1DXWA

Structure of hetero complex of non structural protein (ns) of hepatitis c virus (hcv) and synthetic peptidic compound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
TGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRASKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEASE
publication title Inhibitor Binding Induces Active Site Stabilisation of the Hcv Ns3 Protein Serine Protease Domain
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2000-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dxwA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1dxwA01
1NY22 3U9AH 1AFQB 1JOUB 1RIWC 1P9UA 2ZCHP 2V6NA 1E38B 2WPJS 1A0HB 5DP4A 2CXVA 5DP6A 1A3BH 2P3UB 4BAMB 4DJZB 3CS0A 1NFYA 1EQ9A 3QTVH 2ZECA 4UFFH 2IJOB 1SGDE 2BY6X 1GBIA 4ZAEA 2P94A 1GJ6A 1LHEH 1XX9A 5TJXA 1V2UT 1RTFB 1GMCG 3RUOA 4IBLH 3SV9A 2W7SA 5FPYA 1S6FA 3V13A 1BITA 1VR1H 2EI8A 5TCAA 2WUBA 1C1SA 2BM2A 2R3UA 3BTKE 1S82A 1BMAA 5C5OA 1GBDA 1UMAH 1WQSA 2NWNA 4AB9A 1BRAA 2SGAA 2BLQA 2C93B 2PV9B 1ZTLA 1C2DA 2Y81A 5GNDA 1AI8H 2HNTE 2BQ7B 1LHFH 1S83A 2ZDLA 1V2JT 3I77A 1NFWA 2ZO3H 2JKHA 4A7IB 4YT7H 4MDSA 4OS2A 1G2LA 1N8OC 2ZU3A 1C9TA 3PMJA 3AVZA 1D3QB 1UTJA 3LOXA 1QB1A 4H4FA 1QB9A 4CREA 1QL8A 1C2MA 3LH3A 4YOIA 1NU7B 2VIDA 1JIRA 2P8OC 1LPGB 3SBKA 2BY8X 1N1LA 4BANB 2ZHWH 3UQVA 2Y7XA 2VGCB 2Y5HA 3BTHE 2ZCLP 1O2NA 3TJNA 1W7XH 4RN6A 5T6FA 1O30A 3VPKA 3DD2H 1DOJA 3LC3A 2QXHA 1NRQH 4J1YA 2ZU1A 2ZFPH 2ZTZA 1BT7A 3MNBA 1TPSA 1EZQA 1TNJA 3GYLB 1TALA 3UWIA 1Z8IB 2H6MA 1ELFA 1VCWA 1O2VA 1GGDC 3PTNA 1UTQA 4JZIA 4ABJA 3ODDA 1P2IA 3K6YA 3RXDA 1ZGVA 1FNIA 4LZ4B 1Y3UA 1HB0B 1PPEE 4Y0ZE 8KME2 3MH6A 1P2OA 1O3LA 2UUFB 1AVXA 1NT1A 1Z1JA 2B7DH 4Q2KA 1VJAU 5B6LA 1JXPA 4CR9A 5A8YA 1ARBA 2A45B 1NPMA 1G3DA 2UWPA 2G4TA 1SGEE 1Y3WA 1O2MA 2Y5GA 2XXLA 1CE5A 3BIUH 1FI8A 3BSQA 1ELCA 1GBEA 1TMBH 4DVAU 7KMEH 1UCYE 1XM1A 3ENSB 5AVDA 4B75A 3ZVAA 3RXMA 1AZ8A 2AIQA 1EXFA 1UTOA 1GI1A 1WTGH 2NU4E 2Z9LA 2ZU4A 1UVTH 3EYDA 3PMBB 4MPWA 1SG8B 1EAUA 1C5XB 1NU9A 1JBUH 4Y79A 3FANA 3GCOA 2RDLA 2VINA 2TBSA 4I33A 1IQJA 1TNHA 1U6QA 3DT0H 3ZZBA 5K7RA 3LGVA 4DGJA 2OINA 1CO7E 3QZRA 2H9EH 2LNCA 1BTUA 2BD7A 3SV2H 1WV7H 3EA8A 2ZU5A 4BTUB 5CE1A 3MMGA 1GDQA 1B7XB 1WTHD 1EKBB 1FONA 1KY9A 1SGYE 2EEKA 1EB2A 5EG4A 4CHAC 3SNAA 3AK5A 3ESTA 3BIVH 4X0WU 4X8SH 3MWIU 1QRWA 2W26A 1S0RA 2ODYB 5GDSH 4CBNA 1MTNB 3ZZ7A 4NFEA 1QURH 3PV4A 2FYQA 2Z94A 3RM2H 3SU5A 2Y80A 3LGWA 1CBWB 1UVSH 4Y0YE 2HPPH 4BTTB 4WXVA 1C1VH 2BMGB 3RU4D 3RXVA 2A4OA 2PGBB 3LU9B 2B8OH 4YESB 4AFSA 4FU9A 5PTPA 4DY7B 1O3KA 1W14U 3TU7H 1SOTA 3SUDA 4B73A 1O2UA 1SQAA 4OS6A 3SJOA 5JBAS 1BUIA 4ZMAH 2WPKS 1O2XA 1DT2A 5C1UA 1Z6JH 1XUGA 1L2EA 1MTUA 4WMEA 2FO9A 1MQ5A 1MH0A 1IAUA 4ZXYH 3A8DA 4HI3A 1HLTH 1JMOH 3SN8A 2G8TA 4Q80A 4FUFA 2O9QA 2TIOA 2ZF0H 3RXFA 2VU8E 2FI5E 1CU1A 2ZTYA 3V12A 2QXIA 2HLCA 1KYNA 2ZTXA 2G55A 4BXWA 1W10U 4FVDA 3E1XB 1HIAA 2PLXA 1HNEE 3EGKH 2XC0A 1C1NA 5E0JA 1C1TA 3TGKE 1Q3XA 5DPAA 1DS2E 1CHOG 1ZTKA 3JZ2B 2A7HA 4XBBA 1PPFE 1SR5C 1SGTA 3U1JB 1WYKA 4JK6A 3RDZA 2P59A 2B0FA 3E3TA 4Y8ZA 3QLPH 2RA3A 1TX8A 2WPIS 4XE4A 1CGIE 5ETXA 3KF2A 3MYWA 1P03A 2OCVB 1AVGH 1W7GH 4K8BA 1J15A 1LQEA 2ANMH 4UFEH 1LO6A 4X8TH 4JCNA 1BHXB 3R3GB 1HRTH 1O2KA 5AFZH 3QGJA 1DM4B 3PB1E 3A81A 1GPZA 3F68H 5JB8S 1UHBA 1O32A 1RS0A 1K1JA 1HV7A 3GDSA 4Y71A 1O3PB 4ABFA 3A8BA 4MPVA 2VWOA 1YPHC 3LT3A 4UFGH 3RXSA 3ZZDA 4A5TS 1UVPA 5EQRA 1YF4A 3PLPA 4NCYA 3SJIA 1G3CA 1EOLA 3Q77A 1O3EA 2PTNA 2A1DB 1TMTH 3SUFA 4IMQA 3ZZ3A 1GI6A 5H4IB 4D7FA 3S0NA 1T4VH 3LC5A 4X8UH 4B1TA 1ZMNA 4I8HA 4Q7YA 1ELBA 3G01A 1O3MA 4NZQA 1TGNA 2IPHA 2XBXA 3E0NB 1F0TA 1WXRA 1DDJA 1AD8H 3ZZ6A 4X1RU 1BA8B 1PJPA 2V3HH 1YKTA 1S84A 5A8ZA 4I8KA 1C5SA 1TGSZ 5DP7A 1Z7KA 4HGCA 3M3SA 1TOCB 3MU5A 1OP0A 2DUCA 1GJ7B 1EZSC 1GCTC 2R2MB 3A8CA 1K1MA 1QQ4A 3GCNA 3LIWA 3LPRA 1CA8B 1MCTA 1LPZB 3K6ZA 1O3AA 2PKAA 1L1GA 1SQOA 2CF9H 3SGBE 5C67A 1ABIH 1GDNA 4YLUA 1ZHRA 2GV7A 1GJBB 1LHDH 3HK3B 2BZAA 1H4WA 1F0RA 4X2WA 1GDUA 1AE8H 1NN6A 2ALPA 3OY5U 1ANBA 4IN2A 1RTKA 5LGOA 2P95A 1O34A 1SSXA 2GZ9A 1BZXE 3VXEH 4Y7BA 2W3IA 1N8OB 2C90B 3QZQA 2WV4A 3A7XA 5EPYA 2IOTA 2Q6GA 3DUXH 2ZDAH 3RC6A 2Y5FA 2WHXA 1CVWH 3S9BA 4MG3A 1UK3A 3SGQE 2WPHS 2RG3A 1ESBA 2GCHG 1A0JA 2AMDA 1AQ7A 2G5VA 3A7TA 1XUIA 1QHRB 4NWKA 5I46H 2H9TH 2C3SA 1B0EA 5L30H 2GCHF 1W8BH 1C4U2 2GZ7A 1QB6A 1O3IA 1ZHPA 4H6TA 4O3UA 3SU6A 4M9FA 3FAOA 8LPRA 4FUJA 2GDEH 3KIDU 5L2YH 1C4V2 3ZVDA 1FDPA 2OC7A 3NWUA 1V2ST 4FUBA 4X1PU 1BRBE 4O03A 1XUFA 1YM0A 3F6UH 4NSVA 2PWXA 5JB9S 1RTLA 6ESTA 4OS4A 3OSYA 4X8VH 3GCHB 3UFAA 4X1NU 1PPBH 1TBZH 1GGDB 1QBNA 1CT4E 4K3JA 1G37A 1TONA 1WOFA 3P92A 2GT8A 4X2XA 3SNCA 1K1PA 2VWMA 1QRZA 3GDUA 3ITIA 2W7UA 3C27B 1D3PB 1SVPA 2BDAA 1YPLH 1V2QT 1GJ8B 4XBCA 3UR9A 2RA0A 2BTCE 3KQBA 2AMQA 2SGQE 5EXLA 3P17H 4YT6H 1LHCH 5FXLA 1A46H 1OOKB 2WV5A 2G4UA 2J92A 3GDVA 1NRSH 1GMHG 4OGYA 2STAE 4J2YB 3ZZAA 4RSPA 4FUDA 2A5AA 5GJ4B 1DWDH 2ZIQH 1BB0B 4INLA 1EUFA 2BXTH 3T62A 2Y82A 4DW2U 1VGCC 2FIRH 4BNRA 2ZI2H 4XBDA 1A61H 2SGDE 3SYJA 3T5FH 2FOGA 1O3FA 2ZQ2A 4PROA 1ETTH 1FPHH 1C2JA 1DICA 2BY5X 1GHZA 5C2ZA 4ABBA 2XCFA 2UWLA 2PFEA 1YP9A 3GY3A 1YCPK 4LZ1H 2A4GA 4D7GA 1TRNA 3RXHA 2AGGX 2ZFQH 3F9HA 2NU2E 1TFXA 2O8LA 3PLBA 3MO3A 3SU4A 1FIZA 1MD8A 2FOBA 2A31A 4CHAB 1P06A 1IQMA 1UCYH 3HGPA 3KHVA 1AIXH 2ULLA 1O3NA 1GJ9B 1ZPZA 3I29A 2ZP0H 1EZUC 1KXDA 1IQLA 1S6HA 3T28A 3NK8A 5LPRA 1C1RA 1SGRE 5A8XA 1O2JA 1TQ0B 3TPIZ 1OYTH 1TAWA 7LPRA 4JK5A 1NRNH 5DP9A 1C1MA 1PYTC 3P95A 3CENA 1LQDB 1HAVB 3E8LA 1O2IA 1RD3B 2WV9A 4E05H 2GMTC 2OTVA 1TB6H 1E0FD 1YLCA 1NO9H 3ZZ8A 3MO6A 2GTBA 2PUQH 1QQUA 1EJAA 1HDTH 1E35B 4Q7XA 1ELVA 2FDAA 2FS8A 1T8OA 2TGTA 1C5VA 2OC1A 3C1KA 3LJJA 1SGFA 3FP6E 1DPOA 3TGJE 1A7SA 2OC0A 4ABHA 2FZZA 3TH2H 4CRGA 3N7OA 2WYJA 1Y5BT 1CGJE 1TIOA 1YPEH 1GHAG 3K65B 1P05A 1DWBH 4MPXA 1VZQH 3HPTB 5GPIB 2JH5D 5HYOA 1J8AA 1UCYK 3O8BA 3TVJB 4CH8B 3HGNA 4LXBH 2AFQB 2AGIX 2GGVB 4Y10E 1KTSB 2I6SA 4AGJA 2QCYA 1NRRH 2P93A 2XW9A 2F9NA 3NPSA 1A5IA 2BZ6H 1OWDA 5HGGA 2JH6D 1C5ZB 4O97A 2F4LA 4XDEA 3SUEA 3TLOA 3MO9A 4B71A 2VIQA 1HXFH 4NIXA 2FI3E 1Y59T 3ZZ4A 4K2YA 1O2PA 1GJCB 1CQQA 1ORFA 1HPGA 1YPKH 4JMYA 1GBAA 3S9AA 1BTWA 2AH4X 3MHWU 7GCHG 1IQEA 3MOCA 5ESBA 3ZZ5A 1UJ1A 2STBE 1C9PA 2ALVA 1DE7H 7GCHF 1BRUP 2G81E 5L2ZH 2ZFSA 3ZVEA 1AUTC 5DJ7A 1C5UA 3E16B 2YNAA 3SO3A 1GBMA 2OP9A 2WZQA 1F7ZA 1JIMA 4HZHA 1QNJA 1Q2WA 1Z8RA 3CP7A 1D4PB 5GIBA 1GMCF 5LPFA 4ABAA 1MU6B 4AOQA 1BQYA 3A82A 4FVBA 4JYVH 1QIXB 5EW2H 3MU4A 1C5QA 3RU4T 3MH5A 3M5OA 2ZGBH 3LGIA 2C8YB 2F83A 1Y3XA 2C8ZB 1P04A 1QL7A 2VIOA 3KGPA 1TGTA 1LMWB 5ESTE 2ZGXH 1EZXC 2R2WU 4GAWA 1BTYA 3TK5A 2BQWB 4WH8A 2C4FH 4YLQH 3TK9A 1O5DH 3M35A 4NA8A 5EW1H 3RXJA 2BD9A 8ESTE 3LGYA 5A2MH 1OWKA 1V2VT 1TNIA 3FZZA 2O8UA 1ZSKA 4UFDH 2OK5A 2BDBA 2P16A 1C5RA 2VBCA 1EB1H 4E7NA 4YO9A 1EPTC 1FZZA 3OY6U 3OTPA 3BTDE 2Y6TA 1MZDA 3KQCA 2A0QB 2W3KA 3Q00A 1C1QA 3LKWA 1ELTA 1QJ1B 3O8CA 4ZHLU 4CRDA 3PM3A 3GY7A 4KKDA 4TPYA 1YPHE 1ETRH 1T31A 5GXPA 1C1WH 5L6NH 3PO1C 2Z9KA 2FLBH 1NRPH 1O36A 1O0DH 4I8JA 4DOQA 4VGCC 1Y3YA 3TJUA 1OPHB 1ZRKA 1FUJA 1GI0A 2GZ8A 1PFXC 2ZA5A 4THNH 1HUTH 4KP0A 5EPNA 4DCDA 2UWOA 2A7CA 1HJ9A 1TLDA 4BTIB 5EGMA 1VITH 2HRVA 4D76A 8GCHG 1FPCH 2ZDKA 3TJVA 4BXSA 3ZYDA 1OS8A 1MTVA 2QXGA 3D62A 4Z6AH 2VIWA 2OD3B 1LTOA 1WAYB 2VIVA 4F49A 4Y76A 3P8FA 1F5LA 3VGCC 1GG6C 1DUEA 2VWNA 5A0AE 3MNXA 3V3MA 1K9OE 5T1VA 1AKSB 3V0XA 1JRTA 2ZGCA 1GJDB 2AERH 1FXYA 5LPEA 1NESE 1P9SA 1FY4A 3SJ9A 3RMNH 3ODFA 2O8MA 2XBVA 1HYLA 1O5CB 4I32A 3M5MA 1XMNB 2ZWLH 4RI0A 3SU1A 4K1SA 1A5HA 1XXDA 1ESTA 1VGCB 2VNTA 4F4OC 1LKAA 1QY6A 2TPIZ 1K28D 2PW8H 1AVWA 4OS7A 1XVMA 1ANEA 1MMJN 4YTAA 1EOJA 2PR3A 4IN1A 1Q31A 4AN7A 1KLJH 4B76A 1XKBC 2GVFA 1C5LH 1AMHA 4NWLA 1GL0E 1GBFA 3FP7E 4TY6A 2F9VA 2ZNKH 2ZHQH 1J14A 1F0UA 5C3NA 4U32A 1EP5A 2ZFTA 4AORA 5EXNA 5F03A 5BRRE 4AFUA 1BCUH 1ELGA 3E0PB 2BLOA 2EA3A 3QDZB 4YOJA 1GHVH 2FX4A 2UUKB 1KXFA 1D6RA 2Z3CA 3STJA 4GLYA 1YYY1 3SNBA 2HGTH 1OX1A 1BTPA 3KQEA 1LDTT 1W2KH 5EU8A 4BOHA 1V6DA 1UK4A 2VVCA 2YNBA 3ATMA 1IQGA 3ELAH 4UDWH 1IHSH 2ZCKP 4X6NA 4ZROA 1G36A 3OYPA 3RXTA 1O38A 2GMTB 4NZLA 1ZJDA 4NG9H 3PWBA 1L1NA 2A2XH 1HJ8A 1H8IH 4DT7B 2R3YA 3UOPA 3SOSA 3HK6B 1QJ6B 1ZJKA 1RGQA 2PKSC 1E36B 4A1VA 5HM9A 3MI4A 3SV8A 1THPB 2UUJB 1O35A 2OC8A 2VIPA 3SHCH 1CHOF 3H5CB 4DIIH 1TA2A 2EI7A 3RXGA 5C1XA 1NS3A 4MNXA 4B6FA 1P0SH 3A7WA 2QXJA 2V35A 4IS5A 4GCHG 4KGAA 1KDQB 1F5KU 2I6QA 3O8RA 1C2GA 2FS9A 4R0IA 4SGAE 3URCA 2GKVE 1MBMA 2ANWA 4NIYA 3EA9A 3P70B 4FUGA 1TGCA 4GCHF 1O2ZA 5F8ZA 2BD4A 3A7YA 1EAXA 1GBKA 1P09A 2OQUA 5F8XA 1PYTD 3PYHA 1O3OA 2OQ5A 4WJG2 1GHBG 2ZGHA 2JH0D 1VJ9U 1P2NA 1AY6H 1AFQC 1GHBF 1O2HA 1TMUH 1TX7A 2BDYA 2JETC 2QC2A 3TNSA 1SHHB 2ZDVH 5E2PA 3ATWA 2ZHDA 2FI4E 3TK6A 1IQKA 2BDIA 2WINI 3GISB 1RIWB 3GYMA 2FTMA 1BMLA 1GI8B 3BTFE 5DK1A 2ZG0H 3RXAA 1DUAA 3P6ZB 1HAIH 2GX4A 2KAIB 2TRMA 3MFJA 1GBTA 1MBQA 2BOKA 1K1NA 4MQAA 1V2TT 3V7TA 3URDA 2BYAX 2FOHA 4AG1A 4B2BA 2F9UA 1HAPH 4IGDA 4CBOA 2SNVA 5C20A 1V2PT 2FYRA 1BBRK 1DANH 2FOCA 2PTCE 1KIGH 2BDCA 5DP5A 2BD3A 1NZQH 1IQIA 5C5NA 2HVXA 4MNYA 3B9FH 3MH4A 1BIOA 2ODPA 1SFQB 1RRKA 4AYYB 1VCQA 1O2YA 2J4IA 1AFEH 1AE5A 4ZKOU 1FN6A 3H09A 1C2IA 1MKWK 5E0HA 3RXLA 2SGEE 4ABGA 3TNTA 3E90B 1QA0A 1MAXA 4Y11E 4DURA 2GV6A 4ZKRU 2FOEA 1O5AB 3BTWE 4ISLA 2DE9A 1V2KT 1RJXB 3ZYEA 3UTUH 1EAIA 2P8OB 1GJ4H 1GI5A 3DHKH 3AASA 1P01A 1K21H 5G4BA 4XOJA 2B9LA 1YLDA 1A4WH 1YCPH 4ABIA 1V2MT 1O2SA 3SW2B 2GCTC 4GPGA 1EPTB 1L4ZA 2PSYA 3GCTG 1YPMH 4DIHH 3NUMA 4GSOA 5GWZA 4NIVA 5AHGH 2FWWA 5FBEA 3KQDA 3W95A 4WMDA 3GCTF 1FY8E 1DLKB 3RXRA 1SGPE 3GOVB 1SGFG 4XFQA 1DITH 3HKIB 2QF3A 2CF8H 1H9HE 1SLXB 2R0KA 1O5GH 3F9EA 1V2LT 1WU1A 4WY3A 1O2QA 2FTLE 2FMJA 2Z6BD 1ZMJA 3A84A 3UY9A 4B6EA 3BTTE 1PPHE 3S9CA 3EAJA 2R0LA 3SU0A 4GUXA 7ESTE 1C5WB 4MNWA 1SL3A 2NU3E 1XUHA 1YCPM 1IQHA 1QBOA 4YM9A 2A4RA 1K1IA 1UVUH 4KTUA 1P3CA 4QT8C 1CA0C 1MD7A 1GBCA 2A5IA 1ZYOA 1EATA 3UQOA 2BX3A 1GMHF 5JBCS 3M5NA 3PTBA 1RXPA 1INCA 2W5EA 3UREA 1ELEE 1CGHA 3ATKA 1SGCA 1E37B 1ZOMA 1TRYA 3B23B 4LK4A 1W11U 1G3BA 2A32A 3TH4H 2PUXB 3MH7A 1D3DB 1T7CA 4GHQA 1P2JA 1GG6B 2ZDMA 2GT7A 1OP2A 2BLWA 1ZPCA 1ID5H 1A5GH 2H5DA 2CMYA 2FOFA 4I8GA 3ZVFA 3LGTA 3QWCH 2OLGA 2FEQH 1A2CH 1HGTH 3SI4H 3BEUA 4ZKNU 2QY0B 5DG6A 1GHYH 4ISOA 1ZGIA 1MTNC 1D6WA 1H9LB 4SGBE 3GY4A 3RXQA 3NCLA 1N6YA 3SNDA 1BRCE 2VB0A 1NTPA 2B5TB 2XYAA 5FBIA 5DP3A 3BV9B 3Q3YA 1FY1A 2GD4B 1ZHMA 4KTSA 1G30B 1HFDA 1OWEA 2EI6A 3PMHB 1HJAC 5CHAC 4YOGA 2WPLS 5E0GA 1BBRE 1ESAA 2G52A 3GICB 3JZ1B 1DY9A 4WF8A 1AN1E 2V0BA 3A7ZA 1MKXK 4FU8A 4X6MA 3M7TA 1O3HA 2Q6DA 1TBRH 2J2UA 1XVOA 1HAYB 1AB9C 2CJIA 2Q1JA 1O5BB 3UNQA 2H1UA 4ABEA 4O9VA 1YBWA 1YPJH 5HM2A 2QAAA 4ESTE 1LVYA 3PV2A 4ZUHA 2XCNA 3SUGA 1PQ7A 2QF0A 3A89A 3B8JA 4X1SU 3KL6A 2XC4A 6LPRA 1WCZA 5TCCA 3U69H 3I78A 1JRSA 3QTOH 1O2TA 2BDHA 1CT2E 1TBQH 1UK2A 1PQ5A 1QTFA 1T8NA 4WH6A 1J17T 3M7UA 1B0FA 1Y3VA 3RXKA 1GBHA 2NU1E 1UTKA 1F92A 3OU0A 1DWEH 3QO6A 4K1EA 4U01A 4CR5A 1MZAA 1GHAF 1KLIH 3A8AA 3LJOA 5BPEA 4U2WA 1H8DH 2PKSB 4CRCA 1OWJA 1ANDA 2G5NA 5AFYH 1FMGA 1EJNA 2C8XB 3RXUA 2SGPE 1P57B 1AKSA 2H2ZA 3ATIA 4K8YA 4U30A 1FIWA 6CHAC 1GVLA 3M3VA 4GHTA 5A0BA 2M5TA 4HFPB 5HXFA 1Y5AT 5JYIA 3A88A 3LONA 1O5EH 3ZVGA 3BEFB 4O3TA 1TNLA 3PWCA 4MTBA 4H42U 2FLRH 2GP9B 1TPPA 3Q3XA 3EE0B 3PLKA 3IWMA 1BOQA 4UEHH 2R9PA 2XWBI 3P8NA 1KTTB 4CRAA 4A6LA 2D8WA 2TGPZ 1QGFA 1W13U 1GMDG 3AW0A 2FM2A 1BTZA 2JETB 4AFQA 1GMDF 1KXAA 5DP8A 5JDUB 1SC8U 2J94A 1IQFA 2CHAC 3AAUA 3GY5A 1FAKH 2ZDNA 3SHAH 2EC9H 1OXGA 4AGKA 2BD5A 1IQNA 1LVBA 1QBVH 2FX6A 1PQ8A 3KCGH 1AWFH 3D23A 2G51A 3SJ8A 1S0QA 3ATLA 4K5ZA 3RP2A 5FPTA 2ODQA 2VVUA 3WY8A 1ZSJA 1ABJH 1TWXB 1SHYA 1O3JA 5DKMA 1B5GH 1GI4A 3RLWH 3U98H 4FUCA 1O39A 2J95A 5B6OA 1XUKA 2XBYA 3A86A 1GI7B 1Y5UT 3DFLA 1KLTA 1ZR0A 1GCTB 4XSKU 2VH6A 1BTXA 2O8WA 4AZ2B 3M61U 1KXEA 1UTLM 4CRFA 2ASUB 1C2HA 4IMZA 3UOUA 1ELDE 3SZNA 1V2OT 2BVRH 1EP6A 2VJ1A 1F5RA 1C5OH 1S81A 2ANKH 3PMAB 1LPKB 1SPJA 5CMXH 4D8NA 5JBTA 1O2RA 1GVZA 3EA7A 2WYGA 1TOMH 2A5KA 4OS5A 1ZPBA 3BF6H 3SJKA 6GCHG 2ZGJA 1C5YB 3KN2A 1FLEE 1C4Y2 1TNKA 3TGIE 2XRCA 1P2MA 4AX9H 2CN0H 5FCKA 1KDQA 3SZEA 6GCHF 3E6PH 3VFEA 3D49H 2UUYA 1T8LA 1ZZZA 1BMNH 1DVAH 1EAWA 3T25A 1GVKB 1PPCE 1UTMA 1HAZB 2P3TB 3VB5A 2QYIA 5T6GA 4X6PA 3L33A 2OBOA 2THFB 4BAKB 2GCTB 1MUEB 3GCHC 1AU8A 1EASA 2TGDA 3Q3KA 1ETSH 1AUJA 1HXEH 1MTSA 2FOMB 2ZFRH 2A7JA 1L1JA 3P8OA 3A80A 4OGXA 8GCHF 1C2LA 4Y8XA 4B74A 4D9RA 4CRBA 5IYTA 4RKJB 1FQ3A 1KXCA 1EJMA 3P8GA 2KAIA 1P02A 4Z0KA 1QR3E 2ZPSA 1F2SE 2O8TA 2Z3DA 1HAGE 5F6MA 2SFAA 2YOLA 4TY7A 3R0FA 2ILNA 1NFUA 5HMAA 1BTHH 3SU3A 1CA0B 2C8WB 4OM9A 4DG4A 1K1LA 1N6XA 5IDKA 1Z1IA 5JBBS 2J9NA 4TWYA 3L3TA 4WWYA 4WMFA 4BAOB 4X2YA 2FOAA 4ISIH 5T6DA 1HAXB 1GL1A 2ZZUH 1L0ZA 3QUMP 3FFGA 1ELAA 2QV1A 1LVMA 2ZHEH 2XBWA 3SGAE 2PGQB 4H6SB 4ISHH 2ZFFH 1FV9A 3IITA 3U8TH 2OXSA 3OX7U 2D26C 3GY2A 3NZIA 2ZQ1A 1Z71A 1SMFE 1OP8A 4CH2B 4ASHA 5K0HA 1V2WT 1XUJA 1GJAB 4TPIZ 3M7QA 1K22H 3S7HB 2AIPA 2WUCA 2QIQA 3BTME 3A83A 3SQHE 1PQAA 5ABWA 5A0CA 1L4DA 2AYWA 1MQ6A 4UONA 3MU8A 3T26A 5CHAB 1SLUB 1BDAA 1HJAB 1TGBA 2Y7ZA 1EPTA 3QK1A 1O5FH 1ZRBA 1SLWB 3GY6A 4TYDA 3IG6B 4FUEA 1RFNA 1H1BA 1PPZA 2HPQH 4OS1A 3W94A 3EDXB 1AB9B 3M37A 3L6PA 2ZPQA 3MTYA 2BB4A 4TWWA 3RXIA 3SQEE 1QJ7B 1ANCA 1OYQA 1JWTA 3RU4E 2VVVA 2IJD1 1DSTA 1DY8A 2FP7B 4MPUA 3PROA 1Y8TA 3T2NA 4JZ1A 1J16A 1G9IE 2A2QH 3MU0A 5E8EH 3RXBA 1SQTA 2HNTF 3MU1A 3BEIB 4NGAH 4JZFH 4UD9H 4IC5A 1NFXA 2HNTC 3LGUA 1BBRH 1ZLRA 5FHTA 1DFPA 2F9PA 4FXGH 2PSXA 3BTEE 1QA7A 1SI5H 1C2FA 3RM0H 3F9FA 1T32A 2CGAA 1LKBA 3BN9A 3SV6A 1OSSA 3BG4C 1DSUA 3U1IB 3U8OH 1WUNH 3F1SB 1BJUA 2AMPA 2ZHFH 3SV7A 1FY5A 3KEEA 5EODA 4INKA 1O3BA 1MKWH 1C1OA 2ZU2A 9LPRA 1SLVB 2P3FH 1AGJA 3TIUA 1V3XA 1THSH 6CHAB 2AS9A 1C2EA 1XKAC 4FU7A 1P2KA 5A09A 5E2OA 4M7GA 3FZDA 1SB1H 1AO5A 4AFZA 2HALA 3LH1A 2BHGA 1CHGA 3BTGE 2Q6FA 1WQVH 1YC0A 1OKXA 2H5CA 2QN5T 3HKJB 3Q76A 3T27A 1A1RA 1FN8A 1TQ7B 4KELA 3ZV9A 2LPRA 3AAVA 5J4SA 1NROH 4MNVA 1YGCH 2QA9E 3RMMH 1GHWH 1O3GA 3DA9B 1HAVA 2BVXH 3UPEA 2CHAB 5EOKA 1ZTJA 4K1TA 2HOBA 1SGNE 1TNGA 5JPMH 2D2DA 5DO4H 5LH8A 3UIRA 4UE7H 1TPOA 1XXFA 1O33A 1G2MA 1TYNA 2Z3EA 1W0ZU 1ARCA 3QGNB 1SFIA 4WXIA 4ABDA 1A3EH 4X6OA 3RMOH 4RKOB 1AWHB 3TITA 1LVOA 3NXPA 3SU2A 1BJVA 2XNIA 4BAHB 3UNSA 4E06H 1UTNA 1SGQE 1S85A 5F8TA 3STIA 3UNRA 1GI3A 2VGCC 5EXMA 3VEQB 3EQ0H 1K2I1 1C2KA 1DLEA 2Z7FE 4ZXXH 1OWIA 1P2QA 3FP8E 2IN2A 3H7TA 3SNEA 4FUIA 4NA7A 4Y8YA 1ACBE 1F0SA 3ZV8A 1HBTH 2BLVA 2A4QA 2QGRA 3K9XB 4NSYA 3VB7A 2Z9GA 3DFJA 1UTPA 2SGFE 3F9GA 1EX3A 1Z8JB 4Y6DA 3RLYH 2DE8A 3K2UA 1P11E 3ZZ9A 1CT0E 1IHTH 2FODA 3BG8A 4JZDH 1TRMA 1MCVA 3M5LA 2XWAA 3BTQE 9ESTA 2NU0E 2FPZA 3PO1B 4GVUA 1GJ5H 4JYUH 4VGCB 1H9IE 3U8RH 1MKXH 1G32B 2WPMS 1C5NH 1YPGH 1IOEA 1MU8B 1GI2A 5FAHA 1W0YH 1NC6A 4MVNA 1HAHH 1HIAB 4A1TA 2HWLB 2ZKSA 4I7YH 3RXEA 3FVFB 3PV5A 3RXCA 4R8TB 4Y7AA 1TPAE 1V2RT 5FPSA 4FUHA 5GCHG 1AHTH 1O2LA 1FY3A 1SOZA 2GDDA 2BX4A 3TJOA 3H7OA 4MLFB 5J4QA 2BY7X 5GCHF 3VGCB 3T29A 4AYVB 3HATH 1WBGB 2TGAA 1O31A 1P12E 5AF9H 1GBJA 4I31A 3ZZCA 1FAXA 3S7KB 1D9IA 5I25A 3M3TA 1A0LA 1W12U 3E91A 4B2AA 1S5SA 4X2VA 1V2NT 1OWHA 2BD2A 2ZC9H 1C1UH 3MNCA 4ZHMU 1D3TB 5FCRA 2K1QA 1QFKH 1UHBB 3OTJE 3UWJH 3SORA 2OBQA 5T3HA 1AZZA 1J9CH 2H9HA 1KSNA 4K60A 1HCGA 1O2GH 3SI3H 1P10A 1GHXH 1CBWC 4YZUA 1THRH 1GBLA 1QL9A 4X1QU 4NIWA 1CSOE 4B2CA 3RXOA 3A87A 4Q7ZA 1O3CA 5FX5A 3RC5A 3LDXH 1Z8GA 3A7VA 3O8DA 4A1XA 1GBBA 3KNXA 3NKKA 4A92A 1PPGE 1O37A 1DWCH 1UO6A 2CV3A 2D1JA 2SNWA 4D9QA 4AG2A 3AW1A 2BXUH 1C5MD 1M9UA 1T4UH 3VXFH 4JZEH 1ZMLA 1K1OA 2RCEA 3ZVCA 1FJSA 1SGIB 2PHBA 2FXRA 1NM6A 3RC4A 1DX5M 1Z6EA 1C5TA 4IW4E 1DXPA 3D65E 1QRXA 2F3CE 5FX6A 4KTCA 3QX5H 1GI9B 3UUZA 2BOHB 2G00A 4I8LA 4ZKSU 4BAQB 3CS7A 5SGAE 4ZHAA 2PKAB 3M36A 2F9OA 1MTWA 4HTCH 1C1PA 2BD8A 4WVPE 1BMMH 4IC6A 3GY8A 1QCPA 1W3CA 1X7AC 3RXPA 4K69A 2ESTE 5C1YA 2F91A 2ANYA 4JYTA 2FESH 1ZSLA 4ZH8A 1TA6A 2F9BH 1VITG 5EQQA 2BQ6B 3TH3H 3MNSA 2ZEBA 2AGEX 3QN7A 1LHGH 1T8MA 4AB8A 1VITF 3VB6A 1BHXF 2ZPRA 1GWAA 1O2WA 1O2OA 2Z9JA 3VB4A 2Z9IA 1E34B 1KXBA 1TE0A 5DGJA 4E7RG 1P3EA 2OUAA 1DXWA 1MAYA 3RMLH 3UR6A 1UVOA 2XTTB 3ZVBA 1WSSH 2BVSH 1SBWA 1HAOH 2BDGA 4INHA 4NFFA 3VB3A 1O3DA 4NA9H 3BG4B 2AEIH 1VCPA 4LOYH 2BY9X 1P8VC 2VH0A 5EQSA 2V3OH 3S69A 3A85A 2J38A 1TX6A 4ISNA 2J34A 1G3EA 1LCYA 1TABE 2XC5A 1C5PA 2VWLA 1GCDA
chains in the Genus database with same CATH superfamily
1NY22 3U9AH 1AFQB 1JOUB 1RIWC 1P9UA 2ZCHP 2V6NA 1E38B 2WPJS 1A0HB 2M2AA 2CXVA 5DP4A 5DP6A 1A3BH 2P3UB 4BAMB 2IPQX 4DJZB 5HKKD 3CS0A 1NFYA 1EQ9A 3QTVH 2ZECA 4UFFH 2IJOB 1SGDE 2BY6X 1GBIA 4ZAEA 2P94A 1GJ6A 1LHEH 1XX9A 5TJXA 1V2UT 1RTFB 1GMCG 3RUOA 4IBLH 3SV9A 2W7SA 5FPYA 1S6FA 3V13A 1BITA 1VR1H 2EI8A 5TCAA 2WUBA 1C1SA 2BM2A 2R3UA 3BTKE 1S82A 1BMAA 5C5OA 1GBDA 1UMAH 1WQSA 2NWNA 4AB9A 1BRAA 2SGAA 2BLQA 2C93B 2PV9B 1ZTLA 1C2DA 4F48B 2Y81A 5GNDA 1AI8H 2HNTE 2BQ7B 1LHFH 1S83A 2ZDLA 1V2JT 3I77A 1NFWA 2ZO3H 2JKHA 4A7IB 4YT7H 4MDSA 4OS2A 1G2LA 1N8OC 2ZU3A 1C9TA 3PMJA 3AVZA 1D3QB 1UTJA 5EJ1A 3LOXA 1QB1A 4H4FA 1QB9A 4CREA 1QL8A 1C2MA 3LH3A 4YOIA 1NU7B 2VIDA 3OEHD 1JIRA 2P8OC 1LPGB 3SBKA 2BY8X 1N1LA 4BANB 2ZHWH 3UQVA 2Y7XA 2VGCB 2Y5HA 3BTHE 2ZCLP 1O2NA 3TJNA 1W7XH 4RN6A 5T6FA 1O30A 3VPKA 3DD2H 1DOJA 3LC3A 2QXHA 1NRQH 4J1YA 5KEDA 2ZU1A 2ZFPH 2ZTZA 1BT7A 3FO8D 3MNBA 1TPSA 1EZQA 1TNJA 3GYLB 3KYFA 1TALA 3UWIA 1Z8IB 2H6MA 1ELFA 1VCWA 1O2VA 1GGDC 3PTNA 1UTQA 4JZIA 4ABJA 3ODDA 1P2IA 2J98B 3K6YA 3RXDA 5FL7D 1ZGVA 1FNIA 4LZ4B 3FKSD 1Y3UA 1HB0B 1PPEE 4Y0ZE 8KME2 3MH6A 1P2OA 1O3LA 2UUFB 1AVXA 1NT1A 1Z1JA 2B7DH 4Q2KA 5CDFE 1VJAU 5B6LA 1JXPA 4CR9A 5A8YA 1ARBA 2A45B 1NPMA 1G3DA 2UWPA 2G4TA 1SGEE 1Y3WA 1O2MA 2Y5GA 2XXLA 1CE5A 3BIUH 1FI8A 3BSQA 1ELCA 1GBEA 1TMBH 4DVAU 7KMEH 1UCYE 1XM1A 3ENSB 5AVDA 4B75A 3ZVAA 3RXMA 1AZ8A 2AIQA 1EXFA 1UTOA 1GI1A 1WTGH 1YWUA 2NU4E 2Z9LA 1UVTH 2ZU4A 3EYDA 3PMBB 1SG8B 1EAUA 1C5XB 1NU9A 1JBUH 4Y79A 3FANA 3GCOA 2RDLA 2VINA 1KMHB 2TBSA 1IQJA 4I33A 1TNHA 1U6QA 3DT0H 3ZZBA 5K7RA 3LGVA 4DGJA 2OINA 1CO7E 3QZRA 2H9EH 2LNCA 1BTUA 2BD7A 3SV2H 1WV7H 3EA8A 2ZU5A 4BTUB 5CE1A 3MMGA 1GDQA 1B7XB 1WTHD 3DSGA 1EKBB 1FONA 1KY9A 1SGYE 2EEKA 1EB2A 5EG4A 4CHAC 3SNAA 3AK5A 3ESTA 3BIVH 4X0WU 4X8SH 3MWIU 1QRWA 2W26A 1S0RA 2ODYB 5GDSH 4CBNA 1MTNB 3ZZ7A 4NFEA 1QURH 2V3MA 3PV4A 2FYQA 2Z94A 3RM2H 3SU5A 2Y80A 3LGWA 1CBWB 1UVSH 4Y0YE 2HPPH 4BTTB 4WXVA 1C1VH 2BMGB 3RU4D 3RXVA 2A4OA 2PGBB 3LU9B 2B8OH 4YESB 4AFSA 4FU9A 5PTPA 4DY7B 1O3KA 1W14U 3TU7H 1SOTA 3SUDA 4B73A 1O2UA 1SQAA 4OS6A 3SJOA 5JBAS 1BUIA 4ZMAH 2WPKS 1O2XA 1DT2A 5C1UA 1Z6JH 1XUGA 1L2EA 1MTUA 4WMEA 2FO9A 1MQ5A 1MH0A 1IAUA 4ZXYH 3A8DA 4HI3A 1HLTH 1JMOH 3SN8A 2G8TA 4Q80A 4FUFA 2O9QA 2TIOA 2ZF0H 3RXFA 2VU8E 2FI5E 1CU1A 2RFKC 2ZTYA 3V12A 2QXIA 2HLCA 4Q4LA 1KYNA 2ZTXA 2G55A 4BXWA 1W10U 4FVDA 3E1XB 1HIAA 2PLXA 1HNEE 3EGKH 2XC0A 1C1NA 5E0JA 4Z1MD 1C1TA 2QF4A 3TGKE 1Q3XA 5DPAA 1DS2E 1CHOG 1ZTKA 3JZ2B 4XD7D 2A7HA 4XBBA 1PPFE 1SR5C 1SGTA 3U1JB 1WYKA 4JK6A 3RDZA 2P59A 2B0FA 3E3TA 4Y8ZA 3QLPH 2RA3A 1TX8A 2WPIS 4XE4A 1CGIE 5ETXA 3KF2A 3MYWA 1P03A 2OCVB 1AVGH 1W7GH 4K8BA 1J15A 1LQEA 2ANMH 4UFEH 1LO6A 4X8TH 4JCNA 1BHXB 3R3GB 1HRTH 1O2KA 5AFZH 3QGJA 1DM4B 3PB1E 3A81A 1GPZA 3F68H 5JB8S 1UHBA 1O32A 1RS0A 1K1JA 1HV7A 3GDSA 4Y71A 1O3PB 4ABFA 3A8BA 4MPVA 2VWOA 1YPHC 2HLDD 3LT3A 2YMSB 4UFGH 3RXSA 3ZZDA 4A5TS 1UVPA 5EQRA 1YF4A 3PLPA 4NCYA 3SJIA 1VKYA 1G3CA 1EOLA 3Q77A 1O3EA 2PTNA 2A1DB 1TMTH 3SUFA 4IMQA 3ZZ3A 1GI6A 5H4IB 2L74A 4D7FA 3S0NA 1T4VH 3LC5A 4X8UH 4B1TA 1ZMNA 4I8HA 4Q7YA 1ELBA 3G01A 3F2GA 1O3MA 4NZQA 1TGNA 2IPHA 2RDEA 2XBXA 3E0NB 1F0TA 1WXRA 1DDJA 1AD8H 3ZZ6A 4X1RU 1BA8B 1PJPA 2V3HH 1YKTA 1YY3A 1S84A 5A8ZA 4I8KA 1C5SA 1TGSZ 5DP7A 1Z7KA 4HGCA 3M3SA 1TOCB 3MU5A 1OP0A 2DUCA 1GJ7B 1EZSC 1GCTC 2R2MB 3A8CA 1K1MA 1QQ4A 3GCNA 3LIWA 3LPRA 1CA8B 1MCTA 1LPZB 3K6ZA 1O3AA 1L1GA 1SQOA 2CF9H 2PKAA 3SGBE 5C67A 1ABIH 1GDNA 2YMSD 4YLUA 1ZHRA 2GV7A 1GJBB 1LHDH 3HK3B 2BZAA 1H4WA 1F0RA 4X2WA 1GDUA 1AE8H 1NN6A 2ALPA 3OY5U 1ANBA 4IN2A 1RTKA 5LGOA 2P95A 1O34A 1SSXA 2GZ9A 1BZXE 3VXEH 4Y7BA 2W3IA 1N8OB 2C90B 3QZQA 2WV4A 3A7XA 5EPYA 2IOTA 2Q6GA 3DUXH 2WHXA 2ZDAH 2Y5FA 3RC6A 1CVWH 3S9BA 4MG3A 1UK3A 3SGQE 2WPHS 3KQ5A 2RG3A 1ESBA 2GCHG 1A0JA 2AMDA 1AQ7A 2G5VA 3A7TA 1XUIA 1QHRB 4NWKA 5I46H 2H9TH 2C3SA 1B0EA 5L30H 2EY4C 1W8BH 1C4U2 2GCHF 1QB6A 1O3IA 1ZHPA 2GZ7A 4H6TA 4M9FA 4O3UA 3SU6A 3FAOA 8LPRA 4FUJA 2GDEH 3KIDU 5L2YH 3CNRA 5EJZA 1C4V2 3ZVDA 1FDPA 2OC7A 3NWUA 1V2ST 4FUBA 4X1PU 1BRBE 4O03A 1XUFA 1YM0A 3F6UH 4NSVA 2PWXA 5JB9S 1RTLA 6ESTA 4OS4A 3OSYA 4X8VH 3GCHB 3UFAA 4X1NU 1PPBH 1TBZH 1GGDB 1QBNA 1CT4E 4K3JA 1G37A 1TONA 1WOFA 3P92A 2GT8A 4X2XA 3SNCA 1K1PA 2VWMA 1QRZA 3GDUA 3ITIA 2W7UA 3C27B 1D3PB 1SVPA 2BDAA 1YPLH 1V2QT 1GJ8B 4XBCA 3UR9A 2RA0A 2BTCE 3KQBA 2AMQA 4RT1A 2SGQE 5EXLA 1E1RD 3P17H 4YT6H 1LHCH 5FXLA 1A46H 1OOKB 2WV5A 2G4UA 2J92A 3GDVA 1NRSH 1GMHG 4OGYA 2STAE 4J2YB 3ZZAA 4RSPA 4FUDA 2A5AA 5GJ4B 1DWDH 2ZIQH 1BB0B 4INLA 1EUFA 2BXTH 3T62A 2Y82A 4DW2U 1VGCC 2FIRH 4BNRA 2ZI2H 4XBDA 1A61H 2SGDE 3SYJA 3T5FH 2FOGA 1O3FA 2ZQ2A 4PROA 1ETTH 1FPHH 1C2JA 1DICA 2BY5X 1GHZA 1K0HA 5C2ZA 4ABBA 2XCFA 2UWLA 2PFEA 1YP9A 3GY3A 1YCPK 4LZ1H 2A4GA 4D7GA 1TRNA 3RXHA 2AGGX 2ZFQH 3F9HA 2AHME 1TFXA 2NU2E 2O8LA 2KFWA 3PLBA 3MO3A 3SU4A 1FIZA 1MD8A 2FOBA 2A31A 4CHAB 1P06A 1IQMA 1UCYH 3HGPA 3KHVA 1AIXH 2ULLA 1O3NA 1GJ9B 1ZPZA 3I29A 2ZP0H 1EZUC 1KXDA 1IQLA 1S6HA 3T28A 3NK8A 2LELA 5LPRA 1C1RA 1SGRE 5A8XA 1O2JA 1TQ0B 3TPIZ 1OYTH 1TAWA 7LPRA 4JK5A 1NRNH 5DP9A 1C1MA 1PYTC 3P95A 3CENA 1LQDB 1HAVB 3E8LA 1O2IA 1RD3B 2WV9A 4E05H 2GMTC 2OTVA 1TB6H 1E0FD 1YLCA 1NO9H 2J98A 3ZZ8A 2XNDD 3MO6A 2GTBA 1UW7A 2PUQH 1QQUA 1EJAA 1HDTH 4ACBA 1E35B 4Q7XA 1ELVA 2FDAA 2FS8A 1T8OA 2TGTA 1C5VA 2OC1A 3C1KA 3UAIC 3LJJA 1SGFA 3FP6E 1DPOA 3TGJE 1A7SA 2OC0A 4ABHA 2FZZA 3TH2H 4CRGA 3N7OA 2WYJA 1Y5BT 1CGJE 1TIOA 1YPEH 1GHAG 3K65B 1P05A 2W6ID 1DWBH 4RT0A 4MPXA 1VZQH 3HPTB 5GPIB 2JH5D 5HYOA 1J8AA 1UCYK 3O8BA 3TVJB 4CH8B 3HGNA 4LXBH 2AFQB 2AGIX 2GGVB 4Y10E 1KTSB 2I6SA 4AGJA 2QCYA 1NRRH 2P93A 2XW9A 3F2HA 2F9NA 3NPSA 1A5IA 2BZ6H 1OWDA 5HGGA 2JH6D 1C5ZB 2J5UA 4O97A 2F4LA 4XDEA 3SUEA 2CK3D 3TLOA 3MO9A 4B71A 2VIQA 1HXFH 4NIXA 2FI3E 1Y59T 3OE7D 3ZZ4A 4K2YA 1O2PA 1GJCB 1CQQA 3NRLA 1ORFA 1HPGA 1YPKH 1H8ED 1GBAA 4JMYA 3S9AA 1BTWA 2AH4X 3MHWU 1SQRA 7GCHG 1IQEA 3MOCA 5ESBA 3ZZ5A 1UJ1A 2STBE 1C9PA 2ALVA 1DE7H 7GCHF 1BRUP 2G81E 5L2ZH 2ZFSA 3ZVEA 1AUTC 5DJ7A 1C5UA 3E16B 2YNAA 4TT3D 3SO3A 1GBMA 2OP9A 2WZQA 1F7ZA 1JIMA 4HZHA 1QNJA 1Q2WA 1Z8RA 3N7EA 3CP7A 1D4PB 5GIBA 1GMCF 5LPFA 3F2FA 4ABAA 1MU6B 4AOQA 1BQYA 3A82A 4FVBA 4JYVH 1QIXB 5EW2H 3MU4A 1C5QA 3RU4T 3MH5A 3M5OA 2ZGBH 3LGIA 2C8YB 2F83A 1Y3XA 2C8ZB 1P04A 1QL7A 2VIOA 3KGPA 1TGTA 1LMWB 5ESTE 2ZGXH 3W1EA 1EZXC 2R2WU 4GAWA 1BTYA 3TK5A 2BQWB 4WH8A 2C4FH 4YLQH 2WSSD 3TK9A 1O5DH 3M35A 4NA8A 3N7DA 5EW1H 3RXJA 2BD9A 8ESTE 3LGYA 5A2MH 1OWKA 1V2VT 1TNIA 3FZZA 2O8UA 1ZSKA 4UFDH 2OK5A 2BDBA 2P16A 1C5RA 2VBCA 1EB1H 4E7NA 4YO9A 1EPTC 1FZZA 3OY6U 3OTPA 3BTDE 2Y6TA 1MZDA 3KQCA 4AC9A 2A0QB 2W3KA 3Q00A 1C1QA 3LKWA 1ELTA 1QJ1B 4TSFD 3O8CA 4ZHLU 4CRDA 3PM3A 3GY7A 4KKDA 4TPYA 1YPHE 1ETRH 1T31A 5GXPA 5F53A 1C1WH 5L6NH 3PO1C 2Z9KA 2FLBH 1NRPH 1O36A 1O0DH 4I8JA 4DOQA 4VGCC 1Y3YA 3TJUA 1OPHB 1ZRKA 1FUJA 1GI0A 2GZ8A 1PFXC 2ZA5A 4THNH 1HUTH 4KP0A 5EPNA 4DCDA 2UWOA 2A7CA 1HJ9A 1TLDA 4BTIB 5EGMA 1VITH 2HRVA 4D76A 8GCHG 1FPCH 2ZDKA 3F3BA 3TJVA 4BXSA 3ZYDA 1OS8A 3ZIAD 1MTVA 2QXGA 3D62A 4Z6AH 2VIWA 2OD3B 1LTOA 1WAYB 2VIVA 4F49A 4Y76A 3P8FA 1F5LA 3VGCC 1GG6C 1DUEA 2VWNA 5A0AE 3MNXA 3V3MA 1K9OE 5T1VA 1AKSB 3V0XA 1JRTA 2ZGCA 1GJDB 2AERH 1FXYA 5LPEA 1NESE 1P9SA 1FY4A 3SJ9A 3RMNH 2W6JD 3ODFA 2O8MA 2XBVA 1HYLA 1O5CB 4I32A 3M5MA 1XMNB 2ZWLH 4RI0A 3SU1A 4K1SA 1A5HA 1XXDA 1ESTA 1VGCB 2VNTA 4F4OC 1LKAA 1QY6A 2TPIZ 1K28D 2PW8H 1AVWA 5DSFA 4OS7A 1XVMA 1ANEA 1MMJN 2JJ2D 4YTAA 1EOJA 2PR3A 4IN1A 1Q31A 4AN7A 1KLJH 4B76A 1XKBC 2GVFA 1C5LH 1AMHA 4NWLA 1GL0E 1GBFA 3FP7E 4TY6A 2F9VA 5C17A 2ZNKH 2ZHQH 1J14A 1F0UA 5C3NA 4U32A 1EP5A 2ZFTA 4AORA 5EXNA 2V7QD 5F03A 5BRRE 4AFUA 4Q63A 1BCUH 1ELGA 3E0PB 2BLOA 2EA3A 3QDZB 4YOJA 1GHVH 2FX4A 2UUKB 1KXFA 1D6RA 2Z3CA 3STJA 4GLYA 1YYY1 3SNBA 2HGTH 1OX1A 1BTPA 3KQEA 1LDTT 2K8IA 1W2KH 5EU8A 4BOHA 1V6DA 1UK4A 2VVCA 2YNBA 3ATMA 1IQGA 3ELAH 4UDWH 1IHSH 2ZCKP 4X6NA 4ZROA 1G36A 3OYPA 3RXTA 1O38A 2GMTB 4NZLA 1ZJDA 4NG9H 3PWBA 1L1NA 2A2XH 1HJ8A 1H8IH 4DT7B 2R3YA 3UOPA 3SOSA 3HK6B 1QJ6B 1ZJKA 1RGQA 2PKSC 1E36B 4A1VA 5HM9A 3MI4A 3PRBA 3SV8A 1THPB 2UUJB 1O35A 2OC8A 2VIPA 3SHCH 1CHOF 3H5CB 4DIIH 1WDIA 1TA2A 2EI7A 3RXGA 5C1XA 1NS3A 4MNXA 4B6FA 1P0SH 3A7WA 2QXJA 4YXWD 2V35A 4IS5A 4GCHG 4KGAA 1KDQB 1F5KU 2KR7A 2I6QA 3O8RA 1C2GA 2FS9A 4R0IA 4SGAE 3URCA 2GKVE 5EJLA 1MBMA 2ANWA 4NIYA 3EA9A 3P70B 4FUGA 1TGCA 4GCHF 1O2ZA 5F8ZA 2BD4A 3A7YA 1EAXA 1GBKA 1P09A 2OQUA 5F8XA 1PYTD 3PYHA 1O3OA 2OQ5A 4WJG2 1GHBG 2ZGHA 2JH0D 1VJ9U 1P2NA 1AY6H 1AFQC 1GHBF 1O2HA 1TMUH 1TX7A 2BDYA 2JETC 2QC2A 3TNSA 1EFRD 1SHHB 2JJ1D 2ZDVH 5E2PA 3ATWA 2ZHDA 2FI4E 3TK6A 1IQKA 2BDIA 2WINI 3GISB 1RIWB 3GYMA 2FTMA 1BMLA 1GI8B 3BTFE 5DK1A 2ZG0H 3RXAA 1DUAA 3P6ZB 1HAIH 2GX4A 2KAIB 2TRMA 3MFJA 1GBTA 1MBQA 2BOKA 1K1NA 4MQAA 1V2TT 3V7TA 3URDA 2BYAX 2FOHA 4AG1A 4B2BA 2F9UA 1HAPH 4IGDA 4CBOA 2SNVA 5C20A 1V2PT 2FYRA 1BBRK 1DANH 2FOCA 2PTCE 1KIGH 2BDCA 5DP5A 2BD3A 1COWD 1NZQH 1IQIA 5C5NA 2HVXA 4MNYA 3B9FH 3MH4A 1BIOA 2ODPA 1SFQB 1RRKA 4AYYB 2J97A 1VCQA 1O2YA 2J4IA 1AFEH 1AE5A 4ZKOU 1FN6A 3H09A 1C2IA 4FETA 1MKWK 5E0HA 3RXLA 2SGEE 4ABGA 3TNTA 3E90B 1QA0A 1MAXA 4Y11E 4DURA 2GV6A 4ZKRU 2FOEA 1O5AB 3BTWE 4ISLA 2DE9A 1V2KT 1RJXB 3ZYEA 3UTUH 1EAIA 2P8OB 1GJ4H 1GI5A 3DHKH 3AASA 1P01A 2KX4A 1K21H 5G4BA 4XOJA 2B9LA 1YLDA 1A4WH 3PRDA 1YCPH 4ABIA 1V2MT 1O2SA 3SW2B 2GCTC 4GPGA 1EPTB 1L4ZA 2PSYA 3GCTG 1YPMH 4DIHH 3NUMA 4GSOA 5GWZA 4NIVA 5AHGH 2FWWA 5FBEA 3KQDA 3W95A 4WMDA 3GCTF 1FY8E 1DLKB 3RXRA 1SGPE 3GOVB 1SGFG 4XFQA 1DITH 2QE7D 3HKIB 2QF3A 2CF8H 1H9HE 1SLXB 2R0KA 1O5GH 3F9EA 1V2LT 1WU1A 4WY3A 1O2QA 2FTLE 2FMJA 2Z6BD 1ZMJA 3A84A 3UY9A 4B6EA 3BTTE 1PPHE 5KECA 3S9CA 3EAJA 2R0LA 3SU0A 4GUXA 7ESTE 1C5WB 4MNWA 1SL3A 2NU3E 1XUHA 1YCPM 1IQHA 1QBOA 4YM9A 2A4RA 1K1IA 1UVUH 4KTUA 1P3CA 4QT8C 1CA0C 1MD7A 4ACAA 1GBCA 2A5IA 1ZYOA 1EATA 3UQOA 2BX3A 1GMHF 5JBCS 3M5NA 3PTBA 1RXPA 1INCA 2W5EA 4P02A 3UREA 1ELEE 1CGHA 3ATKA 1SGCA 1E37B 1ZOMA 1TRYA 3B23B 4LK4A 1W11U 1G3BA 2A32A 3TH4H 2PUXB 3MH7A 1D3DB 1T7CA 4GHQA 1P2JA 1GG6B 2ZDMA 2GT7A 1OP2A 2BLWA 1ZPCA 1ID5H 1A5GH 2H5DA 2CMYA 2FOFA 4I8GA 3ZVFA 3LGTA 3QWCH 2OLGA 2FEQH 1A2CH 1HGTH 3SI4H 3BEUA 4ZKNU 2QY0B 5DG6A 1GHYH 4ISOA 1ZGIA 1MTNC 1D6WA 1H9LB 4SGBE 3GY4A 3RXQA 3NCLA 1N6YA 3SNDA 1BRCE 2VB0A 1NTPA 2B5TB 2XYAA 5FBIA 5DP3A 3BV9B 3Q3YA 1FY1A 2GD4B 1ZHMA 4KTSA 1G30B 1HFDA 1OWEA 2EI6A 3PMHB 1HJAC 5CHAC 4YOGA 2WPLS 5E0GA 1BBRE 1ESAA 2G52A 3GICB 3JZ1B 1DY9A 4WF8A 1AN1E 2V0BA 3A7ZA 1MKXK 4FU8A 1OHHD 4X6MA 3M7TA 1O3HA 2Q6DA 1TBRH 2J2UA 1XVOA 1HAYB 1AB9C 2CJIA 3MQKC 2Q1JA 1O5BB 3UNQA 2H1UA 4ABEA 4O9VA 1YBWA 1YPJH 4XRNA 5HM2A 2QAAA 4ESTE 1LVYA 3PV2A 4ZUHA 2XCNA 3SUGA 1PQ7A 2QF0A 3A89A 3B8JA 4X1SU 3KL6A 2XC4A 6LPRA 1WCZA 5TCCA 3U69H 3I78A 1JRSA 5EIYA 3QTOH 1O2TA 2BDHA 1CT2E 1TBQH 3FN8A 1UK2A 1PQ5A 1QTFA 3OAAD 1T8NA 4WH6A 1J17T 3M7UA 1B0FA 1Y3VA 3RXKA 1GBHA 2NU1E 1UTKA 1F92A 3OU0A 1DWEH 3QO6A 5C94A 4K1EA 4U01A 4CR5A 1MZAA 1GHAF 1KLIH 3A8AA 3LJOA 5BPEA 4U2WA 1H8DH 2PKSB 4CRCA 4ASUD 1OWJA 1ANDA 2G5NA 5AFYH 1FMGA 1EJNA 2C8XB 3RXUA 2SGPE 1P57B 1AKSA 2H2ZA 3ATIA 4K8YA 4U30A 1FIWA 6CHAC 1GVLA 3M3VA 4GHTA 5A0BA 2M5TA 4HFPB 5HXFA 1Y5AT 2XOKD 5JYIA 3A88A 3LONA 1O5EH 3ZVGA 3BEFB 4O3TA 1TNLA 2KM0A 3PWCA 4MTBA 4H42U 2FLRH 2GP9B 1TPPA 3Q3XA 3EE0B 3PLKA 3IWMA 1BOQA 4UEHH 1FX0B 2YMSC 2R9PA 2XWBI 3P8NA 1KTTB 1YLNA 4CRAA 4A6LA 2D8WA 2TGPZ 2KCPA 1QGFA 2JIZD 1W13U 1GMDG 3OFND 3AW0A 2FM2A 1BTZA 5C0TA 2JETB 4AFQA 1GMDF 1KXAA 1S6LA 5DP8A 5JDUB 1SC8U 2J94A 3WWFA 1IQFA 2CHAC 3AAUA 3GY5A 1FAKH 2ZDNA 3SHAH 2EC9H 1OXGA 4AGKA 2BD5A 1IQNA 1LVBA 1QBVH 2FX6A 1PQ8A 3KCGH 1AWFH 3D23A 2G51A 3SJ8A 1S0QA 3ATLA 4K5ZA 3RP2A 5FPTA 2ODQA 2VVUA 3WY8A 1ZSJA 1ABJH 3OEED 1TWXB 1SHYA 1O3JA 5DKMA 1B5GH 1QZ8A 1GI4A 3RLWH 3U98H 4FUCA 1O39A 2J95A 5B6OA 2JDID 1XUKA 2XBYA 3A86A 3F0OA 1GI7B 1Y5UT 5IK2D 3DFLA 1KLTA 1ZR0A 1GCTB 4XSKU 2VH6A 1BTXA 2O8WA 4AZ2B 3M61U 1KXEA 1UTLM 4CRFA 2ASUB 1C2HA 4IMZA 3UOUA 1ELDE 3SZNA 1V2OT 2BVRH 1EP6A 2VJ1A 1F5RA 1C5OH 1S81A 2ANKH 3PMAB 1LPKB 1SPJA 5CMXH 4D8NA 5JBTA 1O2RA 1GVZA 3EA7A 2WYGA 1TOMH 2A5KA 4OS5A 1ZPBA 3BF6H 3SJKA 6GCHG 2ZGJA 1C5YB 3KN2A 1FLEE 1C4Y2 1TNKA 3TGIE 2XRCA 1P2MA 4AX9H 2CN0H 5FCKA 1KDQA 3SZEA 6GCHF 3E6PH 3VFEA 3D49H 2UUYA 1T8LA 1ZZZA 1BMNH 1DVAH 1EAWA 3T25A 1GVKB 1PPCE 1UTMA 1HAZB 2P3TB 3VB5A 2QYIA 5T6GA 4X6PA 3L33A 2OBOA 2THFB 4BAKB 2GCTB 1MUEB 1E79D 3GCHC 1AU8A 1EASA 2TGDA 3Q3KA 1ETSH 1AUJA 3DSOA 1HXEH 1MTSA 2FOMB 2ZFRH 2A7JA 1L1JA 3P8OA 3A80A 4OGXA 8GCHF 1C2LA 4Y8XA 4B74A 4D9RA 4CRBA 5IYTA 4RKJB 1FQ3A 1KXCA 1EJMA 3P8GA 2KAIA 1P02A 4Z0KA 1QR3E 2ZPSA 1F2SE 2O8TA 2Z3DA 1HAGE 5F6MA 2SFAA 2YOLA 4TY7A 3R0FA 2ILNA 1NFUA 5HMAA 1BTHH 3SU3A 1CA0B 2C8WB 4OM9A 4DG4A 1K1LA 1N6XA 2KZ4A 5IDKA 1SKYE 1Z1IA 5JBBS 2J9NA 2KCYA 4TWYA 3L3TA 4WWYA 4WMFA 4BAOB 4X2YA 2FOAA 4ISIH 5T6DA 1HAXB 1GL1A 2ZZUH 1L0ZA 3QUMP 3FFGA 1ELAA 2QV1A 1LVMA 2ZHEH 2XBWA 3SGAE 2PGQB 4H6SB 4ISHH 2ZFFH 1FV9A 3IITA 3U8TH 2OXSA 3OX7U 2D26C 3GY2A 3NZIA 2ZQ1A 1Z71A 1SMFE 1OP8A 4CH2B 4ASHA 5K0HA 1V2WT 1XUJA 1GJAB 4TPIZ 3M7QA 1K22H 3S7HB 2AIPA 2WUCA 2QIQA 3BTME 3A83A 3SQHE 1PQAA 5ABWA 5A0CA 1L4DA 2AYWA 2EQNA 1MQ6A 4UONA 3MU8A 3GS9A 3T26A 5CHAB 1SLUB 2KCAA 1BDAA 1HJAB 1TGBA 2Y7ZA 4I86A 4MPWA 1EPTA 3QK1A 1O5FH 1ZRBA 1SLWB 3GY6A 4TYDA 3IG6B 4FUEA 1RFNA 1H1BA 1PPZA 2HPQH 4OS1A 3W94A 3EDXB 1AB9B 3M37A 3L6PA 2ZPQA 3MTYA 2BB4A 4TWWA 3RXIA 3SQEE 1QJ7B 1ANCA 1OYQA 3FOAA 1JWTA 3RU4E 2VVVA 2IJD1 1DSTA 2HVYB 1DY8A 2FP7B 4MPUA 3PROA 1Y8TA 3T2NA 4JZ1A 1J16A 1G9IE 2A2QH 3MU0A 5E8EH 1W0KD 3RXBA 1SQTA 2HNTF 3MU1A 3BEIB 4NGAH 4JZFH 4UD9H 4IC5A 1NFXA 2HNTC 3LGUA 1BBRH 1ZLRA 5FHTA 1DFPA 2F9PA 4FXGH 2PSXA 3BTEE 1QA7A 1SI5H 1C2FA 3RM0H 3F9FA 1T32A 2CGAA 1LKBA 3BN9A 3SV6A 1OSSA 3BG4C 1DSUA 3U1IB 3U8OH 1WUNH 3F1SB 1BJUA 2AMPA 2ZHFH 3SV7A 1FY5A 4FOUC 3KEEA 5EODA 4INKA 1O3BA 1MKWH 1C1OA 3VG8A 2ZU2A 9LPRA 1SLVB 2P3FH 1AGJA 3TIUA 1V3XA 1THSH 6CHAB 2AS9A 3UB0A 1W0JD 1C2EA 1XKAC 4FU7A 1P2KA 5A09A 5E2OA 4M7GA 3FZDA 1SB1H 1AO5A 4AFZA 2HALA 5HIZA 3LH1A 2BHGA 1CHGA 3BTGE 2Q6FA 1WQVH 1YC0A 1OKXA 2H5CA 2QN5T 3HKJB 3Q76A 3T27A 1E1QD 1A1RA 1FN8A 1TQ7B 4KELA 3ZV9A 2LPRA 3AAVA 5J4SA 1NROH 4MNVA 1YGCH 2QA9E 3RMMH 1GHWH 1O3GA 3DA9B 1HAVA 2BVXH 2GJGA 3UPEA 2CHAB 5EOKA 1ZTJA 4K1TA 2HOBA 1SGNE 1TNGA 5JPMH 2D2DA 5DO4H 5LH8A 3UIRA 4UE7H 1TPOA 1XXFA 1O33A 3WWBA 1G2MA 1TYNA 2Z3EA 1W0ZU 1ARCA 3QGNB 1SFIA 4WXIA 4ABDA 1A3EH 4X6OA 3RMOH 4RKOB 1AWHB 3TITA 1LVOA 3NXPA 3SU2A 1BJVA 2XNIA 4BAHB 3UNSA 4E06H 3U28C 1UTNA 1SGQE 1S85A 5F8TA 3STIA 3UNRA 1GI3A 2VGCC 5EXMA 3VEQB 3EQ0H 1K2I1 1C2KA 1DLEA 2Z7FE 4ZXXH 1OWIA 1P2QA 3FP8E 2IN2A 3H7TA 3SNEA 4FUIA 4NA7A 3DSPA 4Y8YA 1ACBE 1F0SA 3ZV8A 1HBTH 2BLVA 2A4QA 2QGRA 2L6OA 3K9XB 4NSYA 3EE7A 2Z9GA 3DFJA 3VB7A 1UTPA 2SGFE 3F9GA 4F55A 1EX3A 1Z8JB 4Y6DA 3RLYH 2DE8A 3K2UA 1P11E 3ZZ9A 1CT0E 1IHTH 2FODA 3BG8A 4JZDH 1TRMA 1MCVA 3M5LA 2XWAA 3BTQE 9ESTA 2NU0E 2FPZA 3PO1B 4GVUA 1GJ5H 4JYUH 4VGCB 1H9IE 1NBMD 3U8RH 1MKXH 1G32B 3N99A 2WPMS 1C5NH 1YPGH 1IOEA 1MU8B 1GI2A 5FAHA 1W0YH 1NC6A 5DN6D 4MVNA 1HAHH 1HIAB 4A1TA 2HWLB 2ZKSA 4I7YH 3RXEA 3FVFB 3PV5A 3RXCA 4R8TB 4Y7AA 1TPAE 1V2RT 4HG6A 5FPSA 4FUHA 5GCHG 1AHTH 1O2LA 1FY3A 1SOZA 2GDDA 1BMFD 2BX4A 3TJOA 1NBME 3H7OA 1MABB 4MLFB 4DT4A 5J4QA 2BY7X 5GCHF 3VGCB 3T29A 4AYVB 3HATH 1WBGB 2TGAA 1O31A 1P12E 5AF9H 1GBJA 4I31A 3ZZCA 1FAXA 1H8HD 1D9IA 3S7KB 3M3TA 5I25A 1A0LA 1W12U 3E91A 4B2AA 1S5SA 4X2VA 1V2NT 1OWHA 2BD2A 2ZC9H 1C1UH 3MNCA 4ZHMU 1D3TB 5FCRA 2K1QA 5C0UA 3DCLA 1QFKH 1UHBB 3OTJE 3UWJH 3SORA 2OBQA 5T3HA 1AZZA 1J9CH 2H9HA 1KSNA 4K60A 1HCGA 1O2GH 3SI3H 1P10A 1GHXH 1CBWC 4YZUA 1THRH 1GBLA 1QL9A 4X1QU 4NIWA 1CSOE 4B2CA 3RXOA 3A87A 4Q7ZA 1O3CA 5FX5A 3RC5A 5HIYA 3LDXH 1Z8GA 3A7VA 3O8DA 4A1XA 1GBBA 3KNXA 3NKKA 4A92A 1PPGE 1O37A 2LP6A 1DWCH 1UO6A 2CV3A 2D1JA 2SNWA 4D9QA 4AG2A 3AW1A 2BXUH 1C5MD 1M9UA 1T4UH 3VXFH 4JZEH 2PP6A 1ZMLA 1K1OA 2RCEA 3ZVCA 1FJSA 1SGIB 2PHBA 2FXRA 2WPDD 1NM6A 4ZCNA 3KYGA 3RC4A 1DX5M 1Z6EA 1C5TA 4IW4E 1DXPA 2F43B 3D65E 1QRXA 2F3CE 5FX6A 4KTCA 3QX5H 1GI9B 3UUZA 2BOHB 5CHBA 2G00A 4I8LA 4ZKSU 4BAQB 3CS7A 5SGAE 4ZHAA 2QF5A 2PKAB 3M36A 2F9OA 1MTWA 5KGOA 4HTCH 1C1PA 2BD8A 4WVPE 1BMMH 4IC6A 3GY8A 1QCPA 1W3CA 1X7AC 3RXPA 4K69A 2ESTE 5C1YA 2F91A 2ANYA 4JYTA 2FESH 1ZSLA 4ZH8A 1TA6A 2F9BH 1VITG 5EQQA 2BQ6B 3TH3H 3MNSA 2ZEBA 2AGEX 3QN7A 1LHGH 1T8MA 4AB8A 1VITF 3VB6A 1BHXF 2ZPRA 1GWAA 2K0QA 1O2WA 1O2OA 2Z9JA 3VB4A 2Z9IA 1E34B 1KXBA 1TE0A 5DGJA 4E7RG 1P3EA 2OUAA 1DXWA 1MAYA 3RMLH 3UR6A 1UVOA 2XTTB 4P00A 3ZVBA 1WSSH 2BVSH 1SBWA 3WW7A 1HAOH 2BDGA 4INHA 4NFFA 3VB3A 1O3DA 4NA9H 3BG4B 2AEIH 1VCPA 4LOYH 2BY9X 1P8VC 2VH0A 5EQSA 2V3OH 3S69A 2KCOA 3A85A 2J38A 1TX6A 4ISNA 2J34A 1G3EA 1LCYA 1TABE 2XC5A 1C5PA 3F0PA 2VWLA 1GCDA
chains in the Genus database with same CATH topology
1NY22 3U9AH 1AFQB 1JOUB 1RIWC 1P9UA 2ZCHP 2V6NA 1E38B 2WPJS 1A0HB 5DP4A 2CXVA 5DP6A 2M2AA 1A3BH 2P3UB 4BAMB 4DJZB 5HKKD 3CS0A 1NFYA 1EQ9A 3QTVH 2ZECA 4UFFH 2IJOB 1SGDE 2BY6X 1GBIA 4ZAEA 2P94A 1GJ6A 1LHEH 1XX9A 5TJXA 1V2UT 1RTFB 1GMCG 3RUOA 4IBLH 3SV9A 2W7SA 5FPYA 1S6FA 3V13A 1BITA 1VR1H 2EI8A 5TCAA 2WUBA 1C1SA 2BM2A 2R3UA 3BTKE 1S82A 1BMAA 5C5OA 1GBDA 1UMAH 1WQSA 2NWNA 4AB9A 1BRAA 2SGAA 2BLQA 2C93B 2PV9B 1ZTLA 1C2DA 2Y81A 5GNDA 1AI8H 2HNTE 2BQ7B 1LHFH 1S83A 2ZDLA 1V2JT 3I77A 1NFWA 2ZO3H 2JKHA 4A7IB 4YT7H 4MDSA 4OS2A 1G2LA 1N8OC 2ZU3A 1C9TA 3PMJA 3AVZA 1D3QB 1UTJA 3LOXA 1QB1A 4H4FA 1QB9A 4CREA 1QL8A 1C2MA 3LH3A 4YOIA 1NU7B 2VIDA 3OEHD 1JIRA 2P8OC 1LPGB 3SBKA 2BY8X 1N1LA 4BANB 2ZHWH 3UQVA 2Y7XA 2VGCB 2Y5HA 3BTHE 2ZCLP 1O2NA 3TJNA 1W7XH 4RN6A 5T6FA 1O30A 3VPKA 3DD2H 1DOJA 3LC3A 2QXHA 1NRQH 4J1YA 2ZU1A 2ZFPH 2ZTZA 1BT7A 3FO8D 3MNBA 1TPSA 1EZQA 1TNJA 3GYLB 1TALA 3UWIA 1Z8IB 2H6MA 1ELFA 1VCWA 1O2VA 1GGDC 3PTNA 1UTQA 4JZIA 4ABJA 3ODDA 1P2IA 3K6YA 3RXDA 5FL7D 1ZGVA 1FNIA 4LZ4B 3FKSD 1Y3UA 1HB0B 1PPEE 4Y0ZE 8KME2 3MH6A 1P2OA 1O3LA 2UUFB 1AVXA 1NT1A 1Z1JA 2B7DH 4Q2KA 5CDFE 1VJAU 5B6LA 1JXPA 4CR9A 5A8YA 1ARBA 2A45B 1NPMA 1G3DA 2UWPA 2G4TA 1SGEE 1Y3WA 1O2MA 2Y5GA 2XXLA 1CE5A 3BIUH 1FI8A 3BSQA 1ELCA 1GBEA 1TMBH 4DVAU 7KMEH 1UCYE 1XM1A 3ENSB 5AVDA 4B75A 3ZVAA 3RXMA 1AZ8A 2AIQA 1EXFA 1UTOA 1GI1A 1WTGH 2NU4E 2Z9LA 2ZU4A 1UVTH 3EYDA 3PMBB 4MPWA 1SG8B 1EAUA 1C5XB 1NU9A 1JBUH 4Y79A 3FANA 3GCOA 2RDLA 2VINA 2TBSA 4I33A 1IQJA 1KMHB 1TNHA 1U6QA 3DT0H 3ZZBA 5K7RA 3LGVA 4DGJA 2OINA 1CO7E 3QZRA 2H9EH 2LNCA 1BTUA 2BD7A 3SV2H 1WV7H 3EA8A 2ZU5A 4BTUB 5CE1A 3MMGA 1GDQA 1B7XB 1WTHD 1EKBB 1FONA 1KY9A 1SGYE 2EEKA 1EB2A 5EG4A 4CHAC 3SNAA 3AK5A 3ESTA 3BIVH 4X0WU 4X8SH 3MWIU 1QRWA 2W26A 1S0RA 2ODYB 5GDSH 4CBNA 1MTNB 3ZZ7A 4NFEA 1QURH 3PV4A 2FYQA 2Z94A 3RM2H 3SU5A 2Y80A 3LGWA 1CBWB 1UVSH 4Y0YE 2HPPH 4BTTB 4WXVA 1C1VH 2BMGB 3RU4D 3RXVA 2A4OA 2PGBB 3LU9B 2B8OH 4YESB 4AFSA 4FU9A 5PTPA 4DY7B 1O3KA 1W14U 3TU7H 1SOTA 3SUDA 4B73A 1O2UA 1SQAA 4OS6A 3SJOA 5JBAS 1BUIA 4ZMAH 2WPKS 1O2XA 1DT2A 5C1UA 1Z6JH 1XUGA 1L2EA 1MTUA 4WMEA 2FO9A 1MQ5A 1MH0A 1IAUA 4ZXYH 3A8DA 4HI3A 1HLTH 1JMOH 3SN8A 2G8TA 4Q80A 4FUFA 2O9QA 2TIOA 2ZF0H 3RXFA 2VU8E 2FI5E 1CU1A 2ZTYA 3V12A 2QXIA 2HLCA 4Q4LA 1KYNA 2ZTXA 2G55A 4BXWA 1W10U 4FVDA 3E1XB 1HIAA 2PLXA 1HNEE 3EGKH 2XC0A 1C1NA 5E0JA 4Z1MD 1C1TA 2QF4A 3TGKE 1Q3XA 5DPAA 1DS2E 1CHOG 1ZTKA 3JZ2B 4XD7D 2A7HA 4XBBA 1PPFE 1SR5C 1SGTA 3U1JB 1WYKA 4JK6A 3RDZA 2P59A 2B0FA 3E3TA 4Y8ZA 3QLPH 2RA3A 1TX8A 2WPIS 4XE4A 1CGIE 5ETXA 3KF2A 3MYWA 1P03A 2OCVB 1AVGH 1W7GH 4K8BA 1J15A 1LQEA 2ANMH 4UFEH 1LO6A 4X8TH 4JCNA 1BHXB 3R3GB 1HRTH 1O2KA 5AFZH 3QGJA 1DM4B 3PB1E 3A81A 1GPZA 3F68H 5JB8S 1UHBA 1O32A 1RS0A 1K1JA 1HV7A 3GDSA 4Y71A 1O3PB 4ABFA 3A8BA 4MPVA 2VWOA 1YPHC 3LT3A 2HLDD 2YMSB 4UFGH 3RXSA 3ZZDA 4A5TS 1UVPA 5EQRA 1YF4A 3PLPA 4NCYA 3SJIA 1G3CA 1EOLA 3Q77A 1O3EA 2PTNA 2A1DB 1TMTH 3SUFA 4IMQA 3ZZ3A 1GI6A 5H4IB 4D7FA 3S0NA 1T4VH 3LC5A 4X8UH 4B1TA 1ZMNA 4I8HA 4Q7YA 1ELBA 3G01A 3F2GA 1O3MA 4NZQA 1TGNA 2IPHA 2XBXA 3E0NB 1F0TA 1WXRA 1DDJA 1AD8H 3ZZ6A 4X1RU 1BA8B 1PJPA 2V3HH 1YKTA 1S84A 5A8ZA 4I8KA 1C5SA 1TGSZ 5DP7A 1Z7KA 4HGCA 3M3SA 1TOCB 3MU5A 1OP0A 2DUCA 1GJ7B 1EZSC 1GCTC 2R2MB 3A8CA 1K1MA 1QQ4A 3GCNA 3LIWA 3LPRA 1CA8B 1MCTA 1LPZB 3K6ZA 1O3AA 2PKAA 1L1GA 1SQOA 2CF9H 3SGBE 5C67A 1ABIH 1GDNA 4YLUA 2YMSD 1ZHRA 2GV7A 1GJBB 1LHDH 3HK3B 2BZAA 1H4WA 1F0RA 4X2WA 1GDUA 1AE8H 1NN6A 2ALPA 3OY5U 1ANBA 4IN2A 1RTKA 5LGOA 2P95A 1O34A 1SSXA 2GZ9A 1BZXE 3VXEH 4Y7BA 2W3IA 1N8OB 2C90B 3QZQA 2WV4A 3A7XA 5EPYA 2IOTA 2Q6GA 3DUXH 2ZDAH 3RC6A 2Y5FA 2WHXA 1CVWH 3S9BA 4MG3A 1UK3A 3SGQE 2WPHS 2RG3A 1ESBA 2GCHG 1A0JA 2AMDA 1AQ7A 2G5VA 3A7TA 1XUIA 1QHRB 4NWKA 5I46H 2H9TH 2C3SA 1B0EA 5L30H 2GCHF 1W8BH 1C4U2 2GZ7A 1QB6A 1O3IA 1ZHPA 4H6TA 4O3UA 3SU6A 4M9FA 3FAOA 8LPRA 4FUJA 2GDEH 3KIDU 5L2YH 1C4V2 3ZVDA 1FDPA 2OC7A 3NWUA 1V2ST 4FUBA 4X1PU 1BRBE 4O03A 1XUFA 1YM0A 3F6UH 4NSVA 2PWXA 5JB9S 1RTLA 6ESTA 4OS4A 3OSYA 4X8VH 3GCHB 3UFAA 4X1NU 1PPBH 1TBZH 1GGDB 1QBNA 1CT4E 4K3JA 1G37A 1TONA 1WOFA 3P92A 2GT8A 4X2XA 3SNCA 1K1PA 2VWMA 1QRZA 3GDUA 3ITIA 2W7UA 3C27B 1D3PB 1SVPA 2BDAA 1YPLH 1V2QT 1GJ8B 4XBCA 3UR9A 2RA0A 2BTCE 3KQBA 2AMQA 2SGQE 5EXLA 1E1RD 3P17H 4YT6H 1LHCH 5FXLA 1A46H 1OOKB 2WV5A 2G4UA 2J92A 3GDVA 1NRSH 1GMHG 4OGYA 2STAE 4J2YB 3ZZAA 4RSPA 4FUDA 2A5AA 5GJ4B 1DWDH 2ZIQH 1BB0B 4INLA 1EUFA 2BXTH 3T62A 2Y82A 4DW2U 1VGCC 2FIRH 4BNRA 2ZI2H 4XBDA 1A61H 2SGDE 3SYJA 3T5FH 2FOGA 1O3FA 2ZQ2A 4PROA 1ETTH 1FPHH 1C2JA 1DICA 2BY5X 1GHZA 5C2ZA 4ABBA 2XCFA 2UWLA 2PFEA 1YP9A 3GY3A 1YCPK 4LZ1H 2A4GA 4D7GA 1TRNA 3RXHA 2AGGX 2ZFQH 3F9HA 2NU2E 1TFXA 2O8LA 2AHME 2KFWA 3PLBA 3MO3A 3SU4A 1FIZA 1MD8A 2FOBA 2A31A 4CHAB 1P06A 1IQMA 1UCYH 3HGPA 3KHVA 1AIXH 2ULLA 1O3NA 1GJ9B 1ZPZA 3I29A 2ZP0H 1EZUC 1KXDA 1IQLA 1S6HA 3T28A 3NK8A 2LELA 5LPRA 1C1RA 1SGRE 5A8XA 1O2JA 1TQ0B 3TPIZ 1OYTH 1TAWA 7LPRA 4JK5A 1NRNH 5DP9A 1C1MA 1PYTC 3P95A 3CENA 1LQDB 1HAVB 3E8LA 1O2IA 1RD3B 2WV9A 4E05H 2GMTC 2OTVA 1TB6H 1E0FD 1YLCA 1NO9H 3ZZ8A 2XNDD 3MO6A 2GTBA 2PUQH 1QQUA 1EJAA 1HDTH 1E35B 4Q7XA 1ELVA 2FDAA 2FS8A 1T8OA 2TGTA 1C5VA 2OC1A 3C1KA 3LJJA 1SGFA 3FP6E 1DPOA 3TGJE 1A7SA 2OC0A 4ABHA 2FZZA 3TH2H 4CRGA 3N7OA 2WYJA 1Y5BT 1CGJE 1TIOA 1YPEH 1GHAG 3K65B 1P05A 2W6ID 1DWBH 4MPXA 1VZQH 3HPTB 5GPIB 2JH5D 5HYOA 1J8AA 1UCYK 3O8BA 3TVJB 4CH8B 3HGNA 4LXBH 2AFQB 2AGIX 2GGVB 4Y10E 1KTSB 2I6SA 4AGJA 2QCYA 1NRRH 2P93A 2XW9A 3F2HA 2F9NA 3NPSA 1A5IA 2BZ6H 1OWDA 5HGGA 2JH6D 1C5ZB 2J5UA 4O97A 2F4LA 4XDEA 3SUEA 2CK3D 3TLOA 3MO9A 4B71A 2VIQA 1HXFH 4NIXA 2FI3E 1Y59T 3OE7D 3ZZ4A 4K2YA 1O2PA 1GJCB 1CQQA 3NRLA 1ORFA 1HPGA 1YPKH 4JMYA 1GBAA 3S9AA 1H8ED 1BTWA 2AH4X 3MHWU 7GCHG 1IQEA 3MOCA 5ESBA 3ZZ5A 1UJ1A 2STBE 1C9PA 2ALVA 1DE7H 7GCHF 1BRUP 2G81E 5L2ZH 2ZFSA 3ZVEA 1AUTC 5DJ7A 1C5UA 3E16B 2YNAA 4TT3D 3SO3A 1GBMA 2OP9A 2WZQA 1F7ZA 1JIMA 4HZHA 1QNJA 1Q2WA 1Z8RA 3N7EA 3CP7A 1D4PB 5GIBA 1GMCF 5LPFA 4ABAA 3F2FA 1MU6B 4AOQA 1BQYA 3A82A 4FVBA 4JYVH 1QIXB 5EW2H 3MU4A 1C5QA 3RU4T 3MH5A 3M5OA 2ZGBH 3LGIA 2C8YB 2F83A 1Y3XA 2C8ZB 1P04A 1QL7A 2VIOA 3KGPA 1TGTA 1LMWB 5ESTE 2ZGXH 3W1EA 1EZXC 2R2WU 4GAWA 1BTYA 3TK5A 2BQWB 4WH8A 2C4FH 4YLQH 2WSSD 3TK9A 1O5DH 3M35A 4NA8A 5EW1H 3N7DA 3RXJA 2BD9A 8ESTE 3LGYA 5A2MH 1OWKA 1V2VT 1TNIA 3FZZA 2O8UA 1ZSKA 4UFDH 2OK5A 2BDBA 2P16A 1C5RA 2VBCA 1EB1H 4E7NA 4YO9A 1EPTC 1FZZA 3OY6U 3OTPA 3BTDE 2Y6TA 1MZDA 3KQCA 2A0QB 2W3KA 3Q00A 1C1QA 3LKWA 1ELTA 1QJ1B 4TSFD 3O8CA 4ZHLU 4CRDA 3PM3A 3GY7A 4KKDA 4TPYA 1YPHE 1ETRH 1T31A 5GXPA 5F53A 1C1WH 5L6NH 3PO1C 2Z9KA 2FLBH 1NRPH 1O36A 1O0DH 4I8JA 4DOQA 4VGCC 1Y3YA 3TJUA 1OPHB 1ZRKA 1FUJA 1GI0A 2GZ8A 1PFXC 2ZA5A 4THNH 1HUTH 4KP0A 5EPNA 4DCDA 2UWOA 2A7CA 1HJ9A 1TLDA 4BTIB 5EGMA 1VITH 2HRVA 4D76A 8GCHG 1FPCH 2ZDKA 3F3BA 3TJVA 4BXSA 3ZYDA 1OS8A 3ZIAD 1MTVA 2QXGA 3D62A 4Z6AH 2VIWA 2OD3B 1LTOA 1WAYB 2VIVA 4F49A 4Y76A 3P8FA 1F5LA 3VGCC 1GG6C 1DUEA 2VWNA 5A0AE 3MNXA 3V3MA 1K9OE 5T1VA 1AKSB 3V0XA 1JRTA 2ZGCA 1GJDB 2AERH 1FXYA 5LPEA 1NESE 1P9SA 1FY4A 3SJ9A 3RMNH 2W6JD 3ODFA 2O8MA 2XBVA 1HYLA 1O5CB 4I32A 3M5MA 1XMNB 2ZWLH 4RI0A 3SU1A 4K1SA 1A5HA 1XXDA 1ESTA 1VGCB 2VNTA 4F4OC 1LKAA 1QY6A 2TPIZ 1K28D 2PW8H 1AVWA 5DSFA 4OS7A 1XVMA 1ANEA 1MMJN 4YTAA 2JJ2D 1EOJA 2PR3A 4IN1A 1Q31A 4AN7A 1KLJH 4B76A 1XKBC 2GVFA 1C5LH 1AMHA 4NWLA 1GL0E 1GBFA 3FP7E 4TY6A 2F9VA 5C17A 2ZNKH 2ZHQH 1J14A 1F0UA 5C3NA 4U32A 1EP5A 2ZFTA 4AORA 5EXNA 2V7QD 5F03A 5BRRE 4AFUA 4Q63A 1BCUH 1ELGA 3E0PB 2BLOA 2EA3A 3QDZB 4YOJA 1GHVH 2FX4A 2UUKB 1KXFA 1D6RA 2Z3CA 3STJA 4GLYA 1YYY1 3SNBA 2HGTH 1OX1A 1BTPA 3KQEA 1LDTT 2K8IA 1W2KH 5EU8A 4BOHA 1V6DA 1UK4A 2VVCA 2YNBA 3ATMA 1IQGA 3ELAH 4UDWH 1IHSH 2ZCKP 4X6NA 4ZROA 1G36A 3OYPA 3RXTA 1O38A 2GMTB 4NZLA 1ZJDA 4NG9H 3PWBA 1L1NA 2A2XH