1W13U

Urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w13U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w13U01
1A0JA 4WVPE 1BITA 3O8RA 3OU0A 3V13A 4BTUB 1EP5A 4NIVA 3TNSA 4CRCA 1GJBB 2QGRA 5FAHA 1G32B 1ZTLA 1BTYA 1YPEH 2A4RA 4JZEH 2PR3A 5EQRA 5JBTA 1O3IA 2Z9GA 3FZDA 1HAVB 3LPRA 4BANB 1TX7A 2STBE 1SPJA 4B73A 1Y3VA 1PPHE 1RIWC 3ZZ3A 1P2KA 2STAE 3MNCA 1PQ7A 2AIPA 1GBCA 2GMTB 4GHQA 1K21H 3MH6A 5J4QA 1PYTC 2BLWA 2ZHDA 1JRSA 3SUDA 1A5HA 1UO6A 2FYQA 1O5AB 2GZ9A 3FP6E 4UE7H 1ANDA 1F5KU 2R9PA 1ELFA 1OXGA 1MAXA 2WV5A 3FANA 4F4OC 5A0CA 5CHAB 4D9QA 2OLGA 4K1SA 2O8UA 2CHAC 3SGBE 2O8LA 4IS5A 4LK4A 4NZLA 1L1JA 2H2ZA 1FIWA 2EI8A 3PLBA 4CRBA 1C2FA 1W7GH 3D49H 4GCHG 2VIPA 1GHWH 1ZRBA 1JXPA 5LPRA 2Y5FA 1MH0A 1J15A 2XCNA 3D23A 2RDLA 2GZ8A 1PPEE 2PKAB 4BAKB 1EAXA 1CA0B 1S85A 1JOUB 5FBEA 5PTPA 2FS8A 4X1RU 4YOJA 3MI4A 1P2MA 2TBSA 1LHDH 1PPZA 2AYWA 4HTCH 1QFKH 1BOQA 3MU0A 2VVCA 1TLDA 3NPSA 1GBBA 2A2QH 3NUMA 5C1UA 1SLVB 3A88A 1SOZA 6GCHF 4X6NA 1GBEA 1HIAA 2OUAA 1BMMH 1OWIA 1EZQA 5BPEA 2PLXA 2SGPE 1TGCA 4Y76A 1NS3A 3SHAH 3SQEE 3TITA 5F8XA 5EW1H 4NIXA 2BD7A 2QA9E 4FU7A 2XYAA 3VXEH 4NFEA 2ZFSA 1HFDA 3SJKA 1O3MA 4YZUA 3RU4T 1ELGA 2C3SA 3M5OA 2FIRH 1DFPA 1TBZH 2K1QA 1A0HB 2HNTF 2Y80A 3ITIA 4NFFA 3RUOA 3I78A 1O3PB 3KQDA 2WV4A 2F9BH 4JYVH 2XC5A 5A8ZA 2ZDNA 1DOJA 1XUGA 2BDGA 4PROA 3VB5A 3O8CA 1EOLA 3RXIA 1BRAA 1QL9A 2PKSC 4WMEA 1E38B 3GDVA 4JMYA 1OP2A 3RMLH 1ZLRA 1H1BA 4A6LA 3OY6U 4HGCA 1S5SA 4J1YA 1P3EA 2R2MB 5FCKA 3ATWA 1V2VT 2B7DH 1SQAA 1QHRB 2UUKB 1TBQH 4BTIB 3S7HB 2ZDKA 3MNSA 2C8WB 4INLA 2Z3CA 1E0FD 1FI8A 1Y8TA 1XMNB 3ZZAA 1UHBB 4FUCA 1BTXA 3GYMA 3K65B 2BHGA 3LC5A 3MYWA 3UQVA 3M3VA 2ZU2A 1ZTJA 1BJVA 3URDA 2HVXA 4H42U 4NIYA 2GP9B 3K2UA 1G3EA 4B74A 4AB9A 4F49A 1DWBH 2V6NA 1ZGVA 2H6MA 7KMEH 1PFXC 1LPKB 1Y5UT 1KTSB 1IQGA 3HPTB 3TJNA 1H9IE 1UVTH 2QAAA 4DW2U 4O3UA 1GJDB 2PUXB 4FUGA 2M5TA 3HATH 3MU4A 1W10U 1V2OT 2HOBA 1SSXA 1VGCB 1AFQB 1QIXB 3ATIA 1O3KA 1BRUP 3RLWH 3TU7H 4ZXXH 1ESBA 2F9UA 3ZYEA 3PWBA 4AFQA 2F9NA 2PUQH 5EW2H 2R2WU 4NCYA 3ATKA 2PSYA 4Y8XA 1GBHA 2VU8E 1UTKA 1RRKA 3UNSA 4JK5A 3CS7A 2XW9A 3SV7A 2ZP0H 1O3DA 3PV4A 2ZFRH 1BMNH 1EAUA 1AB9B 3EGKH 4FUBA 4FUIA 1AWHB 1YPJH 1TIOA 2BD2A 2VIQA 2AERH 1D3QB 5HM2A 2DE8A 1TGBA 2WYJA 1EJMA 2SNWA 4R8TB 4TY6A 4X1QU 3E8LA 4INHA 2G52A 3MWIU 3OX7U 1AUTC 1Z1IA 3NZIA 3RU4D 1AVWA 1FQ3A 3M5LA 4ABAA 1NN6A 3ZZ8A 4MNVA 4BTTB 2ZTYA 2NU3E 3ZZ6A 3M3TA 1KXBA 1UTOA 1HAZB 2ZIQH 3BEUA 1N8OC 1O2TA 1T8MA 1TRYA 2ZGCA 1NRNH 1P2IA 2OC0A 1EUFA 2ZHEH 6LPRA 4LZ4B 3Q3KA 1QR3E 1DWCH 1QL8A 3EA9A 4H6TA 1C2HA 3O8BA 1XXFA 4X1NU 1T31A 1K1MA 1O2HA 4WH8A 5I46H 2AFQB 4ABDA 5AVDA 1W0YH 1V6DA 1GMCG 2B9LA 2HGTH 4CH8B 2QIQA 4ABIA 2FOEA 3SGQE 4KTUA 2I6QA 1HAYB 1OP0A 3MHWU 3VEQB 1XKAC 1O2ZA 1O2OA 1JRTA 3RXEA 4ZMAH 3QTOH 1QRWA 1UK4A 5C67A 4I8GA 4X8UH 1GL1A 5DP5A 5C1XA 1IAUA 3SU4A 1GHBG 3LJOA 5G4BA 3L33A 1A46H 4DY7B 2OTVA 3BIUH 1ZSJA 1UTMA 1XUIA 4DGJA 1ORFA 2UWPA 1TA6A 1XVOA 3A7ZA 2ZEBA 1ETSH 3LGIA 1F0RA 5FPYA 1O2LA 3E6PH 4MPXA 1YM0A 3RXKA 4GCHF 4AN7A 2CF9H 2QCYA 3A85A 4E7RG 3GDSA 3KL6A 4NWLA 1F2SE 2BY6X 4Y6DA 2G4TA 3A8AA 1ZHMA 3MMGA 2YNBA 1O2YA 2BLOA 1AKSA 1O32A 5E2OA 5K0HA 1JIMA 4H6SB 3BG4C 4B2CA 2ZNKH 4YO9A 3QLPH 4XDEA 2A2XH 1V2WT 2RG3A 4B2AA 3BV9B 5TCCA 1N1LA 4IW4E 1KXDA 4Y7BA 1NZQH 2GV7A 1GI7B 3ENSB 1KXEA 2WINI 1O2IA 4B1TA 1BUIA 1TNLA 1TNJA 5AFZH 2KAIB 1SGQE 3LC3A 4INKA 1QBOA 1OPHB 1AE8H 2H9HA 3RXAA 1W13U 3MH5A 3ZVGA 5DP6A 1FPCH 1MU8B 1Z6JH 1SC8U 1OKXA 1EPTA 2V3HH 7ESTE 1SG8B 1GBAA 1YLCA 2PKSB 2W3IA 2BVRH 5EODA 2GX4A 2ODPA 4IMZA 3D62A 4AORA 1Q31A 5AFYH 3RC4A 1V2QT 3EA7A 4IMQA 5EPNA 1QL7A 1DM4B 3E16B 1CT4E 1UTJA 1GHZA 4U01A 4KGAA 3ELAH 1PPBH 1MD7A 2ZO3H 4VGCC 1C1PA 4ZUHA 4MPVA 1TPPA 4AFZA 4CR9A 2G00A 1GBJA 5LH8A 1GBMA 1TPSA 3ZVDA 2OQUA 2P94A 2P3TB 4Y0ZE 1RGQA 3TVJB 3GY6A 1EAIA 3SI3H 2ZCLP 2CV3A 1TX8A 1O3AA 2FODA 3QDZB 2BQWB 1O34A 3U8RH 2OC8A 1O39A 1TRNA 5JB8S 1G2LA 1YP9A 4UFGH 1SGTA 3B23B 5C2ZA 4JYUH 3EDXB 1QRZA 2J94A 1UVPA 1MU6B 1B7XB 1UCYH 1ZR0A 5GXPA 3GY8A 5GIBA 1ZMNA 4NIWA 5FX5A 4A1TA 7GCHG 1L4ZA 1SGDE 1J8AA 1TX6A 1O38A 5E0HA 3T2NA 3TIUA 1C2JA 3KCGH 1JIRA 4XBBA 1WQSA 1ZHRA 1ELEE 1KLIH 1LVBA 2J34A 1SHYA 2F9PA 6CHAB 1CE5A 2AMQA 3LGTA 4YOGA 1IQFA 1BJUA 2BY9X 2ZZUH 3VB4A 2G5VA 2OBQA 1BBRE 2F3CE 4HI3A 1O2QA 1HXFH 1O0DH 4D7FA 1P2OA 3SV9A 5CE1A 1O2MA 3PROA 4X8VH 1C1OA 3TPIZ 5EXLA 1GDUA 3U8TH 4X0WU 1ESTA 4OS2A 4GAWA 1CBWB 1A5IA 3T62A 5EXMA 3SNEA 1JMOH 4X2VA 3RC6A 1GI6A 5E8EH 1EOJA 1GBDA 1LVYA 1HAXB 2HPQH 1FLEE 1EAWA 3Q77A 3SORA 3TGKE 2GCTC 3ZZDA 1HAPH 2UUYA 1UVOA 1BMAA 4AZ2B 1IHSH 1ZSKA 1DWEH 1LHEH 4JZFH 1LHGH 4Q2KA 4FVDA 1AZZA 4TWWA 1F0UA 1CGHA 3BTKE 1MCVA 3PO1B 1ABIH 2FX4A 4X2WA 1SGYE 3IITA 1MTNC 3ZVAA 1BMLA 4DJZB 1BZXE 4LOYH 3QN7A 2VWOA 1THPB 4A92A 2ANKH 1ETTH 3RXHA 4NSVA 1LPGB 5DP4A 2AEIH 1GJCB 1P12E 2UUFB 4AOQA 1GMCF 3P8FA 7LPRA 5E2PA 3ZVCA 1RJXB 3LGVA 1XUJA 1GGDC 4FUHA 3AASA 1ZMLA 2PV9B 4UFDH 5DP9A 1FN8A 1O5EH 2QV1A 3KHVA 2P8OB 2ZQ2A 1C2DA 4OS4A 5JBCS 2PWXA 4NSYA 4Q80A 1GDNA 1GHBF 1P06A 1NU7B 3BG8A 1W7XH 1B5GH 3AW1A 1O2PA 1K1LA 3F6UH 3L3TA 1HAGE 1GHYH 4YTAA 2ZF0H 2Y81A 1OYQA 1VJ9U 3ATMA 1NRSH 2XBVA 1LVMA 5C20A 1MKXK 3EAJA 1K2I1 3SO3A 2A4OA 1DUEA 3ATLA 3UREA 2FOHA 2ZDMA 1GI2A 4ASHA 2D1JA 1SGFA 3BTWE 3TK9A 2VWNA 2P3UB 1LPZB 2GCHG 2Q1JA 2FESH 2NU4E 1CSOE 4DT7B 2PTCE 4E7NA 4CREA 2GV6A 4DIHH 5DKMA 1GCTC 1GVKB 1BTZA 1C5MD 2BQ7B 1GVLA 2R0LA 3DFLA 2JETB 1KDQB 2XBYA 3KGPA 1EATA 1MTUA 1VITG 3VB3A 4TYDA 3RXCA 1MAYA 3K6YA 4DOQA 1GVZA 2CGAA 1GBKA 1F5LA 5IYTA 1GJ5H 2GDDA 1T8NA 4ZKSU 3DHKH 3ODDA 2BQ6B 2SGEE 3UQOA 1F5RA 2DE9A 3BSQA 3W94A 4J2YB 1EQ9A 1P03A 1YF4A 4XBCA 1UJ1A 1S84A 1Z8JB 2FM2A 2XC4A 4AG1A 2VJ1A 1VJAU 1V2PT 5C5OA 1L4DA 3HK3B 1MQ6A 3LGUA 4B76A 1CA8B 4JZIA 4FU9A 2F91A 1L2EA 3ZZ5A 1FAXA 5CMXH 1EXFA 2FP7B 3FAOA 3QZQA 1O2WA 1EZSC 3PWCA 2BM2A 3KN2A 1DXPA 4X2XA 2J4IA 1GPZA 1V2NT 4GLYA 4NA9H 1PQAA 1T7CA 1RS0A 1FV9A 3GCHC 2ODYB 3GY2A 4Y7AA 2QY0B 3SV6A 1IHTH 1RTLA 1C5NH 1P02A 1SLXB 3A8BA 3DUXH 2AH4X 3RXRA 4M7GA 4K8YA 3ZYDA 8ESTE 3LDXH 2ALVA 2GKVE 1YCPM 3P8OA 2O8TA 1SGIB 1NFYA 2ZFQH 3MTYA 1LQDB 1V2UT 2XRCA 1DPOA 4A7IB 1EPTC 2AMPA 4ZHLU 1A7SA 2Y5GA 1AU8A 1DSTA 1QCPA 2XCFA 2XXLA 4OS1A 4KELA 4AGJA 2G5NA 1YPHC 1KXCA 1SB1H 3MOCA 4D8NA 1HAVA 1C4U2 1PQ5A 2ANYA 1SI5H 2BD9A 1ZHPA 1Y3XA 1ELDE 2EA3A 3A8CA 1HAIH 5C3NA 3BN9A 1OS8A 2BLQA 2ZGJA 1TONA 5HMAA 2ZU3A 4ABEA 3STIA 2C8YB 3SW2B 3EQ0H 3M7UA 4OS6A 1DWDH 3OTJE 5JB9S 2EC9H 5DP8A 2AIQA 3AAUA 3UFAA 4RN6A 4GUXA 1BHXB 1C1WH 3A86A 1K1OA 1EKBB 1NM6A 1Z7KA 2PGQB 1FUJA 1YPKH 1S6FA 1C1QA 1DICA 3K6ZA 1E37B 3GY3A 2Q6FA 3UOUA 1WBGB 5T3HA 4LXBH 2TGDA 2PKAA 5HGGA 2GDEH 1ELCA 1TMBH 1C1NA 2FTMA 3UWJH 3TK5A 1TOCB 3NKKA 2BY7X 3W95A 4AFSA 1MKXH 2G4UA 5T6GA 1AN1E 3DT0H 1WOFA 2VIOA 1GHAG 1O2VA 4QT8C 1OWHA 1P3CA 2G8TA 1QBVH 1AD8H 1Z8GA 1O35A 4O03A 3RXUA 2W26A 1RTKA 2ZFPH 4CHAC 1AHTH 1O3FA 3MO6A 1P9UA 4ZKRU 1MKWK 3SNBA 2Y7ZA 3ZZBA 2BD3A 1D6WA 3BF6H 4O97A 3CS0A 1BB0B 2C8ZB 3MU1A 3SBKA 5BRRE 4U2WA 4YLUA 2W7SA 1BCUH 1FDPA 2J38A 4GHTA 1SBWA 1AIXH 1N6XA 1SR5C 4DURA 2TGAA 3PMBB 1INCA 3QWCH 1C1SA 2ULLA 3TNTA 3T5FH 3TH3H 1HJ9A 1MQ5A 1BQYA 5JDUB 1IQMA 3GY4A 4Y71A 4BNRA 2F9OA 1KY9A 4LZ1H 3BTFE 1XXDA 2WUBA 3L6PA 2P16A 4MLFB 2FMJA 1QGFA 3QO6A 1C5UA 2PFEA 1BBRK 3SNAA 4BXSA 1LCYA 3KEEA 2PTNA 1C2KA 4FUJA 3ODFA 1C5ZB 1DLKB 1ID5H 1EJAA 1SQOA 1CHOG 1UTPA 4AFUA 3RDZA 2BY8X 1JBUH 2A0QB 1G2MA 5L30H 1YC0A 3TJOA 2GCHF 3RXJA 1A1RA 1O5CB 1BA8B 1V2ST 1RIWB 1NFUA 1GI1A 1SOTA 2CXVA 2H9TH 3SV2H 1PPGE 1QB6A 1UHBA 2W7UA 1H8IH 4RKOB 1YGCH 2QF3A 2DUCA 1G30B 3SUGA 5JYIA 1VITF 2BVSH 4ZKNU 2GVFA 1TABE 1VR1H 2ZGHA 3S9BA 5T6DA 4K2YA 2ZHFH 4Q7XA 3A83A 3UUZA 2BYAX 1Y5BT 4X1SU 1CHGA 1QJ7B 2CHAB 1F0SA 1O3GA 1HJ8A 1HAOH 1ZPCA 1O2KA 1GI0A 3SJOA 1TYNA 4E05H 1BDAA 1BHXF 1BTHH 3FP8E 3QTVH 3P6ZB 1CGJE 4ABHA 1IOEA 3P95A 1FY8E 4I31A 3VGCC 3SJIA 2ZGXH 2FOBA 3EYDA 2B0FA 1TB6H 1EASA 3OY5U 3Q3YA 1QJ1B 5A2MH 1CT0E 1ZRKA 1ZPBA 1C1MA 3KQBA 3SU0A 2Z3DA 1XUFA 4TY7A 3LH3A 4DVAU 4OS7A 2I6SA 3ESTA 1TGSZ 4JYTA 2BX4A 3RXVA 1AMHA 1BTUA 5DP3A 1W0ZU 3C1KA 4GVUA 2H5DA 3RXBA 1ZOMA 4TPYA 1V2RT 1S0RA 1GJAB 1F92A 2LNCA 3SU5A 2A1DB 2GGVB 1SGPE 2YOLA 4X8TH 1PPCE 1LKBA 1LVOA 1AWFH 2P3FH 1K28D 2VWMA 4K3JA 2QXGA 2ANWA 1WYKA 3E0PB 1FPHH 1D3TB 4CRDA 3CP7A 3M61U 4I8JA 5C5NA 2G55A 4WXVA 2ZC9H 2ZCKP 5HM9A 3QGNB 4AYYB 1D9IA 1HPGA 4ISHH 1YPLH 1O3OA 3CENA 5K7RA 1ELVA 1P05A 1MKWH 2RA3A 3S9CA 4ABGA 2O8WA 4XOJA 3P8NA 4D76A 1O3NA 2Z9KA 1LQEA 1DITH 2CMYA 4UFEH 2THFB 2VH0A 4O9VA 2HNTE 3TLOA 2UUJB 3UTUH 1WCZA 3Q3XA 2A5AA 2ZFTA 1LTOA 1E35B 1NO9H 2CN0H 5A09A 2J95A 1ESAA 2ZHQH 3U9AH 1CGIE 2A7JA 1HBTH 3E0NB 2AS9A 3STJA 1O3LA 2Y82A 3SQHE 4IN2A 3UNRA 4NZQA 1O2JA 3SNDA 1K1PA 1YPGH 4XBDA 1C2MA 1ELTA 3U8OH 4FUFA 2BOHB 4MG3A 2QN5T 3LT3A 1O2NA 1FZZA 3M7QA 2D26C 1BBRH 4ISOA 2R3UA 2LPRA 2FOCA 4OS5A 2A31A 5HXFA 2ZWLH 1GHAF 1SGFG 1P2NA 2V0BA 2GMTC 1XKBC 3B8JA 3QGJA 1MBMA 2ZQ1A 2BY5X 1DVAH 1V2JT 1GMDG 3SZNA 1BRCE 2ZTXA 2A4QA 1ZGIA 3A81A 3UPEA 1TOMH 3V0XA 2BDBA 1DUAA 2KAIA 3Q76A 4K5ZA 2FO9A 1E34B 2FWWA 5CHAC 1P8VC 3HGNA 2Z94A 4YOIA 1LHCH 4Z0KA 2VIDA 2BLVA 4BOHA 2WPIS 1LHFH 2PGBB 1BT7A 4UONA 2NU2E 3LU9B 2D8WA 1FXYA 2AMDA 2OXSA 4MPWA 2FI4E 2ZPSA 3O8DA 4KTCA 1Q3XA 2WYGA 4MQAA 4WH6A 1PQ8A 4NA8A 3SV8A 1YBWA 5LGOA 1HLTH 3KQCA 3KIDU 1CA0C 1SFIA 3H7OA 3LGYA 2JH6D 4ZHMU 5EGMA 2H1UA 2ZHWH 1O5BB 1GG6C 3PTBA 2JH0D 2Q6DA 3NWUA 3H5CB 3A7VA 4FUDA 3IG6B 5ESBA 4AX9H 1TA2A 2C93B 1J16A 1N8OB 3GCNA 1BTPA 1K1IA 2W3KA 3OYPA 2TIOA 1C5SA 2FYRA 3FZZA 3SNCA 1HDTH 1QB9A 1CHOF 2GZ7A 1SVPA 1NPMA 1TGTA 3E90B 2BDAA 4YLQH 1TNIA 2FLBH 4WF8A 3EA8A 3GICB 5EQQA 1KYNA 2ZGBH 5DO4H 2VWLA 3RXQA 1AI8H 1ANCA 4I33A 4X6OA 2Z7FE 1Y3YA 1IQJA 1OOKB 2XWAA 2ZU1A 3LKWA 3WY8A 1MTSA 1ELBA 1WV7H 1HCGA 4OGXA 3ZVEA 1QQ4A 1T4VH 1O2XA 1NFXA 4MNWA 1Z71A 2SGAA 4ISLA 1GJ6A 3SN8A 1TE0A 5DK1A 2IPHA 3S69A 2R0KA 3PB1E 4MNYA 4ZHAA 1SQTA 3RMOH 3E1XB 2YNAA 4Q7YA 5B6OA 1RTFB 4IN1A 1P11E 1G3DA 3RXOA 2WUCA 8GCHG 9LPRA 1TMUH 3ZZ4A 4D9RA 1C4V2 1C5QA 3RXSA 2ALPA 4SGBE 1ZMJA 3AVZA 1MCTA 1P0SH 2V35A 1A3BH 1AVGH 1CT2E 8KME2 1BIOA 1HRTH 2AGGX 1HJAC 1AQ7A 3BG4B 2H9EH 1H8DH 4JZDH 1C2LA 1RD3B 3T28A 2WPMS 2A4GA 1A5GH 3DD2H 2ANMH 2VB0A 4Q7ZA 3RXGA 3TGJE 1UMAH 5EQSA 4ZKOU 3N7OA 3RLYH 4FUEA 1NRPH 2BDCA 1VCPA 1W14U 1GI5A 3T29A 1C5RA 2SGDE 2R3YA 1AE5A 2FTLE 3I29A 1KLTA 3RP2A 1MZDA 4YESB 3ZVBA 1SLWB 1NROH 1UVSH 1ANEA 2FOFA 3M3SA 4U30A 1C2GA 1C5TA 1AFQC 1VGCC 2P93A 3B9FH 1C4Y2 3RMMH 3TJVA 1PYTD 2OP9A 3UOPA 1NTPA 1H9HE 4H4FA 1DS2E 1HB0B 3RM2H 1TWXB 3TGIE 5SGAE 2Z6BD 3LJJA 1TQ7B 1C5YB 3D65E 3PM3A 4VGCB 3BTQE 5GPIB 1K9OE 1E36B 1GI9B 1TNGA 4MNXA 1K22H 1TRMA 2Y7XA 1AB9C 3MO9A 3QZRA 4CBNA 3ZV8A 1ZPZA 1HNEE 2XNIA 3T25A 1HIAB 3TK6A 4MDSA 3KF2A 3BTEE 1NFWA 2XC0A 4BAMB 4DCDA 2BDHA 1OWJA 1GJ7B 4Y0YE 2TGTA 2PW8H 5EG4A 1C5WB 1NESE 1ZJKA 4UEHH 3RC5A 3MNXA 1ZTKA 4CBOA 1O33A 1BTWA 1S83A 1P2QA 1D6RA 2WPHS 1QNJA 1THRH 2FX6A 3I77A 1WQVH 4ZROA 3ZZ9A 1O2RA 4SGAE 4UDWH 3JZ2B 4XSKU 2FS9A 1CO7E 5T6FA 4NA7A 4UFFH 1C2EA 1CU1A 1ELAA 1T4UH 5TCAA 1GBTA 4IC5A 1J9CH 1LDTT 1YYY1 3UR6A 2AGIX 2VH6A 4WXIA 3A82A 1T8OA 3F1SB 1QA7A 3A7WA 2ZCHP 1C5PA 7GCHF 2ZG0H 1HV7A 2HRVA 1KDQA 1Z8IB 5EPYA 5JBAS 1FIZA 3LIWA 1Y59T 1GMDF 1T8LA 1G3BA 1P09A 1K1JA 4ISNA 1GBFA 1QURH 2BTCE 1CQQA 2FOMB 3SGAE 2BZAA 3GDUA 1GG6B 2VGCC 1C9TA 1SMFE 3A8DA 2Z9LA 3PMHB 5DP7A 2Q6GA 1F7ZA 1IQNA 2GT8A 1TMTH 5EU8A 3RXTA 3U98H 3PMAB 1M9UA 1ETRH 1RXPA 1YCPK 5E0GA 3SUEA 5DPAA 3VXFH 4A1VA 3RMNH 5L2YH 5F03A 3RXPA 2GCTB 5EXNA 5A0BA 3M5NA 2BZ6H 1L1GA 1P01A 1G36A 1TNHA 2SGQE 3RM0H 1TGNA 3U1JB 4ZXYH 3MU8A 1FY5A 3SU3A 1FMGA 2BD4A 1UK2A 2FI3E 1FJSA 1GBIA 1KIGH 2A5IA 1NY22 5LPFA 5GCHG 4ISIH 3A7XA 4CR5A 1AO5A 1P57B 1YPHE 2XBWA 2A5KA 4A1XA 1MTNB 3U69H 3SU2A 1P04A 4B75A 5C1YA 4Y8ZA 1O5FH 3PYHA 1J17T 1MTVA 3F9EA 3T27A 2OC1A 4GSOA 3HGPA 1LO6A 2ZPQA 5JBBS 3GCTG 4TPIZ 5GDSH 5F6MA 4IGDA 1O36A 3EE0B 3BTHE 4K60A 4YT7H 1RFNA 1YPMH 2OCVB 1EZXC 1G3CA 3H7TA 1EP6A 1W12U 1GGDB 3V7TA 3P8GA 1IQEA 1U6QA 5IDKA 4X6MA 4IBLH 2BXUH 3GISB 1P2JA 2ODQA 1C1UH 1AZ8A 4WJG2 2PHBA 1FY4A 2QXIA 2A7HA 2P95A 3GY5A 1FNIA 4I8LA 3MU5A 4ZH8A 9ESTA 4YT6H 1QB1A 3QUMP 1MBQA 3M37A 2G51A 2Z9IA 2A7CA 1KTTB 1AGJA 4TWYA 3UNQA 1HJAB 3UIRA 1A61H 1UTNA 2NWNA 1B0EA 2RCEA 8GCHF 2EI6A 2CF8H 4KP0A 2J9NA 3LH1A 1O2UA 1A0LA 1EZUC 1SHHB 1TALA 3E3TA 4X1PU 4MTBA 5DG6A 3BTME 2SNVA 1KXAA 3FP7E 2HLCA 4KTSA 2HALA 4MPUA 1O2SA 1IQKA 1DT2A 1MD8A 1GCDA 3NK8A 1OX1A 1EB2A 1C9PA 3RXDA 1A4WH 1DY8A 2QXHA 2OQ5A 1KXFA 1GCTB 1HYLA 4Y79A 2VNTA 1W8BH 1AUJA 1ARBA 1B0FA 1YKTA 1C5OH 1NRRH 1FN6A 3ZZ7A 3UWIA 4KKDA 1C1RA 2XTTB 4A5TS 3HKIB 3ZV9A 4K8BA 6CHAC 4JK6A 4XE4A 4ESTE 1HUTH 1C5XB 1S82A 1A2CH 1TBRH 2VIVA 1Z8RA 3P92A 3RXFA 4WWYA 3SOSA 1C5VA 5A8XA 2TRMA 4BXWA 1FONA 2QYIA 1UCYK 8LPRA 2IN2A 1A3EH 1QBNA 5EOKA 4GPGA 4NG9H 1Y3UA 2EI7A 4AB8A 1CBWC 2HPPH 1GWAA 2NU0E 1DLEA 4I8KA 4NWKA 1X7AC 3MO3A 1SFQB 4K69A 1AKSB 2BD8A 3A80A 1WTHD 3R0FA 1DDJA 1DXWA 3GCHB 2ZU5A 1OWKA 4FVBA 4X8SH 3P17H 1EJNA 1PPFE 1IQLA 1G37A 2FOGA 1J14A 3A7TA 2H5CA 2OBOA 4ABBA 4Y8YA 2IJOB 3RXMA 4ZAEA 2ILNA 3VB7A 2A32A 1YCPH 2BX3A 1ANBA 3AAVA 3LGWA 4X2YA 1EX3A 3PO1C 3BIVH 4DG4A 5DGJA 1GDQA 1XM1A 2QXJA 1SGRE 2FXRA 1H9LB 1TAWA 3GYLB 1EPTB 1C5LH 5DJ7A 3M5MA 4ABFA 3DFJA 1NRQH 1V2TT 2Y5HA 6ESTA 3TH2H 2A45B 2AGEX 2ASUB 2ZA5A 2JKHA 1GI8B 1O3CA 1S6HA 1UVUH 2P59A 2C8XB 3QK1A 4DIIH 5ABWA 1OYTH 1K1NA 3RU4E 4AYVB 4B71A 2VGCB 2EEKA 1TQ0B 5L2ZH 1O3JA 1MZAA 1T32A 4ABJA 5AF9H 2OC7A 3DA9B 2QC2A 4BAHB 1V2MT 1PJPA 2Z9JA 3SU1A 3KNXA 3TJUA 2ZFFH 4AG2A 1DSUA 2P8OC 1EB1H 3PLPA 3RXLA 1D4PB 1DX5M 3BTGE 3MH7A 2ZTZA 1Q2WA 4I8HA 2BOKA 3UR9A 1GMHG 3P70B 1VCWA 3F9GA 5GWZA 4HZHA 2WPJS 1QA0A 2ZPRA 3A87A 1TPAE 1TPOA 3F9FA 3SJ9A 4XFQA 2GT7A 4Y11E 1SGEE 2HNTC 3A84A 2VVVA 5ETXA 1N6YA 4B2BA 1ABJH 1DANH 1O3EA 2O9QA 1L0ZA 4Z6AH 3AW0A 4WMFA 1GL0E 2BDIA 5FXLA 5GCHF 1TNKA 4AGKA 4NGAH 1O30A 1Z1JA 2XBXA 2BVXH 2VINA 3V12A 3BTDE 1SL3A 1OWDA 2C90B 2O8MA 2WPKS 2Z3EA 2JETC 2OINA 4CHAB 1D3PB 1GI4A 3UY9A 1XVMA 1SLUB 1H4WA 1OSSA 1ZJDA 2XWBI 1C1VH 1NT1A 2FOAA 3GCTF 1CVWH 1XX9A 1UK3A 4I32A 1GHXH 4HFPB 3E91A 4WY3A 1HGTH 2B5TB 4CH2B 4X6PA 1O2GH 1QRXA 2TGPZ 4CRAA 1O3HA 3VB6A 3MFJA 1ARCA 1C2IA 1QTFA 1AVXA 5GJ4B 1S0QA 2ZDVH 2F83A 2W5EA 3BEFB 5FBIA 4UD9H 3URCA 5A8YA 4YM9A 4JZ1A 5FPTA 3MNBA 5TJXA 4IC6A 1QJ6B 3A7YA 2ZU4A 3FFGA 1W2KH 1W11U 3SHCH 5JPMH 1OWEA 2ZDAH 3M35A 3SU6A 2FZZA 1P10A 5ESTE 6GCHG 4Y10E 3GCOA 2HWLB 2IOTA 1P9SA 3V3MA 1MMJN 5F8TA 2ESTE 1VCQA 1GJ9B 1XUKA 1HXEH 2PSXA 1GBLA 2BMGB 1V2LT 1O37A 1FY1A 1VITH 2C4FH 2BDYA 2RA0A 5F8ZA 1UTQA 5A0AE 1NU9A 3R3GB 3KQEA 4OGYA 1GJ4H 1UCYE 3Q00A 2FLRH 1QY6A 2WPLS 1BRBE 2ZDLA 1QQUA 2FEQH 2ZI2H 3TH4H 1O5GH 1F0TA 3SJ8A 4RSPA 1WTGH 4JCNA 5AHGH 3ZVFA 2OD3B 3GY7A 1IQHA 3S7KB 1O3BA 2CJIA 1O5DH 5FX6A 3VGCB 4O3TA 3VFEA 4THNH 3JZ1B 1MTWA 2BD5A 1KSNA 3M36A 1ZYOA 2SFAA 1YLDA 4BAOB 3HK6B 5FHTA 3HKJB 1IQIA 4I7YH 1AFEH 2TPIZ 3U1IB 3BTTE 3SI4H 5J4SA 2NU1E 2ZECA 5FCRA 1THSH 2V3OH 2QF0A 2GD4B 4MVNA 1W3CA 1GJ8B 1NC6A 1Y5AT 1C1TA 1GHVH 1VZQH 1S81A 2D2DA 3PMJA 2GTBA 2JH5D 1XUHA 2J92A 3F9HA 2BXTH 1MUEB 4CRFA 3SUFA 4K1TA 5LPEA 2ZKSA 3MH4A 3VPKA 3G01A 1Y3WA 2UWOA 3BEIB 1AY6H 2FDAA 3T26A 3QX5H 2VIWA 4RKJB 1WSSH 3C27B 1SGNE 1UTLM 1WUNH 1GI3A 3PLKA 1D3DB 2F9VA 1HAHH 5HYOA 2UWLA 3NCLA 3NXPA 5E0JA 5I25A 2J2UA 2SGFE 1O31A 2Y6TA 4FXGH 3ZZCA 1TFXA 1V3XA 4BAQB 1JWTA 4E06H 3A89A 1WAYB 4CRGA 1ZSLA 3F68H 2G81E 1DE7H 1ZZZA 1LKAA 2FPZA 1FAKH 1G9IE 1FY3A 3S0NA 1OP8A 1DY9A 4FU8A 2BB4A 3FVFB 4K1EA 1GMHF 1ACBE 1V2KT 3GOVB 1Z6EA 1LMWB 4R0IA 3LOXA 2B8OH 1KLJH 2FI5E 4U32A 5L6NH 1WU1A 5FPSA 4D7GA 3S9AA 3PTNA 3M7TA 2VVUA 4WMDA 3IWMA 3OSYA 5H4IB 1SGCA 3K9XB 1L1NA 3LONA
chains in the Genus database with same CATH superfamily
1A0JA 4WVPE 1BITA 3O8RA 3OU0A 3V13A 4BTUB 1EP5A 4NIVA 3TNSA 4CRCA 1GJBB 2QGRA 5FAHA 1G32B 1ZTLA 1BTYA 1YPEH 2A4RA 4JZEH 2PR3A 5EQRA 5JBTA 1O3IA 2Z9GA 3FZDA 1HAVB 3LPRA 2KCOA 1TX7A 2STBE 1SPJA 4BANB 4B73A 1Y3VA 1PPHE 1RIWC 3ZZ3A 1P2KA 2STAE 3MNCA 1PQ7A 2AIPA 2M2AA 1GBCA 2GMTB 4GHQA 1K21H 3MH6A 5J4QA 1PYTC 2BLWA 2ZHDA 3ZIAD 4OM9A 1BMFD 1JRSA 3SUDA 1A5HA 1UO6A 2FYQA 1O5AB 2GZ9A 3FP6E 4UE7H 1ANDA 1F5KU 2R9PA 1ELFA 1OXGA 1MAXA 2WV5A 3FANA 4F4OC 5A0CA 5CHAB 4D9QA 2OLGA 4K1SA 2O8UA 2CHAC 3SGBE 2O8LA 4IS5A 4LK4A 4NZLA 1L1JA 2H2ZA 1FIWA 2EI8A 3PLBA 4CRBA 1C2FA 1W7GH 3D49H 4GCHG 2VIPA 1GHWH 1ZRBA 1JXPA 5LPRA 2Y5FA 1MH0A 1J15A 2XCNA 3D23A 2RDLA 2GZ8A 1PPEE 2PKAB 4BAKB 1EAXA 1CA0B 1S85A 1JOUB 5FBEA 5PTPA 2FS8A 4X1RU 4YOJA 3MI4A 1P2MA 2TBSA 3PRDA 1LHDH 1PPZA 2AYWA 4HTCH 1QFKH 1BOQA 3MU0A 2VVCA 1TLDA 3NPSA 1GBBA 2A2QH 3NUMA 5C1UA 1SLVB 5HIYA 3OTPA 3A88A 1SOZA 6GCHF 4X6NA 1GBEA 1HIAA 2OUAA 1BMMH 1OWIA 1EZQA 5BPEA 1NBME 2PLXA 2SGPE 1TGCA 4Y76A 1NS3A 3SHAH 1SQRA 2LP6A 3SQEE 3TITA 5F8XA 5EW1H 4NIXA 2BD7A 2QA9E 4FU7A 2XYAA 3VXEH 4NFEA 2ZFSA 1HFDA 3SJKA 4B6FA 1O3MA 4YZUA 3RU4T 1ELGA 2C3SA 3M5OA 2FIRH 1DFPA 1TBZH 2K1QA 1A0HB 2HNTF 2Y80A 2HVYB 3ITIA 4NFFA 3RUOA 3I78A 1O3PB 3KQDA 2WV4A 2F9BH 4JYVH 2XC5A 5A8ZA 2ZDNA 1DOJA 1XUGA 2BDGA 4PROA 3VB5A 3O8CA 1EOLA 3RXIA 1BRAA 1QL9A 2PKSC 4WMEA 1E38B 3GDVA 4JMYA 1OP2A 3RMLH 1ZLRA 1H1BA 2WSSD 4A6LA 3OY6U 4HGCA 1S5SA 4J1YA 1P3EA 2R2MB 5FCKA 3ATWA 1V2VT 2B7DH 1SQAA 1QHRB 2UUKB 1TBQH 4BTIB 3S7HB 2ZDKA 3MNSA 2C8WB 4INLA 2Z3CA 1E0FD 1FI8A 1Y8TA 1XMNB 3WWBA 3ZZAA 1UHBB 4FUCA 3PV5A 1BTXA 3GYMA 3K65B 2BHGA 3LC5A 3MYWA 3UQVA 3M3VA 2ZU2A 1ZTJA 1FX0B 1BJVA 3URDA 2HVXA 1E1QD 4H42U 4NIYA 2GP9B 3K2UA 4ACBA 1G3EA 4B74A 4AB9A 3F2HA 4F49A 1DWBH 1OHHD 2V6NA 1ZGVA 2H6MA 7KMEH 1PFXC 1LPKB 1Y5UT 1KTSB 1IQGA 3HPTB 3TJNA 1H9IE 1UVTH 2QAAA 4DW2U 4O3UA 4TSFD 1GJDB 2PUXB 4FUGA 5C17A 2M5TA 3F0OA 3HATH 3MU4A 1W10U 1V2OT 2HOBA 1SSXA 1VGCB 1AFQB 1QIXB 3ATIA 1O3KA 4YXWD 1BRUP 3RLWH 3TU7H 4ZXXH 1ESBA 2F9UA 3ZYEA 2CK3D 3PWBA 4AFQA 2F9NA 2PUQH 5EW2H 2R2WU 4NCYA 3ATKA 1YLNA 2PSYA 1GBHA 4Y8XA 2VU8E 1UTKA 1RRKA 3UNSA 4JK5A 3CS7A 5HKKD 2XW9A 3SV7A 2ZP0H 1O3DA 3PV4A 2ZFRH 1BMNH 1EAUA 1AB9B 3EGKH 4FUBA 4FUIA 1AWHB 1YPJH 1TIOA 2BD2A 2VIQA 2AERH 1D3QB 5HM2A 2DE8A 1TGBA 2WYJA 1EJMA 2SNWA 4R8TB 4TY6A 4X1QU 2K0QA 3E8LA 4INHA 2G52A 2IJD1 3MWIU 3OX7U 1AUTC 1Z1IA 3NZIA 3RU4D 1AVWA 1FQ3A 3M5LA 4ABAA 1NN6A 3ZZ8A 4MNVA 4BTTB 2ZTYA 2NU3E 3ZZ6A 3M3TA 1KXBA 1UTOA 1HAZB 2ZIQH 3BEUA 1N8OC 1O2TA 1T8MA 1TRYA 2ZGCA 1NRNH 1P2IA 2OC0A 1EUFA 2ZHEH 6LPRA 4LZ4B 3Q3KA 1QR3E 1DWCH 1QL8A 3EA9A 4H6TA 1C2HA 3O8BA 1XXFA 4X1NU 1T31A 1K1MA 1O2HA 2JJ1D 4WH8A 5I46H 2AFQB 4ABDA 5AVDA 1W0YH 1V6DA 1GMCG 2B9LA 2HGTH 4CH8B 2QIQA 4ABIA 2FOEA 3SGQE 4KTUA 2I6QA 1HAYB 1OP0A 3MHWU 3VEQB 1XKAC 1O2ZA 1O2OA 1JRTA 3RXEA 4ZMAH 3QTOH 1QRWA 1UK4A 5C67A 4I8GA 4X8UH 1GL1A 5DP5A 5C1XA 1IAUA 3SU4A 1GHBG 3LJOA 5G4BA 1YY3A 3L33A 1A46H 4DY7B 2OTVA 3BIUH 1ZSJA 1UTMA 1XUIA 4DGJA 1ORFA 2UWPA 1TA6A 1XVOA 3A7ZA 2ZEBA 1ETSH 3LGIA 1F0RA 5FPYA 1O2LA 3E6PH 4MPXA 3WWFA 1YM0A 3RXKA 4GCHF 4AN7A 2CF9H 2QCYA 3A85A 4E7RG 3GDSA 3KL6A 4NWLA 1F2SE 3OE7D 2BY6X 4Y6DA 2G4TA 3A8AA 1ZHMA 3MMGA 2YNBA 1O2YA 3N99A 2BLOA 1AKSA 1O32A 5E2OA 5K0HA 1JIMA 4H6SB 3BG4C 5KGOA 4B2CA 2ZNKH 4YO9A 3QLPH 4XDEA 2A2XH 1V2WT 2RG3A 4B2AA 3BV9B 5TCCA 1N1LA 4IW4E 1KXDA 4Y7BA 1NZQH 2GV7A 1GI7B 3ENSB 1KXEA 2WINI 1O2IA 4B1TA 1BUIA 1TNLA 1TNJA 5AFZH 2KAIB 1SGQE 3LC3A 4INKA 1QBOA 1OPHB 1AE8H 2H9HA 5FL7D 3RXAA 1W13U 3MH5A 3ZVGA 5DP6A 1FPCH 1MU8B 1Z6JH 1SC8U 1OKXA 1EPTA 2V3HH 7ESTE 1SG8B 1GBAA 1YLCA 2PKSB 2W3IA 2BVRH 5EODA 2GX4A 2ODPA 4IMZA 3D62A 4F55A 4AORA 1Q31A 5AFYH 3RC4A 1V2QT 3EA7A 4IMQA 5EPNA 1QL7A 2RDEA 1DM4B 3E16B 1CT4E 1UTJA 1GHZA 4U01A 4KGAA 3ELAH 1PPBH 1MD7A 2ZO3H 4VGCC 1C1PA 4ZUHA 4MPVA 1TPPA 4AFZA 4CR9A 2G00A 1WDIA 2KM0A 1QZ8A 1GBJA 5LH8A 1GBMA 1TPSA 3ZVDA 2OQUA 2P94A 2P3TB 4Y0ZE 1RGQA 3TVJB 3GY6A 1EAIA 3SI3H 2ZCLP 2CV3A 1TX8A 1O3AA 2FODA 3QDZB 2BQWB 1O34A 3U8RH 2OC8A 1O39A 1TRNA 5JB8S 1G2LA 1YP9A 4UFGH 1SGTA 3B23B 5C2ZA 4JYUH 3EDXB 1QRZA 2J94A 1UVPA 1MU6B 1B7XB 1UCYH 1ZR0A 5GXPA 3GY8A 5GIBA 1ZMNA 4NIWA 5FX5A 1H8HD 4A1TA 7GCHG 1L4ZA 1SGDE 1J8AA 1TX6A 1O38A 5E0HA 3T2NA 3TIUA 1C2JA 3KCGH 1JIRA 4XBBA 1WQSA 1ZHRA 1ELEE 1KLIH 1LVBA 2J34A 1SHYA 2F9PA 6CHAB 1CE5A 2AMQA 3LGTA 4YOGA 1IQFA 1BJUA 2BY9X 2ZZUH 3VB4A 2G5VA 2OBQA 1BBRE 2F3CE 4HI3A 1O2QA 1HXFH 3NRLA 1O0DH 4D7FA 1P2OA 3SV9A 5CE1A 1O2MA 3PROA 4X8VH 1C1OA 3TPIZ 5EXLA 1GDUA 3U8TH 1E79D 4X0WU 1ESTA 4OS2A 4GAWA 1CBWB 1A5IA 3T62A 5EXMA 3SNEA 1JMOH 4X2VA 3RC6A 3DCLA 1GI6A 5E8EH 1EOJA 1GBDA 1LVYA 1HAXB 2HPQH 1FLEE 1EAWA 3Q77A 3SORA 3TGKE 2GCTC 3ZZDA 1HAPH 1EFRD 2UUYA 1UVOA 1BMAA 4AZ2B 1IHSH 1ZSKA 1DWEH 1LHEH 4JZFH 1LHGH 4Q2KA 4FVDA 1AZZA 4TWWA 2L6OA 1F0UA 1CGHA 2V7QD 3BTKE 1MCVA 3PO1B 1ABIH 2FX4A 4X2WA 1SGYE 3IITA 1MTNC 3ZVAA 1BMLA 4DJZB 1BZXE 4P02A 2AHME 4LOYH 3QN7A 2VWOA 1THPB 4A92A 2ANKH 1E1RD 1ETTH 2OK5A 3RXHA 4NSVA 1LPGB 2W6ID 5DP4A 2AEIH 1GJCB 1P12E 2UUFB 4AOQA 1GMCF 3P8FA 7LPRA 5E2PA 3ZVCA 1RJXB 3LGVA 1XUJA 1GGDC 4FUHA 3AASA 1ZMLA 1WXRA 4I86A 2PV9B 4UFDH 3FN8A 5DP9A 1FN8A 1O5EH 2QV1A 3KHVA 2P8OB 2ZQ2A 1C2DA 4OS4A 5JBCS 2PWXA 4NSYA 4Q80A 1GDNA 1GHBF 1P06A 1NU7B 3BG8A 1W7XH 1B5GH 2J98B 3AW1A 1O2PA 1K1LA 3F6UH 3L3TA 1HAGE 1GHYH 4YTAA 2ZF0H 2Y81A 1OYQA 1VJ9U 3ATMA 5EJLA 1NRSH 2XBVA 1LVMA 5DSFA 5C20A 1MKXK 3EAJA 1K2I1 3SO3A 2A4OA 1DUEA 3ATLA 3UREA 2FOHA 2ZDMA 1GI2A 4ASHA 2D1JA 1SGFA 3KYGA 3BTWE 3TK9A 2VWNA 2P3UB 1LPZB 2GCHG 2Q1JA 2FESH 2NU4E 1CSOE 4DT7B 2PTCE 4E7NA 4CREA 2GV6A 4DIHH 5DKMA 1GCTC 1GVKB 4RT0A 1BTZA 1C5MD 2BQ7B 2KR7A 1GVLA 2R0LA 3DFLA 2JETB 1KDQB 2XBYA 3KGPA 1EATA 1MTUA 1VITG 3VB3A 4TYDA 3RXCA 1MAYA 3K6YA 4DOQA 1GVZA 2CGAA 1GBKA 1F5LA 5IYTA 1GJ5H 2GDDA 2YMSC 1T8NA 4ZKSU 3DHKH 3DSOA 3ODDA 2BQ6B 2SGEE 3UQOA 1F5RA 2DE9A 3BSQA 3W94A 4J2YB 1EQ9A 1P03A 1YF4A 4XBCA 1UJ1A 1S84A 1Z8JB 2FM2A 2XC4A 4AG1A 2VJ1A 1VJAU 1V2PT 5C5OA 1L4DA 3HK3B 1MQ6A 3LGUA 4B76A 1CA8B 4JZIA 4FU9A 2F91A 1L2EA 3ZZ5A 5IK2D 1FAXA 5CMXH 5DN6D 1EXFA 2FP7B 3FAOA 3QZQA 1O2WA 1EZSC 4Z1MD 1NBMD 3PWCA 2BM2A 4M9FA 3KN2A 1DXPA 4X2XA 2J4IA 1GPZA 1V2NT 4GLYA 4XD7D 4NA9H 1PQAA 1T7CA 1RS0A 1FV9A 3GCHC 2ODYB 3OAAD 3GY2A 4Y7AA 4ACAA 2QY0B 3SV6A 1IHTH 1RTLA 1C5NH 1P02A 2KCAA 1SLXB 3A8BA 3DUXH 2AH4X 3RXRA 4M7GA 4K8YA 3ZYDA 8ESTE 3LDXH 2ALVA 2GKVE 1YCPM 3P8OA 2O8TA 1SGIB 1NFYA 2KX4A 2ZFQH 3MTYA 1LQDB 1V2UT 4ZCNA 2XRCA 1DPOA 5C0UA 4A7IB 1EPTC 2AMPA 4ZHLU 1A7SA 2Y5GA 1AU8A 1DSTA 1QCPA 2XCFA 2XXLA 4OS1A 4KELA 4AGJA 2G5NA 1YPHC 1KXCA 2L74A 1SB1H 3MOCA 4D8NA 1HAVA 1C4U2 1PQ5A 2ANYA 1SI5H 2BD9A 1ZHPA 1Y3XA 1ELDE 2EA3A 3A8CA 1HAIH 5C3NA 3BN9A 1OS8A 2BLQA 2ZGJA 1TONA 5HMAA 2ZU3A 4ABEA 3STIA 2C8YB 3SW2B 3EQ0H 3M7UA 4OS6A 1DWDH 3OTJE 5JB9S 2EC9H 5DP8A 2AIQA 3AAUA 3UFAA 4RN6A 5EJZA 4GUXA 4RT1A 1BHXB 1C1WH 3A86A 1K1OA 1EKBB 1NM6A 1Z7KA 2PGQB 1FUJA 1YPKH 1S6FA 1C1QA 1DICA 3K6ZA 1YWUA 1E37B 3GY3A 2Q6FA 3UOUA 1WBGB 5T3HA 4LXBH 4RI0A 2TGDA 2PKAA 5HGGA 3UB0A 2GDEH 1ELCA 1TMBH 1C1NA 2FTMA 3UWJH 3TK5A 1TOCB 3NKKA 2BY7X 3U28C 3W95A 1MKXH 2G4UA 5T6GA 4AFSA 1AN1E 3DT0H 1WOFA 2VIOA 1GHAG 1O2VA 4QT8C 1OWHA 1P3CA 2G8TA 1QBVH 1AD8H 1Z8GA 1O35A 4O03A 3RXUA 2W26A 1RTKA 3FO8D 2ZFPH 4CHAC 1AHTH 1O3FA 3MO6A 1P9UA 4ZKRU 1MKWK 3SNBA 2Y7ZA 3ZZBA 2BD3A 1D6WA 3BF6H 4O97A 3CS0A 1BB0B 2C8ZB 3MU1A 3SBKA 5BRRE 4U2WA 4YLUA 2W7SA 5C94A 1BCUH 1FDPA 2J38A 4GHTA 1SBWA 1AIXH 1N6XA 1SR5C 3LONA 4DURA 1K0HA 2TGAA 3PMBB 1INCA 3QWCH 1C1SA 2ULLA 3TNTA 3T5FH 3TH3H 1HJ9A 1MQ5A 1BQYA 5JDUB 1IQMA 3F0PA 3GY4A 4Y71A 4BNRA 2F9OA 1KY9A 4LZ1H 3BTFE 1XXDA 2WUBA 3L6PA 2P16A 4MLFB 2FMJA 1QGFA 4AC9A 3QO6A 1C5UA 2PFEA 1BBRK 3SNAA 4BXSA 1LCYA 3KEEA 2PTNA 1C2KA 4FUJA 3ODFA 1C5ZB 1DLKB 1ID5H 1EJAA 1SQOA 1CHOG 1UTPA 4AFUA 3RDZA 2BY8X 1JBUH 2A0QB 2QF5A 1G2MA 5L30H 1YC0A 3TJOA 2GCHF 3RXJA 1A1RA 1O5CB 1BA8B 1V2ST 1RIWB 1NFUA 1GI1A 1SOTA 2CXVA 2H9TH 3SV2H 1PPGE 1QB6A 1UHBA 2W7UA 1H8IH 4RKOB 1YGCH 2QF3A 2DUCA 1G30B 4F48B 3SUGA 5JYIA 3DSGA 1VITF 2BVSH 4ZKNU 2GVFA 1TABE 1VR1H 2ZGHA 3S9BA 5T6DA 4K2YA 2ZHFH 4Q7XA 3A83A 3UUZA 2BYAX 1Y5BT 4X1SU 1CHGA 1QJ7B 2CHAB 1F0SA 1O3GA 1HJ8A 1HAOH 1ZPCA 3DSPA 1O2KA 1GI0A 3SJOA 1TYNA 4E05H 1BDAA 1BHXF 1BTHH 3FP8E 3QTVH 3P6ZB 1CGJE 4ABHA 1IOEA 3P95A 1FY8E 4I31A 3VGCC 3SJIA 2ZGXH 2FOBA 3EYDA 2B0FA 1TB6H 1EASA 3OY5U 3F2FA 3Q3YA 1QJ1B 5A2MH 1CT0E 3SZEA 1ZRKA 1ZPBA 1C1MA 3KQBA 3SU0A 2Z3DA 1XUFA 2W6JD 4TY7A 3LH3A 4DVAU 4OS7A 2I6SA 3ESTA 1TGSZ 4JYTA 2BX4A 2EQNA 3RXVA 1AMHA 1BTUA 5DP3A 1W0ZU 3C1KA 4GVUA 2H5DA 3RXBA 1ZOMA 4TPYA 1V2RT 1S0RA 1GJAB 1F92A 2LNCA 3SU5A 2A1DB 2GGVB 1SGPE 2YOLA 4X8TH 1PPCE 1LKBA 1LVOA 1AWFH 2P3FH 1K28D 2VWMA 4K3JA 2QXGA 2ANWA 1WYKA 3E0PB 1FPHH 1D3TB 4CRDA 3CP7A 3M61U 4I8JA 5C5NA 2G55A 4WXVA 2ZC9H 2ZCKP 5GNDA 5HM9A 3QGNB 4AYYB 1D9IA 1HPGA 4ISHH 1YPLH 2QE7D 1O3OA 3CENA 5K7RA 1ELVA 1P05A 1MKWH 2RA3A 3S9CA 4ABGA 2O8WA 4XOJA 3P8NA 4D76A 1O3NA 2Z9KA 1LQEA 1DITH 2CMYA 4UFEH 2THFB 2VH0A 4O9VA 2HNTE 3TLOA 2UUJB 3UTUH 1WCZA 3Q3XA 2A5AA 2ZFTA 1LTOA 1E35B 1NO9H 2CN0H 5A09A 2J95A 1ESAA 2ZHQH 3U9AH 3VG8A 1CGIE 5EIYA 2A7JA 1HBTH 3E0NB 2AS9A 3STJA 1O3LA 2Y82A 3SQHE 4IN2A 3UNRA 4NZQA 1O2JA 3SNDA 1K1PA 5T1VA 1YPGH 4XBDA 1C2MA 1ELTA 3U8OH 4FUFA 2BOHB 4MG3A 2QN5T 3LT3A 1O2NA 1FZZA 2PP6A 3M7QA 2D26C 1BBRH 4ISOA 2R3UA 2LPRA 2FOCA 4OS5A 2A31A 5HXFA 2ZWLH 1GHAF 1SGFG 1P2NA 2V0BA 3FOAA 2GMTC 1XKBC 3B8JA 3QGJA 1MBMA 2ZQ1A 2BY5X 1W0KD 1DVAH 1V2JT 1GMDG 3SZNA 1BRCE 2ZTXA 2A4QA 1ZGIA 3A81A 3AK5A 3UPEA 1TOMH 3V0XA 2BDBA 1DUAA 2F4LA 2KAIA 3Q76A 2FO9A 1E34B 2FWWA 4K5ZA 5CHAC 1P8VC 3HGNA 2Z94A 4XRNA 4YOIA 1LHCH 4Z0KA 2VIDA 2BLVA 4BOHA 2WPIS 1LHFH 2PGBB 1BT7A 4UONA 2NU2E 3LU9B 2D8WA 1FXYA 2AMDA 2OXSA 4MPWA 3KQ5A 2FI4E 2ZPSA 3O8DA 2F43B 4KTCA 1Q3XA 2WYGA 4MQAA 3PRBA 4WH6A 1PQ8A 4NA8A 3SV8A 1YBWA 5LGOA 1HLTH 3KQCA 3KIDU 1CA0C 1SFIA 3H7OA 3LGYA 2JH6D 4ZHMU 5EGMA 2H1UA 2ZHWH 1O5BB 1GG6C 3PTBA 2JH0D 2Q6DA 3NWUA 3H5CB 3A7VA 4FUDA 2LELA 3IG6B 5ESBA 5CDFE 4AX9H 1TA2A 2C93B 1J16A 1N8OB 3GCNA 1BTPA 1K1IA 2W3KA 3OYPA 2TIOA 1C5SA 2FYRA 3FZZA 3SNCA 2GZ7A 1HDTH 1CHOF 1QB9A 1SVPA 1NPMA 1TGTA 3E90B 2BDAA 4YLQH 1TNIA 2FLBH 4WF8A 3EA8A 3GICB 5EQQA 1KYNA 2ZGBH 5DO4H 2VWLA 3RXQA 1AI8H 1ANCA 4I33A 4X6OA 2Z7FE 1Y3YA 1IQJA 1OOKB 2XWAA 2ZU1A 3LKWA 3WY8A 1MTSA 1ELBA 1WV7H 1HCGA 4HG6A 4OGXA 1QQ4A 3ZVEA 1T4VH 1O2XA 1NFXA 4MNWA 1Z71A 2SGAA 4ISLA 1GJ6A 3SN8A 1TE0A 4B6EA 5DK1A 2IPHA 3S69A 2R0KA 3PB1E 4MNYA 4ZHAA 1SQTA 3RMOH 3E1XB 2YNAA 4Q7YA 5B6OA 1RTFB 4IN1A 1P11E 1G3DA 3RXOA 2RFKC 2WUCA 8GCHG 9LPRA 2GJGA 1TMUH 3ZZ4A 4D9RA 1C4V2 1C5QA 2EY4C 3RXSA 2ALPA 4SGBE 1ZMJA 3AVZA 1MCTA 1P0SH 2V35A 1A3BH 1AVGH 1CT2E 8KME2 1BIOA 1HRTH 2AGGX 1HJAC 1AQ7A 3BG4B 2H9EH 1H8DH 4JZDH 1C2LA 1RD3B 3T28A 2WPMS 2A4GA 1A5GH 3DD2H 2ANMH 2VB0A 4Q7ZA 2V3MA 3RXGA 3TGJE 1UMAH 5EQSA 4ZKOU 3N7OA 3RLYH 4FUEA 1NRPH 2BDCA 1VCPA 1W14U 1GI5A 3T29A 1C5RA 3WW7A 2SGDE 2R3YA 1AE5A 2FTLE 3I29A 1KLTA 3RP2A 1MZDA 4YESB 3ZVBA 1SLWB 3N7EA 1NROH 1UVSH 1ANEA 2FOFA 3M3SA 4U30A 1C2GA 1C5TA 1AFQC 1VGCC 2P93A 3B9FH 1C4Y2 1W0JD 3RMMH 3TJVA 1PYTD 2OP9A 3UOPA 1NTPA 1H9HE 4H4FA 1DS2E 1HB0B 3RM2H 1TWXB 3TGIE 5SGAE 2Z6BD 3LJJA 1TQ7B 1C5YB 3D65E 3PM3A 4VGCB 3BTQE 5GPIB 1K9OE 1E36B 1GI9B 1TNGA 4MNXA 1K22H 1TRMA 2Y7XA 1AB9C 3MO9A 3QZRA 4CBNA 3ZV8A 1ZPZA 1HNEE 2XNIA 3T25A 1HIAB 3TK6A 4MDSA 3KF2A 3BTEE 1NFWA 2XC0A 4BAMB 4DCDA 2BDHA 1OWJA 1GJ7B 2J98A 4Y0YE 2TGTA 2PW8H 5EG4A 1C5WB 1NESE 1ZJKA 4UEHH 3RC5A 3MNXA 1ZTKA 4CBOA 1O33A 1BTWA 1S83A 1P2QA 1D6RA 2WPHS 1QNJA 1THRH 2FX6A 1COWD 3I77A 1WQVH 4ZROA 3ZZ9A 1O2RA 4SGAE 4UDWH 3JZ2B 4XSKU 2FS9A 1CO7E 5T6FA 4NA7A 2WHXA 4UFFH 1C2EA 1CU1A 1ELAA 1T4UH 5TCAA 2VBCA 1GBTA 4FOUC 4IC5A 1J9CH 1LDTT 1YYY1 3UR6A 2AGIX 2VH6A 4WXIA 3A82A 1T8OA 3F1SB 1QA7A 3A7WA 2ZCHP 1C5PA 7GCHF 2ZG0H 1HV7A 2HRVA 1KDQA 1Z8IB 5EPYA 5JBAS 1FIZA 3LIWA 1Y59T 1GMDF 1T8LA 1G3BA 1P09A 1K1JA 4ISNA 1GBFA 1QURH 2BTCE 1CQQA 2FOMB 3SGAE 3EE7A 2BZAA 3GDUA 1GG6B 2VGCC 1C9TA 1SMFE 3A8DA 2Z9LA 3PMHB 5DP7A 2Q6GA 5CHBA 1F7ZA 1IQNA 2GT8A 1TMTH 5EU8A 3RXTA 3U98H 3PMAB 1M9UA 1ETRH 1RXPA 1YCPK 5E0GA 3SUEA 5DPAA 3VXFH 4A1VA 3RMNH 5L2YH 5F03A 3RXPA 2GCTB 5EXNA 5A0BA 3M5NA 2BZ6H 3MQKC 1L1GA 1P01A 1G36A 1TNHA 2SGQE 3RM0H 1TGNA 3U1JB 4ZXYH 3MU8A 1FY5A 3SU3A 1FMGA 2BD4A 1UK2A 2FI3E 1FJSA 1GBIA 1KIGH 2A5IA 1NY22 5LPFA 5GCHG 4ISIH 5F53A 3A7XA 4CR5A 1AO5A 1P57B 1YPHE 2XBWA 2XOKD 2A5KA 5HIZA 4A1XA 1MTNB 3U69H 3SU2A 1P04A 4B75A 5C1YA 4Y8ZA 1O5FH 3PYHA 1J17T 1MTVA 3F9EA 3T27A 2OC1A 4GSOA 3HGPA 1LO6A 2ZPQA 5JBBS 3GCTG 4TPIZ 5GDSH 5F6MA 4IGDA 1O36A 3EE0B 3BTHE 4K60A 4YT7H 1RFNA 1YPMH 2OCVB 1EZXC 1G3CA 3H7TA 1EP6A 1W12U 1GGDB 1H8ED 3V7TA 3P8GA 1IQEA 1U6QA 5IDKA 4X6MA 4IBLH 2WPDD 2BXUH 3GISB 1P2JA 2ODQA 1C1UH 1AZ8A 4WJG2 1FY4A 2PHBA 2QXIA 2A7HA 2P95A 3GY5A 1FNIA 4I8LA 3MU5A 4ZH8A 9ESTA 4YT6H 1QB1A 3QUMP 1MBQA 3M37A 2G51A 2Z9IA 2A7CA 1KTTB 1AGJA 4TWYA 3UNQA 1HJAB 3UIRA 4Q63A 1A61H 1UTNA 2NWNA 1B0EA 2RCEA 3FKSD 8GCHF 2EI6A 2CF8H 4KP0A 2J9NA 3LH1A 1O2UA 1A0LA 1EZUC 1SHHB 1TALA 3E3TA 4X1PU 4MTBA 5DG6A 3BTME 2SNVA 1KXAA 3FP7E 2HLCA 4KTSA 3UAIC 2HALA 4MPUA 1O2SA 2JIZD 1IQKA 1DT2A 1MD8A 1GCDA 3NK8A 1OX1A 1EB2A 1C9PA 3RXDA 1A4WH 1DY8A 2QXHA 2OQ5A 1KXFA 1GCTB 1HYLA 4Y79A 2VNTA 1W8BH 1AUJA 1ARBA 1B0FA 3CNRA 1YKTA 1C5OH 1NRRH 1FN6A 3ZZ7A 3UWIA 4KKDA 2KZ4A 1C1RA 1SKYE 2XTTB 4A5TS 3HKIB 3ZV9A 4K8BA 6CHAC 4JK6A 2YMSB 4XE4A 4ESTE 1HUTH 1C5XB 1S82A 1A2CH 1TBRH 2VIVA 1Z8RA 3P92A 3RXFA 4WWYA 3SOSA 1C5VA 5A8XA 2TRMA 4BXWA 1FONA 2QYIA 1UCYK 8LPRA 2IN2A 1A3EH 1KMHB 1QBNA 5EOKA 1S6LA 4GPGA 4NG9H 1Y3UA 2EI7A 4Q4LA 4AB8A 1CBWC 2HPPH 1GWAA 2NU0E 1DLEA 4I8KA 4NWKA 1X7AC 3MO3A 1SFQB 4K69A 1AKSB 4TT3D 2KCPA 2BD8A 3A80A 1WTHD 3R0FA 1DDJA 1DXWA 3GCHB 2ZU5A 1OWKA 4FVBA 4X8SH 3P17H 1EJNA 3H09A 1PPFE 1IQLA 1G37A 2FOGA 1J14A 3A7TA 2H5CA 2OBOA 1MABB 5C0TA 4ABBA 3KYFA 4Y8YA 2IJOB 5KEDA 3RXMA 4ZAEA 2ILNA 3VB7A 2A32A 1YCPH 2BX3A 1ANBA 3AAVA 3LGWA 4X2YA 1EX3A 3PO1C 5KECA 3BIVH 4DG4A 5DGJA 1GDQA 1XM1A 3N7DA 2QXJA 1SGRE 2FXRA 1H9LB 1TAWA 2J97A 3GYLB 1EPTB 1C5LH 5DJ7A 3M5MA 4ABFA 3DFJA 1NRQH 1V2TT 2Y5HA 6ESTA 3TH2H 2A45B 2AGEX 2ASUB 2ZA5A 2JKHA 1GI8B 1O3CA 1S6HA 1UVUH 2P59A 2C8XB 3QK1A 4DIIH 5ABWA 1OYTH 1K1NA 3RU4E 4AYVB 4B71A 2VGCB 2EEKA 1TQ0B 5L2ZH 1O3JA 1MZAA 1T32A 4ABJA 5AF9H 2OC7A 3DA9B 2QC2A 4BAHB 1V2MT 1PJPA 2Z9JA 3SU1A 3KNXA 3TJUA 2ZFFH 4AG2A 1DSUA 2P8OC 1EB1H 3PLPA 3RXLA 1D4PB 1DX5M 3BTGE 3MH7A 2ZTZA 4DT4A 1Q2WA 4I8HA 2BOKA 3UR9A 1GMHG 3P70B 1VCWA 3F9GA 5GWZA 4HZHA 4FETA 2WPJS 1QA0A 2ZPRA 3A87A 1TPAE 1TPOA 3F9FA 3SJ9A 4XFQA 2GT7A 4Y11E 1SGEE 2HNTC 3A84A 2VVVA 5ETXA 1N6YA 4B2BA 1ABJH 1DANH 1O3EA 2O9QA 1L0ZA 3F2GA 4Z6AH 3AW0A 4WMFA 1GL0E 2BDIA 5FXLA 5GCHF 1TNKA 4AGKA 4NGAH 1O30A 5EJ1A 1Z1JA 2XBXA 2BVXH 2VINA 3V12A 3BTDE 1SL3A 1OWDA 2C90B 2O8MA 2WPKS 2Z3EA 2JETC 2OINA 4CHAB 1D3PB 1GI4A 2QF4A 3UY9A 1XVMA 1SLUB 1H4WA 1OSSA 1ZJDA 2XWBI 1C1VH 1NT1A 3SYJA 2FOAA 3GCTF 1CVWH 1XX9A 1UK3A 4P00A 4I32A 1GHXH 4HFPB 3E91A 4WY3A 1HGTH 2B5TB 4CH2B 4X6PA 1O2GH 1QRXA 2TGPZ 4CRAA 2JJ2D 1O3HA 3VB6A 3MFJA 1ARCA 1C2IA 1QTFA 1AVXA 3PV2A 5GJ4B 1S0QA 2ZDVH 2F83A 2W5EA 3BEFB 5FBIA 4UD9H 3URCA 5A8YA 3W1EA 4YM9A 4JZ1A 5FPTA 2WZQA 3MNBA 5TJXA 4IC6A 1QJ6B 2KCYA 3A7YA 2ZU4A 3FFGA 1W2KH 1W11U 3SHCH 5JPMH 3GS9A 1OWEA 2ZDAH 3M35A 3SU6A 2FZZA 1P10A 5ESTE 6GCHG 4Y10E 3GCOA 2HWLB 2IOTA 1P9SA 3V3MA 1MMJN 5F8TA 2ESTE 1VCQA 1GJ9B 1XUKA 1HXEH 2PSXA 1GBLA 2BMGB 1V2LT 1O37A 1FY1A 1VITH 2C4FH 2BDYA 2RA0A 5F8ZA 1UTQA 5A0AE 1NU9A 3R3GB 3KQEA 4OGYA 1GJ4H 1UCYE 3Q00A 2FLRH 1QY6A 2WPLS 1BRBE 2ZDLA 1QQUA 2FEQH 5B6LA 2ZI2H 3TH4H 1O5GH 1F0TA 3SJ8A 4RSPA 1WTGH 4JCNA 5AHGH 3ZVFA 2IPQX 2OD3B 3GY7A 1IQHA 3S7KB 1O3BA 2J5UA 2CJIA 1O5DH 5FX6A 3VGCB 2XNDD 4O3TA 3VFEA 4THNH 3JZ1B 1MTWA 2BD5A 1KSNA 3M36A 1ZYOA 2SFAA 1YLDA 4BAOB 3HK6B 5FHTA 3HKJB 1IQIA 4I7YH 1AFEH 2TPIZ 3U1IB 3BTTE 3SI4H 5J4SA 2NU1E 2ZECA 5FCRA 1THSH 2V3OH 2QF0A 2GD4B 4MVNA 1W3CA 1GJ8B 1NC6A 1Y5AT 1C1TA 1GHVH 1VZQH 1S81A 2D2DA 2JDID 3PMJA 2GTBA 2JH5D 1XUHA 2J92A 3F9HA 2BXTH 1MUEB 3OFND 4CRFA 3SUFA 4K1TA 5LPEA 2ZKSA 3MH4A 3OEHD 3VPKA 3G01A 2WV9A 1Y3WA 2UWOA 3BEIB 1AY6H 2FDAA 3T26A 3QX5H 2VIWA 4RKJB 1WSSH 3C27B 1SGNE 1UTLM 2KFWA 1WUNH 1GI3A 3PLKA 1D3DB 2F9VA 1HAHH 4ASUD 5HYOA 2UWLA 3NCLA 3NXPA 5E0JA 5I25A 2J2UA 2SGFE 1O31A 2YMSD 2Y6TA 4FXGH 3ZZCA 1TFXA 1V3XA 4BAQB 1JWTA 4E06H 3A89A 1WAYB 4CRGA 1ZSLA 3F68H 2G81E 1DE7H 1ZZZA 1LKAA 3OEED 2FPZA 1FAKH 1G9IE 1FY3A 3S0NA 1OP8A 1DY9A 4FU8A 2BB4A 3FVFB 4K1EA 1GMHF 1ACBE 1V2KT 3F3BA 1Z6EA 3GOVB 1LMWB 4R0IA 2HLDD 3LOXA 2B8OH 1KLJH 2FI5E 4U32A 5L6NH 1WU1A 5FPSA 4D7GA 3S9AA 2K8IA 1UW7A 3PTNA 3M7TA 2VVUA 4WMDA 3IWMA 3OSYA 5H4IB 1SGCA 3K9XB 1L1NA 1VKYA
chains in the Genus database with same CATH topology
1A0JA 4WVPE 1BITA 3O8RA 3OU0A 3V13A 4BTUB 1EP5A 4NIVA 3TNSA 4CRCA 1GJBB 2QGRA 5FAHA 1G32B 1ZTLA 1BTYA 1YPEH 2A4RA 4JZEH 2PR3A 5EQRA 5JBTA 1O3IA 2Z9GA 3FZDA 1HAVB 3LPRA 4BANB 1TX7A 2STBE 1SPJA 4B73A 1Y3VA 1PPHE 1RIWC 3ZZ3A 1P2KA 2STAE 3MNCA 1PQ7A 2AIPA 1GBCA 2GMTB 4GHQA 1K21H 3MH6A 5J4QA 1PYTC 2BLWA 2ZHDA 1JRSA 3SUDA 1A5HA 1UO6A 2FYQA 1O5AB 2GZ9A 3FP6E 4UE7H 1ANDA 1F5KU 2R9PA 1ELFA 1OXGA 1MAXA 2WV5A 3FANA 4F4OC 5A0CA 5CHAB 4D9QA 2OLGA 4K1SA 2O8UA 2CHAC 3SGBE 2O8LA 4IS5A 4LK4A 4NZLA 1L1JA 2H2ZA 1FIWA 2EI8A 3PLBA 4CRBA 1C2FA 1W7GH 3D49H 4GCHG 2VIPA 1GHWH 1ZRBA 1JXPA 5LPRA 2Y5FA 1MH0A 1J15A 2XCNA 3D23A 2RDLA 2GZ8A 1PPEE 2PKAB 4BAKB 1EAXA 1CA0B 1S85A 1JOUB 5FBEA 5PTPA 2FS8A 4X1RU 4YOJA 3MI4A 1P2MA 2TBSA 1LHDH 1PPZA 2AYWA 4HTCH 1QFKH 1BOQA 3MU0A 2VVCA 1TLDA 3NPSA 1GBBA 2A2QH 3NUMA 5C1UA 1SLVB 3A88A 1SOZA 6GCHF 4X6NA 1GBEA 1HIAA 2OUAA 1BMMH 1OWIA 1EZQA 5BPEA 2PLXA 2SGPE 1TGCA 4Y76A 1NS3A 3SHAH 3SQEE 3TITA 5F8XA 5EW1H 4NIXA 2BD7A 2QA9E 4FU7A 2XYAA 3VXEH 4NFEA 2ZFSA 1HFDA 3SJKA 1O3MA 4YZUA 3RU4T 1ELGA 2C3SA 3M5OA 2FIRH 1DFPA 1TBZH 2K1QA 1A0HB 2HNTF 2Y80A 3ITIA 4NFFA 3RUOA 3I78A 1O3PB 3KQDA 2WV4A 2F9BH 4JYVH 2XC5A 5A8ZA 2ZDNA 1DOJA 1XUGA 2BDGA 4PROA 3VB5A 3O8CA 1EOLA 3RXIA 1BRAA 1QL9A 2PKSC 4WMEA 1E38B 3GDVA 4JMYA 1OP2A 3RMLH 1ZLRA 1H1BA 4A6LA 3OY6U 4HGCA 1S5SA 4J1YA 1P3EA 2R2MB 5FCKA 3ATWA 1V2VT 2B7DH 1SQAA 1QHRB 2UUKB 1TBQH 4BTIB 3S7HB 2ZDKA 3MNSA 2C8WB 4INLA 2Z3CA 1E0FD 1FI8A 1Y8TA 1XMNB 3ZZAA 1UHBB 4FUCA 1BTXA 3GYMA 3K65B 2BHGA 3LC5A 3MYWA 3UQVA 3M3VA 2ZU2A 1ZTJA 1BJVA 3URDA 2HVXA 4H42U 4NIYA 2GP9B 3K2UA 1G3EA 4B74A 4AB9A 4F49A 1DWBH 2V6NA 1ZGVA 2H6MA 7KMEH 1PFXC 1LPKB 1Y5UT 1KTSB 1IQGA 3HPTB 3TJNA 1H9IE 1UVTH 2QAAA 4DW2U 4O3UA 1GJDB 2PUXB 4FUGA 2M5TA 3HATH 3MU4A 1W10U 1V2OT 2HOBA 1SSXA 1VGCB 1AFQB 1QIXB 3ATIA 1O3KA 1BRUP 3RLWH 3TU7H 4ZXXH 1ESBA 2F9UA 3ZYEA 3PWBA 4AFQA 2F9NA 2PUQH 5EW2H 2R2WU 4NCYA 3ATKA 2PSYA 4Y8XA 1GBHA 2VU8E 1UTKA 1RRKA 3UNSA 4JK5A 3CS7A 2XW9A 3SV7A 2ZP0H 1O3DA 3PV4A 2ZFRH 1BMNH 1EAUA 1AB9B 3EGKH 4FUBA 4FUIA 1AWHB 1YPJH 1TIOA 2BD2A 2VIQA 2AERH 1D3QB 5HM2A 2DE8A 1TGBA 2WYJA 1EJMA 2SNWA 4R8TB 4TY6A 4X1QU 3E8LA 4INHA 2G52A 3MWIU 3OX7U 1AUTC 1Z1IA 3NZIA 3RU4D 1AVWA 1FQ3A 3M5LA 4ABAA 1NN6A 3ZZ8A 4MNVA 4BTTB 2ZTYA 2NU3E 3ZZ6A 3M3TA 1KXBA 1UTOA 1HAZB 2ZIQH 3BEUA 1N8OC 1O2TA 1T8MA 1TRYA 2ZGCA 1NRNH 1P2IA 2OC0A 1EUFA 2ZHEH 6LPRA 4LZ4B 3Q3KA 1QR3E 1DWCH 1QL8A 3EA9A 4H6TA 1C2HA 3O8BA 1XXFA 4X1NU 1T31A 1K1MA 1O2HA 4WH8A 5I46H 2AFQB 4ABDA 5AVDA 1W0YH 1V6DA 1GMCG 2B9LA 2HGTH 4CH8B 2QIQA 4ABIA 2FOEA 3SGQE 4KTUA 2I6QA 1HAYB 1OP0A 3MHWU 3VEQB 1XKAC 1O2ZA 1O2OA 1JRTA 3RXEA 4ZMAH 3QTOH 1QRWA 1UK4A 5C67A 4I8GA 4X8UH 1GL1A 5DP5A 5C1XA 1IAUA 3SU4A 1GHBG 3LJOA 5G4BA 3L33A 1A46H 4DY7B 2OTVA 3BIUH 1ZSJA 1UTMA 1XUIA 4DGJA 1ORFA 2UWPA 1TA6A 1XVOA 3A7ZA 2ZEBA 1ETSH 3LGIA 1F0RA 5FPYA 1O2LA 3E6PH 4MPXA 1YM0A 3RXKA 4GCHF 4AN7A 2CF9H 2QCYA 3A85A 4E7RG 3GDSA 3KL6A 4NWLA 1F2SE 2BY6X 4Y6DA 2G4TA 3A8AA 1ZHMA 3MMGA 2YNBA 1O2YA 2BLOA 1AKSA 1O32A 5E2OA 5K0HA 1JIMA 4H6SB 3BG4C 4B2CA 2ZNKH 4YO9A 3QLPH 4XDEA 2A2XH 1V2WT 2RG3A 4B2AA 3BV9B 5TCCA 1N1LA 4IW4E 1KXDA 4Y7BA 1NZQH 2GV7A 1GI7B 3ENSB 1KXEA 2WINI 1O2IA 4B1TA 1BUIA 1TNLA 1TNJA 5AFZH 2KAIB 1SGQE 3LC3A 4INKA 1QBOA 1OPHB 1AE8H 2H9HA 3RXAA 1W13U 3MH5A 3ZVGA 5DP6A 1FPCH 1MU8B 1Z6JH 1SC8U 1OKXA 1EPTA 2V3HH 7ESTE 1SG8B 1GBAA 1YLCA 2PKSB 2W3IA 2BVRH 5EODA 2GX4A 2ODPA 4IMZA 3D62A 4AORA 1Q31A 5AFYH 3RC4A 1V2QT 3EA7A 4IMQA 5EPNA 1QL7A 1DM4B 3E16B 1CT4E 1UTJA 1GHZA 4U01A 4KGAA 3ELAH 1PPBH 1MD7A 2ZO3H 4VGCC 1C1PA 4ZUHA 4MPVA 1TPPA 4AFZA 4CR9A 2G00A 1GBJA 5LH8A 1GBMA 1TPSA 3ZVDA 2OQUA 2P94A 2P3TB 4Y0ZE 1RGQA 3TVJB 3GY6A 1EAIA 3SI3H 2ZCLP 2CV3A 1TX8A 1O3AA 2FODA 3QDZB 2BQWB 1O34A 3U8RH 2OC8A 1O39A 1TRNA 5JB8S 1G2LA 1YP9A 4UFGH 1SGTA 3B23B 5C2ZA 4JYUH 3EDXB 1QRZA 2J94A 1UVPA 1MU6B 1B7XB 1UCYH 1ZR0A 5GXPA 3GY8A 5GIBA 1ZMNA 4NIWA 5FX5A 4A1TA 7GCHG 1L4ZA 1SGDE 1J8AA 1TX6A 1O38A 5E0HA 3T2NA 3TIUA 1C2JA 3KCGH 1JIRA 4XBBA 1WQSA 1ZHRA 1ELEE 1KLIH 1LVBA 2J34A 1SHYA 2F9PA 6CHAB 1CE5A 2AMQA 3LGTA 4YOGA 1IQFA 1BJUA 2BY9X 2ZZUH 3VB4A 2G5VA 2OBQA 1BBRE 2F3CE 4HI3A 1O2QA 1HXFH 1O0DH 4D7FA 1P2OA 3SV9A 5CE1A 1O2MA 3PROA 4X8VH 1C1OA 3TPIZ 5EXLA 1GDUA 3U8TH 4X0WU 1ESTA 4OS2A 4GAWA 1CBWB 1A5IA 3T62A 5EXMA 3SNEA 1JMOH 4X2VA 3RC6A 1GI6A 5E8EH 1EOJA 1GBDA 1LVYA 1HAXB 2HPQH 1FLEE 1EAWA 3Q77A 3SORA 3TGKE 2GCTC 3ZZDA 1HAPH 2UUYA 1UVOA 1BMAA 4AZ2B 1IHSH 1ZSKA 1DWEH 1LHEH 4JZFH 1LHGH 4Q2KA 4FVDA 1AZZA 4TWWA 1F0UA 1CGHA 3BTKE 1MCVA 3PO1B 1ABIH 2FX4A 4X2WA 1SGYE 3IITA 1MTNC 3ZVAA 1BMLA 4DJZB 1BZXE 4LOYH 3QN7A 2VWOA 1THPB 4A92A 2ANKH 1ETTH 3RXHA 4NSVA 1LPGB 5DP4A 2AEIH 1GJCB 1P12E 2UUFB 4AOQA 1GMCF 3P8FA 7LPRA 5E2PA 3ZVCA 1RJXB 3LGVA 1XUJA 1GGDC 4FUHA 3AASA 1ZMLA 2PV9B 4UFDH 5DP9A 1FN8A 1O5EH 2QV1A 3KHVA 2P8OB 2ZQ2A 1C2DA 4OS4A 5JBCS 2PWXA 4NSYA 4Q80A 1GDNA 1GHBF 1P06A 1NU7B 3BG8A 1W7XH 1B5GH 3AW1A 1O2PA 1K1LA 3F6UH 3L3TA 1HAGE 1GHYH 4YTAA 2ZF0H 2Y81A 1OYQA 1VJ9U 3ATMA 1NRSH 2XBVA 1LVMA 5C20A 1MKXK 3EAJA 1K2I1 3SO3A 2A4OA 1DUEA 3ATLA 3UREA 2FOHA 2ZDMA 1GI2A 4ASHA 2D1JA 1SGFA 3BTWE 3TK9A 2VWNA 2P3UB 1LPZB 2GCHG 2Q1JA 2FESH 2NU4E 1CSOE 4DT7B 2PTCE 4E7NA 4CREA 2GV6A 4DIHH 5DKMA 1GCTC 1GVKB 1BTZA 1C5MD 2BQ7B 1GVLA 2R0LA 3DFLA 2JETB 1KDQB 2XBYA 3KGPA 1EATA 1MTUA 1VITG 3VB3A 4TYDA 3RXCA 1MAYA 3K6YA 4DOQA 1GVZA 2CGAA 1GBKA 1F5LA 5IYTA 1GJ5H 2GDDA 1T8NA 4ZKSU 3DHKH 3ODDA 2BQ6B 2SGEE 3UQOA 1F5RA 2DE9A 3BSQA 3W94A 4J2YB 1EQ9A 1P03A 1YF4A 4XBCA 1UJ1A 1S84A 1Z8JB 2FM2A 2XC4A 4AG1A 2VJ1A 1VJAU 1V2PT 5C5OA 1L4DA 3HK3B 1MQ6A 3LGUA 4B76A 1CA8B 4JZIA 4FU9A 2F91A 1L2EA 3ZZ5A 1FAXA 5CMXH 1EXFA 2FP7B 3FAOA 3QZQA 1O2WA 1EZSC 3PWCA 2BM2A 3KN2A 1DXPA 4X2XA 2J4IA 1GPZA 1V2NT 4GLYA 4NA9H 1PQAA 1T7CA 1RS0A 1FV9A 3GCHC 2ODYB 3GY2A 4Y7AA 2QY0B 3SV6A 1IHTH 1RTLA 1C5NH 1P02A 1SLXB 3A8BA 3DUXH 2AH4X 3RXRA 4M7GA 4K8YA 3ZYDA 8ESTE 3LDXH 2ALVA 2GKVE 1YCPM 3P8OA 2O8TA 1SGIB 1NFYA 2ZFQH 3MTYA 1LQDB 1V2UT 2XRCA 1DPOA 4A7IB 1EPTC 2AMPA 4ZHLU 1A7SA 2Y5GA 1AU8A 1DSTA 1QCPA 2XCFA 2XXLA 4OS1A 4KELA 4AGJA 2G5NA 1YPHC 1KXCA 1SB1H 3MOCA 4D8NA 1HAVA 1C4U2 1PQ5A 2ANYA 1SI5H 2BD9A 1ZHPA 1Y3XA 1ELDE 2EA3A 3A8CA 1HAIH 5C3NA 3BN9A 1OS8A 2BLQA 2ZGJA 1TONA 5HMAA 2ZU3A 4ABEA 3STIA 2C8YB 3SW2B 3EQ0H 3M7UA 4OS6A 1DWDH 3OTJE 5JB9S 2EC9H 5DP8A 2AIQA 3AAUA 3UFAA 4RN6A 4GUXA 1BHXB 1C1WH 3A86A 1K1OA 1EKBB 1NM6A 1Z7KA 2PGQB 1FUJA 1YPKH 1S6FA 1C1QA 1DICA 3K6ZA 1E37B 3GY3A 2Q6FA 3UOUA 1WBGB 5T3HA 4LXBH 2TGDA 2PKAA 5HGGA 2GDEH 1ELCA 1TMBH 1C1NA 2FTMA 3UWJH 3TK5A 1TOCB 3NKKA 2BY7X 3W95A 4AFSA 1MKXH 2G4UA 5T6GA 1AN1E 3DT0H 1WOFA 2VIOA 1GHAG 1O2VA 4QT8C 1OWHA 1P3CA 2G8TA 1QBVH 1AD8H 1Z8GA 1O35A 4O03A 3RXUA 2W26A 1RTKA 2ZFPH 4CHAC 1AHTH 1O3FA 3MO6A 1P9UA 4ZKRU 1MKWK 3SNBA 2Y7ZA 3ZZBA 2BD3A 1D6WA 3BF6H 4O97A 3CS0A 1BB0B 2C8ZB 3MU1A 3SBKA 5BRRE 4U2WA 4YLUA 2W7SA 1BCUH 1FDPA 2J38A 4GHTA 1SBWA 1AIXH 1N6XA 1SR5C 4DURA 2TGAA 3PMBB 1INCA 3QWCH 1C1SA 2ULLA 3TNTA 3T5FH 3TH3H 1HJ9A 1MQ5A 1BQYA 5JDUB 1IQMA 3GY4A 4Y71A 4BNRA 2F9OA 1KY9A 4LZ1H 3BTFE 1XXDA 2WUBA 3L6PA 2P16A 4MLFB 2FMJA 1QGFA 3QO6A 1C5UA 2PFEA 1BBRK 3SNAA 4BXSA 1LCYA 3KEEA 2PTNA 1C2KA 4FUJA 3ODFA 1C5ZB 1DLKB 1ID5H 1EJAA 1SQOA 1CHOG 1UTPA 4AFUA 3RDZA 2BY8X 1JBUH 2A0QB 1G2MA 5L30H 1YC0A 3TJOA 2GCHF 3RXJA 1A1RA 1O5CB 1BA8B 1V2ST 1RIWB 1NFUA 1GI1A 1SOTA 2CXVA 2H9TH 3SV2H 1PPGE 1QB6A 1UHBA 2W7UA 1H8IH 4RKOB 1YGCH 2QF3A 2DUCA 1G30B 3SUGA 5JYIA 1VITF 2BVSH 4ZKNU 2GVFA 1TABE 1VR1H 2ZGHA 3S9BA 5T6DA 4K2YA 2ZHFH 4Q7XA 3A83A 3UUZA 2BYAX 1Y5BT 4X1SU 1CHGA 1QJ7B 2CHAB 1F0SA 1O3GA 1HJ8A 1HAOH 1ZPCA 1O2KA 1GI0A 3SJOA 1TYNA 4E05H 1BDAA 1BHXF 1BTHH 3FP8E 3QTVH 3P6ZB 1CGJE 4ABHA 1IOEA 3P95A 1FY8E 4I31A 3VGCC 3SJIA 2ZGXH 2FOBA 3EYDA 2B0FA 1TB6H 1EASA 3OY5U 3Q3YA 1QJ1B 5A2MH 1CT0E 1ZRKA 1ZPBA 1C1MA 3KQBA 3SU0A 2Z3DA 1XUFA 4TY7A 3LH3A 4DVAU 4OS7A 2I6SA 3ESTA 1TGSZ 4JYTA 2BX4A 3RXVA 1AMHA 1BTUA 5DP3A