1W13U

Urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w13U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w13U01
1S6FA 5F8XA 1O3DA 1TPSA 4WMFA 1NRSH 1C1QA 2QA9E 1LQEA 3TH4H 1FY5A 1KLTA 5EQRA 1QCPA 1WUNH 1GMHG 1E38B 2ZFFH 2OD3B 3E6PH 3ODDA 1OWIA 2OC0A 1TPAE 4K3JA 3FANA 4YO9A 1BBRH 1Y3YA 3QDZB 2YNBA 2QXIA 1A61H 1P05A 4AFUA 1G9IE 1RTKA 1Z8RA 3I77A 2ZU3A 1EATA 1O32A 1VJ9U 2STAE 3KNXA 3SU1A 3MU4A 1UTOA 3VB3A 2NWNA 6GCHF 3S9CA 3A82A 3VXFH 1V2QT 4B71A 1S5SA 2V3HH 3FFGA 1N1LA 1NO9H 1WCZA 3MH7A 1EB1H 2HRVA 3CS7A 1A3BH 3T26A 1DWEH 1WTGH 2BDHA 3BIUH 4CH2B 2ZECA 2FESH 1RTLA 1D6WA 4INLA 3MOCA 1DM4B 3E1XB 1ELDE 2VWLA 2XCFA 1GDUA 1ARBA 3MH4A 5A8ZA 3EQ0H 3AW1A 4A1TA 4AFQA 1HJAB 2GGVB 1O5GH 2B0FA 2O8TA 2BLQA 2BX4A 3RXIA 1ETSH 1GVLA 2G5NA 4GCHG 2CV3A 1C5NH 2PR3A 2V35A 1GVKB 1THSH 2SGEE 1OP2A 3MYWA 2D26C 4FXGH 1ELVA 2PKAB 1ZJKA 5L30H 3U69H 1NS3A 1ZHRA 3RXPA 1ELBA 2ZI2H 4X6PA 4ZAEA 3TGKE 3SGAE 4R0IA 5DGJA 3TJVA 2ZCLP 8KME2 1P11E 2ZPRA 5AF9H 1J16A 4YT6H 4IC6A 3STJA 3T29A 2IJOB 2VH0A 1IQMA 2ZWLH 4ABBA 3SI3H 1FDPA 4BAOB 1TNKA 1H1BA 1O5DH 4LXBH 1QURH 1QRXA 4ISIH 4JYTA 1W3CA 4GLYA 1L1NA 2G8TA 4K69A 1AD8H 1WU1A 2UUYA 4CHAC 1C1WH 4TWYA 1NFYA 5EW1H 1UK4A 1D6RA 3SZNA 2THFB 2A7CA 1KTSB 3B9FH 1FN8A 3BG4C 1Q31A 4NCYA 4FUEA 4H6TA 4O03A 4Z0KA 5EQQA 1C2GA 3BTFE 1HFDA 4A5TS 3MI4A 1FAXA 4WH6A 1G30B 1A0LA 3E0NB 4A1XA 1W8BH 1ZPBA 1G3BA 4I8JA 3BTKE 4Z6AH 1TGSZ 1O2YA 1O33A 1MTNB 1GJCB 1UO6A 3TU7H 5GIBA 1FMGA 2WINI 1A1RA 1T8MA 1DT2A 3MU0A 2AGGX 3RDZA 1DUAA 1TGTA 3SNDA 1G37A 3SU4A 2C8WB 1XKAC 4GSOA 1DLKB 2HNTC 1KDQA 3RXLA 4Y8ZA 2ZTYA 3F1SB 1GMCF 1VCQA 4IMQA 2P3FH 1O2GH 4MPXA 2BLVA 1QHRB 2K1QA 2Q1JA 3RXEA 1IQKA 2DE9A 3SOSA 4ABFA 1BTUA 3KQBA 4ZHMU 3F9GA 3UUZA 3MO9A 1L4ZA 1FN6A 2R2WU 1C5MD 3BEFB 1AE8H 4ZXYH 1XUJA 4WMDA 1SLXB 2VGCB 4H4FA 1E0FD 1PPGE 1V2MT 1EOJA 1YKTA 2PUQH 3A8DA 2TPIZ 3W94A 4CRBA 2SFAA 2DE8A 2RA0A 2ZGJA 4MNVA 4AX9H 1A7SA 2ZCKP 4WXVA 4CBNA 5K7RA 2BY7X 1YPMH 2F9PA 1CHOG 4CRGA 2VNTA 1T31A 4TPIZ 1JOUB 1T8OA 1XMNB 1TABE 4K1TA 1O2ZA 4GAWA 1H4WA 2D2DA 2VVUA 2Y7ZA 3UNSA 1BBRK 2BX3A 4X8UH 2GZ8A 1GHWH 1ABJH 4B2BA 1O5BB 5HMAA 2CF9H 3UNQA 4HTCH 5GWZA 1GJ9B 2ZGXH 4WJG2 4K5ZA 1FI8A 2P95A 3H5CB 1KXFA 5I46H 1OPHB 4DJZB 2GTBA 1SLVB 2JETC 1PPHE 1WQVH 3A8AA 1OKXA 1MBMA 6CHAB 1LTOA 1ZLRA 1BJVA 3U98H 2OQUA 1IQEA 4ISNA 1GJ8B 1GI3A 1JWTA 4CRFA 3TGIE 3T25A 3I78A 1XUIA 1DSUA 3HGNA 3A7ZA 1V2UT 2XWBI 3URDA 1QBVH 1T4VH 4X1QU 1LDTT 4OS6A 2JH6D 4NFFA 1ETRH 3TJUA 2YOLA 2QV1A 3OTJE 2WYGA 1UVSH 1HAHH 3RC4A 2OP9A 1YC0A 3RXMA 1XUKA 5E2PA 5F8ZA 1RS0A 3OX7U 1W7XH 1YBWA 1BZXE 2QN5T 1K21H 1SBWA 3V3MA 1E36B 1VGCB 3U9AH 1GJ7B 2ZPSA 3PB1E 2BOHB 3DA9B 4MPWA 2W7UA 1VCPA 1A46H 2ASUB 4WVPE 2H9EH 1J14A 1CVWH 4MDSA 2ZU2A 3SU0A 2CGAA 1L0ZA 2PUXB 1Y3VA 1CBWC 3P70B 2A7HA 3E91A 3STIA 5E8EH 4D9RA 1AVXA 1NC6A 3D23A 1CT0E 4MG3A 2AH4X 1SI5H 3PYHA 4ZUHA 3BEIB 3LH3A 1ESBA 3UOUA 1RGQA 4BXWA 3QX5H 1YPLH 1TMTH 1TPOA 1MTVA 1SC8U 3GCHB 3FZZA 1CA0B 3F9HA 1NROH 3BG8A 1TA6A 2C8YB 3B8JA 2XYAA 3A85A 5SGAE 2ODYB 2ZO3H 5GXPA 1O34A 1GCTC 4NZQA 4WY3A 5PTPA 4Y7AA 1O3LA 1ELAA 3VFEA 4UFEH 1O2TA 2BM2A 4J2YB 2QXGA 4I8HA 1YLCA 3A7TA 2FLRH 3MO6A 2BZ6H 1Z7KA 3T27A 5C5NA 1GJBB 1NRQH 3O8RA 2TGDA 1F0TA 3NWUA 1GMHF 3OU0A 3T62A 1T8NA 4CR5A 3LU9B 4DGJA 1PPBH 5C1XA 4ABAA 1ZTKA 3LGIA 1G2LA 1SGCA 2NU4E 2UWOA 1QFKH 2HNTF 4X8TH 2AS9A 5CHAC 1HAPH 5EXNA 4AYYB 4AB8A 1QBOA 3ITIA 1BRUP 2Y7XA 1F5KU 1MD7A 1ESAA 1O2HA 5A0AE 5T6GA 1AFQC 3D49H 3QTOH 3UOPA 2P8OC 1SQAA 1GMCG 1QL9A 1YPKH 1AVGH 2P3UB 1DXPA 2B9LA 4CRAA 1YPGH 3U8RH 2FX4A 2FOMB 3VGCC 2BHGA 1W13U 1GBFA 2BDGA 4OS2A 3P8NA 3LH1A 5DP4A 2ZQ2A 1GJAB 3V12A 1N8OC 1ETTH 3NK8A 5DJ7A 2Z9IA 3AAVA 5G4BA 1P01A 1PFXC 4AG2A 1UJ1A 3JZ1B 4FUJA 2J92A 3MHWU 4Y6DA 1BRCE 3EA8A 2BYAX 2TRMA 1QJ6B 3V0XA 4GCHF 4X6MA 3EAJA 1S0QA 3M5MA 3F68H 3SJIA 1W10U 2H5DA 8GCHF 1HJ9A 3URCA 1DWDH 4X2VA 9ESTA 4Q80A 1C5UA 1HB0B 2ZF0H 1HIAB 1C5LH 1OYTH 2TGPZ 2AYWA 1O2OA 3HPTB 4OS5A 4Y10E 2Z7FE 2Z94A 2XBYA 1QA0A 5AVDA 1DY8A 1D3DB 2PKAA 2WUCA 1HAXB 2PHBA 1V2JT 4U30A 3GY2A 1P9SA 3ODFA 1C4U2 3GDVA 2ZA5A 3FP7E 1MBQA 1Z6EA 4HI3A 1N6XA 3OY6U 2R9PA 3S7KB 3SV9A 2H9TH 2XCNA 2GX4A 3KHVA 3VB7A 3NZIA 1RIWB 2AMDA 1H8DH 2ZTXA 3W95A 1PQ7A 1FUJA 1HAIH 2VIWA 1P10A 1OP8A 3A8BA 2ANYA 5T3HA 2TGTA 2A4QA 3RXDA 1O2MA 2G00A 2G52A 2Y6TA 2FOFA 1O2QA 1J17T 1P8VC 4ZMAH 1GI4A 3LKWA 4FUHA 2O8MA 1QQUA 2A31A 2AGIX 1AN1E 1G3EA 2I6QA 5FXLA 1VR1H 5AFYH 3IITA 2Y81A 1EAUA 3RP2A 4ZKRU 3SV6A 4IS5A 3Q76A 1SGYE 4LZ4B 4MPUA 4JZIA 3UNRA 1V2PT 1G3CA 4K8YA 2ZDAH 3P8GA 1O2XA 4DCDA 4AORA 5IDKA 3OYPA 1QTFA 1Z1IA 3RXBA 4J1YA 1C2EA 3RXHA 1Y5UT 1NPMA 1XXDA 3ZYEA 3EGKH 2BY8X 3QK1A 1ELFA 5EXLA 2QYIA 3PWCA 1WAYB 3SV8A 1FONA 5FHTA 1EQ9A 1LHGH 3TJOA 5DK1A 5C5OA 1V2KT 2PKSB 4B2CA 4D7FA 5EW2H 4D7GA 4Y71A 1WYKA 3A7YA 4KTCA 3SUFA 2P59A 1AZ8A 3UREA 2NU0E 1V2VT 1O2JA 1AY6H 2WPJS 3ZVDA 3A83A 3MFJA 3E90B 1C5PA 1MCVA 1GGDC 1PPCE 2FOAA 3RXKA 3GY8A 1QJ1B 3F6UH 1BITA 2WPIS 2ZC9H 1BMAA 4FU7A 2F9BH 1CHOF 1GJDB 2ZGHA 5JB9S 1GMDF 3D62A 2ZEBA 1O2RA 4CRDA 3RXOA 2BTCE 2J9NA 2IOTA 4DVAU 1Y5BT 3M7TA 3P92A 1HDTH 1P57B 1SGFG 2QIQA 4KTSA 3A81A 2PGQB 4OGYA 4TPYA 5DP8A 1S0RA 4LOYH 2HVXA 1GHZA 1MAYA 1F92A 1Z1JA 2IN2A 3BSQA 4XFQA 1G36A 3AVZA 4GHTA 1GBAA 4WMEA 1ANDA 1ZTJA 4ZKSU 3GICB 1T8LA 1C1RA 5F8TA 3SBKA 1V6DA 5EQSA 1O3HA 3QZRA 2EEKA 1CT2E 2I6SA 3CENA 1SGIB 1V2WT 2OTVA 2WYJA 2Y5GA 3RXVA 3RXJA 1UVPA 1GDQA 5IYTA 3U8OH 4ABEA 3P6ZB 3KL6A 1W7GH 1PYTD 1ELEE 1YGCH 1SQTA 5L2YH 2FXRA 1X7AC 2STBE 2JH0D 4BTUB 2QF3A 3ZZCA 3S7HB 3I29A 4K1EA 3R0FA 2BDCA 2G5VA 1SGTA 4B2AA 4XBBA 5DP3A 1HAVB 1O3BA 3BTHE 4F49A 3ATLA 4A92A 1P2IA 3ZVCA 1FJSA 1YPHC 2FS8A 1YM0A 1E34B 5EXMA 3ZZ7A 1BA8B 2FX6A 3Q00A 2CHAB 1Z71A 1TWXB 3FP8E 1LPZB 1C5OH 3RMMH 3E8LA 1UTMA 1ZSKA 5T6FA 1W12U 3A8CA 4IGDA 1NM6A 3DFJA 1C2HA 1H9LB 4JK5A 1AU8A 2AERH 4UD9H 3RC5A 8GCHG 1SQOA 3LGVA 1CGJE 2ZNKH 3BEUA 3SJ9A 2J94A 2FYRA 2LPRA 2FEQH 4KGAA 1IAUA 3NUMA 3PO1B 3M5NA 1B0EA 3K65B 3A80A 1WBGB 1C1NA 2H5CA 1JMOH 2FS9A 2ZDLA 4TY7A 1C5TA 1LHEH 3KGPA 1TBZH 1FY1A 3RU4T 2VJ1A 1OS8A 5FCRA 1W11U 1O37A 3LONA 3M3VA 1ABIH 3O8DA 2D8WA 2AGEX 3QO6A 1W14U 4K2YA 1K1OA 1VZQH 3RXAA 4BXSA 2ZKSA 2ZDKA 3TK6A 4ZROA 4YT7H 3RU4D 3RXUA 3LJOA 3RXQA 4FUDA 3RXCA 1QNJA 4GPGA 1S82A 4FUBA 1CT4E 3KF2A 1S85A 1RJXB 1PPFE 3Q77A 4FU9A 4NA8A 5GJ4B 1XUGA 4RSPA 3AAUA 2XBVA 5EGMA 1EUFA 1C1PA 1GCDA 4Y8XA 3SNBA 1D3TB 4HZHA 3L33A 3DUXH 1BMMH 3ZZ9A 2KAIB 4B75A 2ZCHP 2ZFPH 1DUEA 1ID5H 1F0RA 3DFLA 4ABHA 2VH6A 3LGYA 2ZHWH 3NCLA 1OWDA 2OXSA 1GBKA 4VGCC 1C2FA 1EJMA 1PPZA 1RFNA 3RMLH 5JYIA 1ACBE 3SHCH 2FOHA 5BRRE 3ZVFA 3K6ZA 3PMBB 2UWLA 4ZXXH 6CHAC 4NSYA 1Z8JB 3H7TA 4OS4A 5FBIA 3GYMA 1ZMNA 5EOKA 3SQEE 1EAWA 3SO3A 1AE5A 1BB0B 1GHAF 1SGQE 4ABGA 2BMGB 1O31A 2AMPA 4NIWA 3QGNB 1QB1A 2ZFTA 1O3AA 1GG6C 1TFXA 3CP7A 3M35A 1AMHA 2PW8H 2SGFE 4DG4A 3SUDA 2LNCA 3FP6E 1TX7A 1MU6B 5B6OA 1SHYA 1IQNA 1C5RA 1GJ4H 3TPIZ 5HM9A 3R3GB 2ANKH 2PLXA 1BIOA 1DX5M 5L6NH 1SPJA 1ZGIA 1AVWA 4X6NA 1C5WB 4D76A 1NRPH 1AO5A 3C27B 1PYTC 4ISHH 5L2ZH 1T7CA 3RXTA 4DURA 2IPHA 2UUKB 1LHCH 3QTVH 1J8AA 3RC6A 1AWHB 4JMYA 1C5XB 3M7UA 1IQFA 5EPNA 2XC0A 1KXBA 5DP5A 3MNCA 1GMDG 1AB9C 1TOCB 2AMQA 3HK6B 2SNWA 2BY9X 1JRTA 3O8BA 2FTLE 1HIAA 5DP6A 2GP9B 1TNGA 3BG4B 4MVNA 1NU7B 1YCPM 3H7OA 2GCHF 3NPSA 2F9OA 4ISOA 2ZFRH 3T28A 2A5KA 2ZU5A 5TJXA 2G51A 1TGCA 4X1PU 2BY6X 1JRSA 3UY9A 4UONA 4JZ1A 3ZZ3A 1K22H 1DWBH 1O2UA 2F3CE 2QC2A 4YOGA 1CA0C 4U2WA 2TBSA 4DIIH 3PTBA 2AFQB 2AIPA 1AUTC 3K6YA 3FVFB 2F83A 1C2IA 1EPTB 1AFEH 5TCCA 3RUOA 3MNXA 1NTPA 1G3DA 1DANH 2BDYA 3LGWA 2C3SA 2W7SA 2BVXH 2W5EA 1PQ8A 1KSNA 1CSOE 1BRBE 4MPVA 1GBDA 3ESTA 3S9AA 1C5QA 1A5IA 1DICA 1F2SE 4IBLH 5FPSA 3ATKA 3MU5A 3LGUA 2ZHFH 1BMLA 1OX1A 5GCHF 1QB9A 5EG4A 2BD5A 1BTXA 4CR9A 1GPZA 4ISLA 4Q7ZA 2A0QB 1THRH 1AWFH 3TGJE 3F9FA 1BCUH 1UTPA 1FV9A 1MTUA 4Y0ZE 1EB2A 4MQAA 1BJUA 2B7DH 3A87A 3PWBA 5C1YA 1O5CB 1HXEH 3VB5A 4OS7A 1ZTLA 1ZHPA 1YPJH 2BLWA 4X8VH 1DSTA 3EE0B 4X6OA 3BTWE 2OLGA 1AGJA 4OGXA 1LMWB 1V2LT 1EP5A 1CU1A 4H42U 2RG3A 2WPMS 4YOIA 2F9NA 2ZGCA 2G55A 2FM2A 3M5OA 1EZXC 2XC5A 2UUJB 2R3UA 3VEQB 3A7VA 4M7GA 1EZSC 5A8XA 1GBJA 3SU3A 3FAOA 2Y80A 2R0LA 3A89A 4H6SB 1ZPCA 1GBBA 1TGNA 5FAHA 3LPRA 1SLWB 3PROA 1XVOA 1BHXF 1EZUC 1EJNA 2SGDE 4FUCA 2A4OA 4OS1A 3ZV8A 3KCGH 2CJIA 4X8SH 1ZGVA 7LPRA 1WQSA 1QBNA 3UPEA 2PV9B 3SJOA 1ARCA 3SU6A 3BIVH 5FPYA 3HKJB 2JETB 2Z9LA 2QAAA 2WV5A 3BF6H 2AIQA 3MH6A 1GHBF 8LPRA 4AB9A 1DVAH 2C8XB 2GKVE 2FDAA 3A88A 3RLWH 3ZYDA 2H6MA 2SNVA 2HPQH 5AFZH 1O3IA 1GL1A 1K1JA 1EAXA 2GT8A 4I33A 1AI8H 2Z9GA 3Q3YA 1TX8A 1BDAA 3QZQA 4A7IB 5ESBA 1P2QA 1QR3E 2Q6DA 5FX6A 3DD2H 4I7YH 1FXYA 5EU8A 4NFEA 4NZLA 1RIWC 2HNTE 3SGBE 1BRAA 1F7ZA 1KXAA 3PMJA 4UDWH 2VIOA 1JBUH 3UIRA 2J2UA 1HNEE 4BOHA 1O5EH 1GHAG 2GDDA 1XKBC 3AASA 4B1TA 1MQ5A 1CBWB 1YCPK 2FI3E 4YM9A 5J4SA 1SGDE 2A2QH 1RXPA 1MKXK 3TH3H 5E0JA 1QB6A 1VITF 1ZRKA 3LT3A 2PTCE 1HAVA 1WOFA 4DT7B 1ZZZA 1C2JA 1FY8E 2XC4A 1IQGA 2ZFQH 1EZQA 1HV7A 1P0SH 2BZAA 3P17H 1MZDA 2Y5FA 3SORA 1W0YH 4HFPB 1P2MA 1S81A 8ESTE 1HGTH 1MH0A 2OUAA 1SMFE 3ZZ8A 1S83A 1ZYOA 4LK4A 3K9XB 5JBCS 4ZH8A 1YPEH 5ETXA 3BTEE 5K0HA 1P2OA 4IN1A 1TBQH 4YESB 1LPGB 1C9TA 1D3PB 4XOJA 1UK3A 2BD7A 3V7TA 1D9IA 4UFGH 3BTGE 5A2MH 5LPEA 1F5RA 5H4IB 1HBTH 1HJ8A 1K1NA 4U32A 2C90B 1DS2E 2GCHG 1GBHA 1UHBB 3BTTE 1HAYB 2FI5E 3UQVA 1A5HA 2XRCA 1FAKH 1SG8B 2Y5HA 1L4DA 4MNWA 2BD4A 3SV7A 2G4TA 4O3TA 1A3EH 4JCNA 2R2MB 3M61U 1XUHA 3A7XA 2GCTC 4KELA 3Q3KA 3ATWA 4ABJA 4ASHA 2BOKA 2GV7A 1UTKA 1HCGA 3SNAA 4WH8A 4XE4A 2O8WA 4GVUA 3QWCH 5JBTA 5C20A 3SU2A 2ZFSA 1AKSB 1GVZA 3GCTF 7GCHF 1GBTA 2A7JA 4FUIA 3F9EA 1XM1A 4DIHH 3LGTA 1O2KA 5GCHG 2Z6BD 3ZZBA 4IW4E 1SGEE 3K2UA 1FPHH 1TMUH 1YP9A 2NU3E 1EKBB 1TIOA 3ZZ5A 1E35B 1RD3B 5E0GA 3VGCB 1QRWA 1GJ5H 4IN2A 2KAIA 1IHTH 2FO9A 1PQ5A 1ANCA 1N8OB 1ZHMA 4E06H 1EASA 1Y3XA 2R3YA 2BQWB 2Y82A 3MH5A 3FZDA 4UFFH 2XNIA 1KTTB 4JZDH 1MZAA 4ABIA 1RRKA 1UCYK 1P03A 1QQ4A 2WPLS 7KMEH 3GY5A 2ILNA 1Y3WA 1MTWA 1Z8GA 1SGPE 2OINA 3M3SA 1MD8A 2PSXA 1DDJA 1KLIH 1UVTH 5CE1A 3SV2H 2GDEH 3U1JB 3PLKA 2V3OH 1TOMH 2OCVB 3SN8A 1V3XA 1K1LA 4AYVB 3A7WA 2GVFA 1KXCA 5EODA 4AZ2B 1F5LA 4UE7H 1AHTH 1ZMLA 3GYLB 1OXGA 1EOLA 1FIWA 1WSSH 3L6PA 4Y79A 5HYOA 1NRRH 1HJAC 4DOQA 4X2WA 2ZPQA 1AUJA 2QXHA 2JH5D 5CMXH 1UTNA 1E37B 3M3TA 2J38A 1KY9A 1TGBA 3HATH 2A1DB 2CMYA 3MNBA 2FOEA 2FWWA 3SGQE 3VPKA 1GHBG 1EX3A 3PO1C 1M9UA 1MTSA 5C2ZA 4Q7XA 2PSYA 2VVCA 4X0WU 5FBEA 3ZVBA 1SFIA 4UEHH 1BUIA 3S69A 1HUTH 1SSXA 1U6QA 2CF8H 3UTUH 1V2TT 4RKJB 1G2MA 1C1UH 1N6YA 1ELGA 3SJ8A 3E3TA 2H1UA 2HLCA 4CBOA 1GI1A 1UK2A 2XBWA 1GI8B 1O39A 1SGFA 2HOBA 4AFSA 1FIZA 3SW2B 4CH8B 3LC5A 1O38A 2V0BA 1UTJA 2H9HA 2VIPA 4K60A 4F4OC 2ZHQH 1Y5AT 4RKOB 1EPTA 1MU8B 3KEEA 1ZR0A 4SGBE 2A4GA 1O3FA 1TBRH 4AG1A 3QN7A 4FU8A 2G4UA 2FLBH 1L1JA 4Q7YA 1ZSLA 2HGTH 1O36A 3TITA 2GMTB 3IG6B 2B5TB 1K1PA 1C9PA 2AEIH 1DE7H 1VITG 3BV9B 3RMOH 1ZSJA 2BLOA 5ABWA 4MNXA 2EC9H 4B74A 1GI0A 1SOTA 3ATIA 4O9VA 1J15A 1MTNC 2ZZUH 4WXIA 3GDUA 4KTUA 4ZKNU 2FOCA 1SGNE 3MTYA 1FY3A 1IQLA 4CRCA 1KLJH 3ZVEA 2A4RA 4Y0YE 2GV6A 3EYDA 1GGDB 3KN2A 1C5YB 1P3EA 3MO3A 2BQ6B 2A5AA 3RXSA 1HXFH 1YF4A 1YLDA 2ZDVH 3MU8A 2UWPA 1L1GA 1DITH 4FUGA 5AHGH 4AN7A 3TK9A 1QA7A 3LJJA 4X2YA 1DLEA 1P3CA 2A32A 1DXWA 2BD3A 1GHXH 3ELAH 5E2OA 4E7RG 1O30A 1O2NA 1C1SA 2FIRH 1ZOMA 3M36A 3PMAB 1SVPA 3ZVGA 3DHKH 4BAMB 2A5IA 4ESTE 1C4V2 2QF0A 2SGQE 1P2JA 5JBBS 3TLOA 2OC1A 3MMGA 2BDAA 1VCWA 2OBOA 2VGCC 3P95A 1AZZA 1DFPA 1O2PA 1B7XB 4A1VA 2EI8A 1GBMA 2XWAA 1MKWK 1DWCH 4K1SA 4PROA 1SGRE 4B76A 1LO6A 3OSYA 1S84A 1T4UH 4BANB 1A2CH 1GI2A 2WUBA 3TH2H 2QGRA 1PPEE 4GHQA 1H9IE 3QLPH 2F91A 1C1VH 5A0BA 2C8ZB 1QIXB 2DUCA 2FTMA 2Z3EA 3GCTG 3UWIA 7GCHG 4AFZA 1P04A 3PV4A 5A09A 4AGJA 1LVMA 3EDXB 3G01A 1FLEE 1O3EA 1LVOA 5FX5A 2G81E 5C1UA 1SOZA 4ABDA 1LCYA 2XTTB 1WTHD 5DKMA 5JPMH 1NN6A 1C1OA 1HLTH 2BVRH 7ESTE 1LKAA 1P09A 1TQ0B 2R0KA 2GZ7A 3BTDE 1C5VA 4E05H 5FCKA 2VWNA 1HAZB 1NZQH 1OOKB 1P9UA 3HKIB 1LHDH 1TE0A 1Y3UA 3RLYH 1BTHH 1EPTC 3QUMP 4Y11E 3SQHE 3KIDU 1P12E 2CN0H 1TNJA 1Y8TA 1LHFH 1XVMA 2HPPH 1FQ3A 1O35A 1SL3A 2BQ7B 2P93A 3RMNH 4NIXA 3ENSB 1CGIE 1FPCH 3MWIU 1NU9A 2GD4B 3N7OA 3AW0A 1O3GA 1ZRBA 2Z9KA 1TNLA 2O9QA 1O3KA 5JDUB 2WV4A 3RM2H 1O2SA 2PGBB 3BTME 2HWLB 4NA9H 1YCPH 5C67A 4CREA 2OC8A 2ZHDA 5JBAS 3GISB 2WPHS 3RXGA 1MKXH 4B73A 2V6NA 3SUGA 2NU2E 1SHHB 1C4Y2 4ZHLU 1P02A 4D8NA 2OBQA 1VGCC 1BT7A 4BTTB 2ALPA 1TALA 1GJ6A 4XBCA 1MUEB 4INHA 2XXLA 3ATMA 2A45B 1BHXB 1K9OE 1BTZA 1PJPA 2C93B 4MTBA 4CHAB 3UR9A 5DG6A 1UCYE 1BTWA 1TNIA 4NWLA 4RN6A 2JKHA 4MNYA 1C5ZB 1TYNA 3HGPA 1O5AB 2UUFB 1BOQA 1A0JA 2NU1E 2EI7A 1BQYA 1JIMA 2BDBA 3GCHC 1SR5C 1CO7E 1CQQA 1C5SA 2ODPA 1PQAA 1EJAA 1O3MA 1K28D 1QL7A 4MLFB 1UHBA 2QCYA 5C3NA 4X2XA 2RDLA 1C2MA 1CE5A 3P8OA 1BTYA 1ANBA 1FY4A 2B8OH 1QY6A 2BD9A 4I32A 5DO4H 1UTQA 1ESTA 1K2I1 2BXUH 1Z6JH 4VGCB 1NESE 2FI4E 3PLPA 4Y8YA 1O2IA 3PLBA 5J4QA 5A0CA 3RXRA 1LVBA 4JK6A 2PTNA 1D3QB 3KQEA 1O3OA 3S9BA 1TAWA 4TY6A 5T6DA 1LKBA 1HRTH 4R8TB 3WY8A 4NGAH 1QGFA 2ZIQH 3PM3A 1TA2A 1AKSA 3E0PB 1YPHE 6GCHG 4SGAE 2J4IA 1GG6B 1GBLA 2FYQA 1LVYA 4KP0A 1TLDA 3U1IB 4JZFH 3RXFA 3QGJA 1INCA 1GI6A 1SLUB 2EI6A 5EPYA 2YNAA 3Q3XA 1OWJA 1DY9A 1GI5A 4IC5A 1CHGA 1EAIA 3KQCA 1O2LA 4THNH 1DPOA 4I8GA 4NA7A 5BPEA 3OY5U 1O0DH 1HYLA 2FOBA 4FVBA 3TNSA 4ZKOU 2VINA 1SFQB 5GPIB 3LC3A 2VIQA 3TIUA 1UCYH 1NY22 2O8LA 1LQDB 2TGAA 1T32A 2SGPE 3GY7A 1KIGH 3PMHB 1C2KA 2VB0A 3E16B 3TNTA 1AB9B 1QJ7B 4E7NA 4BAQB 5JB8S 1TQ7B 2Q6FA 2ODQA 1GI7B 1KXEA 3ZZAA 4TWWA 9LPRA 1DOJA 3EA7A 2J34A 3C1KA 2FPZA 4XBDA 1GBIA 1OYQA 1ZPZA 5LPFA 1A4WH 2XBXA 3V13A 1V2ST 4K8BA 1CA8B 5GDSH 1OWKA 1JIRA 2ANMH 1HAOH 2Q6GA 4BAHB 2BXTH 4AOQA 1V2OT 3NXPA 4ZHAA 2ULLA 3GY6A 1C2LA 1L2EA 1LPKB 2W3KA 1GHVH 1JXPA 4DW2U 3ZZ4A 2VVVA 5A8YA 4YLUA 4BAKB 2ZDNA 1A5GH 2Z3DA 3SNEA 1O5FH 1EP6A 2OQ5A 2A2XH 1TRYA 4X1SU 1D4PB 2P16A 3BTQE 5F03A 3M7QA 4U01A 5DP9A 2ZP0H 1UTLM 4YLQH 4X1RU 1B5GH 3LDXH 2ZGBH 1J9CH 1ANEA 4INKA 2XW9A 1FNIA 1NFWA 3SI4H 3UFAA 2O8UA 2FP7B 1VJAU 2PWXA 4WWYA 2VIVA 1GBCA 1NT1A 1KDQB 1AIXH 2QY0B 5HGGA 2BB4A 3T2NA 1FZZA 5LGOA 1IQIA 3UQOA 3U8TH 2BD8A 1GBEA 4YTAA 1H8IH 3SU5A 2SGAA 5LH8A 2EA3A 3P8FA 1QRZA 3GCNA 3GDSA 4QT8C 1EXFA 2FMJA 2HALA 1P06A 1ZJDA 1TX6A 2VIDA 1O3NA 1XX9A 2GT7A 4JYUH 2ANWA 1TNHA 4D9QA 3L3TA 3SNCA 2C4FH 1P2KA 4WF8A 1TRNA 2ZU1A 4NIYA 3IWMA 1NFXA 2RCEA 2ZDMA 4YOJA 2ESTE 1MQ6A 1UVUH 1TB6H 4BNRA 2FODA 1A0HB 2FOGA 3EA9A 1O3CA 4DY7B 2VWOA 1NFUA 1GCTB 3UWJH 1B0FA 1TPPA 1S6HA 4YZUA 3O8CA 1K1MA 2W3IA 1C1TA 4JZEH 3JZ2B 1THPB 1NRNH 1BTPA 4Q2KA 1O3PB 2PKSC 3ZV9A 3VB6A 2TIOA 2GZ9A 4X1NU 2F9VA 2WPKS 3KQDA 2D1JA 3MU1A 3S0NA 1GI9B 3ZZDA 1MMJN 3VXEH 1C2DA 1CGHA 5LPRA 1Y59T 1GHYH 1HPGA 1OP0A 2ZHEH 3CS0A 1RTFB 6ESTA 1ELCA 3GY4A 3RM0H 1O2VA 5HXFA 2BY5X 3BN9A 3SUEA 4FVDA 3SHAH 1G32B 2CXVA 3MNSA 5CHAB 5ESTE 1MKWH 1GWAA 2BDIA 1W0ZU 2P94A 2F9UA 1IQHA 1F0UA 4I31A 1OSSA 3GCOA 5TCAA 1Q2WA 1BMNH 2ZG0H 1AFQB 3TJNA 2P8OB 1V2NT 1GDNA 1ELTA 3NKKA 6LPRA 3UR6A 4Y7BA 3TK5A 4O97A 5HM2A 1OWHA 1TMBH 3LOXA 1K1IA 2ZQ1A 3RU4E 2ZTZA 5DP7A 1QL8A 1YYY1 3GY3A 1TRMA 1MAXA 1H9HE 4XSKU 1XXFA 1ZMJA 1TONA 2VWMA 1O3JA 1GL0E 4AGKA 4Y76A 1VITH 4HGCA 3A84A 1UMAH 1KYNA 2Z9JA 1BBRE 3T5FH 2BVSH 2QXJA 4XDEA 1XUFA 1HAGE 4A6LA 2OC7A 4NG9H 1OWEA 4KKDA 1W2KH 5DPAA 4IMZA 1C1MA 3GOVB 2J95A 3HK3B 3ZVAA 1UVOA 3SJKA 2FZZA 3TVJB 5E0HA 3VB4A 2PFEA 4I8LA 4UFDH 1WV7H 1O2WA 2GMTC 2W26A 4NWKA 2H2ZA 3D65E 4I8KA 1Q3XA 2BD2A 1MCTA 2CHAC 4BTIB 5F6MA 4JYVH 1ORFA 3PTNA 1F0SA 2P3TB 1Z8IB 1KXDA 5FPTA 2ZU4A 1IHSH 1V2RT 2VU8E 2ALVA 1AQ7A 1SB1H 3LIWA 5I25A 4LZ1H 3ZZ6A 1IOEA 2GCTB 2RA3A 2M5TA 4GUXA 4NSVA 4O3UA 1IQJA 3M5LA 3B23B 3DT0H 4TYDA 4NIVA 3A86A 4FUFA 2Z3CA 1P2NA 3M37A
chains in the Genus database with same CATH superfamily
1S6FA 5F8XA 1O3DA 1TPSA 4WMFA 1NRSH 1C1QA 2QA9E 1LQEA 3TH4H 1FY5A 1KLTA 5EQRA 1QCPA 3KYFA 3OEED 1WUNH 1GMHG 1E38B 2ZFFH 2OD3B 3E6PH 3ODDA 1OWIA 2OC0A 1TPAE 4K3JA 3FANA 4YO9A 1BBRH 1Y3YA 3QDZB 2YNBA 2QXIA 1A61H 3FN8A 1P05A 4AFUA 1G9IE 1RTKA 1Z8RA 3I77A 2ZU3A 1EATA 1O32A 1OHHD 1VJ9U 2STAE 3KNXA 3SU1A 1MABB 3MU4A 1UTOA 3VB3A 2NWNA 6GCHF 3S9CA 3A82A 3VXFH 1V2QT 4B71A 1S5SA 2V3HH 3FFGA 1N1LA 1NO9H 1WCZA 3MH7A 1EB1H 2HRVA 3CS7A 1A3BH 3T26A 3N7EA 1DWEH 1WTGH 2BDHA 3BIUH 4CH2B 2ZECA 2FESH 1RTLA 1D6WA 4INLA 3MOCA 1DM4B 3E1XB 1ELDE 2VWLA 2XCFA 1GDUA 1ARBA 3MH4A 5A8ZA 3EQ0H 3AW1A 4A1TA 4AFQA 1HJAB 2GGVB 1O5GH 2B0FA 2O8TA 2BLQA 2BX4A 3RXIA 1ETSH 1GVLA 2G5NA 4GCHG 2CV3A 1C5NH 2PR3A 2V35A 1GVKB 3F0PA 1THSH 2SGEE 1OP2A 3MYWA 2D26C 2K8IA 4FXGH 1ELVA 2PKAB 1ZJKA 5L30H 3U69H 1NS3A 1ZHRA 3RXPA 1ELBA 2ZI2H 4X6PA 4ZAEA 3TGKE 3SGAE 4R0IA 5DGJA 3TJVA 2ZCLP 8KME2 1P11E 2ZPRA 5AF9H 1J16A 4YT6H 3OAAD 4IC6A 3STJA 3T29A 2IJOB 2VH0A 1IQMA 2ZWLH 4ABBA 3SI3H 1FDPA 4BAOB 1TNKA 1H1BA 1O5DH 4LXBH 1QURH 1QRXA 4ISIH 4JYTA 1W3CA 4GLYA 1L1NA 2IPQX 2G8TA 4K69A 1AD8H 1WU1A 2UUYA 2KCOA 4CHAC 2V7QD 1C1WH 4TWYA 1NFYA 5EW1H 1UK4A 1D6RA 3SZNA 2THFB 2A7CA 1KTSB 3B9FH 1FN8A 3BG4C 1Q31A 4NCYA 4FUEA 4H6TA 4O03A 4Z0KA 5EQQA 1C2GA 3BTFE 1HFDA 5KGOA 4A5TS 1NBMD 3MI4A 2EY4C 1FAXA 4WH6A 1G30B 1A0LA 3E0NB 4A1XA 1W8BH 1ZPBA 1G3BA 4I8JA 3BTKE 4Z6AH 1TGSZ 2YMSD 1O2YA 1O33A 1MTNB 1GJCB 1UO6A 3TU7H 5GIBA 1FMGA 2WINI 1A1RA 1T8MA 1DT2A 3MU0A 2AGGX 3RDZA 1DUAA 1TGTA 3SNDA 1G37A 3SU4A 2C8WB 1XKAC 4GSOA 1DLKB 2HNTC 1KDQA 3RXLA 4Y8ZA 2ZTYA 3F1SB 1GMCF 1VCQA 4IMQA 2P3FH 1O2GH 4MPXA 2WPDD 2BLVA 1QHRB 2K1QA 2Q1JA 3RXEA 3DCLA 1IQKA 2DE9A 3SOSA 4ABFA 1BTUA 3KQBA 4ZHMU 5C0UA 3F9GA 3UUZA 3MO9A 1L4ZA 1FN6A 2R2WU 1C5MD 3BEFB 1AE8H 3DSGA 4ZXYH 1XUJA 4WMDA 1SLXB 2VGCB 4H4FA 5CDFE 5EJ1A 1E0FD 1PPGE 1V2MT 1EOJA 1YKTA 2PUQH 3A8DA 2TPIZ 3W94A 4CRBA 2SFAA 2DE8A 2RA0A 2ZGJA 4MNVA 4AX9H 1A7SA 2ZCKP 4WXVA 4CBNA 2KZ4A 2KCAA 5K7RA 2BY7X 1YPMH 2F9PA 1CHOG 4CRGA 2VNTA 1T31A 4TPIZ 1JOUB 1T8OA 1S6LA 1XMNB 2JIZD 3F0OA 1TABE 4K1TA 1O2ZA 4GAWA 1H4WA 2D2DA 2VVUA 2Y7ZA 3UNSA 1BBRK 2BX3A 4X8UH 2GZ8A 1GHWH 1ABJH 4B2BA 1O5BB 5HMAA 2CF9H 5C94A 3UNQA 4HTCH 5GWZA 1GJ9B 2ZGXH 4WJG2 4K5ZA 1FI8A 2P95A 3H5CB 1KXFA 5I46H 1OPHB 4DJZB 2GTBA 1SLVB 2JETC 1PPHE 1WQVH 3A8AA 1OKXA 1MBMA 6CHAB 1LTOA 1ZLRA 1BJVA 3U98H 2OQUA 1IQEA 4ISNA 1GJ8B 1GI3A 1JWTA 2AHME 4CRFA 3TGIE 3T25A 3I78A 1XUIA 1DSUA 3HGNA 3A7ZA 1V2UT 2XWBI 3URDA 1QBVH 3SZEA 1T4VH 4X1QU 1LDTT 4OS6A 2JH6D 3UB0A 4NFFA 1ETRH 3TJUA 3F2HA 2YOLA 2QV1A 3OTJE 2WYGA 1UVSH 1HAHH 3RC4A 2OP9A 1YC0A 3RXMA 1XUKA 5E2PA 5F8ZA 1RS0A 3OX7U 1W7XH 1YBWA 1BZXE 2QN5T 3WWFA 1K21H 1SBWA 3V3MA 1E36B 1VGCB 3U9AH 1GJ7B 2ZPSA 3PB1E 2BOHB 3DA9B 4MPWA 2W7UA 1VCPA 1A46H 2ASUB 4WVPE 2H9EH 1J14A 1CVWH 4MDSA 2ZU2A 3SU0A 2CGAA 1L0ZA 2PUXB 2QF5A 1Y3VA 1CBWC 3P70B 3OEHD 2A7HA 3E91A 3STIA 5E8EH 4D9RA 1AVXA 1NC6A 3D23A 1CT0E 2LP6A 4MG3A 1K0HA 2AH4X 1SI5H 3PYHA 4ZUHA 2YMSC 3BEIB 3LH3A 1ESBA 3UOUA 1WDIA 1RGQA 4BXWA 3QX5H 1YPLH 1TMTH 1TPOA 1MTVA 1SC8U 3GCHB 3FZZA 1CA0B 3F9HA 1NROH 3BG8A 1TA6A 2C8YB 3B8JA 2XYAA 3A85A 1YY3A 5SGAE 2ODYB 2ZO3H 5GXPA 1O34A 1GCTC 4NZQA 4WY3A 5PTPA 4Y7AA 1O3LA 2JJ2D 1ELAA 3VFEA 4UFEH 1O2TA 2BM2A 4J2YB 2QXGA 4I8HA 1YLCA 3A7TA 2FLRH 3MO6A 2BZ6H 1Z7KA 3T27A 5C5NA 1GJBB 1NRQH 5F53A 3O8RA 2TGDA 1F0TA 3NWUA 1GMHF 3OU0A 3T62A 1T8NA 4CR5A 3LU9B 4DGJA 1PPBH 5C1XA 4ABAA 1E1QD 1ZTKA 3LGIA 1G2LA 1SGCA 2L74A 2NU4E 2UWOA 1QFKH 2HNTF 4X8TH 2VBCA 2AS9A 5CHAC 1HAPH 5EXNA 4AYYB 3FO8D 4AB8A 1QBOA 3UAIC 3ITIA 1BRUP 2Y7XA 1F5KU 1MD7A 1ESAA 1O2HA 5A0AE 5T6GA 1AFQC 3D49H 3QTOH 3UOPA 2P8OC 1SQAA 1GMCG 1QL9A 3U28C 1YPKH 1AVGH 2P3UB 1DXPA 2B9LA 4CRAA 1YPGH 3U8RH 2LELA 2FX4A 2FOMB 3VGCC 2BHGA 1W13U 1GBFA 2BDGA 4OS2A 3P8NA 5IK2D 3LH1A 5DP4A 2ZQ2A 1GJAB 3V12A 1N8OC 1ETTH 3NK8A 5DJ7A 2Z9IA 3AAVA 5G4BA 1P01A 1PFXC 4AG2A 1UJ1A 3JZ1B 4FUJA 2J92A 3MHWU 4Y6DA 1BRCE 3EA8A 2BYAX 2TRMA 1QJ6B 3V0XA 4GCHF 4X6MA 3EAJA 1S0QA 3M5MA 3F68H 5HIZA 3SJIA 1W10U 2H5DA 8GCHF 1HJ9A 3URCA 1DWDH 4X2VA 9ESTA 4Q80A 1C5UA 1HB0B 1FX0B 2ZF0H 1HIAB 1C5LH 1OYTH 2TGPZ 2AYWA 1O2OA 3HPTB 4OS5A 4Y10E 3H09A 3OFND 4Q4LA 4XRNA 2Z7FE 2Z94A 2XBYA 1QA0A 1SKYE 5AVDA 1DY8A 1D3DB 2PKAA 2WUCA 1HAXB 2PHBA 1V2JT 4U30A 3GY2A 1P9SA 3ODFA 1C4U2 3GDVA 2ZA5A 3FP7E 1MBQA 1Z6EA 2KFWA 2WV9A 4HI3A 1N6XA 3OY6U 2R9PA 3S7KB 3SV9A 2H9TH 2XCNA 2GX4A 3KHVA 3VB7A 2F43B 3F2FA 3NZIA 1RIWB 2AMDA 1H8DH 2ZTXA 3W95A 1PQ7A 1FUJA 1HAIH 2VIWA 1P10A 1OP8A 3A8BA 2ANYA 5T3HA 2TGTA 2A4QA 3RXDA 1O2MA 2G00A 2G52A 2HVYB 2Y6TA 5T1VA 2FOFA 1O2QA 1J17T 1P8VC 4ZMAH 1GI4A 3LKWA 4FUHA 2O8MA 1QQUA 2A31A 2AGIX 1AN1E 1G3EA 2I6QA 5FXLA 4HG6A 1VR1H 5AFYH 3IITA 2Y81A 1EAUA 3RP2A 4ZKRU 3SV6A 4IS5A 3Q76A 1SGYE 4LZ4B 4MPUA 4JZIA 3UNRA 1V2PT 1G3CA 4K8YA 2ZDAH 3P8GA 1O2XA 4DCDA 4AORA 5IDKA 3OYPA 1QTFA 1Z1IA 3RXBA 4J1YA 1C2EA 3RXHA 1Y5UT 1NPMA 1XXDA 5DSFA 3ZYEA 3EGKH 2BY8X 3QK1A 1ELFA 5EXLA 2QYIA 3PWCA 1WAYB 3SV8A 1FONA 5FHTA 3KYGA 1EQ9A 1LHGH 3TJOA 5DK1A 5C5OA 3W1EA 1V2KT 2PKSB 4B2CA 4D7FA 5EW2H 4D7GA 4Y71A 1WYKA 3A7YA 4KTCA 3SUFA 2P59A 1AZ8A 3UREA 2NU0E 1V2VT 1O2JA 1AY6H 2WPJS 3ZIAD 3ZVDA 3A83A 3MFJA 3E90B 1W0JD 1C5PA 1MCVA 1GGDC 1PPCE 2FOAA 3RXKA 3GY8A 1QJ1B 3F6UH 1BITA 2WPIS 2ZC9H 1BMAA 4FU7A 2F9BH 1CHOF 1GJDB 2ZGHA 2RDEA 5JB9S 1GMDF 3D62A 2ZEBA 1O2RA 4CRDA 3RXOA 2BTCE 2J9NA 2IOTA 4DVAU 1Y5BT 3M7TA 3P92A 1HDTH 1P57B 1SGFG 2QIQA 4KTSA 3A81A 2PGQB 4OGYA 4TPYA 5DP8A 1S0RA 4LOYH 2HVXA 1GHZA 1MAYA 1F92A 1Z1JA 2IN2A 3BSQA 4XFQA 1G36A 3AVZA 4GHTA 1GBAA 4WMEA 1ANDA 1ZTJA 4ZKSU 3GICB 1T8LA 1C1RA 5F8TA 3SBKA 1V6DA 5EQSA 1O3HA 3QZRA 2EEKA 1CT2E 2I6SA 3CENA 3N99A 1SGIB 1V2WT 2OTVA 2WYJA 2Y5GA 3RXVA 3RXJA 1UVPA 1GDQA 5IYTA 3U8OH 4ABEA 3P6ZB 3KL6A 1W7GH 1PYTD 1ELEE 1YGCH 3PV2A 1SQTA 5L2YH 2FXRA 4FOUC 1X7AC 2STBE 2JH0D 4BTUB 2QF3A 3ZZCA 3S7HB 3I29A 4K1EA 3R0FA 3N7DA 2BDCA 2G5VA 1SGTA 4B2AA 4XBBA 5DP3A 1HAVB 1O3BA 3BTHE 4F49A 3ATLA 4A92A 1P2IA 3ZVCA 1FJSA 1YPHC 2FS8A 1YM0A 3WW7A 1E34B 5EXMA 3ZZ7A 1BA8B 2FX6A 3Q00A 2CHAB 1Z71A 1TWXB 2EQNA 3FP8E 1LPZB 1C5OH 3RMMH 3E8LA 1UTMA 1ZSKA 5T6FA 1W12U 3A8CA 5EJLA 4IGDA 4B6EA 1NM6A 3DFJA 1C2HA 1H9LB 4JK5A 1AU8A 2AERH 4UD9H 3RC5A 8GCHG 1SQOA 3LGVA 1CGJE 2ZNKH 3BEUA 3SJ9A 2J94A 2FYRA 2LPRA 2FEQH 4KGAA 1IAUA 3NUMA 3PO1B 3M5NA 1B0EA 3K65B 3A80A 1WBGB 1C1NA 2H5CA 1JMOH 2FS9A 2ZDLA 4TY7A 1C5TA 1LHEH 5C17A 3KGPA 1TBZH 1FY1A 3RU4T 2VJ1A 1OS8A 5FCRA 1W11U 1O37A 3LONA 3M3VA 1ABIH 3O8DA 2D8WA 2AGEX 3QO6A 1W14U 4K2YA 1K1OA 1VZQH 3RXAA 4BXSA 2ZKSA 1E79D 2ZDKA 3TK6A 4ZROA 4YT7H 3RU4D 3RXUA 3LJOA 3RXQA 4FUDA 3RXCA 1QNJA 4GPGA 1S82A 4FUBA 1CT4E 3KF2A 1S85A 1RJXB 1PPFE 3Q77A 4FU9A 4NA8A 5GJ4B 1XUGA 4RSPA 3AAUA 2XBVA 3PRDA 5EGMA 1EUFA 1SQRA 1C1PA 1GCDA 4Y8XA 3SNBA 1D3TB 4HZHA 3L33A 3DUXH 1BMMH 3ZZ9A 2KAIB 4B75A 2ZCHP 2ZFPH 4AC9A 1DUEA 1ID5H 4F48B 1F0RA 3DFLA 4ABHA 2VH6A 3LGYA 1E1RD 2ZHWH 3NCLA 1OWDA 2OXSA 1GBKA 4VGCC 1C2FA 1EJMA 1PPZA 1RFNA 3RMLH 5JYIA 1ACBE 3SHCH 2FOHA 4B6FA 5HIYA 5BRRE 3ZVFA 3K6ZA 3PMBB 2UWLA 4ZXXH 6CHAC 4NSYA 1VKYA 1Z8JB 3H7TA 4OS4A 5FBIA 3GYMA 1ZMNA 5EOKA 3SQEE 1EAWA 3SO3A 1AE5A 1BB0B 1GHAF 1SGQE 3AK5A 4ABGA 2BMGB 1O31A 2AMPA 4NIWA 3QGNB 1QB1A 2ZFTA 1O3AA 1GG6C 1TFXA 3CP7A 3M35A 1AMHA 2PW8H 2SGFE 4DG4A 3SUDA 2LNCA 3FP6E 1TX7A 1MU6B 5B6OA 1SHYA 1IQNA 1C5RA 1GJ4H 3TPIZ 5HM9A 3R3GB 2ANKH 2PLXA 1BIOA 1DX5M 5L6NH 1SPJA 1ZGIA 1AVWA 4X6NA 1C5WB 4D76A 1NRPH 1AO5A 3C27B 1PYTC 4ISHH 5L2ZH 1T7CA 3RXTA 4DURA 2IPHA 2UUKB 1LHCH 3QTVH 1J8AA 3RC6A 1AWHB 4JMYA 1C5XB 3M7UA 1IQFA 5EPNA 2XC0A 1KXBA 5DP5A 3MNCA 3OE7D 1GMDG 2J98B 1AB9C 1TOCB 2AMQA 3HK6B 2OK5A 2SNWA 2BY9X 1JRTA 3O8BA 2FTLE 1HIAA 5DP6A 2GP9B 1TNGA 3BG4B 4MVNA 1NU7B 1YCPM 2WSSD 3H7OA 2GCHF 3NPSA 2F9OA 4ISOA 2ZFRH 3T28A 4M9FA 2A5KA 2ZU5A 5TJXA 2G51A 3EE7A 1TGCA 4X1PU 2BY6X 1JRSA 3UY9A 4UONA 4JZ1A 3ZZ3A 1K22H 1DWBH 1O2UA 2F3CE 2QC2A 4YOGA 1CA0C 4U2WA 2TBSA 4DIIH 3PTBA 2AFQB 2AIPA 1AUTC 3K6YA 3FVFB 2F83A 1C2IA 1EPTB 1AFEH 5TCCA 3RUOA 3MNXA 1NTPA 1G3DA 1DANH 2BDYA 3LGWA 2C3SA 2W7SA 2BVXH 2W5EA 1PQ8A 1KSNA 1CSOE 1BRBE 4MPVA 1GBDA 3FKSD 3ESTA 3S9AA 1C5QA 1A5IA 1DICA 1F2SE 4IBLH 5FPSA 3ATKA 3MU5A 3LGUA 2ZHFH 1BMLA 1OX1A 5GCHF 1QB9A 5EG4A 2BD5A 1BTXA 4CR9A 1GPZA 4ISLA 4Q7ZA 3PV5A 2A0QB 1THRH 1AWFH 3TGJE 3F9FA 1BCUH 1UTPA 1FV9A 1MTUA 4Y0ZE 1EB2A 4MQAA 1BJUA 5C0TA 2B7DH 3A87A 3CNRA 3PWBA 5C1YA 1UW7A 1O5CB 1HXEH 3VB5A 4OS7A 1ZTLA 1ZHPA 1YPJH 2BLWA 4X8VH 1DSTA 3EE0B 4X6OA 3BTWE 2OLGA 1AGJA 4OGXA 1LMWB 1V2LT 1EP5A 1CU1A 4H42U 2RG3A 2WPMS 4YOIA 2F9NA 2ZGCA 2G55A 2FM2A 3M5OA 1EZXC 2XC5A 2UUJB 2R3UA 3VEQB 3A7VA 4M7GA 1EZSC 5A8XA 1GBJA 3SU3A 3FAOA 2Y80A 2R0LA 3A89A 4H6SB 3WWBA 1ZPCA 1GBBA 1TGNA 5FAHA 3LPRA 1SLWB 3PROA 1XVOA 1BHXF 1EZUC 1EJNA 2SGDE 4FUCA 2A4OA 4OS1A 3ZV8A 3KCGH 2CJIA 4X8SH 1ZGVA 7LPRA 1WQSA 4P02A 1QBNA 3UPEA 5EJZA 2WZQA 2PV9B 3SJOA 1ARCA 3SU6A 3BIVH 5FPYA 3HKJB 2JETB 2Z9LA 2QAAA 2WV5A 3BF6H 2AIQA 3MH6A 1GHBF 5KEDA 8LPRA 4AB9A 1DVAH 2C8XB 2GKVE 3PRBA 2FDAA 3A88A 3RLWH 3ZYDA 2H6MA 2SNVA 2HPQH 4RT0A 5AFZH 1O3IA 1GL1A 1K1JA 1EAXA 2GT8A 4I33A 1AI8H 2Z9GA 3Q3YA 1TX8A 1BDAA 3QZQA 4A7IB 5ESBA 1P2QA 1QR3E 2Q6DA 5FX6A 4Q63A 1BMFD 3DD2H 4I7YH 1FXYA 5EU8A 4NFEA 4NZLA 1RIWC 2HNTE 3SGBE 1BRAA 5KECA 1F7ZA 1KXAA 3PMJA 4UDWH 2VIOA 1JBUH 3UIRA 2J2UA 1HNEE 4BOHA 1O5EH 1GHAG 1YLNA 2J5UA 2GDDA 1XKBC 3AASA 4B1TA 1MQ5A 1CBWB 1YCPK 2FI3E 4YM9A 5J4SA 1SGDE 2A2QH 1RXPA 1MKXK 3TH3H 5E0JA 1QB6A 1VITF 1ZRKA 3LT3A 2PTCE 1HAVA 1WOFA 2YMSB 4DT7B 1ZZZA 1C2JA 1FY8E 2XC4A 1IQGA 2ZFQH 1EZQA 1HV7A 4YXWD 1P0SH 2BZAA 3P17H 1MZDA 2Y5FA 3VG8A 3SORA 1W0YH 4HFPB 1P2MA 1S81A 8ESTE 1HGTH 1MH0A 2OUAA 1SMFE 3ZZ8A 1S83A 4ACBA 1H8ED 1ZYOA 4LK4A 3K9XB 5JBCS 4ZH8A 1YPEH 5ETXA 3BTEE 5K0HA 1P2OA 4IN1A 1TBQH 4YESB 1LPGB 1C9TA 1D3PB 4XOJA 1UK3A 2BD7A 3V7TA 3FOAA 1D9IA 3F2GA 4UFGH 1KMHB 3BTGE 2CK3D 5A2MH 5LPEA 1F5RA 5H4IB 1HBTH 1HJ8A 1K1NA 4U32A 2C90B 1DS2E 2GCHG 1GBHA 1UHBB 3BTTE 1HAYB 2FI5E 3UQVA 1A5HA 2XRCA 1FAKH 1SG8B 2Y5HA 1L4DA 4MNWA 2BD4A 3SV7A 4OM9A 2G4TA 4O3TA 1A3EH 4JCNA 2R2MB 3M61U 1XUHA 3A7XA 2M2AA 2GCTC 4KELA 3Q3KA 3ATWA 4ABJA 4ASHA 2BOKA 2GV7A 1UTKA 1HCGA 3SNAA 4WH8A 4XE4A 2O8WA 4GVUA 3QWCH 5JBTA 5C20A 3SU2A 2ZFSA 1AKSB 1GVZA 3GCTF 7GCHF 1GBTA 2A7JA 4FUIA 3F9EA 1XM1A 4DIHH 3LGTA 1O2KA 5FL7D 5GCHG 5B6LA 2Z6BD 3ZZBA 4IW4E 1SGEE 3K2UA 1FPHH 1TMUH 4TT3D 1YP9A 2NU3E 1EKBB 1TIOA 3ZZ5A 1E35B 1RD3B 5E0GA 3VGCB 1QRWA 1GJ5H 4IN2A 2KAIA 1IHTH 2FO9A 1PQ5A 4I86A 1ANCA 1N8OB 1ZHMA 4E06H 1EASA 1Y3XA 2R3YA 2BQWB 2Y82A 3MH5A 3FZDA 4UFFH 2XNIA 1KTTB 4JZDH 1MZAA 1NBME 4ABIA 1RRKA 1UCYK 1P03A 1QQ4A 2WPLS 7KMEH 3GY5A 2ILNA 1Y3WA 1MTWA 1Z8GA 1SGPE 2OINA 3M3SA 1MD8A 2PSXA 1DDJA 1KLIH 1UVTH 5CE1A 3SV2H 2GDEH 3U1JB 3PLKA 2V3OH 1TOMH 2OCVB 3SN8A 1V3XA 1K1LA 4AYVB 3A7WA 2GVFA 1KXCA 5EODA 4AZ2B 1F5LA 4UE7H 1AHTH 1ZMLA 3GYLB 1OXGA 1EOLA 1FIWA 1WSSH 3L6PA 4Y79A 5HYOA 1NRRH 1HJAC 4DOQA 4X2WA 2ZPQA 1AUJA 2QXHA 2JH5D 5CMXH 1UTNA 1E37B 3M3TA 2J38A 1KY9A 1TGBA 3HATH 2A1DB 5DN6D 2CMYA 3MNBA 2FOEA 2FWWA 3SGQE 3VPKA 1GHBG 1EX3A 3PO1C 1M9UA 1MTSA 5C2ZA 4Q7XA 2PSYA 2XNDD 2J98A 2VVCA 4X0WU 5FBEA 3ZVBA 1SFIA 4UEHH 1BUIA 3S69A 1HUTH 1SSXA 1U6QA 2CF8H 3UTUH 1V2TT 4RKJB 1G2MA 1C1UH 1N6YA 1ELGA 3SJ8A 3E3TA 2H1UA 2HLCA 4CBOA 1GI1A 1UK2A 2XBWA 1GI8B 1O39A 1SGFA 2HOBA 4AFSA 1FIZA 3SW2B 4CH8B 3LC5A 1O38A 2V0BA 1UTJA 2H9HA 2VIPA 2QE7D 4K60A 4F4OC 2ZHQH 1Y5AT 4RKOB 1EPTA 1MU8B 3KEEA 1ZR0A 4SGBE 2A4GA 1O3FA 1TBRH 4AG1A 3QN7A 4FU8A 2G4UA 2FLBH 1L1JA 4Q7YA 1ZSLA 2HGTH 1O36A 3TITA 2GMTB 3IG6B 2B5TB 1K1PA 1C9PA 2AEIH 1DE7H 1VITG 3BV9B 3RMOH 1ZSJA 2BLOA 5ABWA 4MNXA 2EC9H 4B74A 1GI0A 1SOTA 3ATIA 4O9VA 1J15A 1MTNC 2ZZUH 4WXIA 3GDUA 4KTUA 4ZKNU 2FOCA 1EFRD 1SGNE 3MTYA 1FY3A 1IQLA 4CRCA 1KLJH 3ZVEA 2A4RA 4Y0YE 2GV6A 3EYDA 1GGDB 3KN2A 5EIYA 1C5YB 1P3EA 3MO3A 2BQ6B 2A5AA 3RXSA 1HXFH 1YF4A 1YLDA 2ZDVH 3MU8A 2UWPA 1L1GA 1DITH 4FUGA 5AHGH 4AN7A 3TK9A 1QA7A 3LJJA 4X2YA 1DLEA 1P3CA 2A32A 1DXWA 2BD3A 1GHXH 3ELAH 5E2OA 4E7RG 1O30A 1O2NA 1C1SA 2FIRH 1ZOMA 3M36A 3PMAB 1SVPA 3ZVGA 3DHKH 4BAMB 2A5IA 4ESTE 1C4V2 2QF0A 2SGQE 1P2JA 5JBBS 3TLOA 2OC1A 3MMGA 2BDAA 1VCWA 2OBOA 2VGCC 4F55A 3P95A 1AZZA 1DFPA 1O2PA 1B7XB 4A1VA 2EI8A 1GBMA 2XWAA 1MKWK 1DWCH 4K1SA 4PROA 1SGRE 4B76A 1LO6A 3OSYA 1S84A 3OTPA 1T4UH 4BANB 1A2CH 1GI2A 2WUBA 3TH2H 2QGRA 1PPEE 4GHQA 1H9IE 3QLPH 2F91A 1C1VH 5A0BA 2C8ZB 1QIXB 2DUCA 2FTMA 2Z3EA 3GCTG 3UWIA 7GCHG 2KX4A 4AFZA 1P04A 3PV4A 5A09A 5HKKD 3MQKC 4AGJA 1LVMA 3EDXB 3G01A 1FLEE 1O3EA 1LVOA 5FX5A 2G81E 3NRLA 5C1UA 1SOZA 4ABDA 1LCYA 2XTTB 1WTHD 5DKMA 5JPMH 1NN6A 1C1OA 1HLTH 2BVRH 4XD7D 7ESTE 1LKAA 1P09A 1TQ0B 2R0KA 2GZ7A 3BTDE 1C5VA 4E05H 5FCKA 2VWNA 1HAZB 1NZQH 1OOKB 1P9UA 3HKIB 1LHDH 1TE0A 1Y3UA 3RLYH 1BTHH 1EPTC 2KR7A 3QUMP 4Y11E 3SQHE 3KIDU 1P12E 2CN0H 1TNJA 1Y8TA 1LHFH 1XVMA 2HPPH 1FQ3A 1O35A 1SL3A 2BQ7B 2P93A 3RMNH 4NIXA 3ENSB 1CGIE 1FPCH 2KCPA 3MWIU 1NU9A 2GD4B 3N7OA 3AW0A 1O3GA 1ZRBA 2Z9KA 1TNLA 2O9QA 1O3KA 5JDUB 2WV4A 3RM2H 1O2SA 2PGBB 3BTME 2HWLB 4NA9H 1YCPH 5C67A 4CREA 2OC8A 2ZHDA 5JBAS 3GISB 2WPHS 5GNDA 1MKXH 3RXGA 4B73A 2V6NA 3SUGA 2L6OA 2NU2E 1SHHB 1C4Y2 4ZHLU 1P02A 4D8NA 2OBQA 1VGCC 1BT7A 4BTTB 2V3MA 2ALPA 1TALA 1GJ6A 1QZ8A 4XBCA 1MUEB 4INHA 2XXLA 3ATMA 2A45B 1BHXB 1K9OE 1BTZA 1PJPA 2C93B 4MTBA 4CHAB 3UR9A 5DG6A 1UCYE 1BTWA 1TNIA 4NWLA 4RN6A 2JKHA 4MNYA 1C5ZB 1TYNA 3HGPA 1O5AB 2UUFB 1BOQA 1A0JA 2NU1E 2EI7A 1BQYA 3KQ5A 1JIMA 2BDBA 3GCHC 1SR5C 1CO7E 1CQQA 1C5SA 2ODPA 1PQAA 1EJAA 1O3MA 1K28D 1QL7A 4MLFB 1UHBA 2QCYA 5C3NA 4X2XA 2RDLA 1C2MA 1CE5A 3P8OA 1BTYA 1ANBA 1FY4A 2B8OH 1QY6A 2BD9A 4I32A 5DO4H 1UTQA 1ESTA 1K2I1 2BXUH 1Z6JH 4VGCB 1NESE 2FI4E 3PLPA 4Y8YA 1O2IA 3PLBA 5J4QA 5A0CA 3RXRA 1LVBA 4JK6A 2PTNA 1D3QB 3KQEA 1O3OA 3S9BA 1TAWA 4TY6A 5T6DA 1LKBA 1HRTH 4R8TB 3WY8A 2RFKC 4NGAH 1QGFA 2ZIQH 3PM3A 1TA2A 1AKSA 3E0PB 1YPHE 6GCHG 2PP6A 4SGAE 2J4IA 1GG6B 1GBLA 2FYQA 1LVYA 4KP0A 1TLDA 4ZCNA 3U1IB 4JZFH 3RXFA 3QGJA 1INCA 1GI6A 1SLUB 2EI6A 5EPYA 2YNAA 3Q3XA 1OWJA 1DY9A 1GI5A 4IC5A 1CHGA 1EAIA 3KQCA 1COWD 1O2LA 4THNH 1DPOA 4I8GA 4NA7A 5BPEA 3OY5U 1O0DH 1HYLA 2FOBA 4FVBA 3TNSA 4ZKOU 2VINA 1SFQB 2XOKD 5GPIB 4ACAA 3LC3A 2VIQA 3TIUA 1UCYH 1NY22 2O8LA 1LQDB 2TGAA 1T32A 2SGPE 3GY7A 2HLDD 1KIGH 3PMHB 1C2KA 2VB0A 3E16B 3TNTA 1AB9B 1QJ7B 4E7NA 4BAQB 5JB8S 1TQ7B 2Q6FA 2F4LA 2ODQA 1GI7B 1KXEA 3ZZAA 4TWWA 9LPRA 1DOJA 4RI0A 3EA7A 2J34A 3C1KA 2FPZA 4XBDA 1GBIA 1OYQA 3F3BA 1ZPZA 5LPFA 1A4WH 2XBXA 3V13A 1V2ST 4K8BA 1CA8B 5GDSH 1OWKA 1JIRA 2ANMH 1HAOH 2Q6GA 4BAHB 2BXTH 4AOQA 1V2OT 3NXPA 4ZHAA 2ULLA 3GY6A 1C2LA 1L2EA 1LPKB 2W3KA 1WXRA 1GHVH 1JXPA 4DW2U 3ZZ4A 2VVVA 5A8YA 4YLUA 4BAKB 2ZDNA 4RT1A 1A5GH 2Z3DA 3SNEA 1O5FH 3SYJA 1EP6A 2OQ5A 2A2XH 2KCYA 1TRYA 4X1SU 1D4PB 2P16A 2KM0A 3BTQE 5F03A 3M7QA 4U01A 5DP9A 2ZP0H 3DSPA 1UTLM 4YLQH 4X1RU 1B5GH 3LDXH 5CHBA 2ZGBH 1J9CH 1ANEA 2IJD1 4INKA 2XW9A 1FNIA 1NFWA 2JDID 3SI4H 3UFAA 2O8UA 2FP7B 1VJAU 2PWXA 4WWYA 2VIVA 1GBCA 1NT1A 1KDQB 4Z1MD 1AIXH 2QY0B 5HGGA 2BB4A 3T2NA 1FZZA 5LGOA 1IQIA 3UQOA 3U8TH 2BD8A 1GBEA 4YTAA 1H8IH 3SU5A 2SGAA 5LH8A 2EA3A 3P8FA 1QRZA 3GCNA 3GDSA 4QT8C 1EXFA 2FMJA 2HALA 1P06A 1ZJDA 1TX6A 2VIDA 1O3NA 1XX9A 2GT7A 4JYUH 2ANWA 1TNHA 4D9QA 3L3TA 3SNCA 2C4FH 1P2KA 4WF8A 4ASUD 1TRNA 2ZU1A 4NIYA 3IWMA 1NFXA 2RCEA 2ZDMA 4YOJA 2ESTE 1MQ6A 1UVUH 1TB6H 4BNRA 2QF4A 2FODA 1A0HB 2FOGA 3EA9A 1O3CA 4DY7B 2VWOA 1NFUA 1GCTB 3UWJH 1B0FA 1TPPA 1S6HA 4YZUA 3O8CA 1K1MA 2W3IA 1C1TA 4JZEH 2WHXA 3JZ2B 1THPB 1NRNH 1BTPA 4Q2KA 1O3PB 3DSOA 2PKSC 3ZV9A 3VB6A 2TIOA 2GZ9A 4X1NU 2F9VA 2WPKS 3KQDA 2D1JA 3MU1A 3S0NA 1GI9B 3ZZDA 1MMJN 2J97A 3VXEH 1C2DA 1CGHA 1YWUA 5LPRA 1Y59T 1GHYH 1HPGA 1OP0A 2ZHEH 3CS0A 1RTFB 6ESTA 1ELCA 3GY4A 3RM0H 1O2VA 5HXFA 2BY5X 3BN9A 3SUEA 4FVDA 3SHAH 4P00A 1G32B 2CXVA 3MNSA 5CHAB 5ESTE 1MKWH 1GWAA 2BDIA 1W0ZU 2P94A 2F9UA 1IQHA 1F0UA 4I31A 1OSSA 3GCOA 3GS9A 5TCAA 1Q2WA 1BMNH 2ZG0H 1AFQB 3TJNA 1H8HD 1V2NT 2P8OB 1GDNA 1ELTA 3NKKA 6LPRA 3UR6A 4Y7BA 2K0QA 3TK5A 4O97A 5HM2A 1OWHA 1TMBH 3LOXA 2JJ1D 4DT4A 1K1IA 2ZQ1A 3RU4E 2ZTZA 5DP7A 1QL8A 1YYY1 3GY3A 1TRMA 1MAXA 1H9HE 4XSKU 1XXFA 1ZMJA 1TONA 2VWMA 1O3JA 1GL0E 4AGKA 4Y76A 1VITH 4HGCA 3A84A 1UMAH 1KYNA 2Z9JA 1BBRE 3T5FH 2BVSH 2QXJA 4XDEA 1XUFA 1HAGE 4A6LA 2OC7A 4NG9H 1OWEA 4KKDA 1W2KH 5DPAA 4IMZA 1C1MA 3GOVB 2J95A 3HK3B 3ZVAA 4FETA 1UVOA 3SJKA 2FZZA 3TVJB 5E0HA 3VB4A 2PFEA 4I8LA 4UFDH 1WV7H 1O2WA 2GMTC 2W26A 2GJGA 4NWKA 1W0KD 2W6ID 2H2ZA 3D65E 4I8KA 1Q3XA 2BD2A 1MCTA 2CHAC 2W6JD 4BTIB 5F6MA 4JYVH 1ORFA 3PTNA 1F0SA 2P3TB 1Z8IB 1KXDA 5FPTA 2ZU4A 1IHSH 1V2RT 2VU8E 2ALVA 1AQ7A 4TSFD 1SB1H 3LIWA 5I25A 4LZ1H 3ZZ6A 1IOEA 2GCTB 2RA3A 2M5TA 4GUXA 4NSVA 4O3UA 1IQJA 3M5LA 3B23B 3DT0H 4TYDA 4NIVA 3A86A 4FUFA 2Z3CA 1P2NA 3M37A
chains in the Genus database with same CATH topology
1S6FA 5F8XA 1O3DA 1TPSA 4WMFA 1NRSH 1C1QA 2QA9E 1LQEA 3TH4H 1FY5A 1KLTA 5EQRA 1QCPA 1WUNH 1GMHG 1E38B 2ZFFH 2OD3B 3E6PH 3ODDA 1OWIA 2OC0A 1TPAE 4K3JA 3FANA 4YO9A 1BBRH 1Y3YA 3QDZB 2YNBA 2QXIA 1A61H 1P05A 4AFUA 1G9IE 1RTKA 1Z8RA 3I77A 2ZU3A 1EATA 1O32A 1VJ9U 2STAE 3KNXA 3SU1A 3MU4A 1UTOA 3VB3A 2NWNA 6GCHF 3S9CA 3A82A 3VXFH 1V2QT 4B71A 1S5SA 2V3HH 3FFGA 1N1LA 1NO9H 1WCZA 3MH7A 1EB1H 2HRVA 3CS7A 1A3BH 3T26A 1DWEH 1WTGH 2BDHA 3BIUH 4CH2B 2ZECA 2FESH 1RTLA 1D6WA 4INLA 3MOCA 1DM4B 3E1XB 1ELDE 2VWLA 2XCFA 1GDUA 1ARBA 3MH4A 5A8ZA 3EQ0H 3AW1A 4A1TA 4AFQA 1HJAB 2GGVB 1O5GH 2B0FA 2O8TA 2BLQA 2BX4A 3RXIA 1ETSH 1GVLA 2G5NA 4GCHG 2CV3A 1C5NH 2PR3A 2V35A 1GVKB 1THSH 2SGEE 1OP2A 3MYWA 2D26C 4FXGH 1ELVA 2PKAB 1ZJKA 5L30H 3U69H 1NS3A 1ZHRA 3RXPA 1ELBA 2ZI2H 4X6PA 4ZAEA 3TGKE 3SGAE 4R0IA 5DGJA 3TJVA 2ZCLP 8KME2 1P11E 2ZPRA 5AF9H 1J16A 4YT6H 4IC6A 3STJA 3T29A 2IJOB 2VH0A 1IQMA 2ZWLH 4ABBA 3SI3H 1FDPA 4BAOB 1TNKA 1H1BA 1O5DH 4LXBH 1QURH 1QRXA 4ISIH 4JYTA 1W3CA 4GLYA 1L1NA 2G8TA 4K69A 1AD8H 1WU1A 2UUYA 4CHAC 1C1WH 4TWYA 1NFYA 5EW1H 1UK4A 1D6RA 3SZNA 2THFB 2A7CA 1KTSB 3B9FH 1FN8A 3BG4C 1Q31A 4NCYA 4FUEA 4H6TA 4O03A 4Z0KA 5EQQA 1C2GA 3BTFE 1HFDA 4A5TS 3MI4A 1FAXA 4WH6A 1G30B 1A0LA 3E0NB 4A1XA 1W8BH 1ZPBA 1G3BA 4I8JA 3BTKE 4Z6AH 1TGSZ 1O2YA 1O33A 1MTNB 1GJCB 1UO6A 3TU7H 5GIBA 1FMGA 2WINI 1A1RA 1T8MA 1DT2A 3MU0A 2AGGX 3RDZA 1DUAA 1TGTA 3SNDA 1G37A 3SU4A 2C8WB 1XKAC 4GSOA 1DLKB 2HNTC 1KDQA 3RXLA 4Y8ZA 2ZTYA 3F1SB 1GMCF 1VCQA 4IMQA 2P3FH 1O2GH 4MPXA 2BLVA 1QHRB 2K1QA 2Q1JA 3RXEA 1IQKA 2DE9A 3SOSA 4ABFA 1BTUA 3KQBA 4ZHMU 3F9GA 3UUZA 3MO9A 1L4ZA 1FN6A 2R2WU 1C5MD 3BEFB 1AE8H 4ZXYH 1XUJA 4WMDA 1SLXB 2VGCB 4H4FA 1E0FD 1PPGE 1V2MT 1EOJA 1YKTA 2PUQH 3A8DA 2TPIZ 3W94A 4CRBA 2SFAA 2DE8A 2RA0A 2ZGJA 4MNVA 4AX9H 1A7SA 2ZCKP 4WXVA 4CBNA 5K7RA 2BY7X 1YPMH 2F9PA 1CHOG 4CRGA 2VNTA 1T31A 4TPIZ 1JOUB 1T8OA 1XMNB 1TABE 4K1TA 1O2ZA 4GAWA 1H4WA 2D2DA 2VVUA 2Y7ZA 3UNSA 1BBRK 2BX3A 4X8UH 2GZ8A 1GHWH 1ABJH 4B2BA 1O5BB 5HMAA 2CF9H 3UNQA 4HTCH 5GWZA 1GJ9B 2ZGXH 4WJG2 4K5ZA 1FI8A 2P95A 3H5CB 1KXFA 5I46H 1OPHB 4DJZB 2GTBA 1SLVB 2JETC 1PPHE 1WQVH 3A8AA 1OKXA 1MBMA 6CHAB 1LTOA 1ZLRA 1BJVA 3U98H 2OQUA 1IQEA 4ISNA 1GJ8B 1GI3A 1JWTA 4CRFA 3TGIE 3T25A 3I78A 1XUIA 1DSUA 3HGNA 3A7ZA 1V2UT 2XWBI 3URDA 1QBVH 1T4VH 4X1QU 1LDTT 4OS6A 2JH6D 4NFFA 1ETRH 3TJUA 2YOLA 2QV1A 3OTJE 2WYGA 1UVSH 1HAHH 3RC4A 2OP9A 1YC0A 3RXMA 1XUKA 5E2PA 5F8ZA 1RS0A 3OX7U 1W7XH 1YBWA 1BZXE 2QN5T 1K21H 1SBWA 3V3MA 1E36B 1VGCB 3U9AH 1GJ7B 2ZPSA 3PB1E 2BOHB 3DA9B 4MPWA 2W7UA 1VCPA 1A46H 2ASUB 4WVPE 2H9EH 1J14A 1CVWH 4MDSA 2ZU2A 3SU0A 2CGAA 1L0ZA 2PUXB 1Y3VA 1CBWC 3P70B 2A7HA 3E91A 3STIA 5E8EH 4D9RA 1AVXA 1NC6A 3D23A 1CT0E 4MG3A 2AH4X 1SI5H 3PYHA 4ZUHA 3BEIB 3LH3A 1ESBA 3UOUA 1RGQA 4BXWA 3QX5H 1YPLH 1TMTH 1TPOA 1MTVA 1SC8U 3GCHB 3FZZA 1CA0B 3F9HA 1NROH 3BG8A 1TA6A 2C8YB 3B8JA 2XYAA 3A85A 5SGAE 2ODYB 2ZO3H 5GXPA 1O34A 1GCTC 4NZQA 4WY3A 5PTPA 4Y7AA 1O3LA 1ELAA 3VFEA 4UFEH 1O2TA 2BM2A 4J2YB 2QXGA 4I8HA 1YLCA 3A7TA 2FLRH 3MO6A 2BZ6H 1Z7KA 3T27A 5C5NA 1GJBB 1NRQH 3O8RA 2TGDA 1F0TA 3NWUA 1GMHF 3OU0A 3T62A 1T8NA 4CR5A 3LU9B 4DGJA 1PPBH 5C1XA 4ABAA 1ZTKA 3LGIA 1G2LA 1SGCA 2NU4E 2UWOA 1QFKH 2HNTF 4X8TH 2AS9A 5CHAC 1HAPH 5EXNA 4AYYB 4AB8A 1QBOA 3ITIA 1BRUP 2Y7XA 1F5KU 1MD7A 1ESAA 1O2HA 5A0AE 5T6GA 1AFQC 3D49H 3QTOH 3UOPA 2P8OC 1SQAA 1GMCG 1QL9A 1YPKH 1AVGH 2P3UB 1DXPA 2B9LA 4CRAA 1YPGH 3U8RH 2FX4A 2FOMB 3VGCC 2BHGA 1W13U 1GBFA 2BDGA 4OS2A 3P8NA 3LH1A 5DP4A 2ZQ2A 1GJAB 3V12A 1N8OC 1ETTH 3NK8A 5DJ7A 2Z9IA 3AAVA 5G4BA 1P01A 1PFXC 4AG2A 1UJ1A 3JZ1B 4FUJA 2J92A 3MHWU 4Y6DA 1BRCE 3EA8A 2BYAX 2TRMA 1QJ6B 3V0XA 4GCHF 4X6MA 3EAJA 1S0QA 3M5MA 3F68H 3SJIA 1W10U 2H5DA 8GCHF 1HJ9A 3URCA 1DWDH 4X2VA 9ESTA 4Q80A 1C5UA 1HB0B 2ZF0H 1HIAB 1C5LH 1OYTH 2TGPZ 2AYWA 1O2OA 3HPTB 4OS5A 4Y10E 2Z7FE 2Z94A 2XBYA 1QA0A 5AVDA 1DY8A 1D3DB 2PKAA 2WUCA 1HAXB 2PHBA 1V2JT 4U30A 3GY2A 1P9SA 3ODFA 1C4U2 3GDVA 2ZA5A 3FP7E 1MBQA 1Z6EA 4HI3A 1N6XA 3OY6U 2R9PA 3S7KB 3SV9A 2H9TH 2XCNA 2GX4A 3KHVA 3VB7A 3NZIA 1RIWB 2AMDA 1H8DH 2ZTXA 3W95A 1PQ7A 1FUJA 1HAIH 2VIWA 1P10A 1OP8A 3A8BA 2ANYA 5T3HA 2TGTA 2A4QA 3RXDA 1O2MA 2G00A 2G52A 2Y6TA 2FOFA 1O2QA 1J17T 1P8VC 4ZMAH 1GI4A 3LKWA 4FUHA 2O8MA 1QQUA 2A31A 2AGIX 1AN1E 1G3EA 2I6QA 5FXLA 1VR1H 5AFYH 3IITA 2Y81A 1EAUA 3RP2A 4ZKRU 3SV6A 4IS5A 3Q76A 1SGYE 4LZ4B 4MPUA 4JZIA 3UNRA 1V2PT 1G3CA 4K8YA 2ZDAH 3P8GA 1O2XA 4DCDA 4AORA 5IDKA 3OYPA 1QTFA 1Z1IA 3RXBA 4J1YA 1C2EA 3RXHA 1Y5UT 1NPMA 1XXDA 3ZYEA 3EGKH 2BY8X 3QK1A 1ELFA 5EXLA 2QYIA 3PWCA 1WAYB 3SV8A 1FONA 5FHTA 1EQ9A 1LHGH 3TJOA 5DK1A 5C5OA 1V2KT 2PKSB 4B2CA 4D7FA 5EW2H 4D7GA 4Y71A 1WYKA 3A7YA 4KTCA 3SUFA 2P59A 1AZ8A 3UREA 2NU0E 1V2VT 1O2JA 1AY6H 2WPJS 3ZVDA 3A83A 3MFJA 3E90B 1C5PA 1MCVA 1GGDC 1PPCE 2FOAA 3RXKA 3GY8A 1QJ1B 3F6UH 1BITA 2WPIS 2ZC9H 1BMAA 4FU7A 2F9BH 1CHOF 1GJDB 2ZGHA 5JB9S 1GMDF 3D62A 2ZEBA 1O2RA 4CRDA 3RXOA 2BTCE 2J9NA 2IOTA 4DVAU 1Y5BT 3M7TA 3P92A 1HDTH 1P57B 1SGFG 2QIQA 4KTSA 3A81A 2PGQB 4OGYA 4TPYA 5DP8A 1S0RA 4LOYH 2HVXA 1GHZA 1MAYA 1F92A 1Z1JA 2IN2A 3BSQA 4XFQA 1G36A 3AVZA 4GHTA 1GBAA 4WMEA 1ANDA 1ZTJA 4ZKSU 3GICB 1T8LA 1C1RA 5F8TA 3SBKA 1V6DA 5EQSA 1O3HA 3QZRA 2EEKA 1CT2E 2I6SA 3CENA 1SGIB 1V2WT 2OTVA 2WYJA 2Y5GA 3RXVA 3RXJA 1UVPA 1GDQA 5IYTA 3U8OH 4ABEA 3P6ZB 3KL6A 1W7GH 1PYTD 1ELEE 1YGCH 1SQTA 5L2YH 2FXRA 1X7AC 2STBE 2JH0D 4BTUB 2QF3A 3ZZCA 3S7HB 3I29A 4K1EA 3R0FA 2BDCA 2G5VA 1SGTA 4B2AA 4XBBA 5DP3A 1HAVB 1O3BA 3BTHE 4F49A 3ATLA 4A92A 1P2IA 3ZVCA 1FJSA 1YPHC 2FS8A 1YM0A 1E34B 5EXMA 3ZZ7A 1BA8B 2FX6A 3Q00A 2CHAB 1Z71A 1TWXB 3FP8E 1LPZB 1C5OH 3RMMH 3E8LA 1UTMA 1ZSKA 5T6FA 1W12U 3A8CA 4IGDA 1NM6A 3DFJA 1C2HA 1H9LB 4JK5A 1AU8A 2AERH 4UD9H 3RC5A 8GCHG 1SQOA 3LGVA 1CGJE 2ZNKH 3BEUA 3SJ9A 2J94A 2FYRA 2LPRA 2FEQH 4KGAA 1IAUA 3NUMA 3PO1B 3M5NA 1B0EA 3K65B 3A80A 1WBGB 1C1NA 2H5CA 1JMOH 2FS9A 2ZDLA 4TY7A 1C5TA 1LHEH 3KGPA 1TBZH 1FY1A 3RU4T 2VJ1A 1OS8A 5FCRA 1W11U 1O37A 3LONA 3M3VA 1ABIH 3O8DA 2D8WA 2AGEX 3QO6A 1W14U 4K2YA 1K1OA 1VZQH 3RXAA 4BXSA 2ZKSA 2ZDKA 3TK6A 4ZROA 4YT7H 3RU4D 3RXUA 3LJOA 3RXQA 4FUDA 3RXCA 1QNJA 4GPGA 1S82A 4FUBA 1CT4E 3KF2A 1S85A 1RJXB 1PPFE 3Q77A 4FU9A 4NA8A 5GJ4B 1XUGA 4RSPA 3AAUA 2XBVA 5EGMA 1EUFA 1C1PA 1GCDA 4Y8XA 3SNBA 1D3TB 4HZHA 3L33A 3DUXH 1BMMH 3ZZ9A 2KAIB 4B75A 2ZCHP 2ZFPH 1DUEA 1ID5H 1F0RA 3DFLA 4ABHA 2VH6A 3LGYA 2ZHWH 3NCLA 1OWDA 2OXSA 1GBKA 4VGCC 1C2FA 1EJMA 1PPZA 1RFNA 3RMLH 5JYIA 1ACBE 3SHCH 2FOHA 5BRRE 3ZVFA 3K6ZA 3PMBB 2UWLA 4ZXXH 6CHAC 4NSYA 1Z8JB 3H7TA 4OS4A 5FBIA 3GYMA 1ZMNA 5EOKA 3SQEE 1EAWA 3SO3A 1AE5A 1BB0B 1GHAF 1SGQE 4ABGA 2BMGB 1O31A 2AMPA 4NIWA 3QGNB 1QB1A 2ZFTA 1O3AA 1GG6C 1TFXA 3CP7A 3M35A 1AMHA 2PW8H 2SGFE 4DG4A 3SUDA 2LNCA 3FP6E 1TX7A 1MU6B 5B6OA 1SHYA 1IQNA 1C5RA 1GJ4H 3TPIZ 5HM9A 3R3GB 2ANKH 2PLXA 1BIOA 1DX5M 5L6NH 1SPJA 1ZGIA 1AVWA 4X6NA 1C5WB 4D76A 1NRPH 1AO5A 3C27B 1PYTC 4ISHH 5L2ZH 1T7CA 3RXTA 4DURA 2IPHA 2UUKB 1LHCH 3QTVH 1J8AA 3RC6A 1AWHB 4JMYA 1C5XB 3M7UA 1IQFA 5EPNA 2XC0A 1KXBA 5DP5A 3MNCA 1GMDG 1AB9C 1TOCB 2AMQA 3HK6B 2SNWA 2BY9X 1JRTA 3O8BA 2FTLE 1HIAA 5DP6A 2GP9B 1TNGA 3BG4B 4MVNA 1NU7B 1YCPM 3H7OA 2GCHF 3NPSA 2F9OA 4ISOA 2ZFRH 3T28A 2A5KA 2ZU5A 5TJXA 2G51A 1TGCA 4X1PU 2BY6X 1JRSA 3UY9A 4UONA 4JZ1A 3ZZ3A 1K22H 1DWBH 1O2UA 2F3CE 2QC2A 4YOGA 1CA0C 4U2WA 2TBSA 4DIIH 3PTBA 2AFQB 2AIPA 1AUTC 3K6YA 3FVFB 2F83A 1C2IA 1EPTB 1AFEH 5TCCA 3RUOA 3MNXA 1NTPA 1G3DA 1DANH 2BDYA 3LGWA 2C3SA 2W7SA 2BVXH 2W5EA 1PQ8A 1KSNA 1CSOE 1BRBE 4MPVA 1GBDA 3ESTA 3S9AA 1C5QA 1A5IA 1DICA 1F2SE 4IBLH 5FPSA 3ATKA 3MU5A 3LGUA 2ZHFH 1BMLA 1OX1A 5GCHF 1QB9A 5EG4A 2BD5A 1BTXA 4CR9A 1GPZA 4ISLA 4Q7ZA 2A0QB 1THRH 1AWFH 3TGJE 3F9FA 1BCUH 1UTPA 1FV9A 1MTUA 4Y0ZE 1EB2A 4MQAA 1BJUA 2B7DH 3A87A 3PWBA 5C1YA 1O5CB 1HXEH 3VB5A 4OS7A 1ZTLA 1ZHPA 1YPJH 2BLWA 4X8VH 1DSTA 3EE0B 4X6OA 3BTWE 2OLGA 1AGJA 4OGXA 1LMWB 1V2LT 1EP5A 1CU1A 4H42U 2RG3A 2WPMS 4YOIA 2F9NA 2ZGCA 2G55A 2FM2A