1W13U

Urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w13U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w13U01
1LHCH 1QFKH 4INLA 2FTMA 3C27B 1BRUP 4CRDA 5DP4A 1J14A 1W3CA 4MLFB 3SV2H 1GCTC 1VITG 1Z6EA 1IQIA 1P8VC 1C1PA 1F5LA 3KQCA 4WMFA 3CP7A 1GVKB 1AZ8A 1C1RA 1W0ZU 4IW4E 2TGDA 5DK1A 4BAOB 3RXGA 3A8CA 4BTIB 1DPOA 1F92A 3SU4A 1AY6H 2FODA 4NWKA 3C1KA 4X1PU 1EPTC 4UD9H 1YCPK 1CBWC 1O33A 2JH5D 3OYPA 4XDEA 2JH6D 1GGDC 3QWCH 2ZCHP 1GVZA 1GG6C 2ZTZA 1ABIH 2QCYA 3P8OA 3T62A 2WINI 4GUXA 3SUDA 1DWEH 1BRAA 3U69H 3LIWA 1GI9B 2H9TH 1LVYA 3RXBA 3NZIA 1XKAC 4BOHA 2CHAC 1V2JT 3FP6E 1DLKB 1HAOH 4AFZA 4JZIA 2RA3A 2W3KA 2G51A 2BLQA 1FY8E 2R3YA 4U32A 3T28A 1O2SA 5GPIB 3KHVA 2OTVA 4MVNA 2BDCA 4NA7A 2ZEBA 2GTBA 1DSTA 1UTOA 2RCEA 1ZTKA 3HATH 4K60A 1SGQE 1OKXA 2W3IA 2FEQH 2OINA 3VFEA 2ANMH 1SQOA 5ESTE 4CRAA 2PHBA 1MZAA 3ZZCA 1SSXA 1P57B 3RXCA 1DUEA 2EI6A 5C67A 3N7OA 4SGBE 2ZDNA 1O39A 1VCPA 3PMAB 4DGJA 1ELGA 4X2YA 1QBVH 4I7YH 5C1XA 3NUMA 1S83A 2VWLA 3TJOA 4DT7B 3F6UH 3P8FA 1C9TA 1EZSC 1G32B 1EJAA 4NSYA 3T27A 1ID5H 1DFPA 2DUCA 2O8LA 1GWAA 1O5EH 1S82A 2D1JA 1BJUA 1ZTJA 1JIRA 5GCHF 1N1LA 1MBMA 2CJIA 1VGCC 2TIOA 1HAHH 1AB9C 1LMWB 3EA9A 3RMNH 2A5IA 4B75A 2J38A 4MPXA 1QL9A 7GCHG 1T31A 1NU7B 2GZ8A 9LPRA 2A4OA 1YPJH 1NFWA 3O8BA 4INHA 5ESBA 2Y82A 5K7RA 2P3TB 2FYRA 1C5ZB 2XBVA 3M7TA 2J9NA 1ZMLA 4ZXYH 5TCAA 1IOEA 5T6FA 4IC5A 2QF3A 1FAXA 1GI8B 1XX9A 1V2VT 1HCGA 1TQ0B 2HVXA 2STBE 3LGIA 2BVSH 2PKAB 4DW2U 1O37A 2VJ1A 1MKXH 3SU2A 1KXFA 5HXFA 2SNVA 4CRBA 1W2KH 2R0LA 5JBTA 3S7HB 1FJSA 2BXUH 3PO1C 4ISIH 3M3TA 2O8MA 1SGEE 1V6DA 3S9BA 3TPIZ 1GJDB 4B2BA 1N8OB 2ZFRH 3GICB 4FUHA 1HAVA 3ZZ7A 1OX1A 4AG1A 1O3FA 4F49A 5L2YH 3SV8A 2Z3EA 1P04A 2DE9A 3MNCA 4D8NA 1XUFA 2A4RA 4ISOA 1AZZA 1GBKA 2WPHS 4FXGH 2C4FH 3F9HA 4ISNA 4YTAA 1CT4E 1XUHA 4FUCA 1KLTA 2A32A 2GMTB 4X6NA 3S7KB 3VPKA 2PW8H 5DO4H 1BT7A 1GHVH 1FY5A 1XVMA 2A5KA 3QZQA 3K6YA 1LHGH 3B8JA 1TABE 2BDYA 4LZ4B 1MCVA 2QXIA 2VU8E 4DIIH 2ZTXA 3ATKA 3PV4A 1J16A 3A7WA 1G3DA 3M7UA 3RMLH 2G52A 1ANBA 2K1QA 1KLIH 4E7NA 1O2QA 1D3DB 1C5SA 4WVPE 1OS8A 4UEHH 4X1QU 2BQ6B 3URDA 1N6YA 1O5GH 2ZDMA 5FCKA 4Y10E 1NFXA 1WU1A 2G8TA 2BY8X 4O3UA 1P05A 1CT2E 1P9UA 2C8ZB 2ZDAH 1XUKA 1SGFA 2HWLB 4CHAC 3HPTB 3P70B 4O03A 1ZZZA 1TGBA 1T32A 1A2CH 2ZWLH 2BX4A 4U2WA 1UCYK 1W0YH 1TAWA 1HIAA 1AVGH 3TIUA 4A6LA 1TLDA 1ZMJA 6ESTA 1W14U 1LVOA 5CE1A 1GBCA 2BD7A 2J95A 1L0ZA 2AERH 4WJG2 2BD9A 3H5CB 3P6ZB 4E7RG 5HM9A 4D9RA 4ZH8A 1S0QA 4HZHA 2AIPA 3UFAA 1ANEA 4I33A 1MU6B 4MNVA 3SI4H 2OUAA 1LDTT 2ZQ1A 1GBIA 1C1NA 1M9UA 1DOJA 4X1RU 2D26C 1BITA 3BEFB 1AFEH 4AGKA 5AFYH 3SQEE 3P8NA 2CV3A 4OS4A 1Z6JH 1HV7A 4Q80A 1CVWH 3M37A 4AYVB 2JETC 4OGXA 1KDQA 3PWBA 3U8OH 1ARBA 1Y5AT 3GCNA 2ZDVH 3VGCB 3BTTE 3MFJA 3SW2B 4X8SH 2W7UA 2B7DH 3DUXH 1ZSJA 4NFEA 4KTCA 1HAPH 5I25A 4IN2A 3EGKH 1GCDA 1GJCB 4ZKOU 1O3LA 4MPUA 1WOFA 2FTLE 1UVTH 1WAYB 1Z8GA 4IMZA 3NPSA 2OC8A 1IHTH 2WPLS 3F1SB 1V2PT 1EB1H 3ODDA 1BTYA 1A0JA 2OQUA 1TOCB 3NWUA 1SGPE 3TJNA 2PFEA 3A80A 3LJOA 5LPRA 4FUFA 2WPIS 2H1UA 4YOIA 1ZSLA 4TWYA 2BY9X 1TIOA 4IN1A 3MWIU 1TFXA 4AB9A 3ZZ3A 1WQSA 4Q7YA 1GBDA 3FANA 1RJXB 1MAXA 3E0PB 5EQSA 1MKWK 1FXYA 5BPEA 5C2ZA 2A7HA 3E91A 1NRSH 5A0CA 1HJAB 1JIMA 1CA8B 4YLUA 4JK6A 1ZJDA 2BTCE 1GI5A 1BB0B 1CSOE 4NIXA 4CR9A 3LC5A 1WTGH 1V2ST 1P0SH 1Y5UT 2F3CE 2C8YB 4Y79A 4A1TA 3GCHB 3MHWU 5JBCS 5TCCA 1L1JA 3HGPA 2PTNA 1V2QT 2FI3E 1PPFE 4X8VH 1P09A 3L33A 2VIPA 1T8MA 1GBMA 2VGCC 1TRMA 1YPHC 3ITIA 2F91A 3MU0A 1YBWA 3BTGE 1EATA 3SJKA 1AGJA 1BTPA 1EPTA 3E6PH 4D7FA 3EAJA 1ESBA 5EODA 1FV9A 4YZUA 2ZPSA 3SNBA 1ABJH 2DE8A 1UTKA 4RSPA 5FHTA 1LQDB 2ZI2H 2OC0A 1GHXH 1MU8B 1C1QA 1TMTH 1PPBH 4RN6A 1TOMH 2NWNA 1AWFH 2P16A 2V3HH 1JOUB 4ZKRU 3ENSB 1LKAA 2WPJS 1XUJA 3W94A 1H9IE 3ZZ6A 1L2EA 1KIGH 4OGYA 3PWCA 2ZU1A 1HAVB 1YLDA 2XW9A 2KAIA 1G3CA 3FAOA 3CENA 1QBNA 1TA2A 4ZUHA 2SGEE 4DG4A 1CE5A 3PMHB 3VB7A 2ESTE 1NRNH 4Y8ZA 1E34B 1WV7H 1ACBE 2A4GA 2F9PA 2GCTB 1GHAG 5ETXA 1V2UT 3RMMH 1K1NA 5EW1H 3BEUA 3EDXB 5CHAC 1QJ7B 3Q77A 4LXBH 3T2NA 3GISB 3T25A 3HKIB 1O2IA 1KXAA 4R0IA 2PLXA 3Q3YA 3F9EA 3UOUA 3TH4H 1NRRH 1CA0B 2UUKB 1O2WA 2AEIH 2HRVA 2P3FH 3BG4B 3RXUA 4MDSA 2FOEA 1B0EA 2ZG0H 1FIZA 1SFQB 2AGEX 3BG8A 2UUJB 4O9VA 1T4UH 3QN7A 1ETRH 1GMDG 1MTSA 2ZIQH 5EPYA 1O2XA 1D9IA 3SV6A 2FLBH 2HPQH 1DLEA 1B5GH 2Z7FE 3SHAH 3SU3A 2VIQA 1TGTA 2HNTC 2HOBA 1QB9A 4KTSA 4WY3A 1C9PA 5F8ZA 1BTUA 3QO6A 1QQ4A 2AGIX 3BTQE 3AVZA 1BTXA 1ANCA 1YCPH 1G3EA 1C2DA 1TPPA 2A31A 3EA8A 2SNWA 4XOJA 3RM2H 3MOCA 1IQGA 3LC3A 3PTBA 1VCWA 1EAIA 4KKDA 3VB4A 3PM3A 1HPGA 3ZZAA 1O0DH 1UVSH 1QY6A 1HIAB 2FOAA 3F9GA 2F83A 1C2GA 1GI1A 1OP0A 1DWBH 1EJNA 3RXFA 4ABBA 4AG2A 2IJOB 1UTLM 4H6SB 4X8UH 1NC6A 2QXJA 5EQRA 2YNAA 1YP9A 4XE4A 4AX9H 4U30A 1QB6A 1BTWA 3FP7E 4ZKNU 5T3HA 3SUEA 5F6MA 5ABWA 1TALA 2QIQA 1LVMA 2QXHA 3H7TA 2IN2A 2ZDLA 2FOHA 4AYYB 1J8AA 1ELTA 1QBOA 2Z94A 3FVFB 3LDXH 1ZHMA 3BTEE 3DFJA 4IS5A 1KDQB 1ELBA 1FAKH 3PB1E 2P94A 2BY6X 1WQVH 1GMHG 2ZU5A 1ESAA 2FIRH 1V2TT 3SGBE 3GY5A 1VCQA 1XM1A 4FU7A 3MTYA 3TK6A 2XNIA 4YOJA 4K2YA 4B2CA 4B74A 4CBNA 3NCLA 1MUEB 2JKHA 4DY7B 1F2SE 2ANYA 1ETSH 3SUGA 1TPOA 2O8WA 2QYIA 1EZUC 3SJIA 3VB6A 4JZDH 4UDWH 1CO7E 1SC8U 2FDAA 3A8AA 3A7VA 2ALPA 2O9QA 1QHRB 2A5AA 1QA0A 2Z9LA 4B1TA 1OWEA 2CMYA 3A82A 3LKWA 1RTFB 1C1VH 2OQ5A 3RXLA 6GCHF 4H6TA 4K8YA 1MQ6A 4WH8A 3TLOA 1EX3A 2O8UA 3A81A 3QX5H 4CR5A 1A7SA 5IYTA 2ZTYA 1IQFA 4KP0A 3BTFE 6CHAB 1P2JA 1L1GA 1P2IA 4K3JA 3RXKA 1O3HA 3K6ZA 1Z8RA 3LH1A 5HGGA 3A88A 3V7TA 2FI4E 5E0HA 1A1RA 2ALVA 2HALA 5E0JA 2CXVA 3O8CA 1ZYOA 1SQTA 2FZZA 3OSYA 2XBYA 1HAXB 2OBQA 1C1UH 1ZSKA 1O3AA 1L4DA 4GPGA 2ZU3A 4IC6A 4NCYA 1UK3A 1HYLA 4O3TA 1QGFA 5JYIA 3RXVA 2BDIA 1P9SA 1G2LA 2RG3A 1LCYA 2Y5HA 4NFFA 4DJZB 4F4OC 4TPYA 2BYAX 1Y3XA 1GBTA 3LGUA 3OY6U 3L6PA 3H7OA 5HM2A 1DDJA 1YLCA 1SFIA 4I8LA 3ZVAA 1YPEH 4KTUA 3T29A 3P95A 3F68H 2BZ6H 1OWIA 3SU6A 3RXSA 2BY7X 1FY1A 1Q31A 2WYJA 1IQEA 1CBWB 1P11E 1CHOF 2TPIZ 3MMGA 1C5UA 5C1YA 2EEKA 1C2FA 3NK8A 4KELA 1GGDB 1HAGE 4MNWA 1V2RT 2P8OC 2STAE 1THPB 1AQ7A 2G00A 1Z71A 2OCVB 3E3TA 1UTNA 1O2YA 1SGRE 1SGDE 3TJVA 1E38B 5E2PA 1QRWA 1O2TA 4AN7A 1THSH 1BBRH 4J2YB 1J9CH 1C5OH 4A1VA 3TVJB 1SGTA 3ZZ4A 2B9LA 2GKVE 2ULLA 2KAIB 1AKSB 4MTBA 1XUGA 2FLRH 3PROA 2SGAA 1GDQA 1XVOA 3QTOH 4I8HA 4NIWA 1O32A 4AZ2B 1TNKA 2G5VA 1AHTH 2R2MB 5H4IB 2CF8H 2QGRA 1VR1H 1EP6A 3L3TA 1CGHA 2J2UA 3O8DA 1AUTC 3V13A 1BMMH 1F0RA 1DITH 3TNSA 3EE0B 2CGAA 2FO9A 4I32A 4O97A 3SOSA 3MU5A 3MU4A 4CBOA 3AAVA 3M5NA 1GHWH 2WV5A 1T7CA 3DT0H 3M35A 1P02A 4X1SU 2V6NA 2AMPA 4SGAE 4BXWA 3ATWA 1NU9A 4IBLH 1W12U 3SJ8A 3KQDA 2ZGCA 4ISLA 2HGTH 2ZECA 5EG4A 2QV1A 2Z9JA 2PKSB 1C1MA 3KF2A 1RGQA 4QT8C 4YM9A 2EI7A 1ZPZA 4CRGA 1GHBF 5AFZH 2OD3B 1G2MA 1OPHB 4A5TS 2ZU4A 1TRYA 1V2OT 1INCA 2ZC9H 1TWXB 5E0GA 3SBKA 1Z8JB 1UHBA 4FU8A 1O5DH 4Y76A 5LPFA 5A0AE 1HXFH 1TNHA 3ZZ9A 2C90B 2G4UA 3A7TA 3EA7A 3RXMA 1C2JA 3ZV8A 1BCUH 3MH4A 1H8DH 1NESE 1C2LA 1T8NA 2TGAA 3D62A 1KXCA 1YPMH 2AH4X 2HPPH 1J15A 2OLGA 1T4VH 5E8EH 1YM0A 1O2GH 5F8TA 1MTVA 3K2UA 1IQJA 3T26A 4JZFH 4K1SA 3QLPH 2XC5A 2BMGB 3D49H 3OU0A 3CS0A 2VVCA 1B0FA 3GCTF 1EAUA 1O2HA 2FOMB 3UQOA 3LONA 3K9XB 1GDUA 1K2I1 3RM0H 1ANDA 3E0NB 1QTFA 4WXIA 1CQQA 1QURH 3ODFA 3T5FH 1HGTH 1JMOH 1RIWC 1YC0A 1CGIE 2Y80A 2ZCKP 1EZXC 1GJ5H 1GMCG 1O5BB 2ANWA 2CF9H 2PWXA 3PO1B 2ZQ2A 2FOBA 3E16B 1D3TB 2H9HA 3B9FH 5FCRA 3VB3A 3M7QA 1GBLA 5L6NH 1O3DA 1RRKA 2A45B 3FZZA 3TGIE 2FS9A 1IQMA 3GOVB 4XBDA 4BAMB 3AW0A 1AUJA 1O2JA 1ZTLA 1LPKB 2PGBB 2EI8A 3ZVBA 3PMJA 1P2OA 4CREA 4ZAEA 1WYKA 1E36B 1UTJA 4LK4A 3QGNB 2FI5E 1TX7A 3DA9B 2FYQA 4NG9H 2ZZUH 2BM2A 3LPRA 1C5YB 1O2NA 3BSQA 2D8WA 4LOYH 1MD7A 5FAHA 1AVWA 3ZZDA 1AN1E 1OWJA 1ELFA 2HLCA 8GCHF 4ABGA 4UONA 3GY8A 3O8RA 3RXHA 2VH0A 3MYWA 3ZVCA 5K0HA 3PLPA 1MZDA 1CU1A 4IMQA 3LGTA 3LU9B 1O2OA 1OWHA 2ZFTA 4AGJA 2P59A 1DM4B 5I46H 1HJ8A 4M7GA 3JZ2B 2BVXH 3BTDE 3TGKE 2F9VA 4Y6DA 1O3MA 9ESTA 4CHAB 1H4WA 4GCHF 3QUMP 5AF9H 4GHQA 3RU4D 3UOPA 1HUTH 3Q76A 2BLOA 1DSUA 1GI4A 1K1MA 2VWOA 1VJAU 1V3XA 3KQBA 1GI3A 2OBOA 8LPRA 5GCHG 2BVRH 4X8TH 3ZYDA 2ZFQH 1D6RA 1QCPA 1LHEH 1MTWA 1P06A 2HNTF 1MKXK 1EB2A 1KXEA 5SGAE 1TNGA 1UJ1A 4TY7A 2BZAA 3BV9B 3FZDA 1QL8A 4ISHH 1SBWA 3GY6A 2ZCLP 5C1UA 1BTZA 5G4BA 2GDDA 4UFFH 1NY22 2ZGJA 4WXVA 4FUDA 1JWTA 1TB6H 2FM2A 5F03A 1OYQA 4X2VA 3MU1A 1ZRBA 3SV7A 4BAHB 3GYMA 2Y5GA 3LJJA 1GL1A 3KL6A 4VGCC 1PQAA 1TGNA 1GDNA 3PLKA 3NXPA 4I8GA 1A3EH 3LT3A 4MQAA 1N6XA 1V2KT 1O5CB 4U01A 4ABHA 3RP2A 1HJAC 2VWMA 3TU7H 1HB0B 1AFQC 1DVAH 1TMUH 3GY7A 5LH8A 2V35A 2GDEH 2XYAA 4NSVA 1C5NH 4UFDH 1X7AC 1PPCE 4ABFA 1TA6A 1TE0A 5J4QA 2J34A 2GT8A 3QGJA 4ABDA 3GCHC 3LH3A 1HRTH 4X6MA 1DT2A 3U8RH 5JB9S 4FVDA 4R8TB 3ZVFA 3SGQE 1RFNA 1MQ5A 1SGCA 1Z7KA 3S9CA 3P17H 5A09A 1C5TA 4Y11E 1VITH 1MTNC 2QAAA 3RXRA 3OX7U 1W8BH 2J94A 4A92A 1GPZA 2H2ZA 3HK3B 1NN6A 2ZHDA 1O2UA 2BLVA 3DFLA 1V2LT 1B7XB 2GCHF 3M5OA 4I8KA 2BDHA 5FPTA 3ATIA 1D3PB 5L30H 2Y81A 3PTNA 2FPZA 2ZO3H 2ASUB 1Q2WA 2VVUA 2ZGBH 1DY8A 4ESTE 2SFAA 3UNRA 2W7SA 2Q6DA 5J4SA 3S69A 4JYUH 4Q7ZA 1ELDE 3RC5A 4KGAA 1PPZA 2BD8A 1BMAA 1VITF 3FFGA 3DHKH 1P10A 2M5TA 3A85A 1GBEA 4K1TA 4ZXXH 4LZ1H 3DD2H 1AI8H 2WV4A 1ELVA 1FIWA 1ZGIA 1KY9A 2AIQA 1Y3YA 5GIBA 2BD5A 1RXPA 4JK5A 5DPAA 1FY4A 1YCPM 2XCNA 3GY3A 1V2WT 2VWNA 1A5GH 1BRBE 2H5DA 4D9QA 3RC6A 2BD3A 2ZGXH 5FX5A 2AGGX 1C4Y2 3STIA 2C93B 2ODYB 1WCZA 2A4QA 2Z3CA 3UIRA 1HDTH 4X0WU 1SLWB 2VH6A 2AMDA 1F5RA 1ZRKA 1IQLA 8ESTE 1TNJA 5DP6A 1SGFG 4WWYA 2C8XB 7KMEH 1ZHPA 2FOGA 1C2MA 1BTHH 4Q7XA 3GCOA 5T6DA 4CH8B 1HAZB 3ZZ8A 3FP8E 5CHAB 5DP9A 3TH2H 1W7XH 2WUBA 1OSSA 1WSSH 5DP5A 1FN8A 1TBQH 3VXFH 1NT1A 1PFXC 1IQNA 3A8BA 1V2MT 1HXEH 1W13U 4MNYA 4DURA 1O34A 1ELAA 3A7YA 3BTHE 3MO6A 1O5AB 3M36A 4JZ1A 5HMAA 2BQ7B 1ZGVA 5JDUB 3SZNA 5C20A 5TJXA 1C1WH 3UY9A 1O3CA 2ZF0H 4B71A 1ESTA 3AW1A 1TGSZ 2C8WB 1GJ7B 1O3IA 1OWDA 4X2WA 1XXFA 1PYTD 2PV9B 2TRMA 3E8LA 5LGOA 1SHYA 1GVLA 3RU4E 3IITA 2XWBI 1Y59T 4YOGA 2J92A 1BJVA 2G5NA 2XXLA 2Z3DA 2BX3A 2TBSA 2H9EH 1Y3UA 2A7CA 1GI6A 1QRXA 1BBRE 4BANB 1A4WH 4OS1A 1GBBA 5EOKA 7GCHF 2VIOA 1TBRH 2BD2A 3SV9A 4E05H 1BMLA 3TK9A 5C5NA 1G9IE 2GV7A 3MO9A 2A1DB 5EW2H 4BAQB 3QTVH 1O3JA 1SPJA 1LVBA 3GY2A 1P3EA 4BAKB 2RDLA 1NRPH 1NROH 1RTLA 1KLJH 1TX6A 4CH2B 2ZFFH 3UWIA 4AFQA 4FU9A 1Z1IA 2B8OH 2GX4A 1P2MA 2F9BH 2UUYA 6CHAC 5FX6A 1AVXA 4Y7BA 4FUIA 3LGWA 2FESH 1JBUH 1GI7B 2UWLA 1O35A 4THNH 4GLYA 3A7XA 3BTKE 3BEIB 1UTPA 1QNJA 3B23B 1NO9H 1S84A 2FWWA 1H1BA 5EXMA 3LOXA 5DGJA 3ZVGA 4ZHMU 3TGJE 2GP9B 3AAUA 3S0NA 5FBEA 2NU1E 3MH7A 4ZHLU 1K1JA 3E1XB 2GZ7A 2LPRA 1BMNH 3GDSA 1FPHH 5EU8A 2OC7A 5FBIA 1NTPA 1O30A 3BIUH 4OS2A 4CRCA 1K1LA 3KEEA 1H9HE 4YLQH 5IDKA 1ARCA 1TX8A 3M3SA 3RC4A 3TNTA 1LO6A 2YNBA 4DOQA 3I29A 2Y7XA 1GMCF 1BRCE 1O31A 2F9UA 3SI3H 2ANKH 2A7JA 1GJ8B 4K8BA 1RS0A 1GCTB 4XSKU 1KTTB 5BRRE 2D2DA 2UWPA 1F0SA 2F9NA 1YPHE 3Q3KA 1SHHB 4A1XA 1GJBB 2VINA 1DE7H 4Y8YA 1KTSB 3VXEH 1P2QA 4I8JA 1JXPA 2Z6BD 1EPTB 5CMXH 1O3NA 3PMBB 4YESB 1O3OA 2RA0A 2SGQE 4Y7AA 4NA8A 3ZV9A 1NPMA 4NGAH 4TYDA 3RLYH 1O3KA 1UVUH 2XBXA 1ZHRA 1GG6B 2WUCA 3OTJE 2XCFA 3R0FA 5DP3A 1S0RA 3UQVA 2QN5T 1O3PB 1G36A 2IPHA 4H42U 1XMNB 2GT7A 2ZNKH 2ZHFH 1WTHD 1LHDH 1ZPBA 1TONA 4OS6A 4OS5A 4NIVA 1H9LB 3ELAH 2CHAB 3SU0A 2G81E 2IOTA 4IGDA 1FZZA 1GI2A 1YPLH 3UR9A 1HJ9A 4GHTA 4ZHAA 3TK5A 3M61U 3NKKA 1KXBA 1OOKB 2XBWA 2FMJA 3SO3A 2SGFE 2Q6GA 4AB8A 1GL0E 1DWCH 1FMGA 1O5FH 2H5CA 2W26A 3GDUA 5EXNA 4Z0KA 1O2ZA 2F9OA 1MTUA 2ZP0H 1D6WA 2R2WU 2P8OB 1NM6A 1HNEE 1G30B 1QA7A 3VEQB 3TH3H 1S81A 2PKSC 3RUOA 4E06H 1GBAA 1S6FA 4D76A 1P3CA 4NA9H 2QXGA 1A0HB 2GZ9A 1O2MA 1FQ3A 2Z9IA 3D65E 3ZVEA 4D7GA 1YYY1 1PPHE 2BLWA 4UE7H 2HNTE 1ZR0A 1F0TA 1NFUA 1O3GA 1UCYH 3WY8A 3UWJH 1FI8A 5DJ7A 1EAXA 1BZXE 4Q2KA 2ZPRA 3CS7A 1DXWA 1LPZB 3GYLB 3ZZ5A 2O8TA 1TNIA 1E0FD 1TPSA 1ZLRA 1VGCB 1HFDA 3RU4T 3A7ZA 3ZVDA 1O2RA 3ESTA 3RXDA 4AOQA 3KIDU 2P95A 1AB9B 3P92A 1YGCH 1CHGA 2BB4A 1CGJE 2I6QA 4WMDA 3LGYA 4B2AA 1SI5H 1N8OC 2VNTA 2FOFA 1EOLA 1TYNA 5DP7A 1G37A 4BTUB 1C2EA 1QJ1B 4Y0ZE 2ZHWH 2Q1JA 1SMFE 1TBZH 2BDBA 2Y6TA 3G01A 1C5PA 3K65B 3KCGH 1BA8B 2R0KA 3SGAE 3LGVA 1THRH 4HGCA 2NU4E 1YF4A 1DWDH 1EXFA 4XBBA 3UNQA 2BDGA 3Q00A 1J17T 6GCHG 2GMTC 5T6GA 3A86A 1C4V2 2FX4A 1FPCH 4UFEH 1IQKA 1C5MD 2SGPE 1O2VA 2QA9E 3I77A 3Q3XA 1O36A 3M3VA 1HAIH 1MD8A 2QF0A 1FLEE 4NZLA 2BHGA 2PSXA 1P2KA 2LNCA 5HYOA 1HLTH 4JYVH 4X6PA 3RXOA 3RXQA 4FVBA 3SNAA 2JH0D 3EYDA 1LPGB 5A0BA 5GWZA 3M5MA 1C1SA 5E2OA 3SN8A 2VIDA 1V2NT 2EC9H 1UTQA 3HKJB 2ZDKA 3MO3A 1BBRK 4BTTB 2QC2A 3QDZB 2GD4B 2ZGHA 2AMQA 1QQUA 3UNSA 3F9FA 1QL7A 3A87A 1UMAH 1MKWH 2GV6A 4TWWA 1F0UA 3EQ0H 4X1NU 3V12A 3UUZA 4WH6A 1D3QB 1C2IA 2A2QH 2THFB 1BDAA 1C5LH 2PTCE 2B5TB 1RIWB 4JMYA 1OP2A 2FS8A 1SLVB 1K1OA 1XUIA 3RXJA 1LQEA 3TITA 1E35B 1K21H 2XRCA 1SLXB 3MH5A 1AU8A 1Y3VA 2FXRA 2SGDE 4PROA 2C3SA 2PR3A 4K69A 5EPNA 1C2HA 5DP8A 2BOHB 4MPVA 4HTCH 1P2NA 1AMHA 1CHOG 1PQ5A 1K28D 2R9PA 4ZMAH 1VJ9U 2VIVA 1DXPA 1AWHB 1GHAF 2PGQB 1UVPA 1A5IA 4ABEA 3A83A 5B6OA 1FN6A 3V0XA 4Y8XA 1OXGA 2V0BA 3AASA 1BQYA 1ZMNA 2I6SA 1W7GH 4FUBA 1C5XB 1AD8H 4FUJA 1SQAA 5JBBS 3RLWH 3VGCC 1QIXB 1DY9A 4X6OA 1K1PA 3GY4A 2OP9A 3V3MA 1EP5A 3HK6B 1TNLA 4GVUA 1EZQA 4DIHH 4K5ZA 1XXDA 2XWAA 1MCTA 2XC0A 1S5SA 1GMDF 2WPKS 4Y71A 1TMBH 2ZFPH 1SLUB 1W11U 1UO6A 5LPEA 1A0LA 1DUAA 5FPSA 1SR5C 4GSOA 1E37B 4XFQA 4WF8A 4OS7A 5JB8S 1T8LA 3OY5U 4NZQA 3GDVA 1PJPA 3BTWE 4ABJA 1MH0A 2ILNA 1K22H 2G4TA 1RTKA 4ASHA 3JZ1B 3ATMA 1MBQA 5C3NA 4B73A 3SNDA 1O2PA 1JRSA 2NU0E 3RXIA 1IQHA 2JETB 2V3OH 5C5OA 1CT0E 2H6MA 1T8OA 1GHBG 2ODPA 4Y0YE 1S85A 3QZRA 3U8TH 3ZZBA 4HFPB 1PPEE 1PQ7A 1GI0A 3UPEA 3MNSA 4YT7H 1G3BA 1GHZA 2WPMS 4TY6A 1BHXF 3D23A 2EA3A 2PUXB 3M5LA 1KSNA 3UR6A 4FUEA 2Y7ZA 5EXLA 3IG6B 1DS2E 1GBHA 1GJAB 8KME2 1MAYA 2G55A 1YKTA 3SNEA 1ZPCA 2ZHQH 4VGCB 1RD3B 4XBCA 1W10U 3P8GA 1O2KA 1XKBC 3SUFA 3RXPA 5L2ZH 1L4ZA 4NWLA 1SG8B 1GMHF 1S6HA 3MNBA 3A8DA 1A5HA 1GJ6A 4AORA 4FUGA 1A46H 1KXDA 1EJMA 7LPRA 5F8XA 1C5RA 4WMEA 3TJUA 1AFQB 3GCTG 1AIXH 1IHSH 1HAYB 4JZEH 1Y5BT 5DG6A 1YPGH 3U98H 1SOZA 2FX6A 1SGNE 2FOCA 2XC4A 2Z9KA 2UWOA 4MPWA 3QK1A 1UHBB 1P01A 2XTTB 3PLBA 1QR3E 1UVOA 2ZFSA 7ESTE 1IAUA 4AFSA 2AFQB 2TGPZ 1VZQH 2Z9GA 6LPRA 1FNIA 1P12E 3MNXA 3SJ9A 1EQ9A 4GAWA 1EKBB 1MMJN 1MTNB 1NRQH 1PQ8A 5A2MH 1GHYH 2GCTC 5AHGH 2OC1A 1PPGE 2ZA5A 1BUIA 1FUJA 1Z1JA 2VGCB 1LHFH 2ODQA 1CA0C 4ABIA 1ELCA 1JRTA 2BQWB 4MNXA 3RDZA 4X2XA 4UFGH 2A2XH 4I31A 2ZKSA 1DICA 3BG4C 5A8ZA 2VB0A 5DKMA 1TPAE 8GCHG 1GBFA 4ABAA 4MG3A 3S9AA 4B76A 1EUFA 1ZJKA 3RMOH 1AKSA 1C1OA 5AVDA 1HBTH 1NZQH 5JBAS 1K9OE 2R3UA 3U9AH 3U1JB 2B0FA 1OWKA 3SORA 4TPIZ 3KN2A 1GJ9B 1SB1H 3IWMA 1AE8H 1LTOA 3MU8A 3UREA 1FONA 2BDAA 1UTMA 4RKJB 1DX5M 4YO9A 3KGPA 1YPKH 3ZYEA 5GJ4B 3W95A 3HGNA 1OYTH 1UK2A 4JYTA 2ZU2A 5FXLA 2BY5X 1EAWA 1TQ7B 4GCHG 4INKA 1C5WB 3KQEA 1NS3A 5EQQA 1Y8TA 1KYNA 3RXAA 4AFUA 2WYGA 1QJ6B 2NU3E 1C5VA 3BTME 1FDPA 1BIOA 2FP7B 3VB5A 1SGIB 1QRZA 4RKOB 2OXSA 1K1IA 2J4IA 3KNXA 3SHCH 1Y3WA 1H8IH 1O38A 1A61H 1C4U2 1GBJA 1EASA 1BOQA 3SJOA 1DANH 1SGYE 3SU1A 5JPMH 2GVFA 3URCA 1C2KA 2W5EA 3BIVH 4H4FA 1SOTA 2NU2E 3E90B 4Z6AH 5A8YA 4CRFA 1ELEE 2BD4A 2PKAA 1O3EA 3BF6H 1D4PB 2PUQH 1Z8IB 3R3GB 1O3BA 3I78A 2VVVA 2PSYA 1AO5A 1EOJA 5PTPA 4NIYA 1PYTC 4YT6H 2CN0H 2VIWA 1WUNH 1QB1A 1A3BH 1P03A 3SU5A 1ETTH 2AS9A 3PYHA 1SL3A 1TGCA 1C1TA 4JCNA 1F5KU 1ORFA 3UTUH 3RXEA 2A0QB 5GXPA 1OP8A 2BXTH 4ZROA 1FY3A 4HI3A 3MI4A 4DCDA 1AE5A 3STJA 1ZOMA 5EGMA 1Q3XA 1WBGB 5GDSH 1U6QA 1C5QA 3SNCA 1TRNA 4K1EA 1GJ4H 1BHXB 1UK4A 2BOKA 3BN9A 5FPYA 2Y5FA 4ZKSU 3A84A 2UUFB 2YOLA 1L1NA 1F7ZA 2GGVB 2Q6FA 4J1YA 2GCHG 2ZHEH 3U1IB 2AYWA 3MH6A 3SQHE 4A7IB 3ATLA 1UCYE 2P93A 1SVPA 1NFYA 2P3UB 2TGTA 1O2LA 2ZPQA 1LKBA 5A8XA 4BXSA 2QY0B 4DVAU 3A89A 4BNRA 3RXTA
chains in the Genus database with same CATH superfamily
1LHCH 1QFKH 4INLA 2FTMA 3C27B 1BRUP 2WSSD 4CRDA 5DP4A 1J14A 1W3CA 4MLFB 3SV2H 1GCTC 1VITG 1Z6EA 1IQIA 1P8VC 1C1PA 1F5LA 3KQCA 4WMFA 3CP7A 1GVKB 1AZ8A 1C1RA 1W0ZU 4IW4E 2TGDA 5DK1A 4BAOB 3RXGA 3A8CA 4BTIB 1DPOA 5FL7D 1F92A 3SU4A 1AY6H 2FODA 4NWKA 3C1KA 4X1PU 1EPTC 4UD9H 3F0PA 2RFKC 1YCPK 1CBWC 2W6JD 1O33A 2JH5D 3OYPA 4XDEA 2JH6D 1GGDC 3QWCH 2ZCHP 1GVZA 1GG6C 2ZTZA 3OTPA 1ABIH 2QCYA 3P8OA 3T62A 2WINI 4GUXA 3SUDA 1DWEH 1BRAA 3U69H 3LIWA 1GI9B 2H9TH 1LVYA 3RXBA 3NZIA 1XKAC 4BOHA 2CHAC 1V2JT 3FP6E 1DLKB 1HAOH 4AFZA 4JZIA 2RA3A 3F2FA 2W3KA 2G51A 2BLQA 1FY8E 2R3YA 4U32A 3T28A 1O2SA 2K0QA 5GPIB 3KHVA 2OTVA 4MVNA 2BDCA 4NA7A 2ZEBA 2GTBA 1DSTA 1UTOA 2RCEA 1ZTKA 3HATH 4K60A 1SGQE 1OKXA 2W3IA 3PRDA 2FEQH 2OINA 3VFEA 2ANMH 1SQOA 5ESTE 4CRAA 2PHBA 1MZAA 3ZZCA 1SSXA 1P57B 3RXCA 1DUEA 2EI6A 5C67A 3N7OA 4SGBE 1EFRD 2ZDNA 1O39A 1VCPA 3PMAB 4DGJA 1ELGA 4X2YA 1QBVH 4XRNA 4I7YH 5C1XA 3NUMA 1S83A 2VWLA 3TJOA 4DT7B 3F6UH 3P8FA 1C9TA 1EZSC 1G32B 1EJAA 4NSYA 3T27A 1ID5H 1DFPA 2DUCA 2O8LA 1GWAA 1O5EH 1S82A 2D1JA 1BJUA 1ZTJA 1JIRA 5GCHF 1N1LA 1MBMA 2CJIA 1VGCC 2TIOA 1HAHH 1AB9C 1LMWB 3EA9A 4DT4A 1S6LA 3RMNH 2A5IA 5DN6D 4B75A 2J38A 4MPXA 1QL9A 7GCHG 1T31A 1NU7B 2GZ8A 9LPRA 2A4OA 4F48B 1YPJH 1NFWA 1QZ8A 3O8BA 4INHA 5ESBA 4YXWD 2Y82A 5K7RA 2P3TB 2FYRA 1C5ZB 2XBVA 3M7TA 2J9NA 1ZMLA 4ZXYH 5TCAA 1IOEA 5T6FA 4IC5A 2QF3A 1FAXA 1GI8B 1XX9A 1V2VT 1HCGA 1TQ0B 2HVXA 2J98B 2STBE 3LGIA 2BVSH 2PKAB 4DW2U 1O37A 2VJ1A 1MKXH 3SU2A 1KXFA 5HXFA 2SNVA 4CRBA 1W2KH 2R0LA 5JBTA 3S7HB 1FJSA 2BXUH 3PO1C 3WWBA 4ISIH 3M3TA 2O8MA 1E79D 1SGEE 1V6DA 3S9BA 3TPIZ 1GJDB 4B2BA 1N8OB 2ZFRH 3GICB 4FUHA 1HAVA 3ZZ7A 1OX1A 4AG1A 1O3FA 4F49A 5L2YH 3SV8A 2Z3EA 1P04A 2DE9A 3MNCA 4D8NA 1XUFA 2A4RA 4ISOA 1AZZA 1GBKA 2WPHS 4FXGH 2C4FH 3F9HA 4ISNA 4YTAA 2VBCA 1CT4E 1XUHA 4FUCA 3PV2A 1KLTA 2A32A 2GMTB 4X6NA 3S7KB 3VPKA 2PW8H 5DO4H 1BT7A 1GHVH 1FY5A 1XVMA 2A5KA 5KGOA 3F2GA 3QZQA 3K6YA 1LHGH 3B8JA 1TABE 2BDYA 4LZ4B 1MCVA 2QXIA 2VU8E 4DIIH 2ZTXA 3ATKA 3PV4A 1J16A 3A7WA 1G3DA 3M7UA 3RMLH 2G52A 1ANBA 2K1QA 1KLIH 4E7NA 1O2QA 1D3DB 1C5SA 4WVPE 1OS8A 4UEHH 4X1QU 2BQ6B 3URDA 1N6YA 1O5GH 2ZDMA 3OEHD 5FCKA 4Y10E 1NFXA 1WU1A 2G8TA 3ZIAD 2BY8X 4O3UA 1P05A 1CT2E 1P9UA 2C8ZB 2ZDAH 1XUKA 1SGFA 2HWLB 4CHAC 3HPTB 3P70B 2KR7A 4O03A 1ZZZA 1TGBA 1T32A 1A2CH 2ZWLH 2BX4A 4U2WA 1UCYK 1W0YH 1TAWA 1HIAA 1AVGH 3TIUA 4A6LA 1TLDA 1ZMJA 6ESTA 1W14U 1LVOA 5CE1A 1GBCA 2BD7A 2J95A 1L0ZA 2AERH 4WJG2 2BD9A 3H5CB 3P6ZB 4E7RG 5HM9A 4D9RA 4ZH8A 1S0QA 4HZHA 2AIPA 3UFAA 1ANEA 4I33A 1MU6B 4MNVA 3SI4H 2OUAA 1LDTT 2ZQ1A 1GBIA 1C1NA 1M9UA 1DOJA 4X1RU 2D26C 1BITA 3BEFB 1AFEH 4AGKA 5AFYH 3SQEE 3P8NA 2CV3A 4OS4A 1Z6JH 1HV7A 4Q80A 1CVWH 3M37A 4AYVB 2JETC 4OGXA 1KDQA 3PWBA 5CHBA 3U8OH 1ARBA 1Y5AT 3GCNA 2ZDVH 3VGCB 3BTTE 3MFJA 3SW2B 4X8SH 2W7UA 2B7DH 3DUXH 1ZSJA 4P00A 4NFEA 4KTCA 1HAPH 2IJD1 5I25A 4IN2A 1WDIA 3EGKH 1GCDA 1GJCB 4ZKOU 1O3LA 4MPUA 1WOFA 2FTLE 1UVTH 1WAYB 1Z8GA 4IMZA 3NPSA 5F53A 2OC8A 1IHTH 2WPLS 3F1SB 1V2PT 1EB1H 3ODDA 1BTYA 1A0JA 2OQUA 1TOCB 3NWUA 3OEED 1SGPE 3TJNA 2PFEA 3A80A 3LJOA 4ZCNA 5LPRA 4FUFA 2WPIS 2H1UA 4YOIA 1ZSLA 4TWYA 2BY9X 1TIOA 4IN1A 3MWIU 1TFXA 4AB9A 3ZZ3A 1WQSA 4Q7YA 1GBDA 3FANA 1RJXB 1MAXA 3N7EA 3E0PB 2V7QD 1MKWK 1FXYA 5EQSA 5BPEA 5C2ZA 2A7HA 3E91A 1NRSH 5A0CA 1HJAB 1JIMA 1YY3A 1CA8B 1YLNA 4YLUA 4JK6A 1ZJDA 2BTCE 1GI5A 1BB0B 1CSOE 4NIXA 4CR9A 3LC5A 2QF4A 1WTGH 1V2ST 1P0SH 1Y5UT 2M2AA 2F3CE 2HLDD 2C8YB 4Y79A 4A1TA 3GCHB 3MHWU 5JBCS 5TCCA 1L1JA 3HGPA 2PTNA 1V2QT 2FI3E 1PPFE 4X8VH 1P09A 3L33A 2VIPA 3F2HA 1T8MA 1GBMA 2VGCC 1TRMA 1YPHC 3ITIA 2F91A 3MU0A 1YBWA 3BTGE 1EATA 3SJKA 1AGJA 1BTPA 1EPTA 3E6PH 4D7FA 3EAJA 1ESBA 5EODA 1FV9A 4YZUA 2ZPSA 3SNBA 1ABJH 2DE8A 1UTKA 4RSPA 5FHTA 1LQDB 2ZI2H 2OC0A 1GHXH 1MU8B 1C1QA 1TMTH 1PPBH 4RN6A 1TOMH 2NWNA 1AWFH 2P16A 2V3HH 1JOUB 4ZKRU 3ENSB 1LKAA 2WPJS 1XUJA 3W94A 1H9IE 3N99A 3ZZ6A 1L2EA 1KIGH 2XNDD 2V3MA 4OGYA 3PWCA 2ZU1A 1HAVB 1YLDA 2XW9A 2KAIA 1G3CA 3FAOA 3CENA 1QBNA 1TA2A 4ZUHA 2SGEE 4DG4A 1CE5A 2WHXA 3PMHB 3VB7A 2ESTE 1NRNH 4Y8ZA 1E34B 1WV7H 1ACBE 2A4GA 2F9PA 2GCTB 1GHAG 5ETXA 1V2UT 3RMMH 1K1NA 3NRLA 5EW1H 3BEUA 3EDXB 5CHAC 1QJ7B 3Q77A 4LXBH 3T2NA 3GISB 3T25A 3HKIB 1O2IA 1KXAA 4R0IA 2PLXA 3Q3YA 3F9EA 3UOUA 3TH4H 1NRRH 1CA0B 2UUKB 1O2WA 2AEIH 2HRVA 2P3FH 3BG4B 3RXUA 4MDSA 2FOEA 1B0EA 2ZG0H 1FIZA 2F4LA 1SFQB 2AGEX 3BG8A 2UUJB 4O9VA 1T4UH 3QN7A 1ETRH 1GMDG 1MTSA 2ZIQH 5EPYA 1O2XA 1D9IA 3SV6A 2FLBH 2HPQH 1DLEA 1B5GH 2YMSD 2Z7FE 3SHAH 3SU3A 2VIQA 1TGTA 2HNTC 2HOBA 1QB9A 4KTSA 4WY3A 1C9PA 5F8ZA 1BTUA 3QO6A 1QQ4A 2AGIX 3BTQE 5B6LA 4M9FA 3AVZA 1BTXA 1ANCA 1YCPH 1G3EA 1C2DA 1TPPA 2A31A 3EA8A 2SNWA 4XOJA 3RM2H 2JIZD 1SQRA 3MOCA 1IQGA 3LC3A 3PTBA 1VCWA 1EAIA 4KKDA 3VB4A 3PM3A 1HPGA 3ZZAA 1O0DH 1UVSH 1QY6A 1HIAB 3DCLA 2FOAA 3F9GA 2F83A 1C2GA 1GI1A 1OP0A 1DWBH 1EJNA 3RXFA 4ABBA 4AG2A 2IJOB 1UTLM 4H6SB 4X8UH 1NC6A 2YMSB 2RDEA 2QXJA 3AK5A 5EQRA 2YNAA 4B6EA 1YP9A 4XE4A 4AX9H 4U30A 1QB6A 1BTWA 3FP7E 4ZKNU 5T3HA 3SUEA 5F6MA 5ABWA 1TALA 2QIQA 1LVMA 2QXHA 3H7TA 2IN2A 2ZDLA 2FOHA 4AYYB 1J8AA 1ELTA 1QBOA 2Z94A 3FVFB 3LDXH 1ZHMA 3BTEE 3DFJA 4IS5A 1KDQB 1E1QD 1ELBA 1FAKH 3PB1E 2P94A 2BY6X 1WQVH 1GMHG 2ZU5A 1ESAA 2FIRH 1V2TT 3SGBE 3GY5A 1VCQA 1XM1A 4FU7A 3MTYA 3TK6A 2XNIA 4YOJA 4K2YA 4B2CA 4B74A 4CBNA 3NCLA 1MUEB 2JKHA 4DY7B 1F2SE 5IK2D 2ANYA 1ETSH 2IPQX 3SUGA 1TPOA 2O8WA 2QYIA 1EZUC 3SJIA 5EIYA 3VB6A 4JZDH 4UDWH 1CO7E 1SC8U 2FDAA 3A8AA 3A7VA 2ALPA 2O9QA 1QHRB 2A5AA 1QA0A 2Z9LA 4B1TA 1OWEA 2CMYA 3A82A 3LKWA 1RTFB 1C1VH 2OQ5A 3RXLA 6GCHF 4H6TA 4K8YA 1MQ6A 4WH8A 3TLOA 1EX3A 2O8UA 3A81A 3QX5H 5EJ1A 4CR5A 1A7SA 5IYTA 2ZTYA 1IQFA 4KP0A 3BTFE 6CHAB 1P2JA 1L1GA 1P2IA 4K3JA 3RXKA 1O3HA 3K6ZA 1Z8RA 3LH1A 5HGGA 3A88A 3V7TA 2FI4E 5E0HA 1A1RA 2ALVA 2HALA 5E0JA 2CXVA 3O8CA 4F55A 1ZYOA 1SQTA 2FZZA 3OSYA 2XBYA 1HAXB 2OBQA 1C1UH 1ZSKA 1O3AA 1UW7A 1L4DA 4GPGA 2ZU3A 4IC6A 4NCYA 1UK3A 1HYLA 4O3TA 1QGFA 5JYIA 3RXVA 2BDIA 1P9SA 1G2LA 2RG3A 1LCYA 2Y5HA 4NFFA 4DJZB 3KQ5A 4F4OC 4TPYA 2BYAX 1Y3XA 1GBTA 3LGUA 3OY6U 3L6PA 3H7OA 5HM2A 1DDJA 1YLCA 1SFIA 4I8LA 3ZVAA 1YPEH 4KTUA 3T29A 3P95A 3F68H 2BZ6H 1OWIA 3SU6A 3RXSA 2BY7X 1FY1A 1Q31A 2WYJA 1IQEA 1CBWB 1P11E 1CHOF 2TPIZ 3MMGA 1C5UA 5C1YA 2PP6A 2EEKA 1C2FA 3NK8A 4KELA 1GGDB 1HAGE 4MNWA 1V2RT 2P8OC 2STAE 1THPB 1AQ7A 2G00A 1Z71A 2OCVB 3E3TA 1UTNA 1O2YA 4RI0A 1SGRE 1SGDE 3TJVA 1E38B 3FO8D 5E2PA 1QRWA 1O2TA 4AN7A 1THSH 1BBRH 4J2YB 1J9CH 1C5OH 4A1VA 3TVJB 1SGTA 3ZZ4A 2B9LA 2GKVE 2ULLA 2KAIB 1AKSB 4MTBA 1XUGA 2FLRH 3PROA 2SGAA 1GDQA 1XVOA 3QTOH 4I8HA 4NIWA 1O32A 4AZ2B 2JJ2D 1TNKA 2G5VA 1AHTH 2R2MB 5H4IB 2CF8H 2QGRA 1VR1H 1EP6A 3L3TA 1CGHA 2J2UA 3O8DA 2GJGA 1AUTC 3V13A 1BMMH 1F0RA 1DITH 3TNSA 3EE0B 2CGAA 2FO9A 4I32A 4O97A 3SOSA 3MU5A 3MU4A 4CBOA 3AAVA 3M5NA 1GHWH 2WV5A 1T7CA 3DT0H 3M35A 1P02A 4X1SU 2V6NA 2AMPA 4SGAE 4BXWA 3ATWA 1NU9A 4IBLH 1W12U 3SJ8A 3KQDA 4Q4LA 2ZGCA 3FN8A 4ISLA 2HGTH 2ZECA 5EG4A 2QV1A 2Z9JA 2PKSB 1C1MA 3KF2A 1RGQA 4QT8C 4YM9A 2EI7A 2KCOA 1ZPZA 4CRGA 1GHBF 5AFZH 2OD3B 1G2MA 1OPHB 4A5TS 2ZU4A 1TRYA 1V2OT 1INCA 2ZC9H 1TWXB 5E0GA 3SBKA 1Z8JB 1UHBA 4FU8A 1O5DH 4Y76A 5LPFA 5A0AE 1HXFH 1TNHA 3ZZ9A 2C90B 2G4UA 3A7TA 3EA7A 3RXMA 1C2JA 3ZV8A 1BCUH 3MH4A 1H8DH 5C94A 1NESE 1C2LA 1T8NA 4ASUD 2TGAA 2KCYA 3D62A 1KXCA 1YPMH 2AH4X 2HPPH 1J15A 2OLGA 2CK3D 3CNRA 1T4VH 5E8EH 1YM0A 1FX0B 1O2GH 5F8TA 2F43B 1MTVA 3K2UA 1IQJA 3T26A 4JZFH 4K1SA 3QLPH 2XC5A 2BMGB 3D49H 3OU0A 3CS0A 2VVCA 1BMFD 1B0FA 3GCTF 1EAUA 1O2HA 2FOMB 3UQOA 3LONA 3K9XB 1COWD 1GDUA 1K2I1 3RM0H 1ANDA 3E0NB 1QTFA 4WXIA 1CQQA 1QURH 3ODFA 3T5FH 1HGTH 1JMOH 1RIWC 5EJLA 1YC0A 1CGIE 4FOUC 2Y80A 2ZCKP 1EZXC 1GJ5H 1GMCG 1O5BB 2ANWA 4TSFD 2CF9H 2PWXA 3PO1B 2ZQ2A 2FOBA 3E16B 1D3TB 2H9HA 3B9FH 5FCRA 3VB3A 3M7QA 1GBLA 5L6NH 1O3DA 1RRKA 2A45B 3FZZA 3TGIE 2FS9A 1IQMA 3GOVB 4XBDA 4BAMB 3AW0A 1AUJA 1O2JA 1ZTLA 1LPKB 2PGBB 2EI8A 3ZVBA 3PMJA 1P2OA 4CREA 4ZAEA 1WYKA 1E36B 1UTJA 4LK4A 3QGNB 2FI5E 1TX7A 3DA9B 2FYQA 4NG9H 2ZZUH 2BM2A 1H8HD 3LPRA 1C5YB 1O2NA 3BSQA 2D8WA 4LOYH 1MD7A 5FAHA 1AVWA 3ZZDA 1AN1E 1OWJA 1ELFA 2HLCA 8GCHF 4ABGA 4ACAA 4UONA 3GY8A 3O8RA 3RXHA 2VH0A 3MYWA 2KFWA 3ZVCA 5K0HA 3PLPA 1MZDA 1CU1A 4IMQA 3LGTA 3LU9B 1O2OA 3OAAD 1OWHA 2ZFTA 4AGJA 2P59A 1DM4B 5I46H 1HJ8A 4M7GA 3JZ2B 2BVXH 3BTDE 3TGKE 2EY4C 2F9VA 4Y6DA 1O3MA 9ESTA 4CHAB 1H4WA 4GCHF 3QUMP 5AF9H 4GHQA 3RU4D 3UOPA 2KM0A 5GNDA 1HUTH 3Q76A 2BLOA 3FOAA 1DSUA 1GI4A 1K1MA 2VWOA 1VJAU 1V3XA 3KQBA 3KYFA 1GI3A 2L74A 2OBOA 8LPRA 5GCHG 2BVRH 4X8TH 3ZYDA 2ZFQH 1D6RA 1QCPA 2OK5A 1LHEH 1MTWA 1P06A 2HNTF 1MKXK 1EB2A 1KXEA 5SGAE 1TNGA 1UJ1A 4TY7A 2BZAA 5HIYA 3BV9B 3FZDA 1QL8A 4ISHH 1SBWA 3GY6A 3H09A 2ZCLP 5C1UA 1BTZA 5G4BA 2GDDA 4UFFH 1NY22 2ZGJA 4WXVA 4FUDA 1JWTA 1TB6H 2FM2A 5F03A 1OYQA 4X2VA 3MU1A 1ZRBA 3SV7A 4BAHB 3GYMA 2Y5GA 3LJJA 1GL1A 3KL6A 4VGCC 1PQAA 1TGNA 1GDNA 3GS9A 3PLKA 3NXPA 4I8GA 1A3EH 3LT3A 4MQAA 1N6XA 2KZ4A 1V2KT 1O5CB 4U01A 4ABHA 3RP2A 1HJAC 2VWMA 3TU7H 1HB0B 1AFQC 1DVAH 1TMUH 3GY7A 5LH8A 3OFND 2V35A 2GDEH 2XYAA 4NSVA 1C5NH 4UFDH 1X7AC 1PPCE 4ABFA 1TA6A 1TE0A 5J4QA 2J34A 2GT8A 3QGJA 4ABDA 3GCHC 2KX4A 3LH3A 1HRTH 4X6MA 1DT2A 3U8RH 5JB9S 5DSFA 4FVDA 4R8TB 3ZVFA 3SGQE 1RFNA 1MQ5A 1SGCA 1Z7KA 3SZEA 3S9CA 3P17H 5A09A 1C5TA 4Y11E 1VITH 1MTNC 2QAAA 3RXRA 3PV5A 3OX7U 1W8BH 2J94A 4A92A 1GPZA 2H2ZA 3HK3B 1NN6A 2ZHDA 1O2UA 2BLVA 3DFLA 1V2LT 1B7XB 2GCHF 3M5OA 4I8KA 2BDHA 5FPTA 3ATIA 1D3PB 5L30H 2Y81A 3PTNA 2FPZA 2ZO3H 2ASUB 1Q2WA 2VVUA 2ZGBH 1DY8A 4ESTE 3W1EA 2SFAA 3UNRA 2W7SA 2Q6DA 5J4SA 3S69A 4JYUH 4Q7ZA 1ELDE 3RC5A 4KGAA 3WWFA 1PPZA 2BD8A 1BMAA 1VITF 3FFGA 3DHKH 1P10A 2M5TA 3A85A 1GBEA 4K1TA 4ZXXH 4LZ1H 3DD2H 1AI8H 2WV4A 1ELVA 1FIWA 1ZGIA 1KY9A 2AIQA 1Y3YA 5HIZA 5GIBA 2BD5A 1RXPA 4JK5A 5DPAA 1FY4A 1YCPM 1W0JD 2XCNA 3GY3A 1V2WT 2VWNA 1A5GH 1BRBE 2H5DA 4D9QA 3RC6A 2BD3A 2ZGXH 5FX5A 2AGGX 1C4Y2 5T1VA 3STIA 2C93B 5KECA 2ODYB 1WCZA 2A4QA 2Z3CA 2QF5A 5EJZA 1HDTH 3UIRA 4X0WU 1SLWB 2VH6A 2AMDA 1F5RA 1ZRKA 1IQLA 8ESTE 1TNJA 5DP6A 1SGFG 4WWYA 2C8XB 7KMEH 1ZHPA 2FOGA 1C2MA 1BTHH 4Q7XA 3GCOA 5T6DA 4CH8B 1HAZB 3ZZ8A 3FP8E 5CHAB 5DP9A 3TH2H 2WPDD 1W7XH 2WUBA 1OSSA 1WSSH 5DP5A 1FN8A 1TBQH 3VXFH 1NT1A 1PFXC 1IQNA 3A8BA 1V2MT 1HXEH 1W13U 4MNYA 4DURA 2AHME 1O34A 1ELAA 3A7YA 3BTHE 3MO6A 1O5AB 3M36A 4JZ1A 5HMAA 2BQ7B 1ZGVA 5JDUB 3SZNA 5C20A 5TJXA 1C1WH 3UY9A 1O3CA 2ZF0H 3UB0A 4B71A 1ESTA 3AW1A 1TGSZ 2C8WB 1GJ7B 1O3IA 1OWDA 4X2WA 1XXFA 1PYTD 2PV9B 2TRMA 3E8LA 2K8IA 5LGOA 1SHYA 4HG6A 1GVLA 3RU4E 3IITA 2XWBI 1Y59T 4YOGA 4XD7D 2J92A 1BJVA 2G5NA 2XXLA 2Z3DA 2BX3A 2TBSA 2H9EH 1Y3UA 2A7CA 1GI6A 1QRXA 2J97A 1BBRE 4BANB 1A4WH 4OS1A 1GBBA 5EOKA 7GCHF 2VIOA 1TBRH 2BD2A 3SV9A 4AC9A 4E05H 1BMLA 3TK9A 5C5NA 1G9IE 2GV7A 3MO9A 2A1DB 5EW2H 4BAQB 3F0OA 3QTVH 1O3JA 1SPJA 1LVBA 3GY2A 1P3EA 4BAKB 2RDLA 1NRPH 1NROH 1RTLA 1KLJH 1TX6A 4CH2B 2ZFFH 3UWIA 4AFQA 4FU9A 1Z1IA 2B8OH 2GX4A 1P2MA 2F9BH 2UUYA 6CHAC 4B6FA 5FX6A 1AVXA 4Y7BA 4FUIA 3LGWA 2FESH 1JBUH 1GI7B 2UWLA 1O35A 4THNH 2L6OA 4GLYA 3A7XA 3BTKE 3BEIB 1UTPA 1QNJA 3B23B 1NO9H 1S84A 2FWWA 1H1BA 5EXMA 3LOXA 5DGJA 3ZVGA 4ZHMU 1WXRA 3TGJE 2GP9B 3AAUA 3S0NA 5FBEA 2NU1E 3MH7A 4ZHLU 1K1JA 3E1XB 5HKKD 2GZ7A 2LPRA 1BMNH 1NBME 3GDSA 1FPHH 5EU8A 2OC7A 5FBIA 1NTPA 3UAIC 1O30A 3BIUH 3DSPA 4OS2A 4CRCA 1K1LA 3KEEA 1H9HE 4YLQH 5IDKA 1ARCA 1TX8A 3M3SA 3RC4A 3TNTA 1LO6A 5C0UA 2YNBA 4DOQA 3I29A 2Y7XA 1GMCF 1BRCE 1O31A 2F9UA 3SI3H 2ANKH 2A7JA 1GJ8B 4K8BA 1RS0A 1GCTB 4XSKU 1KTTB 5BRRE 2D2DA 2UWPA 1F0SA 2WV9A 2F9NA 1YPHE 3Q3KA 1SHHB 4A1XA 1GJBB 1H8ED 4Q63A 2VINA 2W6ID 1DE7H 4Y8YA 1KTSB 3VXEH 1P2QA 4I8JA 1JXPA 2Z6BD 1EPTB 5CMXH 1O3NA 3PMBB 4YESB 1O3OA 2RA0A 2SGQE 4Y7AA 4NA8A 3ZV9A 1NPMA 4NGAH 4TYDA 3RLYH 1O3KA 1UVUH 2XBXA 1ZHRA 1GG6B 2WUCA 3OTJE 2XCFA 3R0FA 5DP3A 1S0RA 3UQVA 2QN5T 1O3PB 1G36A 2IPHA 4H42U 1XMNB 2GT7A 2ZNKH 2ZHFH 1WTHD 1LHDH 1ZPBA 1TONA 4OS6A 4OS5A 4NIVA 1H9LB 3ELAH 2CHAB 3SU0A 2G81E 2IOTA 4IGDA 1FZZA 1GI2A 1YPLH 3UR9A 1HJ9A 4GHTA 4ZHAA 3TK5A 3M61U 3NKKA 1KXBA 1OOKB 2XBWA 2FMJA 3SO3A 2LELA 2QE7D 2SGFE 2Q6GA 4AB8A 3EE7A 1GL0E 1DWCH 1FMGA 1O5FH 2H5CA 2W26A 3GDUA 5EXNA 4Z0KA 1O2ZA 2F9OA 1MTUA 2ZP0H 1D6WA 2R2WU 2P8OB 1NM6A 1HNEE 1G30B 1QA7A 3VEQB 3TH3H 1S81A 1K0HA 2PKSC 3RUOA 4E06H 1GBAA 1S6FA 4D76A 1P3CA 4NA9H 2QXGA 1A0HB 2GZ9A 1O2MA 1FQ3A 2Z9IA 3D65E 3ZVEA 4D7GA 1YYY1 1PPHE 2BLWA 4UE7H 2HNTE 1ZR0A 1F0TA 1NFUA 1O3GA 1UCYH 3WY8A 3UWJH 1FI8A 5DJ7A 1EAXA 1BZXE 4Q2KA 2ZPRA 3CS7A 1DXWA 1LPZB 3GYLB 3ZZ5A 2O8TA 1TNIA 1E0FD 1TPSA 1ZLRA 1VGCB 1HFDA 2JJ1D 3RU4T 3A7ZA 3ZVDA 1O2RA 3ESTA 3RXDA 4AOQA 3KIDU 2P95A 1AB9B 3P92A 1YGCH 1CHGA 2BB4A 1CGJE 2I6QA 4WMDA 3LGYA 4B2AA 1SI5H 1N8OC 2VNTA 2FOFA 1EOLA 1TYNA 5DP7A 1G37A 4BTUB 1C2EA 1KMHB 1QJ1B 4Y0ZE 2ZHWH 2Q1JA 1SMFE 1TBZH 2BDBA 2Y6TA 3G01A 1C5PA 3K65B 3KCGH 1BA8B 2R0KA 3SGAE 3LGVA 1THRH 4HGCA 2NU4E 1YF4A 1DWDH 1EXFA 4XBBA 3UNQA 2BDGA 3Q00A 1J17T 6GCHG 2GMTC 5T6GA 3A86A 1C4V2 2FX4A 1FPCH 4UFEH 1IQKA 1C5MD 2SGPE 1O2VA 2QA9E 2HVYB 3I77A 3Q3XA 1O36A 1YWUA 3M3VA 1HAIH 2LP6A 1MD8A 2QF0A 1FLEE 1E1RD 2BHGA 4NZLA 2PSXA 1P2KA 2LNCA 2WZQA 5HYOA 1HLTH 4JYVH 4X6PA 3RXOA 3RXQA 4FVBA 3SNAA 2JH0D 3EYDA 1LPGB 5A0BA 5GWZA 3M5MA 1C1SA 5E2OA 4TT3D 3SN8A 2VIDA 1V2NT 2EC9H 1UTQA 3HKJB 2ZDKA 3MO3A 1BBRK 4BTTB 2QC2A 3QDZB 2GD4B 4P02A 2ZGHA 2AMQA 1QQUA 3UNSA 3F9FA 1QL7A 3A87A 1UMAH 1MKWH 2GV6A 4TWWA 1F0UA 3EQ0H 4X1NU 3V12A 3UUZA 4WH6A 1D3QB 1C2IA 2A2QH 2THFB 1BDAA 1C5LH 2PTCE 2B5TB 1RIWB 4JMYA 1OP2A 2FS8A 4OM9A 1SLVB 1K1OA 1XUIA 3RXJA 1LQEA 3TITA 1E35B 1K21H 2XRCA 1SLXB 3MH5A 1AU8A 1Y3VA 2FXRA 2SGDE 3DSGA 2C3SA 4PROA 2PR3A 4K69A 5EPNA 1C2HA 5DP8A 2BOHB 4MPVA 4HTCH 1P2NA 1AMHA 1CHOG 1PQ5A 1K28D 2R9PA 4ZMAH 1VJ9U 2VIVA 1DXPA 1AWHB 1GHAF 2PGQB 1UVPA 1A5IA 3KYGA 3A83A 4ABEA 5B6OA 1FN6A 3V0XA 2J5UA 4Y8XA 1OXGA 2V0BA 3AASA 1BQYA 1ZMNA 2I6SA 1W7GH 4FUBA 1C5XB 1AD8H 2KCPA 4FUJA 1SQAA 5JBBS 3RLWH 3VGCC 1QIXB 5CDFE 1DY9A 4X6OA 1K1PA 3GY4A 2OP9A 3V3MA 1EP5A 3HK6B 1TNLA 4GVUA 1EZQA 4DIHH 4K5ZA 1XXDA 2XWAA 1MCTA 2XC0A 3N7DA 1S5SA 1GMDF 2WPKS 3SYJA 2EQNA 4Y71A 1TMBH 2ZFPH 1SLUB 1W11U 1UO6A 5LPEA 1A0LA 1DUAA 5FPSA 1SR5C 4GSOA 1E37B 4XFQA 4WF8A 4OS7A 4ACBA 5JB8S 1T8LA 3OY5U 4NZQA 3GDVA 1PJPA 3BTWE 4ABJA 1MH0A 2ILNA 1K22H 2G4TA 2XOKD 1RTKA 4RT0A 4ASHA 3JZ1B 3ATMA 1MBQA 5C3NA 4B73A 3SNDA 1O2PA 1JRSA 2NU0E 3RXIA 1IQHA 2JETB 2V3OH 5C5OA 1CT0E 2H6MA 1T8OA 1GHBG 2ODPA 4Y0YE 1S85A 3QZRA 3U8TH 3ZZBA 4HFPB 1PPEE 1PQ7A 1GI0A 3UPEA 3MNSA 4YT7H 1G3BA 1GHZA 2WPMS 4TY6A 1BHXF 3D23A 2EA3A 2PUXB 3M5LA 3DSOA 1KSNA 3UR6A 4FUEA 2Y7ZA 5EXLA 3IG6B 1DS2E 1GBHA 1GJAB 8KME2 1MABB 1MAYA 2G55A 3U28C 1YKTA 3SNEA 1ZPCA 2ZHQH 4VGCB 1RD3B 2JDID 4XBCA 1W10U 3P8GA 1O2KA 1NBMD 1XKBC 3SUFA 3RXPA 5L2ZH 1L4ZA 4NWLA 1SG8B 1GMHF 1S6HA 3MNBA 1VKYA 3A8DA 1A5HA 1GJ6A 4AORA 4FUGA 1A46H 1KXDA 1EJMA 7LPRA 5F8XA 1C5RA 4WMEA 3TJUA 1AFQB 3GCTG 1AIXH 1IHSH 1HAYB 4JZEH 1Y5BT 5DG6A 1YPGH 2KCAA 3U98H 1SOZA 1SKYE 2FX6A 3F3BA 1SGNE 2FOCA 2XC4A 2Z9KA 2UWOA 4MPWA 3QK1A 1UHBB 1P01A 2XTTB 3PLBA 1QR3E 1UVOA 2ZFSA 7ESTE 1IAUA 4AFSA 2AFQB 2TGPZ 1VZQH 2Z9GA 6LPRA 1FNIA 1P12E 3MNXA 3SJ9A 1EQ9A 4GAWA 1EKBB 1MMJN 1MTNB 1NRQH 1PQ8A 5A2MH 1GHYH 2GCTC 5AHGH 4RT1A 2OC1A 1PPGE 3VG8A 2ZA5A 1BUIA 1FUJA 1Z1JA 2VGCB 1LHFH 2ODQA 1CA0C 4ABIA 1ELCA 1JRTA 2BQWB 3PRBA 4MNXA 3RDZA 4FETA 4X2XA 4UFGH 2A2XH 4I31A 2ZKSA 1DICA 3BG4C 5A8ZA 2VB0A 5DKMA 1TPAE 8GCHG 1GBFA 4ABAA 4MG3A 3S9AA 4B76A 1EUFA 1ZJKA 3RMOH 1AKSA 1C1OA 5AVDA 1HBTH 1NZQH 5JBAS 1K9OE 2R3UA 3U9AH 3U1JB 4I86A 2B0FA 4Z1MD 1OWKA 3SORA 4TPIZ 3KN2A 1GJ9B 1SB1H 3IWMA 1AE8H 1LTOA 3MU8A 3UREA 1FONA 2BDAA 3OE7D 1UTMA 4RKJB 1DX5M 4YO9A 3KGPA 1YPKH 3ZYEA 5GJ4B 3W95A 3HGNA 1OYTH 1UK2A 4JYTA 2ZU2A 5FXLA 2BY5X 1EAWA 1TQ7B 4GCHG 4INKA 1C5WB 3KQEA 1NS3A 5EQQA 1Y8TA 1KYNA 3RXAA 4AFUA 2WYGA 1QJ6B 2NU3E 1W0KD 1C5VA 3BTME 1FDPA 1BIOA 2FP7B 3VB5A 1SGIB 1QRZA 4RKOB 2OXSA 1K1IA 2J4IA 3KNXA 3SHCH 3WW7A 2YMSC 1Y3WA 1H8IH 1O38A 1A61H 1C4U2 1GBJA 1EASA 1BOQA 3SJOA 1DANH 1SGYE 3SU1A 5JPMH 2GVFA 3URCA 1C2KA 2W5EA 1OHHD 3BIVH 4H4FA 1SOTA 2NU2E 3E90B 4Z6AH 5C0TA 2J98A 5A8YA 4CRFA 1ELEE 2BD4A 2PKAA 1O3EA 3BF6H 1D4PB 2PUQH 1Z8IB 3R3GB 1O3BA 3I78A 2VVVA 2PSYA 1AO5A 1EOJA 5PTPA 4NIYA 1PYTC 4YT6H 2CN0H 2VIWA 1WUNH 1QB1A 1A3BH 1P03A 3SU5A 1ETTH 2AS9A 3PYHA 1SL3A 1TGCA 1C1TA 4JCNA 5KEDA 1F5KU 1ORFA 3UTUH 5C17A 3RXEA 2A0QB 5GXPA 1OP8A 2BXTH 4ZROA 1FY3A 4HI3A 3MI4A 4DCDA 1AE5A 3STJA 1ZOMA 5EGMA 1Q3XA 1WBGB 5GDSH 1U6QA 1C5QA 3SNCA 1TRNA 4K1EA 1GJ4H 1BHXB 1UK4A 2BOKA 3FKSD 3BN9A 5FPYA 2Y5FA 4ZKSU 3A84A 2UUFB 2YOLA 1L1NA 1F7ZA 2GGVB 3MQKC 2Q6FA 4J1YA 2GCHG 2ZHEH 3U1IB 2AYWA 3MH6A 3SQHE 4A7IB 3ATLA 1UCYE 2P93A 1SVPA 1NFYA 2P3UB 2TGTA 1O2LA 2ZPQA 1LKBA 5A8XA 4BXSA 2QY0B 4DVAU 3A89A 4BNRA 3RXTA
chains in the Genus database with same CATH topology
1LHCH 1QFKH 4INLA 2FTMA 3C27B 1BRUP 4CRDA 5DP4A 1J14A 1W3CA 4MLFB 3SV2H 1GCTC 1VITG 1Z6EA 1IQIA 1P8VC 1C1PA 1F5LA 3KQCA 4WMFA 3CP7A 1GVKB 1AZ8A 1C1RA 1W0ZU 4IW4E 2TGDA 5DK1A 4BAOB 3RXGA 3A8CA 4BTIB 1DPOA 1F92A 3SU4A 1AY6H 2FODA 4NWKA 3C1KA 4X1PU 1EPTC 4UD9H 1YCPK 1CBWC 1O33A 2JH5D 3OYPA 4XDEA 2JH6D 1GGDC 3QWCH 2ZCHP 1GVZA 1GG6C 2ZTZA 1ABIH 2QCYA 3P8OA 3T62A 2WINI 4GUXA 3SUDA 1DWEH 1BRAA 3U69H 3LIWA 1GI9B 2H9TH 1LVYA 3RXBA 3NZIA 1XKAC 4BOHA 2CHAC 1V2JT 3FP6E 1DLKB 1HAOH 4AFZA 4JZIA 2RA3A 2W3KA 2G51A 2BLQA 1FY8E 2R3YA 4U32A 3T28A 1O2SA 5GPIB 3KHVA 2OTVA 4MVNA 2BDCA 4NA7A 2ZEBA 2GTBA 1DSTA 1UTOA 2RCEA 1ZTKA 3HATH 4K60A 1SGQE 1OKXA 2W3IA 2FEQH 2OINA 3VFEA 2ANMH 1SQOA 5ESTE 4CRAA 2PHBA 1MZAA 3ZZCA 1SSXA 1P57B 3RXCA 1DUEA 2EI6A 5C67A 3N7OA 4SGBE 2ZDNA 1O39A 1VCPA 3PMAB 4DGJA 1ELGA 4X2YA 1QBVH 4I7YH 5C1XA 3NUMA 1S83A 2VWLA 3TJOA 4DT7B 3F6UH 3P8FA 1C9TA 1EZSC 1G32B 1EJAA 4NSYA 3T27A 1ID5H 1DFPA 2DUCA 2O8LA 1GWAA 1O5EH 1S82A 2D1JA 1BJUA 1ZTJA 1JIRA 5GCHF 1N1LA 1MBMA 2CJIA 1VGCC 2TIOA 1HAHH 1AB9C 1LMWB 3EA9A 3RMNH 2A5IA 4B75A 2J38A 4MPXA 1QL9A 7GCHG 1T31A 1NU7B 2GZ8A 9LPRA 2A4OA 1YPJH 1NFWA 3O8BA 4INHA 5ESBA 2Y82A 5K7RA 2P3TB 2FYRA 1C5ZB 2XBVA 3M7TA 2J9NA 1ZMLA 4ZXYH 5TCAA 1IOEA 5T6FA 4IC5A 2QF3A 1FAXA 1GI8B 1XX9A 1V2VT 1HCGA 1TQ0B 2HVXA 2STBE 3LGIA 2BVSH 2PKAB 4DW2U 1O37A 2VJ1A 1MKXH 3SU2A 1KXFA 5HXFA 2SNVA 4CRBA 1W2KH 2R0LA 5JBTA 3S7HB 1FJSA 2BXUH 3PO1C 4ISIH 3M3TA 2O8MA 1SGEE 1V6DA 3S9BA 3TPIZ 1GJDB 4B2BA 1N8OB 2ZFRH 3GICB 4FUHA 1HAVA 3ZZ7A 1OX1A 4AG1A 1O3FA 4F49A 5L2YH 3SV8A 2Z3EA 1P04A 2DE9A 3MNCA 4D8NA 1XUFA 2A4RA 4ISOA 1AZZA 1GBKA 2WPHS 4FXGH 2C4FH 3F9HA 4ISNA 4YTAA 1CT4E 1XUHA 4FUCA 1KLTA 2A32A 2GMTB 4X6NA 3S7KB 3VPKA 2PW8H 5DO4H 1BT7A 1GHVH 1FY5A 1XVMA 2A5KA 3QZQA 3K6YA 1LHGH 3B8JA 1TABE 2BDYA 4LZ4B 1MCVA 2QXIA 2VU8E 4DIIH 2ZTXA 3ATKA 3PV4A 1J16A 3A7WA 1G3DA 3M7UA 3RMLH 2G52A 1ANBA 2K1QA 1KLIH 4E7NA 1O2QA 1D3DB 1C5SA 4WVPE 1OS8A 4UEHH 4X1QU 2BQ6B 3URDA 1N6YA 1O5GH 2ZDMA 5FCKA 4Y10E 1NFXA 1WU1A 2G8TA 2BY8X 4O3UA 1P05A 1CT2E 1P9UA 2C8ZB 2ZDAH 1XUKA 1SGFA 2HWLB 4CHAC 3HPTB 3P70B 4O03A 1ZZZA 1TGBA 1T32A 1A2CH 2ZWLH 2BX4A 4U2WA 1UCYK 1W0YH 1TAWA 1HIAA 1AVGH 3TIUA 4A6LA 1TLDA 1ZMJA 6ESTA 1W14U 1LVOA 5CE1A 1GBCA 2BD7A 2J95A 1L0ZA 2AERH 4WJG2 2BD9A 3H5CB 3P6ZB 4E7RG 5HM9A 4D9RA 4ZH8A 1S0QA 4HZHA 2AIPA 3UFAA 1ANEA 4I33A 1MU6B 4MNVA 3SI4H 2OUAA 1LDTT 2ZQ1A 1GBIA 1C1NA 1M9UA 1DOJA 4X1RU 2D26C 1BITA 3BEFB 1AFEH 4AGKA 5AFYH 3SQEE 3P8NA 2CV3A 4OS4A 1Z6JH 1HV7A 4Q80A 1CVWH 3M37A 4AYVB 2JETC 4OGXA 1KDQA 3PWBA 3U8OH 1ARBA 1Y5AT 3GCNA 2ZDVH 3VGCB 3BTTE 3MFJA 3SW2B 4X8SH 2W7UA 2B7DH 3DUXH 1ZSJA 4NFEA 4KTCA 1HAPH 5I25A 4IN2A 3EGKH 1GCDA 1GJCB 4ZKOU 1O3LA 4MPUA 1WOFA 2FTLE 1UVTH 1WAYB 1Z8GA 4IMZA 3NPSA 2OC8A 1IHTH 2WPLS 3F1SB 1V2PT 1EB1H 3ODDA 1BTYA 1A0JA 2OQUA 1TOCB 3NWUA 1SGPE 3TJNA 2PFEA 3A80A 3LJOA 5LPRA 4FUFA 2WPIS 2H1UA 4YOIA 1ZSLA 4TWYA 2BY9X 1TIOA 4IN1A 3MWIU 1TFXA 4AB9A 3ZZ3A 1WQSA 4Q7YA 1GBDA 3FANA 1RJXB 1MAXA 3E0PB 5EQSA 1MKWK 1FXYA 5BPEA 5C2ZA 2A7HA 3E91A 1NRSH 5A0CA 1HJAB 1JIMA 1CA8B 4YLUA 4JK6A 1ZJDA 2BTCE 1GI5A 1BB0B 1CSOE 4NIXA 4CR9A 3LC5A 1WTGH 1V2ST 1P0SH 1Y5UT 2F3CE 2C8YB 4Y79A 4A1TA 3GCHB 3MHWU 5JBCS 5TCCA 1L1JA 3HGPA 2PTNA 1V2QT 2FI3E 1PPFE 4X8VH 1P09A 3L33A 2VIPA 1T8MA 1GBMA 2VGCC 1TRMA 1YPHC 3ITIA 2F91A 3MU0A 1YBWA 3BTGE 1EATA 3SJKA 1AGJA 1BTPA 1EPTA 3E6PH 4D7FA 3EAJA 1ESBA 5EODA 1FV9A 4YZUA 2ZPSA 3SNBA 1ABJH 2DE8A 1UTKA 4RSPA 5FHTA 1LQDB 2ZI2H 2OC0A 1GHXH 1MU8B 1C1QA 1TMTH 1PPBH 4RN6A 1TOMH 2NWNA 1AWFH 2P16A 2V3HH 1JOUB 4ZKRU 3ENSB 1LKAA 2WPJS 1XUJA 3W94A 1H9IE 3ZZ6A 1L2EA 1KIGH 4OGYA 3PWCA 2ZU1A 1HAVB 1YLDA 2XW9A 2KAIA 1G3CA 3FAOA 3CENA 1QBNA 1TA2A 4ZUHA 2SGEE 4DG4A 1CE5A 3PMHB 3VB7A 2ESTE 1NRNH 4Y8ZA 1E34B 1WV7H 1ACBE 2A4GA 2F9PA 2GCTB 1GHAG 5ETXA 1V2UT 3RMMH 1K1NA 5EW1H 3BEUA 3EDXB 5CHAC 1QJ7B 3Q77A 4LXBH 3T2NA 3GISB 3T25A 3HKIB 1O2IA 1KXAA 4R0IA 2PLXA 3Q3YA 3F9EA 3UOUA 3TH4H 1NRRH 1CA0B 2UUKB 1O2WA 2AEIH 2HRVA 2P3FH 3BG4B 3RXUA 4MDSA 2FOEA 1B0EA 2ZG0H 1FIZA 1SFQB 2AGEX 3BG8A 2UUJB 4O9VA 1T4UH 3QN7A 1ETRH 1GMDG 1MTSA 2ZIQH 5EPYA 1O2XA 1D9IA 3SV6A 2FLBH 2HPQH 1DLEA 1B5GH 2Z7FE 3SHAH 3SU3A 2VIQA 1TGTA 2HNTC 2HOBA 1QB9A 4KTSA 4WY3A 1C9PA 5F8ZA 1BTUA 3QO6A 1QQ4A 2AGIX 3BTQE 3AVZA 1BTXA 1ANCA 1YCPH 1G3EA 1C2DA 1TPPA 2A31A 3EA8A 2SNWA 4XOJA 3RM2H 3MOCA 1IQGA 3LC3A 3PTBA 1VCWA 1EAIA 4KKDA 3VB4A 3PM3A 1HPGA 3ZZAA 1O0DH 1UVSH 1QY6A 1HIAB 2FOAA 3F9GA 2F83A 1C2GA 1GI1A 1OP0A 1DWBH 1EJNA 3RXFA 4ABBA 4AG2A 2IJOB 1UTLM 4H6SB 4X8UH 1NC6A 2QXJA 5EQRA 2YNAA 1YP9A 4XE4A 4AX9H 4U30A 1QB6A 1BTWA 3FP7E 4ZKNU 5T3HA 3SUEA 5F6MA 5ABWA 1TALA 2QIQA 1LVMA 2QXHA 3H7TA 2IN2A 2ZDLA 2FOHA 4AYYB 1J8AA 1ELTA 1QBOA 2Z94A 3FVFB 3LDXH 1ZHMA 3BTEE 3DFJA 4IS5A 1KDQB 1ELBA 1FAKH 3PB1E 2P94A 2BY6X 1WQVH 1GMHG 2ZU5A 1ESAA 2FIRH 1V2TT 3SGBE 3GY5A 1VCQA 1XM1A 4FU7A 3MTYA 3TK6A 2XNIA 4YOJA 4K2YA 4B2CA 4B74A 4CBNA 3NCLA 1MUEB 2JKHA 4DY7B 1F2SE 2ANYA 1ETSH 3SUGA 1TPOA 2O8WA 2QYIA 1EZUC 3SJIA 3VB6A 4JZDH 4UDWH 1CO7E 1SC8U 2FDAA 3A8AA 3A7VA 2ALPA 2O9QA 1QHRB 2A5AA 1QA0A 2Z9LA 4B1TA 1OWEA 2CMYA 3A82A 3LKWA 1RTFB 1C1VH 2OQ5A 3RXLA 6GCHF 4H6TA 4K8YA 1MQ6A 4WH8A 3TLOA 1EX3A 2O8UA 3A81A 3QX5H 4CR5A 1A7SA 5IYTA 2ZTYA 1IQFA 4KP0A 3BTFE 6CHAB 1P2JA 1L1GA 1P2IA 4K3JA 3RXKA 1O3HA 3K6ZA 1Z8RA 3LH1A 5HGGA 3A88A 3V7TA 2FI4E 5E0HA 1A1RA 2ALVA 2HALA 5E0JA 2CXVA 3O8CA 1ZYOA 1SQTA 2FZZA 3OSYA 2XBYA 1HAXB 2OBQA 1C1UH 1ZSKA 1O3AA 1L4DA 4GPGA 2ZU3A 4IC6A 4NCYA 1UK3A 1HYLA 4O3TA 1QGFA 5JYIA 3RXVA 2BDIA 1P9SA 1G2LA 2RG3A 1LCYA 2Y5HA 4NFFA 4DJZB 4F4OC 4TPYA 2BYAX 1Y3XA 1GBTA 3LGUA 3OY6U 3L6PA 3H7OA 5HM2A 1DDJA 1YLCA 1SFIA 4I8LA 3ZVAA 1YPEH 4KTUA 3T29A 3P95A 3F68H 2BZ6H 1OWIA 3SU6A 3RXSA 2BY7X 1FY1A 1Q31A 2WYJA 1IQEA 1CBWB 1P11E 1CHOF 2TPIZ 3MMGA 1C5UA 5C1YA 2EEKA 1C2FA 3NK8A 4KELA 1GGDB 1HAGE 4MNWA 1V2RT 2P8OC 2STAE 1THPB 1AQ7A 2G00A 1Z71A 2OCVB 3E3TA 1UTNA 1O2YA 1SGRE 1SGDE 3TJVA 1E38B 5E2PA 1QRWA 1O2TA 4AN7A 1THSH 1BBRH 4J2YB 1J9CH 1C5OH 4A1VA 3TVJB 1SGTA 3ZZ4A 2B9LA 2GKVE 2ULLA 2KAIB 1AKSB 4MTBA 1XUGA 2FLRH 3PROA 2SGAA 1GDQA 1XVOA 3QTOH 4I8HA 4NIWA 1O32A 4AZ2B 1TNKA 2G5VA 1AHTH 2R2MB 5H4IB 2CF8H 2QGRA 1VR1H 1EP6A 3L3TA 1CGHA 2J2UA 3O8DA 1AUTC 3V13A 1BMMH 1F0RA 1DITH 3TNSA 3EE0B 2CGAA 2FO9A 4I32A 4O97A 3SOSA 3MU5A 3MU4A 4CBOA 3AAVA 3M5NA 1GHWH 2WV5A 1T7CA 3DT0H 3M35A 1P02A 4X1SU 2V6NA 2AMPA 4SGAE 4BXWA 3ATWA 1NU9A 4IBLH 1W12U 3SJ8A 3KQDA 2ZGCA 4ISLA 2HGTH 2ZECA 5EG4A 2QV1A 2Z9JA 2PKSB 1C1MA 3KF2A 1RGQA 4QT8C 4YM9A 2EI7A 1ZPZA 4CRGA 1GHBF 5AFZH 2OD3B 1G2MA 1OPHB 4A5TS 2ZU4A 1TRYA 1V2OT 1INCA 2ZC9H 1TWXB 5E0GA 3SBKA 1Z8JB 1UHBA 4FU8A 1O5DH 4Y76A 5LPFA 5A0AE 1HXFH 1TNHA 3ZZ9A 2C90B 2G4UA 3A7TA 3EA7A 3RXMA 1C2JA 3ZV8A 1BCUH 3MH4A 1H8DH 1NESE 1C2LA 1T8NA 2TGAA 3D62A 1KXCA 1YPMH 2AH4X 2HPPH 1J15A 2OLGA 1T4VH 5E8EH 1YM0A 1O2GH 5F8TA 1MTVA 3K2UA 1IQJA 3T26A 4JZFH 4K1SA 3QLPH 2XC5A 2BMGB 3D49H 3OU0A 3CS0A 2VVCA 1B0FA 3GCTF 1EAUA 1O2HA 2FOMB 3UQOA 3LONA 3K9XB 1GDUA 1K2I1 3RM0H 1ANDA 3E0NB 1QTFA 4WXIA 1CQQA 1QURH 3ODFA 3T5FH 1HGTH 1JMOH 1RIWC 1YC0A 1CGIE 2Y80A 2ZCKP 1EZXC 1GJ5H 1GMCG 1O5BB 2ANWA 2CF9H 2PWXA 3PO1B 2ZQ2A 2FOBA 3E16B 1D3TB 2H9HA 3B9FH 5FCRA 3VB3A 3M7QA 1GBLA 5L6NH 1O3DA 1RRKA 2A45B 3FZZA 3TGIE 2FS9A 1IQMA 3GOVB 4XBDA 4BAMB 3AW0A 1AUJA 1O2JA 1ZTLA 1LPKB 2PGBB 2EI8A 3ZVBA 3PMJA 1P2OA 4CREA 4ZAEA 1WYKA 1E36B 1UTJA 4LK4A 3QGNB 2FI5E 1TX7A 3DA9B 2FYQA 4NG9H 2ZZUH 2BM2A 3LPRA 1C5YB 1O2NA 3BSQA 2D8WA 4LOYH 1MD7A 5FAHA 1AVWA 3ZZDA 1AN1E 1OWJA 1ELFA 2HLCA 8GCHF 4ABGA 4UONA 3GY8A 3O8RA 3RXHA 2VH0A 3MYWA 3ZVCA 5K0HA 3PLPA 1MZDA 1CU1A 4IMQA 3LGTA 3LU9B 1O2OA 1OWHA 2ZFTA 4AGJA 2P59A 1DM4B 5I46H 1HJ8A 4M7GA 3JZ2B 2BVXH 3BTDE 3TGKE 2F9VA 4Y6DA 1O3MA 9ESTA 4CHAB 1H4WA 4GCHF 3QUMP 5AF9H 4GHQA 3RU4D 3UOPA 1HUTH 3Q76A 2BLOA 1DSUA 1GI4A 1K1MA 2VWOA 1VJAU 1V3XA 3KQBA 1GI3A 2OBOA 8LPRA 5GCHG 2BVRH 4X8TH 3ZYDA 2ZFQH 1D6RA 1QCPA