2WV4A

Crystal structure of foot-and-mouth disease virus 3c protease in complex with a decameric peptide corresponding to the vp1-2a cleavage junction
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
201
Chain Sequence
DLQKMVMGNTKPVELILDGKTVAICCATGVFGTAYLVPRHLFAEKYDKIMLDGRAMTDSDYRVFEFEIKVKGQDMLSDAALMVLHRGNKVRDITKHFRDTARMKKGTPVVGVVNNADVGRLIFSGEALTYKDIVVLMDGDTMPGLFAYKAATRAGYAGGAVLAKDGADTFIVGTHSAGGNGVGYCSCVSRSMLQKMKAHVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/peptide
molecule keywords PICORNAIN 3C
publication title Insights Into Cleavage Specificity from the Crystal Structure of Foot-and-Mouth Disease Virus 3C Protease Complexed with a Peptide Substrate.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
total genus 44
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wv4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wv4A01
1DWBH 1JBUH 4ABFA 1QBVH 2BDIA 1O3MA 2XC5A 4MNVA 1ARBA 2Z9GA 2H5DA 2AGIX 2C8XB 3TJVA 1CHGA 4LK4A 2EI7A 2QV1A 1IQLA 4CBOA 3OY5U 3BTEE 1Z1IA 3M7QA 3V12A 1CT0E 3BTDE 1ZRBA 3Q00A 4INLA 4IMQA 3RXDA 4HI3A 3TJOA 2BY6X 4K60A 1LMWB 1N6YA 1C1QA 1VITG 4FU9A 3RMOH 1WOFA 2FEQH 1EXFA 1OWKA 1YPJH 4B74A 1BTXA 2ZDLA 3M36A 5FHTA 4Z0KA 4B71A 4BAQB 1KXDA 1M9UA 4RN6A 1ZHRA 2XXLA 1SHHB 2ZDVH 5FX6A 1EASA 1PQ8A 3S9CA 3BN9A 4FVDA 4A92A 2C8ZB 4YESB 1TOMH 5EQQA 4FUCA 3UPEA 2F9BH 2NU3E 1BHXB 3AAUA 1ZTLA 1TPOA 3ESTA 1NFUA 1CSOE 4NCYA 2TGAA 2R0LA 2BDHA 1EP6A 2A2QH 1K1OA 1C1PA 2FS9A 5F03A 3T27A 1K1MA 1L1JA 3RC6A 5PTPA 1FUJA 2BQWB 2HPQH 3SI4H 4WWYA 1QNJA 1TX6A 1P8VC 2VWMA 1TNIA 2GZ7A 3BTQE 1PPHE 1C5QA 1DSUA 5EOKA 1ORFA 4UFFH 1RIWC 3PLPA 4ZHLU 1CU1A 1BDAA 4OS4A 1D9IA 1KLIH 3A89A 5EPYA 3RLYH 3RXEA 1MD8A 2CGAA 1C5LH 4MNWA 5GCHF 1Z71A 5DP6A 1SOTA 2PKAB 1EB2A 2IJOB 3Q3XA 2OQ5A 1K9OE 4H42U 1XX9A 3I78A 3KNXA 4OS5A 1UCYE 4YOIA 1SLWB 1V2WT 4ISLA 5EU8A 5TJXA 1DDJA 1F0UA 1YYY1 2XTTB 3QK1A 3A85A 1ELEE 2QIQA 1YP9A 2LPRA 2H5CA 5FX5A 3A8AA 1L1GA 3T26A 4AYYB 1H9IE 1TNJA 3GY8A 4NIXA 1ANCA 3BTKE 1AUJA 2P8OB 2UUYA 3UIRA 3QTVH 5ABWA 3SJIA 1DFPA 4FU8A 4BANB 2FM2A 1AHTH 1SQAA 1VITH 2HWLB 1HAVB 1J14A 1QRWA 2AERH 8KME2 1BBRK 4BNRA 1GBLA 3RXOA 1YLCA 4JZ1A 1TBZH 2FXRA 1SGFA 1IQKA 1F7ZA 2AGEX 1QY6A 2DUCA 1ACBE 2KAIB 3D62A 1GJ5H 1O32A 5AHGH 3RXAA 3ZZ4A 1OS8A 3RLWH 1AD8H 2F9OA 3GY5A 4JYUH 3B9FH 1SPJA 8ESTE 2ANKH 1NZQH 1MD7A 5K0HA 2QA9E 1BRAA 4KGAA 2ZGXH 2FYRA 1J16A 1DLKB 2W7SA 1CA8B 1ZPZA 3E16B 5C5NA 1LTOA 4BAHB 1GBKA 4XSKU 1GHAG 1YPGH 3T28A 3BF6H 4IBLH 3PROA 2BTCE 4ZHAA 2BY7X 4ABDA 3SGBE 3F9FA 3ZVAA 3T5FH 2P3FH 1MUEB 4X2WA 2ILNA 4AOQA 1BMLA 5EG4A 1C1UH 1EB1H 2ZTZA 3ZZ3A 1TNLA 1Q31A 3AW0A 5ESBA 1HGTH 1WAYB 5E2PA 3VB3A 3KCGH 4ASHA 1TAWA 2FZZA 3TU7H 2BM2A 1S0QA 3QZRA 4XBBA 1C1TA 3SQHE 1T4VH 1IQEA 4K8BA 3ELAH 1TA2A 2Y82A 1XUFA 3T25A 2XCFA 2D8WA 2FESH 3GY7A 2OC0A 1GMCF 1A0JA 1C1OA 4AFQA 3Q3YA 1RGQA 2FPZA 1V2RT 1E36B 3ZYEA 2PWXA 4O9VA 4GLYA 3FP8E 3M3VA 1O2IA 3SU6A 2RA0A 2M5TA 3GCOA 2Z3DA 4K1EA 1O2UA 3RM0H 2TGPZ 3RXJA 3LJOA 4K5ZA 2ZFSA 2Y7XA 3K6ZA 3SJ8A 4D8NA 2J92A 2C8WB 1DXWA 1IQJA 1YPLH 5LGOA 2VIQA 1S0RA 2OD3B 4HGCA 2UUFB 2HPPH 4X8TH 1MKXH 1GJ6A 3LJJA 3QWCH 4I31A 5F8XA 1F0RA 3TGIE 1TNKA 1Q3XA 3UNSA 3Q76A 1PQAA 4XOJA 4YZUA 1N1LA 3ZZCA 3B23B 5G4BA 1D6WA 3CENA 2ZGBH 4WY3A 1VGCC 4Q7ZA 5SGAE 1VR1H 5LH8A 1GHYH 2G00A 4CR9A 1C5ZB 1KDQA 2D1JA 2ZFTA 1PPZA 1EQ9A 4IC5A 2NWNA 1NU9A 2ZDNA 4Q2KA 3FP6E 2FO9A 2ZDMA 3TH4H 1T31A 2BOKA 2XBXA 1C5TA 2F83A 5EW2H 1FPHH 4CRBA 1HJ8A 2PUQH 1O2VA 3P8OA 1TB6H 4INKA 2ASUB 3RU4E 1AU8A 4FUDA 1CHOG 5JBBS 1YPMH 3HATH 3SV7A 6GCHG 3MFJA 3SUFA 1D3DB 1JRTA 4WMDA 3URCA 2OP9A 2A4OA 4K1TA 3UREA 4BXWA 3U9AH 3CP7A 1PQ5A 2ZQ1A 3MNBA 1MAXA 2XWBI 1WV7H 4YT6H 4Q7XA 1GBBA 2GDDA 2C93B 4F49A 1OX1A 2PFEA 1O38A 1TPSA 1O3KA 3QTOH 1QJ7B 4DURA 4NA8A 1O2JA 4NFFA 5EGMA 3EQ0H 2BQ7B 2IPHA 1HCGA 1A3BH 4Y8XA 3ZVCA 3QGJA 2OC8A 1L4DA 2TGDA 1SQOA 1SGPE 2ZFPH 2G55A 4WXIA 5EW1H 1DS2E 2G4TA 3MH6A 1B5GH 1TMTH 1LHEH 1MQ5A 3W95A 2A2XH 2FOHA 1XUHA 3RXBA 2GP9B 2HNTE 4Q7YA 5H4IB 2BLVA 2ZHWH 3SN8A 2QXJA 2BY9X 1P0SH 1INCA 4AYVB 2BLWA 1C4Y2 1O5CB 4WF8A 5LPFA 1QA0A 3U69H 5EQSA 5E0JA 3E6PH 7GCHG 4X8VH 5FXLA 1NM6A 2A5KA 2PGBB 4X6MA 2ZDAH 1KYNA 1TNGA 1SGTA 3FFGA 1SL3A 1V2KT 4NGAH 1HAYB 1OKXA 3TJUA 1B0FA 2RA3A 1NC6A 1GBFA 3BEFB 5JB8S 3UY9A 3SBKA 2FOMB 1OXGA 5C1XA 1O2OA 3SHCH 1SGIB 2VGCC 2A4QA 1PYTC 4JCNA 5EPNA 4TWWA 3ZV8A 1O2NA 1SLUB 2IOTA 1DWCH 4KTUA 2PHBA 3GCTG 1TRNA 1UTMA 1FZZA 4OS7A 2A45B 4X1PU 1C5MD 3ZVBA 1V3XA 3KGPA 3GCNA 2HGTH 2JH0D 1A0HB 1ZSJA 2VIWA 1NY22 3RM2H 2JH5D 3DD2H 1GBIA 1UK2A 2FOFA 3MH4A 1BTYA 1C5VA 4CRAA 2XBWA 3BG8A 8LPRA 7GCHF 1OYQA 2VH6A 3K9XB 4WH6A 3EGKH 1D3PB 2B7DH 2VGCB 3LC3A 4IC6A 3TK5A 1XUIA 5ETXA 2VINA 1FAKH 1TQ0B 3RXVA 3HKIB 5HXFA 1ESAA 3EAJA 1EJAA 1S85A 4O3UA 1ZGIA 2F9PA 4B75A 4FUIA 3HGPA 1UVPA 3P8FA 2Z9KA 3MNSA 1VZQH 1KY9A 4K2YA 3MH5A 3MNXA 1Z8JB 3SNCA 1KDQB 3RXHA 3MU0A 4VGCC 1LHDH 4ISHH 2JKHA 1MZAA 1T8MA 2BOHB 1C1SA 4ZMAH 1G3CA 1O37A 1FJSA 2OBQA 2ZF0H 3SNAA 3FVFB 2G5NA 1V2NT 3PV4A 1C5XB 1O3BA 2P93A 5J4SA 1TLDA 2A32A 1DWEH 1F5KU 1K2I1 1SFIA 1KTSB 4Y7AA 2QAAA 5CHAC 1LO6A 3M5LA 3E8LA 3VXEH 1HJAB 1Y3UA 4ABBA 2AFQB 3UWJH 5IYTA 4GCHG 1XXDA 3BIUH 1QBNA 4MPWA 3OX7U 1GMDG 1SGFG 1ZOMA 2ULLA 4ISNA 3E3TA 1LQDB 5BRRE 1GHZA 1T8NA 4DY7B 1ZJDA 2NU2E 1L1NA 1P03A 1AZZA 3SV8A 1T8LA 1GVKB 4O3TA 4Y79A 2H1UA 1O3JA 3BTTE 2CXVA 1W10U 1ZSKA 1DX5M 5CHAB 5T6DA 2SFAA 3F9GA 4Y0ZE 1DSTA 1SB1H 2HALA 4B73A 1QBOA 2JETC 1P06A 2PV9B 1FY4A 1TQ7B 3VEQB 1Z8RA 2CN0H 3SUDA 4NIYA 2GDEH 2SGPE 1BIOA 1UHBA 1UK4A 1UVTH 3MOCA 4YTAA 3UR9A 1FDPA 1FMGA 2ALVA 2Y5HA 3TH2H 1G37A 5HYOA 1SI5H 4X1SU 1Y3XA 7LPRA 3GY3A 1DUAA 1EAWA 1YPKH 1AI8H 1G30B 4FUFA 4ZKRU 5ESTE 3P8GA 1RS0A 4JZIA 1C2KA 1ZLRA 1G2LA 1W12U 1ZMLA 1K21H 4K1SA 2A7CA 1TABE 2PUXB 1W2KH 1Z7KA 2VWLA 2FIRH 1A4WH 1LQEA 1O3EA 3P70B 4DGJA 1FN6A 2FI3E 3AASA 4BTUB 1JIMA 1IHTH 1NRRH 1SG8B 2FLRH 2P3UB 3PMBB 1RRKA 1V2PT 1MTUA 1ABJH 5CMXH 1SMFE 1O2TA 1HAGE 2XC4A 2I6QA 2QXGA 1NRSH 2Y5GA 2FX4A 5HMAA 1CVWH 1ZGVA 1QRXA 1SLVB 1MTWA 4E7NA 1U6QA 1QR3E 1MKWK 3ZZAA 3ATKA 2HOBA 3MMGA 3QGNB 1LKBA 1NFXA 1C1WH 1THPB 2ZO3H 1ELTA 4SGAE 3I77A 1AVWA 1D6RA 4AN7A 2PKSC 4I8KA 4INHA 1JOUB 1HBTH 1GJ4H 3H7TA 3PLBA 1FPCH 1HIAA 1NRNH 1ANBA 2F9VA 3EA9A 4X1QU 3V3MA 1UVSH 3RMNH 4XFQA 1FI8A 2XW9A 4YO9A 5GCHG 2F9NA 2TRMA 7ESTE 2O9QA 5DP3A 3S7KB 4AG1A 1NRQH 2A7JA 1L4ZA 4X2VA 4H6SB 1O5GH 1NU7B 3MWIU 2GMTC 4YM9A 2J38A 1JMOH 2ZGCA 1OSSA 2ZDKA 2VIOA 3LU9B 3R3GB 1JXPA 3MTYA 1O36A 3STJA 2ZFQH 2BB4A 4AFZA 1AY6H 1G3BA 2K1QA 1KXEA 1IAUA 1MMJN 1CO7E 3F9EA 1C9PA 4B2AA 4FUGA 2GZ9A 1Z8GA 1ZTJA 3E0NB 1W8BH 1O31A 4KTCA 1KXFA 1HAIH 3KQDA 1HAHH 4FU7A 4ABGA 4D76A 2VIVA 3ZV9A 1P10A 2WPKS 1L0ZA 4UONA 2GMTB 3M3TA 1QHRB 3LH3A 4A5TS 1C2GA 1Y59T 1EAUA 2GCHF 2H6MA 2ZCKP 3EA7A 3KQCA 1OPHB 4OS6A 4MPUA 1GGDC 3EA8A 4ZAEA 2BY8X 4UFEH 1YGCH 1DLEA 1SGRE 1LKAA 5B6OA 3QDZB 4TWYA 3U1IB 4BAKB 2HNTF 4Y6DA 1RIWB 4I8HA 1WSSH 2R2WU 1V6DA 2BXUH 2V3OH 5E0GA 3RXQA 4CBNA 1F0TA 1XKBC 4JK6A 1UHBB 1GL1A 3TJNA 1W3CA 1TONA 2NU4E 2VWNA 1BCUH 2BVRH 3SUGA 4WMEA 1GI9B 1FLEE 1W11U 2Z6BD 4Y10E 5GIBA 2AIQA 2SGQE 1WTGH 1GG6C 1NROH 2H9TH 1SR5C 1XMNB 3NPSA 1DUEA 8GCHG 2SNWA 1UTJA 1NT1A 1DT2A 1GBJA 2O8WA 2B8OH 1BRUP 4CH2B 3M3SA 5K7RA 1V2OT 4AG2A 4I7YH 1DPOA 3E1XB 3S69A 1HPGA 1QB1A 3DA9B 2SGDE 3FZZA 1AFEH 2J9NA 5CE1A 3FZDA 3BV9B 4ABAA 1XM1A 3SQEE 3GCHC 6CHAC 3IITA 1UTNA 1O2QA 2G4UA 1MBMA 1ARCA 1GHBF 1GPZA 3NWUA 1AO5A 1O33A 5AF9H 3H7OA 1RJXB 1EX3A 1J15A 3PM3A 4TPYA 1GMCG 2GCTC 1HDTH 2LNCA 4UEHH 3NCLA 1GJ9B 1RTLA 2SGFE 1A5HA 1P2QA 3S9AA 1O2YA 3SNBA 1GBMA 1GG6B 1LCYA 4WMFA 1GJBB 1TIOA 2BD2A 1C5NH 1BBRE 4I8GA 2TBSA 2FP7B 2B9LA 2FTLE 2BVSH 3K65B 2JH6D 2BD5A 3MO3A 5DP8A 1CBWC 1O3GA 8GCHF 1YPEH 1SQTA 4YLUA 3GCHB 1WQSA 3SZNA 1HIAB 1A2CH 2BD8A 1A1RA 2ZWLH 1O2KA 4MVNA 1A46H 1ESTA 2VNTA 1LPKB 3M7TA 2QN5T 1SGYE 3PWBA 3STIA 1O5BB 3KQBA 4NIVA 3PO1C 1P2NA 3BEUA 5GJ4B 1O3LA 4CRGA 1HV7A 2BDBA 5C3NA 1FAXA 1NO9H 2ZCLP 2BD9A 2VH0A 4B2BA 5DP7A 1Y3VA 2WPIS 4LZ4B 3TVJB 5FBEA 5E8EH 5DKMA 3SU2A 5F8ZA 2V35A 4Q80A 2EEKA 2BXTH 5E2OA 1MU6B 2PSYA 3ATWA 3A81A 1O3IA 1CBWB 3MH7A 2WV4A 1O2PA 1P3CA 1IQGA 1O3NA 1A5IA 3BTGE 1C2FA 1AWHB 1GBDA 4F4OC 1TALA 4M7GA 3UWIA 3VFEA 1LHFH 3A84A 2G81E 2ZP0H 4X0WU 1QB6A 2V3HH 1EZXC 1YC0A 1P01A 2P94A 2BLOA 1PPFE 1T8OA 2RDLA 1HNEE 4WJG2 3NZIA 3ZZ7A 3A7XA 2CF9H 4TY7A 1H1BA 4ISIH 4LXBH 1GHVH 3PMJA 4CR5A 2C4FH 5FPYA 3BEIB 3M7UA 3PO1B 1IHSH 5AFZH 2YNAA 3AVZA 1XUKA 2PR3A 2Y81A 3RP2A 3OTJE 2ZPRA 1AFQC 2OCVB 4NZLA 1QIXB 3N7OA 1V2UT 2ZHFH 3OYPA 2OTVA 4B1TA 4RKJB 2VIPA 4X1RU 3ZVEA 3LGTA 1O5FH 1WYKA 1G3DA 3R0FA 3V13A 4XE4A 5DG6A 2W5EA 3K2UA 4R0IA 3EE0B 1MQ6A 3ZYDA 4UFGH 4X6OA 3UQOA 1NESE 4X2YA 1CE5A 1HAOH 4IMZA 1EAXA 1YBWA 2BD7A 2NU0E 1BHXF 2ZA5A 1AB9C 4K3JA 4X2XA 3PTBA 3RXRA 1AWFH 1GMHF 3A8CA 3S7HB 5BPEA 1OWEA 1Z6JH 3LH1A 1BMMH 1VGCB 2O8TA 1AVGH 4YOGA 2GGVB 4LZ1H 3HKJB 3F68H 3TGKE 5L2YH 3WY8A 1BMAA 2ZC9H 4AFSA 4A7IB 1BJUA 4B2CA 1PPEE 1GI5A 3MO6A 2XNIA 2BLQA 4SGBE 1LPZB 4I32A 3GY2A 1GVZA 4GSOA 3LIWA 2FWWA 3FAOA 1H4WA 5E0HA 1AB9B 1TGBA 1AE8H 1P11E 1CT2E 3SJKA 1V2QT 3UOUA 1ZRKA 1WBGB 2FI4E 1BA8B 4NA9H 3VXFH 4JZEH 1CGHA 4Y7BA 1TBRH 1GHXH 1O5EH 1W13U 4UDWH 1AGJA 1ANEA 4WXVA 4ZROA 5JBCS 4RSPA 3A8DA 2R3UA 1IQNA 5FPTA 1O2RA 1ZTKA 3RXFA 4X8SH 1WQVH 3ZZDA 1JWTA 2F3CE 2ANMH 2H9EH 5HM9A 2Q1JA 2UUKB 1YCPH 2ZGJA 1C5OH 3M37A 2G52A 4KKDA 3A8BA 2ZCHP 2EC9H 1T4UH 2ZTYA 5DP5A 4OGYA 5FCRA 1XKAC 3RDZA 1G2MA 1UTOA 2Y80A 1C5PA 4JZDH 2ZI2H 4AZ2B 3D65E 1O2ZA 3KF2A 4HFPB 5GDSH 4B76A 1HRTH 1UTKA 1CGIE 2TGTA 2GT8A 1Y5AT 1MKXK 1DM4B 1ZYOA 3QUMP 1B0EA 2Q6FA 4XDEA 3PLKA 1PPCE 2BX4A 2ZG0H 2BD3A 3LC5A 5T6FA 3KQEA 1PFXC 1E0FD 4AX9H 2P3TB 3GYLB 1Z1JA 1XUJA 4ABJA 1TX8A 2AH4X 6ESTA 2XCNA 2STAE 1D3TB 3VB5A 4DCDA 2XBYA 1AKSA 4UFDH 3RUOA 3SGQE 2ZGHA 4K8YA 1C5WB 1P12E 1C1MA 1LVOA 5EXNA 5A8XA 1C2MA 2HNTC 4ZXYH 7KMEH 5JPMH 1O2GH 3O8BA 3RXUA 3O8CA 1S82A 1C2HA 3TNSA 2ZU5A 3L6PA 4CREA 4D9RA 5C2ZA 3UUZA 1SLXB 1BTWA 3GISB 4YT7H 4MPXA 2QF0A 3GYMA 1ZZZA 2VIDA 1EZUC 4GHTA 3A80A 3UNQA 1GI6A 1W0YH 1GI4A 1V2MT 1HJ9A 3BIVH 4ZUHA 4Y8ZA 2C90B 3GY4A 2G51A 2THFB 1QFKH 1J17T 1A61H 1AE5A 4CHAC 3LKWA 5GWZA 1O34A 3MU4A 2J94A 3MHWU 3SHAH 5C5OA 4TPIZ 1Q2WA 1OP8A 1EATA 2OBOA 2PGQB 2R3YA 3FP7E 3LDXH 1O3DA 1SFQB 1EOJA 1BMNH 2VVUA 2Z9LA 1AQ7A 3A7TA 3UTUH 1QQ4A 2A31A 2TIOA 1GBEA 1KXAA 2BDYA 3OU0A 3ZVGA 2OC7A 2SGEE 4JMYA 1ETRH 2I6SA 1MH0A 2BDCA 4X1NU 3NKKA 2HLCA 4VGCB 2D2DA 5T3HA 2ODQA 1ELBA 3PTNA 1F5LA 1P04A 3HK6B 4X6PA 5F8TA 5GXPA 3U8TH 4CHAB 3UR6A 4J1YA 5EXMA 1O2XA 2G8TA 3RMLH 2W3KA 2Q6GA 1QL7A 1TGCA 4FUEA 1O2HA 5J4QA 2WPHS 2UWLA 4BTIB 1W14U 3SJOA 1YPHE 2HVXA 2XWAA 1K1LA 3BG4C 3GDSA 1TYNA 1VJAU 5DJ7A 1PPBH 1C1NA 1V2TT 4DW2U 1CGJE 2FODA 3ZZ5A 4UE7H 3SV9A 4MG3A 3HPTB 1XXFA 2R2MB 3ZZBA 2ANYA 1FIZA 2J95A 1PQ7A 4KELA 4AB9A 1WCZA 3V7TA 1O2LA 1QURH 3A82A 2OXSA 1EPTA 3A88A 2UUJB 2FTMA 1J9CH 2QGRA 1JIRA 1IQFA 2WINI 1T32A 2ZPQA 2BX3A 4ZKOU 1DANH 1O39A 4UD9H 1X7AC 1SGCA 4ABEA 4Y0YE 2Y5FA 4E05H 3GY6A 4X6NA 1Y5BT 2QF3A 4YOJA 1RXPA 3SOSA 2RG3A 2GVFA 2ZHDA 1V2VT 1DOJA 2B0FA 1XVMA 1DWDH 1EZQA 1FNIA 1P3EA 2SGAA 5LPRA 1GWAA 3I29A 2W26A 3ZVDA 2QXHA 3EDXB 1HB0B 4ZXXH 3GDUA 5C67A 1SOZA 5JBTA 1JRSA 5JYIA 1ELDE 3SU3A 2JETB 3RXGA 2O8LA 1O35A 1GI1A 1NFWA 1ESBA 1BZXE 4DJZB 3BSQA 4JYVH 3CS7A 1MU8B 1F5RA 1O3PB 2CJIA 1CQQA 1QQUA 3QN7A 1H8DH 1P57B 2KAIA 4BXSA 4FVBA 3Q77A 3SU5A 1ETSH 1DITH 1B7XB 1BTUA 3MO9A 4D9QA 4ESTE 1W0ZU 3LGUA 1TWXB 1BUIA 1HXEH 3MU8A 1H8IH 1AKSB 1UVUH 1YPHC 3JZ1B 1BBRH 1TGTA 2G5VA 2FS8A 3DT0H 1TNHA 1VCPA 2BDAA 4HZHA 3A86A 2C3SA 3VB6A 1GCTC 1N8OC 2WYJA 1W7GH 3RU4T 3KEEA 4MDSA 5HM2A 3JZ2B 2CMYA 2GCHG 3K6YA 3E0PB 3F1SB 2ESTE 1GI3A 1V2JT 2ZFRH 1AMHA 2ZKSA 3CS0A 5FAHA 1T7CA 1S6HA 1MZDA 3P95A 3P8NA 2SNVA 1OP2A 4NZQA 1IQMA 1EJMA 2ZPSA 5L2ZH 4FUBA 1LVMA 1GDNA 3URDA 4Y11E 1HAZB 1VJ9U 2WV5A 3F9HA 2XC0A 5FPSA 1GI2A 3T29A 2PKSB 1DE7H 2STBE 5DK1A 2F91A 1E38B 2Z9IA 1GCTB 2QXIA 5JBAS 1DXPA 1N8OB 1Y5UT 2ZZUH 5DP4A 3S9BA 2NU1E 3UQVA 2ZHQH 1GBAA 3SORA 1Y8TA 1LDTT 1UCYK 2Z3EA 1ZJKA 1UTPA 2H2ZA 1EPTC 1GJAB 4NWKA 4U32A 4I33A 1FN8A 2ZFFH 1VITF 3PWCA 2GV6A 1BTPA 3LONA 5GPIB 4GUXA 1MCTA 4Y8YA 2VJ1A 2ZU1A 1RFNA 3VPKA 5JDUB 2P8OC 1ZR0A 1G3EA 4MNYA 4CH8B 1VCWA 1GDQA 1O0DH 1GHBG 3LGYA 1ELCA 3SO3A 1K1PA 1SHYA 4D7FA 4K69A 2BHGA 1WTHD 2PTCE 1TPAE 1GBHA 1O2SA 2RCEA 1K28D 4WVPE 1F2SE 9ESTA 1TE0A 3MI4A 2CF8H 5JB9S 1K1IA 1EKBB 1EPTB 1O3HA 5F6MA 1BB0B 5EXLA 3RXLA 1QRZA 1TGNA 4RKOB 3RXTA 2J34A 4E06H 4NSVA 3S0NA 1RD3B 2H9HA 1DVAH 2AYWA 1EUFA 1GGDB 1A7SA 1ABIH 3BTME 4THNH 3TNTA 2BMGB 1P9SA 1C4V2 2OQUA 1D4PB 1P2OA 1FXYA 4AB8A 3QZQA 1BRBE 1GJ7B 3TPIZ 4DG4A 4GHQA 1C5YB 1OWJA 3MU5A 3GOVB 3LGWA 1C1RA 1LPGB 1PPGE 4J2YB 2A1DB 1NTPA 3P6ZB 2O8UA 5C20A 1C2EA 1P2MA 5C1UA 4A1XA 2A5AA 4QT8C 1QA7A 3LGIA 5FBIA 3KHVA 2FOCA 1IQHA 1O3CA 1GJDB 3QLPH 2VU8E 1O3FA 3ODDA 1E35B 1S5SA 2GD4B 2A5IA 3SU0A 4NA7A 3ATMA 4ZKSU 3UOPA 4A1VA 1XUGA 3KIDU 2GKVE 1Y3WA 3SUEA 1TGSZ 5FCKA 5C1YA 1BTHH 3B8JA 3BTWE 1OOKB 6CHAB 3L33A 2BD4A 3RXMA 5EQRA 4DT7B 1C2DA 1SGDE 3P92A 1YLDA 3BTFE 2BDGA 3LGVA 1TRYA 4IW4E 2AS9A 3PMAB 3RXKA 3RMMH 1GI7B 2GCTB 1K1JA 1MTVA 2PSXA 5T6GA 2Z3CA 4MQAA 1SGNE 1GI0A 4DIIH 2Z9JA 1DY9A 1NFYA 2ZTXA 1O3OA 5A8ZA 3O8RA 3U8RH 2FLBH 3D23A 4U01A 2ANWA 1YKTA 4AGKA 1D3QB 3FANA 1G9IE 1TMBH 1K22H 3HGNA 1FY8E 1OWDA 1BITA 4CRDA 4FUHA 1V2LT 1HAPH 1GDUA 1ELVA 1UTLM 3ZZ6A 2V0BA 1GCDA 3TIUA 2A7HA 2EA3A 1S6FA 4OS2A 2ODYB 3TLOA 5DO4H 4I8LA 1GMHG 3ATLA 1GHAF 1TMUH 3HK3B 3L3TA 2A4RA 1SC8U 2OLGA 1LHCH 1OYTH 4PROA 4BAMB 4Z6AH 1HLTH 2WUCA 1O5AB 2FOEA 4MPVA 2DE8A 1BJVA 2Y7ZA 2OC1A 4JZFH 1QJ1B 4IN2A 2DE9A 2R9PA 3KL6A 4YLQH 3SU1A 3TH3H 1N6XA 1C5RA 1O30A 2HRVA 2P59A 3BTHE 3UFAA 4ABIA 1QGFA 1UO6A 1KLJH 1HXFH 2Z7FE 1ZHPA 1SGQE 2FDAA 1KLTA 3NK8A 3PB1E 2GT7A 2FOBA 5LPEA 4D7GA 2PLXA 1QB9A 1OWHA 2QCYA 4IGDA 2ZECA 2BVXH 1Y3YA 1G36A 3RXIA 3TK6A 5A0CA 2AEIH 1HYLA 5L6NH 1FIWA 3A87A 2FMJA 1AN1E 2WPLS 2VVCA 3IWMA 4TY6A 5EODA 1AFQB 1DY8A 1ZPBA 5TCAA 3Q3KA 1BT7A 2ODPA 1BQYA 1GJCB 4H4FA 1YCPM 2BZ6H 1SVPA 2P95A 2VB0A 1UMAH 1TOCB 1ZHMA 1EP5A 3TITA 2AGGX 3SW2B 2F9UA 4O03A 2BYAX 4I8JA 2P16A 1UVOA 3M5MA 5A2MH 4JK5A 1MTNC 1HUTH 3D49H 4Y76A 1TFXA 3E91A 2AMPA 2ZU3A 1C5SA 2XBVA 3C27B 3T62A 1TA6A 1F92A 2QY0B 1DICA 2VVVA 4X8UH 3A7ZA 1MTSA 3F6UH 1C2LA 1C4U2 4XBCA 1Z8IB 4CRCA 3PYHA 4NFEA 1LHGH 1C1VH 4HTCH 1FONA 2BZAA 1TBQH 3M35A 2TPIZ 1SSXA 1TPPA 4ABHA 2UWPA 4R8TB 1THSH 1LVBA 1GL0E 3LPRA 1EOLA 3NUMA 3RXSA 1P2KA 2ZEBA 4ISOA 3AW1A 3ZVFA 1NS3A 1AZ8A 3MYWA 4AFUA 1O5DH 1W7XH 3PMHB 5A0AE 1CHOF 1MTNB 6GCHF 3AAVA 3ENSB 1OWIA 2EI6A 1IOEA 4Y71A 4U2WA 4XBDA 1C5UA 4OGXA 4ZKNU 1P05A 2YOLA 4BTTB 3M5OA 5AVDA 1F0SA 3GDVA 2YNBA 1VCQA 1UJ1A 4A6LA 2ZHEH 1MCVA 2XRCA 1IQIA 2D26C 4NSYA 2AIPA 1GJ8B 2GTBA 3IG6B 1O2MA 4E7RG 1NRPH 1CA0C 1E37B 2ZU4A 3O8DA 2PTNA 1GI8B 1OP0A 3UNRA 2GZ8A 3M61U 2QYIA 3DUXH 1FY1A 3C1KA 2GV7A 6LPRA 1EAIA 2GX4A 1KIGH 3MU1A 1PJPA 4GAWA 2Y6TA 1ID5H 1ZPCA 3MNCA 1TRMA 5I46H 1QCPA 4DVAU 1EJNA 1QL9A 1EZSC 1L2EA 2J4IA 1YM0A 4IS5A 1SGEE 3TGJE 3LT3A 1KTTB 3SJ9A 5DP9A 3KN2A 3VB7A 1ZMJA 1A3EH 1YF4A 1H9LB 1GBCA 4KP0A 1CA0B 5HGGA 3QO6A 4NWLA 1FV9A 1ELAA 2A4GA 2W3IA 3GICB 2Q6DA 3RC4A 4LOYH 1P02A 4DIHH 3M5NA 3ODFA 3SV2H 1KSNA 1C9TA 4H6TA 1NPMA 5A0BA 4DOQA 5IDKA 2QC2A 1NN6A 1S81A 4WH8A 4JYTA 1K1NA 2FOAA 1HJAC 4NG9H 1THRH 4BOHA 1E34B 1AIXH 3GCTF 1ZMNA 1O3AA 1MBQA 1MKWH 2FI5E 3DFJA 2WPJS 1HAXB 1P09A 4OS1A 1H9HE 2W7UA 3H5CB 1RTFB 3U98H 1V2ST 4BAOB 2O8MA 4IN1A 3U1JB 3SGAE 1QJ6B 1P9UA 4FUJA 3SU4A 4ZHMU 3RXCA 1FY3A 1WUNH 4GVUA 5A8YA 4U30A 1J8AA 3SI3H 2FX6A 4AORA 5I25A 5DGJA 1HFDA 3RU4D 4ZH8A 1FQ3A 5A09A 1TX7A 1KXBA 3ZZ8A 2ALPA 3DFLA 3OY6U 3VGCC 3NXPA 1QL8A 1PYTD 1AUTC 3QX5H 1A0LA 2WYGA 3TK9A 3OSYA 1WU1A 1A5GH 4MNXA 4O97A 2PW8H 4TYDA 1FY5A 1S83A 2UWOA 3W94A 1O2WA 2ZNKH 1S84A 2BQ6B 3P17H 2OINA 3A7YA 2ZIQH 3RXPA 2WPMS 1BRCE 1YCPK 2PKAA 3ATIA 3A83A 3E90B 3RC5A 1XVOA 4GPGA 1ETTH 2WUBA 3T2NA 1ANDA 1MAYA 1LVYA 3ITIA 1Z6EA 1BTZA 2A0QB 3LOXA 1UCYH 1ZSLA 2B5TB 2CHAC 4MLFB 1GBTA 3G01A 1GHWH 1BOQA 1ELFA 1P2JA 2FOGA 1RTKA 2CV3A 3VGCB 1GVLA 3VB4A 3SV6A 3V0XA 4A1TA 1SBWA 3A7VA 2EI8A 4NIWA 1AVXA 2J2UA 5TCCA 1CT4E 2VWOA 1C2JA 5DPAA 2AMQA 1UTQA 3BG4B 2AMDA 2OUAA 3U8OH 1G32B 3ZZ9A 5AFYH 4AGJA 2V6NA 5L30H 2C8YB 3A7WA 1HAVA 1P2IA 9LPRA 3SNDA 2XYAA 3SNEA 4GCHF 2Z94A 4FXGH 2ZU2A 1KXCA 2IN2A 1QTFA 1GMDF 1ELGA 2R0KA 4KTSA 1UK3A 2ZQ2A 3DHKH 4MTBA 2CHAB 3EYDA 4CRFA 2FYQA 1C2IA 2BY5X
chains in the Genus database with same CATH superfamily
1DWBH 1JBUH 4ABFA 1QBVH 2BDIA 1O3MA 2XC5A 4MNVA 1ARBA 2Z9GA 2H5DA 2AGIX 2C8XB 3TJVA 1CHGA 4LK4A 2EI7A 2KCYA 2QV1A 1IQLA 4CBOA 1W0KD 3OY5U 3BTEE 1Z1IA 3M7QA 3V12A 1CT0E 3BTDE 1ZRBA 3Q00A 4INLA 4IMQA 3RXDA 4HI3A 3TJOA 2BY6X 4K60A 3OE7D 1KMHB 1LMWB 1N6YA 4RT0A 1C1QA 1VITG 4FU9A 3RMOH 1WOFA 2FEQH 1EXFA 1OWKA 1YPJH 4B74A 1BTXA 2ZDLA 3M36A 5FHTA 4Z0KA 4B71A 4BAQB 1KXDA 1M9UA 4RN6A 1ZHRA 2XXLA 1SHHB 2ZDVH 5FX6A 1EASA 1PQ8A 3S9CA 3BN9A 4FVDA 4A92A 2C8ZB 4YESB 1TOMH 5EQQA 4FUCA 3UPEA 2F9BH 2NU3E 1BHXB 3AAUA 1ZTLA 1TPOA 3ESTA 1NFUA 1CSOE 4NCYA 2TGAA 2R0LA 2BDHA 3GS9A 1EP6A 2A2QH 1K1OA 1C1PA 2FS9A 5F03A 3T27A 1K1MA 1L1JA 3RC6A 5PTPA 1FUJA 2BQWB 2HPQH 3SI4H 4WWYA 1QNJA 1TX6A 1P8VC 2VWMA 1TNIA 2GZ7A 3BTQE 1PPHE 1C5QA 1DSUA 5EOKA 1ORFA 2WHXA 4UFFH 1RIWC 3PLPA 2XOKD 4ZHLU 1CU1A 1BDAA 4OS4A 1D9IA 1KLIH 3A89A 5EPYA 3RLYH 3RXEA 1MD8A 2CGAA 1C5LH 4MNWA 5GCHF 1Z71A 5DP6A 1SOTA 2PKAB 1EB2A 2IJOB 3Q3XA 2OQ5A 1K9OE 4H42U 1XX9A 3I78A 3KNXA 4OS5A 1UCYE 4YOIA 1SLWB 1V2WT 3EE7A 4ISLA 5EU8A 5TJXA 1DDJA 3DSPA 1F0UA 1YYY1 2XTTB 3QK1A 3A85A 1ELEE 2QIQA 1YP9A 2LPRA 2H5CA 5FX5A 3A8AA 1L1GA 3T26A 4AYYB 1H9IE 1TNJA 3GY8A 4NIXA 1ANCA 3BTKE 1AUJA 2P8OB 2UUYA 3UIRA 3QTVH 5ABWA 3SJIA 1DFPA 4FU8A 4BANB 2FM2A 1AHTH 1SQAA 1VITH 2HWLB 1HAVB 1J14A 1QRWA 2AERH 8KME2 1BBRK 4BNRA 1GBLA 3RXOA 1YLCA 4JZ1A 3UAIC 1TBZH 2FXRA 1SGFA 1IQKA 1F7ZA 2AGEX 1QY6A 2DUCA 1ACBE 2KAIB 3D62A 2W6ID 1GJ5H 1O32A 5AHGH 3RXAA 3ZZ4A 1OS8A 3RLWH 1AD8H 2F9OA 3GY5A 4JYUH 3B9FH 1SPJA 8ESTE 2ANKH 1NZQH 1MD7A 5K0HA 2QA9E 3AK5A 1BRAA 3FKSD 4KGAA 2ZGXH 2FYRA 1J16A 1DLKB 2W7SA 1CA8B 1ZPZA 3E16B 5C5NA 1LTOA 4BAHB 1GBKA 4XSKU 1GHAG 1YPGH 3T28A 3BF6H 4IBLH 3PROA 2BTCE 4ZHAA 2BY7X 4ABDA 3SGBE 3F9FA 3ZVAA 3T5FH 2P3FH 5KECA 1MUEB 4X2WA 2ILNA 4AOQA 1BMLA 5EG4A 1C1UH 2K0QA 1EB1H 2ZTZA 3ZZ3A 1TNLA 1Q31A 3AW0A 5EIYA 5ESBA 1HGTH 1WAYB 4TT3D 5E2PA 3VB3A 3KCGH 4ASHA 1TAWA 2FZZA 3TU7H 2BM2A 1S0QA 3QZRA 4XBBA 1C1TA 3SQHE 4ZCNA 1T4VH 1IQEA 4K8BA 3ELAH 1TA2A 2Y82A 1XUFA 3T25A 2XCFA 2D8WA 2FESH 3GY7A 2W6JD 2OC0A 1GMCF 1A0JA 1C1OA 4AFQA 3Q3YA 1RGQA 2FPZA 1V2RT 3F0PA 1E36B 3ZYEA 2PWXA 4O9VA 4GLYA 3FP8E 3M3VA 1O2IA 3SU6A 2RA0A 2M5TA 3GCOA 2Z3DA 3OEHD 4K1EA 1O2UA 3RM0H 2TGPZ 3RXJA 1FX0B 3LJOA 4K5ZA 2ZFSA 2Y7XA 3K6ZA 3SJ8A 4D8NA 2J92A 2C8WB 1DXWA 1IQJA 1YPLH 5LGOA 2VIQA 1S0RA 2OD3B 4HGCA 2UUFB 2HPPH 4X8TH 1MKXH 1GJ6A 3LJJA 3QWCH 4I31A 5F8XA 1F0RA 3TGIE 1TNKA 1Q3XA 3UNSA 3Q76A 1PQAA 2RFKC 4XOJA 4YZUA 1N1LA 3ZZCA 3B23B 5G4BA 1D6WA 1NBMD 3CENA 2ZGBH 4WY3A 1VGCC 4Q7ZA 5SGAE 1VR1H 5LH8A 1GHYH 2G00A 4CR9A 1C5ZB 1KDQA 2D1JA 2ZFTA 1PPZA 1EQ9A 5F53A 4IC5A 2NWNA 1NU9A 2ZDNA 4Q2KA 3FP6E 2FO9A 2ZDMA 3TH4H 1T31A 2BOKA 2XBXA 1C5TA 2F83A 5EW2H 1FPHH 4CRBA 1HJ8A 2PUQH 1O2VA 3P8OA 1TB6H 4INKA 2ASUB 3RU4E 1AU8A 4FUDA 1CHOG 5JBBS 1YPMH 3HATH 3SV7A 6GCHG 3MFJA 3SUFA 1D3DB 1JRTA 4WMDA 3URCA 2OP9A 2A4OA 4K1TA 3UREA 4BXWA 3U9AH 3CP7A 1PQ5A 2ZQ1A 3MNBA 1MAXA 2XWBI 1WV7H 4YT6H 4Q7XA 1GBBA 2GDDA 2C93B 4F49A 1OX1A 2PFEA 1O38A 1TPSA 1O3KA 3QTOH 1QJ7B 2WV9A 4DURA 4NA8A 1O2JA 4NFFA 5EGMA 3F0OA 3EQ0H 2BQ7B 2IPHA 1HCGA 1A3BH 4Y8XA 3ZVCA 3QGJA 2OC8A 2JJ1D 1L4DA 2TGDA 1SQOA 1SGPE 2ZFPH 2G55A 4WXIA 5EW1H 1DS2E 2G4TA 3MH6A 1B5GH 1TMTH 1LHEH 1MQ5A 3W95A 2A2XH 2FOHA 1XUHA 3RXBA 2GP9B 2HNTE 4Q7YA 5H4IB 2BLVA 2ZHWH 3SN8A 2QXJA 2BY9X 1P0SH 1INCA 4AYVB 2BLWA 1C4Y2 1O5CB 4WF8A 5LPFA 1QA0A 3U69H 5EQSA 5E0JA 3E6PH 7GCHG 4X8VH 5FXLA 1NM6A 2A5KA 2PGBB 4X6MA 2ZDAH 1KYNA 1TNGA 1SGTA 3FFGA 1SL3A 1V2KT 4NGAH 4YXWD 1HAYB 1OKXA 3TJUA 1B0FA 2RA3A 1NC6A 1GBFA 3BEFB 5JB8S 3UY9A 3SBKA 2FOMB 1OXGA 5C1XA 1O2OA 3SHCH 1SGIB 2VGCC 2A4QA 1PYTC 4JCNA 5EPNA 4TWWA 3ZV8A 1O2NA 1SLUB 2IOTA 1DWCH 4KTUA 2PHBA 3GCTG 1TRNA 1UTMA 1FZZA 4OS7A 2A45B 4X1PU 1C5MD 3ZVBA 1V3XA 3KGPA 3GCNA 2HGTH 2JH0D 1A0HB 2WZQA 1ZSJA 2VIWA 1NY22 3RM2H 2JH5D 3DD2H 1GBIA 1UK2A 2FOFA 3MH4A 1BTYA 2YMSC 1C5VA 2EY4C 3F2HA 4CRAA 2XBWA 3BG8A 8LPRA 7GCHF 1OYQA 2VH6A 3K9XB 4WH6A 3EGKH 1D3PB 2B7DH 2VGCB 3LC3A 4IC6A 3TK5A 1XUIA 5ETXA 2VINA 1FAKH 1TQ0B 3RXVA 3HKIB 5HXFA 1ESAA 3EAJA 1EJAA 1S85A 2M2AA 2WSSD 4O3UA 1ZGIA 2F9PA 4B75A 4FUIA 3HGPA 1UVPA 3P8FA 2Z9KA 3MNSA 1VZQH 1KY9A 4K2YA 3MH5A 3MNXA 1Z8JB 3SNCA 1KDQB 3RXHA 3MU0A 4VGCC 1LHDH 4ISHH 2JKHA 1MZAA 1T8MA 2BOHB 1C1SA 4ZMAH 1G3CA 1O37A 1FJSA 2OBQA 2ZF0H 3SNAA 3FVFB 2G5NA 1V2NT 3PV4A 1C5XB 1O3BA 2P93A 5J4SA 1TLDA 2A32A 1DWEH 1F5KU 1K2I1 1SFIA 1KTSB 4Y7AA 2QAAA 5CHAC 1LO6A 3M5LA 3E8LA 2V3MA 3VXEH 1HJAB 1Y3UA 4ABBA 2AFQB 3UWJH 5IYTA 4GCHG 1XXDA 3BIUH 1QBNA 4MPWA 3OX7U 1GMDG 1SGFG 1ZOMA 2ULLA 4ISNA 3E3TA 1LQDB 5BRRE 1GHZA 1T8NA 4DY7B 1ZJDA 2NU2E 1L1NA 1P03A 1AZZA 3SV8A 1T8LA 1GVKB 4O3TA 4Y79A 2H1UA 1O3JA 4F48B 3BTTE 2CXVA 1W10U 1ZSKA 1DX5M 5CHAB 2QF4A 5T6DA 2SFAA 3F9GA 4Y0ZE 1DSTA 1SB1H 2HALA 4B73A 1QBOA 2JETC 1P06A 2PV9B 1FY4A 1TQ7B 3VEQB 1Z8RA 2CN0H 3SUDA 4NIYA 2GDEH 2SGPE 1BIOA 1UHBA 1UK4A 1UVTH 3MOCA 4YTAA 3UR9A 1FDPA 1FMGA 2ALVA 2Y5HA 3TH2H 1G37A 5HYOA 1SI5H 4X1SU 1Y3XA 7LPRA 3GY3A 2IJD1 1DUAA 1EAWA 1YPKH 2V7QD 1AI8H 1G30B 4FUFA 4ZKRU 5ESTE 3P8GA 1RS0A 4JZIA 1C2KA 1ZLRA 1G2LA 1W12U 1ZMLA 1K21H 4K1SA 2A7CA 1TABE 2PUXB 1W2KH 1Z7KA 2VWLA 2FIRH 1A4WH 1LQEA 1O3EA 3P70B 4DGJA 1FN6A 2FI3E 2HVYB 3AASA 4BTUB 1EFRD 1JIMA 1IHTH 1NRRH 1SG8B 2FLRH 2P3UB 3PMBB 1RRKA 1V2PT 1MTUA 1ABJH 5CMXH 1SMFE 1O2TA 1HAGE 2XC4A 2I6QA 2QXGA 1NRSH 2Y5GA 2FX4A 5HMAA 1CVWH 1ZGVA 1QRXA 1SLVB 1MTWA 4E7NA 1U6QA 1QR3E 1MKWK 3ZZAA 3ATKA 2HOBA 3MMGA 3QGNB 1LKBA 1NFXA 1C1WH 1THPB 2ZO3H 1ELTA 4SGAE 3I77A 1AVWA 1D6RA 4AN7A 2PKSC 4I8KA 4INHA 1JOUB 1HBTH 3FO8D 2LP6A 1GJ4H 3H7TA 3PLBA 1FPCH 1HIAA 1NRNH 1ANBA 2F9VA 3EA9A 4X1QU 4B6EA 3V3MA 1UVSH 3RMNH 4XFQA 1FI8A 2XW9A 4YO9A 5GCHG 2F9NA 2TRMA 7ESTE 2O9QA 3OFND 5DP3A 3S7KB 4AG1A 1NRQH 2A7JA 1L4ZA 4X2VA 1W0JD 4H6SB 1O5GH 1NU7B 3MWIU 2GMTC 4YM9A 2J38A 1JMOH 2ZGCA 1OSSA 2ZDKA 2VIOA 3LU9B 3R3GB 1JXPA 3MTYA 1O36A 4XRNA 3STJA 2ZFQH 2BB4A 4AFZA 1AY6H 4F55A 2J98A 1G3BA 2K1QA 1KXEA 1IAUA 1MMJN 1CO7E 3F9EA 1C9PA 4B2AA 4FUGA 2GZ9A 1Z8GA 4DT4A 1ZTJA 3E0NB 1W8BH 1O31A 4KTCA 5HIZA 1KXFA 1HAIH 3KQDA 1HAHH 5DSFA 4FU7A 4ABGA 4D76A 2VIVA 3ZV9A 1P10A 2WPKS 1L0ZA 4UONA 2GMTB 3M3TA 1QHRB 3LH3A 4A5TS 4ASUD 1C2GA 1Y59T 1EAUA 2GCHF 2H6MA 2ZCKP 3EA7A 4Q63A 3KQCA 1NBME 1OPHB 4OS6A 4MPUA 1GGDC 3EA8A 4ZAEA 2BY8X 4UFEH 1H8ED 1YGCH 1DLEA 1SGRE 1LKAA 5B6OA 2AHME 3QDZB 4TWYA 3U1IB 4BAKB 3SZEA 2HNTF 4Y6DA 1RIWB 4I8HA 1WSSH 2R2WU 1V6DA 2BXUH 2V3OH 5E0GA 3RXQA 4CBNA 1F0TA 2EQNA 1XKBC 4JK6A 1UHBB 1GL1A 3TJNA 1W3CA 1TONA 2NU4E 2VWNA 2KCOA 1BCUH 2BVRH 2KFWA 3SUGA 4WMEA 1GI9B 1FLEE 2KZ4A 1W11U 2Z6BD 4Y10E 5GIBA 2AIQA 2SGQE 1WTGH 1GG6C 1NROH 4P02A 2H9TH 1SR5C 1XMNB 3NPSA 1DUEA 8GCHG 2SNWA 1UTJA 1NT1A 1DT2A 1GBJA 2O8WA 2B8OH 1BRUP 4CH2B 3M3SA 5K7RA 1V2OT 4AG2A 4I7YH 1DPOA 3E1XB 3S69A 1HPGA 1QB1A 3DA9B 2SGDE 3FZZA 1AFEH 2J9NA 5CE1A 3FZDA 3BV9B 4ABAA 1XM1A 3SQEE 3GCHC 3H09A 6CHAC 3IITA 1UTNA 1O2QA 2G4UA 1MBMA 1ARCA 1GHBF 1GPZA 5CHBA 3NWUA 1AO5A 1O33A 5AF9H 3H7OA 1RJXB 1EX3A 1J15A 3PM3A 4AC9A 4TPYA 1GMCG 2GCTC 3WW7A 1HDTH 2HLDD 2LNCA 4UEHH 3NCLA 1GJ9B 1RTLA 2SGFE 1A5HA 1P2QA 3S9AA 1O2YA 3SNBA 1GBMA 1GG6B 1LCYA 4WMFA 1GJBB 1TIOA 2BD2A 1C5NH 1BBRE 4I8GA 2TBSA 2FP7B 2B9LA 2FTLE 2BVSH 3K65B 2JH6D 2BD5A 3MO3A 5DP8A 1CBWC 1O3GA 8GCHF 1YPEH 1SQTA 4YLUA 3GCHB 4FOUC 1WQSA 3SZNA 1HIAB 1A2CH 2BD8A 1A1RA 2ZWLH 1O2KA 4MVNA 1A46H 1ESTA 2VNTA 1LPKB 3M7TA 2QN5T 4B6FA 1SGYE 3PWBA 3STIA 1O5BB 3KQBA 4NIVA 3PO1C 1P2NA 3BEUA 5GJ4B 1O3LA 4CRGA 1HV7A 2BDBA 5C3NA 1FAXA 1NO9H 2ZCLP 2BD9A 2VH0A 4B2BA 5DP7A 1Y3VA 2WPIS 4LZ4B 3TVJB 5FBEA 5E8EH 5DKMA 3SU2A 5F8ZA 2V35A 4Q80A 2EEKA 2BXTH 5E2OA 1MU6B 2PSYA 3ATWA 3A81A 1O3IA 1CBWB 3MH7A 5EJLA 2WV4A 1O2PA 1P3CA 1IQGA 1O3NA 1A5IA 3BTGE 1C2FA 1AWHB 1GBDA 4F4OC 1TALA 4M7GA 3UWIA 3VFEA 1LHFH 3A84A 2G81E 2ZP0H 3MQKC 4X0WU 1QB6A 2V3HH 1EZXC 1YC0A 1P01A 2BLOA 1PPFE 1T8OA 2P94A 2RDLA 1HNEE 4WJG2 3NZIA 3ZZ7A 3A7XA 2CF9H 3OEED 4P00A 4TY7A 1H1BA 4ISIH 4LXBH 1GHVH 3PMJA 4CR5A 2C4FH 5FPYA 3DSGA 3BEIB 3M7UA 3PO1B 1IHSH 5AFZH 2YNAA 3AVZA 1XUKA 4XD7D 2PR3A 2Y81A 3RP2A 3OTJE 2ZPRA 1AFQC 2OCVB 4NZLA 1QIXB 3N7OA 1V2UT 2ZHFH 3OYPA 2OTVA 4B1TA 4RKJB 2VIPA 4X1RU 3ZVEA 3LGTA 1O5FH 2L74A 1WYKA 1G3DA 3R0FA 3V13A 4XE4A 5DG6A 2W5EA 3K2UA 4R0IA 3EE0B 1MQ6A 3ZYDA 4UFGH 4X6OA 3UQOA 1NESE 4X2YA 1CE5A 1HAOH 4IMZA 1EAXA 1YBWA 2BD7A 2NU0E 1BHXF 2ZA5A 1AB9C 4K3JA 4ACAA 4X2XA 3PTBA 3RXRA 1AWFH 1GMHF 3A8CA 3S7HB 5BPEA 1OWEA 1Z6JH 1WXRA 3LH1A 1BMMH 1VGCB 2O8TA 1AVGH 1K0HA 4YOGA 2GGVB 4LZ1H 3HKJB 3F68H 3TGKE 5L2YH 3WY8A 1BMAA 2ZC9H 4AFSA 4A7IB 1BJUA 4B2CA 1PPEE 1GI5A 3MO6A 2XNIA 2BLQA 4SGBE 1LPZB 4I32A 3GY2A 1GVZA 4GSOA 3LIWA 2FWWA 3FAOA 4OM9A 1H4WA 5E0HA 1AB9B 1TGBA 1AE8H 1P11E 1CT2E 3SJKA 1V2QT 3UOUA 1ZRKA 1WBGB 2FI4E 1BA8B 4NA9H 3VXFH 4M9FA 2JIZD 4JZEH 1CGHA 4Y7BA 1TBRH 1GHXH 1O5EH 1W13U 4UDWH 1AGJA 1ANEA 4WXVA 4ZROA 3WWBA 5JBCS 4RSPA 3A8DA 2R3UA 1IQNA 2K8IA 5FPTA 1O2RA 1ZTKA 3RXFA 4X8SH 1WQVH 3ZZDA 1JWTA 2F3CE 2ANMH 2H9EH 5HM9A 2Q1JA 2UUKB 2KR7A 1YCPH 2ZGJA 3VG8A 1C5OH 3M37A 2G52A 4KKDA 3A8BA 2ZCHP 2EC9H 1T4UH 2ZTYA 5DP5A 4OGYA 5FCRA 1XKAC 3RDZA 1G2MA 1UTOA 2Y80A 1C5PA 4JZDH 2ZI2H 4AZ2B 3D65E 1O2ZA 3KF2A 4HFPB 5GDSH 4B76A 1HRTH 1UTKA 1CGIE 2TGTA 2GT8A 1Y5AT 1MKXK 1DM4B 1ZYOA 3QUMP 1B0EA 2Q6FA 4XDEA 3PLKA 1PPCE 2BX4A 5C0UA 2ZG0H 2BD3A 3LC5A 5T6FA 3KQEA 1PFXC 1E0FD 4AX9H 2P3TB 3GYLB 1Z1JA 1XUJA 4ABJA 1TX8A 2AH4X 6ESTA 2XCNA 2STAE 1D3TB 3VB5A 4DCDA 2XBYA 1AKSA 4UFDH 3RUOA 3SGQE 2ZGHA 4K8YA 1C5WB 1P12E 1C1MA 1LVOA 5EXNA 5A8XA 1C2MA 2IPQX 3NRLA 2HNTC 4ZXYH 7KMEH 5JPMH 1O2GH 3O8BA 3RXUA 3O8CA 1S82A 1C2HA 3TNSA 2ZU5A 3L6PA 4CREA 4D9RA 5C2ZA 3UUZA 1SLXB 1BTWA 3GISB 4YT7H 4MPXA 2QF0A 3GYMA 4ACBA 1ZZZA 2VIDA 1EZUC 4GHTA 3F3BA 3A80A 3UNQA 1GI6A 3OTPA 1W0YH 1GI4A 1V2MT 1HJ9A 3BIVH 2YMSB 4ZUHA 5EJ1A 4Y8ZA 2C90B 3GY4A 2G51A 2THFB 1QFKH 1J17T 1A61H 1AE5A 4CHAC 3LKWA 3PV5A 5GWZA 1O34A 3MU4A 2KX4A 2J94A 3ZIAD 3MHWU 3SHAH 5C5OA 4TPIZ 1Q2WA 1OP8A 1EATA 2OBOA 2PGQB 2R3YA 3FP7E 3LDXH 1O3DA 1SFQB 1EOJA 1BMNH 2VVUA 2Z9LA 1AQ7A 1H8HD 3A7TA 3UTUH 1QQ4A 2A31A 2TIOA 1GBEA 1KXAA 2BDYA 3OU0A 3ZVGA 2OC7A 2SGEE 4JMYA 1ETRH 2I6SA 1MH0A 2BDCA 4X1NU 3NKKA 1E79D 2HLCA 4VGCB 2D2DA 5T3HA 2ODQA 1ELBA 3PTNA 1F5LA 1P04A 3HK6B 4X6PA 5F8TA 5GXPA 3U8TH 1SKYE 4CHAB 3UR6A 4J1YA 5EXMA 1O2XA 2G8TA 3RMLH 5T1VA 2W3KA 2Q6GA 1QL7A 1TGCA 4FUEA 1O2HA 5J4QA 2WPHS 2UWLA 4BTIB 1W14U 3SJOA 1YPHE 2HVXA 2XWAA 1K1LA 3BG4C 3GDSA 1TYNA 1VJAU 5DJ7A 1PPBH 1C1NA 1V2TT 4DW2U 1CGJE 2FODA 3ZZ5A 4UE7H 3SV9A 4MG3A 3HPTB 1XXFA 2R2MB 3ZZBA 2ANYA 1FIZA 2GJGA 2J95A 1PQ7A 4KELA 4AB9A 1WCZA 3V7TA 1O2LA 1QURH 3A82A 2OXSA 1EPTA 3A88A 2UUJB 2FTMA 1J9CH 2QGRA 1JIRA 1IQFA 2WINI 1T32A 2ZPQA 2BX3A 4ZKOU 1DANH 1O39A 4UD9H 1X7AC 1SGCA 4ABEA 4Y0YE 2Y5FA 4E05H 3GY6A 4X6NA 1Y5BT 2QF3A 4YOJA 1RXPA 3SOSA 2RG3A 2GVFA 2ZHDA 1V2VT 1DOJA 2B0FA 1XVMA 5EJZA 1DWDH 1EZQA 1FNIA 1P3EA 2SGAA 2KM0A 5LPRA 1GWAA 3I29A 3N99A 2W26A 3ZVDA 2QXHA 3EDXB 3KYGA 1HB0B 4ZXXH 3GDUA 5C94A 5C67A 1SOZA 5JBTA 1JRSA 5JYIA 1ELDE 3SU3A 2JETB 3RXGA 1O35A 1NFWA 1GI1A 2O8LA 1ESBA 1BZXE 4DJZB 3BSQA 4JYVH 3CS7A 1MU8B 1F5RA 1O3PB 2CJIA 1CQQA 1QQUA 3QN7A 2J5UA 1H8DH 1P57B 2KAIA 4BXSA 4FVBA 3Q77A 3SU5A 1ETSH 1SQRA 1DITH 1B7XB 1BTUA 3MO9A 4D9QA 4ESTE 1W0ZU 5KEDA 3LGUA 1TWXB 1BUIA 1HXEH 3MU8A 1H8IH 1AKSB 3OAAD 1UVUH 1YPHC 3JZ1B 1BBRH 1TGTA 2G5VA 2FS8A 3DT0H 1TNHA 1VCPA 2BDAA 2CK3D 4HZHA 3A86A 2C3SA 3VB6A 1GCTC 1N8OC 2WYJA 1W7GH 3RU4T 3KEEA 4MDSA 5HM2A 3JZ2B 2CMYA 2GCHG 3SYJA 3K6YA 2PP6A 3E0PB 3F1SB 2ESTE 1GI3A 1V2JT 2ZFRH 1AMHA 2ZKSA 3CS0A 5FAHA 1T7CA 1S6HA 1MZDA 3P95A 3P8NA 2SNVA 1OP2A 4NZQA 1IQMA 1EJMA 2ZPSA 5L2ZH 4FUBA 1LVMA 1GDNA 3URDA 4Y11E 1HAZB 1VJ9U 2WV5A 3F9HA 2XC0A 5FPSA 1GI2A 3T29A 2PKSB 1DE7H 2STBE 5DK1A 2F91A 1E38B 5C17A 2Z9IA 1GCTB 2QXIA 5JBAS 1DXPA 1N8OB 1Y5UT 2ZZUH 5DP4A 3S9BA 2NU1E 3UQVA 2ZHQH 1GBAA 3SORA 1Y8TA 1LDTT 1UCYK 2Z3EA 1ZJKA 5HIYA 1UTPA 2H2ZA 1EPTC 1GJAB 4NWKA 3KQ5A 4U32A 4I33A 1FN8A 2ZFFH 2OK5A 1VITF 3PWCA 2GV6A 1BTPA 3LONA 5GPIB 4GUXA 1MCTA 4Y8YA 2VJ1A 3UB0A 2ZU1A 1RFNA 3VPKA 5JDUB 2P8OC 1ZR0A 1G3EA 4MNYA 2F43B 4CH8B 1OHHD 1VCWA 1GDQA 1O0DH 1GHBG 3LGYA 1ELCA 5GNDA 3SO3A 1K1PA 1SHYA 4D7FA 4K69A 2BHGA 1WTHD 2PTCE 1TPAE 1GBHA 1O2SA 2RCEA 1K28D 4WVPE 1F2SE 3FOAA 9ESTA 1TE0A 3MI4A 2CF8H 5JB9S 1K1IA 1EKBB 1EPTB 1O3HA 5F6MA 1BB0B 5EXLA 3RXLA 1QRZA 1TGNA 4RKOB 3RXTA 2J34A 4E06H 4NSVA 3S0NA 1RD3B 2H9HA 4TSFD 1DVAH 2AYWA 1EUFA 1GGDB 1A7SA 1ABIH 3BTME 3DSOA 4THNH 3TNTA 2BMGB 1P9SA 1C4V2 2OQUA 1D4PB 1P2OA 1VKYA 1FXYA 4AB8A 3QZQA 1BRBE 1GJ7B 3TPIZ 4DG4A 4GHQA 1C5YB 1OWJA 3MU5A 3GOVB 3LGWA 1C1RA 1LPGB 1PPGE 1YLNA 4J2YB 5DN6D 2A1DB 1NTPA 3P6ZB 2O8UA 5C20A 1C2EA 1P2MA 5C1UA 4A1XA 2A5AA 4QT8C 1QA7A 3LGIA 5FBIA 3KHVA 2FOCA 1IQHA 1O3CA 1GJDB 3PRDA 3QLPH 2VU8E 1O3FA 3ODDA 1E35B 1S5SA 2GD4B 1WDIA 2A5IA 3SU0A 4NA7A 3ATMA 4ZKSU 3UOPA 4A1VA 1XUGA 3KIDU 2GKVE 1Y3WA 3SUEA 1TGSZ 5FCKA 5C1YA 1BTHH 3B8JA 3BTWE 1OOKB 6CHAB 3L33A 2BD4A 3RXMA 5EQRA 4DT7B 5HKKD 1C2DA 1SGDE 3P92A 1YLDA 3BTFE 2BDGA 3LGVA 1TRYA 4IW4E 2AS9A 3PMAB 3RXKA 1COWD 3RMMH 1GI7B 2GCTB 1K1JA 1MTVA 2PSXA 5T6GA 2Z3CA 4MQAA 1SGNE 2JDID 1GI0A 4DIIH 2Z9JA 1DY9A 1NFYA 2ZTXA 1O3OA 5A8ZA 3O8RA 3U8RH 2FLBH 3D23A 4U01A 3F2GA 2ANWA 1YKTA 4AGKA 5CDFE 2WPDD 1D3QB 3FANA 1G9IE 1TMBH 1K22H 2J98B 3HGNA 1FY8E 1OWDA 1BITA 4CRDA 4FUHA 1V2LT 1HAPH 1GDUA 1ELVA 1UTLM 3ZZ6A 2V0BA 1YWUA 1GCDA 3TIUA 2A7HA 2EA3A 1S6FA 4OS2A 2ODYB 3TLOA 5DO4H 4I8LA 1GMHG 3ATLA 1GHAF 1TMUH 3HK3B 3L3TA 2A4RA 1SC8U 2OLGA 1LHCH 1OYTH 4PROA 4BAMB 4Z6AH 1HLTH 2WUCA 1O5AB 2FOEA 4MPVA 2DE8A 1BJVA 1UW7A 2Y7ZA 2KCPA 2OC1A 4JZFH 1QJ1B 3DCLA 2QE7D 4IN2A 3N7EA 2DE9A 2R9PA 3KL6A 3N7DA 4YLQH 3SU1A 3TH3H 1N6XA 1C5RA 1O30A 2HRVA 2P59A 3BTHE 3UFAA 4ABIA 1QGFA 1E1QD 1UO6A 1KLJH 1HXFH 2Z7FE 1ZHPA 1SGQE 2FDAA 1KLTA 3NK8A 3PB1E 2GT7A 2FOBA 5LPEA 2RDEA 4D7GA 2PLXA 1QB9A 1OWHA 2QCYA 4IGDA 2ZECA 2BVXH 1Y3YA 1G36A 3RXIA 3TK6A 5A0CA 2AEIH 1HYLA 5L6NH 1FIWA 3A87A 3U28C 2FMJA 1AN1E 2WPLS 2VVCA 3IWMA 4TY6A 5EODA 1AFQB 1DY8A 1ZPBA 5TCAA 3Q3KA 4Z1MD 2ODPA 1BQYA 1GJCB 1BT7A 3PV2A 4H4FA 1YCPM 2BZ6H 1SVPA 2P95A 2VB0A 1UMAH 1TOCB 1ZHMA 1EP5A 3TITA 2JJ2D 2AGGX 3SW2B 2F9UA 4O03A 2BYAX 4I8JA 2P16A 1UVOA 3M5MA 5A2MH 4JK5A 1MTNC 3CNRA 1HUTH 3D49H 4Y76A 1TFXA 3E91A 2AMPA 2ZU3A 1C5SA 2XBVA 3C27B 3T62A 1TA6A 1F92A 2QY0B 1DICA 2VVVA 4X8UH 3A7ZA 1MTSA 3F6UH 1C2LA 1C4U2 4XBCA 1Z8IB 4CRCA 4RI0A 3PYHA 4NFEA 1LHGH 1C1VH 1YY3A 4HTCH 1FONA 2BZAA 1TBQH 3M35A 2TPIZ 1SSXA 1TPPA 4ABHA 2UWPA 4R8TB 1THSH 3PRBA 1LVBA 1GL0E 3LPRA 1EOLA 3NUMA 3RXSA 1P2KA 2ZEBA 4ISOA 3AW1A 3ZVFA 1NS3A 1AZ8A 3MYWA 4AFUA 1O5DH 1W7XH 3PMHB 4FETA 1CHOF 5A0AE 1MTNB 6GCHF 3AAVA 3ENSB 1OWIA 1BMFD 2EI6A 1IOEA 4Y71A 4U2WA 4XBDA 1C5UA 4OGXA 4ZKNU 3FN8A 1P05A 2YOLA 4BTTB 3M5OA 5AVDA 1F0SA 3GDVA 2YNBA 1VCQA 1UJ1A 2LELA 4A6LA 2ZHEH 1MCVA 1MABB 2XRCA 1IQIA 2D26C 4NSYA 2AIPA 1GJ8B 2GTBA 3IG6B 1O2MA 4E7RG 1NRPH 1CA0C 1E37B 2ZU4A 3O8DA 2PTNA 1GI8B 1OP0A 3UNRA 2GZ8A 3M61U 2QYIA 3DUXH 1FY1A 3C1KA 2GV7A 6LPRA 1EAIA 2GX4A 1QZ8A 1KIGH 5B6LA 3MU1A 1PJPA 1E1RD 4GAWA 2Y6TA 1ID5H 1ZPCA 3MNCA 5FL7D 1TRMA 5I46H 1QCPA 4DVAU 1EJNA 1QL9A 1EZSC 1L2EA 2J4IA 1YM0A 4IS5A 1SGEE 3TGJE 3LT3A 1KTTB 3SJ9A 4HG6A 5DP9A 3KN2A 3VB7A 1ZMJA 1A3EH 1YF4A 1H9LB 1GBCA 4KP0A 1CA0B 5HGGA 3QO6A 4NWLA 1FV9A 1ELAA 2A4GA 2W3IA 3GICB 2Q6DA 3RC4A 2J97A 4LOYH 4RT1A 1P02A 4DIHH 3M5NA 3ODFA 3SV2H 1KSNA 1C9TA 2KCAA 4H6TA 1NPMA 5A0BA 2QF5A 4DOQA 5IDKA 2QC2A 1NN6A 1S81A 4WH8A 4JYTA 1K1NA 2FOAA 1HJAC 4NG9H 1THRH 4BOHA 1E34B 1AIXH 3GCTF 1ZMNA 1O3AA 1MBQA 1MKWH 3F2FA 2FI5E 3DFJA 2WPJS 1HAXB 1P09A 4OS1A 1H9HE 2W7UA 3H5CB 1RTFB 3U98H 1V2ST 4BAOB 2O8MA 4IN1A 3U1JB 3SGAE 1QJ6B 1P9UA 4FUJA 3SU4A 4ZHMU 3RXCA 1FY3A 1WUNH 4GVUA 5A8YA 4U30A 1J8AA 3W1EA 3SI3H 2FX6A 4AORA 5I25A 5DGJA 1HFDA 3RU4D 4ZH8A 1FQ3A 5A09A 1TX7A 1KXBA 3ZZ8A 2ALPA 3KYFA 3DFLA 3OY6U 3VGCC 3NXPA 1QL8A 1PYTD 5C0TA 1AUTC 3QX5H 1A0LA 2WYGA 3TK9A 3OSYA 1WU1A 1A5GH 4MNXA 4O97A 2PW8H 4TYDA 1FY5A 1S83A 2UWOA 4I86A 3W94A 1O2WA 2ZNKH 1S84A 2BQ6B 3P17H 3WWFA 2OINA 3A7YA 2ZIQH 3RXPA 2WPMS 1BRCE 1S6LA 1YCPK 2PKAA 3ATIA 3A83A 3E90B 3RC5A 1XVOA 4GPGA 1ETTH 2WUBA 3T2NA 1ANDA 2YMSD 1MAYA 1LVYA 3ITIA 1Z6EA 1BTZA 2A0QB 3LOXA 1UCYH 1ZSLA 2B5TB 2CHAC 4MLFB 1GBTA 3G01A 1GHWH 1BOQA 1ELFA 1P2JA 2FOGA 1RTKA 2CV3A 3VGCB 1GVLA 3VB4A 3SV6A 3V0XA 4A1TA 1SBWA 3A7VA 2VBCA 2EI8A 4NIWA 2XNDD 1AVXA 2J2UA 5IK2D 5TCCA 1CT4E 2VWOA 1C2JA 5DPAA 2AMQA 1UTQA 3BG4B 2AMDA 2OUAA 3U8OH 1G32B 2F4LA 3ZZ9A 5AFYH 4AGJA 2V6NA 5L30H 2C8YB 3A7WA 1HAVA 1P2IA 9LPRA 3SNDA 2XYAA 3SNEA 4GCHF 2Z94A 4FXGH 2ZU2A 1KXCA 2IN2A 1QTFA 1GMDF 1ELGA 2R0KA 4KTSA 1UK3A 2ZQ2A 3DHKH 4MTBA 2CHAB 5KGOA 3EYDA 4CRFA 2FYQA 4Q4LA 2L6OA 1C2IA 2BY5X
chains in the Genus database with same CATH topology
1DWBH 1JBUH 4ABFA 1QBVH 2BDIA 1O3MA 2XC5A 4MNVA 1ARBA 2Z9GA 2H5DA 2AGIX 2C8XB 3TJVA 1CHGA 4LK4A 2EI7A 2QV1A 1IQLA 4CBOA 3OY5U 3BTEE 1Z1IA 3M7QA 3V12A 1CT0E 3BTDE 1ZRBA 3Q00A 4INLA 4IMQA 3RXDA 4HI3A 3TJOA 2BY6X 4K60A 1LMWB 1N6YA 1C1QA 1VITG 4FU9A 3RMOH 1WOFA 2FEQH 1EXFA 1OWKA 1YPJH 4B74A 1BTXA 2ZDLA 3M36A 5FHTA 4Z0KA 4B71A 4BAQB 1KXDA 1M9UA 4RN6A 1ZHRA 2XXLA 1SHHB 2ZDVH 5FX6A 1EASA 1PQ8A 3S9CA 3BN9A 4FVDA 4A92A 2C8ZB 4YESB 1TOMH 5EQQA 4FUCA 3UPEA 2F9BH 2NU3E 1BHXB 3AAUA 1ZTLA 1TPOA 3ESTA 1NFUA 1CSOE 4NCYA 2TGAA 2R0LA 2BDHA 1EP6A 2A2QH 1K1OA 1C1PA 2FS9A 5F03A 3T27A 1K1MA 1L1JA 3RC6A 5PTPA 1FUJA 2BQWB 2HPQH 3SI4H 4WWYA 1QNJA 1TX6A 1P8VC 2VWMA 1TNIA 2GZ7A 3BTQE 1PPHE 1C5QA 1DSUA 5EOKA 1ORFA 4UFFH 1RIWC 3PLPA 4ZHLU 1CU1A 1BDAA 4OS4A 1D9IA 1KLIH 3A89A 5EPYA 3RLYH 3RXEA 1MD8A 2CGAA 1C5LH 4MNWA 5GCHF 1Z71A 5DP6A 1SOTA 2PKAB 1EB2A 2IJOB 3Q3XA 2OQ5A 1K9OE 4H42U 1XX9A 3I78A 3KNXA 4OS5A 1UCYE 4YOIA 1SLWB 1V2WT 4ISLA 5EU8A 5TJXA 1DDJA 1F0UA 1YYY1 2XTTB 3QK1A 3A85A 1ELEE 2QIQA 1YP9A 2LPRA 2H5CA 5FX5A 3A8AA 1L1GA 3T26A 4AYYB 1H9IE 1TNJA 3GY8A 4NIXA 1ANCA 3BTKE 1AUJA 2P8OB 2UUYA 3UIRA 3QTVH 5ABWA 3SJIA 1DFPA 4FU8A 4BANB 2FM2A 1AHTH 1SQAA 1VITH 2HWLB 1HAVB 1J14A 1QRWA 2AERH 8KME2 1BBRK 4BNRA 1GBLA 3RXOA 1YLCA 4JZ1A 1TBZH 2FXRA 1SGFA 1IQKA 1F7ZA 2AGEX 1QY6A 2DUCA 1ACBE 2KAIB 3D62A 1GJ5H 1O32A 5AHGH 3RXAA 3ZZ4A 1OS8A 3RLWH 1AD8H 2F9OA 3GY5A 4JYUH 3B9FH 1SPJA 8ESTE 2ANKH 1NZQH 1MD7A 5K0HA 2QA9E 1BRAA 4KGAA 2ZGXH 2FYRA 1J16A 1DLKB 2W7SA 1CA8B 1ZPZA 3E16B 5C5NA 1LTOA 4BAHB 1GBKA 4XSKU 1GHAG 1YPGH 3T28A 3BF6H 4IBLH 3PROA 2BTCE 4ZHAA 2BY7X 4ABDA 3SGBE 3F9FA 3ZVAA 3T5FH 2P3FH 1MUEB 4X2WA 2ILNA 4AOQA 1BMLA 5EG4A 1C1UH 1EB1H 2ZTZA 3ZZ3A 1TNLA 1Q31A 3AW0A 5ESBA 1HGTH 1WAYB 5E2PA 3VB3A 3KCGH 4ASHA 1TAWA 2FZZA 3TU7H 2BM2A 1S0QA 3QZRA 4XBBA 1C1TA 3SQHE 1T4VH 1IQEA 4K8BA 3ELAH 1TA2A 2Y82A 1XUFA 3T25A 2XCFA 2D8WA 2FESH 3GY7A 2OC0A 1GMCF 1A0JA 1C1OA 4AFQA 3Q3YA 1RGQA 2FPZA 1V2RT 1E36B 3ZYEA 2PWXA 4O9VA 4GLYA 3FP8E 3M3VA 1O2IA 3SU6A 2RA0A 2M5TA 3GCOA 2Z3DA 4K1EA 1O2UA 3RM0H 2TGPZ 3RXJA 3LJOA 4K5ZA 2ZFSA 2Y7XA 3K6ZA 3SJ8A 4D8NA 2J92A 2C8WB 1DXWA 1IQJA 1YPLH 5LGOA 2VIQA 1S0RA 2OD3B 4HGCA 2UUFB 2HPPH 4X8TH 1MKXH 1GJ6A 3LJJA 3QWCH 4I31A 5F8XA 1F0RA 3TGIE 1TNKA 1Q3XA 3UNSA 3Q76A 1PQAA 4XOJA 4YZUA 1N1LA 3ZZCA 3B23B 5G4BA 1D6WA 3CENA 2ZGBH 4WY3A 1VGCC 4Q7ZA 5SGAE 1VR1H 5LH8A 1GHYH 2G00A 4CR9A 1C5ZB 1KDQA 2D1JA 2ZFTA 1PPZA 1EQ9A 4IC5A 2NWNA 1NU9A 2ZDNA 4Q2KA 3FP6E 2FO9A 2ZDMA 3TH4H 1T31A 2BOKA 2XBXA 1C5TA 2F83A 5EW2H 1FPHH 4CRBA 1HJ8A 2PUQH 1O2VA 3P8OA 1TB6H 4INKA 2ASUB 3RU4E 1AU8A 4FUDA 1CHOG 5JBBS 1YPMH 3HATH 3SV7A 6GCHG 3MFJA 3SUFA 1D3DB 1JRTA 4WMDA 3URCA 2OP9A 2A4OA 4K1TA 3UREA 4BXWA 3U9AH 3CP7A 1PQ5A 2ZQ1A 3MNBA 1MAXA 2XWBI 1WV7H 4YT6H 4Q7XA 1GBBA 2GDDA 2C93B 4F49A 1OX1A 2PFEA 1O38A 1TPSA 1O3KA 3QTOH 1QJ7B 4DURA 4NA8A 1O2JA 4NFFA 5EGMA 3EQ0H 2BQ7B 2IPHA 1HCGA 1A3BH 4Y8XA 3ZVCA 3QGJA 2OC8A 1L4DA 2TGDA 1SQOA 1SGPE 2ZFPH 2G55A 4WXIA 5EW1H 1DS2E 2G4TA 3MH6A 1B5GH 1TMTH 1LHEH 1MQ5A 3W95A 2A2XH 2FOHA 1XUHA 3RXBA 2GP9B 2HNTE 4Q7YA 5H4IB 2BLVA 2ZHWH 3SN8A 2QXJA 2BY9X 1P0SH 1INCA 4AYVB 2BLWA 1C4Y2 1O5CB 4WF8A 5LPFA 1QA0A 3U69H 5EQSA 5E0JA 3E6PH 7GCHG 4X8VH 5FXLA 1NM6A 2A5KA 2PGBB 4X6MA 2ZDAH 1KYNA 1TNGA 1SGTA 3FFGA 1SL3A 1V2KT 4NGAH 1HAYB 1OKXA 3TJUA 1B0FA 2RA3A 1NC6A 1GBFA 3BEFB 5JB8S 3UY9A 3SBKA 2FOMB 1OXGA 5C1XA 1O2OA 3SHCH 1SGIB 2VGCC 2A4QA 1PYTC 4JCNA 5EPNA 4TWWA 3ZV8A 1O2NA 1SLUB 2IOTA 1DWCH 4KTUA 2PHBA 3GCTG 1TRNA 1UTMA 1FZZA 4OS7A 2A45B 4X1PU 1C5MD 3ZVBA 1V3XA 3KGPA 3GCNA 2HGTH 2JH0D 1A0HB 1ZSJA 2VIWA 1NY22 3RM2H 2JH5D 3DD2H 1GBIA 1UK2A 2FOFA 3MH4A 1BTYA 1C5VA 4CRAA 2XBWA 3BG8A 8LPRA 7GCHF 1OYQA 2VH6A 3K9XB 4WH6A 3EGKH 1D3PB 2B7DH 2VGCB 3LC3A 4IC6A 3TK5A 1XUIA 5ETXA 2VINA 1FAKH 1TQ0B 3RXVA 3HKIB 5HXFA 1ESAA 3EAJA 1EJAA 1S85A 4O3UA 1ZGIA 2F9PA 4B75A 4FUIA 3HGPA 1UVPA 3P8FA 2Z9KA 3MNSA 1VZQH 1KY9A 4K2YA 3MH5A 3MNXA 1Z8JB 3SNCA 1KDQB 3RXHA 3MU0A 4VGCC 1LHDH 4ISHH 2JKHA 1MZAA 1T8MA 2BOHB 1C1SA 4ZMAH 1G3CA 1O37A 1FJSA 2OBQA 2ZF0H 3SNAA 3FVFB 2G5NA 1V2NT 3PV4A 1C5XB 1O3BA 2P93A 5J4SA 1TLDA 2A32A 1DWEH 1F5KU 1K2I1 1SFIA 1KTSB 4Y7AA 2QAAA 5CHAC 1LO6A 3M5LA 3E8LA 3VXEH 1HJAB 1Y3UA 4ABBA 2AFQB 3UWJH 5IYTA 4GCHG 1XXDA 3BIUH 1QBNA 4MPWA 3OX7U 1GMDG 1SGFG 1ZOMA 2ULLA 4ISNA 3E3TA 1LQDB 5BRRE 1GHZA 1T8NA 4DY7B 1ZJDA 2NU2E 1L1NA 1P03A 1AZZA 3SV8A 1T8LA 1GVKB 4O3TA 4Y79A 2H1UA 1O3JA 3BTTE 2CXVA 1W10U 1ZSKA 1DX5M 5CHAB 5T6DA 2SFAA 3F9GA 4Y0ZE 1DSTA 1SB1H 2HALA 4B73A 1QBOA 2JETC 1P06A 2PV9B 1FY4A 1TQ7B 3VEQB 1Z8RA 2CN0H 3SUDA 4NIYA 2GDEH 2SGPE 1BIOA 1UHBA 1UK4A 1UVTH 3MOCA 4YTAA 3UR9A 1FDPA 1FMGA 2ALVA 2Y5HA 3TH2H 1G37A 5HYOA 1SI5H 4X1SU 1Y3XA 7LPRA 3GY3A 1DUAA 1EAWA 1YPKH 1AI8H 1G30B 4FUFA 4ZKRU 5ESTE 3P8GA 1RS0A 4JZIA 1C2KA 1ZLRA 1G2LA 1W12U 1ZMLA 1K21H 4K1SA 2A7CA 1TABE 2PUXB 1W2KH 1Z7KA 2VWLA 2FIRH 1A4WH 1LQEA 1O3EA 3P70B 4DGJA 1FN6A 2FI3E 3AASA 4BTUB 1JIMA 1IHTH 1NRRH 1SG8B 2FLRH 2P3UB 3PMBB 1RRKA 1V2PT 1MTUA 1ABJH 5CMXH 1SMFE 1O2TA 1HAGE 2XC4A 2I6QA 2QXGA 1NRSH 2Y5GA 2FX4A 5HMAA 1CVWH 1ZGVA 1QRXA 1SLVB 1MTWA 4E7NA 1U6QA 1QR3E 1MKWK 3ZZAA 3ATKA 2HOBA 3MMGA 3QGNB 1LKBA 1NFXA 1C1WH 1THPB 2ZO3H 1ELTA 4SGAE 3I77A 1AVWA 1D6RA 4AN7A 2PKSC 4I8KA 4INHA 1JOUB 1HBTH 1GJ4H 3H7TA 3PLBA 1FPCH 1HIAA 1NRNH 1ANBA 2F9VA 3EA9A 4X1QU 3V3MA 1UVSH 3RMNH 4XFQA 1FI8A 2XW9A 4YO9A 5GCHG 2F9NA 2TRMA 7ESTE 2O9QA 5DP3A 3S7KB 4AG1A 1NRQH 2A7JA 1L4ZA 4X2VA 4H6SB 1O5GH 1NU7B 3MWIU 2GMTC 4YM9A 2J38A 1JMOH 2ZGCA 1OSSA 2ZDKA 2VIOA 3LU9B 3R3GB 1JXPA 3MTYA 1O36A 3STJA 2ZFQH 2BB4A 4AFZA 1AY6H 1G3BA 2K1QA 1KXEA 1IAUA 1MMJN 1CO7E 3F9EA 1C9PA 4B2AA 4FUGA 2GZ9A 1Z8GA 1ZTJA 3E0NB 1W8BH 1O31A 4KTCA 1KXFA 1HAIH 3KQDA 1HAHH 4FU7A 4ABGA 4D76A 2VIVA 3ZV9A 1P10A 2WPKS 1L0ZA 4UONA 2GMTB 3M3TA 1QHRB 3LH3A 4A5TS 1C2GA 1Y59T 1EAUA 2GCHF 2H6MA 2ZCKP 3EA7A 3KQCA 1OPHB 4OS6A 4MPUA 1GGDC 3EA8A 4ZAEA 2BY8X 4UFEH 1YGCH 1DLEA 1SGRE 1LKAA 5B6OA 3QDZB 4TWYA 3U1IB 4BAKB 2HNTF 4Y6DA 1RIWB 4I8HA 1WSSH 2R2WU 1V6DA 2BXUH 2V3OH 5E0GA 3RXQA 4CBNA 1F0TA 1XKBC 4JK6A 1UHBB 1GL1A 3TJNA 1W3CA 1TONA 2NU4E 2VWNA 1BCUH 2BVRH 3SUGA 4WMEA 1GI9B 1FLEE 1W11U 2Z6BD 4Y10E 5GIBA 2AIQA 2SGQE 1WTGH 1GG6C 1NROH 2H9TH 1SR5C 1XMNB 3NPSA 1DUEA 8GCHG 2SNWA 1UTJA 1NT1A 1DT2A 1GBJA 2O8WA 2B8OH 1BRUP 4CH2B 3M3SA 5K7RA 1V2OT 4AG2A 4I7YH 1DPOA 3E1XB 3S69A 1HPGA 1QB1A 3DA9B 2SGDE 3FZZA 1AFEH 2J9NA 5CE1A 3FZDA 3BV9B 4ABAA 1XM1A 3SQEE 3GCHC 6CHAC 3IITA 1UTNA 1O2QA 2G4UA 1MBMA 1ARCA 1GHBF 1GPZA 3NWUA 1AO5A 1O33A 5AF9H 3H7OA 1RJXB 1EX3A 1J15A 3PM3A 4TPYA 1GMCG 2GCTC 1HDTH 2LNCA 4UEHH 3NCLA 1GJ9B 1RTLA 2SGFE 1A5HA 1P2QA 3S9AA 1O2YA 3SNBA 1GBMA 1GG6B 1LCYA 4WMFA 1GJBB 1TIOA 2BD2A 1C5NH 1BBRE 4I8GA 2TBSA 2FP7B 2B9LA 2FTLE 2BVSH 3K65B 2JH6D 2BD5A 3MO3A 5DP8A 1CBWC 1O3GA 8GCHF 1YPEH 1SQTA 4YLUA 3GCHB 1WQSA 3SZNA 1HIAB 1A2CH 2BD8A 1A1RA 2ZWLH 1O2KA 4MVNA 1A46H 1ESTA 2VNTA 1LPKB 3M7TA 2QN5T 1SGYE 3PWBA 3STIA 1O5BB 3KQBA 4NIVA 3PO1C 1P2NA 3BEUA 5GJ4B 1O3LA 4CRGA 1HV7A 2BDBA 5C3NA 1FAXA 1NO9H 2ZCLP 2BD9A 2VH0A 4B2BA 5DP7A 1Y3VA 2WPIS 4LZ4B 3TVJB 5FBEA 5E8EH 5DKMA 3SU2A 5F8ZA 2V35A 4Q80A 2EEKA 2BXTH 5E2OA 1MU6B 2PSYA 3ATWA 3A81A 1O3IA 1CBWB 3MH7A 2WV4A 1O2PA 1P3CA 1IQGA 1O3NA 1A5IA 3BTGE 1C2FA 1AWHB 1GBDA 4F4OC 1TALA 4M7GA 3UWIA 3VFEA 1LHFH 3A84A 2G81E 2ZP0H 4X0WU 1QB6A 2V3HH 1EZXC 1YC0A 1P01A 2P94A 2BLOA 1PPFE 1T8OA 2RDLA 1HNEE 4WJG2 3NZIA 3ZZ7A 3A7XA 2CF9H 4TY7A 1H1BA 4ISIH 4LXBH 1GHVH 3PMJA 4CR5A 2C4FH 5FPYA 3BEIB 3M7UA 3PO1B 1IHSH 5AFZH 2YNAA 3AVZA 1XUKA 2PR3A 2Y81A 3RP2A 3OTJE 2ZPRA 1AFQC 2OCVB 4NZLA 1QIXB 3N7OA 1V2UT 2ZHFH 3OYPA 2OTVA 4B1TA 4RKJB 2VIPA 4X1RU 3ZVEA 3LGTA 1O5FH 1WYKA 1G3DA 3R0FA 3V13A 4XE4A 5DG6A 2W5EA 3K2UA 4R0IA 3EE0B 1MQ6A 3ZYDA 4UFGH 4X6OA 3UQOA 1NESE 4X2YA 1CE5A 1HAOH 4IMZA 1EAXA 1YBWA 2BD7A 2NU0E 1BHXF 2ZA5A 1AB9C 4K3JA 4X2XA 3PTBA 3RXRA 1AWFH 1GMHF 3A8CA 3S7