEA 4CR9A 1WQSA 4NG9H 1YLDA 1YPHE 3ZV9A 3MO9A 2VVUA 1JIRA 1H8DH 4Y6DA 2SGAA 3RDZA 1JRSA 1E36B 4BAOB 1Z1IA 1DE7H 3LJJA 4E7RG 3UPEA 2RA0A 4CREA 3VB7A 1THRH 1DDJA 1S83A 1LKAA 2BDHA 1SGEE 2HOBA 2PHBA 3V0XA 7GCHF 3SJKA 1A3EH 3BTHE 3A81A 2FYRA 3ELAH 2H5DA 2FODA 1HNEE 1T4UH 1DY8A 2ZDLA 3GCNA 1ANCA 3U8OH 1EOJA 3K65B 3L33A 4JMYA 3U1JB 4WWYA 3HKIB 5L2ZH 2O8LA 1CGHA 1FZZA 1GGDC 4TWWA 2A7CA 2ODQA 2AERH 1BMNH 4ISOA 2SGQE 2ALPA 4X8TH 3A85A 3T5FH 1GG6C 1DWEH 4YO9A 1GI3A 3T29A 3MFJA 3RXIA 3U1IB 3RP2A 3SU4A 1G36A 3OY6U 2VGCC 5CMXH 4H6SB 6GCHF 4B2AA 1KYNA 1RTLA 3BTGE 1P02A 1C2HA 4TPIZ 1F0RA 1TMUH 4XBBA 1V2MT 2BYAX 1BA8B 2P93A 3R0FA 3GY8A 4B73A 6CHAC 1BTXA 1SGYE 1BRCE 2H1UA 1T7CA 8GCHF 4I7YH 1BRUP 1QJ7B 1VJAU 2OC7A 3BF6H 3S7KB 2GT8A 2ZTZA 2BD9A 2ZF0H 5A09A 2A31A 1O2JA 2O8MA 1K21H 4HFPB 1GHBF 4B74A 1GHZA 2HLCA 2NU2E 3D62A 2Y82A 5GDSH 1SLWB 4U30A 4WH8A 1F5RA 1QL7A 2J34A 3NK8A 2WYGA 3FVFB 3SV7A 3ZZ8A 3ZZCA 1PQAA 3VB4A 3PYHA 1EB1H 1TFXA 2BVRH 3HGNA 2J2UA 3E91A 3AW0A 5EXMA 2Z9GA 2WPMS 4JZFH 3SV6A 1CSOE 3BN9A 2W3IA 3UR6A 1N8OC 4U2WA 1BB0B 2NU4E 3SUDA 1SQOA 3TJVA 1UTMA 1ZLRA 2BQ7B 1L1NA 1TNJA 2TBSA 3PMBB 2AS9A 3T26A 3T28A 4O9VA 4ZAEA 1FDPA 1QTFA 1GI0A 1OWHA 3M3VA 5TJXA 1KTTB 1KDQB 1RS0A 2AGGX 3HATH 1SHHB 2QXJA 3MO3A 1A5GH 3E0NB 1PQ8A 3DD2H 4VGCB 5JYIA 2STBE 4MNWA 1Y8TA 3QTVH 2Y80A 2FLBH 5JB8S 1QBOA 2IJD1 3H7TA 4A92A 4IW4E 5FBIA 5IYTA 1RXPA 1O2NA 1FY1A 1C5TA 4JZEH 2UUJB 1O2IA 1XKAC 1HAOH 3SI3H 1NTPA 2FZZA 3GY6A 3RMMH 4IC5A 2PLXA 5DP4A 2ANWA 2VIWA 3K9XB 2EI8A 2CHAC 3QWCH 1BTWA 5GJ4B 1T8NA 1WAYB 1PPBH 3STJA 4O03A 4H42U 1P3CA 1ID5H 2PTCE 3FANA 4INKA 1ZSJA 1DXWA 2V6NA 1P2OA 2TGTA 2RG3A 3R3GB 4UFFH 3M35A 2HALA 4BXWA 1S0RA 1OWIA 1ORFA 1OWEA 2FXRA 1EZSC 1QQ4A 4AFQA 3M7UA 2F9BH 5HM2A 2BY8X 4I8KA 3TH2H 3PV5A 3LIWA 2GKVE 1TRMA 1GI2A 3UFAA 4BANB 3RU4E 4NWKA 5L6NH 3GYLB 5A8ZA 5EW2H 1LMWB 3RU4D 1ETSH 2ALVA 2PWXA 1HV7A 1O5FH 1BDAA 1UTKA 2EC9H 1P11E 2ILNA 2B8OH 1P0SH 3RLWH 4BAHB 1O3AA 3M5OA 1IQIA 3CS0A 3OTJE 3Q77A 1O2WA 1VCQA 3SGAE 1YCPM 2GDDA 2VH6A 1K2I1 1GMHG 1EOLA 3GISB 1C5SA 3SO3A 3RUOA 1BBRH 4U32A 9LPRA 2ZGHA 2QIQA 5DGJA 1SGCA 3ATIA 3P95A 1D3TB 1GPZA 1TMTH 1AIXH 4TY6A 1HAIH 2BD8A 4X0WU 1TB6H 1KSNA 2LPRA 2G00A 1O2MA 1OYTH 4DY7B 5HM9A 1V2VT 2OD3B 1O30A 4K1SA 3SV2H 4Y71A 1HRTH 1XX9A 1QGFA 2EA3A 3KN2A 3LGWA 4R8TB 1K1IA 3RXKA 2O8WA 3ATWA 2ZDKA 3P17H 4F49A 4MPWA 4ABHA 2FWWA 1Z8RA 1XUKA 1O5GH 2VGCB 3AW1A 4K60A 1KXDA 2W26A 4B6FA 5JPMH 1CT0E 3K2UA 4IGDA 1Z1JA 5A2MH 2VWMA 4ZH8A 4MLFB 3TGJE 3RXSA 3GICB 4FUDA 2XC4A 1O2HA 2CF9H 1YPJH 3GY2A 3KL6A 3SU1A 1HB0B 3WY8A 1GG6B 3OTPA 3A8CA 3A7ZA 3VGCB 1L4DA 2J38A 2FIRH 2ZTYA 1ZRBA 3BG4C 2OC1A 4AFSA 5JBTA 4NGAH 3MU0A 5GPIB 3SNBA 3HKJB 2QXHA 2QY0B 3SUFA 2ZEBA 1CT2E 1MCVA 2GX4A 1QA0A 1ELVA 1GMHF 1GBHA 3SQHE 1TONA 1EPTB 1Y59T 2R2MB 3SNCA 3URDA 1INCA 2G5VA 1O2PA 1TNGA 2A7HA 2FX6A 4I8JA 3BEUA 1O33A 2P3UB 2H9TH 5F8XA 3IWMA 4JK5A 2TPIZ 1VJ9U 2ZCHP 2PKSB 3RXOA 2WPJS 5JBCS 1IQHA 4MPXA 2B5TB 1GJ8B 2VIVA 2FMJA 1NN6A 4X2YA 2BY9X 3P92A 2FI3E 1LVOA 2A5IA 3BTDE 1XM1A 2QXIA 2RA3A 3QN7A 4X6OA 2RDLA 1D4PB 1Q2WA 4QT8C 1FONA 2ZQ1A 1W14U 5HXFA 1TPAE 1HCGA 1IQLA 1T8LA 3SUEA 1P2IA 3GOVB 1VGCB 2GTBA 1JXPA 1C5OH 3OYPA 3DFLA 4H6TA 1SOTA 1XKBC 2WPKS 1ELCA 1N8OB 1GI5A 2WYJA 1HIAA 2WPIS 1PPHE 3TPIZ 4AZ2B 2AFQB 3PLBA 1BHXB 3QX5H 2XNIA 1AUJA 1RD3B 2BX4A 2ZGCA 1BUIA 1SR5C 1BJUA 1MD8A 3P8OA 1NRRH 1CU1A 2W5EA 1SGPE 1GMCG 1XUFA 5FBEA 3BIVH 1G32B 3H09A 4O3TA 1WBGB 3UOPA 1TX7A 3TGIE 1MQ6A 2A4RA 4INHA 4ISNA 3RXMA 2NU1E 5B6LA 7KMEH 1AFQB 1TPOA 2BY5X 1LPGB 1L0ZA 1KXFA 4FUGA 2FTMA 5C5OA 3UIRA 1BT7A 1ELTA 2J4IA 6ESTA 1FUJA 4JZDH 1GJ5H 3MU5A 5ESBA 1PYTC 4HZHA 2WINI 3MH7A 2I6QA 2OXSA 1RRKA 1RGQA 1AKSB 1ANDA 4NIVA 4MNXA 1BJVA 4X8UH 3LONA 4ABGA 1OXGA 1SLXB 1EZXC 1BRAA 2THFB 9ESTA 1DLEA 1GBTA 4M7GA 1Z8JB 1PJPA 1SI5H 1YYY1 5I25A 1GDQA 2BDCA 3EA8A 5DP9A 4AYVB 3KEEA 1O2LA 4X1SU 3RXHA 4BTTB 4XDEA 1E35B 3DT0H 3PV4A 3UY9A 5EU8A 4BTUB 1TE0A 1HIAB 1H4WA 2WUCA 1KLTA 4BTIB 2VB0A 1X7AC 1GJCB 1GVZA 2ZCLP 1IQNA 4I8LA 2Y5HA 1IAUA 5ESTE 3MH4A 1GJDB 1TGNA 2F83A 1G2MA 1UMAH 4NFFA 1BTYA 1G3CA 3S9BA 2SGFE 1G30B 1PQ5A 1W12U 2XRCA 2A0QB 3MMGA 2IPHA 4K1TA 3B9FH 4UE7H 1ZR0A 1HAGE 1GHXH 4OS2A 3AAUA 3M5LA 2ANMH 1QQUA 4J1YA 1C2KA 6GCHG 1THSH 1TBRH 1TALA 3ZVFA 4KTUA 1YCPK 3VB5A 1DICA 2JH0D 3TU7H 4E06H 5C2ZA 4AG2A 4CH2B 1ARCA 4IMQA 1V2RT 1OX1A 5I46H 1TBZH 1MTWA 1V2LT 1ZHPA 2VH0A 4NCYA 1EAIA 3SU5A 4A7IB 2GP9B 1C2DA 1Z71A 3E6PH 3NXPA 5EPYA 1ACBE 2BQ6B 2F3CE 1Y5UT 1N1LA 4ESTE 5T6DA 4MDSA 2AH4X 3RC5A 1Y3VA 3B8JA 4Y0YE 4Q7ZA 2VIQA 2ZKSA 1A61H 1O5DH 2TGDA 1FNIA 5CE1A 1UVTH 4GVUA 3T62A 1TMBH 3PROA 1BTHH 1O2SA 2FOAA 2WV5A 1WCZA 1LHDH 1E38B 3RXPA 1YC0A 3QUMP 2QF3A 2ZO3H 2YNBA 4RN6A 1EPTC 1VCPA 4YTAA 2ODPA 3DHKH 1C1TA 3O8RA 1DS2E 2OTVA 5EPNA 4ABBA 1PYTD 1TA6A 1DM4B 2HNTE 2TGPZ 2FOEA 3K6YA 2FPZA 1EP5A 4IMZA 2FP7B 2XWAA 3BG4B 1O32A 2ANKH 1WOFA 3E90B 5AF9H 2Z3EA 4WMFA 3LKWA 1MKWH 1HXEH 2CJIA 2BD4A 2IJOB 1DOJA 2Q6GA 1G37A 2Q6FA 5DP6A 1ARBA 2GGVB 3TGKE 2ZDVH 3ODFA 1ZSLA 1OWKA
chains in the Genus database with same CATH superfamily
1SQTA 2BLOA 3EQ0H 3STIA 1O3JA 4Y0ZE 3CP7A 1HAXB 1VZQH 2JETB 2Y6TA 1HXFH 1YPHC 1EZQA 2B0FA 1G3DA 1HDTH 3JZ2B 4TPYA 4GHQA 2BMGB 3PTNA 2AMQA 3BTFE 1DUAA 2BTCE 1TQ0B 1AVWA 2IPQX 1YCPH 1NC6A 1O3FA 2Z9LA 1UTOA 3PM3A 4DCDA 3ODDA 2P3FH 2Z7FE 2QYIA 5AHGH 1U6QA 3TITA 4FUJA 1W8BH 1OP2A 2CK3D 2DUCA 1THPB 2VJ1A 3ZVGA 1WXRA 4TYDA 2DE8A 3RM2H 4R0IA 3SHAH 1QBNA 3A8BA 4NIWA 4ABFA 4RI0A 1GDUA 1E79D 1SFIA 4Y7AA 5EQSA 1CO7E 3VXEH 1UK2A 4CRDA 1UVSH 3UWIA 5C3NA 1J15A 1FIWA 1XUJA 1A4WH 1H8IH 1ELGA 1P2NA 1TAWA 1A2CH 2XBXA 3GYMA 2HVYB 5IDKA 4MPUA 2OLGA 4ABIA 1P04A 1QL8A 2A2XH 3SU0A 2EI7A 5ETXA 1QRZA 2FOBA 1SOZA 3GCHB 3S7HB 2ASUB 3LPRA 1WUNH 2UUKB 4K2YA 5C0TA 1O5CB 3RXVA 3F9GA 2V3HH 1FY3A 2ZHQH 2OUAA 3MU1A 2BZ6H 1D9IA 2Y7ZA 3QTOH 1B7XB 4K8BA 2YMSB 4B71A 2WV4A 1G2LA 4DIIH 5T3HA 1NESE 1Y3WA 2F4LA 3SJOA 2F9VA 1K1MA 3A87A 4XOJA 4KGAA 7LPRA 4DT7B 1Q31A 3SJ8A 2XCNA 1CHOG 1O2UA 5EJLA 1IOEA 1VITH 2AMPA 3MU4A 4JK6A 3P6ZB 3OEED 1MAYA 1S6HA 5DJ7A 1BTPA 5FPTA 4NSVA 1GBBA 1GBCA 5A0AE 3SBKA 3VFEA 1O3LA 1VGCC 2W3KA 4Y8YA 1AVGH 5F53A 3A83A 2GMTC 1C2MA 3A8DA 2D2DA 1C2FA 1O34A 2D8WA 5F8ZA 2P95A 4CR5A 3PMAB 2XBWA 4WF8A 2PUXB 4Q4LA 2WSSD 1ELBA 1PFXC 2XWBI 2VIOA 1WTHD 1CHGA 1O2XA 4Q7XA 2R0LA 5JBAS 1IQMA 1NU7B 8LPRA 1C1VH 2B7DH 2JH5D 2BVSH 1ZMLA 3MYWA 3SU3A 2C8XB 2FI5E 2SGEE 3A84A 3PO1C 1Y3XA 3PWBA 1FV9A 1BMLA 2FOFA 3TH3H 3KIDU 2W7SA 1D6WA 1MTVA 1UCYH 5EXLA 1FJSA 1EAXA 1IQFA 1P03A 2QE7D 3UTUH 1ELEE 3A82A 3A7TA 4D7FA 1ABJH 1G9IE 2ZWLH 3TK9A 4J2YB 1Y3UA 4YT6H 2A4QA 2BHGA 2UUFB 4Q2KA 5T1VA 1YPKH 4BOHA 4FOUC 4MG3A 1H1BA 1C1OA 2F43B 1IQGA 3PTBA 3P8NA 1D3DB 1HAHH 1NRNH 2ZGBH 3D49H 1MTNC 1TA2A 5E0GA 3RMOH 1SGFG 1UHBA 3DFJA 2VNTA 3TIUA 2ZFSA 3GDVA 3M5MA 4K5ZA 1QB9A 1AUTC 2JKHA 4NIYA 1EPTA 4AB9A 1XVOA 3LGYA 1C2IA 1A5IA 5GCHF 4NA7A 4MNVA 1V6DA 1YLCA 4SGAE 1UK4A 4YT7H 4XBCA 4U01A 2XBYA 4K3JA 1V2UT 2ZFFH 1QIXB 4ISIH 3VB6A 2BD2A 2BDYA 1KMHB 2JETC 4O3UA 1GBAA 4I33A 1O36A 1ZZZA 1HAYB 1GL1A 3AK5A 1ESBA 5J4QA 1D6RA 4DVAU 2UWLA 2ULLA 2BX3A 2BXTH 3VEQB 1RTKA 4GCHG 1HJ9A 1Y5BT 1C5UA 2BLVA 1O3BA 1AD8H 2GCHF 3TNTA 1NFXA 1GBMA 5C20A 5EOKA 1GL0E 1QL9A 1W11U 1NBME 4BAMB 1ZPZA 2IN2A 4ASUD 2F9OA 3T27A 1LHFH 1AB9C 1BTZA 1MUEB 5DO4H 1DPOA 4GUXA 2J97A 1TX6A 5C1YA 1C2LA 4RT1A 1WU1A 3URCA 1LVMA 3RMLH 2P59A 2QV1A 4H4FA 1MU8B 1YP9A 2R3YA 1GCTC 2ZA5A 1P01A 2Z3DA 2G52A 2EY4C 1O3KA 1GMDF 2BDAA 2R9PA 1Z6JH 1C2GA 1HUTH 4B6EA 1AI8H 1TQ7B 1HGTH 2V3OH 1EJAA 4Z6AH 4WH6A 4AX9H 1UTNA 2L74A 1O35A 3GCHC 1TRNA 1D3QB 4IC6A 4ABAA 1OSSA 3BTEE 4K69A 4CHAB 1OOKB 1TPPA 4FUIA 4BAKB 4E05H 1IQJA 1CQQA 3SYJA 3KHVA 1ESTA 1S84A 4AG1A 1UO6A 4A1TA 4LOYH 1O39A 3E3TA 2G51A 2HPQH 3MNCA 1O3NA 2XC0A 1YF4A 2ZIQH 2Z9KA 1ANBA 1SQAA 4FETA 4ZHLU 3KQBA 1LQDB 4DW2U 3KYGA 4WJG2 1C5NH 4DGJA 3RM0H 2Q6DA 1C4V2 2BVXH 3VB3A 1J14A 1UVPA 1BMFD 1GI6A 4P00A 4I86A 4GSOA 1FPHH 4CRFA 1QNJA 2XBVA 3LGIA 3ZZ4A 2V0BA 2JH6D 1A0JA 5J4SA 5E2OA 1TWXB 3MHWU 3QZQA 1OWJA 1SGQE 4OS5A 1FAKH 1GMDG 3RXBA 1A7SA 1QHRB 2GZ9A 1E0FD 2Q1JA 2ZHDA 3DSOA 2P94A 4Q80A 1KXBA 1SKYE 2GMTB 3WWBA 2A5KA 3PWCA 3KF2A 3M3TA 4ABDA 3U69H 3SV8A 5DK1A 1V2NT 3NWUA 3JZ1B 3SOSA 2KCOA 3GCTG 3PLKA 1HJAB 4X6NA 1O3CA 3LJOA 1ZHMA 3A7WA 1LHGH 1F92A 2F91A 1TLDA 2FI4E 2Y7XA 1FLEE 1TABE 1AU8A 4YOIA 1GHAF 5AFYH 3HGPA 2G5NA 5TCCA 5FAHA 1F7ZA 4KELA 1K1JA 1AZ8A 1BQYA 4Y8XA 5F03A 3ZZ7A 5LPEA 1W7XH 3O8CA 1QCPA 2P8OC 2B9LA 2OK5A 1GJ9B 5FX5A 2H9HA 3TH4H 1GMCF 1CBWB 2O8TA 4HGCA 1P9UA 2ZHFH 4CBOA 2UUYA 1UVOA 1GCDA 3C1KA 3F0OA 3ZVEA 1HLTH 1KXCA 5CHAC 2FO9A 3SU2A 3MOCA 1O5BB 2VIPA 1QBVH 4XFQA 3M61U 1O2QA 4IBLH 4UFEH 1ZMNA 2SFAA 1TOMH 2VIDA 3SI4H 1EAWA 1GWAA 2J94A 1GBIA 1P8VC 3C27B 1MTNB 1P9SA 1DFPA 3PO1B 5FCRA 4DJZB 1EXFA 4YESB 1NRSH 2ZFQH 1AWFH 1MMJN 1N6XA 3E8LA 4OGXA 3F9FA 1TGTA 1MCTA 1GVLA 1S82A 1P2KA 5CHBA 2ZHEH 4MNYA 2WPDD 2BM2A 3OAAD 5DP8A 2JIZD 1T4VH 3P8GA 3F68H 4NA8A 5GXPA 4A5TS 1CA0C 1V2KT 2M5TA 2PV9B 4RSPA 4I8HA 3Q3XA 3QGJA 4HTCH 2XC5A 1RIWB 3KGPA 3DA9B 1SQRA 2SNWA 4F48B 1JWTA 5LPRA 2CN0H 3HK6B 3GY3A 4X1QU 5EQRA 2FOMB 1T8OA 4GLYA 3KQ5A 3N99A 1C5ZB 1NU9A 1DWCH 1NZQH 1PPCE 1C2JA 4ABJA 5JBBS 3I78A 3OSYA 1P57B 1ZGIA 1GJ7B 2XYAA 4WMEA 1BTUA 1MD7A 3EGKH 1SPJA 4NWLA 2GZ8A 2C4FH 3PB1E 1MTSA 3MH6A 4FUCA 1ELDE 2GCTB 3RXGA 4FUFA 1UTQA 2AGIX 3MWIU 3ZVCA 4JZ1A 5EIYA 1UHBB 3S9AA 2CMYA 2PSYA 5EQQA 1FN8A 2ESTE 2FM2A 1O3EA 4CRCA 4F4OC 4WXIA 4YM9A 5FPYA 1KIGH 1W7GH 2OC0A 3FZZA 1F0TA 1E34B 4JYVH 2Y5GA 4DOQA 3ATLA 5C94A 1OWDA 1TNIA 1ZPBA 2J98A 4F55A 2Z94A 3WWFA 2R3UA 3I29A 4D9QA 1W0ZU 2ZFPH 1ZPCA 1C5WB 3U8RH 1VR1H 2WPHS 4CHAC 1QRXA 3PMJA 2FTLE 3O8DA 1QURH 1BBRE 1DX5M 5LPFA 1EATA 4D7GA 5HGGA 5C17A 1WQVH 2QF5A 3UB0A 3F2HA 4ACAA 1S0QA 1UCYK 2C93B 3UNSA 1AFEH 1C2EA 2G81E 2V3MA 2CV3A 3BTME 4OS1A 2A7JA 1YKTA 1NY22 1PPEE 2AIPA 2FS9A 4D76A 4E7NA 4FU7A 3KQCA 2BDGA 2WHXA 3SUGA 3ZZ9A 4AFZA 2BZAA 3MTYA 1GGDB 1GBLA 1YBWA 1C4Y2 5AFZH 4X1RU 3LT3A 5E0JA 3QDZB 4B75A 3V3MA 5BRRE 1HPGA 1NT1A 2DE9A 3KNXA 3L6PA 4ISHH 4KP0A 2GT7A 4LK4A 4JYUH 1TGBA 3CS7A 3GDSA 3L3TA 1SGDE 2BB4A 2F9NA 1GHWH 4WY3A 1BMAA 1F5KU 1O31A 3RXUA 2GZ7A 1TOCB 3EE7A 1HJAC 4X2WA 3PLPA 3UR9A 5C1UA 1P06A 1SSXA 5K7RA 5T6GA 1AB9B 3D65E 3LC5A 1NRQH 4GHTA 2A2QH 1LPZB 3QK1A 4FXGH 1B5GH 3UREA 4PROA 1EJNA 2ODYB 5CDFE 5EXNA 1O3MA 2H9EH 3NCLA 1YPGH 4X6PA 1GHYH 2EEKA 1S6FA 1YPEH 2AYWA 3S69A 1HBTH 4I32A 3P8FA 1QB1A 4RKJB 3SGQE 2AGEX 2C8ZB 1SBWA 1WYKA 3KCGH 4O97A 4ZXXH 2H6MA 5IK2D 1SHYA 5CHAB 2FX4A 2BD5A 1P09A 3E16B 3U9AH 3ATMA 4OM9A 5KGOA 1GBKA 2G8TA 1DUEA 3MH5A 5LH8A 1T8MA 4A6LA 2CXVA 3GCOA 4Q7YA 1P12E 2ZU4A 5SGAE 2FS8A 5A0CA 1SGTA 4B1TA 1CBWC 3BTKE 1DY9A 4X1PU 1K1PA 1KDQA 4OS7A 4JZIA 1C5YB 1TNHA 1CGJE 4Y76A 5A8YA 2CF8H 2LNCA 1AHTH 3W1EA 4ZKOU 2F9PA 1GHBG 1AKSA 2ZFTA 2EQNA 2SGDE 1CGIE 3MI4A 4P02A 2C90B 8KME2 2PW8H 1ZOMA 4AORA 2ZCKP 3ZZ5A 1CA0B 7GCHG 1FQ3A 1T31A 4K8YA 5PTPA 1C1NA 1GBDA 1TNKA 2Y5FA 4KKDA 4NFEA 4Y7BA 1GJ4H 3LC3A 2KCAA 4VGCC 1SGRE 1S85A 2ZFRH 1LVBA 3MO6A 2R0KA 3RMNH 4TY7A 4XRNA 1HFDA 1C1PA 1NFWA 1E1QD 4K1EA 5GWZA 1A5HA 1T32A 4UEHH 3ZYEA 2PKAB 2TIOA 5FXLA 3ZZ6A 3V12A 4ZHAA 1Q3XA 2ZECA 3T25A 2UWPA 1FY4A 2RDEA 1FIZA 3RXRA 1FY8E 1TYNA 2CHAB 2ZC9H 1RTFB 2ANYA 3SQEE 2P16A 1EUFA 2HVXA 1Z7KA 5GIBA 3ITIA 1AZZA 4NA9H 3N7OA 2WPLS 1XXDA 2ZPRA 1WSSH 3A7XA 1RIWC 3FP7E 1BHXF 1MBQA 2ZTXA 3TLOA 4ZHMU 5F6MA 1A1RA 2M2AA 3RC4A 3SNEA 2A1DB 4B2BA 1MZDA 3EA7A 4Z0KA 3FZDA 2G55A 2G4UA 2ZU2A 3EYDA 4JYTA 1QRWA 1F0SA 1O37A 4FVBA 4OS6A 4ISLA 4Y11E 8ESTE 1P3EA 3TK6A 3RXAA 4UDWH 3V13A 3F9HA 1XXFA 2ZI2H 1OS8A 4ZKNU 1GVKB 2PGQB 2BLQA 4FUBA 2Z9IA 1A0HB 3W95A 3UNQA 1LCYA 3MNXA 1TX8A 1UJ1A 1MKXH 5H4IB 2OQ5A 4OS4A 3RXCA 3UQOA 5BPEA 1AQ7A 2VBCA 2Z9JA 7ESTE 1AE5A 1MZAA 3MNBA 3QO6A 3D23A 4MPVA 5ABWA 3UOUA 4CRGA 2HWLB 2TRMA 3BSQA 1AVXA 2A45B 1BZXE 3LOXA 1H8HD 1JBUH 1SGIB 2AEIH 3RXTA 4ABEA 5DN6D 1JIMA 4IS5A 3SJ9A 1P2JA 3EDXB 1GHVH 1J8AA 2H2ZA 3AAVA 1SG8B 4ZCNA 2P3TB 4AGKA 2FOGA 1LDTT 1GDNA 3HK3B 1FAXA 5HIZA 3RXJA 3RXQA 1SB1H 3MNSA 1E1RD 3F9EA 5FX6A 2VU8E 1PPZA 1O3OA 1QB6A 1IHTH 2A5AA 3TNSA 2OINA 5A0BA 4HI3A 1W3CA 3B23B 1MQ5A 2BXUH 3ZV8A 5GNDA 4SGBE 1AMHA 1GJ6A 2STAE 1LHCH 1PQ7A 1TBQH 1YM0A 8GCHG 3G01A 3W94A 1ANEA 3TVJB 2NWNA 3M3SA 2OBQA 4FUHA 4KTSA 3FAOA 1GI4A 2FOCA 3Q76A 2JDID 1C9TA 1NM6A 5L2YH 4THNH 1ZJKA 1ZRKA 4A1XA 5DP5A 5EODA 1LVYA 2ZHWH 1AE8H 2NU0E 3LU9B 1V2PT 2GCTC 1GI7B 1LHEH 2OBOA 1YPLH 5GCHG 3GY7A 1K1LA 1MBMA 1QZ8A 2HPPH 1K0HA 1P2MA 3RXLA 1O2YA 4JCNA 1K1OA 2BLWA 4LZ1H 4YOGA 2HRVA 4MVNA 1GBFA 1P2QA 1SMFE 2OP9A 1SL3A 1C5PA 2XTTB 2D1JA 1RJXB 2V35A 5E2PA 2WZQA 1MH0A 1V2OT 4IN2A 1EQ9A 3IITA 3UNRA 3BTTE 3F2FA 2ZGJA 4DURA 3SW2B 3OE7D 2BDBA 2ZU1A 1QJ6B 2XW9A 3A80A 3BIUH 3NRLA 4INLA 4UFGH 4GCHF 2PKSC 2YNAA 4ZXYH 1V2TT 1AWHB 4UD9H 5FHTA 1O2GH 1O2VA 4M9FA 4BXSA 4AFUA 1L1GA 3ESTA 1W10U 1C5VA 1O3HA 1LTOA 4AOQA 3F1SB 1HAPH 5C5NA 1QJ1B 4ZROA 1NFYA 2PTNA 3A88A 4DG4A 2GV7A 1GI1A 1M9UA 1CE5A 1SC8U 3SZEA 4DIHH 4CBNA 1O2TA 1A46H 2OQUA 3LDXH 3BEIB 1VITG 3U8TH 3ZVDA 3V7TA 3PV2A 3U28C 4LZ4B 2VWNA 1AGJA 1GHAG 3OEHD 5C67A 4X1NU 2BD7A 1TPSA 1JOUB 3T2NA 1KTSB 4FUEA 1C5RA 3NUMA 4NZQA 1DLKB 1C1QA 1BCUH 1SGNE 5JB9S 3BTQE 1EFRD 1YGCH 1OP0A 1TGCA 1SGFA 5EGMA 3EE0B 2GD4B 5FCKA 3ZZBA 5LGOA 4AB8A 1J9CH 1VITF 1A3BH 1TGSZ 1AFQC 2KM0A 5FPSA 2VVCA 4ZUHA 3LH3A 1EX3A 1PPFE 3FP6E 1H9LB 5AVDA 4YLQH 4ZMAH 2BY7X 2QGRA 1Z8GA 3OX7U 5HMAA 1HAVA 2J5UA 3QLPH 3FO8D 2J95A 1V2WT 2FDAA 4OGYA 3SNAA 5DP7A 3BEFB 2ZU3A 1AN1E 3S0NA 2EI6A 2ZDMA 1HAVB 1O5EH 1IQKA 1GBEA 4D8NA 3Q00A 4AGJA 2Y81A 1MAXA 1ZGVA 1ELFA 1BRBE 3ENSB 2C8YB 4YZUA 2FYQA 1AY6H 1W0KD 2GV6A 1Z6EA 3ZIAD 1L2EA 1PPGE 1JRTA 3UQVA 1S6LA 1WTGH 2ZP0H 1C5MD 1Y5AT 3ZZAA 2VWLA 1SLVB 3BTWE 4ASHA 3M7TA 2ZZUH 4X2VA 3A8AA 1P10A 1TIOA 2YOLA 3A7VA 1E37B 5DG6A 1EJMA 4D9RA 3ZVAA 1MU6B 4Y10E 3DUXH 4X8SH 1CA8B 2FOHA 1KLJH 4GPGA 1N6YA 2RCEA 1FPCH 1DVAH 1GBJA 1ZMJA 3FFGA 4TWYA 5E8EH 1C5QA 2VINA 1CHOF 1O3IA 5KEDA 4LXBH 3VPKA 1C1MA 1BMMH 3TJOA 1D3PB 1KXAA 4UONA 1ZTJA 4FU8A 2KAIB 3SORA 1F5LA 1XUGA 1FXYA 5DP3A 1L1JA 1UVUH 2PGBB 2UWOA 3S9CA 2QA9E 5C1XA 3TJUA 2TGAA 1Z8IB 2LELA 1OPHB 1BIOA 1EP6A 3RLYH 5B6OA 1J17T 2WV9A 1DSUA 1C4U2 1TRYA 2YMSD 3GY5A 2VVVA 3O8BA 3Q3YA 3IG6B 5L30H 3I77A 4BAQB 1H9HE 1LQEA 1HAZB 1O3GA 1K9OE 1EZUC 2BY6X 1XUHA 1ESAA 1UW7A 1W2KH 3M7QA 1C1SA 5TCAA 1B0EA 2ZU5A 3K6ZA 2QF0A 3LGTA 5JDUB 2ZDAH 1H8ED 2ZG0H 3FP8E 1O2KA 5EJZA 2SGPE 1FI8A 2PUQH 1F0UA 1NFUA 1S5SA 1FMGA 2J98B 3E0PB 4GAWA 4ZKSU 1O3DA 1HYLA 1DANH 3PMHB 1SVPA 4Z1MD 1LPKB 1QA7A 2QXGA 3M37A 2Z6BD 1NO9H 3QZRA 2OCVB 1MKWK 2AIQA 1GCTB 2O8UA 4X8VH 1W0YH 1UTJA 1GI9B 1IQEA 1J16A 1KXEA 3VXFH 3DCLA 2BD3A 2HGTH 5DKMA 3SGBE 1MABB 2PR3A 5EW1H 2OC8A 1BITA 1XMNB 2D26C 1K1NA 4Y8ZA 4CH8B 2KAIA 2GCHG 3FOAA 1UTLM 4TT3D 3SHCH 4NSYA 4I31A 3U98H 1XVMA 4YLUA 1HJ8A 1GJAB 1C5LH 1O38A 4XD7D 2BOKA 1QY6A 3KQEA 1G3BA 2BOHB 1DWBH 3NKKA 2FEQH 2FESH 1GJBB 1V3XA 3GY4A 3LGVA 5F8TA 3SZNA 2VWOA 2ZGXH 1ZHRA 1NROH 2J9NA 3SNDA 2A4OA 2J92A 3TK5A 2PFEA 3EA9A 3A89A 1ABIH 1C9PA 5A8XA 3MU8A 4CRBA 1RFNA 3PRDA 2C3SA 3RXDA 1P05A 1O2OA 4FU9A 1CT4E 5FL7D 3A7YA 3EAJA 3RC6A 1O0DH 3NZIA 1SFQB 2K1QA 1C5XB 4NZLA 1XUIA 2F9UA 5HYOA 3HPTB 1OKXA 4YOJA 1LO6A 2H5CA 2BDIA 1OP8A 1H9IE 2GDEH 3UUZA 1OYQA 3QGNB 4WMDA 3SJIA 3H7OA 4MTBA 2ZPQA 3OU0A 1KY9A 1Y3YA 2W7UA 6CHAB 4HG6A 1QR3E 1ZSKA 4BNRA 2XNDD 1DWDH 1V2ST 3SN8A 2A32A 2ZNKH 2A4GA 3ZZDA 1UK3A 4MQAA 1K22H 3F6UH 2WUBA 1KLIH 2QN5T 3M5NA 2AHME 2FLRH 2IOTA 1O2ZA 2R2WU 1ETTH 2P8OB 1YPMH 1LKBA 2O9QA 2G4TA 1JMOH 1DXPA 1IHSH 1QFKH 1FY5A 3AASA 2CGAA 3H5CB 1BBRK 1AO5A 4ZKRU 4XE4A 3ZYDA 1ZTKA 5KECA 2XOKD 3ATKA 1UCYE 3TJNA 1G3EA 1MKXK 5E0HA 2I6SA 4XBDA 1O3PB 3E1XB 5EG4A 4CRAA 4AN7A 1S81A 3UWJH 4I8GA 1EB2A 2ZDNA 4X6MA 2HNTF 1CVWH 4Y79A 1MTUA 4A1VA 3BG8A 1O5AB 4KTCA 4IN1A 1C1RA 3RU4T 2NU3E 4NIXA 2PKAA 1UTPA 3ZZ3A 1EASA 4B76A 1ZJDA 2QC2A 3Q3KA 3P70B 5DPAA 3BV9B 3GDUA 1WV7H 1YY3A 3LH1A 1NPMA 2QAAA 1EKBB 4RKOB 1ETRH 4B2CA 4WXVA 1V2JT 1EAUA 1BOQA 2SNVA 1L4ZA 3KQDA 4UFDH 1DITH 6LPRA 1K28D 2HNTC 4AYYB 3ZVBA 1W13U 1B0FA 2C8WB 1DT2A 2BQWB 1A0LA 1ZYOA 3LGUA 5G4BA 1NBMD 3A86A 1VCWA 2QCYA 1V2QT 5K0HA 3RXFA 1O2RA 3SV9A 1SLUB 1F2SE 2ZQ2A 3CENA 2GVFA 3GCTF 2XCFA 3OY5U 3M36A 1ELAA 1C1WH 2Z3CA 4FVDA 4XSKU 5T6FA 2AMDA 1FN6A 1C1UH 2PSXA 2XXLA 4X2XA 1ZTLA 3AVZA 1GI8B 4WVPE 2ZPSA 1NS3A 3VGCC 3SU6A 1DSTA 1NRPH 1TNLA 3NPSA 3RXEA 4CR9A 2RFKC 1WQSA 4NG9H 1YLDA 1YPHE 3ZV9A 3MO9A 4DT4A 2VVUA 1JIRA 1H8DH 4Y6DA 2SGAA 3RDZA 1JRSA 1E36B 4BAOB 1Z1IA 1DE7H 3LJJA 4E7RG 3UPEA 2RA0A 4CREA 3VB7A 1THRH 1DDJA 1S83A 1LKAA 2BDHA 1SGEE 2HOBA 2PHBA 3CNRA 3V0XA 7GCHF 3SJKA 1A3EH 3BTHE 3A81A 2FYRA 3ELAH 2H5DA 3FKSD 3MQKC 2FODA 1HNEE 1T4UH 1DY8A 2ZDLA 3GCNA 1ANCA 3U8OH 1EOJA 3K65B 3L33A 4JMYA 3U1JB 4WWYA 3HKIB 5L2ZH 2O8LA 1CGHA 1FZZA 1GGDC 4TWWA 2A7CA 2ODQA 2AERH 1BMNH 4ISOA 2SGQE 2K8IA 2ALPA 4X8TH 3A85A 3T5FH 1GG6C 1DWEH 4YO9A 1GI3A 3T29A 3MFJA 1FX0B 3RXIA 3U1IB 3RP2A 3SU4A 1G36A 3OY6U 2VGCC 5CMXH 4H6SB 6GCHF 4B2AA 1KYNA 1RTLA 3BTGE 1P02A 1C2HA 4TPIZ 1F0RA 1TMUH 1YLNA 1V2MT 2BYAX 4XBBA 1BA8B 2P93A 3R0FA 3GY8A 4B73A 6CHAC 4RT0A 1BTXA 1SGYE 1BRCE 2H1UA 1T7CA 4TSFD 5DSFA 8GCHF 2L6OA 4I7YH 1BRUP 1QJ7B 1VJAU 2OC7A 3BF6H 3S7KB 2GT8A 2ZTZA 2BD9A 2ZF0H 5A09A 2A31A 1O2JA 2O8MA 1K21H 4HFPB 1GHBF 4B74A 1GHZA 2HLCA 2NU2E 3D62A 2Y82A 5GDSH 1SLWB 4U30A 4WH8A 1F5RA 1QL7A 2J34A 3NK8A 2WYGA 3FVFB 3SV7A 3ZZ8A 3ZZCA 1PQAA 3VB4A 3PYHA 1EB1H 1TFXA 2BVRH 3HGNA 2J2UA 3E91A 3AW0A 5EXMA 2Z9GA 2WPMS 4JZFH 3SV6A 1CSOE 3BN9A 2W3IA 3UR6A 1N8OC 4U2WA 1BB0B 2NU4E 3SUDA 1SQOA 3TJVA 1UTMA 1ZLRA 2BQ7B 1L1NA 1TNJA 2TBSA 3PMBB 2AS9A 3T26A 3T28A 4O9VA 4ZAEA 5EJ1A 1FDPA 1QTFA 1GI0A 1OWHA 2PP6A 3M3VA 5TJXA 1KTTB 1KDQB 1RS0A 2AGGX 3HATH 2KCPA 1SHHB 2QXJA 3MO3A 1A5GH 3E0NB 1PQ8A 3DD2H 4VGCB 5JYIA 2STBE 4MNWA 5HIYA 1Y8TA 3QTVH 2Y80A 2FLBH 5JB8S 1VKYA 1QBOA 2IJD1 3H7TA 4A92A 4IW4E 5FBIA 2HLDD 5IYTA 1RXPA 1O2NA 1FY1A 1C5TA 4JZEH 2UUJB 1O2IA 3KYFA 1XKAC 1HAOH 3SI3H 1NTPA 2FZZA 3GY6A 2JJ2D 3RMMH 4IC5A 2PLXA 5DP4A 2ANWA 2VIWA 3K9XB 2EI8A 2CHAC 3QWCH 1BTWA 5GJ4B 1T8NA 3UAIC 1WAYB 1PPBH 3STJA 4O03A 4H42U 1P3CA 1ID5H 2PTCE 3FANA 4INKA 1ZSJA 1DXWA 2V6NA 1P2OA 2TGTA 2RG3A 3R3GB 4UFFH 3M35A 2HALA 4BXWA 1S0RA 1OWIA 1ORFA 1OWEA 2FXRA 1EZSC 1QQ4A 4AFQA 3M7UA 2F9BH 5HM2A 2BY8X 4I8KA 3TH2H 3PV5A 3LIWA 2GKVE 1TRMA 1GI2A 3UFAA 4BANB 3RU4E 4NWKA 3F3BA 3GYLB 5A8ZA 5L6NH 5EW2H 1LMWB 3RU4D 1ETSH 2ALVA 2PWXA 1HV7A 1O5FH 1BDAA 1UTKA 2EC9H 1P11E 2ILNA 2B8OH 1P0SH 3RLWH 4BAHB 1O3AA 3M5OA 1IQIA 3CS0A 3OTJE 3Q77A 1O2WA 1VCQA 3SGAE 1YCPM 2GDDA 2VH6A 1K2I1 1GMHG 1EOLA 3GISB 1C5SA 3SO3A 3RUOA 1BBRH 4U32A 9LPRA 2ZGHA 2QIQA 5DGJA 1SGCA 3ATIA 3P95A 1D3TB 1GPZA 1TMTH 1AIXH 4TY6A 1HAIH 2W6ID 2BD8A 4X0WU 1TB6H 1KSNA 2LPRA 3FN8A 2G00A 1O2MA 1OYTH 4DY7B 5HM9A 1V2VT 2OD3B 1O30A 4K1SA 3SV2H 4Y71A 1HRTH 1XX9A 1QGFA 2EA3A 3KN2A 3LGWA 4R8TB 1K1IA 3RXKA 2O8WA 3ATWA 2ZDKA 3P17H 4F49A 4MPWA 4ABHA 2FWWA 1Z8RA 1XUKA 1O5GH 2VGCB 3AW1A 2KFWA 4K60A 1KXDA 2W26A 4B6FA 5JPMH 1CT0E 3K2UA 4IGDA 1Z1JA 5A2MH 2VWMA 4ZH8A 4MLFB 3TGJE 3RXSA 3GICB 4FUDA 2XC4A 1O2HA 2CF9H 1YPJH 3GY2A 3KL6A 3GS9A 3SU1A 1HB0B 2V7QD 3WY8A 1GG6B 3OTPA 3A8CA 3A7ZA 3VGCB 1L4DA 2J38A 2FIRH 2QF4A 2ZTYA 1ZRBA 3BG4C 2OC1A 4AFSA 4Q63A 5JBTA 4NGAH 3MU0A 5GPIB 3SNBA 3HKJB 2QXHA 2QY0B 3SUFA 2ZEBA 1CT2E 1MCVA 2GX4A 1QA0A 1ELVA 1GMHF 1GBHA 3SQHE 1TONA 1EPTB 1Y59T 2R2MB 3SNCA 3URDA 1INCA 2G5VA 1O2PA 1TNGA 3VG8A 2A7HA 2FX6A 4I8JA 3BEUA 1O33A 2P3UB 2H9TH 5F8XA 3IWMA 4JK5A 2TPIZ 1VJ9U 2ZCHP 2PKSB 3RXOA 2W6JD 2WPJS 5JBCS 2YMSC 1IQHA 4MPXA 2B5TB 4AC9A 1GJ8B 2FMJA 2VIVA 1NN6A 1WDIA 4X2YA 2BY9X 3P92A 2FI3E 1LVOA 2A5IA 3BTDE 1XM1A 2QXIA 2RA3A 3QN7A 4X6OA 2RDLA 1D4PB 1Q2WA 4QT8C 1FONA 2ZQ1A 1W14U 5HXFA 1TPAE 1HCGA 1IQLA 1T8LA 3SUEA 1P2IA 3GOVB 1VGCB 2GTBA 1JXPA 1C5OH 3OYPA 3DFLA 3PRBA 4H6TA 1SOTA 1XKBC 2WPKS 1ELCA 1N8OB 5C0UA 1GI5A 2WYJA 1HIAA 2WPIS 1PPHE 3TPIZ 4AZ2B 2AFQB 3PLBA 1BHXB 3QX5H 2XNIA 1AUJA 1RD3B 2BX4A 2ZGCA 1BUIA 1SR5C 1BJUA 1MD8A 3P8OA 1NRRH 1CU1A 2W5EA 1SGPE 1GMCG 1XUFA 5FBEA 3BIVH 1G32B 3H09A 4O3TA 1WBGB 3UOPA 1TX7A 3TGIE 1MQ6A 2A4RA 4INHA 4ISNA 3RXMA 2NU1E 5B6LA 7KMEH 1AFQB 1TPOA 2BY5X 1LPGB 1L0ZA 1KXFA 4FUGA 2FTMA 5C5OA 3UIRA 1BT7A 1ELTA 2J4IA 6ESTA 1FUJA 4JZDH 1GJ5H 3MU5A 5ESBA 3DSGA 1PYTC 4HZHA 2WINI 3MH7A 2I6QA 2OXSA 1RRKA 1RGQA 1AKSB 1ANDA 4NIVA 4MNXA 1BJVA 4X8UH 3LONA 4ABGA 1OXGA 1SLXB 1EZXC 1BRAA 2THFB 9ESTA 2LP6A 3WW7A 1DLEA 1GBTA 4M7GA 1Z8JB 1PJPA 1SI5H 1YYY1 3F0PA 5I25A 1GDQA 2BDCA 3EA8A 5DP9A 4AYVB 3KEEA 1O2LA 4X1SU 3RXHA 4BTTB 4XDEA 1E35B 3DT0H 3PV4A 3UY9A 5EU8A 4BTUB 1TE0A 1HIAB 1H4WA 2WUCA 1KLTA 4BTIB 2VB0A 1X7AC 1GJCB 1GVZA 2ZCLP 1IQNA 4I8LA 2Y5HA 3OFND 1IAUA 3F2GA 3MH4A 5ESTE 1GJDB 1TGNA 2F83A 1G2MA 1UMAH 4NFFA 1BTYA 1G3CA 3S9BA 2SGFE 1G30B 1PQ5A 1W12U 2XRCA 2A0QB 3MMGA 2IPHA 4K1TA 3B9FH 4UE7H 1ZR0A 1HAGE 1GHXH 4OS2A 4YXWD 3AAUA 3DSPA 3M5LA 2ANMH 1QQUA 4J1YA 1C2KA 6GCHG 1THSH 3N7EA 1TBRH 1TALA 3ZVFA 4KTUA 1YCPK 3VB5A 1DICA 1COWD 2JH0D 3TU7H 4E06H 5C2ZA 4AG2A 4CH2B 3N7DA 2JJ1D 1ARCA 4IMQA 1V2RT 1OX1A 5I46H 1TBZH 1MTWA 1V2LT 1ZHPA 2VH0A 4NCYA 1EAIA 3SU5A 4A7IB 2GP9B 1C2DA 1Z71A 3E6PH 3NXPA 5EPYA 1ACBE 2BQ6B 2F3CE 2KR7A 1Y5UT 1N1LA 4ESTE 5T6DA 4MDSA 2AH4X 3RC5A 1Y3VA 3B8JA 4Y0YE 4Q7ZA 2VIQA 2ZKSA 1A61H 1O5DH 2TGDA 1FNIA 5CE1A 1UVTH 4GVUA 3T62A 1TMBH 3PROA 1BTHH 1O2SA 2KCYA 2FOAA 2WV5A 1WCZA 1LHDH 1E38B 3RXPA 2GJGA 1YC0A 3QUMP 2QF3A 1YWUA 2ZO3H 2YNBA 4RN6A 1EPTC 1VCPA 4YTAA 2KZ4A 2ODPA 1C1TA 3DHKH 3O8RA 1DS2E 2OTVA 5EPNA 4ABBA 1PYTD 1TA6A 1DM4B 1OHHD 2HNTE 2TGPZ 2FOEA 3K6YA 2FPZA 1EP5A 4IMZA 2FP7B 2XWAA 3BG4B 1O32A 2ANKH 1WOFA 3E90B 5AF9H 5HKKD 2Z3EA 4WMFA 4ACBA 3LKWA 1MKWH 2K0QA 1HXEH 2KX4A 2CJIA 2BD4A 2IJOB 1DOJA 2Q6GA 1G37A 2Q6FA 5DP6A 1ARBA 1W0JD 2GGVB 3TGKE 2ZDVH 3ODFA 1ZSLA 1OWKA
chains in the Genus database with same CATH topology
1SQTA 2BLOA 3EQ0H 3STIA 1O3JA 4Y0ZE 3CP7A 1HAXB 1VZQH 2JETB 2Y6TA 1HXFH 1YPHC 1EZQA 2B0FA 1G3DA 1HDTH 3JZ2B 4TPYA 4GHQA 2BMGB 3PTNA 2AMQA 3BTFE 1DUAA 2BTCE 1TQ0B 1AVWA 1YCPH 1NC6A 1O3FA 2Z9LA 1UTOA 3PM3A 4DCDA 3ODDA 2P3FH 2Z7FE 2QYIA 5AHGH 1U6QA 3TITA 4FUJA 1W8BH 1OP2A 2CK3D 2DUCA 1THPB 2VJ1A 3ZVGA 1WXRA 4TYDA 2DE8A 3RM2H 4R0IA 3SHAH 1QBNA 3A8BA 4NIWA 4ABFA 4RI0A 1GDUA 4Y7AA 1SFIA 5EQSA 1E79D 1CO7E 3VXEH 1UK2A 4CRDA 1UVSH 3UWIA 5C3NA 1J15A 1FIWA 1XUJA 1A4WH 1H8IH 1ELGA 1P2NA 1TAWA 1A2CH 2XBXA 3GYMA 5IDKA 4MPUA 2OLGA 4ABIA 1P04A 1QL8A 2A2XH 3SU0A 2EI7A 5ETXA 1QRZA 2FOBA 1SOZA 3GCHB 3S7HB 2ASUB 3LPRA 1WUNH 2UUKB 4K2YA 5C0TA 1O5CB 3RXVA 3F9GA 2V3HH 1FY3A 2ZHQH 2OUAA 3MU1A 2BZ6H 1D9IA 2Y7ZA 3QTOH 1B7XB 4K8BA 2YMSB 4B71A 2WV4A 1G2LA 4DIIH 5T3HA 1NESE 1Y3WA 3SJOA 2F4LA 2F9VA 1K1MA 3A87A 4XOJA 4KGAA 7LPRA 4DT7B 1Q31A 3SJ8A 2XCNA 1CHOG 1O2UA 1IOEA 1VITH 2AMPA 3MU4A 4JK6A 3P6ZB 3OEED 1MAYA 1S6HA 5DJ7A 1BTPA 5FPTA 4NSVA 1GBBA 1GBCA 5A0AE 3SBKA 3VFEA 1O3LA 1VGCC 2W3KA 4Y8YA 1AVGH 5F53A 3A83A 2GMTC 1C2MA 3A8DA 2D2DA 1C2FA 1O34A 2D8WA 5F8ZA 2P95A 4CR5A 3PMAB 2XBWA 4WF8A 2PUXB 4Q4LA 2WSSD 1ELBA 1PFXC 2XWBI 2VIOA 1WTHD 1CHGA 1O2XA 4Q7XA 2R0LA 5JBAS 1IQMA 1NU7B 8LPRA 1C1VH 2B7DH 2JH5D 2BVSH 1ZMLA 3MYWA 3SU3A 2C8XB 2FI5E 2SGEE 3A84A 3PO1C 1Y3XA 3PWBA 1FV9A 1BMLA 2FOFA 3TH3H 3KIDU 2W7SA 1D6WA 1MTVA 1UCYH 5EXLA 1FJSA 1EAXA 1IQFA 1P03A 2QE7D 3UTUH 1ELEE 3A82A 3A7TA 4D7FA 1ABJH 1G9IE 2ZWLH 3TK9A 4J2YB 1Y3UA 4YT6H 2A4QA 2BHGA 2UUFB 4Q2KA 5T1VA 1YPKH 4BOHA 4MG3A 1H1BA 1C1OA 3PTBA 1IQGA 2F43B 3P8NA 1D3DB 1HAHH 1NRNH 2ZGBH 3D49H 1MTNC 1TA2A 5E0GA 3RMOH 1SGFG 1UHBA 3DFJA 2VNTA 3TIUA 2ZFSA 3GDVA 3M5MA 4K5ZA 1QB9A 1AUTC 2JKHA 4NIYA 1EPTA 4AB9A 1XVOA 3LGYA 1C2IA 1A5IA 5GCHF 4NA7A 4MNVA 1V6DA 1YLCA 4SGAE 1UK4A 4YT7H 4XBCA 4U01A 2XBYA 4K3JA 1V2UT 2ZFFH 1QIXB 4ISIH 3VB6A 2BD2A 2BDYA 1KMHB 2JETC 4O3UA 1GBAA 4I33A 1O36A 1ZZZA 1HAYB 1GL1A 3AK5A 1ESBA 5J4QA 1D6RA 4DVAU 2UWLA 2ULLA 2BX3A 2BXTH 3VEQB 1RTKA 4GCHG 1HJ9A 1Y5BT 1C5UA 2BLVA 1O3BA 1AD8H 2GCHF 3TNTA 1NFXA 1GBMA 5C20A 5EOKA 1GL0E 1QL9A 1W11U 4BAMB 1NBME 1ZPZA 2IN2A 4ASUD 2F9OA 3T27A 1LHFH 1AB9C 1BTZA 1MUEB 5DO4H 1DPOA 4GUXA 1TX6A 5C1YA 1C2LA 1WU1A 3URCA 1LVMA 3RMLH 2P59A 2QV1A 4H4FA 1MU8B 1YP9A 2R3YA 1GCTC 2ZA5A 1P01A 2Z3DA 2G52A 1O3KA 1GMDF 2BDAA 2R9PA 1Z6JH 1C2GA 1HUTH 4B6EA 1AI8H 1TQ7B 1HGTH 2V3OH 1EJAA 4Z6AH 4WH6A 4AX9H 1UTNA 1O35A 3GCHC 1TRNA 1D3QB 4IC6A 4ABAA 1OSSA 3BTEE 4K69A 4CHAB 1OOKB 1TPPA 4FUIA 4BAKB 4E05H 1IQJA 1CQQA 3SYJA 3KHVA 1ESTA 1S84A 4AG1A 1UO6A 4A1TA 4LOYH 1O39A 3E3TA 2G51A 2HPQH 3MNCA 1O3NA 2XC0A 1YF4A 2ZIQH 2Z9KA 1ANBA 1SQAA 4FETA 4ZHLU 3KQBA 1LQDB 4DW2U 4WJG2 1C5NH 4DGJA 3RM0H 2Q6DA 1C4V2 2BVXH 3VB3A 1J14A 1UVPA 1BMFD 1GI6A 4GSOA 1FPHH 4CRFA 1QNJA 2XBVA 3LGIA 3ZZ4A 2V0BA 2JH6D 1A0JA 5J4SA 5E2OA 1TWXB 3MHWU 3QZQA 1OWJA 1SGQE 4OS5A 1FAKH 1GMDG 3RXBA 1A7SA 1QHRB 2GZ9A 1E0FD 2Q1JA 2ZHDA 3DSOA 2P94A 4Q80A 1KXBA 2GMTB 1SKYE 3WWBA 2A5KA 3PWCA 3KF2A 3M3TA 4ABDA 3U69H 3SV8A 5DK1A 1V2NT 3NWUA 3JZ1B 3SOSA 2KCOA 3GCTG 3PLKA 1HJAB 4X6NA 1O3CA 3LJOA 1ZHMA 3A7WA 1LHGH 1F92A 2F91A 1TLDA 2FI4E 2Y7XA 1FLEE 1TABE 1AU8A 4YOIA 1GHAF 5AFYH 3HGPA 2G5NA 5TCCA 5FAHA 1F7ZA 4KELA 1K1JA 1AZ8A 1BQYA 4Y8XA 5F03A 3ZZ7A 5LPEA 1W7XH 3O8CA 1QCPA 2P8OC 2B9LA 2OK5A 1GJ9B 5FX5A 2H9HA 3TH4H 1GMCF 1CBWB 2O8TA 4HGCA 1P9UA 2ZHFH 4CBOA 2UUYA 1UVOA 1GCDA 3C1KA 3ZVEA 3F0OA 1HLTH 1KXCA 5CHAC 2FO9A 3SU2A 3MOCA 1O5BB 2VIPA 1QBVH 4XFQA 3M61U 1O2QA 4IBLH 4UFEH 1ZMNA 2SFAA 1TOMH 2VIDA 3SI4H 1EAWA 1GWAA 2J94A 1GBIA 1P8VC 3C27B 1MTNB 1P9SA 1DFPA 3PO1B 5FCRA 4DJZB 1EXFA 4YESB 1NRSH 2ZFQH 1AWFH 1MMJN 1N6XA 3E8LA 4OGXA 3F9FA 1TGTA 1MCTA 1GVLA 1S82A 1P2KA 5CHBA 2ZHEH 4MNYA 2WPDD 2BM2A 5DP8A 3OAAD 3P8GA 1T4VH 2JIZD 3F68H 4NA8A 5GXPA 4A5TS 1CA0C 1V2KT 2M5TA 2PV9B 4RSPA 4I8HA 3Q3XA 3QGJA 4HTCH 2XC5A 1RIWB 3KGPA 3DA9B 2SNWA 1JWTA 5LPRA 2CN0H 3HK6B 3GY3A 4X1QU 5EQRA 2FOMB 1T8OA 4GLYA 3N99A 1C5ZB 1NU9A 1DWCH 1NZQH 1PPCE 1C2JA 4ABJA 5JBBS 3I78A 3OSYA 1P57B 1ZGIA 1GJ7B 2XYAA 4WMEA 1BTUA 1MD7A 3EGKH 1SPJA 4NWLA 2GZ8A 2C4FH 3PB1E 1MTSA 3MH6A 4FUCA 1ELDE 2GCTB 3RXGA 4FUFA 1UTQA 2AGIX 3MWIU 3ZVCA 4JZ1A 1UHBB 3S9AA 2CMYA 2PSYA 5EQQA 1FN8A 2ESTE 2FM2A 1O3EA 4CRCA 4F4OC 4WXIA 4YM9A 5FPYA 1KIGH 1W7GH 2OC0A 3FZZA 1F0TA 1E34B 4JYVH 2Y5GA 4DOQA 3ATLA 1OWDA 1TNIA 1ZPBA 4F55A 2Z94A 3WWFA 2R3UA 3I29A 4D9QA 1W0ZU 2ZFPH 1ZPCA 1C5WB 3U8RH 1VR1H 2WPHS 4CHAC 1QRXA 3PMJA 2FTLE 3O8DA 1QURH 1BBRE 1DX5M 5LPFA 1EATA 4D7GA 5HGGA 5C17A 1WQVH 2QF5A 3UB0A 3F2HA 1S0QA 1UCYK 2C93B 3UNSA 1AFEH 1C2EA 2G81E 2CV3A 3BTME 4OS1A 2A7JA 1YKTA 1NY22 1PPEE 2AIPA 2FS9A 4D76A 4E7NA 4FU7A 3KQCA 2BDGA 2WHXA 3SUGA 3ZZ9A 4AFZA 2BZAA 3MTYA 1GGDB 1GBLA 1YBWA 1C4Y2 5AFZH 4X1RU 3LT3A 5E0JA 3QDZB 4B75A 3V3MA 5BRRE 1HPGA 1NT1A 2DE9A 3KNXA 3L6PA 4ISHH 4KP0A 2GT7A 4LK4A 4JYUH 1TGBA 3CS7A 3GDSA 3L3TA 1SGDE 2BB4A 2F9NA 1GHWH 4WY3A 1BMAA 1F5KU 1O31A 3RXUA 2GZ7A 1TOCB 1HJAC 4X2WA 3PLPA 3UR9A 5C1UA 1P06A 1SSXA 5K7RA 5T6GA 1AB9B 3D65E 3LC5A 1NRQH 4GHTA 2A2QH 1LPZB 3QK1A 4FXGH 1B5GH 3UREA 4PROA 1EJNA 2ODYB 5CDFE 5EXNA 1O3MA 2H9EH 3NCLA 1YPGH 4X6PA 1GHYH 2EEKA 1S6FA 1YPEH 2AYWA 3S69A 1HBTH 4I32A 3P8FA 1QB1A 4RKJB 3SGQE 2AGEX 2C8ZB 1SBWA 1WYKA 3KCGH 4O97A 4ZXXH 2H6MA 5IK2D 1SHYA 5CHAB 2FX4A 2BD5A 1P09A 3E16B 3U9AH 3ATMA 4OM9A 1GBKA 2G8TA 1DUEA 3MH5A 5LH8A 1T8MA 4A6LA 2CXVA 3GCOA 4Q7YA 1P12E 2ZU4A 5SGAE 2FS8A 5A0CA 1SGTA 4B1TA 1CBWC 3BTKE 1DY9A 4X1PU 1K1PA 1KDQA 4OS7A 4JZIA 1C5YB 1TNHA 1CGJE 4Y76A 5A8YA 2CF8H 2LNCA 1AHTH 3W1EA 4ZKOU 2F9PA 1GHBG 1AKSA 2ZFTA 2SGDE 1CGIE 3MI4A 8KME2 2C90B 2PW8H 1ZOMA 4AORA 2ZCKP 3ZZ5A 1CA0B 7GCHG 1FQ3A 1T31A 4K8YA 5PTPA 1C1NA 1GBDA 1TNKA 2Y5FA 4KKDA 4NFEA 4Y7BA 1GJ4H 3LC3A 2KCAA 4VGCC 1SGRE 1S85A 2ZFRH 1LVBA 3MO6A 2R0KA 3RMNH 4TY7A 1HFDA 1C1PA 1NFWA 1E1QD 4K1EA 5GWZA 1A5HA 1T32A 4UEHH 3ZYEA 2PKAB 2TIOA 5FXLA 3ZZ6A 3V12A 4ZHAA 1Q3XA 2ZECA 3T25A 2UWPA 1FY4A 1FIZA 3RXRA 1FY8E 1TYNA 2CHAB 2ZC9H 1RTFB 2ANYA 3SQEE 2P16A 1EUFA 2HVXA 1Z7KA 5GIBA 3ITIA 1AZZA 4NA9H 3N7OA 2WPLS 1XXDA 2ZPRA 1WSSH 3A7XA 1RIWC 3FP7E 1BHXF 1MBQA 2ZTXA 3TLOA 4ZHMU 5F6MA 1A1RA 2M2AA 3RC4A 3SNEA 2A1DB 4B2BA 1MZDA 3EA7A 4Z0KA 3FZDA 2G55A 2G4UA 2ZU2A 3EYDA 4JYTA 1QRWA 1F0SA 1O37A 4FVBA 4OS6A 4ISLA 4Y11E 8ESTE 1P3EA 3TK6A 3RXAA 4UDWH 3V13A 3F9HA 1XXFA 2ZI2H 1OS8A 4ZKNU 1GVKB 2PGQB 2BLQA 4FUBA 2Z9IA 1A0HB 3W95A 3UNQA 1LCYA 3MNXA 1TX8A 1UJ1A 1MKXH 5H4IB 2OQ5A 4OS4A 3RXCA 3UQOA 5BPEA 1AQ7A 2VBCA 2Z9JA 7ESTE 1AE5A 1MZAA 3MNBA 3QO6A 3D23A 4MPVA 5ABWA 3UOUA 4CRGA 2HWLB 2TRMA 3BSQA 1AVXA 2A45B 1BZXE 3LOXA 1H8HD 1JBUH 1SGIB 2AEIH 3RXTA 4ABEA 5DN6D 1JIMA 4IS5A 3SJ9A 1P2JA 3EDXB 1GHVH 1J8AA 2H2ZA 3AAVA 1SG8B 4ZCNA 2P3TB 4AGKA 2FOGA 1LDTT 1GDNA 3HK3B 1FAXA 3RXJA 3RXQA 1SB1H 3MNSA 1E1RD 3F9EA 5FX6A 2VU8E 1PPZA 1O3OA 1QB6A 1IHTH 2A5AA 3TNSA 2OINA 5A0BA 4HI3A 1W3CA 3B23B 1MQ5A 2BXUH 3ZV8A 5GNDA 4SGBE 1AMHA 1GJ6A 2STAE 1LHCH 1PQ7A 1TBQH 1YM0A 8GCHG 3G01A 3W94A 1ANEA 3TVJB 2NWNA 3M3SA 2OBQA 4FUHA 4KTSA 3FAOA 1GI4A 2FOCA 3Q76A 2JDID 1C9TA 1NM6A 5L2YH 4THNH 1ZJKA 1ZRKA 4A1XA 5DP5A 5EODA 1LVYA 2ZHWH 1AE8H 2NU0E 3LU9B 1V2PT 2GCTC 1GI7B 1LHEH 2OBOA 1YPLH 5GCHG 3GY7A 1K1LA 1MBMA 2HPPH 1P2MA 3RXLA 1O2YA 4JCNA 1K1OA 2BLWA 4LZ1H 4YOGA 2HRVA 4MVNA 1GBFA 1P2QA 1SMFE 2OP9A 1SL3A 1C5PA 2XTTB 2D1JA 1RJXB 2V35A 5E2PA 2WZQA 1MH0A 1V2OT 4IN2A 1EQ9A 3IITA 3UNRA 3BTTE 3F2FA 2ZGJA 4DURA 3SW2B 3OE7D 2BDBA 2ZU1A 1QJ6B 2XW9A 3A80A 3BIUH 4INLA 3NRLA 4UFGH 4GCHF 2PKSC 2YNAA 4ZXYH 1V2TT 1AWHB 4UD9H 5FHTA 1O2GH 1O2VA 4M9FA 4BXSA 4AFUA 1L1GA 3ESTA 1W10U 1C5VA 1O3HA 1LTOA 4AOQA 3F1SB 1HAPH 5C5NA 1QJ1B 4ZROA 1NFYA 2PTNA 3A88A 4DG4A 2GV7A 1GI1A 1M9UA 1CE5A 1SC8U 3SZEA 4DIHH 4CBNA 1O2TA 1A46H 2OQUA 3LDXH 3BEIB 1VITG 3U8TH 3ZVDA 3V7TA 3PV2A 4LZ4B 2VWNA 1AGJA