1V2LT

Benzamidine in complex with bovine trypsin variant x(triple.glu)bt.d1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2lT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2lT02
1P03A 3GCHB 1P9SA 2J95A 7LPRA 1W8BH 1QBVH 2XBXA 4LXBH 1L0ZA 1U6QA 2JH5D 2ZNKH 2FWWA 4Y0YE 2ZU1A 3BEIB 1CVWH 1PPHE 1H8IH 1THPB 1A61H 4X8SH 3O8CA 2SGAA 1VJAU 2PTNA 3CENA 3SORA 2FTLE 2O8TA 2VWNA 3A7VA 3E90B 1EZUC 1ORFA 4FUDA 3E6PH 1PYTD 3ZZ6A 1AUTC 2TGDA 3PTBA 4D9QA 3PLBA 2B5TB 4CRGA 2Y81A 1C2LA 3SUDA 4Y11E 4IC6A 2IN2A 3GYMA 1G30B 3QDZB 1Y3WA 1HJAC 2FYQA 3RXRA 4BAOB 3VXEH 4F4OC 4XE4A 1K1NA 1IQIA 1DUEA 1O2XA 4BNRA 1DWDH 1GCTB 2PUQH 1V2PT 3NPSA 4Z0KA 5GWZA 1ELCA 1UCYK 2H1UA 1ZGIA 3NUMA 8KME2 5EG4A 4VGCC 1SMFE 1O5DH 4O97A 1CGHA 3TIUA 2GX4A 5JYIA 3LH3A 3F9GA 2ZTXA 3ZVCA 3BTWE 1QBOA 2AEIH 1KTTB 4AGJA 1VITG 2SGEE 5EQRA 3SV6A 3MO3A 1GGDC 3PTNA 1IHSH 1N8OB 2ZFSA 1LQEA 4FUFA 1AVGH 3LC3A 4RN6A 1GI4A 4NFEA 1WOFA 2NU4E 1PQAA 1E37B 1LVBA 3TH3H 1GBFA 3PO1B 1EAIA 4FUBA 2HRVA 1CGIE 1GBEA 2ANKH 3GDVA 1AKSA 3RM2H 2A7CA 1LMWB 3OY5U 1XUFA 5ETXA 2ZGHA 3GCTF 1TGSZ 2FOEA 1PQ7A 2BXTH 3I78A 3H5CB 4YOIA 2IOTA 1ZZZA 2QV1A 2BLVA 5FAHA 2ODYB 1BTWA 1AHTH 2OQUA 2CHAC 1J9CH 3AVZA 1TMBH 3TNTA 3ODDA 1GBLA 4HFPB 2A5KA 1O2UA 2BX4A 1XM1A 2AH4X 2GD4B 3B8JA 1C5YB 3HKIB 3KCGH 3LJJA 4O3UA 1MD7A 4NSVA 3SU6A 4U30A 1K22H 4M7GA 4IBLH 2GV6A 2CJIA 2OBQA 5F03A 2ZDLA 1XXFA 4ISIH 4BXSA 4X2VA 1GMHG 1O2SA 1ZHRA 1Z71A 1ZSJA 3BTFE 1P12E 1NC6A 6GCHF 1MUEB 2XCNA 2EEKA 5DP3A 1HAVA 3A8DA 2A7JA 1BMMH 1O3AA 1QRZA 2FLRH 1FY5A 1M9UA 3SO3A 4K3JA 4JK6A 1LVOA 3AW1A 2NU2E 3A86A 5EPNA 5AF9H 1P3CA 1QRXA 1GVZA 1VZQH 1BCUH 3SW2B 3RXTA 2VIWA 1T4VH 2VH6A 3SI4H 5DO4H 1Y3YA 2ZU2A 4KTUA 1HPGA 3GCOA 1MCVA 1C1NA 1NFYA 1PPBH 3HKJB 4AZ2B 2A1DB 3MI4A 1YLDA 3SJOA 5HXFA 1MZAA 3TJNA 1NU7B 2HOBA 4CRAA 3TJUA 1OWIA 4ZKOU 4ZMAH 4DGJA 2ZDMA 1GBTA 3GISB 4CR5A 4MDSA 3LKWA 1LHDH 2VINA 5FPYA 5E2OA 2Q6DA 1IQKA 3ATLA 1CHOG 4MQAA 2PKAB 4AX9H 2FOFA 1KY9A 4NIWA 4BAMB 1QY6A 3N7OA 1SGFA 1DPOA 1GBIA 2PV9B 2G5NA 4WVPE 1CSOE 1C5WB 3EAJA 2P59A 1EB1H 1MU8B 4TWYA 8ESTE 1GPZA 1O3PB 1ANDA 1NTPA 4FU9A 4UFGH 1SLXB 1MBMA 2QC2A 1NRNH 1SHHB 3ZZAA 1OKXA 4A92A 2QF0A 2XNIA 5DP4A 3LT3A 4BAKB 1GCDA 1ZSLA 1GBHA 3UOPA 1OPHB 2STBE 1TB6H 2Z3EA 1XUJA 4D76A 4CHAC 2FPZA 3MOCA 2C93B 1O37A 3C27B 4TY7A 5DP7A 3UOUA 2CN0H 3OX7U 3RXOA 3RXVA 3VEQB 3VGCB 3A8CA 4RKJB 4IN1A 2TRMA 4B71A 2ZGCA 5JBCS 1V2TT 1GMDF 4X1PU 1HAPH 1PPEE 4R8TB 1XMNB 1SGYE 1TMUH 5K0HA 3PYHA 4HGCA 2Y5GA 2CF8H 4GVUA 4CRDA 1X7AC 1Y59T 2Z94A 4K60A 4IMZA 1SOZA 4ABDA 2GTBA 4Q7XA 3BTEE 3QTOH 1YPMH 2G00A 1OWJA 2VVCA 3KF2A 3UQOA 1YPHE 1LDTT 4UEHH 3LJOA 4I31A 2H6MA 3AAUA 3A85A 1H8DH 3JZ2B 4ISHH 1YYY1 3TLOA 1D4PB 3GY2A 4U32A 3EA8A 1GJCB 2H2ZA 1P2NA 1TA6A 3NWUA 1C5SA 1C5MD 5F6MA 3I29A 4K5ZA 1HAYB 1BITA 1QL7A 2BVSH 4XBDA 1Y5UT 1HAGE 1C2HA 1AO5A 3NKKA 1GI8B 1FIZA 1DXPA 3F9FA 3KQEA 4CRBA 2PW8H 1BTYA 1A0HB 2P8OB 4OGXA 1NFXA 1C9TA 3MU1A 4AFQA 2CXVA 1C5TA 7ESTE 1MQ5A 4MG3A 4D7FA 3GY3A 2JETC 2ZA5A 1TGTA 1HXFH 1D3PB 2PLXA 3IWMA 2FI5E 4MNYA 2FEQH 5A0CA 1TBZH 2R0LA 4X6OA 5GCHF 1FQ3A 5FPSA 3FFGA 2G4TA 4ASHA 2JH6D 3FP6E 1ZOMA 8GCHF 1AB9C 3A89A 1SR5C 2EI7A 2HPPH 3RXDA 5DKMA 2BMGB 1KLTA 1F92A 2A4QA 3SJKA 2J34A 1TNJA 4Y76A 4DURA 2ZKSA 3BTTE 4HI3A 1H1BA 1EAXA 2AYWA 1O38A 1UTKA 4WJG2 1KXEA 1ZMJA 2CGAA 2ZI2H 3UFAA 1ZPZA 4ISNA 4NZLA 3RXBA 1SGDE 2W5EA 1F0RA 5F8TA 1B0EA 4FVBA 1EJNA 1QL8A 9ESTA 1TX8A 4H6TA 1YBWA 2V35A 7GCHF 1GI1A 3U1JB 1A2CH 1EP5A 1P2MA 4CBNA 2ESTE 1DLEA 4A7IB 4KTCA 1KLIH 1AQ7A 3RXIA 2Y6TA 1LPKB 3TK6A 4BTUB 1QQ4A 1DWCH 1MTNB 5DP5A 3U8TH 1CU1A 2ANWA 3BN9A 1KXBA 4YZUA 1B5GH 1K1IA 1O3OA 4HZHA 1V3XA 2XWBI 5DJ7A 3RDZA 2VGCC 2O8MA 1RTKA 1D6RA 4A1VA 1GJ8B 4CREA 3E8LA 1V2QT 4LK4A 4DW2U 3M7QA 4BXWA 1GVKB 3LGTA 3SU3A 2Z9JA 1IQHA 2ZQ2A 2BDAA 2Q6FA 3RLWH 5DP9A 4ABIA 1Z1JA 1Y8TA 1ZRKA 2LPRA 2NU3E 1IAUA 1TQ7B 1WCZA 2VIDA 1LHFH 5C2ZA 1MD8A 1BT7A 2QGRA 4A1XA 4X0WU 3P95A 3RMOH 1KTSB 1THRH 1ELDE 2BLWA 4XDEA 3TJOA 1L1NA 3T28A 1GBCA 4ZROA 1PPGE 1ABJH 5E0JA 1HIAB 3Q77A 1C1VH 1WQVH 1QHRB 1LKBA 1P02A 4Y6DA 1TPOA 3TGIE 1UTJA 1N6XA 1O2WA 1FAKH 1ID5H 2R0KA 1DFPA 2OC1A 5GXPA 3FZDA 2C8XB 4I8KA 2VWOA 2OCVB 4Q2KA 2C8WB 5DP6A 1P09A 1FLEE 3ZZ3A 2HNTE 1SGEE 1SQOA 3UR6A 4UE7H 1S81A 2QCYA 1QJ7B 2Z6BD 1FY3A 1ELTA 3UTUH 3NCLA 1GHVH 2CF9H 2A2XH 3E3TA 3DFLA 5FCKA 4ZXXH 1A4WH 4AG1A 4GSOA 1XXDA 2FI3E 1UCYH 1C5LH 2ZHWH 4FU8A 1C5RA 2V3OH 3U69H 2UUJB 2V6NA 3UNRA 5A0AE 1C1RA 2ANYA 1C5UA 1T7CA 1AFQB 3PMAB 4O3TA 1XKAC 1RTLA 1TIOA 1SVPA 1E38B 1CT0E 3T62A 4H42U 3L6PA 1G3CA 1BTHH 1FN8A 3IITA 1VR1H 2QY0B 3QGJA 1FY8E 3QWCH 1EJAA 4ABJA 1GMCF 1S6HA 1RTFB 3BIVH 2Z3DA 1C9PA 1TNHA 3V0XA 3SNEA 1SB1H 1GI3A 1ZJKA 2BD4A 3SOSA 1UK3A 2HWLB 1H4WA 1YC0A 1A3EH 1Z8GA 2R3YA 2XBWA 4XSKU 1C5ZB 1OS8A 2EI6A 3P8NA 2ILNA 3FVFB 5LPFA 1GDQA 3QX5H 2Y5FA 4NIYA 1WYKA 3UPEA 1EOLA 1SGTA 1TNGA 3RXPA 2AGEX 4CRFA 1JRTA 2FM2A 4AFSA 4K1SA 1NM6A 1TX7A 1TPAE 1E34B 1DXWA 3U9AH 6ESTA 1DE7H 3KQCA 1E36B 1FAXA 2GGVB 2ZTYA 3SQEE 2AERH 1BBRE 1RIWC 2Y7XA 5A8XA 4MVNA 3BG4B 4WF8A 1FPHH 1CBWC 3MNBA 1XX9A 1ZYOA 4H4FA 2PGBB 3M3SA 1JMOH 2H5DA 4X2YA 2BXUH 1IQMA 5EXLA 3SU2A 2OLGA 1T4UH 2ZCHP 2XTTB 4YT7H 3SJIA 1P2QA 1GG6B 4OS7A 1AD8H 1C1OA 1QA7A 1TOMH 1LKAA 1W12U 2BY9X 4CH8B 4DOQA 3TH4H 1AWHB 4I7YH 2TIOA 2XC4A 5JBBS 2ZFPH 6LPRA 4X8TH 1HB0B 5T6GA 2XC5A 1FZZA 3A7WA 1S83A 3NXPA 5F8XA 3LGYA 3LIWA 1MTWA 1ESAA 2W3KA 1BJVA 2Q6GA 4QT8C 4NGAH 1H9IE 2UWPA 2RA3A 1TABE 2EA3A 3A8AA 1SBWA 6GCHG 5SGAE 3SHCH 2R2MB 2BD5A 2O9QA 5C1UA 4PROA 3RU4T 2A32A 2OC7A 2QA9E 1PFXC 1SI5H 3DA9B 3KQDA 5LH8A 4I8GA 1NN6A 3ZV8A 3GY5A 4I8JA 3RXLA 1YPGH 3SI3H 2C8ZB 1V2WT 4A1TA 2ALVA 2J94A 2ZCLP 3M5LA 3GCNA 4K1TA 1ANCA 1RFNA 5FPTA 1QCPA 2QAAA 2G81E 1CT4E 1RXPA 4UFDH 1TQ0B 5T6FA 1G32B 2OBOA 2F9BH 3BG8A 1TBRH 1O35A 1GHBF 1JWTA 1OOKB 1S85A 2FI4E 3EE0B 3M5MA 3TK9A 1HAOH 4KP0A 5EXNA 3BTDE 1JXPA 5AFZH 5L30H 5EW1H 2BYAX 1TRMA 2BHGA 8LPRA 2ZZUH 1QIXB 1F5RA 1UCYE 1QJ1B 2IPHA 3PMBB 3SBKA 1LHGH 1BMLA 3RXAA 3GICB 3RC6A 3A84A 4NZQA 1NESE 1ESTA 4MNXA 1DX5M 3LH1A 3KGPA 1VGCC 2G4UA 3FP8E 1MCTA 3DHKH 2PFEA 2FZZA 5ABWA 3RP2A 2XCFA 1ETRH 1MMJN 2BY5X 2WPIS 1IQJA 2STAE 3URDA 2ZPSA 2FLBH 1ZR0A 2FYRA 2P94A 1UTMA 2ULLA 1ELVA 4IMQA 1P10A 2WV5A 1A5GH 1O5AB 1BUIA 3LC5A 1ZPBA 1Z8IB 1GHAF 1MKWK 3RXSA 2Z9KA 1DANH 2BQWB 2C90B 3KN2A 2XYAA 2TPIZ 1O3LA 2WPLS 2WUBA 2AMDA 3SQHE 2VIOA 3T26A 1S84A 1GBAA 4NCYA 1K2I1 1HXEH 5FX6A 3OTJE 4WXIA 2GCTC 1DICA 1EAUA 3M36A 3SU1A 4R0IA 1TGBA 5E0HA 5BPEA 1SG8B 3O8DA 3ATIA 3R3GB 3P8GA 4Y7AA 3PLPA 1A3BH 3U8OH 2TGAA 4B2BA 1MH0A 1O2YA 3KIDU 3RMLH 1TLDA 1CA0C 1C5PA 1HV7A 4U2WA 1BMNH 2Z7FE 3O8RA 3ITIA 5ESTE 2D2DA 5ESBA 3EA9A 2A5IA 2BTCE 3PB1E 4IC5A 1O3EA 1IQGA 1EASA 4XBBA 2OXSA 1AFEH 2THFB 1Y3VA 1PYTC 3TJVA 5C1XA 2XC0A 2PKAA 1GL1A 3OYPA 4X6MA 1BMAA 5K7RA 1PJPA 4X2WA 1WTHD 3EA7A 3MHWU 5I46H 2QIQA 2WPMS 5FBEA 3MH7A 1YLCA 2ZG0H 4IS5A 3TGKE 2A4GA 2H9TH 3M5NA 2GMTC 6CHAB 1FY1A 1GDNA 1A0LA 2ZFTA 1EQ9A 1YCPK 2HNTF 4INLA 4X1NU 3M37A 5T3HA 4ZUHA 4FU7A 1NRQH 3HATH 4IW4E 4E7NA 3ENSB 2W3IA 3P17H 3GDSA 5A2MH 5EQQA 1V6DA 4BAQB 2ZP0H 2VIPA 2A2QH 1BB0B 4FUCA 3S0NA 2VWMA 4FUEA 3PMJA 1O3JA 1LHEH 3AAVA 3RXFA 4NWKA 1K1JA 1O2LA 4OS2A 3QZRA 4JYVH 4WH6A 1J16A 1LHCH 4MPUA 1NS3A 5BRRE 1LPZB 2A0QB 1VITF 2PKSC 1BZXE 3ELAH 1SHYA 1K9OE 2OUAA 2BZ6H 4NA9H 2ZTZA 4Y8XA 1VCWA 1KXAA 4K8BA 3SGQE 1C2FA 2GZ7A 4UFFH 4ESTE 2ZC9H 1P04A 1P01A 4HTCH 4IGDA 4CRCA 1E0FD 4JYTA 2PUXB 2J4IA 4AFZA 1GVLA 2D1JA 3KQBA 4KGAA 3U8RH 1ZPCA 1YM0A 3IG6B 1TFXA 1J17T 1ZRBA 1K1MA 2VU8E 1H9LB 1MKXK 4DY7B 3P8OA 1O2HA 1O3GA 5C67A 2XWAA 3KNXA 2SGQE 2GP9B 4ZHAA 1IQNA 4JK5A 5J4SA 2PTCE 1HJAB 4GUXA 1O33A 3E1XB 3R0FA 3MH5A 2BY6X 3MO9A 3CP7A 1GMHF 3GDUA 1C1PA 1TGCA 1UTNA 3KL6A 1WQSA 5LPEA 1W11U 2A4OA 4VGCB 5TJXA 1F0SA 2ZHDA 1QB1A 2ZECA 3URCA 1HAIH 1C4U2 5CE1A 1ZGVA 2VNTA 2BDCA 2RCEA 3MH4A 3QGNB 1UVSH 1AIXH 4FUJA 1O2NA 3M35A 2GT8A 4YTAA 1NRSH 5T6DA 5E8EH 1OYTH 1GGDB 1W7GH 1YPEH 4LZ4B 1UTLM 1QB6A 4XBCA 1YPHC 3H7OA 3ZYEA 5L2ZH 1SC8U 3PROA 1BRCE 3OU0A 2ZHQH 2PGQB 1ANEA 3QO6A 1NT1A 2H9HA 1FV9A 1ZMLA 1J15A 1UHBA 1EATA 1G2LA 2BOKA 1MBQA 3BV9B 3D23A 1FY4A 2AS9A 1XVMA 4GCHG 4ZKSU 2ZHFH 3VFEA 2M5TA 1UO6A 1C5NH 2XXLA 4TY6A 1SGRE 3ZZBA 3UQVA 4JZEH 3BTHE 1O0DH 1W3CA 2CHAB 1GJAB 4E05H 3TGJE 1ACBE 1O36A 1ZTLA 1YGCH 2Y82A 1WV7H 3UNSA 1CHOF 5CHAC 3QZQA 1C4V2 2GCTB 4KTSA 5JB9S 3Q00A 1OP8A 1EPTC 1O30A 5C5OA 1TAWA 2BLOA 2CV3A 3ATMA 3QUMP 1ELFA 3JZ1B 3EYDA 1D3QB 4ABAA 4WWYA 1RD3B 3RXQA 1C2GA 3RXJA 1ELBA 1YKTA 3RUOA 4DT7B 5GIBA 2ZU5A 2C4FH 5EW2H 1O2RA 3ESTA 1O3IA 1QL9A 1KIGH 1MTSA 1ZHPA 3STIA 4JZIA 1EUFA 4O9VA 3E91A 1GJDB 2J38A 3GCHC 1G3BA 1TRYA 5A09A 1A5HA 1GMCG 3MMGA 3BTQE 3BEUA 2W7SA 3A88A 3M5OA 1C2JA 1UMAH 1LO6A 1TPPA 2H5CA 1GHXH 3RXCA 4YOGA 1LQDB 4X6PA 2PSYA 2VWLA 1FUJA 3SV8A 3A7YA 1KDQA 2GMTB 4O03A 4B73A 2Z9LA 1V2LT 3ATKA 3ZVBA 2P16A 4X8VH 2GT7A 1O3BA 3VPKA 1Q31A 3SNCA 1C1UH 4B1TA 5JBAS 2O8UA 1G2MA 1CQQA 1ZMNA 4DCDA 2RDLA 2O8WA 1GJ6A 3FZZA 3ATWA 2WPJS 2AIPA 1B7XB 1OP2A 1VCQA 2FESH 3RU4D 4YT6H 1SGPE 1YCPM 3ZZDA 2SNWA 3TH2H 3S7HB 1F2SE 1GCTC 4JCNA 1DM4B 4X8UH 3ZVFA 2VJ1A 1MTVA 4D8NA 1P0SH 3SV2H 4NA8A 4H6SB 1JOUB 1JRSA 1AZ8A 1WBGB 2FIRH 3GOVB 1PPZA 3M3VA 1V2MT 3DUXH 3OY6U 3MH6A 1BHXF 2OP9A 2WUCA 2BD3A 2GZ9A 3PMHB 2FP7B 3B9FH 4E06H 1HFDA 2WYGA 1W10U 2ZIQH 2PSXA 1S5SA 1TX6A 4NIXA 3NZIA 3TPIZ 2YNBA 4SGBE 1GJ5H 1MU6B 3D49H 1A5IA 1L1GA 4CHAB 1HAHH 4MTBA 2OINA 1C4Y2 1PQ8A 3SGAE 3A8BA 3E0PB 5C1YA 3PO1C 1T8NA 2AGIX 1K1OA 3BTME 4KELA 1UVPA 3CS0A 3K9XB 4MPXA 4B74A 2ZO3H 2R3UA 2WPKS 1MQ6A 1RS0A 4BAHB 4XOJA 5DK1A 4Q7ZA 4I8HA 2HNTC 3RXGA 1SQAA 2P93A 2JH0D 1V2VT 5H4IB 1DSTA 1O2ZA 4TPIZ 3GYLB 4JZFH 1DVAH 3SU4A 3P8FA 3ZZCA 1GBBA 2FOHA 3GY6A 3T27A 1O2MA 1HUTH 3BTGE 1OWKA 1UVTH 1TNLA 2W26A 5EOKA 1HNEE 2FDAA 1GHWH 1UVOA 5A0BA 4WMDA 2RA0A 4GPGA 4TWWA 1CT2E 2ZEBA 3SUEA 1EPTA 1ETTH 1TA2A 2J2UA 2CMYA 4NFFA 3VXFH 5IDKA 1EZXC 1F5KU 1UTOA 2QYIA 1NRRH 3LONA 2K1QA 3DT0H 3A80A 3BEFB 1MKWH 1FDPA 1BRUP 1DSUA 2KAIB 3TK5A 3SUGA 3ZVDA 1LTOA 2BOHB 3KEEA 2B0FA 3DD2H 1F5LA 1VCPA 5F8ZA 1UJ1A 2JETB 3TNSA 4B76A 2BQ6B 1YF4A 3SZNA 1BBRK 3PM3A 2P95A 2F9PA 4DG4A 1OWDA 4AYYB 4OS4A 2RG3A 4FUHA 3LU9B 1ZSKA 1C2DA 1KSNA 1D9IA 2V0BA 1FI8A 3H7TA 3GCTG 2VVVA 1GBDA 1K1LA 1AB9B 4UFEH 1XUIA 1O2OA 3RXHA 1A0JA 2ZFQH 2A7HA 1L4ZA 4INHA 2BDGA 4RKOB 1Y5BT 3CS7A 5HMAA 3S9AA 1G9IE 1O5FH 1GWAA 4ABBA 2ZGXH 5A8ZA 1DLKB 3LGVA 4WXVA 3A83A 1W7XH 3KHVA 2BD7A 2F9VA 1O5GH 4GHQA 3U1IB 4AORA 2NWNA 2ZDVH 2QXHA 1EX3A 3M7TA 1EP6A 1SOTA 3DFJA 4ZH8A 1W2KH 1CO7E 4ABGA 4CH2B 2GDEH 1OX1A 1SLWB 1QB9A 1MZDA 2DE9A 5HM9A 3WY8A 1JIMA 2G5VA 1AGJA 1YCPH 2WYJA 4U01A 2BY8X 1XVOA 3A7ZA 1C2IA 1D3TB 4ABFA 5A8YA 1LPGB 1SL3A 4DIIH 2ZPRA 3UR9A 3K6YA 5FHTA 3E0NB 2VGCB 5JPMH 1O3CA 4UD9H 4YLQH 3VGCC 2D8WA 1S6FA 2DUCA 1O2QA 2GDDA 1P2JA 2J92A 2XBVA 2ZWLH 2GV7A 4ABHA 1HRTH 1QNJA 3TVJB 1F0TA 4B2CA 3ZYDA 2BX3A 2BD9A 1BIOA 3SN8A 1C5QA 3C1KA 3RXUA 3T25A 2BDIA 2QXIA 1KXDA 1QRWA 1P2IA 5HM2A 1SQTA 1V2KT 2H9EH 1TYNA 3HK3B 3MWIU 1Q2WA 3BTKE 4FVDA 3RMMH 1DT2A 2GCHF 3RC4A 1BA8B 2NU0E 4Y7BA 3SU5A 1DOJA 1GJ4H 4X2XA 4I8LA 2DE8A 4YM9A 2PWXA 1BDAA 3PWBA 5DGJA 1Z8JB 1ZLRA 4LZ1H 4AG2A 1XUGA 5EXMA 2J9NA 2WV4A 2AIQA 1MKXH 1YPKH 3A7TA 2P3FH 1MAXA 4E7RG 2TGTA 1OXGA 3UIRA 1SGIB 1N6YA 1EB2A 3A87A 1LVYA 2HVXA 3PLKA 2P8OC 1KXCA 1ARCA 1C1WH 4Y71A 2P3TB 4X6NA 5I25A 3ZZ8A 4THNH 4NWLA 5JDUB 4TPYA 4K1EA 2FX6A 1L2EA 1C1SA 2BY7X 1W14U 1AI8H 1FNIA 1T8MA 1EOJA 2B8OH 4AB8A 2FOGA 1J8AA 2Y7ZA 1O2JA 3T2NA 4ZAEA 1OWHA 1BTXA 4Y79A 3QLPH 1AMHA 1DY9A 1S0RA 1YP9A 5EU8A 4GHTA 4TYDA 1GMDG 1WAYB 3V7TA 1THSH 1W0ZU 2F9UA 1AVWA 3K2UA 3MYWA 3VB6A 2WPHS 4BOHA 2ZPQA 1GL0E 4B2AA 2VVUA 5HGGA 1AE5A 1AVXA 1FMGA 2UUFB 1L4DA 1Z1IA 2SGFE 2FODA 1TE0A 1NPMA 5LGOA 3HGNA 3B23B 2LNCA 1AKSB 4MLFB 2Z9IA 1TGNA 3P6ZB 1TRNA 2OC8A 1ZTKA 3A7XA 1GI6A 1E35B 1ARBA 1AN1E 2EI8A 2G55A 1V2NT 1EAWA 2SGDE 2F3CE 4I33A 1BRAA 3EQ0H 1K1PA 1HYLA 3ZV9A 2VH0A 1YPJH 3PV4A 4CBOA 2QXJA 4X1RU 2PHBA 1SLVB 1GDUA 4ZXYH 1BTUA 4BANB 1DS2E 1N1LA 1W13U 1D3DB 2ZFRH 1NFWA 4MNVA 2BLQA 5FXLA 5L6NH 1MTNC 1RIWB 3UY9A 3L33A 3VB4A 3ZVEA 1GJ9B 1WSSH 1SGCA 1CBWB 1O2TA 1GI5A 4ZHMU 3RM0H 3SJ8A 4GAWA 3LGWA 1C5OH 3BF6H 4Y10E 4AN7A 4WMFA 2XW9A 1HAVB 1TNKA 3RMNH 2BD8A 5GCHG 1SGFG 4X1SU 4J1YA 3MTYA 3ZZ7A 1SSXA 2FOMB 5EQSA 2BD2A 1Y3UA 2BQ7B 4WH8A 2G51A 4Z6AH 3F1SB 1FIWA 1OSSA 8GCHG 3SNAA 3Q3YA 1LCYA 3K65B 3ZZ5A 2FOAA 1QQUA 1FPCH 1BOQA 1O5CB 4MNWA 2BDYA 5EODA 4WY3A 2ALPA 2G52A 5FX5A 1GI7B 2FOBA 4OS1A 1TWXB 1TMTH 2FOCA 1HJ9A 2WINI 3SV7A 5GDSH 3G01A 1P57B 3MNXA 1V2JT 1EZSC 7GCHG 2B9LA 2SFAA 1WTGH 5GPIB 1V2ST 3VB7A 5JBTA 2SNVA 1MTUA 2FTMA 3M7UA 4ABEA 1O2PA 3S7KB 4ZKRU 3MNCA 2C8YB 3TITA 1NROH 2FXRA 1V2OT 3GY4A 4JZ1A 1HJ8A 1BTZA 4Y8YA 2VIQA 3ODFA 1O31A 1GI0A 1INCA 4JMYA 2HLCA 1HCGA 3EDXB 3S9CA 2F9OA 3NK8A 4IN2A 1W0YH 4DJZB 1FJSA 1O5BB 1P2KA 3ZZ4A 3STJA 1SLUB 1O3FA 1BRBE 1QJ6B 5G4BA 1PPFE 4MPVA 1SGQE 1QBNA 1C1QA 3FANA 1XUKA 1AFQC 2AMQA 4FUIA 4ZKNU 5GJ4B 1G36A 1IQEA 2OC0A 3OSYA 1FN6A 5FCRA 1ELEE 1UK4A 3M61U 1ZTJA 3Q3XA 1NO9H 1C5XB 2F91A 1T32A 2JKHA 1OWEA 1O34A 1VGCB 3A82A 2ZCKP 1BJUA 3HK6B 3QK1A 3SGBE 3S9BA 1SGNE 1UTPA 4NIVA 1TALA 4X1QU 5TCCA 1ETSH 1GJ7B 1G3EA 2XBYA 1ABIH 1DDJA 4OS5A 1A46H 3Q3KA 5J4QA 5B6OA 4AB9A 7KMEH 1VJ9U 2AGGX 1OYQA 2Z9GA 3MFJA 5DPAA 1NFUA 1AWFH 4WMEA 2A45B 2UUYA 3MO6A 3P92A 1A7SA 1YPLH 1VITH 5CMXH 4D9RA 5TCAA 3UREA 3D65E 1C1MA 1P9UA 2A5AA 4YESB 2W7UA 3BG4C 4K69A 3LPRA 4NA7A 4AOQA 2FMJA 3UUZA 2ZF0H 2YOLA 4Q7YA 5C5NA 2VIVA 1RGQA 1H9HE 1O3MA 3F9EA 1DUAA 1IOEA 3LOXA 1EXFA 1C2MA 4AYVB 3PWCA 1GG6C 2ODQA 1RRKA 2C3SA 2SGPE 1O32A 2TGPZ 1ELGA 1CA0B 1UVUH 4LOYH 3MU5A 2G8TA 3RXKA 5FBIA 5AHGH 3SV9A 3F9HA 1ZJDA 5LPRA 2ZU3A 1O5EH 3W94A 1TPSA 5E0GA 3LGUA 1HLTH 1CE5A 1V2RT 4INKA 1Z6EA 2AFQB 4B75A 1GI9B 1P06A 2HGTH 1UHBB 2YNAA 3AW0A 4AFUA 5C3NA 2ZGJA 1J14A 1O39A 3L3TA 1BHXB 4K8YA 1BQYA 1BBRH 2TBSA 1HIAA 1F0UA 2V3HH 3VB5A 2UWOA 1P11E 3UNQA 2GKVE 1QURH 3FAOA 1P2OA 1O3DA 2VB0A 1B0FA 1QTFA 1QR3E 2F83A 3QTVH 4BTTB 1GBMA 1Z8RA 2BVRH 2BVXH 1Z6JH 1C2KA 4F49A 1XKBC 2ZDKA 1C1TA 3FP7E 3D62A 1NY22 5L2YH 3S69A 3SNBA 3O8BA 1O3HA 4DVAU 2B7DH 2OQ5A 1KXFA 1WU1A 1T31A 3GY7A 1EKBB 1WUNH 5DP8A 1G3DA 2ZU4A 2A4RA 4YLUA 1TNIA 1GHYH 1CHGA 4KKDA 1D6WA 5EGMA 3T29A 5HYOA 4GLYA 2ZGBH 1FONA 1IQLA 2PKSB 2ZQ1A 1TONA 1O2KA 1QGFA 4I32A 1PQ5A 3F6UH 3SNDA 1HAXB 1HDTH 3VB3A 3W95A 3SHAH 1P05A 3HGPA 1AE8H 5EPYA 5AVDA 4NG9H 4A5TS 1DWEH 1ELAA 1N8OC 3Q76A 1P8VC 4Y0ZE 3EGKH 3QN7A 1DWBH 4K2YA 2HPQH 2QN5T 1KDQB 5DG6A 1MAYA 1V2UT 1RJXB 3V13A 5IYTA 3P70B 1EZQA 2UWLA 5E2PA 4GCHF 1C2EA 1CGJE 1DY8A 3MU0A 4YOJA 5C20A 4Y8ZA 1TBQH 1TOCB 2Y5HA 1HGTH 2I6SA 1AY6H 4UONA 2GVFA 1UTQA 1Z7KA 1Y5AT 4AGKA 9LPRA 1T8LA 1F7ZA 2UUKB 2A31A 1IQFA 1K21H 5AFYH 1HBTH 4BTIB 2XRCA 4ZHLU 1KYNA 2BDHA 2KAIA 3E16B 4RSPA 2BDBA 1ANBA 1O2GH 4JZDH 3TU7H 2BZAA 3ZVGA 2ASUB 2ZHEH 3RC5A 3M3TA 3BSQA 2AMPA 3V12A 5JB8S 1O3KA 1ZHMA 1SFQB 2ZDNA 3T5FH 1KLJH 2FS8A 3SU0A 1GHBG 1AUJA 4NSYA 2GZ8A 1P3EA 3I77A 2D26C 1GJBB 1T8OA 3RXEA 1IHTH 3RU4E 3RLYH 1LVMA 2IJOB 1GHZA 1O2VA 1AZZA 1JIRA 1FXYA 1L1JA 1PPCE 3SJ9A 4ISLA 1GBJA 1QA0A 1GBKA 2OTVA 2OD3B 3LDXH 4J2YB 1GI2A 3ZVAA 2FS9A 2Y80A 4DIHH 2HALA 1NRPH 1BTPA 2GCHG 3UWJH 1OP0A 1Y3XA 2FX4A 1ESBA 1XUHA 1QFKH 2NU1E 4XFQA 2BB4A 2F9NA 4MPWA 2FO9A 1EJMA 3ZZ9A 3AASA 4FUGA 1DITH 5PTPA 1K28D 3RXMA 3SUFA 2O8LA 2PR3A 1CA8B 4OGYA 3LGIA 6CHAC 3A81A 1UK2A 3MU4A 4JYUH 4A6LA 2P3UB 4Q80A 2QXGA 1GHAG 4OS6A 3MU8A 5CHAB 1C5VA 4SGAE 2R9PA 2ZDAH 1O3NA 1S0QA 3K6ZA 4UDWH 1A1RA 3BIUH 1JBUH 1EPTB 3UWIA 2I6QA 3HPTB 3MNSA 1SFIA 2Q1JA 4ISOA 3U98H 1SPJA 1NZQH 4FXGH 2QF3A 2EC9H 1O2IA 1S82A 4CR9A 1HAZB 1G37A 2ODPA 1AU8A 1Q3XA 3GY8A 2R2WU 2ZFFH 2Z3CA 2BM2A 4YO9A 3V3MA 4D7GA 1NU9A 2ANMH 3F68H
chains in the Genus database with same CATH superfamily
1P03A 3GCHB 1P9SA 2J95A 7LPRA 1MABB 1W8BH 4P00A 1QBVH 2XBXA 4LXBH 1L0ZA 1U6QA 2JH5D 2ZNKH 2FWWA 4Y0YE 2ZU1A 3BEIB 1CVWH 1PPHE 1H8IH 1THPB 1A61H 4X8SH 3KYGA 3O8CA 2SGAA 1VJAU 2PTNA 3CENA 3SORA 2FTLE 2O8TA 2VWNA 3A7VA 3E90B 1EZUC 3H09A 1ORFA 4FUDA 3E6PH 1PYTD 3ZZ6A 1AUTC 2TGDA 3PTBA 2KZ4A 4Q63A 4D9QA 3PLBA 2B5TB 4CRGA 2Y81A 1C2LA 3SUDA 5HIZA 4Y11E 4IC6A 2IN2A 3GYMA 1G30B 3QDZB 1Y3WA 5KECA 1HJAC 2FYQA 3RXRA 4BAOB 3VXEH 4F4OC 4XE4A 1K1NA 1IQIA 1DUEA 1O2XA 4BNRA 1DWDH 1GCTB 4B6EA 4YXWD 2PUQH 1V2PT 3NPSA 4Z0KA 5GWZA 1ELCA 1UCYK 2H1UA 1ZGIA 2RFKC 3N99A 3NUMA 8KME2 5EG4A 4VGCC 1SMFE 1O5DH 4O97A 1CGHA 3SZEA 3TIUA 2GX4A 5JYIA 3LH3A 3F9GA 2ZTXA 3ZVCA 3BTWE 2AHME 1QBOA 2AEIH 2F4LA 1KTTB 4AGJA 1VITG 2SGEE 5EQRA 3SV6A 3MO3A 1GGDC 3GS9A 3PTNA 1IHSH 1N8OB 2ZFSA 1LQEA 4FUFA 1AVGH 3LC3A 4RN6A 1GI4A 4NFEA 1WOFA 2NU4E 1PQAA 1E37B 1LVBA 3TH3H 1GBFA 3PO1B 2RDEA 1EAIA 4FUBA 2HRVA 1CGIE 1GBEA 2ANKH 3GDVA 3F3BA 1AKSA 3RM2H 2A7CA 1LMWB 3OY5U 1XUFA 5ETXA 2ZGHA 3GCTF 1TGSZ 2FOEA 1PQ7A 2BXTH 3I78A 3H5CB 4YOIA 2IOTA 1ZZZA 2QV1A 2BLVA 5FAHA 2ODYB 1BTWA 1AHTH 3N7EA 2OQUA 2CHAC 1J9CH 3AVZA 1TMBH 3TNTA 3ODDA 1GBLA 4HFPB 2A5KA 1O2UA 2BX4A 1XM1A 2AH4X 2GD4B 3B8JA 1C5YB 3HKIB 3KCGH 3LJJA 4O3UA 1MD7A 4NSVA 3SU6A 4U30A 1K22H 4M7GA 4IBLH 5DSFA 2GV6A 2CJIA 2OBQA 5F03A 2ZDLA 1XXFA 4ISIH 4BXSA 4X2VA 1GMHG 1O2SA 1ZHRA 1Z71A 1ZSJA 3BTFE 1P12E 1NC6A 6GCHF 1MUEB 2XCNA 2EEKA 5DP3A 1HAVA 2QF5A 3A8DA 2A7JA 2LELA 1BMMH 1O3AA 1QRZA 2FLRH 1FY5A 4FETA 1M9UA 3SO3A 4K3JA 4JK6A 1LVOA 3AW1A 2NU2E 3A86A 5EPNA 5AF9H 5KGOA 1P3CA 1QRXA 1GVZA 1VZQH 1BCUH 2HVYB 3SW2B 3RXTA 2W6ID 3PRBA 2VIWA 1T4VH 2VH6A 3SI4H 5DO4H 1Y3YA 2ZU2A 4KTUA 1HPGA 3GCOA 1MCVA 1C1NA 1NFYA 1PPBH 3HKJB 2YMSD 4AZ2B 2A1DB 3MI4A 1YLDA 3SJOA 5HXFA 1MZAA 3TJNA 1NU7B 2HOBA 4CRAA 3TJUA 1OWIA 4ZKOU 4ZMAH 4DGJA 2ZDMA 1GBTA 3GISB 4CR5A 4MDSA 3LKWA 4ACAA 1LHDH 2VINA 5FPYA 5E2OA 2Q6DA 1IQKA 3ATLA 1CHOG 4MQAA 2PKAB 4AX9H 2FOFA 1KY9A 4NIWA 4BAMB 1QY6A 3N7OA 1SGFA 1DPOA 1GBIA 2PV9B 2G5NA 4WVPE 1CSOE 1C5WB 3EAJA 3OE7D 2P59A 1EB1H 1MU8B 4TWYA 8ESTE 1GPZA 1O3PB 1ANDA 1NTPA 4FU9A 4UFGH 1SLXB 1MBMA 2QC2A 1NRNH 1SHHB 3ZZAA 1OKXA 4A92A 2QF0A 2XNIA 5DP4A 3LT3A 4BAKB 1GCDA 3FOAA 1ZSLA 1GBHA 3UOPA 1OPHB 2STBE 1TB6H 2Z3EA 1XUJA 4D76A 4CHAC 2FPZA 3MOCA 2C93B 1O37A 3C27B 4TY7A 5DP7A 3UOUA 2CN0H 3OX7U 3RXOA 3RXVA 3VEQB 3VGCB 3A8CA 4RKJB 4IN1A 2TRMA 4B71A 2ZGCA 5JBCS 1V2TT 1GMDF 4X1PU 1E1QD 1HAPH 1PPEE 4R8TB 1XMNB 1SGYE 1TMUH 5K0HA 3PYHA 4HGCA 2Y5GA 2CF8H 4GVUA 4CRDA 1X7AC 1Y59T 2Z94A 4K60A 4IMZA 1SOZA 4ABDA 2GTBA 4Q7XA 2XNDD 3BTEE 3QTOH 1YPMH 2G00A 1OWJA 2VVCA 3KF2A 3UQOA 1YPHE 1LDTT 2GJGA 4UEHH 3LJOA 4F48B 2V3MA 4I31A 2H6MA 3AAUA 3A85A 1H8DH 3JZ2B 4ISHH 1YYY1 3TLOA 1D4PB 3GY2A 4U32A 3EA8A 1GJCB 2H2ZA 1P2NA 1TA6A 3NWUA 1C5SA 1C5MD 5F6MA 3I29A 4K5ZA 1HAYB 2PP6A 1BITA 1QL7A 2BVSH 4XBDA 1Y5UT 1HAGE 1C2HA 1AO5A 3NKKA 1GI8B 1FIZA 1DXPA 3F9FA 3KQEA 4CRBA 2PW8H 1BTYA 1A0HB 2P8OB 4OGXA 1NFXA 1C9TA 3MU1A 4AFQA 2CXVA 1C5TA 7ESTE 1FX0B 1MQ5A 1W0JD 4MG3A 4D7FA 3GY3A 2JETC 2ZA5A 1TGTA 1HXFH 4FOUC 1D3PB 2PLXA 3IWMA 2FI5E 4MNYA 2FEQH 5A0CA 1TBZH 2R0LA 4X6OA 5GCHF 1FQ3A 5FPSA 3FFGA 2G4TA 4ASHA 2JH6D 3FP6E 1ZOMA 8GCHF 3WWFA 1AB9C 3A89A 1SR5C 2EI7A 2HPPH 3RXDA 5DKMA 2BMGB 1KLTA 1F92A 2A4QA 3SJKA 2J34A 1TNJA 4Y76A 4DURA 2ZKSA 3BTTE 4HI3A 1H1BA 1EAXA 2AYWA 1O38A 1UTKA 4WJG2 1KXEA 1ZMJA 2CGAA 2ZI2H 3UFAA 1ZPZA 4ISNA 4NZLA 3RXBA 1SGDE 3OEHD 2W5EA 1F0RA 5F8TA 1B0EA 4FVBA 1EJNA 1QL8A 9ESTA 1TX8A 4H6TA 1YBWA 2V35A 7GCHF 1GI1A 3U1JB 1A2CH 1EP5A 1P2MA 4CBNA 2ESTE 1DLEA 4I86A 4A7IB 4KTCA 1KLIH 1AQ7A 4RT0A 3RXIA 2Y6TA 1H8ED 1LPKB 3TK6A 4BTUB 1QQ4A 1QZ8A 1DWCH 1MTNB 5DP5A 3U8TH 5EJZA 1CU1A 2ANWA 3BN9A 5C17A 1KXBA 4YZUA 1B5GH 1K1IA 1O3OA 4HZHA 1V3XA 2XWBI 5DJ7A 3RDZA 2VGCC 2O8MA 1RTKA 1D6RA 4A1VA 1GJ8B 4CREA 3E8LA 1V2QT 4LK4A 4DW2U 3M7QA 4BXWA 1GVKB 3LGTA 3SU3A 2Z9JA 1IQHA 2ZQ2A 2BDAA 2Q6FA 3RLWH 5DP9A 3WWBA 4ABIA 1Z1JA 1Y8TA 1ZRKA 2LPRA 2NU3E 1IAUA 1TQ7B 1WCZA 2VIDA 1LHFH 5C2ZA 1MD8A 1BT7A 2QGRA 4A1XA 4X0WU 3P95A 2WZQA 3RMOH 1KTSB 1THRH 1ELDE 2BLWA 4XDEA 5T1VA 3TJOA 1COWD 1L1NA 3T28A 1GBCA 4ZROA 1PPGE 1ABJH 5E0JA 2OK5A 1HIAB 2J98A 3Q77A 1C1VH 1WQVH 1QHRB 1LKBA 4Q4LA 1P02A 4Y6DA 1TPOA 3TGIE 1UTJA 1N6XA 1O2WA 1FAKH 1ID5H 2R0KA 1DFPA 2OC1A 5GXPA 3FZDA 2C8XB 4I8KA 2VWOA 2OCVB 4Q2KA 2C8WB 5DP6A 1P09A 4DT4A 1FLEE 3ZZ3A 2HNTE 1SGEE 1SQOA 3UR6A 4UE7H 1S81A 1E1RD 2QCYA 1QJ7B 2Z6BD 1FY3A 1ELTA 3UTUH 3NCLA 1GHVH 2CF9H 2A2XH 3E3TA 3W1EA 3DFLA 5FCKA 2CK3D 4ZXXH 1A4WH 4AG1A 4GSOA 1XXDA 2FI3E 1UCYH 1C5LH 2ZHWH 4FU8A 1C5RA 2V3OH 3U69H 4B6FA 2UUJB 2V6NA 3UNRA 5A0AE 1C1RA 2ANYA 1C5UA 1T7CA 1AFQB 3PMAB 4O3TA 1XKAC 1RTLA 1TIOA 1SVPA 1E38B 1CT0E 3T62A 4H42U 3L6PA 1G3CA 1BTHH 1FN8A 4HG6A 2WSSD 3IITA 1VR1H 2QY0B 3QGJA 1FY8E 3QWCH 1EJAA 4ABJA 1GMCF 1S6HA 1RTFB 3BIVH 2Z3DA 1C9PA 1TNHA 3V0XA 3SNEA 1SB1H 1GI3A 1ZJKA 2BD4A 3SOSA 3VG8A 1UK3A 2HWLB 1H4WA 1YC0A 1A3EH 1Z8GA 2R3YA 2XBWA 4XSKU 1C5ZB 1OS8A 2EI6A 3P8NA 2ILNA 3FVFB 5LPFA 1GDQA 3QX5H 2Y5FA 4NIYA 4XD7D 1WYKA 3UPEA 1EOLA 3KYFA 1SGTA 1TNGA 3RXPA 2AGEX 4CRFA 1JRTA 2FM2A 4AFSA 4K1SA 1NM6A 1TX7A 1TPAE 1E34B 4ZCNA 1DXWA 3U9AH 2LP6A 6ESTA 1DE7H 3KQCA 1E36B 1FAXA 2GGVB 2ZTYA 3SQEE 2AERH 1BBRE 1RIWC 2Y7XA 5A8XA 4MVNA 3BG4B 4WF8A 1FPHH 1CBWC 3MNBA 1NBMD 1XX9A 1ZYOA 4H4FA 2PGBB 3M3SA 1JMOH 2H5DA 4X2YA 2BXUH 1IQMA 5EXLA 3SU2A 2OLGA 1T4UH 2ZCHP 2XTTB 4YT7H 3SJIA 1P2QA 1GG6B 4OS7A 1AD8H 1C1OA 1QA7A 1TOMH 1LKAA 1W12U 2BY9X 4CH8B 4DOQA 3TH4H 1AWHB 4I7YH 2TIOA 2XC4A 5JBBS 2ZFPH 6LPRA 4X8TH 1HB0B 5T6GA 2XC5A 1FZZA 3A7WA 1S83A 3NXPA 5F8XA 3LGYA 3LIWA 1MTWA 1ESAA 2W3KA 1K0HA 1BJVA 2Q6GA 4QT8C 4NGAH 1H9IE 2UWPA 2RA3A 1TABE 2EA3A 3A8AA 1SBWA 6GCHG 5SGAE 3SHCH 2R2MB 2BD5A 2O9QA 5C1UA 5DN6D 2KR7A 4PROA 3RU4T 2HLDD 2A32A 2OC7A 2QA9E 1PFXC 1SI5H 3DA9B 3KQDA 5LH8A 4I8GA 1NN6A 3ZV8A 5EJ1A 3GY5A 4I8JA 3RXLA 1YPGH 3SI3H 2C8ZB 1V2WT 4A1TA 2ALVA 2J94A 2ZCLP 5FL7D 3M5LA 3GCNA 4Z1MD 4K1TA 1ANCA 1RFNA 4OM9A 5FPTA 1QCPA 2QAAA 2G81E 1CT4E 1RXPA 1W0KD 4UFDH 1TQ0B 5T6FA 1G32B 2OBOA 2F9BH 3BG8A 1TBRH 1O35A 1GHBF 1JWTA 1OOKB 1S85A 2FI4E 3EE0B 3M5MA 3TK9A 1HAOH 4KP0A 5EXNA 3BTDE 1JXPA 5AFZH 5L30H 5EW1H 2BYAX 1TRMA 2BHGA 8LPRA 2ZZUH 1QIXB 1F5RA 1UCYE 1QJ1B 2IPHA 3PMBB 3SBKA 1LHGH 1BMLA 3RXAA 3GICB 3RC6A 3A84A 4NZQA 1BMFD 1NESE 1ESTA 4AC9A 4MNXA 1DX5M 3LH1A 3KGPA 1VGCC 2G4UA 3FP8E 1UW7A 1MCTA 3DHKH 2PFEA 2FZZA 5ABWA 3RP2A 2XCFA 1ETRH 1MMJN 3DCLA 2BY5X 3UB0A 2WPIS 1IQJA 2STAE 3URDA 2ZPSA 2FLBH 1ZR0A 2FYRA 2P94A 1UTMA 2ULLA 1ELVA 4IMQA 1P10A 2WV5A 1A5GH 1O5AB 1BUIA 3N7DA 3LC5A 1ZPBA 1Z8IB 1GHAF 1MKWK 1S6LA 3RXSA 2Z9KA 1DANH 2BQWB 2C90B 3KN2A 2XYAA 2TPIZ 1O3LA 2WPLS 2WUBA 2AMDA 1YLNA 3SQHE 2VIOA 3T26A 1S84A 1GBAA 4NCYA 1K2I1 1HXEH 5FX6A 3AK5A 3OTJE 4WXIA 2GCTC 1DICA 1EAUA 3M36A 3SU1A 4R0IA 1TGBA 5E0HA 5BPEA 1SG8B 3O8DA 3ATIA 2J5UA 3R3GB 3P8GA 4Y7AA 3PLPA 1A3BH 3U8OH 2TGAA 4B2BA 1MH0A 1O2YA 3KIDU 3RMLH 1OHHD 1TLDA 1CA0C 1C5PA 1HV7A 4U2WA 1BMNH 2Z7FE 3O8RA 3ITIA 5ESTE 2D2DA 5ESBA 3EA9A 2A5IA 2BTCE 3PB1E 4IC5A 1O3EA 1IQGA 1EASA 4XBBA 2OXSA 1AFEH 2THFB 1Y3VA 1PYTC 3TJVA 5C1XA 2XC0A 2PKAA 1GL1A 3OYPA 4X6MA 1BMAA 5K7RA 1PJPA 4X2WA 1WTHD 3EA7A 3MHWU 5I46H 2QIQA 2WPMS 5FBEA 3MH7A 1YLCA 2ZG0H 4IS5A 3TGKE 2A4GA 2H9TH 3M5NA 2GMTC 3FKSD 6CHAB 3DSGA 1FY1A 1GDNA 1A0LA 2ZFTA 4ACBA 1EQ9A 1YCPK 2HNTF 4INLA 4X1NU 3M37A 5T3HA 4ZUHA 4FU7A 1NRQH 3HATH 4IW4E 4E7NA 3ENSB 2W3IA 3P17H 3GDSA 5A2MH 5EQQA 1V6DA 4BAQB 2ZP0H 2VIPA 2A2QH 1BB0B 3PRDA 4FUCA 3S0NA 2VWMA 4FUEA 3PMJA 1O3JA 1LHEH 3AAVA 3RXFA 4NWKA 1K1JA 1O2LA 4OS2A 3QZRA 4JYVH 4WH6A 1J16A 1LHCH 4MPUA 1NS3A 5BRRE 1LPZB 2A0QB 1VITF 2PKSC 1BZXE 3ELAH 1SHYA 1K9OE 2BZ6H 2OUAA 4NA9H 2ZTZA 4Y8XA 1VCWA 1KXAA 4K8BA 3SGQE 1C2FA 2GZ7A 4UFFH 4ESTE 2ZC9H 1P04A 1P01A 4HTCH 4IGDA 4CRCA 5HIYA 1E0FD 4JYTA 3MQKC 2PUXB 2J4IA 4AFZA 1GVLA 2D1JA 3KQBA 4KGAA 3U8RH 1ZPCA 1YM0A 3IG6B 1TFXA 1J17T 1ZRBA 1K1MA 2VU8E 1H9LB 1MKXK 4DY7B 3P8OA 1O2HA 1O3GA 5C67A 2XWAA 3KNXA 2SGQE 2GP9B 4ZHAA 1IQNA 4JK5A 5J4SA 2PTCE 1HJAB 4GUXA 1O33A 3E1XB 3UAIC 3R0FA 3MH5A 2BY6X 3MO9A 3CP7A 1GMHF 3GDUA 1C1PA 1TGCA 1UTNA 3KL6A 1WQSA 5LPEA 1W11U 5EJLA 2A4OA 4XRNA 4VGCB 5TJXA 1F0SA 2ZHDA 1QB1A 2ZECA 3URCA 1HAIH 1C4U2 5CE1A 1ZGVA 2VNTA 2BDCA 2RCEA 3MH4A 3QGNB 1UVSH 1AIXH 4FUJA 1O2NA 3M35A 2GT8A 4YTAA 1NRSH 5T6DA 5E8EH 1OYTH 1GGDB 1W7GH 2WV9A 2YMSC 1YPEH 4LZ4B 1UTLM 1QB6A 4XBCA 1YPHC 3H7OA 3ZYEA 5L2ZH 1SC8U 3PROA 1BRCE 3OU0A 2ZHQH 2PGQB 1ANEA 3QO6A 1NT1A 2H9HA 1FV9A 1ZMLA 1J15A 1UHBA 1EATA 1G2LA 2BOKA 1MBQA 3BV9B 3D23A 1FY4A 2AS9A 1XVMA 4GCHG 4ZKSU 2ZHFH 3VFEA 2M5TA 1UO6A 1C5NH 2XXLA 3DSOA 1SGRE 4TY6A 3ZZBA 5C0TA 3UQVA 2KX4A 4JZEH 3BTHE 1O0DH 1W3CA 2CHAB 1GJAB 3F0OA 4E05H 3TGJE 5GNDA 1ACBE 1O36A 1ZTLA 1YGCH 2Y82A 1WV7H 3UNSA 1CHOF 5CHAC 3QZQA 1C4V2 2GCTB 4KTSA 5JB9S 3Q00A 1OP8A 1EPTC 1O30A 5C5OA 3OFND 1TAWA 2BLOA 2CV3A 3ATMA 3QUMP 1ELFA 3JZ1B 3EYDA 1D3QB 4ABAA 4WWYA 1RD3B 3RXQA 1C2GA 3RXJA 1ELBA 1YKTA 3RUOA 4DT7B 5GIBA 2ZU5A 2C4FH 2KCAA 5EW2H 1O2RA 3ESTA 1O3IA 1QL9A 1KIGH 1MTSA 1ZHPA 3STIA 4JZIA 1EUFA 4O9VA 3E91A 1GJDB 2KM0A 2J38A 3GCHC 1G3BA 1TRYA 5A09A 1A5HA 1GMCG 3MMGA 3BTQE 3BEUA 2W7SA 3A88A 3M5OA 1C2JA 1UMAH 1LO6A 1TPPA 2H5CA 1GHXH 3RXCA 4YOGA 1LQDB 3FN8A 2PSYA 4X6PA 2VWLA 1FUJA 3SV8A 5C0UA 3A7YA 1KDQA 2GMTB 4O03A 4B73A 2Z9LA 1V2LT 3ATKA 3ZVBA 2V7QD 2P16A 4X8VH 2GT7A 1O3BA 3VPKA 1Q31A 3SNCA 1C1UH 4B1TA 5JBAS 2O8UA 1G2MA 1CQQA 1ZMNA 2J97A 4DCDA 2RDLA 2O8WA 1GJ6A 3FZZA 2KCYA 3ATWA 2WPJS 2AIPA 1B7XB 1OP2A 1VCQA 2FESH 3RU4D 4YT6H 1SGPE 1YCPM 3ZZDA 2SNWA 3TH2H 3S7HB 1F2SE 1GCTC 4JCNA 1DM4B 4X8UH 3ZVFA 2VJ1A 1MTVA 4D8NA 1P0SH 3F2HA 3SV2H 4NA8A 4P02A 4H6SB 1JOUB 1JRSA 1AZ8A 1WBGB 2FIRH 3GOVB 1PPZA 3M3VA 1V2MT 3DUXH 3OY6U 3MH6A 1BHXF 2OP9A 2WUCA 2BD3A 2GZ9A 3PMHB 2FP7B 3B9FH 4E06H 1HFDA 2WYGA 1W10U 2ZIQH 2PSXA 1S5SA 1TX6A 4NIXA 3NZIA 3TPIZ 2YNBA 3F0PA 4SGBE 1GJ5H 1MU6B 3D49H 1A5IA 1L1GA 4CHAB 1HAHH 4MTBA 2OINA 1C4Y2 1PQ8A 3SGAE 3A8BA 3E0PB 5C1YA 3PO1C 1T8NA 2AGIX 1K1OA 3BTME 4KELA 1UVPA 3CS0A 3K9XB 4MPXA 4B74A 2ZO3H 2R3UA 2WPKS 1MQ6A 1RS0A 4BAHB 4XOJA 5DK1A 4Q7ZA 5EIYA 4I8HA 2HNTC 3RXGA 1SQAA 2P93A 2JH0D 1V2VT 5H4IB 1DSTA 1O2ZA 4TPIZ 3GYLB 4JZFH 1DVAH 2J98B 3SU4A 3P8FA 3ZZCA 1GBBA 2FOHA 3GY6A 3T27A 1O2MA 1HUTH 3BTGE 1OWKA 1UVTH 1TNLA 2W26A 5EOKA 1HNEE 2FDAA 1GHWH 1UVOA 5A0BA 4WMDA 2RA0A 4GPGA 4TWWA 1CT2E 1YY3A 2ZEBA 3SUEA 1EPTA 1ETTH 1TA2A 2J2UA 2CMYA 4NFFA 3VXFH 5IDKA 1EZXC 1F5KU 1UTOA 2QYIA 1NRRH 3LONA 2K1QA 2XOKD 3DT0H 3A80A 3BEFB 1MKWH 1FDPA 1BRUP 1DSUA 2KAIB 3TK5A 3SUGA 3ZVDA 1LTOA 2BOHB 3KEEA 2B0FA 3DD2H 1F5LA 1VCPA 5F8ZA 1UJ1A 2JETB 3TNSA 1YWUA 4B76A 2BQ6B 1YF4A 3SZNA 1BBRK 3PM3A 2P95A 2F9PA 4DG4A 1OWDA 4AYYB 4OS4A 2RG3A 4FUHA 3LU9B 1ZSKA 1C2DA 1KSNA 1D9IA 2V0BA 1FI8A 3H7TA 3GCTG 2VVVA 1GBDA 1K1LA 1AB9B 3FO8D 4UFEH 1XUIA 1O2OA 3RXHA 1A0JA 2ZFQH 2A7HA 1L4ZA 4INHA 2BDGA 5B6LA 4RKOB 1Y5BT 3CS7A 5HMAA 3S9AA 1G9IE 1O5FH 1GWAA 4ABBA 2ZGXH 3OTPA 1VKYA 5A8ZA 1DLKB 3LGVA 4WXVA 3A83A 1W7XH 3KHVA 4RI0A 2BD7A 2F9VA 1O5GH 4GHQA 3U1IB 4AORA 2NWNA 2ZDVH 2QXHA 1EX3A 3M7TA 2K8IA 1EP6A 1SOTA 3DFJA 4ZH8A 1W2KH 1CO7E 4ABGA 4CH2B 2GDEH 1OX1A 1SLWB 1QB9A 1MZDA 2DE9A 3SYJA 5HM9A 3WY8A 1JIMA 2G5VA 1AGJA 1YCPH 2WYJA 4U01A 2BY8X 1XVOA 3A7ZA 1C2IA 1D3TB 4ABFA 2QE7D 5A8YA 1LPGB 1SL3A 4DIIH 2ZPRA 3UR9A 3K6YA 5FHTA 3E0NB 2VGCB 5JPMH 1O3CA 4UD9H 4YLQH 3VGCC 2D8WA 1S6FA 2DUCA 1O2QA 2GDDA 1P2JA 2J92A 2XBVA 2ZWLH 2GV7A 4ABHA 4TT3D 1HRTH 1QNJA 3TVJB 1F0TA 4B2CA 3ZYDA 2BX3A 2BD9A 1BIOA 1NBME 3SN8A 1C5QA 3C1KA 3RXUA 5CHBA 3T25A 2BDIA 2QXIA 1KXDA 1QRWA 1P2IA 5HM2A 1SQTA 1V2KT 2H9EH 1TYNA 3HK3B 3MWIU 1Q2WA 3BTKE 4FVDA 3RMMH 3OAAD 1DT2A 2GCHF 3RC4A 1BA8B 2NU0E 4Y7BA 3SU5A 1DOJA 1GJ4H 4X2XA 4I8LA 2DE8A 4YM9A 2PWXA 1BDAA 3PWBA 5DGJA 4RT1A 1Z8JB 2JIZD 1ZLRA 4LZ1H 4AG2A 1XUGA 1WDIA 5EXMA 2J9NA 2WV4A 2AIQA 1MKXH 1YPKH 3A7TA 2P3FH 1MAXA 4E7RG 2TGTA 1OXGA 3UIRA 1SGIB 1N6YA 1EB2A 3A87A 1LVYA 2HVXA 3PLKA 1KXCA 2P8OC 1ARCA 1C1WH 4TSFD 4Y71A 2P3TB 4X6NA 5I25A 3ZZ8A 4THNH 4NWLA 5JDUB 2JJ1D 4TPYA 4K1EA 2FX6A 1L2EA 1C1SA 2BY7X 1W14U 1AI8H 1FNIA 1T8MA 1EOJA 2B8OH 4AB8A 2FOGA 1J8AA 2Y7ZA 1O2JA 3T2NA 4ZAEA 1OWHA 1BTXA 4Y79A 3QLPH 1AMHA 1DY9A 1S0RA 1YP9A 5EU8A 4GHTA 4TYDA 1GMDG 1WAYB 3V7TA 1THSH 1W0ZU 2F9UA 1AVWA 3K2UA 3MYWA 3VB6A 2WPHS 4BOHA 2JJ2D 2ZPQA 1GL0E 4B2AA 2VVUA 5HGGA 1AE5A 1AVXA 1FMGA 2UUFB 1L4DA 1Z1IA 2SGFE 2FODA 1TE0A 1NPMA 5LGOA 3HGNA 3B23B 2LNCA 1AKSB 4MLFB 3KQ5A 2Z9IA 1TGNA 3P6ZB 1TRNA 2OC8A 1ZTKA 3PV2A 3A7XA 1GI6A 1E35B 1ARBA 1AN1E 2EI8A 2G55A 1V2NT 1EAWA 2SGDE 2F3CE 4I33A 1BRAA 3EQ0H 1K1PA 1HYLA 3ZIAD 3ZV9A 2VH0A 1YPJH 3PV4A 4CBOA 2QXJA 4X1RU 2PHBA 1SLVB 1GDUA 4ZXYH 1BTUA 4BANB 1DS2E 1N1LA 1W13U 1D3DB 2ZFRH 1NFWA 4MNVA 1KMHB 2BLQA 5FXLA 5L6NH 1MTNC 1RIWB 3UY9A 3L33A 3VB4A 3ZVEA 1GJ9B 1WSSH 1SGCA 1CBWB 1O2TA 1GI5A 4ZHMU 3RM0H 3SJ8A 4GAWA 3LGWA 1C5OH 3BF6H 2IJD1 4Y10E 4WMFA 4AN7A 2XW9A 1HAVB 1TNKA 3RMNH 5IK2D 1WXRA 2BD8A 5GCHG 1SGFG 4X1SU 3DSPA 4J1YA 3MTYA 3ZZ7A 1SSXA 2FOMB 5EQSA 2BD2A 1Y3UA 2BQ7B 4WH8A 2G51A 4Z6AH 3F1SB 1FIWA 1OSSA 8GCHG 3SNAA 3Q3YA 1LCYA 3K65B 3ZZ5A 2FOAA 1QQUA 1FPCH 1BOQA 1O5CB 4MNWA 2BDYA 5EODA 4WY3A 2ALPA 2G52A 5FX5A 1GI7B 2FOBA 3F2FA 4OS1A 1TWXB 1TMTH 2FOCA 1EFRD 1HJ9A 2WINI 3SV7A 5GDSH 3G01A 1P57B 3MNXA 1V2JT 1EZSC 7GCHG 2B9LA 2SFAA 1WTGH 5GPIB 1V2ST 3VB7A 5JBTA 2SNVA 1MTUA 2FTMA 3M7UA 4ABEA 1O2PA 3S7KB 4M9FA 3U28C 4ZKRU 3MNCA 2C8YB 2VBCA 3TITA 1NROH 2FXRA 1V2OT 3GY4A 4JZ1A 1HJ8A 1BTZA 4Y8YA 2VIQA 3ODFA 1O31A 1GI0A 1INCA 4JMYA 2HLCA 1HCGA 3EDXB 3S9CA 2F9OA 3NK8A 4IN2A 1W0YH 4DJZB 1FJSA 1O5BB 1P2KA 3ZZ4A 3STJA 1SLUB 1O3FA 1BRBE 1QJ6B 5G4BA 1PPFE 4MPVA 1SGQE 1QBNA 1C1QA 3FANA 1XUKA 1AFQC 2AMQA 4FUIA 4ZKNU 5GJ4B 1G36A 1IQEA 2OC0A 3OSYA 1FN6A 5KEDA 5FCRA 1ELEE 1UK4A 3M61U 1ZTJA 3Q3XA 1NO9H 1C5XB 2F91A 4F55A 1T32A 2JKHA 1OWEA 1O34A 1VGCB 3A82A 2ZCKP 1BJUA 3HK6B 3QK1A 3SGBE 3S9BA 1SGNE 1UTPA 4NIVA 1TALA 2IPQX 4X1QU 2KCPA 5TCCA 1ETSH 1GJ7B 1G3EA 2XBYA 1ABIH 1DDJA 4OS5A 1A46H 3Q3KA 3OEED 5J4QA 5B6OA 4AB9A 7KMEH 1VJ9U 2AGGX 1OYQA 2Z9GA 3MFJA 5DPAA 1NFUA 1AWFH 4WMEA 2A45B 2UUYA 3MO6A 3P92A 1A7SA 1YPLH 1VITH 5CMXH 4D9RA 5TCAA 3UREA 3D65E 1C1MA 1P9UA 2A5AA 2W6JD 4YESB 2W7UA 3BG4C 4K69A 3LPRA 4NA7A 4AOQA 2FMJA 3UUZA 2ZF0H 2YOLA 4Q7YA 5C5NA 2VIVA 1RGQA 1H9HE 1O3MA 2M2AA 3F9EA 1DUAA 1IOEA 2L74A 2F43B 3LOXA 1EXFA 1C2MA 4AYVB 3PWCA 2QF4A 1GG6C 2ODQA 1RRKA 2C3SA 2SGPE 1O32A 2TGPZ 1ELGA 1CA0B 1UVUH 4LOYH 3MU5A 2G8TA 3RXKA 5FBIA 5AHGH 3SV9A 3F9HA 1ZJDA 5LPRA 2ZU3A 2EQNA 1O5EH 3W94A 1TPSA 5E0GA 3LGUA 1HLTH 1CE5A 1V2RT 4INKA 1Z6EA 2AFQB 4B75A 1H8HD 1GI9B 1P06A 2HGTH 1UHBB 2YNAA 3AW0A 4AFUA 5C3NA 2ZGJA 1J14A 1O39A 3L3TA 1BHXB 4K8YA 1BQYA 1BBRH 1E79D 1HIAA 1F0UA 2TBSA 2V3HH 3VB5A 2UWOA 1P11E 3UNQA 2GKVE 1QURH 3FAOA 1P2OA 1O3DA 2VB0A 2K0QA 1B0FA 1QTFA 1QR3E 2F83A 3QTVH 4BTTB 1GBMA 1Z8RA 2BVRH 2BVXH 1Z6JH 1C2KA 4F49A 1XKBC 2ZDKA 1C1TA 3FP7E 3D62A 1NY22 5L2YH 3S69A 3SNBA 3O8BA 1O3HA 4DVAU 2B7DH 2OQ5A 1KXFA 1WU1A 1T31A 3GY7A 1EKBB 1WUNH 5DP8A 1G3DA 2ZU4A 2A4RA 4YLUA 1TNIA 1GHYH 1CHGA 4KKDA 1D6WA 5EGMA 3T29A 5HYOA 4GLYA 2ZGBH 1FONA 1IQLA 2PKSB 2ZQ1A 1TONA 1O2KA 1QGFA 4I32A 1PQ5A 3F6UH 3SNDA 1HAXB 1HDTH 5CDFE 3VB3A 3W95A 3SHAH 1P05A 3HGPA 1AE8H 5EPYA 5AVDA 4NG9H 4A5TS 1DWEH 1ELAA 1N8OC 3Q76A 1P8VC 4Y0ZE 3EGKH 3QN7A 1DWBH 4K2YA 2HPQH 2QN5T 1KDQB 5DG6A 1MAYA 1V2UT 1RJXB 3V13A 5IYTA 3P70B 1EZQA 3F2GA 2UWLA 5E2PA 4GCHF 1C2EA 3NRLA 1CGJE 1DY8A 3MU0A 2WHXA 4YOJA 5C20A 4Y8ZA 1TBQH 1TOCB 2Y5HA 1HGTH 5HKKD 2I6SA 1AY6H 4UONA 2GVFA 1UTQA 1Z7KA 1Y5AT 4AGKA 9LPRA 1T8LA 1F7ZA 5F53A 2UUKB 2A31A 1IQFA 1K21H 5AFYH 1HBTH 4BTIB 2XRCA 4ZHLU 1KYNA 2BDHA 2KAIA 3E16B 4RSPA 2BDBA 1ANBA 1O2GH 4JZDH 3TU7H 2BZAA 3ZVGA 2ASUB 2ZHEH 3RC5A 3M3TA 3BSQA 2EY4C 2AMPA 3V12A 4ASUD 5JB8S 1O3KA 1SQRA 1ZHMA 1SFQB 2ZDNA 3T5FH 1KLJH 2FS8A 3SU0A 1GHBG 1AUJA 4NSYA 2GZ8A 1SKYE 1P3EA 3I77A 2D26C 1GJBB 1T8OA 3RXEA 1IHTH 3RU4E 3RLYH 1LVMA 2IJOB 1GHZA 3CNRA 1O2VA 1AZZA 2YMSB 1JIRA 1FXYA 1L1JA 1PPCE 3SJ9A 4ISLA 1GBJA 1QA0A 1GBKA 2OTVA 2OD3B 3LDXH 4J2YB 1GI2A 3ZVAA 2FS9A 2Y80A 4DIHH 2HALA 1NRPH 1BTPA 2GCHG 3UWJH 5C94A 1OP0A 1Y3XA 2FX4A 1ESBA 1XUHA 1QFKH 2NU1E 4XFQA 2BB4A 2F9NA 4MPWA 2FO9A 1EJMA 3ZZ9A 2KCOA 3AASA 4FUGA 1DITH 5PTPA 1K28D 3RXMA 3SUFA 2O8LA 2PR3A 1CA8B 4OGYA 3LGIA 6CHAC 3A81A 1UK2A 3MU4A 4JYUH 4A6LA 2P3UB 4Q80A 2QXGA 1GHAG 4OS6A 3MU8A 5CHAB 1C5VA 4SGAE 2R9PA 2ZDAH 1O3NA 3PV5A 1S0QA 3K6ZA 4UDWH 1A1RA 3WW7A 3BIUH 1JBUH 1EPTB 3UWIA 2I6QA 3HPTB 3MNSA 1SFIA 3EE7A 2Q1JA 2WPDD 4ISOA 3U98H 1SPJA 1NZQH 4FXGH 2QF3A 2L6OA 2KFWA 2EC9H 1O2IA 1S82A 4CR9A 1HAZB 1G37A 2ODPA 1AU8A 1Q3XA 3GY8A 2R2WU 2ZFFH 2Z3CA 2BM2A 4YO9A 3V3MA 4D7GA 1NU9A 2JDID 2ANMH 3F68H
chains in the Genus database with same CATH topology
1P03A 3GCHB 1P9SA 2J95A 7LPRA 1W8BH 1QBVH 2XBXA 4LXBH 1L0ZA 1U6QA 2JH5D 2ZNKH 2FWWA 4Y0YE 2ZU1A 3BEIB 1CVWH 1PPHE 1H8IH 1THPB 1A61H 4X8SH 3O8CA 2SGAA 1VJAU 2PTNA 3CENA 3SORA 2FTLE 2O8TA 2VWNA 3A7VA 3E90B 1EZUC 1ORFA 4FUDA 3E6PH 1PYTD 3ZZ6A 1AUTC 2TGDA 3PTBA 4D9QA 3PLBA 2B5TB 4CRGA 2Y81A 1C2LA 3SUDA 4Y11E 4IC6A 2IN2A 3GYMA 1G30B 3QDZB 1Y3WA 1HJAC 2FYQA 3RXRA 4BAOB 3VXEH 4F4OC 4XE4A 1K1NA 1IQIA 1DUEA 1O2XA 4BNRA 1DWDH 1GCTB 2PUQH 1V2PT 3NPSA 4Z0KA 5GWZA 1ELCA 1UCYK 2H1UA 1ZGIA 3NUMA 8KME2 5EG4A 4VGCC 1SMFE 1O5DH 4O97A 1CGHA 3TIUA 2GX4A 5JYIA 3LH3A 3F9GA 2ZTXA 3ZVCA 3BTWE 1QBOA 2AEIH 1KTTB 4AGJA 1VITG 2SGEE 5EQRA 3SV6A 3MO3A 1GGDC 3PTNA 1IHSH 1N8OB 2ZFSA 1LQEA 4FUFA 1AVGH 3LC3A 4RN6A 1GI4A 4NFEA 1WOFA 2NU4E 1PQAA 1E37B 1LVBA 3TH3H 1GBFA 3PO1B 1EAIA 4FUBA 2HRVA 1CGIE 1GBEA 2ANKH 3GDVA 1AKSA 3RM2H 2A7CA 1LMWB 3OY5U 1XUFA 5ETXA 2ZGHA 3GCTF 1TGSZ 2FOEA 1PQ7A 2BXTH 3I78A 3H5CB 4YOIA 2IOTA 1ZZZA 2QV1A 2BLVA 5FAHA 2ODYB 1BTWA 1AHTH 2OQUA 2CHAC 1J9CH 3AVZA 1TMBH 3TNTA 3ODDA 1GBLA 4HFPB 2A5KA 1O2UA 2BX4A 1XM1A 2AH4X 2GD4B 3B8JA 1C5YB 3HKIB 3KCGH 3LJJA 4O3UA 1MD7A 4NSVA 3SU6A 4U30A 1K22H 4M7GA 4IBLH 2GV6A 2CJIA 2OBQA 5F03A 2ZDLA 1XXFA 4ISIH 4BXSA 4X2VA 1GMHG 1O2SA 1ZHRA 1Z71A 1ZSJA 3BTFE 1P12E 1NC6A 6GCHF 1MUEB 2XCNA 2EEKA 5DP3A 1HAVA 3A8DA 2A7JA 1BMMH 1O3AA 1QRZA 2FLRH 1FY5A 1M9UA 3SO3A 4K3JA 4JK6A 1LVOA 3AW1A 2NU2E 3A86A 5EPNA 5AF9H 1P3CA 1QRXA 1GVZA 1VZQH 1BCUH 3SW2B 3RXTA 2VIWA 1T4VH 2VH6A 3SI4H 5DO4H 1Y3YA 2ZU2A 4KTUA 1HPGA 3GCOA 1MCVA 1C1NA 1NFYA 1PPBH 3HKJB 4AZ2B 2A1DB 3MI4A 1YLDA 3SJOA 5HXFA 1MZAA 3TJNA 1NU7B 2HOBA 4CRAA 3TJUA 1OWIA 4ZKOU 4ZMAH 4DGJA 2ZDMA 1GBTA 3GISB 4CR5A 4MDSA 3LKWA 1LHDH 2VINA 5FPYA 5E2OA 2Q6DA 1IQKA 3ATLA 1CHOG 4MQAA 2PKAB 4AX9H 2FOFA 1KY9A 4NIWA 4BAMB 1QY6A 3N7OA 1SGFA 1DPOA 1GBIA 2PV9B 2G5NA 4WVPE 1CSOE 1C5WB 3EAJA 2P59A 1EB1H 1MU8B 4TWYA 8ESTE 1GPZA 1O3PB 1ANDA 1NTPA 4FU9A 4UFGH 1SLXB 1MBMA 2QC2A 1NRNH 1SHHB 3ZZAA 1OKXA 4A92A 2QF0A 2XNIA 5DP4A 3LT3A 4BAKB 1GCDA 1ZSLA 1GBHA 3UOPA 1OPHB 2STBE 1TB6H 2Z3EA 1XUJA 4D76A 4CHAC 2FPZA 3MOCA 2C93B 1O37A 3C27B 4TY7A 5DP7A 3UOUA 2CN0H 3OX7U 3RXOA 3RXVA 3VEQB 3VGCB 3A8CA 4RKJB 4IN1A 2TRMA 4B71A 2ZGCA 5JBCS 1V2TT 1GMDF 4X1PU 1HAPH 1PPEE 4R8TB 1XMNB 1SGYE 1TMUH 5K0HA 3PYHA 4HGCA 2Y5GA 2CF8H 4GVUA 4CRDA 1X7AC 1Y59T 2Z94A 4K60A 4IMZA 1SOZA 4ABDA 2GTBA 4Q7XA 3BTEE 3QTOH 1YPMH 2G00A 1OWJA 2VVCA 3KF2A 3UQOA 1YPHE 1LDTT 4UEHH 3LJOA 4I31A 2H6MA 3AAUA 3A85A 1H8DH 3JZ2B 4ISHH 1YYY1 3TLOA 1D4PB 3GY2A 4U32A 3EA8A 1GJCB 2H2ZA 1P2NA 1TA6A 3NWUA 1C5SA 1C5MD 5F6MA 3I29A 4K5ZA 1HAYB 1BITA 1QL7A 2BVSH 4XBDA 1Y5UT 1HAGE 1C2HA 1AO5A 3NKKA 1GI8B 1FIZA 1DXPA 3F9FA 3KQEA 4CRBA 2PW8H 1BTYA 1A0HB 2P8OB 4OGXA 1NFXA 1C9TA 3MU1A 4AFQA 2CXVA 1C5TA 7ESTE 1MQ5A 4MG3A 4D7FA 3GY3A 2JETC 2ZA5A 1TGTA 1HXFH 1D3PB 2PLXA 3IWMA 2FI5E 4MNYA 2FEQH 5A0CA 1TBZH 2R0LA 4X6OA 5GCHF 1FQ3A 5FPSA 3FFGA 2G4TA 4ASHA 2JH6D 3FP6E 1ZOMA 8GCHF 1AB9C 3A89A 1SR5C 2EI7A 2HPPH 3RXDA 5DKMA 2BMGB 1KLTA 1F92A 2A4QA 3SJKA 2J34A 1TNJA 4Y76A 4DURA 2ZKSA 3BTTE 4HI3A 1H1BA 1EAXA 2AYWA 1O38A 1UTKA 4WJG2 1KXEA 1ZMJA 2CGAA 2ZI2H 3UFAA 1ZPZA 4ISNA 4NZLA 3RXBA 1SGDE 2W5EA 1F0RA 5F8TA 1B0EA 4FVBA 1EJNA 1QL8A 9ESTA 1TX8A 4H6TA 1YBWA 2V35A 7GCHF 1GI1A 3U1JB 1A2CH 1EP5A 1P2MA 4CBNA 2ESTE 1DLEA 4A7IB 4KTCA 1KLIH 1AQ7A 3RXIA 2Y6TA 1LPKB 3TK6A 4BTUB 1QQ4A 1DWCH 1MTNB 5DP5A 3U8TH 1CU1A 2ANWA 3BN9A 1KXBA 4YZUA 1B5GH 1K1IA 1O3OA 4HZHA 1V3XA 2XWBI 5DJ7A 3RDZA 2VGCC 2O8MA 1RTKA 1D6RA 4A1VA 1GJ8B 4CREA 3E8LA 1V2QT 4LK4A 4DW2U 3M7QA 4BXWA 1GVKB 3LGTA 3SU3A 2Z9JA 1IQHA 2ZQ2A 2BDAA 2Q6FA 3RLWH 5DP9A 4ABIA 1Z1JA 1Y8TA 1ZRKA 2LPRA 2NU3E 1IAUA 1TQ7B 1WCZA 2VIDA 1LHFH 5C2ZA 1MD8A 1BT7A 2QGRA 4A1XA 4X0WU 3P95A 3RMOH 1KTSB 1THRH 1ELDE 2BLWA 4XDEA 3TJOA 1L1NA 3T28A 1GBCA 4ZROA 1PPGE 1ABJH 5E0JA 1HIAB 3Q77A 1C1VH 1WQVH 1QHRB 1LKBA 1P02A 4Y6DA 1TPOA 3TGIE 1UTJA 1N6XA 1O2WA 1FAKH 1ID5H 2R0KA 1DFPA 2OC1A 5GXPA 3FZDA 2C8XB 4I8KA 2VWOA 2OCVB 4Q2KA 2C8WB 5DP6A 1P09A 1FLEE 3ZZ3A 2HNTE 1SGEE 1SQOA 3UR6A 4UE7H 1S81A 2QCYA 1QJ7B 2Z6BD 1FY3A 1ELTA 3UTUH 3NCLA 1GHVH 2CF9H 2A2XH 3E3TA 3DFLA 5FCKA 4ZXXH 1A4WH 4AG1A 4GSOA 1XXDA 2FI3E 1UCYH 1C5LH 2ZHWH 4FU8A 1C5RA 2V3OH 3U69H 2UUJB 2V6NA 3UNRA 5A0AE 1C1RA 2ANYA 1C5UA 1T7CA 1AFQB 3PMAB 4O3TA 1XKAC 1RTLA 1TIOA 1SVPA 1E38B 1CT0E 3T62A 4H42U 3L6PA 1G3CA 1BTHH 1FN8A 3IITA 1VR1H 2QY0B 3QGJA 1FY8E 3QWCH 1EJAA 4ABJA 1GMCF 1S6HA 1RTFB 3BIVH 2Z3DA 1C9PA 1TNHA 3V0XA 3SNEA 1SB1H 1GI3A 1ZJKA 2BD4A 3SOSA 1UK3A 2HWLB 1H4WA 1YC0A 1A3EH 1Z8GA 2R3YA 2XBWA 4XSKU 1C5ZB 1OS8A 2EI6A 3P8NA 2ILNA 3FVFB 5LPFA 1GDQA 3QX5H 2Y5FA 4NIYA 1WYKA 3UPEA 1EOLA 1SGTA 1TNGA 3RXPA 2AGEX 4CRFA 1JRTA 2FM2A 4AFSA 4K1SA 1NM6A 1TX7A 1TPAE 1E34B 1DXWA 3U9AH 6ESTA 1DE7H 3KQCA 1E36B 1FAXA 2GGVB 2ZTYA 3SQEE 2AERH 1BBRE 1RIWC 2Y7XA 5A8XA 4MVNA 3BG4B 4WF8A 1FPHH 1CBWC 3MNBA 1XX9A 1ZYOA 4H4FA 2PGBB 3M3SA 1JMOH 2H5DA 4X2YA 2BXUH 1IQMA 5EXLA 3SU2A 2OLGA 1T4UH 2ZCHP 2XTTB 4YT7H 3SJIA 1P2QA 1GG6B 4OS7A 1AD8H 1C1OA 1QA7A 1TOMH 1LKAA 1W12U 2BY9X 4CH8B 4DOQA 3TH4H 1AWHB 4I7YH 2TIOA 2XC4A 5JBBS 2ZFPH 6LPRA 4X8TH 1HB0B 5T6GA 2XC5A 1FZZA 3A7WA 1S83A 3NXPA 5F8XA 3LGYA 3LIWA 1MTWA 1ESAA 2W3KA 1BJVA 2Q6GA 4QT8C 4NGAH 1H9IE 2UWPA 2RA3A 1TABE 2EA3A 3A8AA 1SBWA 6GCHG 5SGAE 3SHCH 2R2MB 2BD5A 2O9QA 5C1UA 4PROA 3RU4T 2A32A 2OC7A 2QA9E 1PFXC 1SI5H 3DA9B 3KQDA 5LH8A 4I8GA 1NN6A 3ZV8A 3GY5A 4I8JA 3RXLA 1YPGH 3SI3H 2C8ZB 1V2WT 4A1TA 2ALVA 2J94A 2ZCLP 3M5LA 3GCNA 4K1TA 1ANCA 1RFNA 5FPTA 1QCPA 2QAAA 2G81E 1CT4E 1RXPA 4UFDH 1TQ0B 5T6FA 1G32B 2OBOA 2F9BH 3BG8A 1TBRH 1O35A 1GHBF 1JWTA 1OOKB 1S85A 2FI4E 3EE0B 3M5MA 3TK9A 1HAOH 4KP0A 5EXNA 3BTDE 1JXPA 5AFZH 5L30H 5EW1H 2BYAX 1TRMA 2BHGA 8LPRA 2ZZUH 1QIXB 1F5RA 1UCYE 1QJ1B 2IPHA 3PMBB 3SBKA 1LHGH 1BMLA 3RXAA 3GICB 3RC6A 3A84A 4NZQA 1NESE 1ESTA 4MNXA 1DX5M 3LH1A 3KGPA 1VGCC 2G4UA 3FP8E 1MCTA 3DHKH 2PFEA 2FZZA 5ABWA 3RP2A 2XCFA 1ETRH 1MMJN 2BY5X 2WPIS 1IQJA 2STAE 3URDA 2ZPSA 2FLBH 1ZR0A 2FYRA 2P94A 1UTMA 2ULLA 1ELVA 4IMQA 1P10A 2WV5A 1A5GH 1O5AB 1BUIA 3LC5A 1ZPBA 1Z8IB 1GHAF 1MKWK 3RXSA 2Z9KA 1DANH 2BQWB 2C90B 3KN2A 2XYAA 2TPIZ 1O3LA 2WPLS 2WUBA 2AMDA 3SQHE 2VIOA 3T26A 1S84A 1GBAA 4NCYA 1K2I1 1HXEH 5FX6A 3OTJE 4WXIA 2GCTC 1DICA 1EAUA 3M36A 3SU1A 4R0IA 1TGBA 5E0HA 5BPEA 1SG8B 3O8DA 3ATIA 3R3GB 3P8GA 4Y7AA 3PLPA 1A3BH 3U8OH 2TGAA 4B2BA 1MH0A 1O2YA 3KIDU 3RMLH 1TLDA 1CA0C 1C5PA 1HV7A 4U2WA 1BMNH 2Z7FE 3O8RA 3ITIA 5ESTE 2D2DA 5ESBA 3EA9A 2A5IA 2BTCE 3PB1E 4IC5A 1O3EA 1IQGA 1EASA 4XBBA 2OXSA 1AFEH 2THFB 1Y3VA 1PYTC 3TJVA 5C1XA 2XC0A 2PKAA 1GL1A 3OYPA 4X6MA 1BMAA 5K7RA 1PJPA 4X2WA 1WTHD 3EA7A 3MHWU 5I46H 2QIQA 2WPMS 5FBEA 3MH7A 1YLCA 2ZG0H 4IS5A 3TGKE 2A4GA 2H9TH 3M5NA 2GMTC 6CHAB 1FY1A 1GDNA 1A0LA 2ZFTA 1EQ9A 1YCPK 2HNTF 4INLA 4X1NU 3M37A 5T3HA 4ZUHA 4FU7A 1NRQH 3HATH 4IW4E 4E7NA 3ENSB 2W3IA 3P17H 3GDSA 5A2MH 5EQQA 1V6DA 4BAQB 2ZP0H 2VIPA 2A2QH 1BB0B 4FUCA 3S0NA 2VWMA 4FUEA 3PMJA 1O3JA 1LHEH 3AAVA 3RXFA 4NWKA 1K1JA 1O2LA 4OS2A 3QZRA 4JYVH 4WH6A 1J16A 1LHCH 4MPUA 1NS3A 5BRRE 1LPZB 2A0QB 1VITF 2PKSC 1BZXE 3ELAH 1SHYA 1K9OE 2OUAA 2BZ6H 4NA9H 2ZTZA 4Y8XA 1VCWA 1KXAA 4K8BA 3SGQE 1C2FA 2GZ7A 4UFFH 4ESTE 2ZC9H 1P04A 1P01A 4HTCH 4IGDA 4CRCA 1E0FD 4JYTA 2PUXB 2J4IA 4AFZA 1GVLA 2D1JA 3KQBA 4KGAA 3U8RH 1ZPCA 1YM0A 3IG6B 1TFXA 1J17T 1ZRBA 1K1MA 2VU8E 1H9LB 1MKXK 4DY7B 3P8OA 1O2HA 1O3GA 5C67A 2XWAA 3KNXA 2SGQE 2GP9B 4ZHAA 1IQNA 4JK5A 5J4SA 2PTCE 1HJAB 4GUXA 1O33A 3E1XB 3R0FA 3MH5A 2BY6X 3MO9A 3CP7A 1GMHF 3GDUA 1C1PA 1TGCA 1UTNA 3KL6A 1WQSA 5LPEA 1W11U 2A4OA 4VGCB 5TJXA 1F0SA 2ZHDA 1QB1A 2ZECA 3URCA 1HAIH 1C4U2 5CE1A 1ZGVA 2VNTA 2BDCA 2RCEA 3MH4A 3QGNB 1UVSH 1AIXH 4FUJA 1O2NA 3M35A 2GT8A 4YTAA 1NRSH 5T6DA 5E8EH 1OYTH 1GGDB 1W7GH 1YPEH 4LZ4B 1UTLM 1QB6A 4XBCA 1YPHC 3H7OA 3ZYEA 5L2ZH 1SC8U 3PROA 1BRCE 3OU0A 2ZHQH 2PGQB 1ANEA 3QO6A 1NT1A 2H9HA 1FV9A 1ZMLA 1J15A 1UHBA 1EATA 1G2LA 2BOKA 1MBQA 3BV9B 3D23A 1FY4A