2WV4A

Crystal structure of foot-and-mouth disease virus 3c protease in complex with a decameric peptide corresponding to the vp1-2a cleavage junction
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
201
Chain Sequence
DLQKMVMGNTKPVELILDGKTVAICCATGVFGTAYLVPRHLFAEKYDKIMLDGRAMTDSDYRVFEFEIKVKGQDMLSDAALMVLHRGNKVRDITKHFRDTARMKKGTPVVGVVNNADVGRLIFSGEALTYKDIVVLMDGDTMPGLFAYKAATRAGYAGGAVLAKDGADTFIVGTHSAGGNGVGYCSCVSRSMLQKMKAHVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PICORNAIN 3C
publication title Insights Into Cleavage Specificity from the Crystal Structure of Foot-and-Mouth Disease Virus 3C Protease Complexed with a Peptide Substrate.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Hydrolase/peptide
total genus 44
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wv4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wv4A01
1CQQA 2ZFSA 5A0BA 1O2YA 1XXDA 1K9OE 1QBVH 4WWYA 3QN7A 1IQEA 5DP8A 5IYTA 2P8OB 1O2ZA 2AS9A 8ESTE 3PROA 1GBLA 4NIYA 4ABJA 1GCDA 1FIZA 4K2YA 2ZIQH 1GBCA 2BYAX 3M7UA 2AIPA 3MFJA 4FUGA 4NSYA 3UOUA 1FPCH 2WPMS 5AVDA 1MTWA 1C2KA 1UVPA 4NIXA 1LMWB 2G00A 1WCZA 1O34A 1LVBA 1MKWK 2BXTH 2ZDLA 3ZZ8A 1ESAA 2ZU1A 3A83A 2YNAA 3VXEH 3LONA 1C5QA 1C2LA 3GCOA 1FY8E 2LNCA 3BN9A 4NIVA 2AERH 5EXNA 4Y10E 1O3KA 1KDQA 5E2PA 1S83A 1C2IA 2UUKB 2NU4E 1C4Y2 1OP0A 1PQ7A 4IW4E 2Z3DA 3NK8A 1SB1H 3ZV8A 5ABWA 1QIXB 1G30B 1Y5UT 4X6MA 1BTYA 2VWOA 5TCCA 1CGHA 2BLWA 1P3EA 1HAZB 1HLTH 4HZHA 4RKJB 1H9HE 4BAOB 3ODDA 3MHWU 1AE8H 2AGIX 1T31A 2LPRA 1A3BH 2ZHEH 1TX8A 1B0FA 5DP3A 4ZHAA 1GJ9B 4ABGA 5JB9S 1J14A 1ZTJA 3DFJA 3SUFA 4J1YA 3RXFA 1QA0A 4KTSA 2XCNA 1RD3B 5LGOA 3RU4E 1ANEA 3PTNA 1A0JA 4F4OC 4TPIZ 4Z6AH 1D4PB 1C2FA 2ODYB 4YOIA 3RC6A 4BXWA 1K28D 2BD9A 4Y71A 1NU9A 1OX1A 2TGPZ 2FS9A 1U6QA 1W7GH 2ZECA 4ISLA 1J17T 5EW1H 2ANMH 4H4FA 1JBUH 1ELEE 1OWKA 1VZQH 3FZDA 2VWLA 2Z3EA 3RC4A 1WAYB 4OGXA 4O3TA 1MKXK 3TK5A 4NIWA 1FXYA 2BY7X 1NESE 1V2KT 1GBHA 2PUQH 2XC5A 3D65E 2FOGA 2V35A 4FUIA 2ZNKH 2QY0B 1W2KH 1BOQA 2HALA 1IQLA 4B1TA 4CREA 1PJPA 1PPBH 3GDSA 2WPKS 1GI2A 4U2WA 1T4UH 2Z6BD 1N6YA 4O3UA 1CSOE 4JYVH 4CRDA 2VVVA 1NRQH 1ETRH 1H8IH 3RXLA 1DT2A 1L2EA 4X1QU 2GT8A 2R3UA 3GYMA 1C2MA 1HFDA 5C3NA 1MH0A 1QL9A 3AAVA 5EXLA 4FUEA 5ESBA 2UWLA 2O8WA 2D26C 4X2XA 3D49H 1FDPA 4UFDH 3SNBA 4IMZA 1GMDF 1O2JA 5C5NA 1GJBB 2F9VA 1C1TA 1E35B 1EZQA 4JZ1A 1FN6A 4CR9A 4M7GA 3E0PB 1RXPA 2M5TA 3T25A 1GI6A 4K1EA 1ELGA 4TWWA 1XUJA 5JBAS 2ZO3H 3M3SA 2VIQA 2KAIB 2GCTC 1CGJE 2ZWLH 3HKIB 2GZ8A 5FBEA 1GCTB 3SOSA 2BQWB 2BVXH 5L2ZH 3P8OA 1KYNA 1ZHMA 1EAUA 3SU4A 5B6OA 3E8LA 4K8BA 1CT0E 4H42U 1MAYA 1WQVH 3QUMP 1GHYH 1FV9A 1H8DH 3PLBA 5GWZA 4UONA 2B9LA 2EA3A 1GJ8B 1BJUA 3S7KB 1WU1A 3W95A 5JBBS 1ZRKA 1GMDG 1NFUA 1PQ8A 3MMGA 5EOKA 3RMOH 1K2I1 1GI8B 2J95A 3A89A 1D6RA 2OBOA 4WVPE 3FP6E 2AMDA 2OQ5A 1C9PA 1TAWA 2NWNA 3CP7A 5DKMA 3F6UH 4D9QA 3PMAB 1B0EA 1NM6A 3GCNA 1TBQH 1O2GH 1SLXB 1UTNA 2PSYA 4BTIB 1O3IA 1F5RA 1MKWH 1C1WH 1EUFA 2AFQB 4JK5A 1OYTH 3MNCA 1FY1A 1UVSH 3E6PH 1O5FH 1KTSB 1SGEE 6GCHF 1EASA 1K1MA 4OS2A 1ZJKA 1O3PB 4CRBA 1H1BA 5G4BA 3GOVB 4BNRA 1SGFA 2ODPA 2VH0A 5H4IB 1SGQE 2CXVA 2UUFB 1H9IE 1Z8GA 4JZDH 3KQEA 4A1VA 2QXIA 3KNXA 2GP9B 3ZZ6A 1DSTA 1LVYA 1ZYOA 3PTBA 3VB3A 1MQ6A 4B73A 2F83A 2QF3A 1INCA 1BBRK 1LVOA 1JIMA 4MPVA 4YT6H 1AFQB 2GZ9A 3EAJA 4I7YH 5E8EH 1F2SE 5T6DA 4MPXA 1AKSA 3AW0A 4AFSA 3I77A 4Y11E 1TFXA 1ABIH 4R8TB 4WH8A 2BZAA 1E36B 3ATWA 1NFWA 1EKBB 3FFGA 1SGFG 3NCLA 6GCHG 1BDAA 1ZJDA 3K2UA 4X6NA 3RM0H 4MNYA 1FNIA 2BOHB 2OQUA 2Z7FE 1OOKB 1HIAA 2FS8A 2ZHFH 1D3PB 1SOTA 5DP5A 4HTCH 1O2LA 1QY6A 3QTVH 4JZIA 3S9BA 1GBAA 4DY7B 1SOZA 2G81E 4FUBA 2XWBI 1UTKA 1EAXA 1C2JA 1DWEH 1DDJA 1W14U 1KLJH 1GDQA 1O3BA 1CA0C 2A4GA 2SNVA 2FPZA 2UWOA 4F49A 2ZU3A 4A92A 1GBMA 1K22H 4DGJA 1A61H 4NFFA 2F9PA 3BEIB 4X0WU 2W7UA 4X1RU 2Z3CA 2AMQA 4E7NA 4A1TA 2CF9H 3BEFB 1DLEA 4ISIH 2G5NA 1LO6A 1ETSH 1GHWH 1RGQA 2PGQB 3MO6A 1NO9H 4YZUA 4JYUH 2PTNA 3F1SB 4BAMB 1O2IA 1OWHA 3SHCH 4MQAA 1YM0A 1P05A 4GCHF 2BX4A 1MCVA 2WYJA 3RXSA 4AX9H 1TA2A 1ELFA 1CGIE 2CJIA 4MPWA 1AI8H 2RDLA 2BLQA 4AFUA 4A7IB 3V7TA 3P8GA 3RXIA 2Q6GA 3LGWA 3SJKA 3ATIA 4AG1A 4Y0ZE 4GPGA 2B8OH 1G9IE 3SU0A 1C2HA 4ASHA 3I78A 1P2MA 2O8LA 4ABDA 4I31A 1ELCA 4MPUA 3QGJA 2QCYA 4E05H 1O2MA 1UHBB 3HKJB 1AE5A 1Q31A 2P93A 3BF6H 5T6FA 4FUDA 5DP7A 3KCGH 1VGCB 1YKTA 5FCRA 1DVAH 4GVUA 3D23A 5PTPA 1O3FA 2W7SA 1GBFA 5GPIB 1GWAA 1P11E 4GCHG 2C4FH 2G55A 1OWDA 2FDAA 1A3EH 2GCTB 1HAOH 3P6ZB 3SU5A 4XBCA 5FCKA 3SJOA 4D76A 1RS0A 2TIOA 1ANBA 3SW2B 1ELTA 4ZKSU 1MUEB 3U69H 1BRBE 2VB0A 1T4VH 1AUJA 1LPGB 1O5AB 4GSOA 3UR9A 1Z71A 3CS0A 4BAHB 3OY6U 3TGIE 3RM2H 1GDUA 2A4OA 1NFXA 3MH7A 1HDTH 5A8XA 1G32B 4ZAEA 1HAGE 2SGQE 2ESTE 3SNAA 2DE9A 2QYIA 1C1UH 1XUFA 2PKSB 1BBRE 5EG4A 5LPRA 2R2WU 4MNXA 3U8OH 3TGKE 3RP2A 4I8LA 4K1SA 1O39A 2P94A 1NU7B 2HOBA 2FMJA 4D9RA 5T6GA 1Z1IA 1HAVB 2ZU4A 1O5BB 3GY2A 4X1PU 1HUTH 1GGDC 1TNLA 3ZVFA 2GT7A 1W0YH 3I29A 2QXGA 1VJAU 1V6DA 2V3HH 4X2YA 1ORFA 2OBQA 2BMGB 1WSSH 2P3FH 3RXJA 1GI3A 1NTPA 3A82A 4WMEA 5EGMA 3RXCA 3BTGE 5CHAC 3SV9A 1C5YB 2TBSA 4FUCA 3TJNA 1W10U 3M5MA 3M35A 3MI4A 4ZXXH 2XRCA 5EODA 1UK4A 3SV8A 4ZKNU 2B5TB 1SGTA 2A7JA 2JETB 1GL1A 5AHGH 4B71A 5F8ZA 1IQHA 4ZH8A 4XBDA 1BBRH 1KY9A 3ITIA 4X8UH 6CHAB 1TIOA 1MD8A 3MYWA 5FAHA 1P2KA 4BTTB 1AZ8A 2A32A 4NA7A 1O2QA 1K1LA 1GJ7B 2A45B 1PPCE 1C9TA 1RTKA 3F9EA 5GJ4B 2ZU5A 1C1RA 1UTJA 1AB9C 1BMMH 1P12E 4NA9H 1H9LB 2XC4A 3A7XA 2AGGX 1GJ4H 3GCHC 1C5SA 1DUAA 1O2UA 2XYAA 3EQ0H 1XXFA 3ATMA 3TU7H 1EXFA 3FP8E 1CA0B 1TGNA 3VPKA 1MQ5A 3TK9A 2Z9GA 3A7YA 3RXAA 2P3UB 4YM9A 1ZMLA 3Q3YA 1OPHB 1LHCH 3VGCC 2BVSH 2VVUA 2HRVA 1KLIH 2A1DB 1Z8RA 1XKAC 4UDWH 1EB1H 2A5KA 3GISB 1LHDH 5L30H 5K7RA 2CHAB 5E0JA 1H4WA 5FX6A 1P09A 2A4QA 1BJVA 3TJUA 3AAUA 3E16B 3KL6A 3TLOA 1AY6H 4K8YA 1S6FA 2WV4A 1O3JA 4AG2A 3BTFE 1YPKH 1TPPA 4WMFA 1NPMA 1GDNA 2H5CA 3PO1B 3KQCA 5JPMH 3A81A 2H1UA 1CHOF 2OD3B 1YPMH 2Y5HA 1ETTH 1BA8B 4OGYA 1LCYA 3U9AH 3HPTB 4INLA 3T28A 3S9CA 2FI4E 3RLWH 3ZZBA 1BZXE 4LOYH 5K0HA 1TPSA 2BDCA 4DOQA 1LKAA 2NU3E 1ZGVA 3STIA 4YESB 3F9FA 2ZGJA 2A2QH 1QFKH 3F9HA 1G2LA 2JKHA 1O2KA 1TMTH 5A8YA 3T2NA 1EJNA 3SI4H 3MWIU 1UTMA 2OCVB 4GHTA 1CHOG 1GI9B 1O2HA 4Q7XA 3SNCA 2WPLS 3VXFH 1BTHH 1TNHA 3BV9B 2W26A 2PKAB 2ZFQH 3BG4C 1DM4B 4CBNA 1QB9A 1A5IA 1MU8B 3RXQA 1ZMNA 4NZLA 2ZQ2A 2KAIA 2ZEBA 2ZHDA 4MNVA 1PFXC 1ACBE 1PPGE 3RXHA 1F92A 2FYQA 3KGPA 1Q2WA 2XNIA 1QR3E 1SFIA 1SLVB 2A7CA 2R0KA 1TGTA 1P3CA 3SNDA 3ZZ9A 2XCFA 2EEKA 2VWNA 3SNEA 3SJ8A 9ESTA 1UMAH 3A8BA 1O3OA 5J4SA 3SUEA 3TJVA 2BZ6H 3ZZAA 1W3CA 4DJZB 1E34B 3KEEA 1IQGA 3ZVAA 1V2TT 1KIGH 1KXAA 5CE1A 1S0QA 2ZC9H 4I32A 1LQDB 4HGCA 2A2XH 5DO4H 1ABJH 2BLOA 1K1PA 3KN2A 1HAXB 3VEQB 5TCAA 4AB8A 3ESTA 5AFZH 1SVPA 1WUNH 3IWMA 1SPJA 2A0QB 3LC5A 1TX6A 2BY6X 3A87A 1C1QA 1ZTKA 2QGRA 2OC8A 3TH2H 1BB0B 1O2VA 2ZCKP 2JH0D 3O8RA 4YLQH 1UTQA 5F03A 1CVWH 1N8OC 4XFQA 1SGNE 1FUJA 1FAXA 3SQEE 4ZKRU 3MNBA 4RSPA 1L4DA 2Y80A 3VB5A 2VH6A 1O30A 1AIXH 1KXBA 2BD7A 3RU4D 3W94A 1YPJH 2GGVB 2FEQH 1O2XA 3TPIZ 1UJ1A 1X7AC 4DT7B 4X1NU 1EP5A 3L3TA 1QNJA 1O2OA 3M5OA 2PGBB 1ESBA 1RTFB 1EPTC 2D2DA 1QL8A 2A31A 3PMJA 1SGDE 1TNGA 2FZZA 2ZF0H 2PWXA 1UO6A 3SUDA 3OSYA 4XOJA 1SG8B 1DWDH 3RXMA 1N6XA 1XMNB 5DP9A 1QB1A 4Y8XA 2VNTA 5FPTA 1ELAA 1SSXA 1BITA 1P8VC 4BAKB 2GMTC 1HNEE 1WTHD 2P95A 3LT3A 2C8XB 3TITA 4ABFA 2C8WB 1L1JA 4Y76A 1CHGA 1V2WT 3V12A 4AB9A 1EOJA 1F0UA 4GLYA 2HPQH 2UWPA 2B0FA 4I8KA 2BM2A 1UVUH 2OC7A 1YGCH 1OKXA 2CN0H 1EAWA 2FI5E 2R0LA 1EZXC 4CH2B 1Y3UA 1TX7A 3ZZ7A 3CENA 2STAE 3UQOA 2FXRA 1ZZZA 2BTCE 1C5WB 1J8AA 1JWTA 4AFQA 1DXPA 2J4IA 3B9FH 1O0DH 4K69A 4INHA 4AZ2B 3SV6A 1XX9A 3WY8A 1SGYE 4IGDA 3ZVGA 1XUGA 1DWBH 1UCYK 1LHFH 2ASUB 2NU2E 1BHXB 4BOHA 4CHAC 3R3GB 4Q7ZA 1CT2E 2Y81A 1P04A 3SHAH 1MAXA 1Y8TA 1LKBA 1OXGA 1NC6A 1Y3WA 1FLEE 2PSXA 1ID5H 1EJAA 1OWEA 3OX7U 1GVLA 2PTCE 3A7VA 4R0IA 1C5PA 3BTHE 3LKWA 2K1QA 1UVOA 2V3OH 3UREA 4DG4A 1DICA 1B7XB 2ZTXA 1TNJA 1TNIA 3SO3A 1C5TA 1UTPA 4DURA 2ZFRH 1WV7H 1P2IA 3A86A 3U98H 1UHBA 4YLUA 2FTMA 1O31A 3ATKA 4Z0KA 1DXWA 2TPIZ 1XUHA 1QA7A 1AO5A 3M3VA 3SU6A 3LJJA 4DIHH 1TBRH 1T32A 1C5VA 1BTZA 5DG6A 4LZ1H 2H9TH 3SN8A 1S84A 2Y7XA 1JIRA 4KTCA 1RJXB 1MTVA 2J94A 4X6OA 3L6PA 1O2PA 4X6PA 2VU8E 1IQKA 4JZFH 1C5OH 1FMGA 2FTLE 1O3NA 2SFAA 2W3IA 3BG8A 1CT4E 1G2MA 1O36A 2XWAA 3E3TA 3B23B 3R0FA 1J15A 1SMFE 5GXPA 3KQDA 1C4V2 2ZFFH 2AMPA 1MD7A 1P10A 3BTKE 1FPHH 3P8NA 3UFAA 1G37A 1GVKB 5FHTA 2A7HA 2PUXB 2VGCC 4U01A 5FXLA 1C1SA 4LZ4B 4AGKA 3RMNH 3VFEA 1O3LA 5A0AE 3FVFB 4NG9H 1BRUP 1TWXB 1EZSC 3N7OA 5F6MA 4FU8A 3LJOA 1KSNA 2FODA 1TMUH 1V2QT 4X8SH 1P2QA 5L6NH 1JXPA 2F9UA 4GAWA 1N8OB 4JCNA 2O8TA 4FUHA 2C3SA 1P06A 4PROA 1HAVA 1QQ4A 1O3CA 1V2PT 3FANA 2BDYA 3ODFA 2Y5GA 3SU2A 2J34A 1GG6C 3QZRA 4UFEH 2Y5FA 3QZQA 1OP8A 1AQ7A 1DANH 2F9OA 4ABBA 5C1UA 4CRAA 2IPHA 5A0CA 1W12U 2DE8A 2QA9E 1G3BA 1PQAA 2ZGCA 1FY5A 1IQJA 4ISHH 3FAOA 1XVMA 2XC0A 1S82A 1E37B 3A88A 4INKA 3RXBA 2A5AA 4KKDA 3PMBB 1P57B 3AVZA 5CMXH 1GJ5H 4JZEH 2H2ZA 1ZPZA 4Q80A 1UCYE 2Z9JA 2PHBA 4IMQA 3JZ2B 2WV5A 4FU7A 1FIWA 1TBZH 2FLBH 1LHGH 1HJ8A 2BDHA 1YCPK 2BD3A 1O3HA 1FZZA 1DFPA 2G8TA 1AN1E 3O8BA 4I33A 5LPEA 4MNWA 1NRSH 1C5XB 8GCHF 3LGIA 1WTGH 1G3DA 3BTWE 1TB6H 2R2MB 1BMLA 4Y7BA 3RC5A 2FOHA 3F9GA 1PPEE 2O8UA 4HI3A 1F5LA 5FBIA 2RCEA 4MDSA 1L1NA 2UUYA 1ZRBA 5FPSA 2FESH 1NZQH 2HNTF 2WPHS 1P03A 1BRCE 1T8OA 5J4QA 2WUBA 1DY9A 3RMMH 3RXUA 2JH5D 2O9QA 5L2YH 1T8LA 3DFLA 1GPZA 1FJSA 1OWJA 3T29A 5DJ7A 2FOEA 1ZSLA 3RXOA 4WMDA 3G01A 2ILNA 2JH6D 4O97A 2F91A 1XVOA 1TRYA 1NT1A 1BTUA 3MU0A 2D8WA 3DUXH 3M3TA 4CHAB 2P16A 3GY5A 3UR6A 3TGJE 1D6WA 1LTOA 2V6NA 3H7OA 1UCYH 3GY6A 3ZYEA 8GCHG 1TQ0B 2G4UA 3PMHB 2G5VA 5T3HA 3KF2A 1OWIA 1EQ9A 1MTNC 1FQ3A 1C5NH 1C4U2 1TPOA 1VR1H 2PW8H 1AD8H 1VITF 1XUKA 1YLCA 2XBXA 1HV7A 1ZSJA 1P2OA 3ZVCA 1SLWB 1TGCA 2XBWA 2VIOA 2ZI2H 3VB4A 4BAQB 3VB6A 6ESTA 5SGAE 1SQTA 1ZGIA 1E38B 1TONA 4Y0YE 1HGTH 3A8CA 1B5GH 2BHGA 1O3MA 3SJ9A 1IQFA 1O37A 1YPEH 1MZAA 4K1TA 2OUAA 3NZIA 1DS2E 2AGEX 3GYLB 1D3QB 1O5CB 4ABHA 1RIWC 2EC9H 1ZPCA 5A09A 1AHTH 3ZYDA 5JBTA 1D3TB 1VITG 1S85A 3DHKH 3ATLA 4B2AA 2Y7ZA 3SQHE 1HXEH 1TNKA 2A4RA 2NU0E 1WBGB 1W0ZU 2PKAA 5GIBA 5JYIA 1P2JA 2C8ZB 4D7GA 2AIQA 3UIRA 1HAPH 5JBCS 3QLPH 4UEHH 3HK6B 1A1RA 2ODQA 4K60A 2ZHQH 3BIVH 1O3DA 4WXIA 1LPZB 3ELAH 4HFPB 2GDEH 1THRH 3PWBA 1IQIA 2WUCA 2IOTA 1QB6A 3HK3B 2FOFA 1HCGA 2XBVA 4ZHLU 2HGTH 3MTYA 1W13U 1TABE 1TA6A 2OXSA 1ZHPA 1K1JA 3C27B 3NKKA 3K6ZA 1O2SA 1O38A 3GY3A 2FLRH 1UTLM 3GCTF 3UY9A 3A7TA 2GCHF 4KGAA 4D7FA 2Q1JA 1GHVH 5BPEA 2Y6TA 3UOPA 5DPAA 2VIVA 3E90B 1ZLRA 2AYWA 1THPB 1GBEA 3MU4A 5JB8S 1GBJA 1Z6EA 2PR3A 3M61U 5E0GA 4Y7AA 1FY4A 1SHHB 3CS7A 1SQOA 9LPRA 1TGBA 5JDUB 4YT7H 4JYTA 1L1GA 3GICB 1ZR0A 1F0RA 4ZXYH 3BIUH 3FZZA 1HJAC 1ZTLA 3EE0B 1A5HA 3GCTG 1Y5AT 1TALA 3Q3KA 1KLTA 2GCHG 2D1JA 1QCPA 1HBTH 1A0LA 3UNRA 1QJ1B 2BLVA 3DT0H 4AYYB 1K21H 1VCQA 2ZPRA 1TGSZ 5C1XA 1DY8A 1C1MA 4VGCC 2AH4X 1EP6A 1TOCB 4MTBA 2FX4A 3T5FH 4I8HA 1HAIH 3GY4A 4ZUHA 1NROH 3PV4A 2PV9B 1YCPH 4KTUA 1FAKH 5TJXA 1TQ7B 4U32A 2F9NA 3H5CB 3RMLH 1A4WH 1IQMA 1Y3YA 2WPJS 1IHTH 4IN1A 3M7TA 3QWCH 1JRSA 1A2CH 1HB0B 1YC0A 2G52A 3HGNA 3UQVA 2PFEA 4XSKU 1GHZA 1C2DA 4LK4A 1RFNA 3TH4H 1QRXA 1Y3VA 3LDXH 5GCHF 4X8TH 1HAYB 3RXDA 3ZZDA 2I6SA 2ZDKA 1CBWC 2GTBA 4FU9A 1DUEA 1L0ZA 4U30A 1GCTC 3URCA 2H9HA 5EQSA 1V2VT 1TRMA 2VINA 1SQAA 1C2GA 2ZCLP 1CO7E 3LPRA 1V2JT 2H5DA 2Z94A 3M7QA 1WYKA 1BHXF 2VIDA 1FY3A 2TGAA 4KP0A 3P8FA 3SGBE 5EXMA 3A84A 3Q77A 3SJIA 1O5DH 3K9XB 3TNTA 1ESTA 1KXFA 3TVJB 2GVFA 5GCHG 3IITA 1ELDE 1EOLA 2OTVA 1EATA 2CF8H 3GY7A 1MZDA 1PPZA 2BD5A 3PYHA 4WY3A 1WQSA 1O3AA 1O2RA 3A7ZA 1DX5M 1MU6B 1KXCA 3RXGA 4K5ZA 2IJOB 4NCYA 4AGJA 4IS5A 3RXTA 2ZA5A 1RIWB 3EYDA 3BTQE 4O9VA 4OS1A 2QC2A 3TJOA 3OTJE 6LPRA 1SHYA 2QXHA 5EQRA 2C90B 1GBDA 1P01A 4X2WA 3T26A 1C1VH 1HJ9A 1GGDB 3MU8A 1T8MA 3RXKA 2C93B 1BUIA 1YPHE 3ENSB 4AYVB 1NN6A 1YBWA 2BDGA 2BY9X 2GX4A 2R9PA 2VVCA 2HNTE 3NXPA 2WYGA 3EDXB 3RLYH 2DUCA 3OY5U 5CHAB 3LH1A 1VCPA 1AFQC 5EU8A 1YF4A 3MU5A 2GV7A 2ZDMA 3EGKH 4WXVA 1Z7KA 2OLGA 1MCTA 1KXEA 3ZZ3A 2FO9A 1DPOA 1S5SA 1L4ZA 2BY8X 4B2CA 4ISOA 1J9CH 3SUGA 4MVNA 1C5MD 3S69A 3E0NB 1P02A 3A85A 1SI5H 2H6MA 3FP7E 4I8GA 1SFQB 1BCUH 3UUZA 1XM1A 4ZMAH 1IQNA 1FN8A 2J2UA 5C5OA 4KELA 1MBMA 1Z8JB 3MH6A 4WF8A 1O2TA 1AB9B 2P59A 3P92A 1QJ7B 4D8NA 4AN7A 4IN2A 1PQ5A 2ZQ1A 3GCHB 3ZV9A 4X1SU 1AWHB 1DLKB 4DCDA 1V2RT 1YPLH 3D62A 1V2NT 3JZ1B 1GI4A 3TNSA 1DOJA 3BTME 4E7RG 2FOAA 4TWYA 5I25A 1V2MT 3MNXA 2ZCHP 3VGCB 4SGBE 2CV3A 1QRZA 1SGPE 2P3TB 4FUJA 1HJAB 1M9UA 3P17H 1C1PA 2XXLA 3MU1A 2BDIA 4TYDA 1MMJN 1EPTA 1CU1A 2XTTB 1GBBA 4JK6A 2BQ6B 1SGIB 5BRRE 4X2VA 1EAIA 4VGCB 2BOKA 2XBYA 1HXFH 5HGGA 3RUOA 5A8ZA 2ANWA 4XDEA 3NWUA 4E06H 1FONA 2W5EA 4BANB 2SNWA 4ZKOU 1VITH 1BTWA 4DW2U 3KHVA 3DD2H 1BIOA 1DITH 1ANDA 4UFGH 3LH3A 1A5GH 3A8DA 2EI8A 2QN5T 5DK1A 1AUTC 1VGCC 3UNQA 2BDBA 3RXEA 1C5UA 3QO6A 1BT7A 1PYTC 1BTXA 1C5ZB 4NSVA 1UTOA 2FIRH 1PPFE 1D3DB 1OP2A 4MG3A 2CGAA 1CBWB 4YTAA 1ZHRA 1P9UA 2XW9A 3UNSA 4OS4A 5F8TA 1KDQB 2ZDVH 1TMBH 3SV2H 8LPRA 3EA9A 1LVMA 1K1OA 1NFYA 5HM2A 2EI6A 2ZZUH 1AVWA 3BTDE 1S0RA 3Q76A 1C5LH 5DP4A 1TYNA 3SGAE 3RXVA 1F7ZA 3BSQA 5AFYH 2QAAA 3VB7A 2ZGHA 4DVAU 2FP7B 3NUMA 5EW2H 1T8NA 1Y59T 1GMCF 2W3KA 3E91A 3ZVEA 2BD2A 1AWFH 5ETXA 1TPAE 3BG4B 3KQBA 1GHBF 1XKBC 3P95A 2TRMA 3MH5A 1QBOA 4ZHMU 2FOBA 2ZGBH 3EA8A 3O8CA 2PKSC 1EX3A 4ABAA 2BX3A 2J9NA 5C20A 1UK2A 1SL3A 2Z9LA 4X8VH 2QXJA 3QK1A 1SGRE 4BXSA 2FI3E 2ANYA 2Z9IA 4B2BA 3ZVBA 3QGNB 3BEUA 4OS5A 2BB4A 1ELVA 2ZHWH 1GMCG 3BTEE 1MBQA 2UUJB 4UFFH 3Q00A 2BD4A 1GHBG 2OC1A 2TGTA 5DGJA 1T7CA 3RXRA 3LGYA 3LU9B 5HYOA 1TLDA 1YLDA 2TGDA 1IOEA 3BTTE 2A5IA 3LGTA 4FUFA 1O33A 1S81A 4B74A 2ZTZA 1DWCH 1YPGH 3RU4T 4FXGH 1F0SA 3H7TA 3O8DA 3OU0A 4NWKA 4DIIH 2JETC 3ZZCA 1ELBA 1Z6JH 4AFZA 4IBLH 1UK3A 1GL0E 2ZDAH 4BTUB 1TE0A 4Y79A 5FX5A 1NRPH 3V3MA 1KXDA 3LOXA 6CHAC 1RRKA 1Y5BT 2AEIH 5DP6A 5FPYA 1EPTB 4RN6A 4Y8YA 4QT8C 1BMNH 1JOUB 3Q3XA 2ZG0H 1QHRB 1N1LA 3M5LA 1TRNA 2BY5X 2FM2A 2ZPQA 4O03A 4OS6A 3TIUA 1GBTA 4LXBH 1V2LT 1NRNH 1A7SA 3P70B 4NWLA 1UVTH 1SGCA 2RG3A 3QTOH 3DA9B 1GJDB 1YPHC 2GMTB 5HM9A 1W7XH 1C2EA 3SBKA 3SI3H 1F0TA 3EA7A 3UTUH 4TY6A 1AVXA 1GI7B 2HNTC 7KMEH 1F5KU 4NZQA 7ESTE 1ZSKA 3ZVDA 4YO9A 1O2NA 2OC0A 7GCHF 1P2NA 4CRGA 5LH8A 2BVRH 1C5RA 2ZP0H 1MKXH 1SBWA 2HVXA 2VIWA 2CHAC 2QF0A 3STJA 3M37A 1NY22 2ZFTA 1V2UT 1BQYA 1GHAF 3ZZ5A 1VJ9U 3NPSA 1SLUB 1GI1A 1O3EA 1GJCB 4WH6A 2FOCA 3PLPA 2ZGXH 3T62A 1LHEH 5C67A 1MTUA 2ZPSA 1EB2A 2HPPH 3PO1C 4Q2KA 1OS8A 2FWWA 4NGAH 5I46H 2PLXA 2WINI 4NA8A 1A0HB 3SU3A 2VWMA 4JMYA 4GHQA 4MLFB 1GMHF 2WPIS 5HMAA 5A2MH 1RTLA 3S7HB 1AU8A 1BTPA 1ZOMA 3UWIA 7GCHG 4UE7H 3MOCA 4IC5A 2ZDNA 2ZKSA 3S9AA 4OS7A 1Y3XA 3V0XA 2GKVE 3M5NA 3QX5H 4K3JA 2OP9A 4THNH 1S6HA 2RA0A 1ZPBA 1GHAG 5EQQA 1K1NA 2GDDA 3RDZA 2P8OC 4Y6DA 2G51A 1JRTA 1V2OT 1GI5A 2FYRA 1LQEA 3URDA 5ESTE 1G36A 1W8BH 4UD9H 5LPFA 3A7WA 1A46H 3MO9A 3U1JB 4ESTE 2BXUH 5AF9H 1GMHG 1CA8B 1GJ6A 3KIDU 1FI8A 1JMOH 4H6SB 4YOGA 2SGFE 4CBOA 1QGFA 2ALVA 3T27A 2VIPA 2RA3A 3SGQE 1E0FD 2CMYA 5C2ZA 4B76A 3A8AA 3LIWA 1AKSB 3B8JA 1AZZA 2OINA 4XE4A 5GDSH 1HPGA 4ABEA 1PPHE 1XUIA 3MO3A 1BRAA 4I8JA 1GHXH 3GDVA 5IDKA 2BDAA 1AMHA 3LGVA 1YYY1 4IC6A 1HIAB 5EPYA 5C1YA 2GZ7A 4Y8ZA 4FVBA 2VGCB 1AVGH 2IN2A 2ANKH 4AORA 1QQUA 3SV7A 2Q6FA 3K65B 1O5GH 2GD4B 2ZFPH 1DSUA 1NS3A 1GBKA 2F9BH 4A6LA 4B75A 1O5EH 4A1XA 4H6TA 3UPEA 4CH8B 4XBBA 1W11U 2ZTYA 1HAHH 4ZROA 1ARBA 1IHSH 1NRRH 2BD8A 2FOMB 2ALPA 2ZU2A 2NU1E 2J92A 4TY7A 1GG6B 1DE7H 5E2OA 3LC3A 2H9EH 3OYPA 3F68H 1EJMA 3GY8A 1OSSA 1O32A 1V2ST 1D9IA 1YCPM 1C1OA 3S0NA 1TOMH 1ANCA 3PLKA 4Q7YA 3TH3H 1V3XA 2SGAA 2O8MA 1QRWA 2BQ7B 1QTFA 1LPKB 2VJ1A 4ISNA 1QBNA 2C8YB 2Q6DA 1HRTH 2ULLA 2G4TA 3GDUA 5F8XA 3AASA 4J2YB 2Y82A 4CRCA 2QIQA 2SGEE 4FVDA 2HLCA 1SC8U 3IG6B 2QV1A 1YP9A 3K6YA 3U8RH 1Z8IB 2R3YA 3V13A 1QL7A 3ZZ4A 5HXFA 4GUXA 4A5TS 1EZUC 3SORA 1AFEH 1PYTD 4AOQA 3LGUA 4CR5A 1P0SH 8KME2 1CE5A 1O35A 1C1NA 1HYLA 2SGDE 1O2WA 1K1IA 2HWLB 1P9SA 1GI0A 1QURH 1O3GA 1BMAA 3HGPA 3MH4A 1THSH 2SGPE 2V0BA 2I6QA 3PB1E 3SZNA 3AW1A 2THFB 2B7DH 2F3CE 3MNSA 1GVZA 5E0HA 1Q3XA 1AGJA 4CRFA 3PWCA 3SU1A 1Z1JA 1ARCA 1GBIA 1SR5C 3QDZB 3A80A 3M36A 4NFEA 3E1XB 1QJ6B 3U1IB 4WJG2 2EI7A 2STBE 3TK6A 1WOFA 4SGAE 1J16A 1LDTT 2Z9KA 3UWJH 1G3EA 3C1KA 4TPYA 1MTSA 4RKOB 1ZMJA 2GV6A 1GJAB 3HATH 2YNBA 1IAUA 3PM3A 1G3CA 4ABIA 2YOLA 1OYQA 4YOJA 7LPRA 1KTTB 2J38A 3U8TH 3L33A 1VCWA 3RXPA 5EPNA 2FX6A 1MTNB
chains in the Genus database with same CATH superfamily
1CQQA 2ZFSA 5A0BA 1O2YA 1XXDA 1K9OE 1QBVH 4WWYA 3QN7A 1IQEA 5DP8A 5IYTA 2P8OB 1O2ZA 2AS9A 2WSSD 8ESTE 3PROA 1GBLA 4NIYA 4ABJA 1GCDA 1FIZA 4K2YA 2ZIQH 1GBCA 2BYAX 3M7UA 3SZEA 2AIPA 3MFJA 4FUGA 4NSYA 3UOUA 1FPCH 2WPMS 5AVDA 1MTWA 1C2KA 1UVPA 4NIXA 1LMWB 2G00A 1WCZA 1O34A 1LVBA 1MKWK 2BXTH 2V3MA 2ZDLA 3ZZ8A 1ESAA 2ZU1A 3A83A 2YNAA 2WV9A 3VXEH 3LONA 1C5QA 1C2LA 3GCOA 1FY8E 2LNCA 3BN9A 4NIVA 2AERH 5EXNA 3PRBA 4Y10E 1O3KA 1KDQA 5E2PA 1S83A 1C2IA 2UUKB 2NU4E 1C4Y2 1OP0A 1PQ7A 4IW4E 2Z3DA 3NK8A 1SB1H 3ZV8A 5ABWA 1QIXB 1G30B 1Y5UT 4X6MA 1BTYA 2VWOA 5TCCA 1CGHA 4RT0A 2BLWA 1P3EA 1HAZB 1HLTH 3PRDA 2KCAA 4HZHA 4RKJB 1H9HE 4BAOB 3ODDA 3MHWU 1AE8H 2AGIX 1NBMD 1T31A 2LPRA 1A3BH 2ZHEH 1TX8A 1B0FA 5DP3A 4ZHAA 1GJ9B 4ABGA 5JB9S 1J14A 1ZTJA 3DFJA 3SUFA 4J1YA 3N7DA 3RXFA 1QA0A 4KTSA 2XCNA 1RD3B 5LGOA 3RU4E 1ANEA 3PTNA 1A0JA 4F4OC 4TPIZ 4Z6AH 1D4PB 1C2FA 2ODYB 4YOIA 3RC6A 4BXWA 1K28D 2BD9A 4Y71A 1NU9A 1OX1A 2TGPZ 2FS9A 1U6QA 1W7GH 2ZECA 4ISLA 1J17T 5EW1H 2YMSD 2ANMH 4H4FA 1JBUH 1ELEE 1OWKA 1VZQH 4P00A 3FZDA 2VWLA 2Z3EA 3RC4A 1WAYB 4OGXA 4O3TA 1MKXK 3TK5A 1BMFD 4NIWA 1FXYA 2BY7X 1NESE 1V2KT 1GBHA 2PUQH 2XC5A 3D65E 2FOGA 1FX0B 2V35A 1K0HA 4FUIA 2ZNKH 2QY0B 1W2KH 1BOQA 2HALA 1IQLA 4B1TA 4CREA 2J98B 1PJPA 1PPBH 3GDSA 2WPKS 1GI2A 1YLNA 4U2WA 1T4UH 2Z6BD 1N6YA 4O3UA 1CSOE 4JYVH 4CRDA 2VVVA 1NRQH 2CK3D 1ETRH 1H8IH 3RXLA 1DT2A 1L2EA 4X1QU 2GT8A 2R3UA 3GYMA 1C2MA 1HFDA 5C3NA 1MH0A 1QL9A 3AAVA 5EXLA 4FUEA 5ESBA 2UWLA 2O8WA 2D26C 4X2XA 3D49H 1FDPA 4UFDH 3SNBA 4IMZA 1GMDF 1O2JA 5C5NA 1GJBB 2F9VA 1C1TA 1E35B 1EZQA 4JZ1A 1FN6A 4CR9A 4M7GA 3E0PB 1RXPA 2M5TA 3T25A 1GI6A 4K1EA 1ELGA 4TWWA 1XUJA 5JBAS 2ZO3H 3M3SA 2VIQA 2KAIB 2GCTC 1CGJE 2ZWLH 3HKIB 2GZ8A 5FBEA 1GCTB 3SOSA 2BQWB 2BVXH 3W1EA 3P8OA 5L2ZH 1KYNA 1ZHMA 1EAUA 3SU4A 5B6OA 3E8LA 4K8BA 1CT0E 4H42U 1MAYA 1WQVH 3QUMP 1GHYH 1FV9A 1H8DH 3PLBA 5GWZA 4UONA 2B9LA 2EA3A 1GJ8B 1BJUA 3S7KB 1WU1A 1YWUA 3W95A 5JBBS 1ZRKA 1GMDG 1NFUA 1PQ8A 3MMGA 5EOKA 3RMOH 1K2I1 1GI8B 2J95A 3A89A 1D6RA 2OBOA 4WVPE 3FP6E 2AMDA 2OQ5A 2IPQX 1C9PA 1TAWA 2NWNA 3CP7A 5DKMA 3F6UH 4D9QA 3PMAB 4ACBA 1B0EA 1NM6A 3GCNA 1TBQH 1O2GH 1SLXB 1UTNA 3F2FA 2PSYA 3CNRA 4BTIB 1O3IA 1F5RA 1MKWH 1C1WH 1EUFA 2AFQB 4JK5A 1OYTH 3MNCA 1FY1A 1UVSH 3E6PH 1O5FH 1KTSB 1SGEE 6GCHF 1EASA 1K1MA 4OS2A 2KCPA 1ZJKA 1O3PB 4CRBA 1H1BA 2AHME 5G4BA 3GOVB 4BNRA 1SGFA 2ODPA 2VH0A 5H4IB 1SGQE 2CXVA 2UUFB 1H9IE 1Z8GA 4JZDH 3KQEA 4A1VA 2QXIA 3KNXA 2GP9B 3ZZ6A 1DSTA 1LVYA 1ZYOA 3PTBA 3VB3A 1MQ6A 4B73A 2F83A 2V7QD 2QF3A 1INCA 1BBRK 1LVOA 1JIMA 4MPVA 4YT6H 1AFQB 2GZ9A 3EAJA 4I7YH 5E8EH 1F2SE 5T6DA 4MPXA 1AKSA 3AW0A 4AFSA 3I77A 4Y11E 1TFXA 1ABIH 4R8TB 4WH8A 2BZAA 1E36B 3ATWA 1NFWA 1EKBB 3FFGA 1SGFG 3NCLA 6GCHG 1BDAA 1ZJDA 3K2UA 4X6NA 3RM0H 4MNYA 1FNIA 2BOHB 2OQUA 2HLDD 2Z7FE 1OOKB 1HIAA 2FS8A 2ZHFH 1D3PB 2F43B 1SOTA 3FOAA 5DP5A 4HTCH 1O2LA 1QY6A 3QTVH 4JZIA 3S9BA 1GBAA 4DY7B 1SOZA 2G81E 4FUBA 2XWBI 1UTKA 1EAXA 1C2JA 1DWEH 3FN8A 1DDJA 4B6FA 1W14U 3UB0A 3OFND 1KLJH 1GDQA 1O3BA 1CA0C 2A4GA 2SNVA 2FPZA 2UWOA 4F49A 5F53A 2ZU3A 4A92A 1GBMA 1K22H 4DGJA 1A61H 4NFFA 2F9PA 3BEIB 4X0WU 2W7UA 4X1RU 2Z3CA 2AMQA 4E7NA 4A1TA 2CF9H 3BEFB 1DLEA 4ISIH 2G5NA 1LO6A 1ETSH 1GHWH 1RGQA 2PGQB 3MO6A 1NO9H 4YZUA 4JYUH 2PTNA 3F1SB 4BAMB 1O2IA 1OWHA 3SHCH 4MQAA 1YM0A 1P05A 4GCHF 2BX4A 1MCVA 2WYJA 3RXSA 4AX9H 1TA2A 1ELFA 1CGIE 2CJIA 4MPWA 1AI8H 2RDLA 2BLQA 4AFUA 4A7IB 3V7TA 3P8GA 3RXIA 2Q6GA 3LGWA 3SJKA 3ATIA 3FO8D 4AG1A 4Y0ZE 4GPGA 2B8OH 1G9IE 4FETA 3SU0A 1C2HA 4ASHA 3I78A 1P2MA 5B6LA 3WW7A 2O8LA 4ABDA 4I31A 1ELCA 4MPUA 3QGJA 2QCYA 4E05H 1O2MA 1UHBB 3HKJB 1AE5A 1Q31A 2P93A 3BF6H 5T6FA 5C0TA 4FUDA 5DP7A 3KCGH 1VGCB 1YKTA 5FCRA 1DVAH 4GVUA 3D23A 5PTPA 2KCYA 1O3FA 2W7SA 5DN6D 1GBFA 5GPIB 1GWAA 1P11E 4GCHG 2C4FH 2G55A 1OWDA 2FDAA 1A3EH 2GCTB 1HAOH 3P6ZB 3SU5A 4XBCA 5FCKA 3SJOA 4D76A 1RS0A 2TIOA 1ANBA 3SW2B 1ELTA 4ZKSU 1MUEB 3U69H 1BRBE 2VB0A 1T4VH 3H09A 1AUJA 1LPGB 1O5AB 4GSOA 3UR9A 1Z71A 3CS0A 4BAHB 3OY6U 3TGIE 1E79D 3RM2H 1GDUA 2A4OA 1NFXA 3MH7A 1HDTH 5A8XA 1G32B 4ZAEA 1HAGE 2SGQE 2ESTE 3SNAA 2DE9A 2QYIA 1C1UH 1XUFA 2PKSB 1BBRE 5EG4A 5LPRA 2W6JD 2R2WU 4MNXA 3U8OH 3TGKE 3RP2A 4I8LA 4K1SA 2LP6A 1O39A 2P94A 1NU7B 2HOBA 2FMJA 4D9RA 5T6GA 1Z1IA 1HAVB 2ZU4A 1O5BB 3GY2A 4X1PU 1HUTH 1GGDC 1TNLA 3ZVFA 2GT7A 1W0JD 1W0YH 3I29A 2QXGA 1VJAU 1V6DA 2V3HH 4X2YA 1ORFA 2OBQA 2BMGB 1WSSH 2P3FH 3RXJA 1GI3A 4AC9A 1NTPA 3A82A 4WMEA 5EGMA 3RXCA 3BTGE 5CHAC 3SV9A 1C5YB 2TBSA 4FUCA 3TJNA 1W10U 3M5MA 3M35A 3MI4A 5HIZA 4ZXXH 2XRCA 5EODA 1UK4A 3SV8A 4ZKNU 2B5TB 1SGTA 2A7JA 2JETB 1GL1A 5AHGH 4B71A 5F8ZA 1IQHA 4ZH8A 4XBDA 3N99A 2K8IA 1BBRH 1KY9A 3ITIA 4X8UH 6CHAB 1TIOA 1MD8A 3MYWA 5FAHA 1P2KA 4BTTB 1AZ8A 2A32A 4NA7A 1O2QA 1K1LA 1GJ7B 2A45B 4FOUC 1PPCE 1C9TA 1RTKA 3F9EA 5GJ4B 2ZU5A 1C1RA 1UTJA 1AB9C 1BMMH 1P12E 4NA9H 1H9LB 2XC4A 3A7XA 2AGGX 1GJ4H 3GCHC 1UW7A 1C5SA 1DUAA 1O2UA 2XYAA 3EQ0H 2RFKC 1XXFA 3ATMA 3TU7H 1EXFA 3FP8E 1CA0B 1TGNA 3VPKA 1MQ5A 3TK9A 2Z9GA 1E1RD 1WXRA 3A7YA 3RXAA 2P3UB 3N7EA 1ZMLA 1KMHB 4YM9A 2KFWA 3PV5A 1OPHB 1LHCH 3Q3YA 3VGCC 2BVSH 2VVUA 2HRVA 1KLIH 2A1DB 1Z8RA 1XKAC 4UDWH 1EB1H 2A5KA 3GISB 1LHDH 5L30H 5K7RA 2CHAB 5E0JA 1H4WA 1YY3A 1P09A 5FX6A 2KM0A 2A4QA 1BJVA 2YMSB 4XD7D 3TJUA 3AAUA 3E16B 3KL6A 2XNDD 3TLOA 1AY6H 2XOKD 4K8YA 1S6FA 2WV4A 1O3JA 4AG2A 3BTFE 1YPKH 1TPPA 4WMFA 1NPMA 1GDNA 5EJZA 2H5CA 3PO1B 4F48B 3KQCA 5JPMH 3A81A 2J98A 2H1UA 1CHOF 2OD3B 1YPMH 2Y5HA 1ETTH 1BA8B 4OGYA 1LCYA 3U9AH 3HPTB 4INLA 3T28A 3S9CA 2FI4E 3RLWH 3ZZBA 1BZXE 4LOYH 5K0HA 1TPSA 2BDCA 4DOQA 1LKAA 2NU3E 1ZGVA 3STIA 4YESB 3F9FA 2ZGJA 2A2QH 1QFKH 3F9HA 1G2LA 2JKHA 1O2KA 1TMTH 5A8YA 3T2NA 1EJNA 3SI4H 3MWIU 1UTMA 2OCVB 4GHTA 1CHOG 1GI9B 1O2HA 4Q7XA 3SNCA 2WPLS 3VXFH 1BTHH 1TNHA 3BV9B 2W26A 2PKAB 2ZFQH 3BG4C 1DM4B 4CBNA 1QB9A 1A5IA 1MU8B 3RXQA 1ZMNA 4NZLA 2ZQ2A 2KAIA 2ZEBA 5IK2D 2ZHDA 4MNVA 1PFXC 1ACBE 1PPGE 3RXHA 5CDFE 1F92A 2FYQA 3KGPA 1Q2WA 2XNIA 1QR3E 1SFIA 1SLVB 2A7CA 2R0KA 1TGTA 3F3BA 1P3CA 3SNDA 3ZZ9A 2XCFA 2EEKA 2VWNA 3SNEA 3SJ8A 9ESTA 1UMAH 3A8BA 1O3OA 5J4SA 3SUEA 3TJVA 2BZ6H 3ZZAA 1W3CA 4DJZB 1E34B 3KEEA 1IQGA 3ZVAA 1V2TT 1KIGH 1KXAA 5CE1A 1S0QA 2ZC9H 4I32A 1LQDB 4HGCA 2A2XH 5DO4H 1ABJH 2BLOA 1K1PA 3KN2A 1HAXB 3VEQB 5TCAA 4AB8A 3ESTA 5AFZH 1SVPA 1WUNH 3IWMA 1SPJA 2A0QB 3LC5A 1TX6A 2BY6X 3A87A 1C1QA 1ZTKA 2QGRA 2OC8A 3TH2H 1BB0B 1O2VA 5C0UA 2ZCKP 2JH0D 3O8RA 4YLQH 1UTQA 5F03A 1CVWH 1N8OC 4XFQA 1SGNE 1FUJA 3KYGA 1FAXA 3SQEE 4ZKRU 3MNBA 4RSPA 1L4DA 2Y80A 3VB5A 2VH6A 1O30A 1AIXH 1KXBA 2BD7A 3RU4D 3W94A 1YPJH 2GGVB 2FEQH 1O2XA 3TPIZ 1UJ1A 1X7AC 4DT7B 4X1NU 1EP5A 3L3TA 1QNJA 1O2OA 3M5OA 2PGBB 1ESBA 1RTFB 1EPTC 2D2DA 1QL8A 2A31A 3PMJA 1SGDE 1TNGA 2FZZA 2ZF0H 2PWXA 1UO6A 3SUDA 3OSYA 5T1VA 4XOJA 1SG8B 1DWDH 3RXMA 1N6XA 2L6OA 4DT4A 1XMNB 5DP9A 1QB1A 4Y8XA 2VNTA 5FPTA 1ELAA 1SSXA 1BITA 2L74A 1P8VC 4BAKB 2GMTC 1HNEE 1WTHD 2P95A 3LT3A 2C8XB 3TITA 4ABFA 2C8WB 5C17A 1L1JA 4Y76A 1CHGA 1V2WT 3V12A 4AB9A 1EOJA 1F0UA 4GLYA 2HPQH 2UWPA 2B0FA 4I8KA 2BM2A 1UVUH 3UAIC 2OC7A 1YGCH 1OKXA 2CN0H 1EAWA 2FI5E 2R0LA 1EZXC 2RDEA 4CH2B 1Y3UA 1TX7A 3ZZ7A 3CENA 2STAE 3UQOA 2FXRA 1ZZZA 2BTCE 1C5WB 1J8AA 1JWTA 4AFQA 1DXPA 2J4IA 3B9FH 1O0DH 4K69A 4INHA 4AZ2B 3SV6A 1XX9A 3WY8A 1SGYE 4IGDA 3ZVGA 1XUGA 1DWBH 1UCYK 1LHFH 2ASUB 2NU2E 1BHXB 4BOHA 4CHAC 3R3GB 4Q7ZA 1CT2E 2Y81A 1P04A 3SHAH 1MAXA 1Y8TA 1LKBA 1OXGA 1NC6A 1Y3WA 1FLEE 2PSXA 1ID5H 1EJAA 1OWEA 3OX7U 1GVLA 2PTCE 2WHXA 3A7VA 4R0IA 1C5PA 3BTHE 3LKWA 2K1QA 1UVOA 2V3OH 3UREA 4DG4A 1DICA 1B7XB 1H8HD 2ZTXA 1TNJA 1TNIA 3SO3A 2M2AA 1C5TA 1UTPA 4DURA 2ZFRH 1WV7H 1P2IA 2WPDD 3A86A 4HG6A 1UHBA 3U98H 4YLUA 2FTMA 1O31A 3ATKA 4Z0KA 1DXWA 2TPIZ 1XUHA 1QA7A 1AO5A 3M3VA 3SU6A 3LJJA 4DIHH 1TBRH 2WZQA 1T32A 1C5VA 1BTZA 5DG6A 4LZ1H 4TSFD 2H9TH 3SN8A 1S84A 2Y7XA 1JIRA 4KTCA 1RJXB 1MTVA 2J94A 4X6OA 3L6PA 2HVYB 1O2PA 4X6PA 2VU8E 2EY4C 1IQKA 4JZFH 1C5OH 1FMGA 2FTLE 1O3NA 2SFAA 2W3IA 3BG8A 1CT4E 1G2MA 1O36A 2XWAA 3E3TA 3B23B 3R0FA 1J15A 1SMFE 5GXPA 3KQDA 1C4V2 2ZFFH 2AMPA 1MD7A 1P10A 3BTKE 1FPHH 3P8NA 3UFAA 1G37A 1GVKB 5FHTA 3OEHD 2A7HA 2PUXB 2VGCC 4U01A 5FXLA 1C1SA 4LZ4B 4AGKA 3RMNH 3VFEA 1O3LA 5A0AE 3FVFB 4NG9H 1BRUP 1TWXB 1EZSC 3N7OA 5F6MA 4FU8A 2KCOA 3LJOA 1KSNA 2FODA 1TMUH 1V2QT 4X8SH 3PV2A 1P2QA 5L6NH 1JXPA 2F9UA 4GAWA 1N8OB 4JCNA 2O8TA 2LELA 4FUHA 2C3SA 1P06A 4PROA 1HAVA 1QQ4A 1O3CA 1V2PT 3FANA 2BDYA 3ODFA 2Y5GA 3SU2A 2J34A 1GG6C 3QZRA 4UFEH 2Y5FA 3QZQA 1OP8A 1AQ7A 1DANH 3F2GA 2IJD1 2F9OA 4ABBA 5C1UA 4CRAA 2IPHA 5A0CA 1W12U 2DE8A 2QA9E 1G3BA 1PQAA 2ZGCA 1FY5A 1IQJA 4ISHH 3VG8A 3FAOA 1XVMA 2XC0A 1S82A 1E37B 3A88A 4INKA 1VKYA 3RXBA 2A5AA 4KKDA 3PMBB 1P57B 3AVZA 5CMXH 1GJ5H 4JZEH 2H2ZA 1ZPZA 4Q80A 1UCYE 2Z9JA 2K0QA 2PHBA 4IMQA 3JZ2B 2WV5A 4FU7A 1FIWA 1TBZH 2FLBH 1LHGH 1HJ8A 2BDHA 1YCPK 2BD3A 1O3HA 1FZZA 1DFPA 2G8TA 1AN1E 3O8BA 4I33A 5LPEA 4MNWA 1NRSH 1C5XB 8GCHF 3LGIA 1WTGH 1G3DA 3BTWE 1TB6H 2R2MB 1BMLA 4Y7BA 3RC5A 2FOHA 3F9GA 1PPEE 2O8UA 4HI3A 1F5LA 5FBIA 4B6EA 2RCEA 4MDSA 1L1NA 2UUYA 1ZRBA 5FPSA 2FESH 1NZQH 1SQRA 2HNTF 2WPHS 1P03A 1BRCE 1T8OA 5HKKD 2WUBA 5J4QA 1DY9A 3RMMH 3RXUA 2JH5D 2O9QA 5L2YH 1T8LA 3DFLA 1GPZA 1FJSA 1OWJA 3T29A 5DJ7A 2FOEA 1ZSLA 3RXOA 4WMDA 3G01A 2ILNA 2JH6D 4O97A 2F91A 1XVOA 1TRYA 1NT1A 1BTUA 3F2HA 3MU0A 2D8WA 3DUXH 3M3TA 4CHAB 2P16A 3OE7D 3GY5A 3UR6A 3TGJE 1D6WA 1LTOA 4RI0A 2V6NA 3H7OA 1UCYH 3GY6A 2JJ2D 3ZYEA 8GCHG 3DSPA 1COWD 1TQ0B 2G4UA 3PMHB 2G5VA 5T3HA 2PP6A 3KF2A 1OWIA 1EQ9A 1MTNC 2J97A 1FQ3A 1C5NH 1C4U2 1TPOA 1VR1H 2PW8H 1AD8H 1VITF 1XUKA 1YLCA 2XBXA 1HV7A 1ZSJA 1P2OA 3ZVCA 1SLWB 1TGCA 2XBWA 2VIOA 2ZI2H 3VB4A 4BAQB 3VB6A 6ESTA 5SGAE 1SQTA 1ZGIA 1E38B 1TONA 2EQNA 4Y0YE 1HGTH 3A8CA 1B5GH 2BHGA 1O3MA 3SJ9A 1IQFA 1O37A 1YPEH 1MZAA 4K1TA 2OUAA 3NZIA 1DS2E 2AGEX 3GYLB 1D3QB 1O5CB 3DCLA 4ABHA 1RIWC 2EC9H 1ZPCA 5A09A 1AHTH 3ZYDA 5JBTA 2QF4A 1D3TB 1VITG 1S85A 3DHKH 3ATLA 4B2AA 2Y7ZA 3SQHE 1HXEH 1WDIA 1TNKA 2A4RA 2NU0E 5KEDA 1WBGB 1W0ZU 2PKAA 5GIBA 5JYIA 1P2JA 2C8ZB 4D7GA 2AIQA 3UIRA 1HAPH 5JBCS 3QLPH 4UEHH 3HK6B 1A1RA 2ODQA 4K60A 2ZHQH 3BIVH 1O3DA 4WXIA 1LPZB 3ELAH 4HFPB 2GDEH 1THRH 3PWBA 1IQIA 2WUCA 2IOTA 1QB6A 3HK3B 2FOFA 1HCGA 2XBVA 4ZHLU 2HGTH 3MTYA 1W13U 1TABE 1TA6A 2OXSA 1ZHPA 1K1JA 3C27B 3NKKA 4M9FA 3K6ZA 5GNDA 1O2SA 1O38A 3GY3A 2FLRH 1UTLM 3GCTF 2KR7A 3UY9A 3A7TA 2GCHF 4KGAA 4D7FA 2W6ID 2Q1JA 2QF5A 1GHVH 5BPEA 2Y6TA 3UOPA 5DPAA 2VIVA 3E90B 1ZLRA 2AYWA 5C94A 1THPB 3MQKC 1GBEA 3MU4A 5JB8S 1GBJA 1Z6EA 2PR3A 3FKSD 3M61U 5E0GA 4Y7AA 4ASUD 1FY4A 1SHHB 3CS7A 1SQOA 9LPRA 1TGBA 5JDUB 4YT7H 4JYTA 1L1GA 3GICB 3U28C 1ZR0A 1F0RA 4ZXYH 3BIUH 3FZZA 1HJAC 1ZTLA 3EE0B 1A5HA 3GCTG 1Y5AT 1TALA 3Q3KA 1KLTA 2GCHG 2D1JA 1QCPA 1HBTH 1A0LA 3UNRA 1QJ1B 2BLVA 3DT0H 4AYYB 1K21H 1VCQA 2ZPRA 1TGSZ 5C1XA 1DY8A 1C1MA 4VGCC 2AH4X 1EP6A 1TOCB 2F4LA 4MTBA 2FX4A 3T5FH 4I8HA 1HAIH 3GY4A 4ZUHA 1NROH 3PV4A 2PV9B 1YCPH 4KTUA 1FAKH 5TJXA 1TQ7B 4U32A 2F9NA 3H5CB 3RMLH 1A4WH 3AK5A 1IQMA 1Y3YA 3F0PA 2WPJS 1IHTH 4IN1A 3M7TA 3QWCH 1JRSA 1A2CH 1HB0B 3OTPA 1YC0A 2G52A 3HGNA 3UQVA 2PFEA 4XSKU 1GHZA 1C2DA 4LK4A 1RFNA 3TH4H 1QRXA 1Y3VA 3LDXH 5GCHF 4X8TH 1HAYB 3RXDA 3ZZDA 2I6SA 2ZDKA 1CBWC 2GTBA 4FU9A 1DUEA 4TT3D 1L0ZA 4U30A 1GCTC 3URCA 2H9HA 5EQSA 1V2VT 1TRMA 2VINA 1SQAA 1C2GA 2ZCLP 1CO7E 3LPRA 1V2JT 2H5DA 2Z94A 3M7QA 1WYKA 1BHXF 2VIDA 1FY3A 2TGAA 4KP0A 3P8FA 3SGBE 5EXMA 3A84A 3Q77A 3SJIA 1O5DH 3K9XB 3TNTA 1ESTA 1KXFA 1OHHD 3TVJB 1QZ8A 2GVFA 5GCHG 3IITA 1ELDE 1EOLA 2OTVA 1EATA 5HIYA 2CF8H 3GY7A 1MZDA 1PPZA 2BD5A 3PYHA 4WY3A 1WQSA 1O3AA 1O2RA 3A7ZA 1DX5M 1MU6B 1KXCA 3RXGA 4K5ZA 2IJOB 4NCYA 4AGJA 4IS5A 3RXTA 2ZA5A 1RIWB 3EYDA 3BTQE 4O9VA 1EFRD 2QC2A 4OS1A 3TJOA 1NBME 3OTJE 6LPRA 1SHYA 2QXHA 5EQRA 2C90B 1GBDA 1P01A 4X2WA 3T26A 1C1VH 1HJ9A 4XRNA 1GGDB 3MU8A 4ACAA 1T8MA 3RXKA 2C93B 1BUIA 1YPHE 3ENSB 4AYVB 1NN6A 1YBWA 2BDGA 2BY9X 2GX4A 2R9PA 2VVCA 2HNTE 5DSFA 3NXPA 2WYGA 3EDXB 3RLYH 2DUCA 3OY5U 5CHAB 3LH1A 1VCPA 1AFQC 5EU8A 1YF4A 3MU5A 2GV7A 4Q4LA 2ZDMA 3EGKH 5EIYA 4WXVA 1Z7KA 1E1QD 2OLGA 1MCTA 1KXEA 3ZZ3A 2FO9A 1DPOA 1S5SA 1L4ZA 2BY8X 4B2CA 4ISOA 1J9CH 3SUGA 4MVNA 1C5MD 3S69A 3E0NB 3WWBA 1P02A 3A85A 1SI5H 2H6MA 3FP7E 4I8GA 1SFQB 1BCUH 3UUZA 1XM1A 4ZMAH 1IQNA 1FN8A 2J2UA 5C5OA 4KELA 1MBMA 1Z8JB 3MH6A 4WF8A 1O2TA 1AB9B 2P59A 3P92A 3SYJA 1QJ7B 4D8NA 4AN7A 4Z1MD 4IN2A 1PQ5A 2ZQ1A 3GCHB 3ZV9A 4X1SU 1AWHB 1DLKB 4DCDA 1V2RT 1YPLH 3D62A 1V2NT 3JZ1B 1GI4A 3TNSA 1DOJA 3BTME 4E7RG 2FOAA 4TWYA 5I25A 1V2MT 3MNXA 2ZCHP 3VGCB 4SGBE 2CV3A 1QRZA 1SGPE 2P3TB 4FUJA 1HJAB 1M9UA 3P17H 1C1PA 5FL7D 2XXLA 3MU1A 2BDIA 4TYDA 1MMJN 1EPTA 1CU1A 2XTTB 1MABB 1GBBA 4JK6A 2BQ6B 1SGIB 5BRRE 4X2VA 1EAIA 4VGCB 2BOKA 2XBYA 1HXFH 5HGGA 3RUOA 5A8ZA 2ANWA 4XDEA 3OAAD 3ZIAD 3NWUA 4E06H 1FONA 2W5EA 5KECA 4BANB 2SNWA 4ZKOU 1VITH 1BTWA 4DW2U 3KHVA 3DD2H 1BIOA 1DITH 1ANDA 4UFGH 3LH3A 1A5GH 3A8DA 2EI8A 3WWFA 2QN5T 2J5UA 5DK1A 1AUTC 1VGCC 3UNQA 2BDBA 3RXEA 1C5UA 3QO6A 1BT7A 1PYTC 1BTXA 1C5ZB 2JDID 4NSVA 1UTOA 2FIRH 1PPFE 1D3DB 5KGOA 1OP2A 4MG3A 2CGAA 1CBWB 4YTAA 1ZHRA 1P9UA 2XW9A 3UNSA 4OS4A 5F8TA 1KDQB 2ZDVH 1TMBH 3SV2H 8LPRA 3EA9A 1LVMA 1K1OA 1NFYA 5HM2A 2EI6A 2ZZUH 1AVWA 3BTDE 1S0RA 3Q76A 1C5LH 5DP4A 1TYNA 3SGAE 3RXVA 1F7ZA 3BSQA 5AFYH 2QAAA 3VB7A 2ZGHA 4DVAU 2FP7B 3NUMA 5EW2H 1T8NA 1Y59T 1GMCF 2W3KA 3E91A 3ZVEA 2BD2A 1AWFH 5ETXA 1TPAE 3BG4B 3KQBA 1GHBF 1XKBC 3P95A 2TRMA 3MH5A 1QBOA 2KX4A 4ZHMU 2FOBA 2ZGBH 3EA8A 3O8CA 5CHBA 2PKSC 1EX3A 2GJGA 4ABAA 2BX3A 2J9NA 5C20A 1UK2A 1SL3A 2Z9LA 4X8VH 2QXJA 3QK1A 1SGRE 4BXSA 2FI3E 2ANYA 2Z9IA 4B2BA 3ZVBA 3QGNB 3BEUA 4OS5A 2BB4A 1ELVA 2ZHWH 1GMCG 3BTEE 1MBQA 2UUJB 4UFFH 3Q00A 2BD4A 1GHBG 2OC1A 2TGTA 5DGJA 1T7CA 3RXRA 3LGYA 3LU9B 5HYOA 1TLDA 1YLDA 2TGDA 1IOEA 3BTTE 2A5IA 3LGTA 4FUFA 1O33A 1S81A 4B74A 2ZTZA 1DWCH 1YPGH 3RU4T 4FXGH 1F0SA 1S6LA 3H7TA 3O8DA 4ZCNA 3OU0A 4NWKA 4DIIH 2JETC 3ZZCA 1ELBA 1Z6JH 4AFZA 4IBLH 1UK3A 1GL0E 2ZDAH 4BTUB 1TE0A 4Y79A 3GS9A 5FX5A 1NRPH 3V3MA 4I86A 1KXDA 3LOXA 6CHAC 1RRKA 1Y5BT 2AEIH 5DP6A 5FPYA 1EPTB 4RN6A 4Y8YA 4QT8C 1BMNH 1JOUB 3Q3XA 2ZG0H 1QHRB 1N1LA 3M5LA 1TRNA 2BY5X 2FM2A 2ZPQA 4O03A 4OS6A 3TIUA 1GBTA 4LXBH 1W0KD 1V2LT 1NRNH 1A7SA 3P70B 4NWLA 1UVTH 3OEED 1SGCA 2RG3A 3QTOH 3DA9B 1GJDB 1YPHC 2GMTB 5HM9A 1W7XH 1C2EA 3SBKA 3SI3H 1F0TA 3EA7A 3UTUH 4TY6A 1AVXA 1GI7B 2HNTC 7KMEH 1F5KU 4NZQA 7ESTE 1ZSKA 3ZVDA 4YO9A 1O2NA 2OC0A 7GCHF 1P2NA 4CRGA 5LH8A 2BVRH 1C5RA 2ZP0H 1MKXH 1SBWA 2HVXA 2VIWA 2CHAC 2QF0A 3STJA 3M37A 1NY22 2ZFTA 1V2UT 2YMSC 1BQYA 1GHAF 3ZZ5A 1VJ9U 3NPSA 1SLUB 1H8ED 1GI1A 1O3EA 1GJCB 4WH6A 2FOCA 3PLPA 2ZGXH 3T62A 1LHEH 5C67A 1MTUA 2ZPSA 1EB2A 4F55A 2HPPH 3PO1C 4Q2KA 1SKYE 1OS8A 2FWWA 4NGAH 5I46H 2PLXA 2WINI 4NA8A 1A0HB 3SU3A 2VWMA 4JMYA 4GHQA 4MLFB 1GMHF 2WPIS 5HMAA 5A2MH 1RTLA 3S7HB 1AU8A 1BTPA 1ZOMA 3UWIA 7GCHG 4UE7H 4OM9A 3MOCA 4IC5A 2ZDNA 2ZKSA 3S9AA 4OS7A 1Y3XA 3V0XA 2GKVE 3M5NA 3QX5H 4K3JA 2OP9A 4THNH 1S6HA 2RA0A 1ZPBA 1GHAG 5EQQA 1K1NA 2GDDA 3RDZA 5EJ1A 2P8OC 4Y6DA 2G51A 1JRTA 2JJ1D 1V2OT 1GI5A 2FYRA 1LQEA 3URDA 5ESTE 1G36A 1W8BH 4UD9H 5LPFA 3A7WA 1A46H 3MO9A 3U1JB 4ESTE 2BXUH 5AF9H 1GMHG 1CA8B 1GJ6A 3KIDU 1FI8A 1JMOH 4H6SB 4YOGA 2SGFE 4CBOA 1QGFA 2ALVA 3T27A 2VIPA 2RA3A 3SGQE 1E0FD 2CMYA 5C2ZA 5EJLA 4YXWD 4B76A 3A8AA 3LIWA 1AKSB 3B8JA 1AZZA 2OINA 4XE4A 5GDSH 1HPGA 4ABEA 4Q63A 1PPHE 1XUIA 3MO3A 1BRAA 4I8JA 1GHXH 3GDVA 5IDKA 3KYFA 2BDAA 1AMHA 3LGVA 1YYY1 4IC6A 1HIAB 5EPYA 5C1YA 2GZ7A 4Y8ZA 4FVBA 2VGCB 1AVGH 3DSOA 2IN2A 2ANKH 4AORA 1QQUA 3SV7A 2JIZD 2Q6FA 3K65B 1O5GH 2GD4B 2ZFPH 1DSUA 1NS3A 1GBKA 2F9BH 4A6LA 4B75A 1O5EH 2OK5A 4A1XA 4H6TA 2VBCA 4P02A 4XBBA 3UPEA 4CH8B 1W11U 2ZTYA 1HAHH 4ZROA 1ARBA 1IHSH 1NRRH 2BD8A 2FOMB 2ALPA 2ZU2A 2NU1E 2J92A 4TY7A 1GG6B 1DE7H 5E2OA 3LC3A 2H9EH 3OYPA 3F68H 1EJMA 3GY8A 1OSSA 3DSGA 1O32A 1V2ST 3KQ5A 1D9IA 1YCPM 2KZ4A 1C1OA 3S0NA 1TOMH 1ANCA 3PLKA 4Q7YA 3TH3H 1V3XA 2SGAA 2O8MA 1QRWA 2BQ7B 1QTFA 1LPKB 2VJ1A 4ISNA 1QBNA 2C8YB 2Q6DA 1HRTH 2ULLA 2G4TA 3GDUA 5F8XA 3AASA 4J2YB 2Y82A 4CRCA 2QIQA 2SGEE 4FVDA 2HLCA 1SC8U 3IG6B 2QV1A 1YP9A 3K6YA 3U8RH 1Z8IB 2R3YA 3V13A 1QL7A 3ZZ4A 5HXFA 4GUXA 4A5TS 1EZUC 3SORA 1AFEH 1PYTD 4AOQA 3LGUA 3NRLA 4CR5A 1P0SH 8KME2 1CE5A 1O35A 1C1NA 1HYLA 2SGDE 1O2WA 1K1IA 2HWLB 1P9SA 1GI0A 1QURH 1O3GA 1BMAA 3HGPA 2QE7D 3MH4A 1THSH 2SGPE 2V0BA 2I6QA 3PB1E 3SZNA 3AW1A 2THFB 2B7DH 2F3CE 3MNSA 1GVZA 5E0HA 1Q3XA 1AGJA 4CRFA 3PWCA 3F0OA 3SU1A 1Z1JA 1ARCA 1GBIA 4RT1A 1SR5C 3QDZB 3A80A 3M36A 4NFEA 3E1XB 1QJ6B 3U1IB 4WJG2 2EI7A 2STBE 3TK6A 1WOFA 4SGAE 1J16A 1LDTT 2Z9KA 3UWJH 1G3EA 3C1KA 4TPYA 1MTSA 4RKOB 1ZMJA 2GV6A 3EE7A 1GJAB 3HATH 2YNBA 1IAUA 3PM3A 1G3CA 4ABIA 2YOLA 1OYQA 4YOJA 7LPRA 1KTTB 2J38A 3U8TH 3L33A 1VCWA 3RXPA 5EPNA 2FX6A 1MTNB
chains in the Genus database with same CATH topology
1CQQA 2ZFSA 5A0BA 1O2YA 1XXDA 1K9OE 1QBVH 4WWYA 3QN7A 1IQEA 5DP8A 5IYTA 2P8OB 1O2ZA 2AS9A 8ESTE 3PROA 1GBLA 4NIYA 4ABJA 1GCDA 1FIZA 4K2YA 2ZIQH 1GBCA 2BYAX 3M7UA 2AIPA 3MFJA 4FUGA 4NSYA 3UOUA 1FPCH 2WPMS 5AVDA 1MTWA 1C2KA 1UVPA 4NIXA 1LMWB 2G00A 1WCZA 1O34A 1LVBA 1MKWK 2BXTH 2ZDLA 3ZZ8A 1ESAA 2ZU1A 3A83A 2YNAA 3VXEH 3LONA 1C5QA 1C2LA 3GCOA 1FY8E 2LNCA 3BN9A 4NIVA 2AERH 5EXNA 4Y10E 1O3KA 1KDQA 5E2PA 1S83A 1C2IA 2UUKB 2NU4E 1C4Y2 1OP0A 1PQ7A 4IW4E 2Z3DA 3NK8A 1SB1H 3ZV8A 5ABWA 1QIXB 1G30B 1Y5UT 4X6MA 1BTYA 2VWOA 5TCCA 1CGHA 2BLWA 1P3EA 1HAZB 1HLTH 4HZHA 4RKJB 1H9HE 4BAOB 3ODDA 3MHWU 1AE8H 2AGIX 1T31A 2LPRA 1A3BH 2ZHEH 1TX8A 1B0FA 5DP3A 4ZHAA 1GJ9B 4ABGA 5JB9S 1J14A 1ZTJA 3DFJA 3SUFA 4J1YA 3RXFA 1QA0A 4KTSA 2XCNA 1RD3B 5LGOA 3RU4E 1ANEA 3PTNA 1A0JA 4F4OC 4TPIZ 4Z6AH 1D4PB 1C2FA 2ODYB 4YOIA 3RC6A 4BXWA 1K28D 2BD9A 4Y71A 1NU9A 1OX1A 2TGPZ 2FS9A 1U6QA 1W7GH 2ZECA 4ISLA 1J17T 5EW1H 2ANMH 4H4FA 1JBUH 1ELEE 1OWKA 1VZQH 3FZDA 2VWLA 2Z3EA 3RC4A 1WAYB 4OGXA 4O3TA 1MKXK 3TK5A 4NIWA 1FXYA 2BY7X 1NESE 1V2KT 1GBHA 2PUQH 2XC5A 3D65E 2FOGA 2V35A 4FUIA 2ZNKH 2QY0B 1W2KH 1BOQA 2HALA 1IQLA 4B1TA 4CREA 1PJPA 1PPBH 3GDSA 2WPKS 1GI2A 4U2WA 1T4UH 2Z6BD 1N6YA 4O3UA 1CSOE 4JYVH 4CRDA 2VVVA 1NRQH 1ETRH 1H8IH 3RXLA 1DT2A 1L2EA 4X1QU 2GT8A 2R3UA 3GYMA 1C2MA 1HFDA 5C3NA 1MH0A 1QL9A 3AAVA 5EXLA 4FUEA 5ESBA 2UWLA 2O8WA 2D26C 4X2XA 3D49H 1FDPA 4UFDH 3SNBA 4IMZA 1GMDF 1O2JA 5C5NA 1GJBB 2F9VA 1C1TA 1E35B 1EZQA 4JZ1A 1FN6A 4CR9A 4M7GA 3E0PB 1RXPA 2M5TA 3T25A 1GI6A 4K1EA 1ELGA 4TWWA 1XUJA 5JBAS 2ZO3H 3M3SA 2VIQA 2KAIB 2GCTC 1CGJE 2ZWLH 3HKIB 2GZ8A 5FBEA 1GCTB 3SOSA 2BQWB 2BVXH 5L2ZH 3P8OA 1KYNA 1ZHMA 1EAUA 3SU4A 5B6OA 3E8LA 4K8BA 1CT0E 4H42U 1MAYA 1WQVH 3QUMP 1GHYH 1FV9A 1H8DH 3PLBA 5GWZA 4UONA 2B9LA 2EA3A 1GJ8B 1BJUA 3S7KB 1WU1A 3W95A 5JBBS 1ZRKA 1GMDG 1NFUA 1PQ8A 3MMGA 5EOKA 3RMOH 1K2I1 1GI8B 2J95A 3A89A 1D6RA 2OBOA 4WVPE 3FP6E 2AMDA 2OQ5A 1C9PA 1TAWA 2NWNA 3CP7A 5DKMA 3F6UH 4D9QA 3PMAB 1B0EA 1NM6A 3GCNA 1TBQH 1O2GH 1SLXB 1UTNA 2PSYA 4BTIB 1O3IA 1F5RA 1MKWH 1C1WH 1EUFA 2AFQB 4JK5A 1OYTH 3MNCA 1FY1A 1UVSH 3E6PH 1O5FH 1KTSB 1SGEE 6GCHF 1EASA 1K1MA 4OS2A 1ZJKA 1O3PB 4CRBA 1H1BA 5G4BA 3GOVB 4BNRA 1SGFA 2ODPA 2VH0A 5H4IB 1SGQE 2CXVA 2UUFB 1H9IE 1Z8GA 4JZDH 3KQEA 4A1VA 2QXIA 3KNXA 2GP9B 3ZZ6A 1DSTA 1LVYA 1ZYOA 3PTBA 3VB3A 1MQ6A 4B73A 2F83A 2QF3A 1INCA 1BBRK 1LVOA 1JIMA 4MPVA 4YT6H 1AFQB 2GZ9A 3EAJA 4I7YH 5E8EH 1F2SE 5T6DA 4MPXA 1AKSA 3AW0A 4AFSA 3I77A 4Y11E 1TFXA 1ABIH 4R8TB 4WH8A 2BZAA 1E36B 3ATWA 1NFWA 1EKBB 3FFGA 1SGFG 3NCLA 6GCHG 1BDAA 1ZJDA 3K2UA 4X6NA 3RM0H 4MNYA 1FNIA 2BOHB 2OQUA 2Z7FE 1OOKB 1HIAA 2FS8A 2ZHFH 1D3PB 1SOTA 5DP5A 4HTCH 1O2LA 1QY6A 3QTVH 4JZIA 3S9BA 1GBAA 4DY7B 1SOZA 2G81E 4FUBA 2XWBI 1UTKA 1EAXA 1C2JA 1DWEH 1DDJA 1W14U 1KLJH 1GDQA 1O3BA 1CA0C 2A4GA 2SNVA 2FPZA 2UWOA 4F49A 2ZU3A 4A92A 1GBMA 1K22H 4DGJA 1A61H 4NFFA 2F9PA 3BEIB 4X0WU 2W7UA 4X1RU 2Z3CA 2AMQA 4E7NA 4A1TA 2CF9H 3BEFB 1DLEA 4ISIH 2G5NA 1LO6A 1ETSH 1GHWH 1RGQA 2PGQB 3MO6A 1NO9H 4YZUA 4JYUH 2PTNA 3F1SB 4BAMB 1O2IA 1OWHA 3SHCH 4MQAA 1YM0A 1P05A 4GCHF 2BX4A 1MCVA 2WYJA 3RXSA 4AX9H 1TA2A 1ELFA 1CGIE 2CJIA 4MPWA 1AI8H 2RDLA 2BLQA 4AFUA 4A7IB 3V7TA 3P8GA 3RXIA 2Q6GA 3LGWA 3SJKA 3ATIA 4AG1A 4Y0ZE 4GPGA 2B8OH 1G9IE 3SU0A 1C2HA 4ASHA 3I78A 1P2MA 2O8LA 4ABDA 4I31A 1ELCA 4MPUA 3QGJA 2QCYA 4E05H 1O2MA 1UHBB 3HKJB 1AE5A 1Q31A 2P93A 3BF6H 5T6FA 4FUDA 5DP7A 3KCGH 1VGCB 1YKTA 5FCRA 1DVAH 4GVUA 3D23A 5PTPA 1O3FA 2W7SA 1GBFA 5GPIB 1GWAA 1P11E 4GCHG 2C4FH 2G55A 1OWDA 2FDAA 1A3EH 2GCTB 1HAOH 3P6ZB 3SU5A 4XBCA 5FCKA 3SJOA 4D76A 1RS0A 2TIOA 1ANBA 3SW2B 1ELTA 4ZKSU 1MUEB 3U69H 1BRBE 2VB0A 1T4VH 1AUJA 1LPGB 1O5AB 4GSOA 3UR9A 1Z71A 3CS0A 4BAHB 3OY6U 3TGIE 3RM2H 1GDUA 2A4OA 1NFXA 3MH7A 1HDTH 5A8XA 1G32B 4ZAEA 1HAGE 2SGQE 2ESTE 3SNAA 2DE9A 2QYIA 1C1UH 1XUFA 2PKSB 1BBRE 5EG4A 5LPRA 2R2WU 4MNXA 3U8OH 3TGKE 3RP2A 4I8LA 4K1SA 1O39A 2P94A 1NU7B 2HOBA 2FMJA 4D9RA 5T6GA 1Z1IA 1HAVB 2ZU4A 1O5BB 3GY2A 4X1PU 1HUTH 1GGDC 1TNLA 3ZVFA 2GT7A 1W0YH 3I29A 2QXGA 1VJAU 1V6DA 2V3HH 4X2YA 1ORFA 2OBQA 2BMGB 1WSSH 2P3FH 3RXJA 1GI3A 1NTPA 3A82A 4WMEA 5EGMA 3RXCA 3BTGE 5CHAC 3SV9A 1C5YB 2TBSA 4FUCA 3TJNA 1W10U 3M5MA 3M35A 3MI4A 4ZXXH 2XRCA 5EODA 1UK4A 3SV8A 4ZKNU 2B5TB 1SGTA 2A7JA 2JETB 1GL1A 5AHGH 4B71A 5F8ZA 1IQHA 4ZH8A 4XBDA 1BBRH 1KY9A 3ITIA 4X8UH 6CHAB 1TIOA 1MD8A 3MYWA 5FAHA 1P2KA 4BTTB 1AZ8A 2A32A 4NA7A 1O2QA 1K1LA 1GJ7B 2A45B 1PPCE 1C9TA 1RTKA 3F9EA 5GJ4B 2ZU5A 1C1RA 1UTJA 1AB9C 1BMMH 1P12E 4NA9H 1H9LB 2XC4A 3A7XA 2AGGX 1GJ4H 3GCHC 1C5SA 1DUAA 1O2UA 2XYAA 3EQ0H 1XXFA 3ATMA 3TU7H 1EXFA 3FP8E 1CA0B 1TGNA 3VPKA 1MQ5A 3TK9A 2Z9GA 3A7YA 3RXAA 2P3UB 4YM9A 1ZMLA 3Q3YA 1OPHB 1LHCH 3VGCC 2BVSH 2VVUA 2HRVA 1KLIH 2A1DB 1Z8RA 1XKAC 4UDWH 1EB1H 2A5KA 3GISB 1LHDH 5L30H 5K7RA 2CHAB 5E0JA 1H4WA 5FX6A 1P09A 2A4QA 1BJVA 3TJUA 3AAUA 3E16B 3KL6A 3TLOA 1AY6H 4K8YA 1S6FA 2WV4A 1O3JA 4AG2A 3BTFE 1YPKH 1TPPA 4WMFA 1NPMA 1GDNA 2H5CA 3PO1B 3KQCA 5JPMH 3A81A 2H1UA 1CHOF 2OD3B 1YPMH 2Y5HA 1ETTH 1BA8B 4OGYA 1LCYA 3U9AH 3HPTB 4INLA 3T28A 3S9CA 2FI4E 3RLWH 3ZZBA 1BZXE 4LOYH 5K0HA 1TPSA 2BDCA 4DOQA 1LKAA 2NU3E 1ZGVA 3STIA 4YESB 3F9FA 2ZGJA 2A2QH 1QFKH 3F9HA 1G2LA 2JKHA 1O2KA 1TMTH 5A8YA 3T2NA 1EJNA 3SI4H 3MWIU 1UTMA 2OCVB 4GHTA 1CHOG 1GI9B 1O2HA 4Q7XA 3SNCA 2WPLS 3VXFH 1BTHH 1TNHA 3BV9B 2W26A 2PKAB 2ZFQH 3BG4C 1DM4B 4CBNA 1QB9A 1A5IA 1MU8B 3RXQA 1ZMNA 4NZLA 2ZQ2A 2KAIA 2ZEBA 2ZHDA 4MNVA 1PFXC 1ACBE 1PPGE 3RXHA 1F92A 2FYQA 3KGPA 1Q2WA 2XNIA 1QR3E 1SFIA 1SLVB 2A7CA 2R0KA 1TGTA 1P3CA 3SNDA 3ZZ9A 2XCFA 2EEKA 2VWNA 3SNEA 3SJ8A 9ESTA 1UMAH 3A8BA 1O3OA 5J4SA 3SUEA 3TJVA 2BZ6H 3ZZAA 1W3CA 4DJZB 1E34B 3KEEA 1IQGA 3ZVAA 1V2TT 1KIGH 1KXAA 5CE1A 1S0QA 2ZC9H 4I32A 1LQDB 4HGCA 2A2XH 5DO4H 1ABJH 2BLOA 1K1PA 3KN2A 1HAXB 3VEQB 5TCAA 4AB8A 3ESTA 5AFZH 1SVPA 1WUNH 3IWMA 1SPJA 2A0QB 3LC5A 1TX6A 2BY6X 3A87A 1C1QA 1ZTKA 2QGRA 2OC8A 3TH2H 1BB0B 1O2VA 2ZCKP 2JH0D 3O8RA 4YLQH 1UTQA 5F03A 1CVWH 1N8OC 4XFQA 1SGNE 1FUJA 1FAXA 3SQEE 4ZKRU 3MNBA 4RSPA 1L4DA 2Y80A 3VB5A 2VH6A 1O30A 1AIXH 1KXBA 2BD7A 3RU4D 3W94A 1YPJH 2GGVB 2FEQH 1O2XA 3TPIZ 1UJ1A 1X7AC 4DT7B 4X1NU 1EP5A 3L3TA 1QNJA 1O2OA 3M5OA 2PGBB 1ESBA 1RTFB 1EPTC 2D2DA 1QL8A 2A31A 3PMJA 1SGDE 1TNGA 2FZZA 2ZF0H 2PWXA 1UO6A 3SUDA 3OSYA 4XOJA 1SG8B 1DWDH 3RXMA 1N6XA 1XMNB 5DP9A 1QB1A 4Y8XA 2VNTA 5FPTA 1ELAA 1SSXA 1BITA 1P8VC 4BAKB 2GMTC 1HNEE 1WTHD 2P95A 3LT3A 2C8XB 3TITA 4ABFA 2C8WB 1L1JA 4Y76A 1CHGA 1V2WT 3V12A 4AB9A 1EOJA 1F0UA 4GLYA 2HPQH 2UWPA 2B0FA 4I8KA 2BM2A 1UVUH 2OC7A 1YGCH 1OKXA 2CN0H 1EAWA 2FI5E 2R0LA 1EZXC 4CH2B 1Y3UA 1TX7A 3ZZ7A 3CENA 2STAE 3UQOA 2FXRA 1ZZZA 2BTCE 1C5WB 1J8AA 1JWTA 4AFQA 1DXPA 2J4IA 3B9FH 1O0DH 4K69A 4INHA 4AZ2B 3SV6A 1XX9A 3WY8A 1SGYE 4IGDA 3ZVGA 1XUGA 1DWBH 1UCYK 1LHFH 2ASUB 2NU2E 1BHXB 4BOHA 4CHAC 3R3GB 4Q7ZA 1CT2E 2Y81A 1P04A 3SHAH 1MAXA 1Y8TA 1LKBA 1OXGA 1NC6A 1Y3WA 1FLEE 2PSXA 1ID5H 1EJAA 1OWEA 3OX7U 1GVLA 2PTCE 3A7VA 4R0IA 1C5PA 3BTHE 3LKWA 2K1QA 1UVOA 2V3OH 3UREA 4DG4A 1DICA 1B7XB 2ZTXA 1TNJA 1TNIA 3SO3A 1C5TA 1UTPA 4DURA 2ZFRH 1WV7H 1P2IA 3A86A 3U98H 1UHBA 4YLUA 2FTMA 1O31A 3ATKA 4Z0KA 1DXWA 2TPIZ 1XUHA 1QA7A 1AO5A 3M3VA 3SU6A 3LJJA 4DIHH 1TBRH 1T32A 1C5VA 1BTZA 5DG6A 4LZ1H 2H9TH 3SN8A 1S84A 2Y7XA 1JIRA 4KTCA 1RJXB 1MTVA 2J94A 4X6OA 3L6PA 1O2PA 4X6PA 2VU8E 1IQKA 4JZFH 1C5OH 1FMGA 2FTLE 1O3NA 2SFAA 2W3IA 3BG8A 1CT4E 1G2MA 1O36A 2XWAA 3E3TA 3B23B 3R0FA 1J15A 1SMFE 5GXPA 3KQDA 1C4V2 2ZFFH 2AMPA 1MD7A 1P10A 3BTKE 1FPHH 3P8NA 3UFAA 1G37A 1GVKB 5FHTA 2A7HA 2PUXB 2VGCC 4U01A 5FXLA 1C1SA 4LZ4B 4AGKA 3RMNH 3VFEA 1O3LA 5A0AE 3FVFB 4NG9H 1BRUP 1TWXB 1EZSC 3N7OA 5F6MA 4FU8A 3LJOA 1KSNA 2FODA 1TMUH 1V2QT 4X8SH 1P2QA 5L6NH 1JXPA 2F9UA 4GAWA 1N8OB 4JCNA 2O8TA 4FUHA 2C3SA 1P06A 4PROA 1HAVA 1QQ4A 1O3CA 1V2PT 3FANA 2BDYA 3ODFA 2Y5GA 3SU2A 2J34A 1GG6C 3QZRA 4UFEH 2Y5FA 3QZQA 1OP8A 1AQ7A 1DANH 2F9OA 4ABBA 5C1UA 4CRAA 2IPHA<