1V2LT

Benzamidine in complex with bovine trypsin variant x(triple.glu)bt.d1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2lT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2lT02
3MO9A 4JZIA 1P03A 2CHAB 3UQVA 1LQDB 1DUAA 3GCTF 4FUCA 4Y10E 1CSOE 1FZZA 1QA0A 3TJVA 5C2ZA 1Y5BT 4X8TH 1O2SA 4TWYA 1RIWB 2F9NA 3D49H 2G55A 2PTCE 4BAOB 1GJ9B 3OY5U 2PKSC 3W95A 3KGPA 3LGVA 4K8YA 1ZHRA 2HLCA 4KP0A 3F1SB 5A09A 3SGAE 5DP9A 4CBOA 1SGPE 4DIHH 3BG8A 4F49A 5GXPA 2SNVA 1A46H 1ZTLA 2WYJA 5JBBS 3GY7A 2BLVA 1Z8IB 1RS0A 5EPNA 2BD3A 5HGGA 1UJ1A 2ZFQH 1C2LA 4GVUA 4ZKRU 1H8DH 2VWOA 1CO7E 3PMAB 1DY9A 1UTPA 2ZDVH 4DURA 3SV8A 2Q6GA 3FP8E 2A0QB 3E0NB 2YOLA 3STJA 1EP5A 1F0UA 2ZFRH 3T27A 4BXWA 1YP9A 4ABAA 9ESTA 2OQUA 3BTQE 1QJ6B 3C1KA 4TY6A 6ESTA 5C67A 1C2JA 3BEFB 4JZFH 4ZHLU 4NG9H 4K69A 4FVDA 1FY1A 1IHTH 1UHBA 2GVFA 3PYHA 1S6HA 1AGJA 4A6LA 2QXIA 1TRNA 2QA9E 1C1TA 4BTTB 2SFAA 2OTVA 3BN9A 3LJOA 3PLBA 2F9UA 4UFFH 1HLTH 1ARBA 2ZHFH 1GBTA 2ZFPH 1OX1A 4LZ4B 5FBIA 3ZYDA 3VB4A 2XRCA 2W3KA 2XNIA 4BOHA 5F8XA 3GDVA 1IQLA 1VITG 4Q7ZA 1GI7B 2BYAX 2Y6TA 4INLA 1C5ZB 8ESTE 1P2MA 3RMNH 3ATIA 5A0AE 1O2IA 1O3LA 4Y71A 3GISB 4AGKA 5AF9H 3SUGA 4HZHA 3BG4B 1WOFA 4DVAU 3F6UH 1FQ3A 2FWWA 2AGEX 4I8LA 1ZMJA 1O5EH 1W7XH 3ELAH 3A87A 2VIOA 2G8TA 1DITH 3FVFB 2CGAA 1TGSZ 1BHXF 1QBVH 3RMOH 1JMOH 1VITH 3MH6A 5E2PA 2AH4X 2GV6A 1LVOA 3RXIA 2F91A 5EODA 2FOGA 3P8GA 4CH8B 1SGRE 1GMHF 1GVLA 3O8CA 2CHAC 2ZPQA 5HM9A 4BXSA 2RCEA 1D3QB 5JYIA 1O3DA 2ODPA 5C1YA 3MOCA 1RIWC 3ZZ9A 1QFKH 2R3YA 1Y59T 2CXVA 2BQ6B 4A7IB 1SC8U 2BB4A 1YM0A 4CRFA 1W8BH 1O34A 2FZZA 3F9HA 3VFEA 3ZVEA 3QX5H 2C8WB 5T6DA 5ESBA 4ZAEA 1P06A 2PWXA 1O3NA 1DWEH 3A7ZA 3RXUA 5IDKA 5K0HA 1MKWH 3LT3A 1BRBE 3LPRA 1LHCH 2PGQB 2QN5T 2ZG0H 1ZOMA 3FP6E 2PFEA 2XC4A 4XDEA 1MD7A 1LPGB 3HKJB 4X8SH 1MTUA 1D3DB 3TH4H 1OWHA 1HBTH 1Y3YA 1QRZA 1L1JA 1IQGA 4I7YH 3QUMP 1P8VC 2A5KA 2A5IA 2FYQA 3MNBA 4O3UA 1O5DH 2J38A 1VR1H 5L2YH 1C1MA 1BITA 2VIDA 2Z3CA 4I8GA 2BXUH 4GCHF 1QRWA 1GI0A 1EZQA 1EJAA 3SV7A 2SGAA 1GBHA 1MKXK 1MD8A 2A32A 2ZF0H 1E36B 1YPLH 1HAXB 1FAXA 3QO6A 1OP0A 3RXPA 1P2KA 1Z1JA 5FPTA 1UTKA 2HWLB 3ZZ7A 2WPMS 1PPEE 1PPGE 3I29A 4OS2A 2VIWA 1LPKB 3PV4A 3PMJA 1SLUB 1IQNA 5JDUB 4IC6A 5FBEA 2NU0E 1TMUH 4A1XA 1LHEH 1ELBA 2OQ5A 3S69A 2FP7B 5C5NA 1SR5C 5FPSA 1MH0A 1AY6H 3RXQA 3ESTA 4ISNA 1BMAA 1IQFA 1SG8B 4MDSA 1SGTA 2D26C 2EEKA 2BVRH 2UWLA 3ODFA 1T8OA 3A81A 3K9XB 1W10U 1IQHA 1NZQH 3P8OA 1MBQA 4ABEA 5FAHA 3BTDE 1UCYH 4MLFB 4X2XA 5EQRA 4FU7A 2F83A 5JPMH 1C5WB 4YOGA 3Q00A 1W3CA 2VJ1A 1XXFA 1C2KA 2QC2A 3MHWU 4I8KA 3BG4C 3T28A 4YT6H 1O2NA 3TIUA 3QWCH 3SHCH 1UTMA 2Z3DA 2FLRH 3A7XA 1MZDA 1QRXA 2AYWA 2ZDKA 2VVVA 5BRRE 1IQEA 3EAJA 3RXVA 2Z9LA 3NWUA 4FUGA 2VWNA 3UOUA 2GTBA 1TRYA 4R0IA 5EXNA 3SJKA 4B76A 1W0ZU 1GI4A 1PPHE 3SI4H 1SQAA 1V2RT 1TABE 3SJ9A 2OBQA 1MCTA 5ABWA 3MU5A 2OCVB 4I8HA 3HKIB 1TBRH 1MU6B 1Y3XA 1YPEH 4NIYA 3SU0A 1O3GA 1T31A 3VEQB 3SNCA 3V7TA 1GG6B 2EC9H 4X2WA 3MFJA 2P3FH 3PROA 1GMCF 3VXFH 3NCLA 1O5AB 5HYOA 4M7GA 1WQVH 3R0FA 1JXPA 2JETB 1HB0B 1SHHB 4INHA 1D9IA 1FPCH 1AI8H 1AE5A 1O2ZA 2WUCA 2FS8A 2W5EA 4J2YB 2VVCA 3TGIE 4IN1A 5EOKA 4XE4A 1DUEA 1TGBA 1AB9B 3AVZA 3MNCA 5TCCA 1C5SA 3LOXA 1XMNB 1KLJH 1N8OB 2QCYA 3S9CA 2KAIB 3SU3A 2UUYA 1FUJA 1BA8B 2H1UA 5AFYH 2ZQ1A 4ABBA 3OSYA 1EAXA 1BJUA 1O2MA 2FEQH 4FU9A 4XBBA 1AN1E 4DOQA 1Y3WA 2HNTE 3LGUA 4JZ1A 2PW8H 2ZHEH 1NRQH 1G2MA 3V0XA 2DE9A 3TVJB 1XUKA 2ANWA 1SI5H 5F8TA 1G3BA 4X1SU 2GCHF 3NPSA 1V2ST 1S0QA 3ZV8A 1SGEE 1O2GH 3TH2H 2ANKH 4WJG2 4DT7B 1C1PA 3RU4T 2BDCA 1O5BB 5C5OA 4FUBA 3SNDA 1QURH 1HXEH 4IBLH 3SNAA 1EX3A 4UONA 2P94A 2WINI 2BY5X 1OXGA 2PUXB 1ESAA 3P17H 3A7WA 1A0LA 3OYPA 2OC0A 1RTKA 1SOTA 5EU8A 1DX5M 1W11U 2GMTC 1SVPA 4FUFA 1TPPA 1PYTC 3OTJE 1SGFG 1A0HB 3GCNA 3EQ0H 4PROA 1YLDA 5CE1A 3LU9B 1BTHH 4KELA 1EQ9A 1C5QA 3P6ZB 4RN6A 1XVMA 5EPYA 4WF8A 3A7TA 4K1SA 3MYWA 3SHAH 1NC6A 2V35A 3SGBE 2PSXA 2THFB 3CENA 5FCRA 4MNYA 2ZP0H 4YM9A 2A5AA 1QJ1B 4X1RU 4YESB 1HAVB 3SGQE 3RXBA 3TGKE 4J1YA 3SU2A 1A61H 4BAMB 2GD4B 4NSYA 2OLGA 4U32A 2R3UA 1KLTA 1A5GH 5K7RA 1QNJA 1S0RA 1FIWA 2PGBB 3SV2H 1GJ4H 3M7TA 4BTIB 1HPGA 1BMMH 1TNIA 1O31A 4MPXA 3ATLA 5E8EH 4MNWA 2VWLA 5A0BA 1F7ZA 1BQYA 1ZPZA 1Q31A 4ISLA 1ELFA 1GJ8B 1O2VA 1MAYA 4U30A 3P92A 1FXYA 2UUFB 3SUFA 1MQ5A 2O8LA 1P0SH 1UO6A 1SGIB 2Z9IA 3UQOA 1CT2E 1GG6C 1K1OA 2G81E 1UTOA 2ZO3H 4JZDH 5EW1H 3O8BA 1KLIH 3ZVCA 1ACBE 1XUHA 1XKAC 1C2IA 1LKAA 2BXTH 2AGIX 1ZJDA 1A2CH 2JETC 3RM0H 1OS8A 3RXSA 1KY9A 5JB9S 2WV5A 4D76A 1SHYA 3MU1A 4MQAA 4MPVA 1SQTA 4F4OC 2HPQH 1C2FA 1DXPA 4CRBA 1N8OC 1FMGA 3BTWE 2WUBA 1EZXC 2VWMA 8LPRA 1UVTH 1PPBH 1J14A 1BOQA 1P12E 3TITA 1EAWA 2EA3A 3K6YA 2F9PA 4Y0YE 5DP7A 1F0TA 1AZ8A 4FUHA 2ZI2H 1O30A 4CR9A 1BTPA 1OWDA 2ILNA 2J92A 2PLXA 4INKA 1XVOA 3CS7A 3BTHE 1ARCA 1CGIE 1ZTKA 1ANEA 1Y3VA 2H6MA 1HRTH 5GPIB 3T62A 3TGJE 2PUQH 1UHBB 4HFPB 2H9TH 4YT7H 2C8XB 2BLWA 2FM2A 3UNRA 4UE7H 4YOJA 3P95A 3QK1A 1C1NA 3H7OA 2ZU5A 1Y5UT 3CP7A 1IQMA 5EG4A 4Q2KA 3URDA 1C9PA 1SFQB 4D9RA 3F68H 1UVSH 3VB6A 1SSXA 4X8VH 2RG3A 2BD7A 1ESTA 2ZPSA 1LHFH 3FZDA 1L1GA 1C4V2 3AAUA 1TB6H 1Q2WA 1DWCH 3A88A 2A4RA 1BUIA 2AERH 4KTUA 1GPZA 4BAHB 1FAKH 3RMLH 2PHBA 4GLYA 2CN0H 2QF0A 1GBCA 2BDAA 5FXLA 1GVKB 2OINA 1TGCA 2GDEH 2CF8H 1RFNA 4Q7YA 1GHYH 2AMQA 5E2OA 1P2NA 3MO6A 3GCTG 4ASHA 1CHOF 3A83A 3NZIA 3AW0A 3KQDA 1MTNB 1Z6EA 2A7JA 1V2QT 3GDUA 1OWEA 4IMQA 5C1XA 1N6YA 3SUDA 1TA2A 6CHAB 3U98H 1A1RA 1CU1A 4NIWA 3DFJA 1DLKB 2ZECA 1GGDC 4YO9A 3RXAA 2ULLA 5SGAE 1C5UA 4JZEH 2Y82A 4R8TB 1TBZH 4WY3A 4NFEA 1YPHE 3BSQA 5T6FA 2D8WA 2GP9B 1V2JT 1BMNH 4A5TS 1YPMH 3M5OA 1CT0E 2A45B 2UWPA 1KYNA 2C3SA 2ANMH 2TGTA 1QL9A 1IHSH 2M5TA 3FFGA 4Y7AA 1ZGVA 1IQJA 1MKWK 1FNIA 4CRGA 3A7YA 1OWIA 3RP2A 1KXAA 3RXMA 2BX3A 2P8OB 1TGNA 2BOKA 3L3TA 4IC5A 1XUFA 2Z94A 3T29A 3CS0A 1O5FH 1D6RA 1MU8B 3TJUA 3LKWA 1GCTB 1BBRH 4OS5A 1V3XA 2TIOA 4DCDA 3EGKH 2G5NA 3DT0H 1DE7H 1ELTA 6GCHF 1LCYA 3KIDU 1GHBF 1B7XB 1FIZA 1N1LA 4AB9A 2WPIS 3GYLB 1AKSA 4KTCA 3HPTB 1BHXB 1UTQA 2ODQA 1AHTH 1GI2A 1VCQA 1IAUA 1GL1A 2TBSA 3EE0B 1ELEE 4NSVA 1ZLRA 2A7HA 1GHVH 4U01A 3GY8A 2G5VA 1PQ5A 2NU4E 1HAHH 1GMDF 1NFYA 1IQKA 3DA9B 3RXGA 1EJNA 3L6PA 5EQSA 1MZAA 3UREA 1UTJA 1H9HE 2AFQB 4K60A 1WTHD 5GCHF 2B0FA 4ZXYH 2GCTB 1INCA 3BIVH 1TWXB 1CVWH 1HAPH 1C1SA 2ZU4A 2JH0D 3JZ2B 3U8TH 5FX6A 7KMEH 2AIQA 1OWJA 5A2MH 1O2RA 1T4VH 2SGEE 2NU1E 4MNXA 2BDGA 1UCYK 4JMYA 2VU8E 1F5LA 1TLDA 3F9FA 5A8YA 2OUAA 3VGCB 1P9UA 1JIMA 1NPMA 3GY2A 1RXPA 1A3BH 4UDWH 1P57B 3I78A 1O5GH 1BT7A 1NO9H 1O2UA 1G30B 1BMLA 3TNSA 1BB0B 1TNLA 3TPIZ 1TNKA 2RA0A 5C3NA 4JK6A 3BIUH 1NRNH 3RXLA 2ZZUH 1UMAH 3ZVAA 1OWKA 3KHVA 3MTYA 2ZFFH 3RDZA 4BAQB 2FI4E 5C20A 1GMHG 3E6PH 1DSUA 1S5SA 3LONA 2BY9X 4KKDA 1ZTJA 2B9LA 1TALA 1S6FA 4X2YA 2G00A 1UK4A 4OGYA 1SBWA 1MTNC 3RLWH 3UNQA 4FUIA 4ZMAH 1C5PA 2TGPZ 1B0FA 1OP8A 1AMHA 5CMXH 5LGOA 4NGAH 3KNXA 3IWMA 1NY22 1SGYE 2K1QA 1GBBA 2BZAA 2ZQ2A 1KTSB 3HATH 1EAUA 1QQUA 1BRAA 4ABJA 2VH6A 4Y0ZE 4OGXA 1TPOA 4E7RG 1XKBC 4H6TA 3T26A 3IITA 3E90B 4O97A 4ABGA 5TJXA 1QB9A 4ISOA 1NFXA 1BZXE 1ZZZA 4A1VA 2V3OH 2CMYA 1PQ7A 2AGGX 5DKMA 1G36A 2C8YB 1V2KT 2ZGBH 2H9HA 1TAWA 1WV7H 2VIVA 2XWAA 3BTKE 4B2BA 4B71A 4BTUB 1MUEB 4GHTA 2D2DA 2WV4A 2STBE 3SQEE 4IMZA 5JBCS 2P8OC 1WAYB 1DWBH 1V2OT 5GDSH 2BDHA 2BLOA 2J2UA 4AG2A 3KN2A 3A80A 2ZCHP 4GCHG 4NCYA 3ZZDA 1NRRH 2ZIQH 3SU6A 1GCTC 2WYGA 5DK1A 1SMFE 3DUXH 1QR3E 1O33A 1NRSH 4HGCA 1C5NH 2WPHS 8GCHF 2TRMA 2R0LA 2HNTF 5JBTA 4K5ZA 8GCHG 1TGTA 1O2HA 4BNRA 1SGDE 2TGDA 3M7UA 1QQ4A 1GDNA 1O3OA 5JB8S 5JBAS 4MNVA 1O0DH 4ZROA 1KTTB 4X8UH 1MTSA 1WCZA 1G3DA 1AO5A 2QXHA 4XFQA 5ETXA 3M3SA 4CR5A 3EA8A 1AD8H 2XBWA 1BRUP 1ZRBA 1AWFH 3STIA 1AVXA 3URCA 2GCTC 2G4UA 1Z8RA 1W14U 1EPTA 2C4FH 3A7VA 3VPKA 3O8DA 1S84A 2XC0A 1HYLA 5DG6A 1QA7A 1THSH 1TX6A 1MBMA 1J9CH 2WPKS 4ABDA 4AN7A 1UVOA 3GOVB 1TOMH 3QTOH 4FVBA 4WH8A 1LHDH 3SNEA 3VGCC 4NIVA 1DPOA 2BVXH 3KQCA 2UUKB 1QY6A 3P70B 1EOJA 1NFUA 1AZZA 1OPHB 1ZJKA 3UWJH 4DW2U 5A8ZA 5DJ7A 3SV6A 1LHGH 1V2NT 2ODYB 1GI6A 1FONA 3SV9A 4A1TA 1SGNE 4MPWA 1ELVA 1TX8A 1CGHA 2BD2A 1W2KH 3V12A 2JH5D 4AB8A 3S0NA 1JWTA 5LH8A 1MCVA 4B1TA 2J4IA 3LGTA 4TPYA 1L2EA 1UK2A 2G4TA 2O8MA 3GY6A 3H7TA 4THNH 2XBVA 2Z6BD 3NXPA 4B73A 1NN6A 1O3PB 2BY6X 3UR9A 1GI5A 2FX6A 1QBOA 4O03A 1V2UT 2OXSA 1QGFA 4Y6DA 4NA7A 1GMCG 2XTTB 3A82A 3GY3A 1EJMA 3MI4A 1EB2A 2BD9A 5CHAB 1FY3A 3U8OH 2JH6D 3EDXB 2ZCKP 4RKOB 1YPJH 7GCHF 2OBOA 3QTVH 3V3MA 1ZGIA 3P8FA 5BPEA 1HGTH 1PYTD 1TX7A 5HMAA 3UTUH 4Y8ZA 1LVMA 2ZHQH 3M36A 2VVUA 2GKVE 1C2GA 5FHTA 1YBWA 3RXFA 4NIXA 1K1JA 4D8NA 1Z6JH 3BTEE 2QV1A 4X6NA 1GHAF 2ZU3A 2P93A 1PPFE 2BY7X 1SGCA 4Q7XA 1HJ9A 3SW2B 2RDLA 2QY0B 1C1UH 1GDUA 1ZR0A 4X6OA 2BDYA 1E34B 3QZRA 1N6XA 4TY7A 4HTCH 1ETTH 2ZGCA 1QHRB 4SGBE 4JK5A 1UCYE 1P02A 5E0GA 1O37A 3B8JA 1Z8JB 2EI7A 2GCHG 1E0FD 2ANYA 9LPRA 1JRSA 3MNSA 1KIGH 1PJPA 5T3HA 1B0EA 2O8TA 1RTFB 2P16A 3P8NA 3JZ1B 3LC5A 4AFQA 5A8XA 2BQWB 3SBKA 1DWDH 2QYIA 4CRCA 1O38A 2BQ7B 3SZNA 1WSSH 3UY9A 3ZZ6A 1G2LA 2BDBA 3MMGA 1ETSH 1P01A 5DP8A 5GJ4B 3RC4A 1KDQB 2XBXA 2RA3A 3WY8A 1OOKB 1ZSLA 2V3HH 4AYVB 1L1NA 3GY4A 2ESTE 4CRDA 1D3PB 2I6SA 4ZKOU 4LOYH 1AVGH 3LC3A 1EB1H 4K1EA 2BD5A 3RLYH 1S82A 5L30H 1SQOA 3UWIA 1YCPK 1TQ7B 4LZ1H 1GBLA 2F3CE 2ZDLA 1DM4B 1HCGA 3MH4A 1CA0B 3SJIA 3RXCA 3PMHB 3ZVDA 4LXBH 1D6WA 1YF4A 1C9TA 2PV9B 3A85A 5L6NH 1JBUH 3GDSA 1FDPA 2ZDNA 3SUEA 3UOPA 2PSYA 2J34A 1DANH 1HAOH 4NFFA 2F9VA 2QGRA 1GJ7B 1K28D 1OKXA 1AFEH 3OX7U 3PMBB 5EW2H 1LKBA 3MNXA 1RTLA 1V2LT 1NM6A 1GI3A 1ORFA 1BRCE 1GCDA 3K2UA 4I33A 2ZDAH 3PO1B 4X1PU 2Z7FE 2ZU2A 1J17T 1E35B 1O3MA 1L4ZA 1T8LA 1DXWA 4XBDA 3GICB 4ZH8A 3SJ8A 1YCPM 2ZKSA 4X2VA 3SN8A 3MH5A 1HDTH 2HOBA 1QB6A 3M35A 2FESH 3MWIU 1YKTA 1Z8GA 2F9BH 2VH0A 4Y79A 2O8WA 1SGFA 4Y8YA 4UEHH 2FO9A 1AFQB 2SNWA 3A8DA 3QDZB 1D4PB 1LMWB 2H2ZA 3RXDA 1CQQA 5CHAC 2KAIA 2ZTXA 1P09A 1BDAA 1ELAA 3V13A 2W7SA 2YNAA 3DFLA 1DFPA 1DT2A 3ATWA 3U8RH 1C4Y2 2J94A 3TK5A 2ZTYA 2PR3A 1AB9C 1OYTH 1SLVB 1K2I1 1O3KA 5LPRA 1O3EA 3A89A 2TGAA 3M7QA 1TPSA 1HAIH 4ESTE 1QL7A 2H5CA 3QN7A 5LPFA 1O32A 1XUGA 5L2ZH 4Y7BA 1VZQH 1ZPBA 2FX4A 3RMMH 3RXHA 1BBRK 2SGDE 1YPGH 2P59A 2SGPE 1F0SA 4ABIA 4K8BA 1ZHPA 3D62A 1SGQE 3FANA 4NA9H 1TNGA 4FUJA 4NA8A 2NU2E 1XX9A 3QGNB 3SNBA 3C27B 2R2MB 3T2NA 1NT1A 4QT8C 1JOUB 3O8RA 1HIAA 1HJAB 4AZ2B 1T7CA 1SFIA 1O2QA 3OU0A 2XYAA 3TJNA 1G3EA 4ISHH 1HAGE 1UTNA 3M3TA 3B23B 2OP9A 2Y7ZA 1GBEA 3UFAA 2A4GA 1O3IA 1AKSB 1O2WA 2OD3B 1ZHMA 1HV7A 1YCPH 1ABIH 2GDDA 5T6GA 4Z6AH 2B5TB 2BD8A 1QTFA 1V2WT 4X1QU 5G4BA 3A84A 1ETRH 3T25A 3VB7A 1C1QA 1U6QA 1SL3A 3GY5A 2I6QA 1KXDA 2VGCB 1AUJA 2BZ6H 1AVWA 1KXBA 2A31A 2H5DA 3LGWA 4OS7A 2AMDA 1O2TA 1EXFA 3EA7A 1NRPH 1WTGH 3QLPH 1K9OE 1O2JA 1V2VT 4U2WA 1CA0C 2Q6DA 3Q77A 1A0JA 1HAVA 3S9BA 1H4WA 4DJZB 4K1TA 1V2MT 1LPZB 1O3BA 1CE5A 4ZHMU 3EYDA 1FY5A 1EAIA 3VB3A 4ABHA 3AAVA 2BDIA 2Q6FA 1RGQA 5EGMA 1X7AC 1P2IA 1C1VH 5F6MA 2FDAA 1CHOG 4WXIA 1C2MA 2H9EH 1BIOA 1GBFA 3E3TA 3PO1C 2FOBA 1LO6A 3HK3B 1F2SE 4O3TA 4KTSA 4WXVA 2J9NA 4CRAA 3GCHB 1GHZA 4BAKB 4H42U 2HPPH 2XCNA 3UUZA 1C5MD 3ITIA 4GAWA 2NWNA 2IOTA 3W94A 4E06H 1WBGB 2EI6A 5I46H 1O39A 1Z7KA 5FX5A 1VJAU 2ZDMA 1K1PA 1BTYA 1HUTH 1FJSA 1FY8E 2Y5FA 4AORA 3TK6A 2QXGA 1C4U2 2ZU1A 1PQAA 1AFQC 4OS4A 2Y5HA 3ZZ3A 4ZHAA 2P95A 1WU1A 1TNHA 4TWWA 1BTWA 4JCNA 4MPUA 1MAXA 3K6ZA 4TPIZ 5HM2A 4IS5A 1H8IH 1YPKH 1B5GH 2ZFTA 4XBCA 1GJBB 2W7UA 1IQIA 1G3CA 1EZUC 2A7CA 2B8OH 5J4SA 4OS1A 1A5HA 2PKAA 6GCHG 1GHBG 1KXEA 1MQ6A 1PQ8A 2Z9KA 1ZYOA 3SU5A 1C5OH 1A7SA 2IPHA 2J95A 5A0CA 1NROH 3QZQA 1EZSC 4K3JA 1WYKA 2FOMB 1V2TT 3UIRA 2BY8X 2GGVB 2A2XH 3TK9A 4AOQA 2A2QH 1VCPA 4AFZA 1GMDG 1PFXC 1GI8B 1DS2E 2FOHA 1TIOA 1F0RA 2R0KA 2ZA5A 1GBKA 3T5FH 3ZZ5A 1O2PA 1GVZA 2P3TB 1HJAC 1GDQA 1UVUH 5GCHG 4UD9H 2ZCLP 2LPRA 4IGDA 1H1BA 2GZ9A 1O5CB 3S9AA 1CT4E 2C8ZB 2EI8A 1K1LA 1VITF 2Y80A 2UWOA 4NZQA 5DP4A 3UR6A 2R9PA 3ZZ4A 4YOIA 1TFXA 1FY4A 1P10A 1ID5H 8KME2 1ELGA 2VGCC 4FU8A 1FV9A 1RRKA 2XC5A 3A86A 3TH3H 1GHXH 3NKKA 2OC1A 3ZVBA 1GBAA 1Z1IA 3PTBA 3SI3H 5DP6A 2BLQA 3BTTE 5DGJA 1T4UH 3ZZCA 3LDXH 4GPGA 1EPTB 4H4FA 4UFEH 3TU7H 3VXEH 2BD4A 3IG6B 2ZTZA 3MO3A 2O8UA 3MH7A 3A8CA 2BVSH 2C93B 1H9LB 2ALVA 5PTPA 2DE8A 1A4WH 1NFWA 2D1JA 5C1UA 3ENSB 3RU4D 1BBRE 1WUNH 6CHAC 1ZMLA 1K1IA 3GCHC 4Y8XA 2XXLA 3BEIB 4UFDH 1O35A 3E91A 3NUMA 3PTNA 4YLUA 4Z0KA 2BTCE 4I32A 3PB1E 3S7HB 2Y7XA 4WVPE 4GSOA 1K1MA 3KCGH 1GWAA 1UK3A 2CF9H 3BTGE 3RXKA 2FODA 5ESTE 1ZRKA 1ELCA 3RXRA 1V2PT 1Y3UA 1SLXB 2WPJS 4VGCB 1UVPA 1BTZA 4B2CA 1DVAH 4NWKA 2SGFE 3PLKA 1S83A 1C2HA 4E05H 1TBQH 1O3AA 3ZZAA 2QF3A 1TQ0B 2HVXA 1CBWB 1J15A 4Q80A 3Q76A 2FMJA 1JIRA 2NU3E 1FLEE 1JRTA 1THRH 3F9GA 4Y11E 4SGAE 1QCPA 1THPB 1CA8B 1HFDA 1P2OA 2GZ8A 1TMTH 3M5MA 4FXGH 3KQEA 3RXEA 1LVYA 1O3FA 2STAE 2FI5E 1YYY1 3LIWA 4JYUH 4WH6A 3SOSA 1P3CA 1P2QA 4DIIH 1YLCA 4YZUA 4CH2B 1MMJN 1EP6A 1F5KU 3PWBA 2A4OA 3SORA 4XOJA 1LDTT 1SLWB 1C5LH 3ATMA 1P11E 5DP5A 1FPHH 3UNSA 7LPRA 2AMPA 3EA9A 4B74A 2V6NA 1ZSKA 1BJVA 1HXFH 2FI3E 4MG3A 1F92A 4H6SB 6LPRA 2QIQA 4ZKSU 1WQSA 1GI1A 1OYQA 1MTWA 1VGCB 1NESE 3MU0A 1LTOA 5H4IB 4CBNA 1O3JA 3E0PB 3F9EA 1AUTC 2QXJA 1M9UA 4AFUA 4X6PA 2GMTB 3SQHE 2IN2A 1ANCA 2BX4A 3M61U 2PTNA 1C5RA 1O2KA 3VB5A 1KXFA 1O2OA 5FCKA 3MU4A 3U9AH 1ANBA 2OC8A 4D7FA 1GI9B 3L33A 4NZLA 3TLOA 3ZYEA 5IYTA 3RU4E 2FPZA 3KF2A 1P9SA 4YTAA 1L0ZA 1O2LA 1XXDA 1AWHB 1UTLM 1GJCB 1ZPCA 4OS6A 2HRVA 2XBYA 1DDJA 3ZVFA 2ZFSA 2ZPRA 2V0BA 2CV3A 3RXJA 1P04A 1C5YB 1O2XA 1EPTC 2FS9A 2YNBA 1VJ9U 2WPLS 2GX4A 1C2DA 3M5NA 3TJOA 1A3EH 3ATKA 3G01A 1C1OA 4FUDA 5B6OA 3FAOA 4X6MA 1SPJA 5DO4H 5EQQA 2ZNKH 1BTXA 3B9FH 5I25A 2HNTC 4CHAB 4IW4E 1Z71A 2ZHDA 3E1XB 7ESTE 1P2JA 5HXFA 7GCHG 1ABJH 1NS3A 2VINA 3SU4A 3D65E 2ZHWH 1O36A 4AYYB 3DD2H 4MTBA 2Y5GA 3K65B 4VGCC 5J4QA 5AFZH 3LH3A 4B75A 1Q3XA 4RKJB 1C2EA 2ALPA 1W7GH 2GT7A 3ZV9A 1E38B 2ZGJA 1V6DA 1C5TA 1SB1H 1SOZA 3NK8A 1GHAG 5E0HA 2HALA 2XCFA 1CBWC 3KEEA 3D23A 1NU7B 2XW9A 3HGNA 2G51A 3FP7E 1AIXH 2Z3EA 2IJOB 4KGAA 1MKXH 1OSSA 1VCWA 2A4QA 2FOCA 5FPYA 5DP3A 2FOEA 2Q1JA 1K22H 1EKBB 4WMDA 1FN8A 1DICA 2BM2A 1P3EA 1FI8A 3LJJA 4YLQH 3OY6U 1G32B 3SJOA 1K21H 4I8JA 1QB1A 3GCOA 1TPAE 1XUIA 5AVDA 1AE8H 3H5CB 2AEIH 1OP2A 3HGPA 3U69H 1W0YH 5LPEA 5F8ZA 1GL0E 1J16A 1C5VA 2BMGB 1GJ6A 2B7DH 2TPIZ 4AX9H 3RM2H 1AQ7A 1RD3B 2VIQA 1MTVA 3RXOA 4Y76A 1VGCC 1TOCB 2P3UB 1TYNA 1GBJA 1QIXB 1W13U 4ZUHA 1HIAB 1TONA 1XM1A 4WWYA 3U1IB 1HJ8A 1G9IE 1NU9A 2F9OA 3M3VA 1CHGA 3N7OA 4LK4A 1ANDA 2GV7A 3PWCA 1FN6A 1HAZB 1EASA 3LH1A 4MVNA 3ODDA 2VB0A 4GHQA 1F5RA 2BOHB 1S81A 3BTFE 2G52A 3AASA 2Y81A 3ZVGA 2CJIA 1T8MA 2QAAA 3KL6A 3AW1A 3Q3KA 4WMEA 1CGJE 3BV9B 1DSTA 4IN2A 4BANB 4DGJA 3Q3XA 1TA6A 1BCUH 4ISIH 1ESBA 3S7KB 1O3HA 1QL8A 4TYDA 3BTME 2PKSB 2VNTA 3MU8A 3TNTA 1LVBA 2GZ7A 3LGIA 4DG4A 3I77A 1GGDB 1YGCH 2GT8A 2R2WU 1C1RA 4E7NA 3SU1A 1EATA 3QGJA 3R3GB 4AFSA 4AGJA 1GJAB 4CHAC 2ZWLH 1S85A 4ZXXH 3DHKH 2A1DB 4JYVH 5TCAA 5EXLA 1GJ5H 3RC5A 2HGTH 1GHWH 2FYRA 3HK6B 4UFGH 5AHGH 1T8NA 3LGYA 4A92A 4ZKNU 1TE0A 4K2YA 1QJ7B 5GWZA 3FZZA 2AIPA 1DOJA 2Z9JA 3ZZ8A 1C5XB 2Z9GA 1BTUA 2BHGA 2FLBH 1E37B 2FTLE 1RJXB 3SO3A 2C90B 2FIRH 3RXTA 3GYMA 1IOEA 3E8LA 4JYTA 1K1NA 2ZGXH 1QBNA 1GJDB 1ELDE 1DLEA 2SGQE 1XUJA 1AU8A 2FTMA 2VIPA 4GUXA 4X1NU 1KDQA 3M37A 3BEUA 2FXRA 4CREA 4X0WU 1TRMA 4B2AA 1TMBH 2UUJB 2ZC9H 1EUFA 2PKAB 2W3IA 4RSPA 3RC6A 1D3TB 3BF6H 1KXCA 1LQEA 1W12U 2OC7A 1G37A 1GBIA 3KQBA 1ZSJA 3A8BA 1P05A 1T32A 2W26A 4XSKU 4D9QA 4WMFA 1TNJA 2LNCA 5GIBA 1YC0A 4O9VA 3ZZBA 2DUCA 4FUEA 1KSNA 3UPEA 1C1WH 1L4DA 1O3CA 4NWLA 4D7GA 1Y5AT 5EXMA 1ZMNA 1H9IE 4AG1A 1EOLA 5DPAA 2ZGHA 1DY8A 1A5IA 2XWBI 3PLPA 4HI3A 1PPCE 4ABFA 3U1JB 5F03A 2FOFA 2AS9A 1GBDA 1YPHC 4I31A 1HNEE 2FOAA 3E16B 1PPZA 2ASUB 3M5LA 2O9QA 3Q3YA 5E0JA 4DY7B 1NTPA 1O2YA 3RUOA 1HAYB 2JKHA 3A8AA 1J8AA 1Y8TA 2ZEBA 3PM3A 1GBMA
chains in the Genus database with same CATH superfamily
3MO9A 4JZIA 1P03A 2CHAB 3UQVA 1LQDB 1DUAA 3GCTF 4FUCA 4Y10E 1CSOE 1FZZA 1QA0A 3TJVA 5C2ZA 1Y5BT 4X8TH 1O2SA 4TWYA 1RIWB 2F9NA 3D49H 2G55A 2PTCE 4BAOB 1GJ9B 3OY5U 2PKSC 3W95A 3KGPA 3LGVA 3F0OA 4K8YA 1ZHRA 2HLCA 3VG8A 4KP0A 3F1SB 5A09A 3SGAE 5DP9A 4CBOA 1SGPE 4DIHH 3BG8A 4F49A 5GXPA 2SNVA 1A46H 1ZTLA 2WYJA 5JBBS 3GY7A 2L6OA 2BLVA 1Z8IB 1RS0A 5EPNA 2BD3A 5HGGA 1UJ1A 2ZFQH 1C2LA 4GVUA 4ZKRU 1H8DH 2VWOA 1CO7E 1E79D 3PMAB 1DY9A 1UTPA 2ZDVH 4DURA 3SV8A 2Q6GA 3FP8E 2A0QB 3E0NB 2YOLA 3STJA 1EP5A 1F0UA 2ZFRH 3T27A 4BXWA 1YP9A 4ABAA 9ESTA 2OQUA 3BTQE 1QJ6B 3C1KA 4TY6A 6ESTA 5C67A 1C2JA 3BEFB 4JZFH 4ZHLU 4NG9H 4K69A 4FVDA 1FY1A 1IHTH 1UHBA 2GVFA 3PYHA 1S6HA 1AGJA 4A6LA 2QXIA 1TRNA 1S6LA 2QA9E 2AHME 1C1TA 4BTTB 2SFAA 2OTVA 3BN9A 3LJOA 3PLBA 2F9UA 4UFFH 1HLTH 1ARBA 2ZHFH 2EQNA 1GBTA 2ZFPH 1OX1A 4LZ4B 3F0PA 5FBIA 3ZYDA 3VB4A 2XRCA 2W3KA 2XNIA 4BOHA 5F8XA 3GDVA 1IQLA 1VITG 2WSSD 1GI7B 4Q7ZA 2BYAX 2Y6TA 4INLA 1C5ZB 8ESTE 1P2MA 3RMNH 3ATIA 5A0AE 1O2IA 1O3LA 4Y71A 3GISB 4AGKA 5AF9H 3SUGA 4HZHA 3BG4B 1WOFA 2YMSC 4P02A 4DVAU 3F6UH 1FQ3A 2FWWA 2AGEX 4I8LA 1ZMJA 1O5EH 1W7XH 3ELAH 3A87A 4B6EA 2VIOA 2G8TA 1DITH 3FVFB 2CGAA 1TGSZ 1BHXF 1QBVH 3RMOH 1JMOH 1VITH 3MH6A 5E2PA 2AH4X 2GV6A 1LVOA 3RXIA 2F91A 5EODA 2FOGA 3P8GA 4CH8B 1SGRE 1GMHF 1GVLA 3O8CA 5KEDA 2CHAC 2ZPQA 5HM9A 4BXSA 2RCEA 1D3QB 5JYIA 1O3DA 2ODPA 5C1YA 3MOCA 1RIWC 3ZZ9A 1QFKH 2R3YA 3F3BA 1Y59T 2CXVA 2BQ6B 2V3MA 4A7IB 1SC8U 2BB4A 1YM0A 4CRFA 1W8BH 1O34A 2FZZA 3F9HA 3VFEA 3ZVEA 3QX5H 2C8WB 5T6DA 3UB0A 5ESBA 4ZAEA 1P06A 2PWXA 1O3NA 1DWEH 3A7ZA 3RXUA 5IDKA 5K0HA 1MKWH 3LT3A 1BRBE 3LPRA 1LHCH 2PGQB 2QN5T 2ZG0H 4RT0A 1ZOMA 3FP6E 2PFEA 2XC4A 2JDID 4XDEA 1MD7A 1LPGB 3HKJB 4X8SH 1MTUA 1D3DB 3TH4H 1OWHA 1HBTH 1Y3YA 1QRZA 1L1JA 1IQGA 4I7YH 3QUMP 1P8VC 2A5KA 2A5IA 2FYQA 3MNBA 3OE7D 4O3UA 1O5DH 2J38A 1VR1H 5L2YH 1C1MA 1BITA 2VIDA 2Z3CA 4I8GA 2BXUH 4GCHF 2RDEA 1QRWA 1GI0A 1EZQA 1EJAA 3SV7A 2SGAA 1GBHA 1MKXK 1MD8A 2A32A 2ZF0H 3F2FA 1E36B 1YPLH 1HAXB 1FAXA 3QO6A 1OP0A 3RXPA 3OAAD 1P2KA 1Z1JA 5FPTA 1UTKA 2HWLB 3ZZ7A 2WPMS 1PPEE 1PPGE 3I29A 4OS2A 2VIWA 3FKSD 5C94A 2WHXA 1LPKB 3PV4A 3UAIC 3PMJA 1SLUB 1IQNA 5JDUB 4IC6A 5FBEA 2NU0E 1TMUH 4A1XA 1LHEH 1ELBA 2OQ5A 3S69A 2FP7B 5C5NA 1SR5C 5FPSA 1MH0A 1AY6H 3RXQA 3ESTA 4ISNA 1BMAA 1IQFA 1SG8B 5F53A 4MDSA 1SGTA 2D26C 2EEKA 2BVRH 2UWLA 3ODFA 1T8OA 3A81A 3K9XB 1W10U 1IQHA 3N7EA 1NBMD 3SZEA 1NZQH 3P8OA 1MBQA 4ABEA 5FAHA 3BTDE 1UCYH 4MLFB 4X2XA 5EQRA 4FU7A 2GJGA 2F83A 5JPMH 1C5WB 4YOGA 3Q00A 1W3CA 2VJ1A 1XXFA 1C2KA 2QC2A 3MHWU 2WZQA 4I8KA 3BG4C 2QF4A 3T28A 4YT6H 1O2NA 2LP6A 3TIUA 3QWCH 3SHCH 1UTMA 2Z3DA 2FLRH 3A7XA 1MZDA 1QRXA 2AYWA 2ZDKA 2J97A 2VVVA 5BRRE 1IQEA 3EAJA 3RXVA 2Z9LA 3NWUA 4FUGA 2VWNA 3UOUA 2GTBA 1TRYA 4R0IA 5EXNA 3SJKA 4B76A 1W0ZU 1GI4A 1PPHE 3SI4H 1SQAA 1V2RT 1TABE 3SJ9A 2OBQA 1MCTA 5ABWA 3MU5A 2OCVB 4I8HA 3HKIB 1TBRH 1MU6B 1MABB 1Y3XA 1YPEH 4NIYA 3SU0A 1O3GA 1T31A 3VEQB 3SNCA 3V7TA 1GG6B 2EC9H 4X2WA 3MFJA 2P3FH 2QF5A 3PROA 1GMCF 3VXFH 3NCLA 1O5AB 5HYOA 4M7GA 1WQVH 3R0FA 1JXPA 2JETB 1HB0B 1SHHB 4INHA 1D9IA 1FPCH 1AI8H 1AE5A 1O2ZA 2WUCA 2FS8A 2W5EA 4J2YB 2VVCA 3TGIE 4IN1A 5EOKA 4XE4A 1DUEA 1TGBA 1AB9B 3AVZA 3MNCA 5TCCA 1C5SA 3LOXA 1XMNB 1KLJH 1N8OB 1SKYE 2QCYA 3S9CA 2KAIB 3SU3A 2UUYA 1FUJA 1BA8B 2H1UA 5AFYH 2ZQ1A 4ABBA 3OSYA 1EAXA 2KCYA 1BJUA 1O2MA 2FEQH 4FU9A 3SYJA 4XBBA 1AN1E 4DOQA 1Y3WA 2HNTE 3LGUA 4JZ1A 2OK5A 2PW8H 2ZHEH 1NRQH 1G2MA 3V0XA 2DE9A 3TVJB 1XUKA 2ANWA 1SI5H 5F8TA 3DCLA 1G3BA 1NBME 4X1SU 2GCHF 3NPSA 4Q4LA 1V2ST 1S0QA 3ZV8A 1SGEE 1O2GH 3TH2H 2ANKH 4WJG2 4DT7B 1C1PA 3RU4T 2BDCA 1O5BB 5C5OA 4FUBA 3SNDA 1QURH 1HXEH 4IBLH 3SNAA 1EX3A 4UONA 2P94A 2WINI 2BY5X 1OXGA 2PUXB 1ESAA 3P17H 3A7WA 1A0LA 3OYPA 2OC0A 1RTKA 1SOTA 5EU8A 1DX5M 1W11U 2GMTC 1SVPA 4FUFA 1TPPA 1PYTC 3OTJE 1SGFG 1A0HB 3GCNA 3EQ0H 4PROA 1YLDA 5CE1A 3LU9B 1BTHH 4KELA 1EQ9A 1C5QA 3P6ZB 4RN6A 1XVMA 5EPYA 4WF8A 3A7TA 4K1SA 3MYWA 3SHAH 1NC6A 2V35A 2CK3D 3SGBE 2PSXA 2THFB 3CENA 4F55A 5FCRA 4MNYA 1E1QD 2ZP0H 4YM9A 2A5AA 1QJ1B 4X1RU 1SQRA 4YESB 1HAVB 3SGQE 3RXBA 5KECA 3TGKE 4J1YA 3SU2A 1A61H 4BAMB 2GD4B 4NSYA 2LELA 2QE7D 2OLGA 4U32A 2R3UA 1KLTA 1K0HA 1A5GH 5K7RA 1QNJA 1S0RA 1FIWA 2PGBB 3SV2H 1GJ4H 3H09A 3M7TA 4BTIB 1HPGA 1BMMH 1TNIA 1O31A 4MPXA 3ATLA 5E8EH 4MNWA 2VWLA 5A0BA 1F7ZA 1BQYA 1ZPZA 1Q31A 4ISLA 1ELFA 1GJ8B 1O2VA 1MAYA 4U30A 3P92A 1FXYA 2UUFB 3SUFA 4I86A 1MQ5A 4ZCNA 2O8LA 1P0SH 1UO6A 1SGIB 2Z9IA 3UQOA 1CT2E 1GG6C 1K1OA 2G81E 1UTOA 2ZO3H 4JZDH 3CNRA 5EW1H 3O8BA 1KLIH 3ZVCA 1ACBE 1XUHA 1XKAC 1C2IA 1LKAA 2BXTH 2AGIX 1ZJDA 1A2CH 2JETC 3RM0H 1OS8A 3RXSA 1KY9A 5JB9S 2WV5A 4D76A 1SHYA 3MU1A 4MQAA 1UW7A 4MPVA 1SQTA 4F4OC 2HPQH 1C2FA 1DXPA 4CRBA 1N8OC 1FMGA 3BTWE 2WUBA 1EZXC 2VWMA 8LPRA 1UVTH 1PPBH 1J14A 1BOQA 1P12E 3TITA 1EAWA 2EA3A 3K6YA 2F9PA 4Y0YE 5DP7A 1F0TA 1AZ8A 4FUHA 3WWFA 2ZI2H 1O30A 4CR9A 1BTPA 1OWDA 2ILNA 2J92A 2PLXA 4INKA 1XVOA 4AC9A 3CS7A 1H8HD 3BTHE 1ARCA 1CGIE 1ZTKA 1ANEA 1Y3VA 2H6MA 1HRTH 5GPIB 3T62A 3TGJE 2PUQH 1UHBB 4HFPB 2H9TH 4YT7H 2C8XB 2BLWA 2FM2A 3UNRA 4UE7H 4YOJA 3P95A 3QK1A 1C1NA 3H7OA 2ZU5A 1Y5UT 3CP7A 1IQMA 5EG4A 4Q2KA 3URDA 1C9PA 1SFQB 4D9RA 3WWBA 3F68H 1UVSH 3VB6A 1SSXA 4X8VH 1FX0B 2RG3A 2BD7A 1ESTA 2IPQX 2ZPSA 1LHFH 3FZDA 5B6LA 2K0QA 1L1GA 1C4V2 2KCAA 3AAUA 1TB6H 1Q2WA 1DWCH 1YWUA 3A88A 2A4RA 1BUIA 2AERH 4KTUA 1GPZA 5HIZA 4BAHB 1FAKH 3RMLH 2PHBA 4GLYA 2CN0H 2QF0A 1GBCA 2BDAA 5FXLA 1GVKB 2OINA 1TGCA 2GDEH 2CF8H 3KYFA 1RFNA 4Q7YA 1GHYH 2AMQA 5E2OA 1P2NA 3MO6A 3GCTG 4ASHA 1CHOF 3A83A 3NZIA 3AW0A 3GS9A 2K8IA 3KQDA 1MTNB 1Z6EA 2A7JA 1V2QT 3GDUA 1OWEA 4IMQA 5C1XA 1N6YA 3SUDA 1TA2A 6CHAB 3U98H 1A1RA 1CU1A 1COWD 4NIWA 3DFJA 1DLKB 2ZECA 1GGDC 4YO9A 4FETA 3RXAA 2ULLA 5SGAE 1C5UA 4JZEH 2Y82A 4R8TB 1TBZH 4WY3A 4NFEA 4TT3D 1YPHE 3BSQA 5T6FA 2D8WA 2GP9B 2WPDD 1V2JT 1BMNH 4A5TS 1YPMH 3M5OA 1CT0E 2A45B 2UWPA 1KYNA 2C3SA 2ANMH 2TGTA 1QL9A 1IHSH 2M5TA 3FFGA 4Y7AA 1ZGVA 1IQJA 1MKWK 1FNIA 5CHBA 4CRGA 3A7YA 1OWIA 3RP2A 2KX4A 3DSPA 1KXAA 3RXMA 2BX3A 2P8OB 1TGNA 2BOKA 3KYGA 3L3TA 4IC5A 1XUFA 5EJ1A 2Z94A 3T29A 3CS0A 1O5FH 1D6RA 1MU8B 3TJUA 3LKWA 1GCTB 1BBRH 5KGOA 4OS5A 1V3XA 2TIOA 2XOKD 3EGKH 4DCDA 2G5NA 3DT0H 1DE7H 1ELTA 6GCHF 1LCYA 3KIDU 3ZIAD 1GHBF 1B7XB 1FIZA 1N1LA 4AB9A 2WPIS 3GYLB 1AKSA 4KTCA 3HPTB 1BHXB 1UTQA 2ODQA 4F48B 1AHTH 1GI2A 3W1EA 1VCQA 1IAUA 1GL1A 2TBSA 3EE0B 1ELEE 4NSVA 1ZLRA 2A7HA 1GHVH 4U01A 3GY8A 2G5VA 1PQ5A 2NU4E 1HAHH 1GMDF 1NFYA 1IQKA 3DA9B 3RXGA 1EJNA 3L6PA 5EQSA 1MZAA 3UREA 1UTJA 1H9HE 2AFQB 4K60A 1WTHD 5GCHF 2B0FA 4ZXYH 2GCTB 4B6FA 1INCA 3BIVH 1TWXB 1CVWH 1HAPH 1C1SA 2ZU4A 2JH0D 3JZ2B 3U8TH 5FX6A 2RFKC 7KMEH 2AIQA 1OWJA 5A2MH 2KZ4A 1O2RA 1T4VH 2SGEE 2NU1E 4MNXA 2BDGA 1UCYK 4JMYA 2VU8E 1F5LA 1TLDA 3F9FA 5A8YA 2OUAA 3VGCB 1P9UA 1JIMA 1NPMA 3GY2A 5T1VA 1RXPA 2KCPA 3N7DA 1A3BH 4UDWH 1P57B 3I78A 1O5GH 1BT7A 1NO9H 1O2UA 1G30B 1BMLA 3TNSA 1BB0B 1TNLA 4RI0A 3TPIZ 1TNKA 2RA0A 5C3NA 4JK6A 3BIUH 1NRNH 3RXLA 2ZZUH 1UMAH 3ZVAA 3EE7A 1OWKA 3KHVA 3MTYA 2ZFFH 3RDZA 4BAQB 2FI4E 5C20A 1GMHG 3E6PH 1WXRA 1DSUA 1S5SA 3LONA 2BY9X 4KKDA 1ZTJA 2B9LA 1TALA 1S6FA 4X2YA 2G00A 1UK4A 4OGYA 1SBWA 1MTNC 3RLWH 3UNQA 4FUIA 4ZMAH 1C5PA 2TGPZ 1B0FA 1OP8A 1AMHA 5CMXH 5LGOA 4NGAH 3KNXA 3IWMA 1NY22 1SGYE 2K1QA 1GBBA 2BZAA 2ZQ2A 1KTSB 3HATH 1EAUA 1QQUA 1BRAA 4ABJA 2VH6A 4Y0ZE 4OGXA 1TPOA 4E7RG 1XKBC 4H6TA 3T26A 3IITA 3E90B 4O97A 4ABGA 5TJXA 1QB9A 4ISOA 1NFXA 1BZXE 1ZZZA 4A1VA 2V3OH 2CMYA 1PQ7A 2AGGX 5DKMA 1G36A 2C8YB 1V2KT 2ZGBH 2H9HA 1TAWA 1WV7H 2VIVA 2XWAA 3BTKE 4B2BA 4B71A 4BTUB 1MUEB 4GHTA 2D2DA 2WV4A 2F4LA 2STBE 3SQEE 3U28C 4IMZA 5JBCS 2P8OC 1WAYB 1DWBH 1V2OT 5GDSH 2BDHA 2BLOA 2J2UA 4AG2A 3KN2A 3A80A 2ZCHP 4GCHG 4NCYA 3ZZDA 1NRRH 2ZIQH 3SU6A 1GCTC 2WYGA 2J98B 5DK1A 1SMFE 3DUXH 1QR3E 1O33A 4TSFD 1NRSH 4HGCA 1C5NH 2WPHS 8GCHF 2TRMA 2R0LA 2HNTF 4OM9A 5JBTA 4K5ZA 8GCHG 1TGTA 1O2HA 4BNRA 1SGDE 2TGDA 3M7UA 3PV2A 1QQ4A 1GDNA 1O3OA 5JB8S 5JBAS 3PRDA 3N99A 4MNVA 1O0DH 4ZROA 1KTTB 4X8UH 1MTSA 1WCZA 1G3DA 1AO5A 2QXHA 2JJ2D 5IK2D 4XFQA 5ETXA 3M3SA 4CR5A 3EA8A 1AD8H 2XBWA 1BRUP 1ZRBA 1AWFH 3STIA 1AVXA 3URCA 2GCTC 2G4UA 1Z8RA 3F2HA 1W14U 1EPTA 2C4FH 3A7VA 3VPKA 3O8DA 1S84A 2XC0A 1HYLA 5DG6A 1QA7A 1THSH 1TX6A 1MBMA 1J9CH 2WPKS 4ABDA 4AN7A 1UVOA 3GOVB 1TOMH 3QTOH 4FVBA 4WH8A 1LHDH 3SNEA 3VGCC 4NIVA 1DPOA 2BVXH 5CDFE 3KQCA 2UUKB 1QY6A 3P70B 1EOJA 1NFUA 1AZZA 1OPHB 1ZJKA 3UWJH 4DW2U 5A8ZA 5DJ7A 3SV6A 1LHGH 1V2NT 2ODYB 1GI6A 1FONA 3SV9A 4A1TA 1SGNE 4MPWA 1ELVA 1TX8A 1CGHA 2BD2A 1W2KH 3V12A 2JH5D 4AB8A 3S0NA 1JWTA 5LH8A 1MCVA 4B1TA 2J4IA 3LGTA 4M9FA 4TPYA 1L2EA 1UK2A 2G4TA 2O8MA 3GY6A 3H7TA 4THNH 2XBVA 2Z6BD 3NXPA 4B73A 1NN6A 1O3PB 2BY6X 3UR9A 1GI5A 2FX6A 1QBOA 4O03A 1V2UT 2OXSA 1QGFA 4Y6DA 4NA7A 1GMCG 2XTTB 3A82A 3GY3A 1EJMA 3MI4A 1EB2A 2BD9A 5CHAB 1FY3A 3U8OH 2JH6D 3EDXB 2ZCKP 4RKOB 1YPJH 7GCHF 2OBOA 3QTVH 3V3MA 1ZGIA 3P8FA 5BPEA 1HGTH 1PYTD 1TX7A 5HMAA 3UTUH 4Y8ZA 5C17A 1LVMA 2ZHQH 3M36A 2VVUA 2GKVE 1C2GA 5FHTA 1YBWA 3RXFA 4NIXA 1K1JA 4D8NA 1Z6JH 3BTEE 2QV1A 4X6NA 1GHAF 2ZU3A 2P93A 1PPFE 2BY7X 1SGCA 4Q7XA 1HJ9A 3SW2B 2RDLA 2QY0B 1C1UH 1GDUA 1ZR0A 4X6OA 2BDYA 1E34B 3QZRA 1N6XA 4TY7A 4HTCH 1ETTH 2ZGCA 1QHRB 4SGBE 4JK5A 1UCYE 1P02A 5E0GA 1O37A 3B8JA 1Z8JB 2EI7A 2GCHG 1E0FD 2ANYA 9LPRA 1JRSA 3MNSA 1KIGH 1PJPA 5T3HA 1B0EA 2O8TA 1RTFB 2P16A 3P8NA 3JZ1B 3LC5A 4AFQA 5A8XA 2BQWB 3SBKA 2KR7A 1DWDH 2QYIA 4CRCA 1O38A 2BQ7B 3SZNA 1WSSH 3UY9A 3ZZ6A 1G2LA 2BDBA 3MMGA 1ETSH 1P01A 5DP8A 5GJ4B 3RC4A 1VKYA 1KDQB 2XBXA 2RA3A 3WY8A 1OOKB 1ZSLA 2V3HH 4AYVB 1L1NA 3GY4A 2ESTE 4CRDA 1D3PB 2I6SA 4ZKOU 4LOYH 1AVGH 3LC3A 1EB1H 4K1EA 2BD5A 3RLYH 1S82A 5L30H 1SQOA 3UWIA 1YCPK 1TQ7B 4LZ1H 1GBLA 2F3CE 2ZDLA 3PV5A 1DM4B 1HCGA 3MH4A 1CA0B 3SJIA 3RXCA 3PMHB 3ZVDA 4LXBH 1D6WA 1YF4A 1C9TA 2PV9B 3A85A 5L6NH 1JBUH 3GDSA 1FDPA 2ZDNA 3SUEA 3UOPA 2PSYA 2J34A 1DANH 1HAOH 4NFFA 2F9VA 2QGRA 1GJ7B 3F2GA 1K28D 1OKXA 1AFEH 3OX7U 3PMBB 5EW2H 1LKBA 3MNXA 1RTLA 1V2LT 1NM6A 1GI3A 1ORFA 1BRCE 1GCDA 3K2UA 4I33A 2ZDAH 3PO1B 4X1PU 2Z7FE 2ZU2A 1J17T 1E35B 1O3MA 1L4ZA 1T8LA 1DXWA 4XBDA 3GICB 4ZH8A 3SJ8A 1YCPM 3PRBA 2HLDD 2ZKSA 4X2VA 1H8ED 3SN8A 3MH5A 1HDTH 2HOBA 1QB6A 5EIYA 3M35A 2FESH 3MWIU 1YKTA 1Z8GA 1YLNA 2F9BH 2VH0A 4Y79A 2O8WA 1SGFA 4Y8YA 4UEHH 2FO9A 1AFQB 2SNWA 3A8DA 3QDZB 1D4PB 1LMWB 2H2ZA 3RXDA 1CQQA 5CHAC 2KAIA 2ZTXA 1P09A 1BDAA 1ELAA 3V13A 2W7SA 2YNAA 1KMHB 3DFLA 1DFPA 1DT2A 3ATWA 3U8RH 1C4Y2 2J94A 3TK5A 2ZTYA 2PR3A 1AB9C 1OYTH 1SLVB 1K2I1 1O3KA 5LPRA 1O3EA 3A89A 2TGAA 3M7QA 1TPSA 1HAIH 4ESTE 1QL7A 2H5CA 3QN7A 5LPFA 1O32A 1XUGA 5L2ZH 4Y7BA 1VZQH 1ZPBA 2FX4A 3RMMH 3RXHA 1BBRK 2SGDE 1YPGH 4Q63A 2P59A 2SGPE 3OFND 1F0SA 4ABIA 4K8BA 5HKKD 3FO8D 1ZHPA 3D62A 1SGQE 3FANA 4NA9H 1TNGA 4FUJA 4NA8A 2NU2E 4P00A 1XX9A 3QGNB 3KQ5A 3SNBA 3C27B 2R2MB 3T2NA 1NT1A 4QT8C 1JOUB 3O8RA 1HIAA 1HJAB 4AZ2B 1T7CA 1SFIA 1O2QA 3OU0A 2XYAA 3TJNA 2JJ1D 1G3EA 4ISHH 1HAGE 1UTNA 3M3TA 3B23B 2OP9A 2Y7ZA 1GBEA 3UFAA 2A4GA 1O3IA 1AKSB 4HG6A 4ACAA 1O2WA 2OD3B 1ZHMA 1HV7A 1YCPH 1ABIH 2GDDA 5T6GA 4Z6AH 2B5TB 2BD8A 1QTFA 1V2WT 4X1QU 5G4BA 3A84A 1ETRH 3T25A 3VB7A 1C1QA 1U6QA 1SL3A 3GY5A 2I6QA 1KXDA 2VGCB 1AUJA 2BZ6H 1AVWA 1KXBA 2A31A 2H5DA 3LGWA 4OS7A 2AMDA 1O2TA 2W6ID 1EXFA 3EA7A 3FOAA 1NRPH 1WTGH 3QLPH 1K9OE 1O2JA 1V2VT 4U2WA 1CA0C 2Q6DA 3Q77A 1A0JA 1HAVA 3S9BA 1H4WA 4DJZB 4K1TA 1V2MT 1LPZB 1O3BA 1CE5A 4ZHMU 3EYDA 1FY5A 1EAIA 4XRNA 3VB3A 4ABHA 3AAVA 2BDIA 2Q6FA 1RGQA 5EGMA 1X7AC 1P2IA 4XD7D 1C1VH 5F6MA 2FDAA 1CHOG 4WXIA 1C2MA 2H9EH 1BIOA 1GBFA 3E3TA 3PO1C 2FOBA 1LO6A 3HK3B 1F2SE 4O3TA 4KTSA 4WXVA 2J9NA 4CRAA 3GCHB 1GHZA 4BAKB 4H42U 2HPPH 2WV9A 2XCNA 3UUZA 1C5MD 3ITIA 4GAWA 2NWNA 2IOTA 3W94A 4E06H 1WBGB 2EI6A 5I46H 1O39A 1Z7KA 5FX5A 1VJAU 2ZDMA 1K1PA 1BTYA 1HUTH 1FJSA 1FY8E 2Y5FA 4AORA 3TK6A 2QXGA 1C4U2 2ZU1A 1PQAA 1AFQC 4OS4A 2Y5HA 3ZZ3A 4ZHAA 2P95A 1WU1A 3MQKC 1TNHA 4TWWA 1BTWA 4JCNA 4MPUA 1MAXA 3K6ZA 4TPIZ 5HM2A 4IS5A 2YMSD 5FL7D 1H8IH 1YPKH 1B5GH 2ZFTA 4XBCA 1GJBB 2W7UA 1IQIA 1G3CA 5EJZA 1EZUC 2A7CA 2B8OH 5J4SA 4OS1A 1A5HA 2PKAA 6GCHG 1GHBG 1KXEA 1MQ6A 3DSGA 1PQ8A 2Z9KA 1ZYOA 3SU5A 1C5OH 1A7SA 2IPHA 2J95A 5A0CA 1NROH 3QZQA 1EZSC 4K3JA 1WYKA 2FOMB 1V2TT 3UIRA 2BY8X 2GGVB 2A2XH 3TK9A 3FN8A 4AOQA 2A2QH 1VCPA 4AFZA 1GMDG 1PFXC 1GI8B 1DS2E 2FOHA 1TIOA 1F0RA 2R0KA 2ZA5A 1GBKA 3T5FH 3ZZ5A 1O2PA 1GVZA 2P3TB 1HJAC 1WDIA 1GDQA 1UVUH 2KFWA 5GCHG 1W0JD 4UD9H 2ZCLP 2LPRA 2EY4C 4IGDA 1H1BA 2GZ9A 1O5CB 5DN6D 3S9AA 2VBCA 1CT4E 2C8ZB 2EI8A 1K1LA 3OEHD 1VITF 2Y80A 2UWOA 4NZQA 5DP4A 3UR6A 2R9PA 3ZZ4A 4YOIA 1TFXA 1EFRD 1FY4A 1P10A 1ID5H 2F43B 8KME2 1ELGA 2VGCC 4FU8A 1FV9A 1RRKA 2XC5A 3A86A 3TH3H 1GHXH 3NKKA 2OC1A 3ZVBA 1GBAA 2KCOA 1Z1IA 3PTBA 3SI3H 5DP6A 2BLQA 3BTTE 5DGJA 1T4UH 3ZZCA 3LDXH 4GPGA 1EPTB 4H4FA 4UFEH 3TU7H 3VXEH 2IJD1 2BD4A 3IG6B 2ZTZA 3MO3A 2O8UA 1W0KD 3MH7A 3A8CA 2BVSH 2C93B 2M2AA 1H9LB 2ALVA 5PTPA 2DE8A 1A4WH 1NFWA 2D1JA 5C1UA 3ENSB 3RU4D 1BBRE 1WUNH 6CHAC 1ZMLA 1K1IA 3GCHC 4Y8XA 2XXLA 3BEIB 4UFDH 1O35A 3E91A 3NUMA 3PTNA 4YLUA 4Z0KA 2BTCE 4I32A 3PB1E 3S7HB 2Y7XA 4WVPE 4GSOA 1K1MA 3KCGH 1GWAA 1UK3A 2CF9H 3BTGE 3RXKA 2FODA 5ESTE 1ZRKA 1ELCA 3RXRA 1V2PT 1Y3UA 1SLXB 2WPJS 4VGCB 1UVPA 1BTZA 2V7QD 4B2CA 1DVAH 4NWKA 2SGFE 3PLKA 1S83A 1C2HA 4E05H 3DSOA 1TBQH 1O3AA 3ZZAA 2QF3A 1TQ0B 2HVXA 1CBWB 1J15A 4Q80A 3Q76A 2FMJA 1JIRA 2NU3E 1FLEE 1JRTA 1THRH 3F9GA 4Y11E 4SGAE 1QCPA 1THPB 1CA8B 1HFDA 1P2OA 2GZ8A 1TMTH 3M5MA 4FXGH 3KQEA 3RXEA 2HVYB 1LVYA 1O3FA 2STAE 2FI5E 1YYY1 3LIWA 4JYUH 4WH6A 3SOSA 1P3CA 1P2QA 4DIIH 1YLCA 4YZUA 4CH2B 1MMJN 5HIYA 1EP6A 1F5KU 3PWBA 2A4OA 3SORA 4XOJA 1LDTT 1SLWB 1C5LH 3ATMA 1P11E 5DP5A 1FPHH 3UNSA 7LPRA 2AMPA 3EA9A 4B74A 2V6NA 1ZSKA 2KM0A 1BJVA 1HXFH 2FI3E 4MG3A 1F92A 4H6SB 6LPRA 2QIQA 4ZKSU 1WQSA 1GI1A 1OYQA 1MTWA 1VGCB 1NESE 3MU0A 1LTOA 5H4IB 4CBNA 1O3JA 3E0PB 3F9EA 1AUTC 2QXJA 1M9UA 4AFUA 4X6PA 2GMTB 3SQHE 2IN2A 1ANCA 2BX4A 3M61U 5GNDA 3WW7A 2PTNA 1C5RA 1O2KA 3VB5A 1KXFA 1O2OA 5FCKA 3MU4A 3U9AH 1ANBA 2OC8A 4D7FA 1GI9B 3L33A 4NZLA 3TLOA 3ZYEA 5IYTA 3RU4E 2FPZA 3KF2A 1P9SA 4YTAA 1L0ZA 1O2LA 1XXDA 1AWHB 1UTLM 1GJCB 1ZPCA 4OS6A 2HRVA 2XBYA 1DDJA 3ZVFA 2ZFSA 2ZPRA 2V0BA 2CV3A 3RXJA 1P04A 1C5YB 1O2XA 1EPTC 2FS9A 2YNBA 1VJ9U 2WPLS 2GX4A 1C2DA 3M5NA 3TJOA 1A3EH 3ATKA 3G01A 1C1OA 3OEED 4FUDA 5B6OA 3FAOA 4X6MA 1SPJA 5DO4H 5EQQA 2ZNKH 1BTXA 3B9FH 5I25A 2HNTC 4CHAB 4IW4E 1Z71A 2ZHDA 3E1XB 7ESTE 1P2JA 5HXFA 7GCHG 1ABJH 1NS3A 2VINA 3SU4A 3D65E 2ZHWH 1O36A 4AYYB 3DD2H 4MTBA 2Y5GA 3K65B 4VGCC 5J4QA 5AFZH 3LH3A 4B75A 1Q3XA 4RKJB 1C2EA 2ALPA 1W7GH 2GT7A 3ZV9A 1E38B 2ZGJA 1V6DA 1C5TA 1SB1H 1SOZA 1YY3A 2J98A 3NK8A 1GHAG 5E0HA 2HALA 2XCFA 1CBWC 3KEEA 3D23A 1NU7B 2XW9A 3HGNA 2G51A 3FP7E 1AIXH 2Z3EA 2IJOB 4KGAA 1MKXH 1OSSA 1VCWA 2A4QA 2FOCA 5FPYA 5DP3A 2FOEA 2Q1JA 1K22H 1EKBB 4WMDA 1FN8A 1DICA 2BM2A 1P3EA 1FI8A 3LJJA 4DT4A 4YLQH 3OY6U 1G32B 5EJLA 1QZ8A 3SJOA 1K21H 4I8JA 1QB1A 3GCOA 1TPAE 1XUIA 5AVDA 1AE8H 3H5CB 2AEIH 1OP2A 3HGPA 3U69H 1W0YH 5LPEA 5F8ZA 1GL0E 1J16A 1C5VA 2BMGB 1GJ6A 2B7DH 2TPIZ 4AX9H 3RM2H 1AQ7A 1RD3B 2VIQA 1MTVA 3RXOA 4Y76A 5C0UA 1VGCC 1TOCB 2P3UB 1TYNA 1GBJA 1QIXB 1W13U 4ZUHA 1HIAB 1TONA 4YXWD 1XM1A 4WWYA 3U1IB 1HJ8A 1G9IE 1NU9A 2F9OA 1OHHD 2L74A 3M3VA 1CHGA 3N7OA 4LK4A 1ANDA 2GV7A 3PWCA 1FN6A 1HAZB 1EASA 3LH1A 4MVNA 3ODDA 2VB0A 4GHQA 1F5RA 2BOHB 1S81A 5C0TA 3BTFE 2G52A 3AASA 2Y81A 3ZVGA 2CJIA 1T8MA 2QAAA 3KL6A 4RT1A 3AW1A 3Q3KA 4WMEA 1CGJE 3BV9B 1DSTA 4IN2A 4BANB 4DGJA 3Q3XA 1TA6A 1BCUH 3NRLA 4ISIH 1ESBA 3S7KB 1O3HA 1QL8A 4ACBA 4TYDA 3BTME 1BMFD 2PKSB 2VNTA 3MU8A 1LVBA 2GZ7A 3TNTA 3LGIA 4DG4A 3I77A 1GGDB 1YGCH 2GT8A 2R2WU 1C1RA 4E7NA 3SU1A 1EATA 2XNDD 3QGJA 3R3GB 4AFSA 4AGJA 1E1RD 1GJAB 4CHAC 2ZWLH 1S85A 4ZXXH 3DHKH 2A1DB 4JYVH 5TCAA 5EXLA 1GJ5H 3RC5A 2HGTH 1GHWH 2FYRA 3HK6B 4UFGH 5AHGH 1T8NA 3LGYA 4A92A 4ZKNU 1TE0A 2JIZD 4K2YA 4Z1MD 1QJ7B 5GWZA 3FZZA 2AIPA 1DOJA 2Z9JA 3ZZ8A 1C5XB 5DSFA 2Z9GA 1BTUA 2BHGA 2FLBH 1E37B 2FTLE 1RJXB 3SO3A 2C90B 2FIRH 3RXTA 3GYMA 1IOEA 3E8LA 4JYTA 1K1NA 2ZGXH 1QBNA 1GJDB 1ELDE 1DLEA 2SGQE 1XUJA 1AU8A 2FTMA 2VIPA 4GUXA 4X1NU 2J5UA 1KDQA 3M37A 3BEUA 2FXRA 4CREA 4X0WU 1TRMA 4FOUC 4B2AA 1TMBH 2UUJB 2ZC9H 1EUFA 2PKAB 2W3IA 4RSPA 3RC6A 1D3TB 3BF6H 1KXCA 1LQEA 1W12U 2OC7A 1G37A 1GBIA 3KQBA 1ZSJA 3A8BA 1P05A 1T32A 2W26A 4XSKU 4D9QA 4WMFA 1TNJA 2LNCA 5GIBA 1YC0A 3AK5A 4O9VA 3ZZBA 2DUCA 4FUEA 2PP6A 1KSNA 3UPEA 1C1WH 1L4DA 1O3CA 4NWLA 4D7GA 1Y5AT 5EXMA 1ZMNA 1H9IE 4AG1A 2YMSB 1EOLA 5DPAA 2ZGHA 1DY8A 1A5IA 2XWBI 3PLPA 4HI3A 1PPCE 2W6JD 4ABFA 3U1JB 3OTPA 5F03A 2FOFA 2AS9A 1GBDA 1YPHC 4I31A 1HNEE 2FOAA 3E16B 1PPZA 4ASUD 2ASUB 3M5LA 2O9QA 3Q3YA 5E0JA 4DY7B 1NTPA 1O2YA 3RUOA 1HAYB 2JKHA 3A8AA 1J8AA 1Y8TA 2ZEBA 3PM3A 1GBMA
chains in the Genus database with same CATH topology
3MO9A 4JZIA 1P03A 2CHAB 3UQVA 1LQDB 1DUAA 3GCTF 4FUCA 4Y10E 1CSOE 1FZZA 1QA0A 3TJVA 5C2ZA 1Y5BT 4X8TH 1O2SA 4TWYA 1RIWB 2F9NA 3D49H 2G55A 2PTCE 4BAOB 1GJ9B 3OY5U 2PKSC 3W95A 3KGPA 3LGVA 4K8YA 1ZHRA 2HLCA 4KP0A 3F1SB 5A09A 3SGAE 5DP9A 4CBOA 1SGPE 4DIHH 3BG8A 4F49A 5GXPA 2SNVA 1A46H 1ZTLA 2WYJA 5JBBS 3GY7A 2BLVA 1Z8IB 1RS0A 5EPNA 2BD3A 5HGGA 1UJ1A 2ZFQH 1C2LA 4GVUA 4ZKRU 1H8DH 2VWOA 1CO7E 3PMAB 1DY9A 1UTPA 2ZDVH 4DURA 3SV8A 2Q6GA 3FP8E 2A0QB 3E0NB 2YOLA 3STJA 1EP5A 1F0UA 2ZFRH 3T27A 4BXWA 1YP9A 4ABAA 9ESTA 2OQUA 3BTQE 1QJ6B 3C1KA 4TY6A 6ESTA 5C67A 1C2JA 3BEFB 4JZFH 4ZHLU 4NG9H 4K69A 4FVDA 1FY1A 1IHTH 1UHBA 2GVFA 3PYHA 1S6HA 1AGJA 4A6LA 2QXIA 1TRNA 2QA9E 1C1TA 4BTTB 2SFAA 2OTVA 3BN9A 3LJOA 3PLBA 2F9UA 4UFFH 1HLTH 1ARBA 2ZHFH 1GBTA 2ZFPH 1OX1A 4LZ4B 5FBIA 3ZYDA 3VB4A 2XRCA 2W3KA 2XNIA 4BOHA 5F8XA 3GDVA 1IQLA 1VITG 4Q7ZA 1GI7B 2BYAX 2Y6TA 4INLA 1C5ZB 8ESTE 1P2MA 3RMNH 3ATIA 5A0AE 1O2IA 1O3LA 4Y71A 3GISB 4AGKA 5AF9H 3SUGA 4HZHA 3BG4B 1WOFA 4DVAU 3F6UH 1FQ3A 2FWWA 2AGEX 4I8LA 1ZMJA 1O5EH 1W7XH 3ELAH 3A87A 2VIOA 2G8TA 1DITH 3FVFB 2CGAA 1TGSZ 1BHXF 1QBVH 3RMOH 1JMOH 1VITH 3MH6A 5E2PA 2AH4X 2GV6A 1LVOA 3RXIA 2F91A 5EODA 2FOGA 3P8GA 4CH8B 1SGRE 1GMHF 1GVLA 3O8CA 2CHAC 2ZPQA 5HM9A 4BXSA 2RCEA 1D3QB 5JYIA 1O3DA 2ODPA 5C1YA 3MOCA 1RIWC 3ZZ9A 1QFKH 2R3YA 1Y59T 2CXVA 2BQ6B 4A7IB 1SC8U 2BB4A 1YM0A 4CRFA 1W8BH 1O34A 2FZZA 3F9HA 3VFEA 3ZVEA 3QX5H 2C8WB 5T6DA 5ESBA 4ZAEA 1P06A 2PWXA 1O3NA 1DWEH 3A7ZA 3RXUA 5IDKA 5K0HA 1MKWH 3LT3A 1BRBE 3LPRA 1LHCH 2PGQB 2QN5T 2ZG0H 1ZOMA 3FP6E 2PFEA 2XC4A 4XDEA 1MD7A 1LPGB 3HKJB 4X8SH 1MTUA 1D3DB 3TH4H 1OWHA 1HBTH 1Y3YA 1QRZA 1L1JA 1IQGA 4I7YH 3QUMP 1P8VC 2A5KA 2A5IA 2FYQA 3MNBA 4O3UA 1O5DH 2J38A 1VR1H 5L2YH 1C1MA 1BITA 2VIDA 2Z3CA 4I8GA 2BXUH 4GCHF 1QRWA 1GI0A 1EZQA 1EJAA 3SV7A 2SGAA 1GBHA 1MKXK 1MD8A 2A32A 2ZF0H 1E36B 1YPLH 1HAXB 1FAXA 3QO6A 1OP0A 3RXPA 1P2KA 1Z1JA 5FPTA 1UTKA 2HWLB 3ZZ7A 2WPMS 1PPEE 1PPGE 3I29A 4OS2A 2VIWA 1LPKB 3PV4A 3PMJA 1SLUB 1IQNA 5JDUB 4IC6A 5FBEA 2NU0E 1TMUH 4A1XA 1LHEH 1ELBA 2OQ5A 3S69A 2FP7B 5C5NA 1SR5C 5FPSA 1MH0A 1AY6H 3RXQA 3ESTA 4ISNA 1BMAA 1IQFA 1SG8B 4MDSA 1SGTA 2D26C 2EEKA 2BVRH 2UWLA 3ODFA 1T8OA 3A81A 3K9XB 1W10U 1IQHA 1NZQH 3P8OA 1MBQA 4ABEA 5FAHA 3BTDE 1UCYH 4MLFB 4X2XA 5EQRA 4FU7A 2F83A 5JPMH 1C5WB 4YOGA 3Q00A 1W3CA 2VJ1A 1XXFA 1C2KA 2QC2A 3MHWU 4I8KA 3BG4C 3T28A 4YT6H 1O2NA 3TIUA 3QWCH 3SHCH 1UTMA 2Z3DA 2FLRH 3A7XA 1MZDA 1QRXA 2AYWA 2ZDKA 2VVVA 5BRRE 1IQEA 3EAJA 3RXVA 2Z9LA 3NWUA 4FUGA 2VWNA 3UOUA 2GTBA 1TRYA 4R0IA 5EXNA 3SJKA 4B76A 1W0ZU 1GI4A 1PPHE 3SI4H 1SQAA 1V2RT 1TABE 3SJ9A 2OBQA 1MCTA 5ABWA 3MU5A 2OCVB 4I8HA 3HKIB 1TBRH 1MU6B 1Y3XA 1YPEH 4NIYA 3SU0A 1O3GA 1T31A 3VEQB 3SNCA 3V7TA 1GG6B 2EC9H 4X2WA 3MFJA 2P3FH 3PROA 1GMCF 3VXFH 3NCLA 1O5AB 5HYOA 4M7GA 1WQVH 3R0FA 1JXPA 2JETB 1HB0B 1SHHB 4INHA 1D9IA 1FPCH 1AI8H 1AE5A 1O2ZA 2WUCA 2FS8A 2W5EA 4J2YB 2VVCA 3TGIE 4IN1A 5EOKA 4XE4A 1DUEA 1TGBA 1AB9B 3AVZA 3MNCA 5TCCA 1C5SA 3LOXA 1XMNB 1KLJH 1N8OB 2QCYA 3S9CA 2KAIB 3SU3A 2UUYA 1FUJA 1BA8B 2H1UA 5AFYH 2ZQ1A 4ABBA 3OSYA 1EAXA 1BJUA 1O2MA 2FEQH 4FU9A 4XBBA 1AN1E 4DOQA 1Y3WA 2HNTE 3LGUA 4JZ1A 2PW8H 2ZHEH 1NRQH 1G2MA 3V0XA 2DE9A 3TVJB 1XUKA 2ANWA 1SI5H 5F8TA 1G3BA 4X1SU 2GCHF 3NPSA 1V2ST 1S0QA 3ZV8A 1SGEE 1O2GH 3TH2H 2ANKH 4WJG2 4DT7B 1C1PA 3RU4T 2BDCA 1O5BB 5C5OA 4FUBA 3SNDA 1QURH 1HXEH 4IBLH 3SNAA 1EX3A 4UONA 2P94A 2WINI 2BY5X 1OXGA 2PUXB 1ESAA 3P17H 3A7WA 1A0LA 3OYPA 2OC0A 1RTKA 1SOTA 5EU8A 1DX5M 1W11U 2GMTC 1SVPA 4FUFA 1TPPA 1PYTC 3OTJE 1SGFG 1A0HB 3GCNA 3EQ0H 4PROA 1YLDA 5CE1A 3LU9B 1BTHH 4KELA 1EQ9A 1C5QA 3P6ZB 4RN6A 1XVMA 5EPYA 4WF8A 3A7TA 4K1SA 3MYWA 3SHAH 1NC6A 2V35A 3SGBE 2PSXA 2THFB 3CENA 5FCRA 4MNYA 2ZP0H 4YM9A 2A5AA 1QJ1B 4X1RU 4YESB 1HAVB 3SGQE 3RXBA 3TGKE 4J1YA 3SU2A 1A61H 4BAMB 2GD4B 4NSYA 2OLGA 4U32A 2R3UA 1KLTA 1A5GH 5K7RA 1QNJA 1S0RA 1FIWA 2PGBB 3SV2H 1GJ4H 3M7TA 4BTIB 1HPGA 1BMMH 1TNIA 1O31A 4MPXA 3ATLA 5E8EH 4MNWA 2VWLA 5A0BA 1F7ZA 1BQYA 1ZPZA 1Q31A 4ISLA 1ELFA 1GJ8B 1O2VA 1MAYA 4U30A 3P92A 1FXYA 2UUFB 3SUFA 1MQ5A 2O8LA 1P0SH 1UO6A 1SGIB 2Z9IA 3UQOA 1CT2E 1GG6C 1K1OA 2G81E 1UTOA 2ZO3H 4JZDH 5EW1H 3O8BA 1KLIH 3ZVCA 1ACBE 1XUHA 1XKAC 1C2IA 1LKAA 2BXTH 2AGIX 1ZJDA 1A2CH 2JETC 3RM0H 1OS8A 3RXSA 1KY9A 5JB9S 2WV5A 4D76A 1SHYA 3MU1A 4MQAA 4MPVA 1SQTA 4F4OC 2HPQH 1C2FA 1DXPA 4CRBA 1N8OC 1FMGA 3BTWE 2WUBA 1EZXC 2VWMA 8LPRA 1UVTH 1PPBH 1J14A 1BOQA 1P12E 3TITA 1EAWA 2EA3A 3K6YA 2F9PA 4Y0YE 5DP7A 1F0TA 1AZ8A 4FUHA 2ZI2H 1O30A 4CR9A 1BTPA 1OWDA 2ILNA 2J92A 2PLXA 4INKA 1XVOA 3CS7A 3BTHE 1ARCA 1CGIE 1ZTKA 1ANEA 1Y3VA 2H6MA 1HRTH 5GPIB 3T62A 3TGJE 2PUQH 1UHBB 4HFPB 2H9TH 4YT7H 2C8XB 2BLWA 2FM2A 3UNRA 4UE7H 4YOJA 3P95A 3QK1A 1C1NA 3H7OA 2ZU5A 1Y5UT 3CP7A 1IQMA 5EG4A 4Q2KA 3URDA 1C9PA 1SFQB 4D9RA 3F68H 1UVSH 3VB6A 1SSXA 4X8VH 2RG3A 2BD7A 1ESTA 2ZPSA 1LHFH 3FZDA 1L1GA 1C4V2 3AAUA 1TB6H 1Q2WA 1DWCH 3A88A 2A4RA 1BUIA 2AERH 4KTUA 1GPZA 4BAHB 1FAKH 3RMLH 2PHBA 4GLYA 2CN0H 2QF0A 1GBCA 2BDAA 5FXLA 1GVKB 2OINA 1TGCA 2GDEH 2CF8H 1RFNA 4Q7YA 1GHYH 2AMQA 5E2OA 1P2NA 3MO6A 3GCTG 4ASHA 1CHOF 3A83A 3NZIA 3AW0A 3KQDA 1MTNB 1Z6EA 2A7JA 1V2QT 3GDUA 1OWEA 4IMQA 5C1XA 1N6YA 3SUDA 1TA2A 6CHAB 3U98H 1A1RA 1CU1A 4NIWA 3DFJA 1DLKB 2ZECA 1GGDC 4YO9A 3RXAA 2ULLA 5SGAE 1C5UA 4JZEH 2Y82A 4R8TB 1TBZH 4WY3A 4NFEA 1YPHE 3BSQA 5T6FA 2D8WA 2GP9B 1V2JT 1BMNH 4A5TS 1YPMH 3M5OA 1CT0E 2A45B 2UWPA 1KYNA 2C3SA 2ANMH 2TGTA 1QL9A 1IHSH 2M5TA 3FFGA 4Y7AA 1ZGVA 1IQJA 1MKWK 1FNIA 4CRGA 3A7YA 1OWIA 3RP2A 1KXAA 3RXMA 2BX3A 2P8OB 1TGNA 2BOKA 3L3TA 4IC5A 1XUFA 2Z94A 3T29A 3CS0A 1O5FH 1D6RA 1MU8B 3TJUA 3LKWA 1GCTB 1BBRH 4OS5A 1V3XA 2TIOA 4DCDA 3EGKH 2G5NA 3DT0H 1DE7H 1ELTA 6GCHF 1LCYA 3KIDU 1GHBF 1B7XB 1FIZA 1N1LA 4AB9A 2WPIS 3GYLB 1AKSA 4KTCA 3HPTB 1BHXB 1UTQA 2ODQA 1AHTH 1GI2A 1VCQA 1IAUA 1GL1A 2TBSA 3EE0B 1ELEE 4NSVA 1ZLRA 2A7HA 1GHVH 4U01A 3GY8A 2G5VA 1PQ5A 2NU4E 1HAHH 1GMDF 1NFYA 1IQKA 3DA9B 3RXGA 1EJNA 3L6PA 5EQSA 1MZAA 3UREA 1UTJA 1H9HE 2AFQB 4K60A 1WTHD 5GCHF 2B0FA 4ZXYH 2GCTB 1INCA 3BIVH 1TWXB 1CVWH 1HAPH 1C1SA 2ZU4A 2JH0D 3JZ2B 3U8TH 5FX6A 7KMEH 2AIQA 1OWJA 5A2MH 1O2RA 1T4VH 2SGEE 2NU1E 4MNXA 2BDGA 1UCYK 4JMYA 2VU8E 1F5LA 1TLDA 3F9FA 5A8YA 2OUAA 3VGCB 1P9UA 1JIMA 1NPMA 3GY2A 1RXPA 1A3BH 4UDWH 1P57B 3I78A 1O5GH 1BT7A 1NO9H 1O2UA 1G30B 1BMLA 3TNSA 1BB0B 1TNLA 3TPIZ 1TNKA 2RA0A 5C3NA 4JK6A 3BIUH 1NRNH 3RXLA 2ZZUH 1UMAH 3ZVAA 1OWKA 3KHVA 3MTYA 2ZFFH 3RDZA 4BAQB 2FI4E 5C20A 1GMHG 3E6PH 1DSUA 1S5SA 3LONA 2BY9X 4KKDA 1ZTJA 2B9LA 1TALA 1S6FA 4X2YA 2G00A 1UK4A 4OGYA 1SBWA 1MTNC 3RLWH 3UNQA 4FUIA 4ZMAH 1C5PA 2TGPZ 1B0FA 1OP8A 1AMHA 5CMXH 5LGOA 4NGAH 3KNXA 3IWMA 1NY22 1SGYE 2K1QA 1GBBA 2BZAA 2ZQ2A 1KTSB 3HATH 1EAUA 1QQUA 1BRAA 4ABJA 2VH6A 4Y0ZE 4OGXA 1TPOA 4E7RG 1XKBC 4H6TA 3T26A 3IITA 3E90B 4O97A 4ABGA 5TJXA 1QB9A 4ISOA 1NFXA 1BZXE 1ZZZA 4A1VA 2V3OH 2CMYA 1PQ7A 2AGGX 5DKMA 1G36A 2C8YB 1V2KT 2ZGBH 2H9HA 1TAWA 1WV7H 2VIVA 2XWAA 3BTKE 4B2BA 4B71A 4BTUB 1MUEB 4GHTA 2D2DA 2WV4A 2STBE 3SQEE 4IMZA 5JBCS 2P8OC 1WAYB 1DWBH 1V2OT 5GDSH 2BDHA 2BLOA 2J2UA 4AG2A 3KN2A 3A80A 2ZCHP 4GCHG 4NCYA 3ZZDA 1NRRH 2ZIQH 3SU6A 1GCTC 2WYGA 5DK1A 1SMFE 3DUXH 1QR3E 1O33A 1NRSH 4HGCA 1C5NH 2WPHS 8GCHF 2TRMA 2R0LA 2HNTF 5JBTA 4K5ZA 8GCHG 1TGTA 1O2HA 4BNRA 1SGDE 2TGDA 3M7UA 1QQ4A 1GDNA 1O3OA 5JB8S 5JBAS 4MNVA 1O0DH 4ZROA 1KTTB 4X8UH 1MTSA 1WCZA 1G3DA 1AO5A 2QXHA 4XFQA 5ETXA 3M3SA 4CR5A 3EA8A 1AD8H 2XBWA 1BRUP 1ZRBA 1AWFH 3STIA 1AVXA 3URCA 2GCTC 2G4UA 1Z8RA 1W14U 1EPTA 2C4FH 3A7VA 3VPKA 3O8DA 1S84A 2XC0A 1HYLA 5DG6A 1QA7A 1THSH 1TX6A 1MBMA 1J9CH 2WPKS 4ABDA 4AN7A 1UVOA 3GOVB 1TOMH 3QTOH 4FVBA 4WH8A 1LHDH 3SNEA 3VGCC 4NIVA 1DPOA 2BVXH 3KQCA 2UUKB 1QY6A 3P70B 1EOJA 1NFUA 1AZZA 1OPHB 1ZJKA 3UWJH 4DW2U 5A8ZA 5DJ7A 3SV6A 1LHGH 1V2NT 2ODYB 1GI6A 1FONA 3SV9A 4A1TA 1SGNE 4MPWA 1ELVA 1TX8A 1CGHA 2BD2A 1W2KH 3V12A 2JH5D 4AB8A 3S0NA 1JWTA 5LH8A 1MCVA 4B1TA 2J4IA 3LGTA 4TPYA 1L2EA 1UK2A 2G4TA