1TPSA

Atomic structure of the trypsin-a90720a complex: a unified approach to structure and function
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Atomic structure of the trypsin-A90720A complex: a unified approach to structure and function.
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tpsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tpsA02
4YOGA 2GX4A 1A5HA 1TGCA 2STBE 3GICB 2BQWB 1GJBB 1BHXB 1QRXA 3EGKH 3U8RH 1ZSJA 5C1XA 4KELA 1FPCH 5K7RA 3T2NA 3EAJA 2AGGX 2FX4A 2PV9B 4I8GA 1LVYA 2G51A 5BRRE 2UWLA 3LH1A 1EPTB 1XVMA 1DWEH 3HK6B 4B1TA 3QX5H 1PPHE 3MH6A 2RCEA 5AFYH 1TRYA 2G8TA 4JYVH 2OTVA 1ZMNA 2XWBI 1NRSH 1DS2E 2BY7X 1C1PA 3QZRA 1V6DA 5EQSA 4CRAA 2J4IA 3GCHB 3MO9A 2A31A 1CE5A 1O3GA 2GZ8A 1TRMA 5JBCS 1HLTH 1Y3UA 1SVPA 1C2FA 3KQBA 1OPHB 1D3DB 1ELVA 2BD3A 2VIOA 1C2EA 1C2JA 1O2QA 2BX3A 2Y5FA 3OY6U 3PMAB 1O5EH 3SJKA 2ZHQH 4X0WU 4D7FA 3SN8A 2FOBA 3EDXB 3EQ0H 1C1TA 2D2DA 1OWHA 1D3PB 5CE1A 1GI5A 2XYAA 4A92A 4DURA 4UD9H 1GBKA 4THNH 2G00A 1C5SA 3NXPA 1O2XA 2FP7B 3UOPA 4FUCA 1YM0A 1BQYA 1YPEH 1C5PA 1P03A 4IGDA 2FOMB 1EKBB 1Z8IB 1IQJA 1C1SA 1MUEB 1QJ6B 2QXIA 4BANB 1O2OA 2ZKSA 4Q2KA 1SG8B 3T25A 3T28A 1ZZZA 1HYLA 2Z3CA 4X1RU 1AFQC 5FCRA 3Q00A 1DXWA 4TY6A 2PLXA 4IC5A 1GI4A 1IHTH 1IQLA 1NTPA 3OTJE 1C1QA 1E37B 1TQ7B 2RA3A 1J17T 2EA3A 4MG3A 2C8WB 3JZ2B 5C1YA 4JYUH 2JH5D 2WPIS 3BTHE 4FUHA 1E38B 2TPIZ 4FXGH 1RTFB 1BTUA 4XFQA 1PPZA 4U32A 3RXOA 1EAXA 2J92A 2HRVA 2ZI2H 2SFAA 2VIQA 4NIXA 2M5TA 3L3TA 4O97A 1GBDA 1TX7A 3QO6A 4JMYA 3P92A 4LZ4B 3PMBB 2ZECA 1TABE 1NC6A 4IW4E 2FPZA 3VGCB 1ORFA 4MPXA 2JKHA 1G2MA 1V3XA 4BTUB 1N8OB 2XBYA 1VITH 1CA0B 1GWAA 3A81A 4Q7ZA 1AKSA 1D3TB 2C8YB 2SGDE 2ZQ1A 4NIVA 2PW8H 1AB9C 2FODA 4Y0ZE 5FPYA 1TMUH 4CRCA 1G36A 5LH8A 1XKAC 2WUBA 1YPHC 2GDDA 4AFUA 4ASHA 1FXYA 3E91A 1A3EH 3SU3A 3K6ZA 3RXTA 1IQGA 1JRTA 2Y80A 3L33A 3RC5A 4NSVA 4QT8C 1DANH 2FMJA 2F9UA 1FONA 2R0LA 3K65B 1KLTA 4O3TA 1S0RA 2ODYB 1H9IE 3VB7A 2G52A 4CREA 1L4DA 4BNRA 3Q3YA 2VINA 4ABIA 1AWHB 4OS7A 2JETC 1TBQH 5L2YH 3CP7A 4GCHG 4FU8A 2A1DB 4CRFA 2ODQA 3DA9B 1BTZA 1MMJN 1RIWC 1S81A 4M7GA 7KMEH 2GV7A 1G3EA 1RJXB 2PR3A 1SGFA 3S7KB 3TJNA 1KLJH 2VGCB 3A7VA 1PPCE 1O5BB 3LDXH 1Q3XA 3A8CA 4RKOB 1UCYH 2FO9A 5HGGA 1KXCA 2AERH 1VGCC 4CHAC 4TPYA 4MNVA 4JK5A 4HZHA 3FAOA 3M5MA 2VJ1A 3TVJB 4K8YA 1ABIH 2ULLA 1OXGA 8KME2 1DICA 4IBLH 1G2LA 3I77A 2NU3E 1GHWH 4E05H 3TH4H 2VH0A 1TNIA 1BJVA 2XC0A 5FBEA 3U1JB 1MKWK 2QXGA 1C2DA 1C5WB 2AMPA 2PHBA 1MTNB 4WMFA 2AIQA 1O5FH 1UVSH 1PQ7A 1EPTC 3ZZCA 4AG1A 3H7OA 1P2IA 1SGTA 1M9UA 3D62A 1LVBA 3SV9A 3SUFA 4K60A 1H9LB 3TNSA 3SBKA 1VCPA 5HYOA 2HWLB 2FI5E 1SLVB 1ZPZA 5F8XA 3GCHC 9ESTA 3C1KA 2DE8A 2CHAC 2YNAA 4NGAH 1W7XH 2PKSB 1XXFA 2FIRH 3BF6H 3V13A 1NM6A 5FBIA 2A4QA 2H9EH 3RXLA 5DK1A 2GCTB 1ZPBA 1S83A 1GL0E 5H4IB 3KEEA 4NA9H 3M61U 1EJAA 3E1XB 1BMAA 1NFXA 1H8DH 4JCNA 1UTLM 2Z3EA 2VH6A 5F8TA 2BY6X 5EXNA 1BTYA 2FTMA 3OY5U 4ZXYH 1LHEH 2GD4B 1LHFH 3U9AH 1D6RA 4MNWA 3QWCH 6GCHG 1P2MA 1TE0A 2G4UA 1TRNA 1V2UT 4CRBA 2OBQA 2WINI 4AFZA 4NSYA 4B74A 1YBWA 1OWEA 1CVWH 1HAOH 4B73A 1Q31A 2O9QA 4MLFB 4AX9H 1GBAA 1SI5H 3A85A 1SGYE 2NU2E 3MH7A 1IQNA 1KTTB 1P2KA 3EA7A 2A4GA 3TU7H 1GI2A 2OC7A 1T32A 4A1XA 5DP9A 2BDYA 2ZU5A 1E34B 3KHVA 3BTQE 1SGEE 4K8BA 4GHTA 1BITA 4FUIA 2OP9A 1QL7A 1NZQH 4U01A 4ABBA 2F91A 1ABJH 1ELCA 1O2SA 1QRWA 3GDSA 3ZZAA 5ABWA 1YPGH 1WBGB 4X2WA 1TA2A 3F1SB 3U69H 3Q77A 3VGCC 4ZMAH 3E0PB 3DT0H 1HV7A 1AU8A 5IDKA 1VZQH 3E8LA 1N8OC 2V0BA 2G5NA 3PLBA 2BVRH 1CA0C 5HM2A 3RDZA 1MKWH 4X1SU 5G4BA 1GHVH 2FOGA 1QJ7B 3BIUH 3LJOA 4LK4A 4Q7XA 1XUGA 3OX7U 2PKAA 1BRCE 1ELGA 2XBVA 1FY8E 1Z7KA 1O2GH 1O3HA 4OS4A 5IYTA 4FUEA 3NK8A 1QA7A 1SHHB 1Z1JA 3BTFE 3MNXA 3NWUA 1O3KA 1W0ZU 1V2LT 4AOQA 1YPMH 1Z71A 5TJXA 2PSYA 4KGAA 5EGMA 3QGNB 1TGSZ 1LHDH 1FN6A 1KDQA 3F6UH 5DGJA 1QQUA 1DY9A 3HKIB 2KAIA 2A32A 3QTOH 2ZIQH 1O2RA 2ZGXH 1A0HB 1QY6A 1C4V2 5HXFA 3RXJA 3SHCH 2H2ZA 4Y8XA 4K1EA 2XCNA 3PTNA 5DP6A 2ILNA 1Z8GA 1AVWA 4OS1A 1IQKA 2K1QA 1GBLA 4KTCA 2AGIX 1THPB 3OSYA 4DVAU 2O8WA 2B0FA 2FS9A 1MCVA 5EXLA 4ZKRU 2I6QA 1V2KT 2BD7A 1VITF 5GPIB 4BTIB 1MKXK 1IQHA 3M3TA 2XRCA 4CR9A 1F5LA 1HAVA 4BTTB 1GHYH 1F0TA 1S0QA 3ZZ4A 2BD5A 3ITIA 4BOHA 1P2JA 3AASA 3RMNH 1RTKA 4ZKNU 3E0NB 2F3CE 3MNBA 3KF2A 5E0JA 1BTXA 1O38A 2LNCA 1GI9B 3F9GA 2OUAA 4MDSA 4TY7A 1GGDC 1W3CA 2J2UA 2GCHG 1IAUA 1W11U 3Q76A 1CT0E 1ZHRA 1Z8JB 3S9BA 1F5RA 1MTNC 1O3NA 2R2WU 4Z6AH 3TK5A 1CHOG 3TGIE 1UK4A 1WV7H 1TQ0B 5HMAA 4X6OA 4RKJB 3SHAH 4NA7A 1NFUA 3ZVFA 2ZU4A 1QURH 2A7CA 1LVOA 1RD3B 1G3BA 4JZFH 4INLA 2GT7A 1C2MA 1GJ8B 4CBOA 3GCOA 3A7TA 3UIRA 2SGQE 1AMHA 1L1GA 2PKSC 3SQHE 3EA9A 1JIMA 2AS9A 2R3UA 3EE0B 5GCHG 4K1SA 3BEUA 4DOQA 1SLUB 3LJJA 3S0NA 3GY8A 4GCHF 3RXHA 1EXFA 2ZU2A 3GISB 2GCTC 4X6MA 4BAMB 1YP9A 1C1NA 1FIWA 5ETXA 2GTBA 1DUEA 5AVDA 4AG2A 4MQAA 2BB4A 2Z9LA 1QIXB 2BQ7B 1GBCA 3A7WA 1UVOA 1ARBA 1FY4A 3LGWA 1QHRB 5C5OA 1J8AA 2FLBH 2OINA 1WTGH 1SFQB 5HM9A 1L1NA 4AYYB 4ZKOU 2OC8A 4PROA 1O34A 3NPSA 4XDEA 1LTOA 6LPRA 1OOKB 1QA0A 2ZGBH 1RFNA 1XXDA 1EZUC 1CSOE 1THSH 2SGEE 5JYIA 3M5OA 5EQRA 1HAXB 2BX4A 2R0KA 1PQ5A 1Y59T 2PTCE 1WSSH 3FVFB 4BAQB 1G30B 4J1YA 3F9FA 2Z9KA 3TK9A 5DP7A 1MKXH 2DUCA 3UR9A 2ESTE 1NU9A 4F4OC 1HIAB 1C2GA 1LO6A 1HNEE 2AIPA 4ISOA 4ISLA 3I29A 1V2JT 2EI6A 4WMDA 1GHBG 1BTHH 3FP7E 1PPFE 5I46H 3GCNA 3SJ9A 5LPEA 3LIWA 3KCGH 4UDWH 1GVLA 1N6XA 2VU8E 1SHYA 2ZHDA 4NZQA 3SU1A 2BY5X 4A1VA 1NFWA 2BDCA 1A46H 4WXIA 2WPMS 1O2NA 3OYPA 3LGTA 1MZDA 1ZR0A 2ZDNA 5C3NA 1AUJA 1DM4B 1KXFA 2BDAA 4NG9H 3U98H 2ZTXA 3DFJA 4GSOA 2UUYA 4GHQA 4ABGA 3GCTF 4TPIZ 5FX5A 3TGKE 1LHCH 4X6PA 2GGVB 4SGAE 5GDSH 4Y71A 2V3HH 3SNEA 1BHXF 3RXGA 1N6YA 3ZVAA 3FP8E 2TGTA 1Z6EA 1VJAU 4CH8B 1OP8A 2CHAB 3PV4A 4VGCB 2BMGB 3SGBE 1O3EA 5C5NA 2RDLA 2J94A 1MTWA 6GCHF 1AIXH 1SOZA 1TONA 2GMTB 2UUFB 1E0FD 1UTOA 2ZFQH 1NY22 1O3FA 1OX1A 3SJOA 1CGHA 1ETTH 1A3BH 4X8UH 3VB4A 1KXEA 3M5NA 3ZZ7A 1NU7B 1C1WH 1DSUA 1YPHE 1C2HA 2NU1E 3MMGA 1SL3A 4YT6H 4ABHA 2NWNA 1O2LA 1PPBH 2EC9H 5T6GA 5LPRA 1H4WA 1D4PB 2TBSA 2QA9E 2ZFRH 1RXPA 2Z94A 4K1TA 4NIWA 2PFEA 2FM2A 3Q3XA 4WH6A 5DP8A 3RXSA 2BZ6H 1MTVA 4U2WA 4ISNA 1K28D 1UCYK 1ZJDA 3AW0A 1MCTA 5EQQA 3P8NA 1O2ZA 2A4OA 2W3KA 4JZDH 4CRDA 1W14U 1TB6H 1V2PT 4DT7B 2THFB 2QN5T 8GCHF 4GUXA 1FN8A 2BZAA 2R2MB 5CHAB 2BOHB 2PGQB 2BM2A 1CGIE 1VJ9U 1ZTJA 1AHTH 2G5VA 2A2XH 3ZVBA 1ETRH 4I32A 3UTUH 1NS3A 3SNAA 4WXVA 1HIAA 1VITG 1GHZA 1QL8A 3RC6A 1WCZA 1EAWA 1Y3VA 2VNTA 4HTCH 1MQ6A 4INHA 4IN1A 3ZZ5A 1O2IA 1GBBA 2ZDMA 1ZMLA 3BTME 4DG4A 1XM1A 3QN7A 1P11E 1AWFH 1HDTH 1LCYA 2XNIA 2A0QB 1FUJA 4E7RG 2PWXA 3RU4T 3A82A 5A0CA 4K2YA 2D1JA 3E6PH 3UFAA 3H5CB 3PO1B 1GCDA 1UTNA 4Y7BA 3A89A 3UOUA 1EPTA 3MH5A 1HPGA 5DP3A 1MAYA 2FS8A 4B76A 3EYDA 5T6DA 1C1OA 5B6OA 3E16B 4IMQA 1NRQH 2A5KA 3GDVA 4IN2A 3S69A 1O2TA 2F9NA 2ZFSA 3SGAE 1TGTA 2QV1A 1AD8H 3RXQA 1G32B 4LZ1H 1B5GH 2Z9IA 1LQEA 4LXBH 1LMWB 3BG8A 1S6HA 1UHBB 1GPZA 2V6NA 4CRGA 1GVZA 4HFPB 3UREA 2H1UA 2B5TB 2FESH 3LC3A 2OXSA 2W26A 2ZC9H 1FDPA 3A83A 2FLRH 3PMHB 2Q6GA 1TBRH 3RXUA 3T62A 1HB0B 2ALPA 1LPKB 4H4FA 1BMLA 3CS0A 4AYVB 1P2OA 1O3IA 2PGBB 1JBUH 3BTEE 3EA8A 2ZHWH 4FUDA 5FPSA 1CHGA 1TMTH 5A0BA 4GPGA 1C5NH 1Y5AT 2H9TH 2QXJA 3KNXA 2ZU3A 3STJA 3HK3B 2ZF0H 2GCHF 3GY7A 2O8UA 5ESTE 3ZVDA 1A0LA 2GDEH 2ZTYA 3SI3H 1F0RA 6CHAB 1SMFE 1HAYB 3SNBA 1NRPH 4X2VA 4B2CA 1GG6B 3KIDU 1TPPA 1CHOF 1K1MA 4FVBA 2IOTA 4XE4A 1CU1A 2C4FH 4Y79A 4ABJA 1AVGH 1JMOH 2VVUA 3E90B 1O2UA 4RSPA 1AGJA 1O2MA 1W2KH 1CO7E 1Q2WA 1GGDB 1O3PB 3URDA 2VWMA 1JRSA 3UQOA 2ZFPH 4D8NA 1DX5M 2FEQH 1EJMA 1C5RA 1TX8A 5FXLA 1BOQA 4R0IA 5EW2H 3P6ZB 5GCHF 1GDQA 2NU4E 5GXPA 1BBRK 3MU0A 1LKBA 1HXFH 3AW1A 1U6QA 2FYRA 1WU1A 2CXVA 2A5AA 3RXRA 4AFSA 1G3CA 2ODPA 3VEQB 4AB9A 1K1JA 1CQQA 3ATMA 1K22H 3PROA 5JB8S 1GBEA 4WH8A 1Y5BT 1FPHH 1K2I1 2D26C 2ZFTA 3L6PA 2FOFA 4VGCC 3P17H 1BRUP 1O2KA 1S82A 3FZDA 3BTDE 3SUGA 2GMTC 1H1BA 2J9NA 3ATLA 1NO9H 4A7IB 3HGPA 1FQ3A 1GMDF 1SLWB 1TNJA 1V2OT 3GCTG 4A5TS 5J4QA 1MTUA 5A8ZA 1DPOA 1ZSKA 2ANWA 4MVNA 1V2VT 2XXLA 3SOSA 5A2MH 2BD2A 1SLXB 1F7ZA 4DW2U 1C5QA 4AORA 4NCYA 4FUGA 2BDHA 4WY3A 4XBCA 3M7UA 1WYKA 4X8VH 1O3JA 1O33A 3F9HA 4XSKU 3SU4A 2AH4X 1UTPA 1BT7A 1GBHA 1T31A 1DLKB 3M5LA 4MNXA 2O8LA 5F8ZA 2B7DH 5JB9S 1EQ9A 4DGJA 4HI3A 4J2YB 4Q7YA 1C4U2 3SU6A 3ATKA 1UTJA 1GHBF 3MU4A 3VXEH 3RUOA 1GJ7B 3ESTA 3PWCA 2TIOA 3ZZ6A 4MPWA 5DJ7A 1HAZB 1ETSH 2AEIH 2BLWA 2GZ7A 2TGDA 3JZ1B 3M3SA 3GY5A 3UNSA 1MH0A 1P3EA 1QBOA 1C5TA 2GP9B 3GDUA 2ZZUH 5CHAC 3LGYA 1TYNA 4INKA 1FY3A 2FOAA 1GI0A 1SQOA 2BVSH 1ESTA 1NFYA 4MNYA 1KXAA 3UY9A 1JOUB 2H5DA 1K1PA 1LPZB 3O8DA 1O3DA 2GKVE 1K9OE 3TH3H 3UR6A 2WYJA 3ZV9A 8GCHG 3LONA 3MTYA 4K69A 1MZAA 4D9QA 2B9LA 1F92A 1ESBA 3FFGA 2G81E 1BBRH 1GJ5H 3PO1C 1UK2A 4D76A 1GHAG 4K3JA 1NRRH 2F9OA 1ZLRA 2BVXH 1DSTA 3Q3KA 1C2LA 3TPIZ 2O8MA 1J15A 2IN2A 2ALVA 1MQ5A 5EU8A 5PTPA 2BDBA 1TIOA 5FPTA 1F0UA 7GCHG 2G55A 2ZGCA 1BA8B 2F9PA 4LOYH 1O3OA 1TPOA 3KQEA 4YESB 5DO4H 4O3UA 1L4ZA 1V2RT 1EOJA 1BRAA 1DWCH 1GJ6A 4TYDA 2XBXA 1O31A 2BXUH 1HRTH 2GZ9A 1ANDA 1HJAB 1XUIA 1A0JA 2P94A 1HFDA 2Q6FA 1FJSA 2HNTC 3SQEE 5JBTA 1IQEA 4NFFA 3B9FH 2QIQA 1O2PA 3GYMA 1OP2A 1P2QA 2FI4E 1GJ4H 1BMNH 1EASA 1GBMA 3PMJA 3S9AA 5JBBS 1EP5A 1LVMA 1FAXA 1DWDH 3U8TH 1V2WT 5EPYA 1L0ZA 2QY0B 1TA6A 1UTQA 5CMXH 1GMHG 3B23B 3S9CA 2A7JA 2IJOB 2OC0A 3R0FA 5AF9H 6CHAC 4WJG2 2P95A 2FDAA 1GG6C 1O3CA 5E8EH 4ZROA 1SPJA 3ZVGA 4JYTA 3GY4A 2O8TA 1QBVH 1P3CA 1O36A 1XUHA 1S85A 3A8BA 1A4WH 1A1RA 1C1RA 1RRKA 1L1JA 1E36B 1Z8RA 1T7CA 4Y0YE 1KIGH 2ZGJA 4Y10E 2QF3A 1G37A 2OQUA 1F0SA 3UPEA 1BB0B 3LH3A 3ZZ3A 9LPRA 1TFXA 5FHTA 2OBOA 1HJ9A 1DWBH 2J38A 2LPRA 2IPHA 1AE5A 1TOMH 1QFKH 4JZIA 1GBTA 4FUFA 1W10U 3QLPH 2P93A 2HVXA 2CF8H 1ELTA 2Z9JA 2Q1JA 1TALA 1CGJE 2W3IA 1AZ8A 3ENSB 2G4TA 3RXBA 1BCUH 2EI7A 1Y3XA 1P9UA 1XVOA 4D7GA 3D49H 2P59A 2VIVA 1K1NA 3MWIU 3SORA 3LKWA 2A4RA 1AN1E 2F9BH 1O3MA 1WUNH 1SGDE 2ZDKA 1TNLA 1XMNB 2W7SA 1GCTB 3MOCA 4I8HA 3HPTB 2ZP0H 3LGVA 3RMMH 1CA8B 5FAHA 1ZMJA 2JH0D 3K9XB 1QTFA 3D65E 1WQSA 3A88A 4UFGH 4K5ZA 2CMYA 2HALA 5DPAA 4X1PU 4ZHMU 3F68H 5I25A 4UE7H 4XBDA 3LT3A 3MNCA 1BMMH 5C1UA 4Y6DA 4OS6A 1FLEE 2ZHEH 1FY5A 4X2YA 3ZYEA 4ZXXH 1TNKA 1T8NA 1GMDG 1C1MA 3KQCA 3M3VA 1ZPCA 1YKTA 3TJVA 1WTHD 1O2WA 2C90B 2BLQA 3URCA 1XX9A 2HPQH 1DUAA 3MH4A 3STIA 3SI4H 1VCQA 3KL6A 1DVAH 5A8YA 5T3HA 1LHGH 2JH6D 1MBQA 1GDUA 2Y81A 4I8KA 4ZH8A 3V3MA 1UVUH 1T8OA 2P3TB 3LOXA 5ESBA 5DP4A 3ZYDA 2J34A 2AGEX 4Y8ZA 3IG6B 1SQAA 2WPJS 3A8AA 4YZUA 3AVZA 3SW2B 1EAUA 4YOJA 1DITH 1H9HE 2HOBA 3NCLA 3RMOH 3MU8A 4MTBA 1O5GH 3W94A 1TOCB 2TGPZ 1UTKA 3PLPA 3BIVH 5EXMA 2VVCA 3SU2A 5L6NH 1O35A 4WWYA 2AMQA 2F83A 2WPHS 3A7ZA 1ACBE 3RU4D 4HGCA 1THRH 1GJAB 1IQFA 4KTSA 5JPMH 2EEKA 2J95A 3GYLB 3S7HB 3B8JA 2Z3DA 4UEHH 2VIDA 1OYQA 1C1UH 1IOEA 4MPVA 3RXVA 3SV7A 1ANBA 1ELBA 1PQ8A 1C9PA 2Y7XA 1AKSB 3T26A 2VIPA 4E06H 1EATA 3FZZA 1O3LA 2P8OB 5EOKA 1CT2E 1T8LA 1J16A 1UCYE 1AZZA 1O3AA 4I7YH 2WV4A 1KTSB 1QB6A 1JWTA 2RG3A 1A5IA 4YTAA 4Y76A 3MHWU 2WYGA 5TCCA 3BTKE 4JZEH 1HJAC 1J14A 3RLYH 5E2OA 1EZQA 4DY7B 2P3FH 3PWBA 1V2TT 1W0YH 4UONA 1ZHPA 5EG4A 2QCYA 2HGTH 3NUMA 4NWLA 2QXHA 3RXIA 3M35A 2STAE 3E3TA 4ZKSU 5J4SA 1GMCG 1QRZA 5K0HA 4IC6A 2BHGA 4X1QU 4Y7AA 1JIRA 3A86A 5E0HA 4AB8A 4ISIH 1BZXE 4BAHB 4ABAA 1PPGE 3PB1E 1XKBC 1PPEE 2FXRA 2ZO3H 2SGAA 4ZUHA 1DXPA 1YCPM 1OWDA 4H42U 1EX3A 4X6NA 1C5OH 3LPRA 2ZEBA 1NRNH 5EODA 3SV2H 1WAYB 3UUZA 2BLVA 1WOFA 3BEFB 4ZHLU 3K2UA 4YT7H 1CBWB 2ZDAH 1P2NA 1SFIA 2A2QH 2CJIA 2ZFFH 3QGJA 4H6TA 2OQ5A 1GHAF 3RLWH 4X2XA 2W7UA 1SSXA 2ZQ2A 4OGYA 2H6MA 5LGOA 3LGIA 4BXWA 1QJ1B 3SNDA 1O5CB 4YO9A 7GCHF 1O2VA 3RMLH 1P10A 4I8LA 1DE7H 2UWPA 1O3BA 2Y82A 4DJZB 4ZHAA 1ZOMA 2BDGA 3BV9B 2ZDLA 4AZ2B 1S84A 3RM2H 3ZZ8A 2NU0E 2XC4A 4H6SB 3ATWA 1QR3E 3GY2A 1TBZH 1X7AC 3SJIA 2Z7FE 1K1IA 1ELEE 2SGPE 1V2MT 2PUQH 4TWWA 3SNCA 4U30A 1E35B 1ELAA 2TGAA 2V35A 2BXTH 5FX6A 1JXPA 1EP6A 1TAWA 1V2NT 1OWKA 2XWAA 2OD3B 1QQ4A 2WV5A 4FUJA 1OP0A 3P70B 1TX6A 1S6FA 1UTMA 3VPKA 2CV3A 1C5YB 1GI7B 3SV8A 1RGQA 2R3YA 1GCTC 1TGBA 1GMHF 1C5VA 1Y5UT 2ZPSA 1S5SA 4WF8A 3RP2A 3QUMP 1V2ST 3VB5A 1YLCA 2P3UB 4OGXA 1EOLA 1FI8A 3M7TA 3T29A 3UWJH 1EJNA 2ZCKP 3MU5A 2HLCA 1PFXC 4O03A 1NESE 7LPRA 1HAIH 1ZTKA 4UFEH 1YPJH 2OC1A 3RXFA 3ZV8A 2ANYA 2SNVA 1C5LH 2C8ZB 1BJUA 2ZG0H 3F9EA 1OS8A 1P57B 4KP0A 4Y8YA 1BBRE 3D23A 4GVUA 3RXAA 4B71A 2VWOA 3TITA 2HPPH 1O5AB 1TNHA 2V3OH 3I78A 2BDIA 3O8BA 4WVPE 1TPAE 1B0EA 1C5ZB 1D9IA 2HNTF 4E7NA 2I6SA 3VB6A 2BD8A 1GJ9B 2XBWA 1Z6JH 2YOLA 3W95A 4AFQA 2OLGA 3PM3A 3FP6E 1FAKH 2W5EA 1GDNA 1ESAA 5SGAE 3VB3A 1AO5A 1XUFA 1TNGA 1MU6B 2WUCA 5EW1H 4Z0KA 3RXCA 1HXEH 3UNRA 2DE9A 1HUTH 1UO6A 1T8MA 4D9RA 1HCGA 2FWWA 1GBFA 1GHXH 1T4UH 2ZPQA 4JZ1A 5C67A 1P04A 4I33A 5A0AE 2ASUB 5L2ZH 1C4Y2 1UVTH 1LQDB 2BD4A 3TK6A 2GT8A 1A5GH 1O2HA 1P8VC 3O8RA 4BAOB 1XUKA 1YC0A 2YNBA 2CF9H 4YM9A 1O2YA 1FIZA 5A8XA 1ZTLA 1Z1IA 5C2ZA 2ZTZA 1ZGVA 3M7QA 5GIBA 3RXEA 1MTSA 5AFZH 2PKAB 2UWOA 1GJCB 3GY6A 4OS5A 1HAPH 2AYWA 3TGJE 8ESTE 1HAHH 3BN9A 1UK3A 1TLDA 1DDJA 1Y3WA 2P8OC 3KGPA 4F49A 1ZSLA 4YOIA 5F6MA 1MAXA 3MO3A 1GI1A 3V12A 1ANCA 2XW9A 2QF0A 1BDAA 3LU9B 1F2SE 3MFJA 2P16A 3P8FA 5E0GA 1ID5H 4R8TB 2GV6A 2VB0A 1SGRE 1KDQB 3DUXH 3SZNA 1KLIH 3MU1A 3BEIB 3V7TA 1P9SA 3ATIA 2KAIB 4XBBA 2A45B 2BTCE 1UHBA 4X1NU 2BLOA 4KKDA 3A87A 2UUJB 2D8WA 3T5FH 2RA0A 1AI8H 3P8OA 4X8SH 3QK1A 1IHSH 1P01A 3ZZDA 1VCWA 3GOVB 1ZYOA 1OYTH 3ELAH 2BQ6B 1SQTA 3DFLA 2HNTE 1BTPA 4WMEA 1O2JA 3BTWE 3BG4B 3UQVA 2ZWLH 3A7YA 1D6WA 2AMDA 1C1VH 1INCA 1ZJKA 4I8JA 4IMZA 2ZHFH 3H7TA 4YLQH 3TLOA 3TJOA 1EB1H 2ZNKH 2CN0H 3ODDA 4ABDA 1CBWC 1ARCA 1HAVB 1QL9A 2ZPRA 3SUDA 4TWYA 1QNJA 1YCPK 3HKJB 1NT1A 1KY9A 1GBIA 1NN6A 1QCPA 2PUXB 1KXBA 1TPSA 1PYTD 3NKKA 2BY8X 1PYTC 4DIHH 1HJ8A 3VFEA 4Q80A 4O9VA 4RN6A 1OWIA 1BUIA 1DY8A 1P0SH 4ABFA 3O8CA 2ANKH 1HAGE 1DOJA 1PQAA 2R9PA 2EI8A 2BY9X 1ANEA 3RXKA 2OCVB 1P06A 4DIIH 1YF4A 1SR5C 1K21H 3MO6A 3T27A 5JBAS 2ZDVH 1FNIA 3QDZB 2Z6BD 5AHGH 1GBJA 1DT2A 4JK6A 5E2PA 4B2AA 1ZHMA 1BIOA 2F9VA 3P8GA 3OU0A 1SC8U 1G3DA 1FMGA 4BXSA 1C5MD 4AGJA 5A09A 1SGFG 4NA8A 3V0XA 1O0DH 1TMBH 3BTGE 1TWXB 1OWJA 1V2QT 1GMCF 1SB1H 1RTLA 2A7HA 2AFQB 3KQDA 1AUTC 1GJDB 1FZZA 2PSXA 3R3GB 4GAWA 2ZU1A 4FU9A 4FU7A 1UMAH 1AFEH 1IQMA 1Y8TA 1O30A 3IITA 2XCFA 2GVFA 3U8OH 1PJPA 3AAVA 4KTUA 1RS0A 4NFEA 3AAUA 2Y6TA 1F5KU 1EZSC 5JDUB 2H5CA 4XOJA 2VVVA 3KN2A 2QYIA 2ZA5A 3LGUA 3WY8A 2BYAX 2TRMA 1NPMA 1C2IA 2Y5GA 5GJ4B 1KYNA 1SOTA 4B75A 1C9TA 2Z9GA 1W13U 1EB2A 1OSSA 3PYHA 1G9IE 2Y7ZA 3MI4A 4NWKA 4UFFH 1MD7A 2VWLA 1MBMA 5LPFA 2C8XB 5DG6A 5T6FA 4CBNA 3VXFH 2WPKS 3SU5A 1KSNA 1QBNA 1C5UA 2A5IA 1K1LA 3A80A 1UJ1A 4Y11E 2VIWA 3DHKH 3ZZ9A 1ELDE 1A2CH 3MYWA 1YPKH 1A61H 2WPLS 2C93B 4NIYA 2FI3E 1AFQB 2VGCC 4FUBA 1QB1A 3CS7A 3HGNA 1SGCA 1IQIA 3M37A 4SGBE 1SGIB 5FCKA 4UFDH 1W7GH 3PLKA 3ZVCA 1DLEA 3SJ8A 1DFPA 5TCAA 1LKAA 1UVPA 1YCPH 3LC5A 4FVDA 2QGRA 3P95A 1H8IH 1SBWA 1KXDA 4BAKB 1SGPE 3MNSA 4ISHH 1LDTT 5F03A 1EZXC 5DP5A 5BPEA 1B0FA 1MU8B 1OKXA 4GLYA 4X8TH 1O39A 2XTTB 1O32A 1SGQE 3A84A 5C20A 1ZRKA 1MD8A 1AVXA 3ZZBA 2FOEA 1P02A 2B8OH 1AQ7A 3HATH 1EAIA 4DCDA 1YYY1 4A6LA 3NZIA 7ESTE 3N7OA 1GVKB 4CR5A 1BRBE 3RU4E 1BTWA 1YLDA 2ZCHP 2FYQA 2FOCA 2FZZA 1NROH 4I31A 1O5DH 1HBTH 1YGCH 2FTLE 3SV6A 3DD2H 3SU0A 3RXMA 2SNWA 1WQVH 5L30H 3ODFA 1QGFA 5GWZA 2Y5HA 3UWIA 3M36A 1K1OA 1AB9B 2Q6DA 4ZAEA 1N1LA 3GY3A 2VWNA 2SGFE 3UNQA 4ESTE 1W8BH 1C2KA 1FY1A 1ZRBA 3BTTE 2ANMH 1FV9A 2BD9A 2H9HA 1O37A 1W12U 1HGTH 4A1TA 2UUKB 2C3SA 1SGNE 1AE8H 4NZLA 4AN7A 5EPNA 1D3QB 4ABEA 3C27B 3RXDA 3IWMA 3QTVH 1ZGIA 1P12E 4MPUA 3PTBA 3TJUA 3A8DA 5DKMA 1XUJA 3BG4C 1P05A 2BOKA 8LPRA 4IS5A 1ELFA 1P09A 3K6YA 1C5XB 3SGQE 3SO3A 3TNTA 4YLUA 1GL1A 2JETB 4AGKA 1YPLH 3RC4A 1Y3YA 1RIWB 2FOHA 3TH2H 4OS2A 1GI3A 3SUEA 2ZGHA 1GI8B 1TGNA 4CH2B 1AY6H 3CENA 2QC2A 1J9CH 3BSQA 1CT4E 1EUFA 3A7XA 3G01A 1B7XB 1VR1H 2PTNA 1T4VH 1QB9A 3FANA 3QZQA 3ZVEA 6ESTA 3U1IB 1VGCB 2FX6A 2XC5A 3RM0H 1GI6A 4CHAB 1LPGB 3RXPA 1A7SA 1L2EA 2QAAA 3TIUA 2ZCLP 2CGAA 4B2BA
chains in the Genus database with same CATH superfamily
4YOGA 2GX4A 1A5HA 1TGCA 2STBE 3GICB 2BQWB 1GJBB 1BHXB 1QRXA 3EGKH 3U8RH 1ZSJA 5C1XA 4KELA 3N7EA 1FPCH 5K7RA 3T2NA 3EAJA 2AGGX 2FX4A 2PV9B 4I8GA 1LVYA 2G51A 5BRRE 2UWLA 3LH1A 1EPTB 1XVMA 1DWEH 3HK6B 4B1TA 3QX5H 1PPHE 3MH6A 2RCEA 5AFYH 1TRYA 2G8TA 4JYVH 2OTVA 1ZMNA 2XWBI 1NRSH 1DS2E 2BY7X 1C1PA 3QZRA 1V6DA 2JDID 5EQSA 4CRAA 4RT1A 2J4IA 3GCHB 3MO9A 2A31A 1CE5A 1E1RD 1O3GA 2GZ8A 1TRMA 5JBCS 1HLTH 1Y3UA 1SVPA 1C2FA 3KQBA 1WXRA 1OPHB 1D3DB 1ELVA 2BD3A 2VIOA 1C2EA 1C2JA 1O2QA 2BX3A 2Y5FA 3OY6U 3PMAB 1O5EH 3SJKA 2ZHQH 4X0WU 4D7FA 3SN8A 2FOBA 3EDXB 3EQ0H 1C1TA 3FKSD 2D2DA 1OWHA 1D3PB 5CE1A 1GI5A 2XYAA 4A92A 4DURA 4UD9H 1GBKA 4THNH 2G00A 1C5SA 3NXPA 1O2XA 2FP7B 3UOPA 4FUCA 1YM0A 1BQYA 1YPEH 1C5PA 1P03A 2KM0A 4IGDA 2FOMB 1EKBB 1Z8IB 1IQJA 1C1SA 1MUEB 1QJ6B 2QXIA 4BANB 1O2OA 2ZKSA 4Q2KA 1SG8B 3T25A 3T28A 1ZZZA 1HYLA 4Q4LA 2Z3CA 4X1RU 1AFQC 5FCRA 3Q00A 1DXWA 4TY6A 2PLXA 4IC5A 1GI4A 1IHTH 1IQLA 1NTPA 3OTJE 1C1QA 1E37B 1TQ7B 2J97A 4TSFD 2RA3A 1J17T 2EA3A 4MG3A 2C8WB 3JZ2B 5C1YA 4JYUH 2JH5D 2WPIS 3BTHE 4FUHA 1E38B 2TPIZ 4FXGH 1RTFB 1BTUA 4B6FA 4XFQA 1PPZA 4U32A 3RXOA 1EAXA 2J92A 2HRVA 2ZI2H 2SFAA 2VIQA 4NIXA 2M5TA 3L3TA 4O97A 1GBDA 1TX7A 3QO6A 4JMYA 3P92A 4LZ4B 3PMBB 2ZECA 1TABE 1NC6A 4IW4E 2FPZA 3VGCB 1ORFA 4MPXA 2JKHA 1G2MA 1V3XA 4BTUB 1N8OB 2XBYA 1VITH 1CA0B 1E1QD 1GWAA 3A81A 4Q7ZA 5DN6D 1AKSA 1D3TB 3PV2A 2C8YB 3AK5A 2SGDE 2ZQ1A 4NIVA 2PW8H 1AB9C 2FODA 4Y0ZE 5FPYA 1TMUH 4CRCA 1G36A 5LH8A 1XKAC 2WUBA 1YPHC 2GDDA 2F43B 4AFUA 4ASHA 1FXYA 3E91A 1A3EH 3VG8A 3SU3A 3K6ZA 3RXTA 1IQGA 1JRTA 2Y80A 3L33A 3RC5A 4NSVA 4QT8C 1DANH 4XD7D 2FMJA 2F9UA 1FONA 2R0LA 3K65B 1KLTA 4O3TA 1S0RA 3F2HA 3MQKC 2ODYB 1H9IE 3VB7A 2G52A 4CREA 1L4DA 4BNRA 3Q3YA 2VINA 4ABIA 1AWHB 4OS7A 2W6JD 2JETC 1TBQH 5L2YH 3CP7A 4GCHG 4FU8A 2A1DB 4CRFA 2ODQA 3DA9B 1BTZA 1MMJN 1RIWC 1S81A 4M7GA 7KMEH 2GV7A 1G3EA 1RJXB 2PR3A 1SGFA 3S7KB 3TJNA 1KLJH 2VGCB 3A7VA 1PPCE 1O5BB 3LDXH 1Q3XA 3A8CA 5FL7D 4RKOB 1UCYH 2FO9A 5HGGA 1KXCA 2AERH 1VGCC 4CHAC 4TPYA 4MNVA 4JK5A 4HZHA 3FAOA 3M5MA 2VJ1A 3TVJB 4K8YA 1ABIH 2ULLA 1OXGA 2KZ4A 8KME2 1DICA 4IBLH 1G2LA 3I77A 2NU3E 1GHWH 4E05H 3TH4H 2VH0A 1TNIA 1BJVA 2XC0A 5FBEA 3U1JB 1MKWK 2QXGA 1C2DA 1C5WB 2AMPA 2PHBA 1MTNB 4WMFA 2AIQA 1O5FH 1UVSH 1PQ7A 1EPTC 3W1EA 3ZZCA 4AG1A 3H7OA 1P2IA 1SGTA 1M9UA 3D62A 1LVBA 4RT0A 3SUFA 3SV9A 4K60A 1H9LB 3TNSA 3SBKA 1VCPA 5HYOA 2HWLB 2FI5E 1SLVB 1ZPZA 5F8XA 3GCHC 9ESTA 3C1KA 2DE8A 1E79D 2CHAC 2YNAA 1W7XH 4NGAH 2PKSB 1XXFA 2FIRH 3BF6H 3PV5A 3V13A 1NM6A 5FBIA 2A4QA 2H9EH 3RXLA 5DK1A 2GCTB 1ZPBA 1S83A 1GL0E 5H4IB 3KEEA 4NA9H 3M61U 2HVYB 1EJAA 3E1XB 1BMAA 1NFXA 1H8DH 4JCNA 1UTLM 2Z3EA 2VH6A 5F8TA 2BY6X 5EXNA 1BTYA 2FTMA 3OY5U 4ZXYH 1LHEH 2GD4B 1LHFH 3U9AH 1D6RA 4MNWA 3QWCH 6GCHG 1P2MA 1TE0A 2G4UA 2YMSD 1TRNA 1V2UT 4CRBA 3OAAD 2OBQA 2WINI 4AFZA 4NSYA 4B74A 1YBWA 1OWEA 5KGOA 1CVWH 1HAOH 4B73A 1Q31A 2O9QA 4MLFB 4AX9H 1GBAA 1SI5H 3A85A 1SGYE 2NU2E 3MH7A 1IQNA 1KTTB 1P2KA 3EA7A 2A4GA 3TU7H 1GI2A 2OC7A 1T32A 4A1XA 5DP9A 2BDYA 2ZU5A 1E34B 3KHVA 3BTQE 1SGEE 4K8BA 4GHTA 1BITA 4FUIA 2OP9A 1QL7A 1NZQH 4ZCNA 4U01A 4ABBA 2F91A 1ABJH 1ELCA 1O2SA 1QRWA 3GDSA 3ZZAA 5ABWA 1YPGH 1WBGB 4X2WA 1TA2A 3F1SB 3U69H 3ZIAD 3Q77A 3VGCC 4ZMAH 3E0PB 3DT0H 1HV7A 1AU8A 5IDKA 1VZQH 3E8LA 1N8OC 2V0BA 2G5NA 3PLBA 2BVRH 1CA0C 5HM2A 3RDZA 1MKWH 4X1SU 5G4BA 1GHVH 2FOGA 1QJ7B 3BIUH 3LJOA 4LK4A 4Q7XA 1XUGA 3OX7U 2PKAA 1BRCE 1ELGA 2L74A 2XBVA 1FY8E 1Z7KA 1O2GH 1O3HA 4OS4A 5IYTA 2CK3D 4FUEA 3NK8A 1QA7A 4ASUD 1SHHB 1Z1JA 3BTFE 3MNXA 3NWUA 3KYFA 1O3KA 1W0ZU 1V2LT 4AOQA 1YPMH 1Z71A 5TJXA 2PSYA 4KGAA 5EGMA 3QGNB 1TGSZ 1LHDH 1FN6A 1KDQA 3F6UH 5DGJA 1QQUA 1DY9A 3HKIB 2KAIA 2J98B 2EQNA 2A32A 3QTOH 2ZIQH 1O2RA 2ZGXH 3OFND 1A0HB 1QY6A 1C4V2 4ACAA 5HXFA 3RXJA 3SHCH 2H2ZA 4Y8XA 4K1EA 2XCNA 3PTNA 5DP6A 2ILNA 1Z8GA 1AVWA 2IPQX 4OS1A 1IQKA 2K1QA 1GBLA 4KTCA 2AGIX 1THPB 3OSYA 4DVAU 2O8WA 2B0FA 2FS9A 1MCVA 5EXLA 1FX0B 4ZKRU 2I6QA 1V2KT 2BD7A 3GS9A 1VITF 5GPIB 4BTIB 1MKXK 1IQHA 3M3TA 2XRCA 4CR9A 1F5LA 1HAVA 4BTTB 1GHYH 1F0TA 3OEED 1S0QA 3ZZ4A 2BD5A 3ITIA 4BOHA 1P2JA 3AASA 3RMNH 1RTKA 4ZKNU 3E0NB 2F3CE 3MNBA 3KF2A 5E0JA 1BTXA 1O38A 2LNCA 1GI9B 3F9GA 2OUAA 4MDSA 4TY7A 1GGDC 1W3CA 2J2UA 2GCHG 1IAUA 1W11U 3Q76A 1CT0E 1ZHRA 1Z8JB 3S9BA 1F5RA 1MTNC 1O3NA 2R2WU 4Z6AH 3TK5A 1CHOG 3TGIE 1UK4A 1WV7H 1TQ0B 5HMAA 4X6OA 4RKJB 3SHAH 4NA7A 1NFUA 3ZVFA 2ZU4A 1QURH 2A7CA 1LVOA 1RD3B 1G3BA 4JZFH 4INLA 2GT7A 1C2MA 1GJ8B 4CBOA 3GCOA 3A7TA 3UIRA 1YY3A 2SGQE 1AMHA 1L1GA 2PKSC 3SQHE 3EA9A 1JIMA 2AS9A 2R3UA 2L6OA 3EE0B 5GCHG 4K1SA 3BEUA 4DOQA 1SLUB 3LJJA 3S0NA 3GY8A 4GCHF 3RXHA 1EXFA 2ZU2A 3GISB 2GCTC 4X6MA 4BAMB 1YP9A 1C1NA 1FIWA 5ETXA 2GTBA 1DUEA 5AVDA 3UAIC 4MQAA 4AG2A 4F48B 2BB4A 2Z9LA 1QIXB 2BQ7B 1GBCA 3A7WA 1UVOA 1ARBA 1FY4A 3LGWA 1QHRB 5C5OA 1J8AA 2WZQA 2FLBH 2OINA 1WTGH 1SFQB 5HM9A 1L1NA 4AYYB 4ZKOU 2OC8A 4PROA 1O34A 3NPSA 4XDEA 1LTOA 6LPRA 1OOKB 1QA0A 2ZGBH 1RFNA 1XXDA 1EZUC 1CSOE 1THSH 2SGEE 5JYIA 3M5OA 5EQRA 1HAXB 2BX4A 2R0KA 1PQ5A 1Y59T 2PTCE 1WSSH 3FVFB 4BAQB 1G30B 4J1YA 3F9FA 2Z9KA 3TK9A 5DP7A 1MKXH 2DUCA 3UR9A 2ESTE 1NU9A 4F4OC 1HIAB 1C2GA 1LO6A 1HNEE 2AIPA 4ISOA 4ISLA 3I29A 1V2JT 2EI6A 4WMDA 1GHBG 1BTHH 3FP7E 1PPFE 5I46H 3GCNA 3SJ9A 5LPEA 3LIWA 3KCGH 4UDWH 1GVLA 1N6XA 2VU8E 1SHYA 2ZHDA 4NZQA 3SU1A 2BY5X 4A1VA 1NFWA 2BDCA 5C0TA 1A46H 4WXIA 2WPMS 2GJGA 1O2NA 3OYPA 3LGTA 5EJLA 1MZDA 1ZR0A 2ZDNA 5C3NA 1AUJA 1DM4B 1KXFA 2BDAA 4NG9H 3U98H 2ZTXA 3DFJA 4GSOA 2UUYA 4GHQA 4ABGA 3GCTF 4TPIZ 5FX5A 3TGKE 1LHCH 4X6PA 2GGVB 4SGAE 5GDSH 4Y71A 2V3HH 3SNEA 5T1VA 3KQ5A 1BHXF 3RXGA 1N6YA 3ZVAA 3FP8E 2TGTA 1Z6EA 1VJAU 4CH8B 1OP8A 2CHAB 3PV4A 4VGCB 2BMGB 3F3BA 3SGBE 1O3EA 5C5NA 2RDLA 2J94A 1MTWA 6GCHF 2KCYA 1AIXH 1SOZA 1TONA 2GMTB 2UUFB 1E0FD 1UTOA 2ZFQH 1NY22 1O3FA 1OX1A 3SJOA 1CGHA 1ETTH 1A3BH 4X8UH 3VB4A 1KXEA 3M5NA 3ZZ7A 1NU7B 1C1WH 1DSUA 1YPHE 1C2HA 5C0UA 2NU1E 3MMGA 1SL3A 4YT6H 4ABHA 2NWNA 1O2LA 1PPBH 2EC9H 5T6GA 5LPRA 1H4WA 2KCPA 1D4PB 2TBSA 2QA9E 2ZFRH 1RXPA 2Z94A 4K1TA 4NIWA 2PFEA 2FM2A 3Q3XA 4WH6A 5DP8A 3RXSA 2BZ6H 1MTVA 4U2WA 4ISNA 1K28D 1UCYK 1ZJDA 3AW0A 1MCTA 5HKKD 5EQQA 3P8NA 1O2ZA 2A4OA 2W3KA 4JZDH 4CRDA 1W14U 1TB6H 1V2PT 3DSPA 2THFB 4DT7B 2QN5T 8GCHF 4GUXA 2JIZD 1FN8A 2BZAA 2R2MB 5CHAB 2BOHB 2PGQB 5IK2D 2BM2A 1CGIE 1VJ9U 3OEHD 1ZTJA 1AHTH 2G5VA 2A2XH 3ZVBA 1ETRH 4I32A 3SZEA 3UTUH 4AC9A 1NS3A 3SNAA 4WXVA 1HIAA 1VITG 1GHZA 1QL8A 3RC6A 1WCZA 1EAWA 1Y3VA 2VNTA 4HTCH 1MQ6A 4INHA 4IN1A 3ZZ5A 1O2IA 1GBBA 2ZDMA 1ZMLA 3BTME 4DG4A 1XM1A 3QN7A 1P11E 1AWFH 1HDTH 1LCYA 2XNIA 2A0QB 3CNRA 1FUJA 4E7RG 2PWXA 3RU4T 3A82A 5A0CA 4K2YA 2D1JA 3E6PH 3UFAA 3H5CB 3PO1B 1GCDA 1UTNA 4Y7BA 3A89A 3UOUA 1EPTA 3PRDA 3MH5A 1HPGA 5DP3A 1MAYA 2FS8A 4B76A 3EYDA 5T6DA 1C1OA 5B6OA 5EIYA 5C17A 3E16B 4IMQA 1NRQH 2A5KA 3GDVA 4IN2A 3S69A 1O2TA 2F9NA 4P00A 2ZFSA 3SGAE 1TGTA 2QV1A 1AD8H 3RXQA 1G32B 4LZ1H 1B5GH 2Z9IA 1LQEA 4LXBH 1LMWB 3BG8A 1S6HA 1UHBB 1GPZA 2V6NA 4CRGA 1GVZA 4HFPB 3UREA 2H1UA 2B5TB 2FESH 3LC3A 2OXSA 2W26A 2ZC9H 1FDPA 3A83A 2FLRH 3PMHB 2Q6GA 1TBRH 3RXUA 3T62A 1HB0B 2ALPA 1LPKB 4Q63A 4H4FA 1BMLA 3CS0A 4AYVB 1P2OA 1O3IA 2PGBB 1JBUH 3BTEE 3EA8A 2ZHWH 4FUDA 5FPSA 1CHGA 1TMTH 5A0BA 4GPGA 1C5NH 1Y5AT 2H9TH 2QXJA 3KNXA 2ZU3A 3STJA 3HK3B 2ZF0H 3DSGA 2GCHF 3GY7A 2O8UA 5ESTE 3ZVDA 1A0LA 2GDEH 2ZTYA 3SI3H 1F0RA 6CHAB 1SMFE 1HAYB 3SNBA 1NRPH 4X2VA 4B2CA 1GG6B 3KIDU 2KCAA 1EFRD 1TPPA 1CHOF 1K1MA 4FVBA 2IOTA 4XE4A 1CU1A 2C4FH 4Y79A 4ABJA 1AVGH 1JMOH 2VVUA 3E90B 1O2UA 4RSPA 1AGJA 1O2MA 1W2KH 1CO7E 1Q2WA 1GGDB 1O3PB 3URDA 2VWMA 1JRSA 3UQOA 2ZFPH 4D8NA 1DX5M 2FEQH 1EJMA 1C5RA 1TX8A 5FXLA 1BOQA 1VKYA 4R0IA 5EW2H 3P6ZB 5GCHF 1GDQA 2NU4E 1WDIA 1BBRK 3MU0A 5GXPA 1LKBA 1HXFH 3AW1A 5CDFE 1U6QA 2FYRA 1WU1A 2CXVA 2A5AA 3RXRA 4AFSA 1G3CA 2ODPA 3VEQB 4AB9A 1K1JA 1CQQA 2OK5A 3ATMA 1K22H 3PROA 5JB8S 4F55A 1GBEA 4WH8A 5GNDA 1Y5BT 1FPHH 1K2I1 2D26C 2ZFTA 3L6PA 2FOFA 4VGCC 3P17H 1BRUP 1O2KA 1S82A 3FZDA 3BTDE 3SUGA 3UB0A 2GMTC 1H1BA 2J9NA 3ATLA 1NO9H 4A7IB 3HGPA 1FQ3A 1GMDF 1SLWB 1TNJA 1V2OT 3GCTG 4A5TS 4Z1MD 5J4QA 1MTUA 5A8ZA 2K0QA 1DPOA 4HG6A 1ZSKA 2ANWA 4MVNA 1V2VT 2XXLA 3SOSA 5A2MH 2BD2A 1SLXB 1F7ZA 4DW2U 1C5QA 4AORA 4NCYA 4FUGA 2BDHA 4WY3A 4XBCA 3M7UA 1WYKA 4X8VH 1O3JA 1O33A 3F9HA 4XSKU 3SU4A 3WWFA 2AH4X 1UTPA 1BT7A 1GBHA 1T31A 1DLKB 3M5LA 4MNXA 2O8LA 5F8ZA 2B7DH 5JB9S 1EQ9A 4DGJA 2QE7D 4HI3A 4J2YB 4Q7YA 1C4U2 3SU6A 3ATKA 1UTJA 1GHBF 3MU4A 3VXEH 3RUOA 1GJ7B 3ESTA 3PWCA 2TIOA 3ZZ6A 4MPWA 5DJ7A 1W0KD 1HAZB 1ETSH 2AEIH 2BLWA 2GZ7A 2TGDA 1MABB 3JZ1B 3M3SA 3GY5A 3UNSA 1MH0A 1P3EA 1QBOA 1C5TA 2GP9B 3GDUA 2ZZUH 5CHAC 3LGYA 1TYNA 4INKA 1FY3A 2FOAA 1GI0A 1SQOA 2BVSH 1ESTA 1NFYA 4MNYA 1KXAA 3UY9A 1JOUB 2H5DA 1K1PA 1LPZB 3O8DA 1O3DA 2GKVE 1K9OE 3TH3H 3UR6A 2WYJA 3ZV9A 8GCHG 3LONA 3MTYA 4K69A 1MZAA 3OTPA 4D9QA 2B9LA 1F92A 1ESBA 3FFGA 2G81E 1BBRH 1GJ5H 4M9FA 3PO1C 1YWUA 1UK2A 4D76A 1GHAG 4K3JA 1NRRH 2F9OA 1ZLRA 2BVXH 1DSTA 3Q3KA 1C2LA 3F2FA 2O8MA 3TPIZ 1J15A 2IN2A 3DCLA 2ALVA 1MQ5A 5EU8A 5PTPA 2BDBA 1TIOA 5FPTA 1F0UA 7GCHG 3F2GA 2G55A 2ZGCA 1BA8B 2F9PA 4LOYH 1O3OA 1TPOA 3KQEA 4YESB 5DO4H 4O3UA 1L4ZA 1V2RT 1EOJA 1BRAA 1DWCH 1GJ6A 4TYDA 2XBXA 1O31A 2BXUH 1HRTH 2GZ9A 1ANDA 1HJAB 1XUIA 2HLDD 1A0JA 2P94A 1HFDA 2Q6FA 1FJSA 2HNTC 3SQEE 5JBTA 1IQEA 4NFFA 2KR7A 3B9FH 2QIQA 1O2PA 3GYMA 1OP2A 1P2QA 2FI4E 1GJ4H 1BMNH 1EASA 1GBMA 3PMJA 3S9AA 5JBBS 1EP5A 1LVMA 1FAXA 5C94A 1DWDH 3U8TH 1V2WT 5EPYA 1L0ZA 2QY0B 1TA6A 1H8ED 1UTQA 5CMXH 2K8IA 1GMHG 3B23B 3S9CA 2A7JA 2IJOB 2OC0A 3R0FA 2F4LA 5AF9H 6CHAC 4WJG2 2P95A 2FDAA 2V7QD 1GG6C 1O3CA 5E8EH 4ZROA 1SPJA 3ZVGA 4JYTA 3GY4A 2O8TA 1QBVH 3FN8A 1P3CA 1O36A 1XUHA 1S85A 3A8BA 5CHBA 1A4WH 1S6LA 1A1RA 1C1RA 1RRKA 1L1JA 1E36B 1Z8RA 1T7CA 4Y0YE 1KIGH 2ZGJA 4Y10E 2QF3A 1G37A 2OQUA 1F0SA 3UPEA 1BB0B 3LH3A 3ZZ3A 9LPRA 1TFXA 5FHTA 5EJZA 2OBOA 1HJ9A 1DWBH 2J38A 2LPRA 2IPHA 1AE5A 1TOMH 1QFKH 2JJ2D 4JZIA 3OE7D 1GBTA 4FUFA 1W10U 3QLPH 2P93A 2HVXA 2CF8H 1ELTA 2Z9JA 2Q1JA 1TALA 1CGJE 2W3IA 1AZ8A 3ENSB 2G4TA 3RXBA 1BCUH 2EI7A 1Y3XA 1P9UA 1XVOA 4D7GA 3D49H 2P59A 2VIVA 2W6ID 2VBCA 1K1NA 3MWIU 4FETA 3SORA 3LKWA 2A4RA 1AN1E 2F9BH 3DSOA 1O3MA 1WUNH 1SGDE 2ZDKA 1TNLA 1XMNB 2W7SA 1GCTB 3MOCA 4I8HA 3HPTB 2ZP0H 3LGVA 3RMMH 1CA8B 5FAHA 3F0PA 1ZMJA 2JH0D 3K9XB 1QTFA 3D65E 1WQSA 4P02A 3A88A 5HIZA 4UFGH 4K5ZA 2CMYA 2HALA 5DPAA 4X1PU 4ZHMU 3F68H 5I25A 4UE7H 4XBDA 2J98A 3LT3A 3MNCA 1BMMH 5C1UA 4Y6DA 4OS6A 1FLEE 2ZHEH 1FY5A 4X2YA 3ZYEA 4ZXXH 1TNKA 1T8NA 1GMDG 1C1MA 3KQCA 3M3VA 1ZPCA 1YKTA 3TJVA 1WTHD 1O2WA 2C90B 2BLQA 3URCA 1XX9A 2HPQH 1KMHB 1DUAA 3MH4A 3STIA 3SI4H 1VCQA 3KL6A 1DVAH 5A8YA 5T3HA 1LHGH 2JH6D 1MBQA 1GDUA 2Y81A 4I8KA 4ZH8A 3V3MA 1UVUH 1T8OA 2P3TB 3LOXA 5ESBA 5DP4A 3ZYDA 2J34A 2AGEX 4Y8ZA 3IG6B 1SQAA 2WPJS 3A8AA 4YZUA 3AVZA 3SW2B 1EAUA 4YOJA 1DITH 1H9HE 2HOBA 3NCLA 3RMOH 3MU8A 4MTBA 1O5GH 3W94A 1TOCB 2TGPZ 1UTKA 3PLPA 3BIVH 5EXMA 2VVCA 5F53A 3SU2A 5L6NH 1O35A 4WWYA 2WV9A 2AMQA 2F83A 2WPHS 3A7ZA 1ACBE 3RU4D 4HGCA 1THRH 1GJAB 1IQFA 4KTSA 5JPMH 2EEKA 2J95A 3GYLB 2M2AA 2RDEA 3S7HB 3B8JA 2Z3DA 4UEHH 2VIDA 1COWD 1OYQA 1C1UH 1IOEA 4MPVA 3RXVA 3SV7A 1ANBA 1ELBA 1PQ8A 1C9PA 2Y7XA 1AKSB 1UW7A 2VIPA 3T26A 4E06H 1EATA 3FZZA 1O3LA 2P8OB 5EOKA 1CT2E 1T8LA 3N99A 1J16A 1UCYE 1BMFD 1AZZA 1O3AA 4I7YH 2WV4A 1KTSB 1QB6A 1JWTA 3SYJA 2RG3A 1A5IA 4YTAA 4Y76A 3MHWU 2WYGA 5TCCA 3BTKE 4JZEH 1HJAC 1J14A 3RLYH 5E2OA 1EZQA 3WW7A 4DY7B 2P3FH 3PWBA 1V2TT 1W0YH 4UONA 1H8HD 1ZHPA 5EG4A 2QCYA 2HGTH 3NUMA 4NWLA 2QXHA 3RXIA 3M35A 2STAE 3E3TA 4ZKSU 2V3MA 5J4SA 1GMCG 1QRZA 5K0HA 4IC6A 2BHGA 4X1QU 4Y7AA 1JIRA 3A86A 5E0HA 4AB8A 4ISIH 1BZXE 4BAHB 4ABAA 1PPGE 2EY4C 3PB1E 1XKBC 1PPEE 2FXRA 2ZO3H 2SGAA 4ZUHA 1DXPA 1YCPM 1OWDA 4H42U 1EX3A 1NBMD 4X6NA 1C5OH 4XRNA 3LPRA 2ZEBA 1NRNH 2YMSB 5EODA 3SV2H 1WAYB 3UUZA 2BLVA 1WOFA 3BEFB 4ZHLU 3K2UA 4YT7H 1CBWB 2ZDAH 1P2NA 1SFIA 2A2QH 2CJIA 2ZFFH 3QGJA 4H6TA 2OQ5A 1GHAF 3RLWH 4X2XA 5B6LA 2W7UA 1SSXA 2ZQ2A 4OGYA 2H6MA 5LGOA 3LGIA 4BXWA 1QJ1B 1QZ8A 3SNDA 1O5CB 4YO9A 7GCHF 1O2VA 3RMLH 1P10A 4I8LA 1DE7H 2UWPA 1O3BA 2Y82A 4DJZB 4ZHAA 1ZOMA 2BDGA 3BV9B 2ZDLA 4AZ2B 1S84A 3RM2H 3ZZ8A 2NU0E 2XC4A 4H6SB 3ATWA 1QR3E 3GY2A 2XNDD 1TBZH 1X7AC 3SJIA 2Z7FE 1K1IA 1W0JD 1ELEE 2SGPE 1V2MT 2PUQH 4TWWA 5KECA 3SNCA 4U30A 1E35B 1ELAA 2TGAA 2V35A 2BXTH 5FX6A 2XOKD 1JXPA 1EP6A 1TAWA 1V2NT 1OWKA 2XWAA 3N7DA 2OD3B 1QQ4A 2WV5A 4FUJA 1OP0A 3P70B 4B6EA 1TX6A 1S6FA 1UTMA 3VPKA 2CV3A 1C5YB 1GI7B 3SV8A 1RGQA 2WSSD 2KX4A 1GCTC 1TGBA 2R3YA 1GMHF 1C5VA 1Y5UT 2ZPSA 1S5SA 4WF8A 3RP2A 2KFWA 3QUMP 1V2ST 3VB5A 1YLCA 2P3UB 4OGXA 1EOLA 1FI8A 3M7TA 3T29A 3UWJH 1EJNA 1SKYE 2ZCKP 3MU5A 2HLCA 2PP6A 1PFXC 4O03A 1NESE 7LPRA 1HAIH 1ZTKA 3EE7A 5HIYA 4UFEH 1YPJH 2OC1A 3RXFA 3ZV8A 2ANYA 2SNVA 1C5LH 2C8ZB 1BJUA 2ZG0H 3F9EA 1OS8A 1P57B 4KP0A 4Y8YA 1BBRE 3D23A 4GVUA 3RXAA 4B71A 2VWOA 3TITA 2HPPH 1O5AB 1TNHA 2LP6A 2V3OH 3I78A 2BDIA 3O8BA 4WVPE 1TPAE 1B0EA 4TT3D 1C5ZB 1D9IA 2HNTF 4E7NA 2I6SA 4FOUC 3VB6A 2BD8A 1GJ9B 2XBWA 1Z6JH 2YOLA 3W95A 4AFQA 2OLGA 3PM3A 3FP6E 1FAKH 2W5EA 1GDNA 1ESAA 5SGAE 3VB3A 1AO5A 1XUFA 1TNGA 1MU6B 2WUCA 5EW1H 4Z0KA 3RXCA 1HXEH 3UNRA 2DE9A 1HUTH 1UO6A 1T8MA 4D9RA 1HCGA 2FWWA 1GBFA 1GHXH 1T4UH 2ZPQA 4JZ1A 5C67A 1P04A 4I33A 5A0AE 2ASUB 5L2ZH 1C4Y2 1UVTH 1LQDB 2BD4A 3TK6A 2GT8A 1A5GH 1O2HA 1P8VC 3O8RA 4BAOB 1XUKA 1YC0A 2YNBA 2CF9H 4YM9A 1O2YA 1FIZA 5A8XA 1ZTLA 1Z1IA 5C2ZA 2ZTZA 1ZGVA 3M7QA 5GIBA 3RXEA 1MTSA 5AFZH 3KYGA 2PKAB 2UWOA 1GJCB 4I86A 3GY6A 4OS5A 1HAPH 2AYWA 3TGJE 8ESTE 2QF5A 1HAHH 3BN9A 1UK3A 1TLDA 1DDJA 1Y3WA 2P8OC 3KGPA 4F49A 1ZSLA 4YOIA 5F6MA 1MAXA 3MO3A 1GI1A 3V12A 1ANCA 2XW9A 2QF0A 1BDAA 3LU9B 1F2SE 3MFJA 2P16A 3P8FA 5E0GA 1ID5H 1OHHD 4R8TB 2GV6A 1K0HA 2VB0A 1SGRE 1KDQB 3DUXH 3SZNA 1KLIH 3MU1A 3BEIB 3V7TA 1P9SA 3ATIA 2KAIB 4XBBA 2A45B 2BTCE 1UHBA 4X1NU 2BLOA 4KKDA 3A87A 2UUJB 2D8WA 3T5FH 2RA0A 1AI8H 3P8OA 4X8SH 3QK1A 1IHSH 3PRBA 1P01A 3ZZDA 1VCWA 3GOVB 1ZYOA 3U28C 1OYTH 3ELAH 3H09A 2BQ6B 1SQTA 3DFLA 2HNTE 1BTPA 4WMEA 1O2JA 3BTWE 3BG4B 3UQVA 2ZWLH 1YLNA 1D6WA 2AMDA 3A7YA 1C1VH 1INCA 1ZJKA 4I8JA 4IMZA 2ZHFH 3H7TA 4YLQH 2LELA 3TLOA 3TJOA 1EB1H 2YMSC 2ZNKH 2CN0H 3ODDA 4ABDA 1CBWC 1ARCA 1HAVB 4DT4A 1QL9A 2ZPRA 3SUDA 4TWYA 1QNJA 1YCPK 3HKJB 1NT1A 1KY9A 1GBIA 1NN6A 1QCPA 2PUXB 1KXBA 1TPSA 1PYTD 3NKKA 2BY8X 1PYTC 4DIHH 1HJ8A 3VFEA 4Q80A 4O9VA 4RN6A 1OWIA 1BUIA 1DY8A 1P0SH 4ABFA 3O8CA 2ANKH 1HAGE 1DOJA 1PQAA 2R9PA 2EI8A 2BY9X 1ANEA 3FOAA 3NRLA 3RXKA 2OCVB 1P06A 4DIIH 1YF4A 1SR5C 1K21H 3MO6A 3T27A 2IJD1 5JBAS 2ZDVH 1FNIA 3QDZB 2Z6BD 5AHGH 1GBJA 1DT2A 4JK6A 5E2PA 4B2AA 1ZHMA 2JJ1D 1BIOA 2F9VA 3P8GA 3OU0A 1SC8U 1G3DA 1FMGA 4BXSA 1C5MD 4AGJA 5A09A 1SGFG 2QF4A 4NA8A 3V0XA 1O0DH 1TMBH 3BTGE 1TWXB 1OWJA 1V2QT 1GMCF 1SB1H 1RTLA 2A7HA 2AFQB 3KQDA 1AUTC 1GJDB 1FZZA 2PSXA 3R3GB 4GAWA 2ZU1A 2J5UA 4FU9A 4FU7A 1UMAH 1AFEH 1IQMA 1Y8TA 1O30A 3IITA 2XCFA 2GVFA 3U8OH 1PJPA 3AAVA 4KTUA 1RS0A 4NFEA 3AAUA 2Y6TA 1F5KU 1EZSC 5JDUB 2H5CA 4XOJA 4OM9A 2VVVA 3KN2A 2QYIA 2ZA5A 3LGUA 3WY8A 2BYAX 2TRMA 1NPMA 1C2IA 2Y5GA 5GJ4B 4YXWD 1KYNA 1SOTA 4B75A 4RI0A 1C9TA 2AHME 2Z9GA 1W13U 5KEDA 1EB2A 1OSSA 3PYHA 1G9IE 2Y7ZA 3MI4A 4NWKA 4UFFH 1MD7A 2VWLA 1MBMA 5LPFA 2C8XB 5DG6A 5T6FA 4CBNA 3VXFH 2WPKS 3SU5A 1KSNA 1QBNA 1C5UA 2A5IA 1K1LA 3A80A 1UJ1A 4Y11E 2VIWA 3DHKH 3ZZ9A 1ELDE 1A2CH 3MYWA 1YPKH 1A61H 2WPLS 2C93B 4NIYA 2FI3E 1AFQB 2VGCC 4FUBA 1QB1A 3CS7A 3HGNA 1SGCA 1IQIA 3M37A 4SGBE 1SGIB 5FCKA 4UFDH 1W7GH 3PLKA 3ZVCA 1DLEA 3SJ8A 1DFPA 3FO8D 5TCAA 1LKAA 1UVPA 1YCPH 3LC5A 4FVDA 2QGRA 3P95A 1H8IH 1SBWA 1KXDA 4BAKB 1SGPE 3MNSA 4ISHH 1LDTT 5F03A 1EZXC 5DP5A 5BPEA 1B0FA 1MU8B 1OKXA 4GLYA 4X8TH 1O39A 2XTTB 1O32A 1SGQE 3A84A 5C20A 1ZRKA 1MD8A 1AVXA 3ZZBA 2FOEA 1P02A 2B8OH 1AQ7A 3HATH 1EAIA 4DCDA 1YYY1 4A6LA 3NZIA 7ESTE 3N7OA 1GVKB 4CR5A 1BRBE 3RU4E 1BTWA 1YLDA 2ZCHP 2FYQA 2FOCA 2FZZA 1NROH 4I31A 1O5DH 1HBTH 1YGCH 2FTLE 3SV6A 3DD2H 3SU0A 3RXMA 2SNWA 1WQVH 5L30H 3ODFA 1QGFA 5GWZA 2Y5HA 3UWIA 3M36A 1K1OA 1AB9B 2Q6DA 2RFKC 4ZAEA 1N1LA 3GY3A 2VWNA 2SGFE 3UNQA 4ESTE 1W8BH 1C2KA 1FY1A 1ZRBA 4ACBA 3BTTE 2ANMH 1FV9A 2WHXA 2BD9A 2H9HA 1O37A 1W12U 1HGTH 4A1TA 2UUKB 2C3SA 1SGNE 1AE8H 4NZLA 4AN7A 5EPNA 1D3QB 4ABEA 3C27B 3RXDA 3IWMA 3QTVH 1ZGIA 1P12E 4MPUA 5EJ1A 3PTBA 3TJUA 3A8DA 5DKMA 1XUJA 3BG4C 1P05A 2BOKA 8LPRA 4IS5A 1SQRA 1ELFA 1P09A 3K6YA 1C5XB 3SGQE 3SO3A 3TNTA 4YLUA 1GL1A 2JETB 3WWBA 4AGKA 1YPLH 3RC4A 1Y3YA 1RIWB 2FOHA 3TH2H 4OS2A 1GI3A 3SUEA 2ZGHA 1GI8B 1TGNA 4CH2B 1AY6H 3CENA 5DSFA 2QC2A 1J9CH 3BSQA 1CT4E 1EUFA 3A7XA 2KCOA 3G01A 1B7XB 1VR1H 2PTNA 1T4VH 1QB9A 3FANA 3QZQA 3ZVEA 6ESTA 3F0OA 1NBME 3U1IB 1VGCB 2FX6A 2XC5A 3RM0H 1GI6A 2WPDD 1LPGB 3RXPA 1A7SA 4CHAB 1L2EA 2QAAA 3TIUA 2ZCLP 2CGAA 4B2BA
chains in the Genus database with same CATH topology
4YOGA 2GX4A 1A5HA 1TGCA 2STBE 3GICB 2BQWB 1GJBB 1BHXB 1QRXA 3EGKH 3U8RH 1ZSJA 5C1XA 4KELA 1FPCH 5K7RA 3T2NA 3EAJA 2AGGX 2FX4A 2PV9B 4I8GA 1LVYA 2G51A 5BRRE 2UWLA 3LH1A 1EPTB 1XVMA 1DWEH 3HK6B 4B1TA 3QX5H 1PPHE 3MH6A 2RCEA 5AFYH 1TRYA 2G8TA 4JYVH 2OTVA 1ZMNA 2XWBI 1NRSH 1DS2E 2BY7X 1C1PA 3QZRA 1V6DA 5EQSA 4CRAA 2J4IA 3GCHB 3MO9A 2A31A 1CE5A 1O3GA 2GZ8A 1TRMA 5JBCS 1HLTH 1Y3UA 1SVPA 1C2FA 3KQBA 1OPHB 1D3DB 1ELVA 2BD3A 2VIOA 1C2EA 1C2JA 1O2QA 2BX3A 2Y5FA 3OY6U 3PMAB 1O5EH 3SJKA 2ZHQH 4X0WU 4D7FA 3SN8A 2FOBA 3EDXB 3EQ0H 1C1TA 2D2DA 1OWHA 1D3PB 5CE1A 1GI5A 2XYAA 4A92A 4DURA 4UD9H 1GBKA 4THNH 2G00A 1C5SA 3NXPA 1O2XA 2FP7B 3UOPA 4FUCA 1YM0A 1BQYA 1YPEH 1C5PA 1P03A 4IGDA 2FOMB 1EKBB 1Z8IB 1IQJA 1C1SA 1MUEB 1QJ6B 2QXIA 4BANB 1O2OA 2ZKSA 4Q2KA 1SG8B 3T25A 3T28A 1ZZZA 1HYLA 2Z3CA 4X1RU 1AFQC 5FCRA 3Q00A 1DXWA 4TY6A 2PLXA 4IC5A 1GI4A 1IHTH 1IQLA 1NTPA 3OTJE 1C1QA 1E37B 1TQ7B 2RA3A 1J17T 2EA3A 4MG3A 2C8WB 3JZ2B 5C1YA 4JYUH 2JH5D 2WPIS 3BTHE 4FUHA 1E38B 2TPIZ 4FXGH 1RTFB 1BTUA 4XFQA 1PPZA 4U32A 3RXOA 1EAXA 2J92A 2HRVA 2ZI2H 2SFAA 2VIQA 4NIXA 2M5TA 3L3TA 4O97A 1GBDA 1TX7A 3QO6A 4JMYA 3P92A 4LZ4B 3PMBB 2ZECA 1TABE 1NC6A 4IW4E 2FPZA 3VGCB 1ORFA 4MPXA 2JKHA 1G2MA 1V3XA 4BTUB 1N8OB 2XBYA 1VITH 1CA0B 1GWAA 3A81A 4Q7ZA 1AKSA 1D3TB 2C8YB 2SGDE 2ZQ1A 4NIVA 2PW8H 1AB9C 2FODA 4Y0ZE 5FPYA 1TMUH 4CRCA 1G36A 5LH8A 1XKAC 2WUBA 1YPHC 2GDDA 4AFUA 4ASHA 1FXYA 3E91A 1A3EH 3SU3A 3K6ZA 3RXTA 1IQGA 1JRTA 2Y80A 3L33A 3RC5A 4NSVA 4QT8C 1DANH 2FMJA 2F9UA 1FONA 2R0LA 3K65B 1KLTA 4O3TA 1S0RA 2ODYB 1H9IE 3VB7A 2G52A 4CREA 1L4DA 4BNRA 3Q3YA 2VINA 4ABIA 1AWHB 4OS7A 2JETC 1TBQH 5L2YH 3CP7A 4GCHG 4FU8A 2A1DB 4CRFA 2ODQA 3DA9B 1BTZA 1MMJN 1RIWC 1S81A 4M7GA 7KMEH 2GV7A 1G3EA 1RJXB 2PR3A 1SGFA 3S7KB 3TJNA 1KLJH 2VGCB 3A7VA 1PPCE 1O5BB 3LDXH 1Q3XA 3A8CA 4RKOB 1UCYH 2FO9A 5HGGA 1KXCA 2AERH 1VGCC 4CHAC 4TPYA 4MNVA 4JK5A 4HZHA 3FAOA 3M5MA 2VJ1A 3TVJB 4K8YA 1ABIH 2ULLA 1OXGA 8KME2 1DICA 4IBLH 1G2LA 3I77A 2NU3E 1GHWH 4E05H 3TH4H 2VH0A 1TNIA 1BJVA 2XC0A 5FBEA 3U1JB 1MKWK 2QXGA 1C2DA 1C5WB 2AMPA 2PHBA 1MTNB 4WMFA 2AIQA 1O5FH 1UVSH 1PQ7A 1EPTC 3ZZCA 4AG1A 3H7OA 1P2IA 1SGTA 1M9UA 3D62A 1LVBA 3SV9A 3SUFA 4K60A 1H9LB 3TNSA 3SBKA 1VCPA 5HYOA 2HWLB 2FI5E 1SLVB 1ZPZA 5F8XA 3GCHC 9ESTA 3C1KA 2DE8A 2CHAC 2YNAA 4NGAH 1W7XH 2PKSB 1XXFA 2FIRH 3BF6H 3V13A 1NM6A 5FBIA 2A4QA 2H9EH 3RXLA 5DK1A 2GCTB 1ZPBA 1S83A 1GL0E 5H4IB 3KEEA 4NA9H 3M61U 1EJAA 3E1XB 1BMAA 1NFXA 1H8DH 4JCNA 1UTLM 2Z3EA 2VH6A 5F8TA 2BY6X 5EXNA 1BTYA 2FTMA 3OY5U 4ZXYH 1LHEH 2GD4B 1LHFH 3U9AH 1D6RA 4MNWA 3QWCH 6GCHG 1P2MA 1TE0A 2G4UA 1TRNA 1V2UT 4CRBA 2OBQA 2WINI 4AFZA 4NSYA 4B74A 1YBWA 1OWEA 1CVWH 1HAOH 4B73A 1Q31A 2O9QA 4MLFB 4AX9H 1GBAA 1SI5H 3A85A 1SGYE 2NU2E 3MH7A 1IQNA 1KTTB 1P2KA 3EA7A 2A4GA 3TU7H 1GI2A 2OC7A 1T32A 4A1XA 5DP9A 2BDYA 2ZU5A 1E34B 3KHVA 3BTQE 1SGEE 4K8BA 4GHTA 1BITA 4FUIA 2OP9A 1QL7A 1NZQH 4U01A 4ABBA 2F91A 1ABJH 1ELCA 1O2SA 1QRWA 3GDSA 3ZZAA 5ABWA 1YPGH 1WBGB 4X2WA 1TA2A 3F1SB 3U69H 3Q77A 3VGCC 4ZMAH 3E0PB 3DT0H 1HV7A 1AU8A 5IDKA 1VZQH 3E8LA 1N8OC 2V0BA 2G5NA 3PLBA 2BVRH 1CA0C 5HM2A 3RDZA 1MKWH 4X1SU 5G4BA 1GHVH 2FOGA 1QJ7B 3BIUH 3LJOA 4LK4A 4Q7XA 1XUGA 3OX7U 2PKAA 1BRCE 1ELGA 2XBVA 1FY8E 1Z7KA 1O2GH 1O3HA 4OS4A 5IYTA 4FUEA 3NK8A 1QA7A 1SHHB 1Z1JA 3BTFE 3MNXA 3NWUA 1O3KA 1W0ZU 1V2LT 4AOQA 1YPMH 1Z71A 5TJXA 2PSYA 4KGAA 5EGMA 3QGNB 1TGSZ 1LHDH 1FN6A 1KDQA 3F6UH 5DGJA 1QQUA 1DY9A 3HKIB 2KAIA 2A32A 3QTOH 2ZIQH 1O2RA 2ZGXH 1A0HB 1QY6A 1C4V2 5HXFA 3RXJA 3SHCH 2H2ZA 4Y8XA 4K1EA 2XCNA 3PTNA 5DP6A 2ILNA 1Z8GA 1AVWA 4OS1A 1IQKA 2K1QA 1GBLA 4KTCA 2AGIX 1THPB 3OSYA 4DVAU 2O8WA 2B0FA 2FS9A 1MCVA 5EXLA 4ZKRU 2I6QA 1V2KT 2BD7A 1VITF 5GPIB 4BTIB 1MKXK 1IQHA 3M3TA 2XRCA 4CR9A 1F5LA 1HAVA 4BTTB 1GHYH 1F0TA 1S0QA 3ZZ4A 2BD5A 3ITIA 4BOHA 1P2JA 3AASA 3RMNH 1RTKA 4ZKNU 3E0NB 2F3CE 3MNBA 3KF2A 5E0JA 1BTXA 1O38A 2LNCA 1GI9B 3F9GA 2OUAA 4MDSA 4TY7A 1GGDC 1W3CA 2J2UA 2GCHG 1IAUA 1W11U 3Q76A 1CT0E 1ZHRA 1Z8JB 3S9BA 1F5RA 1MTNC 1O3NA 2R2WU 4Z6AH 3TK5A 1CHOG 3TGIE 1UK4A 1WV7H 1TQ0B 5HMAA 4X6OA 4RKJB 3SHAH 4NA7A 1NFUA 3ZVFA 2ZU4A 1QURH 2A7CA 1LVOA 1RD3B 1G3BA 4JZFH 4INLA 2GT7A 1C2MA 1GJ8B 4CBOA 3GCOA 3A7TA 3UIRA 2SGQE 1AMHA 1L1GA 2PKSC 3SQHE 3EA9A 1JIMA 2AS9A 2R3UA 3EE0B 5GCHG 4K1SA 3BEUA 4DOQA 1SLUB 3LJJA 3S0NA 3GY8A 4GCHF 3RXHA 1EXFA 2ZU2A 3GISB 2GCTC 4X6MA 4BAMB 1YP9A 1C1NA 1FIWA 5ETXA 2GTBA 1DUEA 5AVDA 4AG2A 4MQAA 2BB4A 2Z9LA 1QIXB 2BQ7B 1GBCA 3A7WA 1UVOA 1ARBA 1FY4A 3LGWA 1QHRB 5C5OA 1J8AA 2FLBH 2OINA 1WTGH 1SFQB 5HM9A 1L1NA 4AYYB 4ZKOU 2OC8A 4PROA 1O34A 3NPSA 4XDEA 1LTOA 6LPRA 1OOKB 1QA0A 2ZGBH 1RFNA 1XXDA 1EZUC 1CSOE 1THSH 2SGEE 5JYIA 3M5OA 5EQRA 1HAXB 2BX4A 2R0KA 1PQ5A 1Y59T 2PTCE 1WSSH 3FVFB 4BAQB 1G30B 4J1YA 3F9FA 2Z9KA 3TK9A 5DP7A 1MKXH 2DUCA 3UR9A 2ESTE 1NU9A 4F4OC 1HIAB 1C2GA 1LO6A 1HNEE 2AIPA 4ISOA 4ISLA 3I29A 1V2JT 2EI6A 4WMDA 1GHBG 1BTHH 3FP7E 1PPFE 5I46H 3GCNA 3SJ9A 5LPEA 3LIWA 3KCGH 4UDWH 1GVLA 1N6XA 2VU8E 1SHYA 2ZHDA 4NZQA 3SU1A 2BY5X 4A1VA 1NFWA 2BDCA 1A46H 4WXIA 2WPMS 1O2NA 3OYPA 3LGTA 1MZDA 1ZR0A 2ZDNA 5C3NA 1AUJA 1DM4B 1KXFA 2BDAA 4NG9H 3U98H 2ZTXA 3DFJA 4GSOA 2UUYA 4GHQA 4ABGA 3GCTF 4TPIZ 5FX5A 3TGKE 1LHCH 4X6PA 2GGVB 4SGAE 5GDSH 4Y71A 2V3HH 3SNEA 1BHXF 3RXGA 1N6YA 3ZVAA 3FP8E 2TGTA 1Z6EA 1VJAU 4CH8B 1OP8A 2CHAB 3PV4A 4VGCB 2BMGB 3SGBE 1O3EA 5C5NA 2RDLA 2J94A 1MTWA 6GCHF 1AIXH 1SOZA 1TONA 2GMTB 2UUFB 1E0FD 1UTOA 2ZFQH 1NY22 1O3FA 1OX1A 3SJOA 1CGHA 1ETTH 1A3BH 4X8UH 3VB4A 1KXEA 3M5NA 3ZZ7A 1NU7B 1C1WH 1DSUA 1YPHE 1C2HA 2NU1E 3MMGA 1SL3A 4YT6H 4ABHA 2NWNA 1O2LA 1PPBH 2EC9H 5T6GA 5LPRA 1H4WA 1D4PB 2TBSA 2QA9E 2ZFRH 1RXPA 2Z94A 4K1TA 4NIWA 2PFEA 2FM2A 3Q3XA 4WH6A 5DP8A 3RXSA 2BZ6H 1MTVA 4U2WA 4ISNA 1K28D 1UCYK 1ZJDA 3AW0A 1MCTA 5EQQA 3P8NA 1O2ZA 2A4OA 2W3KA 4JZDH 4CRDA 1W14U 1TB6H 1V2PT 4DT7B 2THFB 2QN5T 8GCHF 4GUXA 1FN8A 2BZAA 2R2MB 5CHAB 2BOHB 2PGQB 2BM2A 1CGIE 1VJ9U 1ZTJA 1AHTH 2G5VA 2A2XH 3ZVBA 1ETRH 4I32A 3UTUH 1NS3A 3SNAA 4WXVA 1HIAA 1VITG 1GHZA 1QL8A 3RC6A 1WCZA 1EAWA 1Y3VA 2VNTA 4HTCH 1MQ6A 4INHA 4IN1A 3ZZ5A 1O2IA 1GBBA 2ZDMA 1ZMLA 3BTME 4DG4A 1XM1A 3QN7A 1P11E 1AWFH 1HDTH 1LCYA 2XNIA 2A0QB 1FUJA 4E7RG 2PWXA 3RU4T 3A82A 5A0CA 4K2YA 2D1JA 3E6PH 3UFAA 3H5CB 3PO1B 1GCDA 1UTNA 4Y7BA 3A89A 3UOUA 1EPTA 3MH5A 1HPGA 5DP3A 1MAYA 2FS8A 4B76A 3EYDA 5T6DA 1C1OA 5B6OA 3E16B 4IMQA 1NRQH 2A5KA 3GDVA 4IN2A 3S69A 1O2TA 2F9NA 2ZFSA 3SGAE 1TGTA 2QV1A 1AD8H 3RXQA 1G32B 4LZ1H 1B5GH 2Z9IA 1LQEA 4LXBH 1LMWB 3BG8A 1S6HA 1UHBB 1GPZA 2V6NA 4CRGA 1GVZA 4HFPB 3UREA 2H1UA 2B5TB 2FESH 3LC3A 2OXSA 2W26A 2ZC9H 1FDPA 3A83A 2FLRH 3PMHB 2Q6GA 1TBRH 3RXUA 3T62A 1HB0B 2ALPA 1LPKB 4H4FA 1BMLA 3CS0A 4AYVB 1P2OA 1O3IA 2PGBB 1JBUH 3BTEE 3EA8A 2ZHWH 4FUDA 5FPSA 1CHGA 1TMTH 5A0BA 4GPGA 1C5NH 1Y5AT 2H9TH 2QXJA 3KNXA 2ZU3A 3STJA 3HK3B 2ZF0H 2GCHF 3GY7A 2O8UA 5ESTE 3ZVDA 1A0LA 2GDEH 2ZTYA 3SI3H 1F0RA 6CHAB 1SMFE 1HAYB 3SNBA 1NRPH 4X2VA 4B2CA 1GG6B 3KIDU 1TPPA 1CHOF 1K1MA 4FVBA 2IOTA 4XE4A 1CU1A 2C4FH 4Y79A 4ABJA 1AVGH 1JMOH 2VVUA 3E90B 1O2UA 4RSPA 1AGJA 1O2MA 1W2KH 1CO7E 1Q2WA 1GGDB 1O3PB 3URDA 2VWMA 1JRSA 3UQOA 2ZFPH 4D8NA 1DX5M 2FEQH 1EJMA 1C5RA 1TX8A 5FXLA 1BOQA 4R0IA 5EW2H 3P6ZB 5GCHF 1GDQA 2NU4E 5GXPA 1BBRK 3MU0A 1LKBA 1HXFH 3AW1A 1U6QA 2FYRA 1WU1A 2CXVA 2A5AA 3RXRA 4AFSA 1G3CA 2ODPA 3VEQB 4AB9A 1K1JA 1CQQA 3ATMA 1K22H 3PROA 5JB8S 1GBEA 4WH8A 1Y5BT 1FPHH 1K2I1 2D26C 2ZFTA 3L6PA 2FOFA 4VGCC 3P17H 1BRUP 1O2KA 1S82A 3FZDA 3BTDE 3SUGA 2GMTC 1H1BA 2J9NA 3ATLA 1NO9H 4A7IB 3HGPA 1FQ3A 1GMDF 1SLWB 1TNJA 1V2OT 3GCTG 4A5TS 5J4QA 1MTUA 5A8ZA 1DPOA 1ZSKA 2ANWA 4MVNA 1V2VT 2XXLA 3SOSA 5A2MH 2BD2A 1SLXB 1F7ZA 4DW2U 1C5QA 4AORA 4NCYA 4FUGA 2BDHA 4WY3A 4XBCA 3M7UA 1WYKA 4X8VH 1O3JA 1O33A 3F9HA 4XSKU 3SU4A 2AH4X 1UTPA 1BT7A 1GBHA 1T31A 1DLKB 3M5LA 4MNXA 2O8LA 5F8ZA 2B7DH 5JB9S 1EQ9A 4DGJA 4HI3A 4J2YB 4Q7YA 1C4U2 3SU6A 3ATKA 1UTJA 1GHBF 3MU4A 3VXEH 3RUOA 1GJ7B 3ESTA 3PWCA 2TIOA 3ZZ6A 4MPWA <