1TPSA

Atomic structure of the trypsin-a90720a complex: a unified approach to structure and function
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Atomic structure of the trypsin-A90720A complex: a unified approach to structure and function.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tpsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tpsA02
1FUJA 2ZKSA 3U98H 1P10A 1LHEH 1P8VC 2STBE 3KQEA 1HXEH 4CRGA 3K9XB 1S6HA 4CRCA 1QIXB 1AUJA 3B23B 5AFYH 2OC1A 5JBAS 2HGTH 3BIUH 1NRNH 3Q76A 3F9GA 1SOZA 1EXFA 3F9HA 1A1RA 4X2YA 1MCTA 1Y5UT 4E7RG 1C2JA 2AEIH 2R0LA 2CXVA 2JETB 3LOXA 3MOCA 1O3HA 1O2ZA 4NZQA 2A0QB 2W7UA 4O97A 1GMDF 1SR5C 2C3SA 2FDAA 3MNSA 5C20A 4TWYA 2VINA 3AAUA 2H6MA 1EJMA 2ZGCA 4XSKU 1BA8B 3BG8A 4WVPE 3EQ0H 1ETTH 1ESBA 3RMMH 1F5RA 4X8TH 3ZVFA 1FIWA 1TQ7B 3SV6A 5HM2A 3RU4D 3T25A 1UCYE 1EAXA 1J14A 2F83A 2PR3A 5FPTA 1GVKB 2P3TB 1KXFA 3MH7A 1NESE 1DUAA 1VITF 3UPEA 1GBFA 1Y3UA 1GL1A 1GI8B 4ZUHA 1TRMA 3P8GA 4D76A 4LZ1H 4X6MA 3A7VA 6GCHF 3SW2B 4FUIA 1YPHC 2ZZUH 2FXRA 2G81E 4H6TA 5HYOA 3OYPA 4IS5A 1ZLRA 1ZJDA 2V3OH 1HAZB 4AX9H 2W7SA 2A4QA 3ATIA 5FCRA 5GWZA 1YPLH 1IQEA 3OU0A 4BNRA 4K8BA 1GG6C 1K1IA 5JDUB 2XCNA 1N8OB 5PTPA 4DVAU 1O2IA 2QV1A 3KIDU 1GCDA 2ANWA 2BY7X 1PFXC 3SNDA 3M5MA 3RU4E 4IMQA 4JYUH 1WU1A 3A82A 2EI6A 2FOMB 3KCGH 1NM6A 1JXPA 3ZZ5A 2ZG0H 2VWMA 1V2PT 4YZUA 1SBWA 1HAOH 4I33A 4Q7ZA 1G37A 2PSXA 1BCUH 5A0AE 4DJZB 3FZZA 4YTAA 1Q2WA 2R9PA 1ABJH 2W3IA 2P8OB 1GHBF 1O2JA 2OD3B 3PO1B 4BTTB 3EYDA 4SGBE 2VIOA 5C2ZA 3ZZCA 2OQUA 1DITH 3ENSB 1DS2E 2SGQE 4UEHH 1QL9A 2BLVA 3EE0B 1O5DH 1DDJA 2WYGA 1K1NA 2TGDA 2QIQA 3OX7U 3QWCH 4ISOA 1FMGA 1P9UA 2FI3E 2FS8A 3T62A 1C9TA 3SJ9A 3RXTA 2IOTA 1BBRH 1TBRH 3A7ZA 3PM3A 2BD2A 2HPPH 4D9RA 1SLUB 1EOLA 3S0NA 4FUBA 2GX4A 1H8IH 2NU1E 4HI3A 4DT7B 4J1YA 3BN9A 3GCOA 2ZP0H 3DT0H 1Z8RA 3M7QA 3SU4A 1V2RT 3GOVB 1F0UA 1C1TA 1IHTH 2THFB 5T6FA 1TPAE 2OC7A 4UE7H 3NKKA 3EA8A 2XC5A 3QTVH 1Y5BT 3TK6A 1C2GA 5FX6A 3A7XA 1ELTA 1O3FA 4GAWA 1HAVB 1V2TT 2A4RA 3GYMA 4HGCA 1BMNH 1AUTC 1O31A 2K1QA 1LQDB 1DWEH 1UK4A 4A6LA 2F9NA 1C5SA 1K9OE 1SGRE 3M5LA 3ATWA 1HJ8A 1XXFA 1TE0A 1GHXH 1V2OT 2GKVE 1ZMJA 1SPJA 3UUZA 1QJ1B 1OSSA 2GCTB 5J4SA 1A46H 3TJOA 4PROA 2ZIQH 1K1LA 2ZFPH 1TWXB 5EG4A 1CHOG 1GMHG 1C5RA 1THSH 2J4IA 4WXVA 4A7IB 4ABJA 2ZI2H 1EPTB 4KP0A 1OYTH 1IAUA 1K1PA 3ODDA 1UTQA 1HAVA 3SHAH 4D7GA 1Z8IB 1O3OA 4INKA 1CGIE 1OWKA 1DANH 1HAXB 1YPEH 1PYTD 1DM4B 4FUHA 5EXLA 1W8BH 5ABWA 1T8MA 2O8MA 4WF8A 3T5FH 3O8BA 4FUJA 2PFEA 2ZHDA 3GY8A 1ZGIA 2G5VA 3H7TA 3A84A 1AO5A 2GT7A 3M61U 1V2VT 2ZFSA 3RXLA 7ESTE 4CR9A 1BBRK 1MU8B 1GHWH 3ZV8A 1FAXA 2XC4A 4YOJA 1MAXA 1MKWH 1BTPA 3V0XA 4B2AA 4UFEH 3RU4T 3MHWU 3GY2A 2AMQA 4JZFH 4AFSA 4Y0ZE 1KXDA 3FVFB 3KQCA 2W26A 1GMDG 1O39A 3SJKA 1F2SE 4UD9H 2QXHA 6ESTA 3ZZ6A 2J2UA 1WBGB 1ZHMA 3GCTF 2PKAA 2Z9IA 1AE8H 4X6OA 3QLPH 1DPOA 1KIGH 1O2SA 3SN8A 3I77A 3OSYA 2HNTC 3SZNA 1ZTJA 2OBOA 3M7UA 1TX8A 3TU7H 1TB6H 1BIOA 1P2QA 2WPHS 5CMXH 1QR3E 1QL7A 2STAE 6GCHG 4IMZA 3VB4A 3K65B 5A2MH 1QA0A 1FPCH 3EAJA 4MTBA 1QQ4A 2G52A 2QF3A 5EPNA 4X2XA 1C4Y2 1UVSH 4AGJA 4A92A 1D6WA 1LMWB 3FANA 2WPMS 1AZZA 1K22H 3V3MA 1EASA 1FIZA 1PPHE 1EB1H 4CBOA 1UJ1A 3A8CA 1JRTA 1O3LA 1Z71A 1CBWB 1ARCA 2SFAA 3PLKA 1KLTA 9LPRA 3A8AA 2BLOA 4X1NU 1HV7A 3U8OH 4ZKSU 3AW1A 1AVXA 3LPRA 1ARBA 2ZECA 1EZQA 1OKXA 1HAGE 1Z8JB 4I8GA 3MU1A 5GJ4B 1A4WH 3S7KB 1HBTH 3T27A 3ZYDA 5LPRA 5JPMH 1C1VH 4ABFA 2O8WA 2I6SA 2OC8A 5T6DA 1HLTH 2RDLA 4ZXYH 3A88A 2ZHQH 2OBQA 4GCHF 2PTNA 4U2WA 3RLWH 1J8AA 1GHBG 3MU8A 1MKWK 2XCFA 1OWDA 2I6QA 3SJOA 1UK2A 2BVXH 4Y11E 5G4BA 2VIQA 1SC8U 2CN0H 2GCHG 1L1NA 4NCYA 1O3MA 2BOHB 1UTOA 1Y3WA 2BX4A 2WUBA 1WCZA 3PROA 4Y8XA 1WV7H 1GG6B 2TGAA 4OS4A 1O2VA 1O3BA 1YP9A 1Z8GA 4NIXA 3QZRA 3RXBA 2B0FA 2Y82A 1XUJA 3BTKE 3M3SA 1YCPH 3OTJE 1MH0A 2NU2E 3K6ZA 3QK1A 2ZGJA 1JBUH 4ZHAA 3SGBE 4NA7A 1ZSLA 3ZZ9A 1B0FA 4OS7A 2BY9X 1NFXA 3O8DA 3ZVGA 2CV3A 3G01A 4CBNA 4J2YB 1C2HA 2ODYB 1HIAB 1O2GH 2SGDE 1KTSB 4AFZA 4AG2A 3BF6H 3PWCA 1GI9B 3T29A 4GUXA 1Y3XA 4RKJB 4BOHA 1O3DA 2GDDA 2ZPSA 2FI5E 3L6PA 5DG6A 1C5NH 1UTLM 2YNBA 1AFEH 1TRNA 3FZDA 5CHAC 1GBMA 5CE1A 2EC9H 1RRKA 3RXPA 1D3TB 2BD9A 1Z1IA 1NS3A 5FX5A 4ISHH 3K2UA 1HCGA 1CE5A 1C4U2 1Q31A 1X7AC 1VR1H 2FPZA 3SORA 2W5EA 1BRAA 2A45B 1C2KA 1G2LA 3A89A 3C1KA 3KL6A 2FOGA 4FUEA 2P59A 1P2JA 1QJ7B 3K6YA 1RFNA 1GJ4H 2ZDAH 3BEIB 3JZ2B 2AS9A 1ELBA 1GI6A 5ESTE 3LGYA 1G36A 4K60A 2LNCA 4I7YH 1O5BB 1MTWA 1T8LA 3MNBA 3MH5A 5JB9S 1RS0A 3LGUA 4KKDA 1BMLA 4YLUA 2YNAA 1GMCF 1S85A 2A5AA 1K1OA 2P8OC 1NO9H 3O8RA 1MUEB 3KNXA 1SGQE 3TLOA 3SV7A 1S84A 4DG4A 3VXEH 2XTTB 1YCPK 1B7XB 2GMTB 1NRSH 4XFQA 1ANDA 2BDHA 5GIBA 2OQ5A 1C5UA 4IC5A 2H5CA 1A5IA 1J16A 1GJ7B 2DE8A 3RC5A 1NN6A 1DY8A 3EGKH 1CU1A 1INCA 2BD8A 1O2KA 2SNWA 4ZMAH 1YC0A 1XUHA 3GCTG 1RXPA 2ODPA 1QA7A 1E36B 1W0ZU 1MTNC 3MH4A 2EEKA 1Z6EA 3SI4H 2BD4A 3LC3A 2WUCA 1S5SA 3SU0A 4HTCH 5JYIA 1Z6JH 5EXMA 1CT4E 1PJPA 1O34A 1FJSA 1L2EA 3SO3A 3A80A 2FODA 1GI1A 1MTSA 4FVBA 1TPSA 1NPMA 4AORA 2Q6GA 2C90B 2UUYA 2BB4A 2GT8A 1Y8TA 2Z3EA 1UCYH 3DHKH 3WY8A 1ZOMA 4BAQB 1T7CA 2O8TA 1F0TA 2EA3A 3GY6A 5HM9A 1Y5AT 8GCHF 1GBDA 1UTMA 1SQTA 5EQQA 3RM0H 2O9QA 1KXBA 3CENA 3PLPA 3TJNA 4FUFA 4I31A 1YCPM 1MD7A 2BZ6H 3GDSA 2Y81A 1IQFA 2A4GA 5EPYA 1ORFA 2NWNA 2ZFFH 2FYRA 5EODA 2KAIB 1C1WH 1O35A 5HMAA 4WWYA 2ZU1A 4BAOB 2PHBA 4KTCA 5E0HA 2FOEA 3RXGA 1QTFA 2Z94A 4IBLH 3NWUA 4MPVA 3SHCH 2UWPA 4WH8A 5K7RA 4K8YA 2QXIA 2G55A 1XUKA 1ZRBA 1UVPA 2RG3A 1BRBE 2ZHEH 1AY6H 1DWDH 2FM2A 2O8LA 4FUGA 4E06H 1KDQB 2AH4X 1T31A 2Y6TA 3ZVBA 1O2PA 4O03A 2IPHA 1LVMA 5BPEA 1GWAA 1BDAA 2WPKS 4INHA 4ZH8A 2R0KA 4MNVA 2H2ZA 4E05H 3QUMP 2GV7A 3LC5A 2P3FH 3L3TA 1WOFA 2OXSA 1SGNE 1DICA 3BEFB 1LHCH 2CF9H 1FNIA 1GL0E 7LPRA 1O3EA 1EOJA 2G4UA 4NWLA 2FTLE 5BRRE 1IQJA 4ABHA 1CHOF 1AQ7A 1GMHF 2J94A 5F6MA 3NPSA 1BUIA 1CHGA 1KDQA 3RXSA 4IN2A 2GDEH 2V6NA 3ZV9A 1AFQC 1S6FA 1HXFH 1TYNA 4AFUA 5I25A 5L30H 2QY0B 3ODFA 1JMOH 1JRSA 3GCHB 2VGCC 2H9HA 3S9BA 1UCYK 1N6XA 2XC0A 1DWBH 1BITA 3M5NA 2ILNA 1GPZA 1SGEE 3SU3A 1VJAU 4IGDA 3TNSA 1FN8A 4Z0KA 1GBCA 2VH6A 1HAIH 3M3TA 1AI8H 2QCYA 3TPIZ 1C2EA 3VXFH 1THPB 1W7XH 1G30B 2CMYA 5AHGH 1G3BA 1CBWC 2M5TA 2BLWA 2BXUH 3LIWA 3PMJA 4B75A 3SNEA 2D2DA 1EJAA 3RXUA 2R3UA 1GJ9B 1XXDA 3QX5H 1V2MT 3PMAB 4Q7YA 3RXJA 1LPKB 1NFYA 1ID5H 5HGGA 3S7HB 3QTOH 1WYKA 1JWTA 1AWFH 3O8CA 4B1TA 1HUTH 1GMCG 1ZR0A 2BDBA 3RXRA 4XE4A 3P70B 2ZNKH 1O3NA 5TJXA 1BMMH 1PQAA 1NU9A 2BVRH 2ODQA 2QXJA 1OWIA 3E91A 2ULLA 1EX3A 1GI2A 1SI5H 1NC6A 2V3HH 5CHAB 1ZTLA 1OPHB 4GPGA 1OWHA 5JB8S 1K1MA 1FV9A 1ELVA 1FZZA 2HRVA 2BM2A 1MQ6A 1O2UA 4OGXA 1BOQA 1CQQA 1O5AB 3LJJA 4IN1A 5FXLA 4DCDA 2PLXA 1TX6A 2HALA 4JK6A 3LH3A 4O3UA 4YM9A 1LQEA 1E38B 2CF8H 1YPKH 3M5OA 3VB6A 1WTHD 2R2MB 3M3VA 1GBEA 5F8XA 1IQHA 3RXDA 1IQNA 5F8TA 1TBQH 1OYQA 4D7FA 4XDEA 2Y7ZA 2ESTE 2PGQB 2A7HA 1EQ9A 1F0RA 3FAOA 1MU6B 1GBIA 3E6PH 3ZZ3A 3I29A 4D9QA 4AYVB 1XVMA 3N7OA 1C5YB 1EKBB 2GCHF 1HYLA 1UTKA 3VB3A 2AFQB 3MNCA 1BHXF 8GCHG 2ZQ1A 4FXGH 4INLA 4A1XA 1UMAH 1PQ8A 3NUMA 2ZU5A 1TGTA 1W0YH 3D49H 4KTSA 3KHVA 3A81A 2BD5A 1S0RA 1MAYA 2BD3A 2FOAA 1MTNB 2J38A 5T3HA 1ELFA 1O2YA 2TGTA 3QN7A 1PPBH 5LPEA 1YKTA 2Y7XA 1GJCB 1FDPA 4NIVA 2ZGHA 2GVFA 1NU7B 3BTFE 2ZFRH 1F0SA 2AYWA 4I8JA 2ZFTA 3RUOA 3H5CB 4CHAC 1SQAA 4GHQA 2ZCHP 4TY6A 1ZSJA 1KXEA 3LGTA 3VEQB 1O3IA 5E0JA 1BTUA 1CO7E 4X8VH 1GJBB 5DP5A 5C5NA 1NFWA 1GDNA 2GMTC 1HAPH 3NZIA 2SNVA 2UWLA 4JYVH 1HGTH 1GBHA 4X1SU 1DLKB 2VVVA 4YLQH 5L2YH 1SQOA 1SLVB 3V13A 2J9NA 3ZVAA 1S81A 4WMDA 2AIQA 4IW4E 2JH6D 3Q00A 1TQ0B 1SGDE 3ATKA 2FLBH 2VVCA 1QFKH 1CT0E 1O2XA 1Z1JA 3UIRA 2RA0A 3B9FH 4ZHLU 1O3JA 1A7SA 2SGAA 5LH8A 1IQIA 3T28A 2EI7A 4ISNA 3E3TA 2ZF0H 2PKAB 1ZRKA 4M7GA 1LPZB 2GD4B 1HPGA 4WY3A 4F49A 2ZFQH 2HLCA 2J92A 1OOKB 1SGTA 1GHZA 3RXQA 3SBKA 2BX3A 2D8WA 3UY9A 1G3CA 9ESTA 2BOKA 1S83A 1V2UT 2XYAA 1SHYA 1TMUH 1SLWB 4NIWA 1MCVA 1ZHPA 4BXWA 1HDTH 3A85A 1UHBA 3TGJE 3GICB 2FZZA 1YM0A 1J15A 1DXPA 2A2XH 5I46H 2FWWA 3A8BA 4AB9A 1BJVA 1PQ7A 3DUXH 4UFDH 1C1UH 1AFQB 1O3GA 1A3EH 1OP8A 4DGJA 3IITA 1LCYA 2F9UA 3BTDE 3U8TH 1P2MA 2VGCB 4TYDA 4XBBA 3M36A 1YPHE 1KXAA 3AVZA 1GI5A 3UQOA 2GGVB 1QY6A 3RXFA 2BD7A 1TGBA 4FUDA 2SGEE 2JKHA 3HATH 1ABIH 1AVGH 1CT2E 2Q6DA 1S82A 2ALVA 1O38A 1TMTH 5C1UA 2HVXA 2CHAB 3GY7A 3A7WA 3EA7A 1JOUB 1UVUH 2ZU4A 2RCEA 2C8XB 2G51A 4CRDA 1C5LH 1D3DB 3VFEA 1TNGA 1OP0A 4Y6DA 1V2KT 3JZ1B 4TY7A 1GI7B 3SNBA 2ZDKA 5C3NA 1O2OA 1P57B 5FAHA 2B7DH 1EATA 2ANYA 1P04A 4SGAE 3VGCC 2GZ9A 4CRFA 4ISLA 2TRMA 3ZZ7A 2OLGA 1JIRA 4ZKNU 1G3DA 4I8LA 4O9VA 1O3AA 1VGCB 1HJ9A 3GCHC 3LKWA 1V2ST 1TPOA 1TMBH 2PV9B 3VB5A 1ETRH 3RP2A 4RKOB 4NSVA 2WINI 3UTUH 8KME2 1P06A 4H4FA 2G00A 2BY5X 4BANB 1CVWH 1FY1A 5DP4A 3UNRA 3NK8A 3URDA 4XBDA 4YT6H 2O8UA 1QRXA 1ZMLA 3SUFA 5L2ZH 4B76A 4BAKB 1ZPBA 3MO6A 3MH6A 3F9EA 1ZHRA 1QB9A 1C9PA 5E8EH 3UWIA 1C5MD 2XXLA 1C5XB 4MNYA 2FYQA 2QXGA 1K2I1 1O2QA 4K1SA 4BXSA 2ZGXH 3U1JB 3U1IB 1CA0C 1CGJE 1HRTH 3MYWA 3HPTB 1OXGA 4JMYA 4Y79A 1C1QA 3Q77A 5C1YA 4CR5A 4A5TS 2FOHA 3PMBB 1O30A 4I8HA 4Y71A 1VCWA 2V35A 2G5NA 3F6UH 2FS9A 2ZGBH 3A7YA 1GBLA 3SI3H 1K1JA 3IG6B 3MTYA 4DW2U 2ZTYA 2ZU3A 1F92A 3FP6E 4Z6AH 1H9LB 1O5EH 3BG4C 2R3YA 1OWJA 1DWCH 1BRUP 1P2NA 3EDXB 2XBVA 4YT7H 1KLJH 1A0JA 1AIXH 4NZLA 1RIWC 3TIUA 4XOJA 3AW0A 3U8RH 3MMGA 4ZKOU 1T4UH 1LPGB 5AF9H 3E8LA 4K5ZA 3ZZBA 5F8ZA 2A32A 4CHAB 3RXVA 4ABDA 1MBMA 1C2DA 1Y3YA 1MTVA 5DP8A 1DXWA 1V2QT 1P2OA 5A8ZA 1SFIA 3GY3A 4TPIZ 4Y7AA 1GJAB 1BRCE 1QBOA 2ZDMA 2PTCE 3SUDA 3TH3H 3P95A 2G8TA 3A86A 1FI8A 1AB9B 3PWBA 1FY4A 3KGPA 1NTPA 2PWXA 1GI3A 4QT8C 1L1JA 1D3PB 3SJ8A 1C5VA 3LH1A 3SU5A 1O32A 2HNTE 1RTLA 1ELCA 2ZTZA 2DE9A 1H4WA 1MTUA 4LK4A 1C2MA 2GP9B 4DIHH 2ANMH 4I32A 1HB0B 1L4ZA 2FTMA 2FLRH 1IHSH 1WTGH 4OS1A 3UFAA 1IQKA 1KXCA 5HXFA 3V12A 2XW9A 3SQHE 1AWHB 1FPHH 4GLYA 2AGGX 1M9UA 1SSXA 1UVOA 2BQWB 2A4OA 1AE5A 1UK3A 1SB1H 3PMHB 2FOBA 3KN2A 1P09A 3RXAA 5C67A 1EB2A 3GCNA 3W95A 2A2QH 2FOFA 1TNKA 3A8DA 2BTCE 4LOYH 1VCPA 1ELDE 4AOQA 3RLYH 1C5PA 1SGPE 1Z7KA 4X0WU 3TNTA 2Z7FE 2ZDNA 4WMEA 1HAHH 1TGNA 4Y76A 2HOBA 1QNJA 2OTVA 3T2NA 3TH4H 5DPAA 1BTXA 1ZYOA 3KEEA 1A5GH 1BTHH 1ZJKA 3UWJH 3BTQE 1SGFG 2V0BA 2Z3DA 3SU2A 7KMEH 1DVAH 3HK3B 2LPRA 2BDCA 3CP7A 4RN6A 1PPZA 4IC6A 1L4DA 5E2OA 2A5IA 2NU3E 1BMAA 1EZSC 3E16B 4MQAA 1Y3VA 2J95A 1C1OA 2H9TH 4JZDH 2PUQH 3TK9A 3Q3KA 2EI8A 3UREA 4X1QU 1O5FH 1D3QB 1O2WA 1S0QA 1XKBC 2OUAA 2Y5GA 1W11U 1GVZA 1SGIB 1C5OH 5GXPA 1LVOA 1Y59T 1LKBA 1LVBA 3ZZ8A 3P17H 4R0IA 1G2MA 1C5ZB 1O37A 3OY6U 4A1VA 3PB1E 4MDSA 3KQDA 1B5GH 1QJ6B 2GZ8A 3SGQE 4BTIB 1OP2A 2WPJS 1QQUA 2PGBB 2ZCKP 3ZZ4A 3RMOH 3UQVA 2ZU2A 3MU0A 1LHFH 3BTME 2ZC9H 3MNXA 1FAKH 1P9SA 8ESTE 2HWLB 3VGCB 2XBWA 5A0BA 4JYTA 3R3GB 1GCTC 4KELA 4AN7A 1AD8H 1YBWA 2NU0E 1K28D 4U01A 1G3EA 3LJOA 3UNQA 1AU8A 1TRYA 1O3CA 5EGMA 1FY8E 2ZWLH 3RXHA 3BIVH 3SQEE 3QDZB 4X2WA 4THNH 3A7TA 2TPIZ 1TPPA 3DA9B 4YOGA 1AN1E 1EAIA 1DT2A 1XUGA 2XBYA 4BAHB 2ZPQA 3F68H 3LGVA 1SHHB 4ISIH 1WAYB 1O3KA 1MQ5A 5DGJA 5AVDA 3L33A 4OS2A 1NT1A 1AKSB 1MKXH 4YESB 1WSSH 2CHAC 3I78A 4AFQA 3PTBA 1P03A 2ASUB 1QHRB 1TBZH 1C5TA 3CS7A 3PV4A 2Z6BD 2VWOA 2VH0A 1YPGH 3UOUA 3PYHA 1RD3B 3STJA 1GBKA 1ANCA 2B5TB 2ZHFH 3NXPA 1CA0B 4NIYA 1EAUA 1V2WT 1O2TA 3D23A 1TIOA 5GCHG 4NFFA 2QC2A 4O3TA 3LGIA 4ASHA 1NY22 1EZUC 2B8OH 1YPMH 1AKSA 3V7TA 4HZHA 4XBCA 1EUFA 3ZZAA 3RDZA 2FOCA 1TOCB 5DP6A 1VGCC 4FVDA 1E35B 3SOSA 3FFGA 3RMLH 1XX9A 1H9IE 2Y5HA 2ZPRA 3STIA 3BG4B 1JIMA 2AGIX 1HAYB 3GY5A 1GJDB 2WV4A 4MPXA 2ZQ2A 1PYTC 1YF4A 3GDUA 2AERH 2VNTA 1THRH 4UFGH 2ANKH 2ZDVH 1O2RA 1J9CH 4X8SH 3UR6A 1D9IA 1HNEE 4A1TA 2H5DA 2ZTXA 1RIWB 3SV8A 1DLEA 1VITH 3SNAA 3RXKA 3LT3A 1C1MA 4CH2B 1UTPA 3HK6B 2Q6FA 2P93A 4Y10E 1P11E 1H1BA 4WXIA 2FX4A 1MKXK 3RM2H 2JH5D 4NA9H 5EW2H 5LGOA 1HFDA 2ZCLP 1ELAA 2Z9GA 5T6GA 1IOEA 1E34B 4NWKA 1EP6A 2BHGA 3LONA 2VWLA 4OS6A 2FMJA 2TBSA 3P8FA 3H7OA 1SVPA 1XUIA 4TWWA 3SU1A 3DFJA 5EQRA 2Y80A 4GHTA 1SGYE 1TA2A 1TONA 1WQSA 3VPKA 1SGCA 5A09A 2WPLS 3M37A 4AB8A 2BYAX 3M7TA 2C8WB 4X2VA 4TPYA 3RC4A 1BJUA 4R8TB 1SFQB 1KSNA 1GGDC 3F9FA 2UUKB 4ZKRU 3A83A 1F5LA 1FXYA 1V2NT 1SMFE 5A8XA 2FI4E 3RC6A 1P3EA 1NROH 1V6DA 2HPQH 4KTUA 3ATMA 3LGWA 5DP7A 3MFJA 1A0HB 1GHAG 1P05A 4RSPA 1E37B 5DJ7A 3E0NB 1VCQA 1HJAC 3PTNA 2BLQA 1C1RA 5E0GA 5H4IB 2VIPA 2TGPZ 3A87A 3TGIE 4YO9A 4LZ4B 2VIVA 4VGCC 3RMNH 8LPRA 3M35A 4OS5A 1SLXB 1SOTA 2BQ6B 2VWNA 1V2LT 3MO9A 1LTOA 1YYY1 1ZMNA 1TALA 3BTEE 1GHYH 1NRRH 1AB9C 4KGAA 1GHVH 1CGHA 4MVNA 1TNHA 5DP3A 1GJ5H 1YLCA 1A61H 5GPIB 3SNCA 1RJXB 3MU4A 4Q80A 4X6NA 1W12U 4ZXXH 1O5GH 2BDIA 1O2LA 2G4TA 2AGEX 4B2BA 1DSTA 3TGKE 1DOJA 1O2NA 1BT7A 1EZXC 1DE7H 2H1UA 3BTTE 3C27B 1UHBB 2A7JA 1ANBA 1U6QA 3ESTA 4F4OC 2QA9E 3SGAE 5E2PA 1RTFB 2Z9JA 1W3CA 1UVTH 2DUCA 1EJNA 1C2LA 2F91A 4YOIA 1GBBA 5JBTA 1OX1A 3ELAH 3BSQA 4X1PU 4ABEA 1AGJA 2W3KA 1AZ8A 2CJIA 5LPFA 1BQYA 5DKMA 1QB6A 1TA6A 4MLFB 1MZDA 1GVLA 1QCPA 4ABIA 1O5CB 2FEQH 1C2IA 4ABAA 2ZHWH 1T32A 3S69A 2GZ7A 4Y7BA 2UWOA 1VJ9U 1YLDA 1IQMA 1EAWA 2Z3CA 1TGSZ 1GCTB 4K1TA 5B6OA 3QGNB 2C8YB 1XVOA 1EPTA 4Q7XA 4FU9A 3IWMA 4JCNA 1C4V2 4BAMB 2WV5A 3GDVA 2GV6A 2PSYA 1Q3XA 3EA9A 2C93B 2FIRH 3KF2A 1A0LA 2VVUA 2PKSB 3OY5U 1W7GH 1LHDH 3RXMA 1NFUA 3BTHE 1C2FA 1VITG 3LU9B 3Q3YA 5J4QA 4AGKA 3P8OA 2FESH 1BB0B 1GI4A 1ZZZA 2FO9A 2H9EH 3P6ZB 1XUFA 2UUFB 1BBRE 2D1JA 1RGQA 1TOMH 1ZTKA 2P94A 1V2JT 2FP7B 4GSOA 4B71A 3CS0A 3SV2H 2F9PA 3UR9A 1RTKA 1KTTB 3P8NA 3ZVDA 1A5HA 2QGRA 4CREA 3HKJB 1BTZA 1O36A 1AMHA 3U9AH 2GTBA 2FX6A 4B74A 1ELEE 1LVYA 1W13U 1FQ3A 2C4FH 2VIWA 2CGAA 2HNTF 2P16A 4NSYA 4DURA 1WUNH 3E1XB 2BDYA 1FONA 2AIPA 1PPGE 2F9VA 2BY8X 2VU8E 3LDXH 4AZ2B 3URCA 1QURH 4FUCA 1D6RA 3HGNA 4ZHMU 1GJ6A 1GJ8B 1G9IE 3ZYEA 3TJUA 4UONA 1LKAA 6CHAC 3SV9A 3AAVA 4JZIA 4GVUA 2A31A 5TCAA 5EW1H 4WH6A 5EQSA 1L0ZA 2C8ZB 7GCHF 4X6PA 1PPEE 2BZAA 1PPFE 3B8JA 3QO6A 4JZEH 2QAAA 2Z9LA 1DSUA 3DFLA 5F03A 2SGPE 4H42U 4U32A 3QGJA 1BHXB 1MZAA 6LPRA 1J17T 1ZPCA 4DOQA 1SL3A 1F5KU 2JETC 1O0DH 3FP7E 1QRZA 1W10U 5FPSA 1ZSKA 3D62A 1TABE 2RA3A 1C1NA 1QBVH 3U69H 2ZO3H 1FY5A 4JZ1A 1KLIH 3VB7A 3NCLA 1O3PB 5C1XA 2A5KA 2WYJA 2F9BH 1UTJA 1OS8A 3QZQA 1P2KA 2Z9KA 1QL8A 2BXTH 4NG9H 4LXBH 5TCCA 3ATLA 3ZZDA 2J34A 2XBXA 1IQGA 3RXEA 5FCKA 4BTUB 1ACBE 1B0EA 1ESTA 1GGDB 4ZAEA 2XWAA 4MNXA 4ZROA 4ABBA 1W14U 3TVJB 2UUJB 2A1DB 4K69A 2ALPA 3SU6A 1DUEA 3SUGA 1DFPA 4CH8B 4NFEA 4K3JA 2ZA5A 5GCHF 5JBBS 1HJAB 5FBIA 1T8OA 1N8OC 2SGFE 1AVWA 5FHTA 1MMJN 5A8YA 4VGCB 1HIAA 1A3BH 1GBAA 1O2MA 2P95A 2IJOB 2ZEBA 5L6NH 2YOLA 5IYTA 4UFFH 3W94A 1G32B 3AASA 3T26A 1KYNA 3UOPA 1C1PA 2VIDA 1TGCA 5DK1A 3TH2H 1FLEE 2VJ1A 2OC0A 2F9OA 3HKIB 3PO1C 4WMFA 4MPUA 5DO4H 1E0FD 1ANEA 3BEUA 1LO6A 2Q1JA 1L1GA 3E90B 3SUEA 2WPIS 4CRBA 2PW8H 2A7CA 1GDUA 1TNLA 3RXCA 1C5QA 4D8NA 4U30A 1WQVH 1TAWA 1N1LA 3BV9B 1TX7A 3HGPA 1DX5M 3RXOA 3F1SB 1GBJA 5EU8A 4K2YA 2QF0A 1QBNA 1T8NA 1VZQH 3BTGE 1H8DH 2B9LA 1ELGA 2R2WU 3TK5A 5FPYA 4E7NA 3TJVA 5ETXA 1GBTA 1T4VH 1V3XA 2BDGA 2ZDLA 3MU5A 4MG3A 4JK5A 1C1SA 1QGFA 1SG8B 1F7ZA 4WJG2 1XM1A 1A2CH 2BDAA 4B2CA 4CRAA 2AMPA 1AHTH 1MD8A 1YGCH 1PQ5A 2P3UB 3P92A 4FU7A 1C5WB 1NRQH 1ZPZA 4B73A 2Y5FA 5EXNA 2NU4E 4X1RU 4DIIH 1FN6A 5AFZH 1P3CA 1IQLA 2D26C 2PUXB 1LDTT 1NRPH 3TITA 1CA8B 1DY9A 1XKAC 1NZQH 1N6YA 2BQ7B 5A0CA 3S9AA 3ITIA 4OGYA 3UNSA 1OWEA 1TFXA 2QYIA 1UTNA 4NGAH 2XRCA 2F3CE 4Y8ZA 2GCTC 4Y8YA 3ZVCA 1GHAF 1BZXE 1P01A 4ESTE 1P12E 5GDSH 1BTYA 2OINA 2XWBI 1MBQA 2TIOA 1O2HA 3SJIA 1H9HE 1EPTC 4MNWA 1P02A 1GDQA 4HFPB 4K1EA 5C5OA 1XMNB 5K0HA 1D4PB 1GI0A 4GCHG 2OP9A 1KY9A 2JH0D 1UO6A 4H6SB 4FU8A 4NA8A 2BVSH 1W2KH 2AMDA 5DP9A 7GCHG 3S9CA 4ABGA 3BTWE 1TNIA 1ETSH 3MO3A 2BMGB 3R0FA 2OCVB 4X8UH 4I8KA 3Q3XA 1TLDA 3PLBA 4MPWA 5FBEA 1CSOE 4AYYB 1EP5A 1SGFA 5SGAE 3D65E 1ZGVA 1P2IA 4AG1A 3DD2H 2KAIA 3E0PB 3ZVEA 3RXIA 2XNIA 1QRWA 3GY4A 3MWIU 4DY7B 1YPJH 5IDKA 1O33A 5EOKA 1P0SH 1ESAA 1LHGH 2QN5T 5ESBA 3GYLB 4Y0YE 1PPCE 2BY6X 1FY3A 4UDWH 5JBCS 3GISB 1TNJA 1BTWA 1QB1A 2PKSC 3KQBA 2IN2A 4Q2KA 2VB0A 6CHAB 3FP8E 1K21H 3MI4A
chains in the Genus database with same CATH superfamily
1FUJA 2ZKSA 3U98H 1P10A 1LHEH 1P8VC 2STBE 3KQEA 2XNDD 1HXEH 4CRGA 3K9XB 1S6HA 4CRCA 1QIXB 1AUJA 3B23B 5AFYH 2OC1A 5JBAS 3OFND 2HGTH 3BIUH 1NRNH 3Q76A 3F9GA 1SOZA 1EXFA 3F9HA 1A1RA 4X2YA 1MCTA 1Y5UT 4E7RG 1C2JA 2AEIH 1NBME 2R0LA 2CXVA 2JETB 5KGOA 3LOXA 3MOCA 1O3HA 1O2ZA 4NZQA 2A0QB 2V3MA 2W7UA 4O97A 1GMDF 1SR5C 2C3SA 2FDAA 3MNSA 5C20A 4TWYA 2VINA 3AAUA 2H6MA 1EJMA 2ZGCA 4XSKU 1BA8B 3BG8A 4WVPE 3EQ0H 1ETTH 1ESBA 3RMMH 1F5RA 4X8TH 3ZVFA 1FIWA 1TQ7B 3SV6A 5HM2A 3RU4D 3T25A 1UCYE 1EAXA 1J14A 2F83A 2PR3A 5FPTA 1GVKB 2P3TB 1KXFA 3MH7A 1NESE 1DUAA 1VITF 3UPEA 1GBFA 1Y3UA 1GL1A 1GI8B 4ZUHA 1TRMA 3P8GA 4D76A 4LZ1H 4X6MA 3A7VA 6GCHF 3SW2B 4FUIA 1YPHC 1SKYE 2ZZUH 2FXRA 2G81E 4H6TA 5HYOA 3OYPA 4IS5A 1ZLRA 1ZJDA 2V3OH 1HAZB 4AX9H 2W7SA 2A4QA 2KCPA 3ATIA 5FCRA 5GWZA 1YPLH 1IQEA 3OU0A 4BNRA 4K8BA 1GG6C 1K1IA 5JDUB 2XCNA 1N8OB 5PTPA 4DVAU 1O2IA 2QV1A 3KIDU 1GCDA 2J98B 2ANWA 2BY7X 2WSSD 4FOUC 1PFXC 3SNDA 3M5MA 3RU4E 4IMQA 4JYUH 1WU1A 3A82A 2EI6A 2FOMB 3KCGH 1NM6A 1JXPA 3ZZ5A 2ZG0H 2VWMA 1V2PT 4YZUA 1SBWA 1HAOH 4I33A 4Q7ZA 1G37A 2EQNA 2PSXA 1BCUH 5A0AE 2HVYB 4DJZB 3FZZA 4YTAA 1Q2WA 2R9PA 1ABJH 2W3IA 2LP6A 2P8OB 1GHBF 1O2JA 2OD3B 3PO1B 4BTTB 3EYDA 4SGBE 2VIOA 5C2ZA 3SYJA 3ZZCA 2OQUA 1DITH 3ENSB 1DS2E 2SGQE 4UEHH 1QL9A 2BLVA 3EE0B 1O5DH 3N7DA 1DDJA 2WYGA 1K1NA 2TGDA 2QIQA 3OX7U 3QWCH 4ISOA 1FMGA 1P9UA 2FI3E 2FS8A 3OEHD 3T62A 1C9TA 3SJ9A 3RXTA 2IOTA 1BBRH 1TBRH 3A7ZA 3PM3A 2BD2A 2HPPH 4D9RA 1SLUB 1EOLA 3S0NA 4FUBA 2GX4A 1H8IH 2NU1E 4HI3A 1FX0B 4DT7B 4J1YA 3BN9A 3GCOA 2ZP0H 3DT0H 1Z8RA 3M7QA 3SU4A 1V2RT 3GOVB 2LELA 1F0UA 1C1TA 1IHTH 2THFB 5T6FA 1TPAE 2OC7A 4UE7H 3NKKA 3EA8A 2XC5A 3QTVH 1Y5BT 3TK6A 1C2GA 5FX6A 3A7XA 1ELTA 1O3FA 4GAWA 1HAVB 1V2TT 2A4RA 3GYMA 4HGCA 1BMNH 1AUTC 1O31A 2K1QA 1LQDB 1DWEH 1UK4A 4A6LA 2F9NA 1C5SA 1K9OE 1SGRE 3M5LA 3ATWA 1HJ8A 1XXFA 1TE0A 1GHXH 1V2OT 1COWD 2GKVE 1ZMJA 1SPJA 3UUZA 1QJ1B 1OSSA 2GCTB 5J4SA 1A46H 3TJOA 4PROA 2ZIQH 5C0TA 1K1LA 2ZFPH 1TWXB 5EG4A 1CHOG 1GMHG 1C5RA 1THSH 2J4IA 4WXVA 4A7IB 2WPDD 4ABJA 2ZI2H 1EPTB 4KP0A 1OYTH 2RDEA 1IAUA 1K1PA 3ODDA 1UTQA 1HAVA 2J97A 3SHAH 4D7GA 1Z8IB 1O3OA 4INKA 1CGIE 1OWKA 1DANH 1HAXB 1YPEH 1PYTD 1DM4B 4FUHA 5EXLA 1W8BH 5ABWA 1T8MA 2O8MA 4WF8A 3T5FH 3O8BA 4FUJA 2PFEA 2ZHDA 3GY8A 1ZGIA 2G5VA 3H7TA 3A84A 1AO5A 2GT7A 3M61U 1V2VT 2ZFSA 3RXLA 7ESTE 4CR9A 1BBRK 1MU8B 1GHWH 3ZV8A 1FAXA 2XC4A 4YOJA 1MAXA 1MKWH 1BTPA 3V0XA 4B2AA 4UFEH 3RU4T 3MHWU 3GY2A 2AMQA 4JZFH 4AFSA 4Y0ZE 1KXDA 3FVFB 3KQCA 2W26A 1GMDG 1O39A 3SJKA 1F2SE 4UD9H 2QXHA 6ESTA 3ZZ6A 2J2UA 2QF4A 2WHXA 1WBGB 1ZHMA 5EJZA 3GCTF 2PKAA 2Z9IA 1AE8H 4X6OA 3QLPH 1DPOA 1KIGH 1O2SA 3SN8A 3I77A 3OSYA 2HNTC 3SZNA 1ZTJA 2OBOA 3M7UA 1TX8A 3TU7H 1TB6H 1BIOA 1P2QA 2WPHS 5CMXH 1QR3E 3F2HA 1QL7A 2STAE 6GCHG 4IMZA 2KX4A 3VB4A 3K65B 5A2MH 1QA0A 1FPCH 3EAJA 4MTBA 4RT0A 1QQ4A 2G52A 2QF3A 5EPNA 4X2XA 1C4Y2 1UVSH 4AGJA 4A92A 1D6WA 4B6FA 3F3BA 1LMWB 3FANA 2WPMS 2KM0A 1AZZA 1K22H 3F0OA 3V3MA 1EASA 1FIZA 1PPHE 1EB1H 4CBOA 1UJ1A 3A8CA 1JRTA 1O3LA 1Z71A 1CBWB 1ARCA 2SFAA 3PLKA 1KLTA 9LPRA 3A8AA 2BLOA 4X1NU 1HV7A 3U8OH 4ZKSU 3AW1A 1AVXA 3LPRA 1ARBA 2ZECA 1EZQA 1OKXA 1HAGE 1Z8JB 4I8GA 3F0PA 3MU1A 5GJ4B 1A4WH 3S7KB 1HBTH 3T27A 3ZYDA 5LPRA 5JPMH 1C1VH 4ABFA 2O8WA 2I6SA 2OC8A 5T6DA 1HLTH 2RDLA 4ZXYH 3A88A 2ZHQH 2OBQA 4GCHF 2PTNA 4U2WA 3RLWH 1J8AA 1GHBG 3MU8A 1MKWK 2XCFA 1OWDA 2I6QA 3SJOA 1UK2A 2BVXH 4Y11E 2KCAA 3N7EA 5G4BA 2VIQA 1SC8U 2CN0H 2GCHG 1L1NA 4NCYA 1O3MA 2BOHB 1UTOA 1Y3WA 2BX4A 2WUBA 1WCZA 3PROA 4Y8XA 1WV7H 1GG6B 2TGAA 4OS4A 1O2VA 1O3BA 1YP9A 1Z8GA 4NIXA 3QZRA 3RXBA 3WWBA 2B0FA 2Y82A 1XUJA 3BTKE 3M3SA 1YCPH 3OTJE 1MH0A 2NU2E 3K6ZA 2OK5A 3QK1A 2ZGJA 1JBUH 4ZHAA 3SGBE 4NA7A 1ZSLA 3ZZ9A 1B0FA 4OS7A 2BY9X 2KFWA 1VKYA 1NFXA 3O8DA 3ZVGA 2CV3A 3G01A 4CBNA 4J2YB 1C2HA 2ODYB 1HIAB 1O2GH 2SGDE 1KTSB 4AFZA 4AG2A 3BF6H 3PWCA 1GI9B 3T29A 4GUXA 1Y3XA 4RKJB 4BOHA 1O3DA 2GDDA 2ZPSA 2FI5E 3L6PA 5DG6A 1C5NH 1UTLM 2YNBA 1AFEH 1TRNA 3FZDA 5CHAC 1GBMA 5CE1A 2EC9H 1RRKA 3RXPA 1D3TB 5IK2D 2BD9A 1Z1IA 1NS3A 5FX5A 4ISHH 3K2UA 1HCGA 1CE5A 1C4U2 1Q31A 3PRDA 1X7AC 1VR1H 2FPZA 3SORA 2W5EA 1BRAA 2YMSC 2A45B 1C2KA 1G2LA 3A89A 3C1KA 3KL6A 2FOGA 4FUEA 2P59A 1P2JA 1QJ7B 5EIYA 3K6YA 4ZCNA 1RFNA 1GJ4H 2ZDAH 3BEIB 3JZ2B 2AS9A 1ELBA 1GI6A 5ESTE 1OHHD 3LGYA 1G36A 4K60A 2LNCA 4I7YH 1O5BB 1MTWA 1T8LA 3MNBA 3MH5A 5JB9S 1RS0A 3LGUA 4KKDA 1BMLA 4YLUA 2YNAA 1GMCF 1S85A 2A5AA 1K1OA 2P8OC 1NO9H 3O8RA 1MUEB 3KNXA 1SGQE 3TLOA 3SV7A 1S84A 4DG4A 3VXEH 2XTTB 3F2FA 1YCPK 1B7XB 2GMTB 1NRSH 4XFQA 1ANDA 2BDHA 5GIBA 2OQ5A 1C5UA 4IC5A 2H5CA 1A5IA 1J16A 1GJ7B 2DE8A 3RC5A 1NN6A 1W0KD 1DY8A 3EGKH 1CU1A 1INCA 2BD8A 1O2KA 2SNWA 4ZMAH 1YC0A 1XUHA 3GCTG 1RXPA 2ODPA 1QA7A 1E36B 1W0ZU 5B6LA 1MTNC 3MH4A 2EEKA 1Z6EA 2IJD1 3SI4H 2BD4A 3LC3A 2WUCA 2F43B 3OAAD 1S5SA 3SU0A 4HTCH 5JYIA 1Z6JH 4TSFD 5EXMA 1CT4E 1PJPA 1O34A 1FJSA 1L2EA 3SO3A 3A80A 2XOKD 2FODA 1GI1A 1MTSA 4FVBA 1TPSA 1NPMA 4AORA 3F2GA 2C90B 2UUYA 2Q6GA 2BB4A 2GT8A 1Y8TA 2Z3EA 1UCYH 3DHKH 3WY8A 1ZOMA 4BAQB 1T7CA 2O8TA 1F0TA 2EA3A 3GY6A 5HM9A 1Y5AT 8GCHF 1GBDA 1UTMA 1SQTA 5EQQA 3RM0H 2O9QA 1KXBA 3CENA 3PLPA 3TJNA 4FUFA 4I31A 1YCPM 1MD7A 2BZ6H 3GDSA 2Y81A 1IQFA 2A4GA 5EPYA 4Q63A 1ORFA 2NWNA 2ZFFH 2FYRA 5EODA 1KMHB 2KAIB 1C1WH 1O35A 5HMAA 4WWYA 1S6LA 5C94A 2ZU1A 4BAOB 2PHBA 4KTCA 5E0HA 2FOEA 3RXGA 1QTFA 1BMFD 2Z94A 4IBLH 3NWUA 4MPVA 3SHCH 2UWPA 4WH8A 5K7RA 4K8YA 2QXIA 2G55A 1XUKA 1ZRBA 1UVPA 2RG3A 1BRBE 2ZHEH 1AY6H 1DWDH 2FM2A 2O8LA 4FUGA 4E06H 1KDQB 2AH4X 1T31A 2Y6TA 3ZVBA 1O2PA 4O03A 2IPHA 1LVMA 5BPEA 1GWAA 1BDAA 2WPKS 4INHA 4ZH8A 2R0KA 4MNVA 2H2ZA 3EE7A 4E05H 3QUMP 1WXRA 2GV7A 3LC5A 2P3FH 3PV2A 3L3TA 1NBMD 1WOFA 2OXSA 1SGNE 1DICA 3BEFB 5CDFE 1LHCH 2CF9H 1FNIA 1GL0E 7LPRA 1O3EA 1EOJA 2G4UA 4NWLA 2FTLE 5BRRE 2M2AA 1IQJA 4ABHA 1CHOF 1AQ7A 1GMHF 2J94A 5F6MA 3NPSA 1BUIA 1CHGA 4AC9A 1KDQA 3RXSA 4IN2A 3FOAA 2GDEH 2V6NA 3ZV9A 1AFQC 1S6FA 1HXFH 1TYNA 4AFUA 5I25A 5L30H 2QY0B 3ODFA 1JMOH 1JRSA 3GCHB 2VGCC 2H9HA 3S9BA 1UCYK 1N6XA 2XC0A 1DWBH 1BITA 3M5NA 2ILNA 1GPZA 1SGEE 3SU3A 1VJAU 4IGDA 3TNSA 1FN8A 3FKSD 4Z0KA 1GBCA 2VH6A 1HAIH 3M3TA 1AI8H 2QCYA 3TPIZ 1C2EA 3VXFH 1THPB 1W7XH 1G30B 2CMYA 5AHGH 1G3BA 1CBWC 2M5TA 2BLWA 2BXUH 3LIWA 3PMJA 4B75A 3SNEA 2D2DA 1EJAA 3RXUA 3U28C 2R3UA 3DSGA 1GJ9B 1XXDA 3QX5H 1V2MT 5EJ1A 3PMAB 4Q7YA 3RXJA 1LPKB 1NFYA 1ID5H 5HGGA 3S7HB 3QTOH 1WYKA 1JWTA 1AWFH 3O8CA 4B1TA 1HUTH 1GMCG 1ZR0A 2BDBA 3RXRA 4XE4A 3P70B 2ZNKH 1O3NA 5TJXA 1BMMH 1PQAA 1NU9A 2BVRH 2ODQA 2WZQA 4ASUD 2QXJA 1OWIA 3E91A 2ULLA 1EX3A 1GI2A 1SI5H 1NC6A 2V3HH 5CHAB 1ZTLA 1OPHB 5DSFA 4GPGA 1OWHA 5JB8S 1K1MA 1FV9A 1ELVA 1FZZA 2HRVA 2BM2A 1MQ6A 4HG6A 1O2UA 4OGXA 1BOQA 1CQQA 1O5AB 3LJJA 2V7QD 2YMSB 4IN1A 5FXLA 4DCDA 2PLXA 1TX6A 2HALA 4JK6A 3LH3A 4O3UA 4YM9A 1LQEA 1E38B 2CF8H 1YPKH 3M5OA 3VB6A 1WTHD 2R2MB 3M3VA 1GBEA 5F8XA 1IQHA 3RXDA 1IQNA 5F8TA 1TBQH 1OYQA 4D7FA 4XDEA 3PRBA 2Y7ZA 2ESTE 2PGQB 2A7HA 1EQ9A 1F0RA 3FAOA 1MU6B 1GBIA 3E6PH 3ZZ3A 3I29A 4D9QA 4AYVB 3FO8D 1XVMA 3N7OA 1C5YB 1EKBB 1WDIA 2GCHF 1HYLA 1UTKA 3VB3A 2AFQB 3CNRA 3MNCA 1BHXF 8GCHG 2ZQ1A 4FXGH 4INLA 2GJGA 4A1XA 1UMAH 1PQ8A 3NUMA 2ZU5A 1TGTA 1W0YH 3D49H 4KTSA 3KHVA 3A81A 2BD5A 1S0RA 1MAYA 2BD3A 2FOAA 1MTNB 2J38A 5T3HA 1ELFA 1O2YA 2TGTA 3QN7A 1PPBH 5LPEA 1YKTA 1SQRA 2Y7XA 1GJCB 1FDPA 4NIVA 2ZGHA 2GVFA 1NU7B 3BTFE 2ZFRH 1F0SA 2AYWA 2KCYA 4I8JA 2ZFTA 3RUOA 3H5CB 4CHAC 1SQAA 4GHQA 2ZCHP 4TY6A 1ZSJA 1KXEA 3LGTA 3VEQB 1O3IA 5E0JA 1BTUA 1CO7E 4X8VH 1GJBB 2JDID 5DP5A 5C5NA 1NFWA 1GDNA 2GMTC 1HAPH 3NZIA 2SNVA 2UWLA 4JYVH 1HGTH 1GBHA 4X1SU 1DLKB 2VVVA 4YLQH 5L2YH 1SQOA 1SLVB 3V13A 2J9NA 3ZVAA 1S81A 4WMDA 5KEDA 2AIQA 4IW4E 2JH6D 3Q00A 4ACBA 1TQ0B 1SGDE 3ATKA 2FLBH 2VVCA 1QFKH 1CT0E 1O2XA 1Z1JA 3UIRA 2RA0A 3B9FH 4ZHLU 1O3JA 1A7SA 2SGAA 5LH8A 1IQIA 3T28A 2EI7A 4ISNA 3E3TA 2ZF0H 2PKAB 1ZRKA 4M7GA 1LPZB 2GD4B 1HPGA 4WY3A 4F49A 2ZFQH 2HLCA 2J92A 4RI0A 1OOKB 1SGTA 1GHZA 3RXQA 3SBKA 2BX3A 2CK3D 2D8WA 3UY9A 1G3CA 9ESTA 2BOKA 1S83A 1V2UT 2XYAA 4FETA 1SHYA 1H8ED 1TMUH 1SLWB 4NIWA 1MCVA 1ZHPA 4BXWA 1HDTH 3A85A 1UHBA 1E1QD 3GICB 3TGJE 2FZZA 1YM0A 1J15A 1DXPA 2A2XH 5I46H 2FWWA 3A8BA 4AB9A 1BJVA 1PQ7A 3DUXH 3FN8A 4UFDH 1C1UH 1AFQB 1O3GA 1A3EH 1OP8A 3GS9A 4DGJA 3IITA 1LCYA 2F9UA 3BTDE 3U8TH 1P2MA 2VGCB 4TYDA 4XBBA 3M36A 1YPHE 1KXAA 3AVZA 1GI5A 3UQOA 2GGVB 1QY6A 3RXFA 2BD7A 1TGBA 4FUDA 2SGEE 2JKHA 3HATH 1ABIH 5HIYA 1AVGH 1CT2E 2Q6DA 1S82A 2ALVA 1O38A 1TMTH 5C1UA 2HVXA 2CHAB 3GY7A 2L6OA 3A7WA 3EA7A 1JOUB 1UVUH 2ZU4A 2RCEA 2C8XB 2G51A 4CRDA 1C5LH 1D3DB 3VFEA 1TNGA 1OP0A 4Y6DA 1V2KT 3JZ1B 4TY7A 1GI7B 3SNBA 5HKKD 2ZDKA 5KECA 5C3NA 1O2OA 1P57B 5FAHA 3DSPA 2B7DH 1EATA 2ANYA 1P04A 4SGAE 3VGCC 2GZ9A 4CRFA 4ISLA 2TRMA 3ZZ7A 2OLGA 1JIRA 4ZKNU 1G3DA 4I8LA 4O9VA 1O3AA 1VGCB 1HJ9A 3GCHC 3OEED 3LKWA 1V2ST 1TPOA 1TMBH 2PV9B 3VB5A 1ETRH 3RP2A 4RKOB 4NSVA 2WINI 3UTUH 8KME2 1P06A 4H4FA 2G00A 2BY5X 4BANB 1CVWH 1FY1A 5DP4A 3UNRA 3NK8A 3URDA 4XBDA 4YT6H 2O8UA 1QRXA 1ZMLA 3SUFA 5L2ZH 4B76A 4BAKB 1ZPBA 3MO6A 3MH6A 3F9EA 1ZHRA 1QB9A 1C9PA 4ACAA 3WWFA 5E8EH 3UWIA 1C5MD 2XXLA 1C5XB 4MNYA 2KR7A 2FYQA 2QXGA 1K2I1 1O2QA 4K1SA 4BXSA 2ZGXH 3U1JB 3U1IB 1CA0C 1CGJE 1HRTH 3MYWA 3HPTB 1OXGA 4JMYA 4Y79A 1C1QA 3Q77A 5C1YA 4CR5A 4A5TS 2FOHA 3PMBB 1O30A 4I8HA 4Y71A 1VCWA 2V35A 2G5NA 3F6UH 2FS9A 2ZGBH 3A7YA 1GBLA 3SI3H 1K1JA 3IG6B 3MTYA 4DW2U 2ZTYA 2ZU3A 1F92A 3FP6E 4Z6AH 1H9LB 1O5EH 3BG4C 2R3YA 1OWJA 1DWCH 1BRUP 2JJ2D 1P2NA 3EDXB 2XBVA 4YT7H 2J5UA 1KLJH 1A0JA 1AIXH 4NZLA 1RIWC 3TIUA 4XOJA 3AW0A 3U8RH 3MMGA 3KQ5A 4ZKOU 4XD7D 1T4UH 1LPGB 5AF9H 4DT4A 3E8LA 2KCOA 4K5ZA 3ZZBA 5F8ZA 2A32A 4CHAB 3RXVA 4ABDA 1MBMA 1C2DA 1Y3YA 1MTVA 5DP8A 1DXWA 1V2QT 1P2OA 5A8ZA 1SFIA 3GY3A 2KZ4A 4TPIZ 4Y7AA 1GJAB 4RT1A 1BRCE 5GNDA 1QBOA 2ZDMA 2PTCE 3SUDA 3TH3H 3P95A 2G8TA 3A86A 1FI8A 1AB9B 3PWBA 1FY4A 3KGPA 1NTPA 2PWXA 1GI3A 4QT8C 1L1JA 1D3PB 3SJ8A 4P02A 1C5VA 3LH1A 3SU5A 1O32A 2HNTE 1RTLA 1ELCA 2ZTZA 2DE9A 1H4WA 1MTUA 4LK4A 1C2MA 2GP9B 4DIHH 2ANMH 4I32A 1HB0B 1L4ZA 2FTMA 2FLRH 1IHSH 1WTGH 4OS1A 3UFAA 1IQKA 1KXCA 5HXFA 3V12A 2XW9A 3SQHE 1AWHB 1FPHH 1K0HA 4GLYA 3OTPA 2AGGX 1M9UA 1SSXA 1UVOA 2A4OA 2BQWB 1AE5A 1UK3A 1SB1H 3PMHB 2FOBA 3KN2A 2HLDD 1P09A 3RXAA 5C67A 1EB2A 3GCNA 1W0JD 3W95A 2A2QH 2FOFA 1TNKA 3A8DA 2BTCE 4LOYH 1VCPA 1ELDE 4AOQA 3RLYH 5DN6D 1C5PA 1SGPE 1Z7KA 4X0WU 3TNTA 2Z7FE 2ZDNA 4WMEA 1HAHH 1TGNA 4Y76A 2HOBA 1QNJA 2OTVA 3T2NA 3TH4H 5DPAA 2WV9A 1BTXA 1ZYOA 3KEEA 1A5GH 1BTHH 1ZJKA 3UWJH 3BTQE 1SGFG 2V0BA 2Z3DA 3SU2A 7KMEH 1DVAH 3HK3B 2LPRA 2BDCA 3CP7A 4RN6A 1PPZA 4IC6A 1L4DA 5E2OA 2A5IA 2NU3E 1BMAA 1EZSC 3E16B 4MQAA 1Y3VA 2J95A 4TT3D 1C1OA 2H9TH 4JZDH 2PUQH 3TK9A 3Q3KA 2EI8A 3UREA 4X1QU 1O5FH 1D3QB 1O2WA 1S0QA 1XKBC 2OUAA 2Y5GA 1W11U 1GVZA 1SGIB 1C5OH 5GXPA 1LVOA 1Y59T 1LKBA 1LVBA 2W6ID 3P17H 4R0IA 3ZZ8A 1G2MA 1C5ZB 1O37A 3OY6U 4A1VA 3PB1E 4MDSA 3KQDA 1B5GH 1QJ6B 2GZ8A 3SGQE 4BTIB 1OP2A 1QZ8A 2WPJS 1QQUA 2PGBB 2ZCKP 3ZZ4A 3RMOH 3UQVA 2ZU2A 3MU0A 1LHFH 3BTME 2YMSD 2ZC9H 3MNXA 1FAKH 1P9SA 8ESTE 2HWLB 3KYFA 3VGCB 2XBWA 4F48B 5A0BA 4JYTA 3R3GB 1GCTC 4KELA 4AN7A 1AD8H 1YBWA 2NU0E 1K28D 4U01A 1G3EA 3LJOA 3UNQA 1AU8A 1TRYA 1O3CA 5EGMA 1FY8E 2ZWLH 3RXHA 3BIVH 3SQEE 3QDZB 1YY3A 3UB0A 4X2WA 4THNH 3A7TA 2TPIZ 1TPPA 3DA9B 4YOGA 1AN1E 1EAIA 1DT2A 1XUGA 2XBYA 4BAHB 2F4LA 2ZPQA 3F68H 3LGVA 1SHHB 4ISIH 1WAYB 1O3KA 1MQ5A 5DGJA 5AVDA 3L33A 4OS2A 1NT1A 1AKSB 1MKXH 4YESB 1WSSH 2CHAC 3I78A 4AFQA 3PTBA 1P03A 2ASUB 1QHRB 1TBZH 1C5TA 3CS7A 3PV4A 2Z6BD 2VWOA 2VH0A 1YPGH 3UOUA 3PYHA 1RD3B 3STJA 1GBKA 1ANCA 2B5TB 2ZHFH 3NXPA 1CA0B 4NIYA 1EAUA 1V2WT 1O2TA 2JIZD 3D23A 1TIOA 5GCHG 4NFFA 2QC2A 4O3TA 3LGIA 4ASHA 1NY22 1EZUC 2B8OH 1YPMH 1AKSA 3V7TA 4HZHA 4XBCA 1EUFA 3ZZAA 3RDZA 2FOCA 1TOCB 5DP6A 1VGCC 4FVDA 1E35B 4P00A 3SOSA 3FFGA 3RMLH 1XX9A 1H9IE 2Y5HA 2ZPRA 3STIA 3BG4B 1JIMA 3PV5A 2AGIX 1HAYB 3GY5A 1GJDB 2WV4A 4MPXA 2ZQ2A 1PYTC 5F53A 1YF4A 3GDUA 2AERH 2VNTA 1THRH 4UFGH 2ANKH 2ZDVH 1O2RA 1J9CH 4X8SH 1YWUA 3UR6A 1D9IA 1HNEE 4A1TA 2H5DA 2ZTXA 1RIWB 3SV8A 1H8HD 1DLEA 1VITH 3SNAA 3RXKA 2RFKC 3LT3A 1C1MA 4CH2B 1UTPA 3HK6B 2Q6FA 2P93A 4Y10E 1P11E 1H1BA 4WXIA 2FX4A 1MKXK 3RM2H 2JH5D 4NA9H 5EW2H 5LGOA 1HFDA 2ZCLP 1ELAA 2Z9GA 5T6GA 1IOEA 1E34B 4NWKA 1EP6A 2BHGA 3LONA 2VWLA 4OS6A 2FMJA 2TBSA 3P8FA 3H7OA 1SVPA 1XUIA 4TWWA 3SU1A 3DFJA 5EQRA 2Y80A 4GHTA 1SGYE 1TA2A 5EJLA 1TONA 1WQSA 3VPKA 1SGCA 5A09A 2WPLS 3M37A 4AB8A 2BYAX 3M7TA 2C8WB 4X2VA 3MQKC 4TPYA 3RC4A 1BJUA 4R8TB 1SFQB 1KSNA 4XRNA 1GGDC 3F9FA 2J98A 2UUKB 2VBCA 4ZKRU 3A83A 1F5LA 1FXYA 3AK5A 1V2NT 1SMFE 5A8XA 2FI4E 3RC6A 1P3EA 1NROH 1V6DA 2HPQH 4KTUA 3ATMA 3LGWA 5DP7A 3MFJA 1A0HB 1GHAG 2L74A 1P05A 4RSPA 1E37B 5DJ7A 4F55A 3N99A 3E0NB 1VCQA 1HJAC 3PTNA 2BLQA 1C1RA 5E0GA 5H4IB 2VIPA 2TGPZ 3A87A 3TGIE 4M9FA 4YO9A 4LZ4B 2VIVA 4VGCC 3RMNH 8LPRA 3M35A 4OS5A 1SLXB 1SOTA 2BQ6B 2VWNA 1V2LT 3MO9A 1LTOA 1YYY1 4I86A 1ZMNA 1TALA 3BTEE 1GHYH 1NRRH 5T1VA 4Q4LA 1AB9C 4KGAA 1GHVH 1CGHA 4MVNA 2PP6A 1TNHA 5DP3A 1GJ5H 1YLCA 1A61H 5GPIB 3SNCA 1RJXB 3MU4A 4Q80A 4X6NA 1W12U 4ZXXH 1O5GH 2BDIA 1O2LA 2G4TA 2AGEX 4B2BA 1DSTA 3TGKE 1DOJA 1UW7A 1O2NA 1BT7A 1EZXC 1DE7H 2H1UA 3BTTE 3C27B 1UHBB 2A7JA 1ANBA 1U6QA 3ESTA 4F4OC 2QA9E 3SGAE 5E2PA 1RTFB 2Z9JA 1W3CA 1UVTH 2DUCA 1EJNA 1C2LA 2F91A 4YOIA 1GBBA 5JBTA 1OX1A 3ELAH 4Z1MD 3BSQA 4X1PU 4ABEA 1AGJA 2W3KA 1AZ8A 2CJIA 5LPFA 1BQYA 5DKMA 1QB6A 1TA6A 4MLFB 1MZDA 1GVLA 1QCPA 4ABIA 1O5CB 2K8IA 2FEQH 1C2IA 4ABAA 2ZHWH 1T32A 3S69A 2GZ7A 4Y7BA 2UWOA 1VJ9U 1YLDA 1IQMA 1EAWA 2Z3CA 1TGSZ 1GCTB 4K1TA 5B6OA 3QGNB 2C8YB 1XVOA 1EPTA 2EY4C 4Q7XA 4FU9A 3IWMA 4JCNA 1C4V2 4BAMB 2WV5A 3GDVA 2GV6A 2PSYA 1Q3XA 3EA9A 2C93B 2FIRH 3KF2A 1A0LA 3UAIC 3DSOA 2VVUA 2PKSB 2W6JD 3OY5U 1W7GH 1LHDH 3RXMA 1NFUA 4B6EA 3BTHE 3NRLA 1C2FA 1VITG 3LU9B 3Q3YA 5J4QA 4AGKA 3P8OA 1E79D 2FESH 1BB0B 1GI4A 1ZZZA 2FO9A 2H9EH 3P6ZB 1XUFA 2UUFB 1BBRE 2D1JA 1RGQA 1TOMH 1ZTKA 2P94A 1V2JT 2FP7B 4GSOA 4B71A 3CS0A 3SV2H 2F9PA 3UR9A 1RTKA 1KTTB 3P8NA 3ZVDA 1A5HA 2QGRA 4CREA 3HKJB 1BTZA 1O36A 1AMHA 3U9AH 2GTBA 2FX6A 4B74A 1ELEE 1LVYA 1W13U 1FQ3A 2C4FH 2VIWA 2CGAA 2HNTF 2P16A 4NSYA 4DURA 1WUNH 3E1XB 2BDYA 1FONA 2AIPA 1PPGE 2F9VA 2BY8X 2VU8E 3LDXH 4AZ2B 3URCA 1QURH 4FUCA 2QE7D 1D6RA 3HGNA 3WW7A 4ZHMU 3SZEA 1GJ6A 1GJ8B 1G9IE 3ZYEA 3TJUA 4UONA 1LKAA 6CHAC 3SV9A 3AAVA 4JZIA 4GVUA 2A31A 5TCAA 1E1RD 5EW1H 4WH6A 5EQSA 1L0ZA 2C8ZB 7GCHF 4X6PA 1PPEE 2BZAA 1PPFE 3B8JA 3QO6A 4JZEH 2QAAA 2Z9LA 1DSUA 3DFLA 5F03A 2SGPE 4H42U 4U32A 3QGJA 1BHXB 1MZAA 6LPRA 1J17T 1ZPCA 4DOQA 1SL3A 1F5KU 2JETC 1O0DH 3H09A 3FP7E 1QRZA 1W10U 2JJ1D 5FPSA 1ZSKA 3D62A 1TABE 3W1EA 2RA3A 1C1NA 1QBVH 3U69H 2ZO3H 1FY5A 4JZ1A 1KLIH 3VB7A 3NCLA 1O3PB 5C1XA 2A5KA 2WYJA 2F9BH 1UTJA 1OS8A 3QZQA 1P2KA 2Z9KA 1QL8A 2BXTH 4NG9H 4LXBH 5TCCA 3ATLA 3ZZDA 1YLNA 2J34A 2XBXA 1IQGA 3RXEA 5FCKA 4OM9A 4BTUB 1ACBE 1B0EA 1ESTA 1GGDB 4ZAEA 2XWAA 4MNXA 4ZROA 4ABBA 1W14U 3TVJB 2UUJB 2A1DB 4K69A 2ALPA 3SU6A 1DUEA 3SUGA 1DFPA 4CH8B 4NFEA 5CHBA 4K3JA 2ZA5A 5GCHF 5JBBS 1HJAB 5FBIA 1T8OA 1N8OC 2SGFE 1AVWA 5FHTA 1MMJN 4YXWD 5A8YA 4VGCB 1HIAA 1A3BH 1GBAA 1O2MA 2P95A 2IJOB 2ZEBA 5L6NH 2YOLA 5IYTA 4UFFH 2AHME 3W94A 1G32B 3AASA 3T26A 1KYNA 3UOPA 1C1PA 2VIDA 1TGCA 5DK1A 2IPQX 3TH2H 1FLEE 3DCLA 2VJ1A 2OC0A 2F9OA 3HKIB 3PO1C 4WMFA 4MPUA 5DO4H 1E0FD 1ANEA 3BEUA 1LO6A 2Q1JA 1L1GA 3E90B 3SUEA 2WPIS 4CRBA 2PW8H 2A7CA 1GDUA 1TNLA 3RXCA 5HIZA 1C5QA 4D8NA 4U30A 1WQVH 1TAWA 1N1LA 3BV9B 1TX7A 3HGPA 3KYGA 1DX5M 3RXOA 3F1SB 1GBJA 5EU8A 4K2YA 2QF0A 1QBNA 1T8NA 2K0QA 1VZQH 3BTGE 1H8DH 2B9LA 1ELGA 2R2WU 3TK5A 5FPYA 4E7NA 3TJVA 5ETXA 1GBTA 1T4VH 1V3XA 2BDGA 2ZDLA 3MU5A 4MG3A 4JK5A 1C1SA 1QGFA 1SG8B 1F7ZA 4WJG2 1XM1A 1A2CH 2BDAA 4B2CA 4CRAA 2AMPA 1AHTH 1MD8A 1YGCH 1PQ5A 2P3UB 3P92A 4FU7A 1C5WB 1NRQH 1ZPZA 4B73A 2Y5FA 5EXNA 2NU4E 4X1RU 4DIIH 1FN6A 5AFZH 1P3CA 1IQLA 2D26C 2PUXB 1LDTT 1NRPH 3TITA 1CA8B 1DY9A 5C17A 1XKAC 1NZQH 1N6YA 2BQ7B 5A0CA 3S9AA 3ITIA 4OGYA 3UNSA 1OWEA 1TFXA 2QYIA 1UTNA 4NGAH 2XRCA 2F3CE 4Y8ZA 2GCTC 4Y8YA 3ZVCA 1GHAF 1BZXE 1P01A 3ZIAD 4ESTE 1P12E 5GDSH 1BTYA 2OINA 2XWBI 1MBQA 2TIOA 1O2HA 3SJIA 1H9HE 1EPTC 4MNWA 1P02A 1GDQA 4HFPB 4K1EA 5C5OA 1XMNB 5K0HA 1D4PB 5C0UA 1GI0A 4GCHG 1KY9A 2JH0D 2OP9A 1UO6A 4H6SB 4FU8A 4NA8A 2BVSH 1W2KH 5FL7D 2AMDA 5DP9A 7GCHG 3S9CA 4ABGA 3BTWE 1TNIA 1ETSH 3MO3A 2BMGB 3R0FA 2OCVB 4X8UH 1MABB 4I8KA 3Q3XA 1TLDA 3PLBA 4MPWA 5FBEA 1CSOE 4AYYB 1EP5A 1SGFA 3OE7D 3D65E 5SGAE 1ZGVA 1P2IA 4AG1A 3DD2H 2KAIA 3E0PB 3ZVEA 3RXIA 2XNIA 1QRWA 3GY4A 3MWIU 4DY7B 1YPJH 5IDKA 1O33A 5EOKA 1P0SH 1ESAA 1LHGH 2QN5T 5ESBA 3GYLB 4Y0YE 1PPCE 2BY6X 1FY3A 4UDWH 5JBCS 3GISB 1TNJA 1BTWA 1QB1A 2PKSC 3KQBA 2IN2A 4Q2KA 2QF5A 2VB0A 1EFRD 3VG8A 6CHAB 3FP8E 1K21H 3MI4A
chains in the Genus database with same CATH topology
1FUJA 2ZKSA 3U98H 1P10A 1LHEH 1P8VC 2STBE 3KQEA 1HXEH 4CRGA 3K9XB 1S6HA 4CRCA 1QIXB 1AUJA 3B23B 5AFYH 2OC1A 5JBAS 2HGTH 3BIUH 1NRNH 3Q76A 3F9GA 1SOZA 1EXFA 3F9HA 1A1RA 4X2YA 1MCTA 1Y5UT 4E7RG 1C2JA 2AEIH 2R0LA 2CXVA 2JETB 3LOXA 3MOCA 1O3HA 1O2ZA 4NZQA 2A0QB 2W7UA 4O97A 1GMDF 1SR5C 2C3SA 2FDAA 3MNSA 5C20A 4TWYA 2VINA 3AAUA 2H6MA 1EJMA 2ZGCA 4XSKU 1BA8B 3BG8A 4WVPE 3EQ0H 1ETTH 1ESBA 3RMMH 1F5RA 4X8TH 3ZVFA 1FIWA 1TQ7B 3SV6A 5HM2A 3RU4D 3T25A 1UCYE 1EAXA 1J14A 2F83A 2PR3A 5FPTA 1GVKB 2P3TB 1KXFA 3MH7A 1NESE 1DUAA 1VITF 3UPEA 1GBFA 1Y3UA 1GL1A 1GI8B 4ZUHA 1TRMA 3P8GA 4D76A 4LZ1H 4X6MA 3A7VA 6GCHF 3SW2B 4FUIA 1YPHC 2ZZUH 2FXRA 2G81E 4H6TA 5HYOA 3OYPA 4IS5A 1ZLRA 1ZJDA 2V3OH 1HAZB 4AX9H 2W7SA 2A4QA 3ATIA 5FCRA 5GWZA 1YPLH 1IQEA 3OU0A 4BNRA 4K8BA 1GG6C 1K1IA 5JDUB 2XCNA 1N8OB 5PTPA 4DVAU 1O2IA 2QV1A 3KIDU 1GCDA 2ANWA 2BY7X 1PFXC 3SNDA 3M5MA 3RU4E 4IMQA 4JYUH 1WU1A 3A82A 2EI6A 2FOMB 3KCGH 1NM6A 1JXPA 3ZZ5A 2ZG0H 2VWMA 1V2PT 4YZUA 1SBWA 1HAOH 4I33A 4Q7ZA 1G37A 2PSXA 1BCUH 5A0AE 4DJZB 3FZZA 4YTAA 1Q2WA 2R9PA 1ABJH 2W3IA 2P8OB 1GHBF 1O2JA 2OD3B 3PO1B 4BTTB 3EYDA 4SGBE 2VIOA 5C2ZA 3ZZCA 2OQUA 1DITH 3ENSB 1DS2E 2SGQE 4UEHH 1QL9A 2BLVA 3EE0B 1O5DH 1DDJA 2WYGA 1K1NA 2TGDA 2QIQA 3OX7U 3QWCH 4ISOA 1FMGA 1P9UA 2FI3E 2FS8A 3T62A 1C9TA 3SJ9A 3RXTA 2IOTA 1BBRH 1TBRH 3A7ZA 3PM3A 2BD2A 2HPPH 4D9RA 1SLUB 1EOLA 3S0NA 4FUBA 2GX4A 1H8IH 2NU1E 4HI3A 4DT7B 4J1YA 3BN9A 3GCOA 2ZP0H 3DT0H 1Z8RA 3M7QA 3SU4A 1V2RT 3GOVB 1F0UA 1C1TA 1IHTH 2THFB 5T6FA 1TPAE 2OC7A 4UE7H 3NKKA 3EA8A 2XC5A 3QTVH 1Y5BT 3TK6A 1C2GA 5FX6A 3A7XA 1ELTA 1O3FA 4GAWA 1HAVB 1V2TT 2A4RA 3GYMA 4HGCA 1BMNH 1AUTC 1O31A 2K1QA 1LQDB 1DWEH 1UK4A 4A6LA 2F9NA 1C5SA 1K9OE 1SGRE 3M5LA 3ATWA 1HJ8A 1XXFA 1TE0A 1GHXH 1V2OT 2GKVE 1ZMJA 1SPJA 3UUZA 1QJ1B 1OSSA 2GCTB 5J4SA 1A46H 3TJOA 4PROA 2ZIQH 1K1LA 2ZFPH 1TWXB 5EG4A 1CHOG 1GMHG 1C5RA 1THSH 2J4IA 4WXVA 4A7IB 4ABJA 2ZI2H 1EPTB 4KP0A 1OYTH 1IAUA 1K1PA 3ODDA 1UTQA 1HAVA 3SHAH 4D7GA 1Z8IB 1O3OA 4INKA 1CGIE 1OWKA 1DANH 1HAXB 1YPEH 1PYTD 1DM4B 4FUHA 5EXLA 1W8BH 5ABWA 1T8MA 2O8MA 4WF8A 3T5FH 3O8BA 4FUJA 2PFEA 2ZHDA 3GY8A 1ZGIA 2G5VA 3H7TA 3A84A 1AO5A 2GT7A 3M61U 1V2VT 2ZFSA 3RXLA 7ESTE 4CR9A 1BBRK 1MU8B 1GHWH 3ZV8A 1FAXA 2XC4A 4YOJA 1MAXA 1MKWH 1BTPA 3V0XA 4B2AA 4UFEH 3RU4T 3MHWU 3GY2A 2AMQA 4JZFH 4AFSA 4Y0ZE 1KXDA 3FVFB 3KQCA 2W26A 1GMDG 1O39A 3SJKA 1F2SE 4UD9H 2QXHA 6ESTA 3ZZ6A 2J2UA 1WBGB 1ZHMA 3GCTF 2PKAA 2Z9IA 1AE8H 4X6OA 3QLPH 1DPOA 1KIGH 1O2SA 3SN8A 3I77A 3OSYA 2HNTC 3SZNA 1ZTJA 2OBOA 3M7UA 1TX8A 3TU7H 1TB6H 1BIOA 1P2QA 2WPHS 5CMXH 1QR3E 1QL7A 2STAE 6GCHG 4IMZA 3VB4A 3K65B 5A2MH 1QA0A 1FPCH 3EAJA 4MTBA 1QQ4A 2G52A 2QF3A 5EPNA 4X2XA 1C4Y2 1UVSH 4AGJA 4A92A 1D6WA 1LMWB 3FANA 2WPMS 1AZZA 1K22H 3V3MA 1EASA 1FIZA 1PPHE 1EB1H 4CBOA 1UJ1A 3A8CA 1JRTA 1O3LA 1Z71A 1CBWB 1ARCA 2SFAA 3PLKA 1KLTA 9LPRA 3A8AA 2BLOA 4X1NU 1HV7A 3U8OH 4ZKSU 3AW1A 1AVXA 3LPRA 1ARBA 2ZECA 1EZQA 1OKXA 1HAGE 1Z8JB 4I8GA 3MU1A 5GJ4B 1A4WH 3S7KB 1HBTH 3T27A 3ZYDA 5LPRA 5JPMH 1C1VH 4ABFA 2O8WA 2I6SA 2OC8A 5T6DA 1HLTH 2RDLA 4ZXYH 3A88A 2ZHQH 2OBQA 4GCHF 2PTNA 4U2WA 3RLWH 1J8AA 1GHBG 3MU8A 1MKWK 2XCFA 1OWDA 2I6QA 3SJOA 1UK2A 2BVXH 4Y11E 5G4BA 2VIQA 1SC8U 2CN0H 2GCHG 1L1NA 4NCYA 1O3MA 2BOHB 1UTOA 1Y3WA 2BX4A 2WUBA 1WCZA 3PROA 4Y8XA 1WV7H 1GG6B 2TGAA 4OS4A 1O2VA 1O3BA 1YP9A 1Z8GA 4NIXA 3QZRA 3RXBA 2B0FA 2Y82A 1XUJA 3BTKE 3M3SA 1YCPH 3OTJE 1MH0A 2NU2E 3K6ZA 3QK1A 2ZGJA 1JBUH 4ZHAA 3SGBE 4NA7A 1ZSLA 3ZZ9A 1B0FA 4OS7A 2BY9X 1NFXA 3O8DA 3ZVGA 2CV3A 3G01A 4CBNA 4J2YB 1C2HA 2ODYB 1HIAB 1O2GH 2SGDE 1KTSB 4AFZA 4AG2A 3BF6H 3PWCA 1GI9B 3T29A 4GUXA 1Y3XA 4RKJB 4BOHA 1O3DA 2GDDA 2ZPSA 2FI5E 3L6PA 5DG6A 1C5NH 1UTLM 2YNBA 1AFEH 1TRNA 3FZDA 5CHAC 1GBMA 5CE1A 2EC9H 1RRKA 3RXPA 1D3TB 2BD9A 1Z1IA 1NS3A 5FX5A 4ISHH 3K2UA 1HCGA 1CE5A 1C4U2 1Q31A 1X7AC 1VR1H 2FPZA 3SORA 2W5EA 1BRAA 2A45B 1C2KA 1G2LA 3A89A 3C1KA 3KL6A 2FOGA 4FUEA 2P59A 1P2JA 1QJ7B 3K6YA 1RFNA 1GJ4H 2ZDAH 3BEIB 3JZ2B 2AS9A 1ELBA 1GI6A 5ESTE 3LGYA 1G36A 4K60A 2LNCA 4I7YH 1O5BB 1MTWA 1T8LA 3MNBA 3MH5A 5JB9S 1RS0A 3LGUA 4KKDA 1BMLA 4YLUA 2YNAA 1GMCF 1S85A 2A5AA 1K1OA 2P8OC 1NO9H 3O8RA 1MUEB 3KNXA 1SGQE 3TLOA 3SV7A 1S84A 4DG4A 3VXEH 2XTTB 1YCPK 1B7XB 2GMTB 1NRSH 4XFQA 1ANDA 2BDHA 5GIBA 2OQ5A 1C5UA 4IC5A 2H5CA 1A5IA 1J16A 1GJ7B 2DE8A 3RC5A 1NN6A 1DY8A 3EGKH 1CU1A 1INCA 2BD8A 1O2KA 2SNWA 4ZMAH 1YC0A 1XUHA 3GCTG 1RXPA 2ODPA 1QA7A 1E36B 1W0ZU 1MTNC 3MH4A 2EEKA 1Z6EA 3SI4H 2BD4A 3LC3A 2WUCA 1S5SA 3SU0A 4HTCH 5JYIA 1Z6JH 5EXMA 1CT4E 1PJPA 1O34A 1FJSA 1L2EA 3SO3A 3A80A 2FODA 1GI1A 1MTSA 4FVBA 1TPSA 1NPMA 4AORA 2Q6GA 2C90B 2UUYA 2BB4A 2GT8A 1Y8TA 2Z3EA 1UCYH 3DHKH 3WY8A 1ZOMA 4BAQB 1T7CA 2O8TA 1F0TA 2EA3A 3GY6A 5HM9A 1Y5AT 8GCHF 1GBDA 1UTMA 1SQTA 5EQQA 3RM0H 2O9QA 1KXBA 3CENA 3PLPA 3TJNA 4FUFA 4I31A 1YCPM 1MD7A 2BZ6H 3GDSA 2Y81A 1IQFA 2A4GA 5EPYA 1ORFA 2NWNA 2ZFFH 2FYRA 5EODA 2KAIB 1C1WH 1O35A 5HMAA 4WWYA 2ZU1A 4BAOB 2PHBA 4KTCA 5E0HA 2FOEA 3RXGA 1QTFA 2Z94A 4IBLH 3NWUA 4MPVA 3SHCH 2UWPA 4WH8A 5K7RA 4K8YA 2QXIA 2G55A 1XUKA 1ZRBA 1UVPA 2RG3A 1BRBE 2ZHEH 1AY6H 1DWDH 2FM2A 2O8LA 4FUGA 4E06H 1KDQB 2AH4X 1T31A 2Y6TA 3ZVBA 1O2PA 4O03A 2IPHA 1LVMA 5BPEA 1GWAA 1BDAA 2WPKS 4INHA 4ZH8A 2R0KA 4MNVA 2H2ZA 4E05H 3QUMP 2GV7A 3LC5A 2P3FH 3L3TA 1WOFA 2OXSA 1SGNE 1DICA 3BEFB 1LHCH 2CF9H 1FNIA 1GL0E 7LPRA 1O3EA 1EOJA 2G4UA 4NWLA 2FTLE 5BRRE 1IQJA 4ABHA 1CHOF 1AQ7A 1GMHF 2J94A 5F6MA 3NPSA 1BUIA 1CHGA 1KDQA 3RXSA 4IN2A 2GDEH 2V6NA 3ZV9A 1AFQC 1S6FA 1HXFH 1TYNA 4AFUA 5I25A 5L30H 2QY0B 3ODFA 1JMOH 1JRSA 3GCHB 2VGCC 2H9HA 3S9BA 1UCYK 1N6XA 2XC0A 1DWBH 1BITA 3M5NA 2ILNA 1GPZA 1SGEE 3SU3A 1VJAU 4IGDA 3TNSA 1FN8A 4Z0KA 1GBCA 2VH6A 1HAIH 3M3TA 1AI8H 2QCYA 3TPIZ 1C2EA 3VXFH 1THPB 1W7XH 1G30B 2CMYA 5AHGH 1G3BA 1CBWC 2M5TA 2BLWA 2BXUH 3LIWA 3PMJA 4B75A 3SNEA 2D2DA 1EJAA 3RXUA 2R3UA 1GJ9B 1XXDA 3QX5H 1V2MT 3PMAB 4Q7YA 3RXJA 1LPKB 1NFYA 1ID5H 5HGGA 3S7HB 3QTOH 1WYKA 1JWTA 1AWFH 3O8CA 4B1TA 1HUTH 1GMCG 1ZR0A 2BDBA 3RXRA 4XE4A 3P70B 2ZNKH 1O3NA 5TJXA 1BMMH 1PQAA 1NU9A 2BVRH 2ODQA 2QXJA 1OWIA 3E91A 2ULLA 1EX3A 1GI2A 1SI5H 1NC6A 2V3HH 5CHAB 1ZTLA 1OPHB 4GPGA 1OWHA 5JB8S 1K1MA 1FV9A 1ELVA 1FZZA 2HRVA 2BM2A 1MQ6A 1O2UA 4OGXA 1BOQA 1CQQA 1O5AB 3LJJA 4IN1A 5FXLA 4DCDA 2PLXA 1TX6A 2HALA 4JK6A 3LH3A 4O3UA 4YM9A 1LQEA 1E38B 2CF8H 1YPKH 3M5OA 3VB6A 1WTHD 2R2MB 3M3VA 1GBEA 5F8XA 1IQHA 3RXDA 1IQNA 5F8TA 1TBQH 1OYQA 4D7FA 4XDEA 2Y7ZA 2ESTE 2PGQB 2A7HA 1EQ9A 1F0RA 3FAOA 1MU6B 1GBIA 3E6PH 3ZZ3A 3I29A 4D9QA 4AYVB 1XVMA 3N7OA 1C5YB 1EKBB 2GCHF 1HYLA 1UTKA 3VB3A 2AFQB 3MNCA 1BHXF 8GCHG 2ZQ1A 4FXGH 4INLA 4A1XA 1UMAH 1PQ8A 3NUMA 2ZU5A 1TGTA 1W0YH 3D49H 4KTSA 3KHVA 3A81A 2BD5A 1S0RA 1MAYA 2BD3A 2FOAA 1MTNB 2J38A 5T3HA 1ELFA 1O2YA 2TGTA 3QN7A 1PPBH 5LPEA 1YKTA 2Y7XA 1GJCB 1FDPA 4NIVA 2ZGHA 2GVFA 1NU7B 3BTFE 2ZFRH 1F0SA 2AYWA 4I8JA 2ZFTA 3RUOA 3H5CB 4CHAC 1SQAA 4GHQA 2ZCHP 4TY6A 1ZSJA 1KXEA 3LGTA 3VEQB 1O3IA 5E0JA 1BTUA 1CO7E 4X8VH 1GJBB 5DP5A 5C5NA 1NFWA 1GDNA 2GMTC 1HAPH 3NZIA 2SNVA 2UWLA 4JYVH 1HGTH 1GBHA 4X1SU 1DLKB 2VVVA 4YLQH 5L2YH 1SQOA 1SLVB 3V13A 2J9NA 3ZVAA 1S81A 4WMDA 2AIQA 4IW4E 2JH6D 3Q00A 1TQ0B 1SGDE 3ATKA 2FLBH 2VVCA 1QFKH 1CT0E 1O2XA 1Z1JA 3UIRA 2RA0A 3B9FH 4ZHLU 1O3JA 1A7SA 2SGAA 5LH8A 1IQIA 3T28A 2EI7A 4ISNA 3E3TA 2ZF0H 2PKAB 1ZRKA 4M7GA 1LPZB 2GD4B 1HPGA 4WY3A 4F49A 2ZFQH 2HLCA 2J92A 1OOKB 1SGTA 1GHZA 3RXQA 3SBKA 2BX3A 2D8WA 3UY9A 1G3CA 9ESTA 2BOKA 1S83A 1V2UT 2XYAA 1SHYA 1TMUH 1SLWB 4NIWA 1MCVA 1ZHPA 4BXWA 1HDTH 3A85A 1UHBA 3TGJE 3GICB 2FZZA 1YM0A 1J15A 1DXPA 2A2XH 5I46H 2FWWA 3A8BA 4AB9A 1BJVA 1PQ7A 3DUXH 4UFDH 1C1UH 1AFQB 1O3GA 1A3EH 1OP8A 4DGJA 3IITA 1LCYA 2F9UA 3BTDE 3U8TH 1P2MA 2VGCB 4TYDA 4XBBA 3M36A 1YPHE 1KXAA 3AVZA 1GI5A 3UQOA 2GGVB 1QY6A 3RXFA 2BD7A 1TGBA 4FUDA 2SGEE 2JKHA 3HATH 1ABIH 1AVGH 1CT2E 2Q6DA 1S82A 2ALVA 1O38A 1TMTH 5C1UA 2HVXA 2CHAB 3GY7A 3A7WA 3EA7A 1JOUB 1UVUH 2ZU4A 2RCEA 2C8XB 2G51A 4CRDA 1C5LH