1TPSA

Atomic structure of the trypsin-a90720a complex: a unified approach to structure and function
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Atomic structure of the trypsin-A90720A complex: a unified approach to structure and function.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tpsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tpsA02
4AORA 5DP8A 1SGFA 1PJPA 1C2LA 3BEIB 1EASA 3A89A 2O8MA 2PGBB 1UK4A 2BY8X 1C2EA 2EA3A 2CGAA 2IJOB 1DFPA 3PYHA 1OKXA 1MBQA 1YCPH 1P2MA 1ZHPA 3VEQB 4ABGA 4A92A 4CRGA 3A86A 1OOKB 1SGIB 2ZFQH 1HFDA 2ZNKH 3QO6A 3PMAB 2A5IA 1M9UA 2OBQA 3A7XA 3SQHE 3ZZ7A 2ZU3A 3GCOA 1JBUH 1O2VA 1AB9C 3P8OA 1PPHE 4M7GA 3PB1E 3SHAH 2VVCA 4UFGH 4UDWH 2BDBA 4TWWA 2A1DB 2HALA 1CA0C 4X8UH 4THNH 1MAYA 3RXIA 3OYPA 1GI4A 2TGAA 2WPHS 5A09A 2GDEH 1O5EH 3IWMA 4CH2B 1JXPA 3RXJA 5L2ZH 1VJAU 4HGCA 1O2YA 3AW1A 4ZHMU 1NU7B 1GDQA 4LK4A 4B2CA 3V12A 5AF9H 3HGPA 1C2GA 2GTBA 4HZHA 1WOFA 1GBFA 4ZMAH 2C90B 2P3FH 3RLWH 2GCTC 1LVOA 1YLCA 4Z6AH 2XWBI 1V2ST 4O9VA 1G37A 1SQTA 1ZZZA 2CF8H 4WXIA 1BBRH 5EXMA 4IGDA 1TMUH 3KQCA 4DIIH 4ABJA 1HIAA 1K1IA 1B0EA 1TQ0B 4H6TA 2BB4A 2OXSA 1NRQH 1J15A 1AB9B 2FLRH 3I29A 4IC6A 4LZ1H 4U30A 4E7NA 1AQ7A 4MTBA 3ENSB 4X8VH 1C5ZB 1TAWA 1S6FA 1DS2E 1GHXH 5EXNA 2EI7A 1JIRA 2GDDA 1EKBB 1HYLA 1H9HE 2FOEA 2Z9LA 3SHCH 1NY22 5GCHG 3SW2B 2QCYA 1XUKA 4X2XA 3DHKH 2FI5E 3TK5A 3BTHE 5ETXA 1DWCH 1LCYA 3M37A 1ZTJA 3SGAE 2PHBA 4RSPA 2YOLA 3SQEE 1IQGA 1SLWB 2P59A 3PLBA 4WMEA 3O8CA 2GCHG 4VGCC 1HAXB 3ZVGA 1TRMA 1EXFA 1RIWB 2Q1JA 1GDNA 3Q3XA 4MLFB 5DP4A 1YBWA 2BXUH 3A7ZA 3WY8A 1FPCH 3A88A 4CRCA 1P2IA 2ZDNA 3LOXA 3EA9A 7GCHG 5EODA 1N8OC 2XYAA 1GHAG 5F8ZA 4X0WU 2ZU4A 1JWTA 2VWMA 4YLQH 5FPYA 4Q80A 3VXEH 3U69H 3DA9B 1O3BA 2Z3EA 1TPAE 1BRBE 1ZPCA 4D9QA 5JB9S 3VB6A 4GCHG 4NIVA 1BCUH 1K1NA 1MTNC 3R0FA 1SC8U 1XKAC 2HNTF 1O2HA 5DO4H 1AZZA 1K28D 2AGGX 4WXVA 4PROA 3ZZCA 2WPMS 2PKSC 3GCHC 2P3UB 1MZAA 3FP6E 7LPRA 2Z3DA 1O32A 1O2JA 4DY7B 2VH0A 3L33A 3LGYA 2W26A 1NZQH 1BB0B 1CVWH 1WBGB 2AIPA 1OWJA 1O2NA 1VITF 3VB4A 1ZRBA 1AGJA 2FLBH 2FS8A 2DE8A 3A80A 3PV4A 4SGBE 2I6SA 3GY8A 4FUHA 4VGCB 1DSTA 1GJDB 3QX5H 1C2IA 1YF4A 3VXFH 3A83A 1BDAA 1HXFH 3W95A 1TRYA 1FAKH 5A8XA 1UTKA 1KDQB 2VB0A 4MPVA 4CBNA 3FAOA 1SGYE 4WY3A 1O3LA 1W14U 2O9QA 1N8OB 2QY0B 3EGKH 3UOPA 1O39A 1C5MD 2HLCA 1P03A 3A8BA 1XUIA 2R9PA 1AY6H 5JDUB 1LDTT 1FIZA 2VIDA 1IQEA 2J38A 3RUOA 1FLEE 5HXFA 1LHCH 2R3UA 1L2EA 4GSOA 1KXBA 3ATLA 4J1YA 1TGNA 5E2OA 1L1NA 3ZVDA 3MWIU 3H5CB 1K9OE 2OCVB 3LGIA 2HGTH 3IITA 2PUQH 3MNCA 2OUAA 1MAXA 5C3NA 5HM9A 5FBEA 1QA0A 1G30B 1P11E 3SJ8A 1HAZB 1RTLA 4B71A 1GJ4H 1BT7A 4X1RU 1TIOA 1O3PB 1YKTA 3B8JA 1BA8B 1HB0B 1W7GH 2P93A 4NIXA 1IQJA 5T6FA 3PWBA 2BTCE 1K22H 1GVZA 1TFXA 2P95A 4CRBA 1CA8B 2WUBA 2EC9H 4BAHB 1HAVB 1O2OA 4OS5A 2V0BA 3EA8A 2CV3A 3PTNA 3T25A 1ELDE 4ZKSU 3RXTA 4ABDA 3OSYA 3BTEE 2RDLA 1GBMA 1C2MA 4JYTA 3RC5A 4ZROA 1QQ4A 3RU4E 4ZKRU 3BTME 1IAUA 3L3TA 2BVSH 5SGAE 3LH1A 1ZYOA 1H8DH 2FIRH 2XBXA 3TJUA 1GMDF 1S81A 4F49A 3GY6A 1WAYB 1GHBF 3RXKA 4I7YH 3SUDA 3T5FH 4FUIA 2UUJB 2R2MB 3SN8A 4AYVB 5JB8S 1S84A 4X2YA 1MUEB 1DWDH 3SNBA 1T8OA 2SNVA 1D6WA 2IOTA 4TWYA 4JK5A 1ZSJA 1THSH 1C2DA 4UONA 2PTNA 3A8DA 4IC5A 1DY8A 2TGPZ 1SGNE 1G2LA 1GBLA 1Z6JH 2HVXA 1CHGA 1DM4B 4Y0YE 4DG4A 1NTPA 1VCQA 1P9SA 1DOJA 5DGJA 3B9FH 1CHOG 1V6DA 2OTVA 2SGFE 1K1OA 3K2UA 2BM2A 4A1VA 1UTOA 4MQAA 1SLXB 1GJ6A 4UFFH 1LVBA 4NFEA 2QXIA 1FQ3A 1DX5M 3VB7A 4TYDA 1MU6B 2DE9A 2SGPE 1O2TA 5JBTA 1G9IE 4I32A 1K1PA 2D2DA 1GHWH 3PROA 1PPBH 2RA3A 4IS5A 2FESH 5JYIA 1RTFB 3N7OA 4BAMB 3PWCA 4NFFA 3U1JB 1GHYH 1GBDA 2EI6A 2VNTA 3T26A 3VGCC 1GJAB 1BRAA 1L4DA 1FZZA 1CGHA 1WUNH 1A3EH 3QGNB 3UQOA 1HAHH 3SZNA 3TH3H 1DDJA 5EQQA 4H42U 4YT6H 2G5VA 3M5MA 1AE8H 1D6RA 2BMGB 3SU0A 2Y7ZA 2VGCB 4YT7H 1H8IH 3Q3YA 1MKWK 2ANKH 4I8JA 5AFYH 2BLVA 1ELVA 1B5GH 2O8UA 5EW2H 3ZZ8A 1W7XH 5TJXA 1VR1H 1O3KA 1O2ZA 2GVFA 3S69A 2FODA 1TONA 2ILNA 1FY3A 2B8OH 3GDUA 1SPJA 5C1XA 3LGUA 2BZAA 1V3XA 8GCHF 4BXWA 5CHAC 2G5NA 2BZ6H 2XC5A 3AAVA 1OYQA 2ZGHA 1EOLA 2JETC 3PM3A 2CHAC 2RG3A 2P94A 1MTVA 3RMMH 3K6YA 5GJ4B 3VGCB 4GPGA 2BDGA 1FAXA 5F8XA 1Z8JB 2J4IA 1S82A 1LMWB 2QAAA 1NROH 1O3EA 3ELAH 1P06A 2ZHFH 2ODYB 1FY8E 1VGCC 2KAIB 5A0AE 3P8NA 1GMCF 1ZR0A 4MDSA 1SGPE 3E1XB 3RMLH 2TPIZ 1Q3XA 1ZMNA 1QJ1B 3BG4B 1AO5A 3CS0A 5DK1A 1F5RA 3K65B 1EP6A 2GD4B 1O2IA 1SGFG 3NK8A 3SU1A 4F4OC 4ISHH 1AKSA 4ZH8A 2SNWA 2STAE 3BSQA 1C1QA 1U6QA 4GHQA 2BDCA 1O31A 1LHGH 2XBWA 4X8TH 3SOSA 4ABEA 1C5NH 1H1BA 3STIA 1JRSA 1GBJA 1HAYB 1VJ9U 2JETB 2CHAB 5FHTA 1F0TA 1V2QT 1UMAH 1KXDA 3MU0A 1EZQA 1V2RT 1O2RA 8LPRA 3SJIA 1AI8H 3QK1A 2FI4E 3ZVBA 3SUGA 1NRRH 2ZF0H 5J4SA 4KP0A 3M61U 5PTPA 1BIOA 3RXSA 1BJVA 5TCCA 1VGCB 1A0JA 2NWNA 1A1RA 1A5GH 1S0QA 1S85A 1UK2A 1SFIA 1FY4A 1DWEH 3RP2A 2H9HA 1TGTA 1A46H 3FVFB 4ABHA 1TRNA 4GHTA 1ELFA 3RDZA 1AVXA 5LPRA 2A0QB 2FX4A 2Y5FA 3GYMA 4ISLA 3UUZA 1SHYA 1V2MT 2FOCA 5EXLA 3TGIE 5C5NA 1Y3XA 1TPSA 1V2VT 3ATKA 4Y79A 3RXRA 1BRCE 1S83A 1O35A 1W3CA 3A7VA 1GVKB 1XX9A 1W13U 1UTLM 3RMNH 4FU9A 3PMHB 1O3HA 4R8TB 2ZC9H 1EAWA 1HNEE 1GMHF 1HCGA 1HAIH 4BXSA 2AYWA 3E16B 4JZ1A 1PPEE 2QYIA 1FY1A 3SJ9A 1QY6A 2BOHB 1TNIA 2HOBA 2BVRH 1Y3VA 1K1LA 3GDVA 3Q77A 4NCYA 1C5OH 3D62A 2FOFA 1GBAA 1C2JA 1C2FA 1VCWA 1T8NA 1GBCA 4BAKB 2ZHDA 1GDUA 4KTCA 4NG9H 1MQ5A 2BD9A 1TGCA 1LTOA 1DANH 1ESTA 3DUXH 2OC1A 3U98H 1A5HA 1ZTKA 1P12E 4GLYA 2ZFRH 5C67A 1BITA 2A31A 2B7DH 3SO3A 1C1PA 2VIOA 1XXFA 1EX3A 3DFLA 1LPGB 1VITG 3TNTA 1ELGA 1Z71A 5I25A 7KMEH 2PSXA 1IQMA 2Y5HA 3CP7A 3AVZA 4FVDA 1GJBB 3BTDE 1ZJDA 3OU0A 4Y76A 1G2MA 1E37B 2A32A 5EOKA 1RXPA 5FX5A 4YLUA 4Q7ZA 3RXFA 4B76A 1NFWA 2BX3A 5LPFA 1O2XA 1ABJH 3TH2H 3BTKE 4MG3A 1Q31A 1QB1A 3GDSA 1O5GH 4R0IA 1FN8A 2H5CA 2TIOA 2ZDLA 1V2TT 1ZHRA 4FXGH 5JPMH 3JZ1B 3RXGA 2F9BH 1QRZA 2DUCA 1MQ6A 2BDYA 2VIVA 3TJOA 4U01A 1C5SA 2FDAA 2HNTE 3GYLB 4Y8YA 1HAPH 1ETRH 3MH4A 2BD8A 5DP3A 3C1KA 1Z6EA 3KEEA 3LPRA 2BLQA 1P02A 1TBRH 1LHDH 1MKXK 1UHBA 2W5EA 2JH5D 3BEUA 3T29A 3P92A 4WWYA 3D49H 4ISIH 1TA6A 5EG4A 2GZ7A 1DVAH 4X6PA 2ZP0H 4NGAH 1KLTA 1TALA 3P70B 1MD8A 1UTJA 1IQNA 2WYGA 2XC0A 3E6PH 1SL3A 3MNXA 1O3IA 1G3CA 3RXDA 2QC2A 1BMAA 2Y81A 1BRUP 1L0ZA 4AFUA 3DD2H 5K7RA 2G81E 1P05A 1RIWC 4BAOB 2CXVA 3KGPA 1E36B 3NUMA 2XW9A 5E0HA 1OWHA 1GJ8B 3A82A 1OSSA 3L6PA 1SQOA 4KKDA 4DOQA 4NSVA 1GI2A 1C5VA 1IQLA 2NU2E 1GWAA 2V6NA 3SORA 1CT2E 1FMGA 4IBLH 5A8YA 1C1VH 2WPJS 1A5IA 5HMAA 1EATA 3BEFB 1YPHE 2VVUA 2NU4E 2A45B 1N6XA 3U8RH 3RXPA 3P8FA 1NRPH 4Q2KA 4JYVH 3UPEA 2YNAA 1QL7A 4GVUA 4K60A 5T3HA 3SUFA 1PQ8A 2HPQH 1QBVH 1MCVA 5HGGA 4TPYA 3TVJB 1Z1IA 1EPTB 3TK6A 3BTWE 2PR3A 1BHXB 2BLOA 1LVYA 1W12U 4UE7H 5ESBA 2XXLA 2SGAA 3T27A 1KYNA 1WSSH 1MZDA 1FONA 5EGMA 3V7TA 1OPHB 3ZV8A 3F9HA 4MNVA 1GI8B 1IQIA 1TE0A 2W3IA 4X1SU 2OC8A 1AHTH 1UTQA 2OC0A 6GCHF 2QIQA 4A6LA 4Y8ZA 3ESTA 5EQRA 3HATH 1C5XB 3SNAA 1O3FA 3TIUA 4ABIA 3E90B 4JZIA 4WF8A 1A0LA 1F2SE 2OLGA 4JCNA 1PQAA 3MU1A 1AUJA 1GGDC 2R0LA 1O3CA 1P10A 2GZ8A 1QL9A 1TMTH 1ZGVA 3ATMA 1ELCA 2P8OC 1O2PA 1TBQH 5A0BA 2TBSA 3C27B 1EAIA 1MKWH 1VZQH 1XUHA 1N1LA 4NWLA 1AIXH 4AZ2B 1DICA 1A0HB 1FNIA 4AFQA 1QB6A 1TBZH 4DCDA 1TQ7B 1K21H 1EUFA 1WU1A 2A5AA 3KF2A 4K1TA 1NFUA 1W10U 2BHGA 1SSXA 1O2GH 3TITA 3SGBE 1PPCE 1CBWC 1OWEA 2A4RA 4I31A 3KQEA 6LPRA 1NPMA 1O2KA 2A2QH 1KTTB 1YPJH 4MVNA 2J9NA 2QN5T 4JYUH 3GCTF 2XNIA 2CF9H 2C93B 1DWBH 2AGEX 2ZQ2A 1HBTH 3UR6A 3NKKA 1P2OA 5HM2A 4Z0KA 1GGDB 1W2KH 1SVPA 1Y3UA 1T32A 1BUIA 1A61H 2P8OB 1IQHA 5E0GA 4ZAEA 1O34A 3UREA 4B75A 1OS8A 1GI3A 1N6YA 1EOJA 3LC5A 2FYQA 3NXPA 1HJ8A 3M5NA 1YC0A 4X1PU 3MMGA 1AWFH 1VITH 1LVMA 4DIHH 2AEIH 1GI7B 1O37A 1YPEH 2HRVA 3S7HB 1ACBE 1GBIA 1CBWB 4X1NU 1G3DA 5FCKA 4KTUA 1BMNH 1Q2WA 2QA9E 1TNHA 3Q3KA 1UVTH 1TNJA 3LDXH 3GY5A 4K1EA 3LJOA 4I8LA 1C5TA 1ORFA 3UTUH 2GT7A 2Z3CA 2G4TA 1OP8A 2Y82A 4BTTB 1TMBH 3S7KB 1HUTH 1UCYK 5LH8A 2ZECA 1HXEH 2ZPSA 4JZFH 4AGJA 1ZMLA 3T2NA 2ZDAH 1OWDA 1HJAC 2ZPQA 4TY7A 1YLDA 2B9LA 2SFAA 4AG1A 1SGEE 1RTKA 2F9PA 5DKMA 1KTSB 1D4PB 4CRDA 3AASA 2BDHA 1O30A 1OYTH 3ZZ3A 5K0HA 5H4IB 3PTBA 1C1MA 2ZCLP 5GCHF 2V35A 2Y5GA 4NIYA 2EEKA 1G3EA 1QRWA 1GJ7B 3M35A 4X1QU 2H9EH 3KL6A 3CENA 4I33A 1KXAA 3SNEA 3LGWA 4D7FA 4DGJA 4D9RA 4OS2A 1O5DH 4ASHA 2GV6A 3M5LA 1O3AA 2XRCA 4ZKNU 1AE5A 3NZIA 3LGVA 2YNBA 5L30H 2VGCC 2C8YB 4CREA 2THFB 2PLXA 4CR5A 4AX9H 4CR9A 2ZG0H 1ABIH 2BDIA 1BTZA 1C5PA 1C5RA 1HJAB 1QTFA 3RC4A 1LHFH 2FYRA 1DE7H 2O8LA 4FUCA 1NC6A 8ESTE 3DFJA 2ANWA 1HRTH 2NU0E 7GCHF 2BVXH 1GHAF 3R3GB 3SI3H 2FZZA 3EE0B 1A3BH 3ZZBA 1ESAA 1FXYA 1EAXA 3W94A 1SQAA 5IDKA 5L6NH 4GCHF 2FI3E 1C1SA 2ZFPH 4FUBA 4ABFA 3ZYDA 4DVAU 1YPKH 2RA0A 2V3OH 2WINI 3F9FA 1O2QA 1T7CA 4ISOA 4E7RG 4KGAA 2XBYA 5ESTE 1KLJH 5CMXH 1DITH 1EP5A 1BHXF 1S6HA 1Z8IB 3F68H 4IMQA 3OY6U 4I8HA 3MU4A 2FOMB 1QIXB 2TGTA 1D3QB 4OS1A 2PGQB 3Q00A 5DJ7A 2SGEE 4ISNA 4CBOA 3VB5A 2PW8H 2WYJA 5J4QA 5FX6A 1AMHA 1MTUA 1YCPM 2ZFSA 3ZVAA 2UUKB 3BG4C 4TPIZ 3O8RA 5AFZH 1KXCA 2VVVA 4XOJA 5LPEA 1PPFE 1HPGA 3UNQA 1K1MA 1PPGE 2BDAA 2F9UA 3GOVB 4A1TA 4JZEH 4Y7AA 2LPRA 5T6DA 1RD3B 2A4OA 2Z9GA 3PMBB 4RKOB 4XFQA 3UR9A 1C1NA 4UFDH 5FXLA 1Y8TA 5C20A 1NU9A 4LOYH 2A4QA 1C1RA 3MI4A 1T4UH 2CN0H 5ABWA 1SLUB 1SGTA 5GPIB 1NRNH 1RFNA 1V2NT 3UNRA 2NU3E 3BN9A 3MH6A 1Z8GA 1JRTA 2O8TA 2CJIA 5LGOA 1HAOH 2B0FA 4AFZA 4D7GA 4O97A 3RXOA 1V2UT 1V2KT 4ZHAA 1IHSH 1Z1JA 4H6SB 3V3MA 3BIUH 1SGDE 4YOJA 1A7SA 1T8MA 1DPOA 5EPNA 4D8NA 2UWOA 1D3DB 4U32A 3A8AA 3RXQA 1EAUA 1OP2A 2J94A 1V2LT 2ZGBH 1GG6B 1CT0E 5CE1A 3E0NB 2VH6A 3VB3A 1UCYE 1AUTC 2ZO3H 4SGAE 3E0PB 1YPMH 3RMOH 1NFYA 1QJ7B 3TJNA 4BANB 1QRXA 2F91A 2J2UA 4YO9A 1WQVH 3TLOA 1QNJA 1GHZA 1GJCB 3LT3A 3LH3A 3QTOH 3FANA 2F83A 3PMJA 4DT7B 1P2KA 1QB9A 3EDXB 2HWLB 4MNXA 3ZYEA 1W0ZU 2FOBA 3UFAA 3CS7A 2Z9KA 4NZQA 3GICB 1C1TA 4KTSA 3SU5A 2G00A 3URCA 1RS0A 2W7SA 5HYOA 3ZZ5A 1O5FH 3UNSA 4B2AA 2Y80A 3SBKA 2PUXB 2AFQB 2D26C 1C5UA 1X7AC 1BMMH 3HK3B 1O3DA 2ALPA 1O3OA 1MCTA 4OS4A 2BY9X 1HIAB 1C2KA 1Z7KA 1GVLA 1QA7A 2F3CE 2F9OA 4LZ4B 1GBBA 3PLPA 1AFEH 1A2CH 1EZSC 1XXDA 3V0XA 1JOUB 1AN1E 3RU4D 5EQSA 1ZTLA 2WUCA 4XDEA 3O8DA 2UUFB 4INLA 3M5OA 2FWWA 3SGQE 1ELTA 2FXRA 1QBNA 2PTCE 1L1GA 1YGCH 3FP7E 1ELBA 3RM0H 1TLDA 3M7QA 1C4V2 1D9IA 1H9LB 1OXGA 1C4U2 3K9XB 3SJKA 1Y5AT 3EAJA 1SFQB 1TOMH 3P8GA 3QWCH 2A4GA 1LKBA 3FP8E 1O33A 3ODFA 4YZUA 4FUEA 3UIRA 4K3JA 1C5WB 5FCRA 2ZA5A 3AW0A 5B6OA 3ZZ4A 2UWPA 3ZVEA 3GCNA 2G52A 3BTFE 3M7UA 4FU8A 1O0DH 1GI0A 2G51A 1C5YB 1G32B 3SU4A 4E05H 4I8KA 2V3HH 1BQYA 2PKAA 2BD5A 4HI3A 4B73A 2PSYA 5EW1H 1GI6A 2VINA 4DJZB 3NCLA 3LONA 2BQ6B 3B23B 1RRKA 5BPEA 1CGIE 1DLEA 4OS6A 2ZI2H 2ALVA 3A7YA 2OQUA 2CMYA 2FO9A 3KHVA 3SNCA 1H4WA 2M5TA 3RLYH 1F5KU 4ABBA 3GISB 3SNDA 1NT1A 3BTQE 2VIWA 1TGBA 1G36A 1E0FD 1RGQA 2FEQH 4BTIB 5A8ZA 1FJSA 1ELAA 3D23A 3S9BA 4O3TA 4UD9H 2VWNA 1OWIA 2ANMH 1QHRB 3BTGE 1DXWA 1H9IE 2JKHA 3NPSA 1ZJKA 1MMJN 3GCTG 3SUEA 1TX8A 4ZXYH 1B7XB 2PWXA 1F92A 1GPZA 1P0SH 1F7ZA 1KXFA 2BQ7B 4MNYA 2QXHA 4K8YA 2KAIA 4OGYA 1TGSZ 3TPIZ 2ZWLH 3M7TA 2GX4A 2D1JA 5DG6A 4I8GA 2VU8E 5BRRE 1NRSH 1NM6A 1QFKH 2OC7A 2ZGXH 1SHHB 2QXGA 3RXAA 2A2XH 1AFQC 1JMOH 1ETTH 1PPZA 4K5ZA 3V13A 2AH4X 1UCYH 3VFEA 1DT2A 1EPTC 3BTTE 3OTJE 1O36A 2Y6TA 5JBBS 2BY6X 3FZDA 1BTPA 1RJXB 5EPYA 1EQ9A 5JBCS 2BLWA 4WMDA 2QGRA 3ZZDA 1BJUA 5C1UA 3MU5A 3A85A 2WPIS 4CHAC 1SOTA 4OGXA 3TH4H 2GMTC 1SLVB 5DP5A 2ZTXA 3A87A 1YM0A 1C9TA 1QURH 2OINA 1QGFA 1LQEA 2BD4A 4NA9H 2ZCKP 3RXLA 1UO6A 4E06H 1P2JA 1QBOA 2J92A 1PQ7A 1TYNA 5TCAA 4XBDA 4X6MA 1O3GA 1GMDG 3ODDA 4Y0ZE 1W8BH 3BF6H 1PFXC 1CSOE 1GHBG 5GDSH 1BTWA 3SV7A 1SGQE 1SGRE 1CA0B 1AFQB 1DUEA 5FBIA 3STJA 1QQUA 4INKA 1GI1A 1O3MA 1Y59T 4FUGA 4FUJA 5GXPA 1MD7A 1TNLA 5C1YA 1ZGIA 4XBCA 4Y71A 3A8CA 4LXBH 3M3TA 2Z94A 1CU1A 3MFJA 1ETSH 2ZHEH 1P9UA 2BYAX 3JZ2B 1EB1H 4X6OA 3LKWA 1TPPA 1ZPBA 3EYDA 2SGDE 1SBWA 1GI9B 1CQQA 2P16A 1W11U 2GCTB 2R2WU 2Q6GA 2K1QA 1FUJA 5A0CA 3U8TH 1LHEH 4Y10E 3MNBA 4CHAB 4X6NA 1L1JA 2GMTB 2QXJA 2ZHQH 2WPLS 3HGNA 1QR3E 2TGDA 4IW4E 4AFSA 4MPXA 1UVOA 2GGVB 4RN6A 3A7WA 1BZXE 1GCDA 1CGJE 3P6ZB 1O5BB 1C9PA 5DP9A 1PQ5A 1DY9A 1UTMA 2ZHWH 2R0KA 2ZFTA 1SOZA 1P09A 2FOAA 2BD7A 1TOCB 1ARCA 1T4VH 1C2HA 1BOQA 1XUJA 1BTHH 3QGJA 3SV2H 3MTYA 4FVBA 1LPKB 1DXPA 2I6QA 5GIBA 5A2MH 4Y11E 1C1UH 1P2QA 1XVMA 3RXEA 3SV6A 1WQSA 4K8BA 4NA8A 4WH8A 4XE4A 4WVPE 3VPKA 1LQDB 2BX4A 3RM2H 1GBKA 2ZDVH 2Y7XA 2Q6DA 1SG8B 2W7UA 1P57B 1MBMA 1TX6A 4FUDA 1E35B 3G01A 1XUGA 1E34B 2R3YA 4JMYA 1UTNA 1UVUH 2AS9A 1NN6A 2ODPA 5EU8A 3ZVFA 1C5QA 4UFEH 1AZ8A 2XCNA 1CT4E 2WV5A 3UWJH 2BQWB 3FFGA 3LC3A 5C5OA 1T31A 1C1OA 3S9AA 4A1XA 5FAHA 2O8WA 3HK6B 2P3TB 4YOIA 3RXHA 1J8AA 3QZQA 2UUYA 2ZU2A 4Q7YA 2SGQE 5DP6A 1LPZB 4YESB 1P3EA 3GY2A 3ZZ9A 8GCHG 1ID5H 1O2MA 1ZRKA 2BY5X 4FU7A 4U2WA 5T6GA 1SGCA 2ZU5A 9LPRA 1MTNB 1QCPA 1V2WT 1F5LA 3A81A 2ZQ1A 3QUMP 1G3BA 2PKSB 3GCHB 9ESTA 1YCPK 4BTUB 1K1JA 1L4ZA 1LKAA 2FM2A 5L2YH 1AD8H 1YPLH 3T62A 2BY7X 2D8WA 5GWZA 4AB8A 4YTAA 1PYTD 3BG8A 3F9EA 2UWLA 1ARBA 2ESTE 3ZZAA 4K69A 2OQ5A 2W3KA 4XBBA 6CHAC 5JBAS 3MO6A 1GMCG 1S5SA 1QJ6B 3AAUA 3RXUA 3KQBA 1KLIH 2C8ZB 4TY6A 2ZIQH 5E8EH 4NWKA 4ZHLU 1ZPZA 2FOGA 4AG2A 4NSYA 1YYY1 1WTGH 2QF0A 3ATIA 2VWOA 4AGKA 2A7JA 1P8VC 2A7CA 3M3VA 1P3CA 4NZLA 4Y8XA 2F9VA 3IG6B 2AIQA 1NO9H 2B5TB 3TK9A 4AB9A 4ZUHA 4A7IB 1EJNA 1GI5A 4X2VA 2FTMA 5AHGH 1O3NA 1AKSB 1IOEA 1SI5H 4B1TA 1FIWA 1VCPA 2VIPA 2XCFA 1EPTA 4CH8B 1BBRK 3MNSA 2H6MA 2ZU1A 3BIVH 3LGTA 4O03A 3MO3A 3M3SA 1F0SA 1XVOA 3TU7H 4DW2U 2FPZA 5DP7A 2XBVA 6CHAB 1ZHMA 3TGKE 1EZXC 4DURA 3Q76A 1SB1H 1J9CH 1TA2A 4JK6A 2G8TA 2ZKSA 3PO1C 1O38A 1Y5BT 3MH7A 2GCHF 1ESBA 4HTCH 2ZDKA 1FY5A 2GV7A 3H7OA 1C1WH 1GL1A 1Y3YA 2Z9JA 3PLKA 2JH6D 2XWAA 2IPHA 3MH5A 1IQKA 2AMPA 1T8LA 1YPGH 3QTVH 1D3TB 3S9CA 2AMQA 2ZZUH 3P17H 3P95A 2ZGJA 1A4WH 2LNCA 1UVPA 1Y3WA 5DPAA 2WV4A 1XUFA 1P2NA 1GMHG 2TRMA 2XTTB 3F6UH 8KME2 3RC6A 2G55A 3F9GA 5E0JA 3SJOA 4B2BA 2ZEBA 4X8SH 1GHVH 1FDPA 1P01A 1ANEA 2VWLA 2F9NA 1TPOA 4FUFA 4IMZA 2WPKS 2GT8A 4WJG2 3PO1B 1KDQA 2A7HA 1TWXB 1O2UA 4Y6DA 3QDZB 4X2WA 2H1UA 1CE5A 1EB2A 2VIQA 3FZZA 5FPTA 3K6ZA 3I78A 1WYKA 3S0NA 1TB6H 2PV9B 1GG6C 1ANCA 1V2OT 1NS3A 3E8LA 4JZDH 2H5DA 2FOHA 2ZFFH 2QF3A 3RXBA 1LO6A 1KY9A 1OX1A 5E2PA 2FTLE 3URDA 2PKAB 3MO9A 1XM1A 3HPTB 1S0RA 3SV9A 1MKXH 4O3UA 2ANYA 1ZSLA 2BD2A 2G4UA 3TJVA 1BTUA 3QLPH 4UEHH 1HAGE 3GY3A 3SU6A 5IYTA 4AN7A 3DT0H 2BD3A 1KXEA 1THPB 2H9TH 1UVSH 1UJ1A 2C4FH 4INHA 2JH0D 4HFPB 2FMJA 2A5KA 3A84A 2C3SA 1ELEE 3KIDU 3U9AH 4Y7BA 4Q7XA 4WMFA 1GCTC 3KCGH 4AYYB 1B0FA 1W0YH 3BV9B 3EA7A 3OY5U 1PYTC 1O2SA 1D3PB 1NESE 3LJJA 4CRAA 2Z7FE 1Z8RA 1AVWA 3QZRA 1SMFE 1GL0E 1HAVA 2FP7B 4KELA 2OP9A 1AWHB 4WH6A 1TABE 1HJ9A 2IN2A 2FS9A 3ATWA 1QL8A 1IHTH 3H7TA 1INCA 1E38B 2HNTC 3SV8A 3MOCA 3ZZ6A 1GJ9B 3UOUA 3M36A 3U8OH 1UHBB 2BXTH 3E91A 3ITIA 3T28A 2GZ9A 1WTHD 3SU3A 5AVDA 1ZOMA 2AERH 4IN1A 5FPSA 3E3TA 1NFXA 3RXMA 3RXCA 4MNWA 1YP9A 1DSUA 1ZSKA 5F03A 1GJ5H 1FV9A 4K2YA 2NU1E 1ZMJA 4BAQB 3F1SB 4H4FA 1BBRE 1V2JT 1IQFA 2ZGCA 2FX6A 3MU8A 3RXVA 2AGIX 1GCTB 4NIWA 1DUAA 3MHWU 1TNKA 1GBHA 3SU2A 1THRH 4BOHA 1UK3A 5CHAB 2OBOA 2ASUB 1MTWA 3EQ0H 3A7TA 1GBTA 4B74A 3TNSA 1TNGA 4K1SA 4A5TS 2ZPRA 4MPUA 1BTYA 1HDTH 2ZDMA 3GY7A 4J2YB 4QT8C 3QN7A 4ABAA 3GY4A 4ESTE 1EJAA 5G4BA 3ZV9A 1WCZA 1BMLA 1CO7E 4YM9A 1ZLRA 1KIGH 4D76A 2H2ZA 5F8TA 3KN2A 2C8WB 1O3JA 2ODQA 1J16A 1TX7A 2J34A 1BTXA 4GAWA 3LU9B 3UWIA 3I77A 1YPHC 1ANDA 1OWKA 2OD3B 1XMNB 4IN2A 3ZVCA 2BOKA 3TGJE 4ZXXH 3UQVA 1FPHH 1HGTH 1F0UA 4RKJB 4GUXA 1UTPA 2HPPH 1EJMA 1MTSA 1MH0A 1XKBC 1F0RA 1CHOF 1HLTH 1HV7A 3NWUA 2XC4A 5I46H 2ZCHP 1MU8B 3MYWA 6GCHG 2AMDA 4MPWA 1C5LH 1KSNA 1O5CB 4NA7A 1J17T 1FI8A 1V2PT 1P04A 1JIMA 1SR5C 2EI8A 2J95A 4YOGA 2STBE 2VJ1A 4AOQA 1K2I1 4BNRA 5F6MA 2C8XB 3HKIB 2QV1A 2Z9IA 3RU4T 4XSKU 4ZKOU 1AVGH 1OP0A 1J14A 3D65E 1GBEA 2Z6BD 3OX7U 1C4Y2 3KNXA 1Y5UT 2Q6FA 1O2LA 2ZTZA 1AU8A 3LIWA 4CRFA 2GKVE 7ESTE 5C2ZA 1ANBA 1O5AB 2RCEA 2ZTYA 1EZUC 2ULLA 3U1IB 3UY9A 1FN6A 3SI4H 3HKJB 3KQDA 3O8BA 1O2WA 1WV7H 2GP9B 2PFEA 1DLKB 4OS7A 6ESTA
chains in the Genus database with same CATH superfamily
4AORA 5DP8A 1SGFA 1PJPA 1C2LA 3BEIB 1EASA 3A89A 2O8MA 2PGBB 1UK4A 2BY8X 1C2EA 2EA3A 2CGAA 2IJOB 1DFPA 3PYHA 1OKXA 1MBQA 5EJLA 1YCPH 1P2MA 1ZHPA 3VEQB 4ABGA 4A92A 4CRGA 4YXWD 3A86A 1OOKB 1SGIB 2ZFQH 1HFDA 2ZNKH 3ZIAD 2WHXA 3QO6A 4XD7D 3PMAB 2A5IA 1M9UA 2OBQA 3A7XA 3SQHE 3ZZ7A 2ZU3A 3GCOA 1JBUH 1O2VA 1AB9C 3P8OA 1PPHE 4M7GA 3PB1E 3SHAH 2VVCA 3F2HA 4UFGH 4UDWH 2BDBA 4TWWA 2A1DB 2HALA 3NRLA 3UAIC 1CA0C 4X8UH 4THNH 1MAYA 3RXIA 3OYPA 1GI4A 2TGAA 2WPHS 5A09A 2GDEH 1O5EH 2IPQX 3IWMA 4CH2B 1JXPA 1YWUA 3RXJA 5L2ZH 1VJAU 4HGCA 1O2YA 3AW1A 4ZHMU 1NU7B 1GDQA 4LK4A 4B2CA 3V12A 5AF9H 3HGPA 1C2GA 2GTBA 4HZHA 1WOFA 1GBFA 4ZMAH 2C90B 2P3FH 3RLWH 2GCTC 1LVOA 1YLCA 4Z6AH 2XWBI 1V2ST 4O9VA 1G37A 1SQTA 1ZZZA 2CF8H 2XOKD 1BBRH 4WXIA 5EXMA 4IGDA 1TMUH 3KQCA 4DIIH 4ABJA 1HIAA 1K1IA 1B0EA 1TQ0B 4H6TA 2BB4A 2OXSA 1NRQH 1J15A 1AB9B 2FLRH 3I29A 4IC6A 4LZ1H 4U30A 4E7NA 1AQ7A 4MTBA 3ENSB 4X8VH 1C5ZB 1TAWA 1S6FA 1DS2E 1GHXH 5EXNA 2EI7A 1JIRA 2GDDA 1EKBB 1HYLA 1H9HE 2FOEA 2Z9LA 3SHCH 1NY22 3F3BA 5GCHG 3SW2B 2QCYA 2CK3D 1XUKA 4X2XA 3DHKH 2FI5E 3TK5A 3BTHE 5ETXA 1DWCH 1LCYA 3M37A 1ZTJA 4B6EA 3SGAE 2PHBA 4RSPA 2YOLA 3SQEE 1IQGA 1SLWB 2P59A 3PLBA 4WMEA 3O8CA 2GCHG 4VGCC 1HAXB 3ZVGA 1TRMA 1EXFA 1RIWB 2Q1JA 1GDNA 3Q3XA 4MLFB 5DP4A 3PRDA 1YBWA 2BXUH 3A7ZA 3WY8A 1FPCH 3A88A 4CRCA 1P2IA 2ZDNA 3LOXA 3EA9A 7GCHG 5EODA 1N8OC 2XYAA 1GHAG 5F8ZA 4X0WU 2ZU4A 1JWTA 2VWMA 4YLQH 5FPYA 4Q80A 3VXEH 3U69H 3DA9B 1O3BA 2Z3EA 1TPAE 1BRBE 1ZPCA 4D9QA 5JB9S 3VB6A 4GCHG 4NIVA 1BCUH 1K1NA 1MTNC 3R0FA 1SC8U 1XKAC 2HNTF 1O2HA 5DO4H 1AZZA 1K28D 2AGGX 4WXVA 4PROA 3ZZCA 2WPMS 5CHBA 2PKSC 3GCHC 2P3UB 1MZAA 3FP6E 7LPRA 2Z3DA 1O32A 1O2JA 4DY7B 2VH0A 3L33A 3LGYA 2W26A 1NZQH 1BB0B 1CVWH 1WBGB 2AIPA 1OWJA 1O2NA 1VITF 3VB4A 1ZRBA 1AGJA 2FLBH 2FS8A 2DE8A 3A80A 3PV4A 4SGBE 2I6SA 3GY8A 4FUHA 4VGCB 1DSTA 1GJDB 3QX5H 1C2IA 1YF4A 4M9FA 3VXFH 3A83A 1BDAA 1HXFH 3W95A 1TRYA 1FAKH 3UR9A 5A8XA 1UTKA 1WDIA 1KDQB 2VB0A 4MPVA 4CBNA 3FAOA 4DT4A 1SGYE 4WY3A 1O3LA 1W14U 2O9QA 1N8OB 2QY0B 3EGKH 3UOPA 1O39A 1C5MD 2HLCA 1P03A 3A8BA 1XUIA 2R9PA 1AY6H 5JDUB 1LDTT 1FIZA 1QZ8A 2KZ4A 2VIDA 1IQEA 2J38A 3RUOA 1FLEE 5HXFA 1LHCH 2R3UA 1L2EA 4GSOA 2QF5A 1KXBA 3ATLA 4J1YA 1TGNA 5E2OA 1L1NA 3ZVDA 3MWIU 3H5CB 1K9OE 2OCVB 3LGIA 3W1EA 2HGTH 3IITA 2PUQH 3MNCA 2OUAA 1MAXA 5C3NA 5HM9A 5FBEA 1QA0A 1G30B 1P11E 4Q63A 3SJ8A 4ACBA 1HAZB 1RTLA 4B71A 1GJ4H 2KCYA 1BT7A 4X1RU 1TIOA 1O3PB 1YKTA 3B8JA 1BA8B 1HB0B 1W7GH 2P93A 4NIXA 1IQJA 5T6FA 3FOAA 3PWBA 2BTCE 1K22H 1GVZA 1TFXA 2P95A 4CRBA 1CA8B 2WUBA 2EC9H 4BAHB 1HAVB 1O2OA 4OS5A 2WSSD 2V0BA 3EA8A 2CV3A 3PTNA 2YMSD 3T25A 1ELDE 4ZKSU 3RXTA 4ABDA 3OSYA 3BTEE 2RDLA 1GBMA 1C2MA 4JYTA 3RC5A 4ZROA 1QQ4A 3RU4E 4ZKRU 3BTME 1IAUA 3L3TA 2BVSH 5SGAE 2W6JD 3LH1A 1ZYOA 2V7QD 1H8DH 2FIRH 2XBXA 3TJUA 1GMDF 1S81A 4F49A 2KCOA 3GY6A 1WAYB 1GHBF 3RXKA 4I7YH 3SUDA 3T5FH 4FUIA 2UUJB 2R2MB 3SN8A 4AYVB 5JB8S 1S84A 2WZQA 3DSOA 4X2YA 1MUEB 1DWDH 3SNBA 1T8OA 2SNVA 1D6WA 2IOTA 1YLNA 4TWYA 4JK5A 1ZSJA 1THSH 1C2DA 4UONA 2PTNA 3A8DA 4IC5A 1DY8A 4TT3D 3KQ5A 2TGPZ 1SGNE 1G2LA 3UB0A 1GBLA 1Z6JH 2HVXA 1CHGA 2J98B 2KX4A 4P02A 1DM4B 4Y0YE 4DG4A 1NTPA 1VCQA 1P9SA 2EY4C 3EE7A 3F0PA 1DOJA 2JIZD 5DGJA 3B9FH 1CHOG 1V6DA 2OTVA 2SGFE 1K1OA 3K2UA 2BM2A 4A1VA 1UTOA 4MQAA 1SLXB 1GJ6A 4UFFH 1LVBA 4NFEA 2QXIA 1FQ3A 1DX5M 3VB7A 4TYDA 1MU6B 2DE9A 2SGPE 1O2TA 1WXRA 5JBTA 1G9IE 4I32A 1K1PA 2D2DA 1GHWH 2F43B 3PROA 1PPBH 3SYJA 2RA3A 5KECA 4IS5A 2FESH 5JYIA 1RTFB 3N7OA 4BAMB 3PWCA 4NFFA 3U1JB 1GHYH 1GBDA 2EI6A 2J97A 2VNTA 3T26A 3VGCC 1GJAB 1BRAA 3OAAD 1L4DA 1FZZA 1CGHA 1WUNH 1A3EH 3QGNB 3UQOA 1HAHH 3SZNA 2LP6A 3MQKC 3TH3H 1DDJA 5EQQA 4H42U 2HLDD 4YT6H 2G5VA 3M5MA 1AE8H 1D6RA 2BMGB 3FKSD 3SU0A 2Y7ZA 2VGCB 4YT7H 1H8IH 3Q3YA 1MKWK 2ANKH 4I8JA 5AFYH 2KFWA 2BLVA 1ELVA 1B5GH 2O8UA 5EW2H 3ZZ8A 1W7XH 5TJXA 1E1RD 1VR1H 1O3KA 1O2ZA 2GVFA 3S69A 2FODA 1TONA 2ILNA 1FY3A 2B8OH 3GDUA 1SPJA 5C1XA 3LGUA 2BZAA 1V3XA 8GCHF 4BXWA 5CHAC 2G5NA 2BZ6H 3OTPA 2XC5A 3AAVA 1OYQA 2ZGHA 1EOLA 2JETC 3PM3A 2CHAC 2RG3A 2P94A 1MTVA 2IJD1 3RMMH 3K6YA 5GJ4B 3VGCB 4GPGA 2BDGA 1FAXA 5F8XA 1MABB 1Z8JB 2J4IA 1S82A 1LMWB 2QAAA 1NROH 1O3EA 3ELAH 1P06A 2ZHFH 2ODYB 1FY8E 1VGCC 2KAIB 5A0AE 3P8NA 1GMCF 1ZR0A 4MDSA 1SGPE 3E1XB 3RMLH 2TPIZ 3GS9A 1Q3XA 1ZMNA 1QJ1B 3BG4B 1AO5A 3CS0A 5DK1A 1F5RA 3K65B 1EP6A 2GD4B 5B6LA 1O2IA 1SGFG 3OE7D 3NK8A 3SU1A 4F4OC 4ISHH 1AKSA 4ZH8A 2SNWA 2STAE 3BSQA 1C1QA 1U6QA 4GHQA 2BDCA 5C94A 1O31A 1LHGH 2XBWA 4X8TH 3SOSA 4ABEA 1C5NH 1H1BA 3STIA 1JRSA 1GBJA 1HAYB 1VJ9U 2JETB 2CHAB 5FHTA 1F0TA 1V2QT 1UMAH 1KXDA 3MU0A 1NBME 1EZQA 2F4LA 1V2RT 1O2RA 8LPRA 3SJIA 1AI8H 3QK1A 2FI4E 3ZVBA 3SUGA 1NRRH 2ZF0H 5J4SA 4KP0A 3M61U 5PTPA 1BIOA 3RXSA 1BJVA 5TCCA 1VGCB 2OK5A 1A0JA 2NWNA 1A1RA 1A5GH 1S0QA 1S85A 1UK2A 1SFIA 1FY4A 1DWEH 3RP2A 2H9HA 1TGTA 1A46H 3FVFB 4ABHA 1TRNA 4GHTA 1ELFA 3RDZA 3FN8A 1AVXA 5LPRA 2A0QB 2FX4A 2Y5FA 3GYMA 4ISLA 3UUZA 1YY3A 1SHYA 1V2MT 2FOCA 5EXLA 3TGIE 5C5NA 1Y3XA 1TPSA 1V2VT 3ATKA 4Y79A 3RXRA 1BRCE 1S83A 1O35A 1W3CA 2J5UA 3A7VA 1GVKB 1XX9A 1W13U 1UTLM 3RMNH 4FU9A 3PMHB 1O3HA 4ASUD 5EIYA 4R8TB 2ZC9H 1EAWA 1HNEE 1GMHF 1HCGA 1HAIH 4BXSA 2AYWA 3E16B 4JZ1A 1PPEE 2QYIA 1FY1A 3SJ9A 1QY6A 2BOHB 1TNIA 2HOBA 2BVRH 1Y3VA 1K1LA 3GDVA 3Q77A 4NCYA 1C5OH 3D62A 2FOFA 1GBAA 1C2JA 4AC9A 1C2FA 1VCWA 1T8NA 1GBCA 4BAKB 2ZHDA 1GDUA 4KTCA 4NG9H 1MQ5A 4ZCNA 2BD9A 1TGCA 1LTOA 1DANH 2AHME 1ESTA 3DUXH 2OC1A 3U98H 1A5HA 1ZTKA 1P12E 4GLYA 2ZFRH 5C67A 1BITA 2A31A 2B7DH 3SO3A 1C1PA 1FX0B 2VIOA 1XXFA 1EX3A 2K0QA 3DFLA 1LPGB 1VITG 3TNTA 1ELGA 1Z71A 5I25A 7KMEH 2PSXA 1IQMA 2Y5HA 3CP7A 3AVZA 4FVDA 1GJBB 3BTDE 1ZJDA 3OU0A 4Y76A 1G2MA 1E37B 2A32A 5EOKA 1RXPA 5FX5A 4YLUA 4Q7ZA 3RXFA 4B76A 1NFWA 2BX3A 5LPFA 1O2XA 1ABJH 3TH2H 3BTKE 4MG3A 1Q31A 1QB1A 3GDSA 1O5GH 4R0IA 1FN8A 2H5CA 2TIOA 2ZDLA 1V2TT 1ZHRA 4FXGH 5JPMH 3JZ1B 2JJ1D 3RXGA 2F9BH 1QRZA 2DUCA 1MQ6A 2BDYA 2VIVA 3TJOA 4U01A 1C5SA 2FDAA 2HNTE 3GYLB 4Y8YA 1HAPH 1ETRH 3MH4A 2BD8A 5DP3A 3C1KA 1Z6EA 3KEEA 3LPRA 3FO8D 2BLQA 1P02A 1TBRH 1LHDH 1MKXK 1UHBA 2W5EA 2JH5D 3BEUA 3T29A 5HIYA 3P92A 4WWYA 3D49H 4ISIH 1TA6A 5EG4A 2GZ7A 1DVAH 4X6PA 2ZP0H 4NGAH 1KLTA 1TALA 3P70B 1MD8A 1UTJA 1IQNA 2WYGA 2XC0A 3E6PH 1SL3A 3MNXA 1O3IA 1G3CA 3RXDA 2QC2A 1BMAA 2Y81A 1BRUP 1L0ZA 4AFUA 3DD2H 5K7RA 2G81E 1P05A 1RIWC 1E1QD 4BAOB 2CXVA 3KGPA 1E36B 3NUMA 2XW9A 5E0HA 1OWHA 1GJ8B 3A82A 1OSSA 3L6PA 1SQOA 4KKDA 4DOQA 4NSVA 1GI2A 1C5VA 1IQLA 2NU2E 1GWAA 2V6NA 3SORA 1CT2E 1FMGA 4IBLH 5A8YA 1C1VH 2WPJS 1A5IA 3DSGA 5HMAA 1EATA 3BEFB 1YPHE 2VVUA 2NU4E 2A45B 1N6XA 3U8RH 3RXPA 3P8FA 1NRPH 4OM9A 4Q2KA 4JYVH 3UPEA 2YNAA 1QL7A 4GVUA 4K60A 5T3HA 3SUFA 1PQ8A 2HPQH 1QBVH 1MCVA 5HGGA 4TPYA 3TVJB 1Z1IA 1EPTB 3TK6A 3BTWE 2PR3A 1BHXB 2BLOA 1LVYA 1W12U 4UE7H 5ESBA 2XXLA 2SGAA 3T27A 1KYNA 1WSSH 1MZDA 1FONA 5EGMA 3V7TA 1OPHB 3ZV8A 3F9HA 4MNVA 1GI8B 1IQIA 1TE0A 2W3IA 4X1SU 2OC8A 1AHTH 1UTQA 2OC0A 6GCHF 2QIQA 4A6LA 4Y8ZA 3ESTA 5EQRA 3HATH 1C5XB 3SNAA 1O3FA 3TIUA 4ABIA 3E90B 4JZIA 4WF8A 1A0LA 1F2SE 2OLGA 4JCNA 3OEED 4F48B 1PQAA 3H09A 3MU1A 1AUJA 1GGDC 2R0LA 1O3CA 1P10A 2GZ8A 1QL9A 1TMTH 1ZGVA 3ATMA 1ELCA 2P8OC 1O2PA 1TBQH 5A0BA 2TBSA 3C27B 1EAIA 1MKWH 1VZQH 1XUHA 1N1LA 4NWLA 1AIXH 4AZ2B 1DICA 1A0HB 1FNIA 4AFQA 1QB6A 1TBZH 4DCDA 1TQ7B 1K21H 1EUFA 1WU1A 2A5AA 2XNDD 3KF2A 4K1TA 1NFUA 1W10U 2BHGA 1SSXA 1O2GH 3TITA 3SGBE 1PPCE 1CBWC 1OWEA 2A4RA 4I31A 3KQEA 6LPRA 1NPMA 1O2KA 2A2QH 1KTTB 1YPJH 4MVNA 2J9NA 2QN5T 4JYUH 3GCTF 2XNIA 2CF9H 2C93B 1DWBH 2AGEX 2ZQ2A 1HBTH 3UR6A 3NKKA 1P2OA 5HM2A 4Z0KA 1GGDB 1W2KH 1SVPA 1Y3UA 1T32A 1BUIA 1A61H 2P8OB 1IQHA 5E0GA 4ZAEA 1O34A 3UREA 4B75A 1OS8A 1GI3A 1N6YA 1EOJA 3LC5A 2FYQA 3NXPA 1HJ8A 3M5NA 1YC0A 4X1PU 5GNDA 3MMGA 1AWFH 1VITH 2HVYB 1LVMA 4DIHH 2AEIH 1GI7B 1O37A 1YPEH 2HRVA 3S7HB 2LELA 1ACBE 1GBIA 1CBWB 1S6LA 4X1NU 4Z1MD 1G3DA 5FCKA 4KTUA 1BMNH 1Q2WA 2QA9E 1TNHA 3Q3KA 1UVTH 1TNJA 3LDXH 3GY5A 4K1EA 3LJOA 2PP6A 1C5TA 4I8LA 1ORFA 3UTUH 2GT7A 2Z3CA 2G4TA 1OP8A 3CNRA 2Y82A 4BTTB 1TMBH 5T1VA 3S7KB 1HUTH 1UCYK 5LH8A 2ZECA 1HXEH 4XRNA 2ZPSA 4JZFH 4AGJA 1ZMLA 3T2NA 2ZDAH 1OWDA 1HJAC 2ZPQA 4TY7A 1YLDA 2B9LA 2SFAA 4AG1A 1SGEE 1RTKA 2F9PA 5DKMA 1KTSB 1D4PB 4CRDA 3AASA 2BDHA 1O30A 1OYTH 3ZZ3A 5K0HA 4FOUC 5H4IB 3PTBA 1C1MA 2ZCLP 5GCHF 2V35A 2Y5GA 4NIYA 2EEKA 1G3EA 1QRWA 1GJ7B 3M35A 4X1QU 2H9EH 3KL6A 3CENA 4I33A 1KXAA 3SNEA 3LGWA 4D7FA 4DGJA 4D9RA 4OS2A 1O5DH 4ASHA 2GV6A 3M5LA 1O3AA 2KR7A 2XRCA 1AE5A 4ZKNU 3NZIA 3LGVA 2YNBA 5L30H 2VGCC 2C8YB 4CREA 2THFB 2PLXA 4CR5A 4AX9H 4CR9A 2ZG0H 1ABIH 2BDIA 1BTZA 1C5PA 1C5RA 1HJAB 1QTFA 3DSPA 3RC4A 1LHFH 4RT1A 3WWFA 2FYRA 1DE7H 2O8LA 4FUCA 1NC6A 8ESTE 3DFJA 2ANWA 1HRTH 2NU0E 7GCHF 2BVXH 1GHAF 3R3GB 3SI3H 2FZZA 3EE0B 1A3BH 3ZZBA 1ESAA 1FXYA 1EAXA 3W94A 1SQAA 5IDKA 5L6NH 4GCHF 2FI3E 1C1SA 2KM0A 2ZFPH 4FUBA 4ABFA 3ZYDA 4DVAU 1YPKH 2RA0A 2V3OH 2WINI 3AK5A 3F9FA 1O2QA 1T7CA 4ISOA 4E7RG 4KGAA 2XBYA 5HKKD 5ESTE 1KLJH 2M2AA 5CMXH 1DITH 1EP5A 1BHXF 1S6HA 1Z8IB 3F68H 4IMQA 3OY6U 3N99A 4I8HA 3MU4A 2FOMB 1QIXB 2TGTA 1D3QB 4OS1A 2QF4A 2PGQB 3Q00A 5DJ7A 2SGEE 4ISNA 4CBOA 3VB5A 2PW8H 2WYJA 5J4QA 5FX6A 1AMHA 1MTUA 1YCPM 2ZFSA 3ZVAA 2UUKB 3BG4C 4TPIZ 3O8RA 5AFZH 5C0UA 1KXCA 2VVVA 4XOJA 5LPEA 1PPFE 1HPGA 3UNQA 1K1MA 1PPGE 2BDAA 2F9UA 3GOVB 4A1TA 4JZEH 4Y7AA 3F2GA 2LPRA 5T6DA 1RD3B 2A4OA 2Z9GA 3N7DA 3PMBB 4RKOB 4XFQA 1C1NA 4UFDH 5FXLA 1Y8TA 5C20A 1NU9A 4LOYH 2A4QA 1C1RA 3MI4A 1T4UH 2CN0H 5ABWA 1SLUB 1SGTA 5GPIB 1NRNH 1RFNA 1V2NT 3UNRA 2NU3E 3BN9A 3MH6A 1Z8GA 1JRTA 2O8TA 2CJIA 5LGOA 1HAOH 2B0FA 4AFZA 4D7GA 4O97A 3RXOA 1V2UT 1V2KT 4ZHAA 1IHSH 1Z1JA 4H6SB 3V3MA 3BIUH 2WV9A 1SGDE 4YOJA 1A7SA 1T8MA 1DPOA 5EPNA 4D8NA 2UWOA 1D3DB 4U32A 3A8AA 3RXQA 1EAUA 1OP2A 2J94A 2GJGA 1V2LT 3WWBA 2ZGBH 1GG6B 1CT0E 5CE1A 3E0NB 2VH6A 3VB3A 1UCYE 1AUTC 2ZO3H 4SGAE 3E0PB 1YPMH 3RMOH 1NFYA 1QJ7B 3TJNA 4BANB 1QRXA 2F91A 2J2UA 4YO9A 1WQVH 3TLOA 1QNJA 1GHZA 1GJCB 3LT3A 3LH3A 3QTOH 3FANA 2F83A 3PMJA 4DT7B 1P2KA 1QB9A 3VG8A 3EDXB 2HWLB 4MNXA 3ZYEA 1W0ZU 1COWD 2FOBA 3UFAA 3CS7A 2Z9KA 4NZQA 3GICB 1C1TA 4KTSA 3SU5A 2G00A 3URCA 1RS0A 2W7SA 5HYOA 3ZZ5A 1O5FH 3UNSA 4B2AA 2Y80A 3SBKA 2PUXB 2AFQB 2D26C 1C5UA 1X7AC 1BMMH 3HK3B 1O3DA 2ALPA 1O3OA 1MCTA 4OS4A 2BY9X 1HIAB 1C2KA 1Z7KA 1GVLA 1QA7A 2F3CE 2F9OA 4LZ4B 1GBBA 3PLPA 1AFEH 2J98A 1A2CH 1EZSC 1XXDA 3V0XA 1JOUB 1AN1E 3RU4D 4TSFD 5EQSA 1ZTLA 2WUCA 4XDEA 3O8DA 2W6ID 2UUFB 4INLA 3M5OA 2FWWA 3F2FA 3SGQE 1ELTA 2FXRA 1QBNA 3KYFA 2PTCE 1L1GA 1YGCH 3FP7E 1ELBA 5CDFE 3RM0H 1TLDA 3M7QA 1C4V2 3OEHD 1D9IA 1H9LB 1OXGA 1C4U2 3K9XB 3SJKA 1Y5AT 3EAJA 1SFQB 1TOMH 3P8GA 3QWCH 2A4GA 1LKBA 3FP8E 1O33A 3ODFA 4YZUA 5KGOA 4FUEA 3UIRA 4K3JA 1C5WB 5FCRA 2ZA5A 3AW0A 5B6OA 3ZZ4A 2UWPA 3ZVEA 3GCNA 2G52A 3BTFE 3M7UA 4FU8A 1O0DH 1GI0A 2G51A 1C5YB 1G32B 1H8HD 3SU4A 4E05H 4I8KA 2V3HH 1BQYA 2PKAA 2BD5A 4HI3A 4B73A 2PSYA 5EW1H 1GI6A 2VINA 4DJZB 3NCLA 1H8ED 3LONA 2BQ6B 3B23B 1RRKA 5BPEA 1CGIE 1DLEA 4OS6A 2ZI2H 2ALVA 3A7YA 2OQUA 2CMYA 2FO9A 3KHVA 3SNCA 1H4WA 2M5TA 3RLYH 1F5KU 4ABBA 3GISB 3SNDA 1NT1A 3BTQE 2VIWA 1TGBA 1G36A 1E0FD 1RGQA 2FEQH 4BTIB 5A8ZA 1FJSA 1ELAA 3D23A 3S9BA 4O3TA 4UD9H 2VWNA 1OWIA 2ANMH 1QHRB 3BTGE 1BMFD 1H9IE 2JKHA 3NPSA 1ZJKA 1DXWA 1MMJN 3GCTG 3SUEA 1TX8A 4ZXYH 1B7XB 5DN6D 2PWXA 1F92A 1GPZA 1P0SH 1F7ZA 1KXFA 2BQ7B 4MNYA 2QXHA 4K8YA 2KAIA 4OGYA 1TGSZ 3TPIZ 2ZWLH 3M7TA 2GX4A 2D1JA 5DG6A 4I8GA 2VU8E 5BRRE 1NRSH 1NM6A 1QFKH 2OC7A 2ZGXH 1SHHB 2QXGA 3RXAA 2A2XH 1AFQC 1JMOH 1ETTH 1PPZA 4K5ZA 3V13A 2AH4X 1UCYH 3VFEA 1DT2A 1EPTC 3BTTE 3OTJE 1O36A 2Y6TA 5JBBS 2BY6X 3FZDA 1BTPA 1RJXB 5EPYA 1EQ9A 5JBCS 2BLWA 4WMDA 2QGRA 3ZZDA 1BJUA 5C1UA 3MU5A 3A85A 4FETA 2WPIS 4CHAC 1SOTA 4OGXA 3TH4H 2GMTC 1SLVB 5DP5A 2ZTXA 3A87A 1YM0A 1C9TA 1QURH 2OINA 1QGFA 1LQEA 2BD4A 4NA9H 2ZCKP 3RXLA 1UO6A 2JDID 4E06H 1P2JA 1QBOA 2J92A 1PQ7A 1TYNA 5TCAA 4XBDA 4X6MA 1O3GA 1GMDG 3ODDA 4Y0ZE 1W8BH 3BF6H 1PFXC 1CSOE 1GHBG 5GDSH 1BTWA 3SV7A 1SGQE 1SGRE 1CA0B 1AFQB 1DUEA 5FBIA 3STJA 1QQUA 4INKA 1GI1A 1O3MA 1Y59T 4FUGA 4FUJA 5GXPA 1MD7A 1TNLA 5C1YA 1ZGIA 4XBCA 4Y71A 3A8CA 4LXBH 3M3TA 2Z94A 1CU1A 3MFJA 1ETSH 2ZHEH 1P9UA 2BYAX 3JZ2B 1EB1H 4X6OA 1NBMD 3LKWA 1TPPA 1ZPBA 3EYDA 2SGDE 1SBWA 1GI9B 1CQQA 2P16A 1W11U 2GCTB 2R2WU 2Q6GA 2K1QA 1FUJA 5A0CA 3U8TH 1LHEH 4Y10E 3MNBA 4CHAB 3N7EA 4X6NA 5FL7D 1L1JA 2GMTB 2QXJA 2ZHQH 2WPLS 3HGNA 1QR3E 2TGDA 4IW4E 4AFSA 4MPXA 1UVOA 2GGVB 4RN6A 3A7WA 1BZXE 1GCDA 1CGJE 3P6ZB 1O5BB 1C9PA 5DP9A 1PQ5A 1DY9A 1UTMA 3U28C 2ZHWH 2R0KA 2ZFTA 1SOZA 1P09A 2FOAA 2BD7A 1TOCB 1ARCA 1T4VH 1C2HA 5EJ1A 1BOQA 1XUJA 1BTHH 3QGJA 3SV2H 3MTYA 4FVBA 1LPKB 1DXPA 2I6QA 5IK2D 5GIBA 5A2MH 4Y11E 1C1UH 1P2QA 1XVMA 3RXEA 3SV6A 1WQSA 4K8BA 4NA8A 4WH8A 4XE4A 4WVPE 3VPKA 3F0OA 1LQDB 2BX4A 3RM2H 1GBKA 2ZDVH 2Y7XA 2Q6DA 1SG8B 3KYGA 2W7UA 1P57B 1MBMA 1TX6A 4FUDA 3DCLA 1E35B 3G01A 1XUGA 1E34B 2R3YA 4JMYA 1UTNA 1UVUH 2AS9A 1NN6A 2ODPA 5EU8A 3ZVFA 1C5QA 5DSFA 4UFEH 1AZ8A 2XCNA 1CT4E 2WV5A 3UWJH 2BQWB 3FFGA 3LC3A 5C5OA 1T31A 1C1OA 3S9AA 4A1XA 5FAHA 2O8WA 3HK6B 2P3TB 4YOIA 3RXHA 1J8AA 3QZQA 2UUYA 2ZU2A 4Q7YA 2SGQE 5DP6A 2JJ2D 1LPZB 4YESB 1P3EA 3GY2A 3ZZ9A 8GCHG 1ID5H 1O2MA 1ZRKA 2BY5X 4FU7A 4U2WA 5T6GA 3PRBA 1SGCA 2ZU5A 9LPRA 1MTNB 1QCPA 1V2WT 1F5LA 3A81A 2ZQ1A 3QUMP 1G3BA 3WW7A 2PKSB 3GCHB 9ESTA 2VBCA 1YCPK 4BTUB 1K1JA 1L4ZA 1LKAA 2FM2A 2WPDD 5L2YH 1AD8H 1YPLH 3T62A 2BY7X 2D8WA 5GWZA 1W0JD 4AB8A 4YTAA 1PYTD 3BG8A 3F9EA 2UWLA 1ARBA 2ESTE 3ZZAA 4K69A 2OQ5A 2W3KA 4XBBA 6CHAC 5JBAS 3MO6A 2V3MA 1GMCG 1S5SA 1QJ6B 2EQNA 3AAUA 3RXUA 3KQBA 1KLIH 1K0HA 2C8ZB 4TY6A 2ZIQH 2KCAA 5E8EH 4NWKA 4ZHLU 1ZPZA 2FOGA 4AG2A 4NSYA 1YYY1 1WTGH 2QF0A 3ATIA 2VWOA 4AGKA 2A7JA 1P8VC 2A7CA 3M3VA 1P3CA 4NZLA 4Y8XA 2F9VA 3IG6B 2AIQA 1NO9H 2B5TB 3TK9A 4AB9A 4ZUHA 4A7IB 1EJNA 1GI5A 4X2VA 2FTMA 5AHGH 1O3NA 1AKSB 1IOEA 1SI5H 4B1TA 1FIWA 1VCPA 2VIPA 2XCFA 1EPTA 4CH8B 1BBRK 3MNSA 2H6MA 2ZU1A 3BIVH 3LGTA 4O03A 3MO3A 3SZEA 3M3SA 1F0SA 1XVOA 3TU7H 4DW2U 2FPZA 5DP7A 2XBVA 6CHAB 1ZHMA 3TGKE 1EZXC 4DURA 3Q76A 1SB1H 1J9CH 1TA2A 4RI0A 4JK6A 2G8TA 2ZKSA 3PO1C 1O38A 1Y5BT 3MH7A 2GCHF 4RT0A 1ESBA 4HTCH 2ZDKA 1FY5A 2GV7A 3H7OA 1C1WH 1GL1A 1Y3YA 2Z9JA 3PLKA 2JH6D 2XWAA 2IPHA 3MH5A 1IQKA 1W0KD 2AMPA 1T8LA 1YPGH 3QTVH 1D3TB 3S9CA 2AMQA 2ZZUH 3P17H 3P95A 4I86A 2ZGJA 1A4WH 2LNCA 1UVPA 1Y3WA 5DPAA 2WV4A 1XUFA 1P2NA 1GMHG 2TRMA 2XTTB 3F6UH 8KME2 3RC6A 2G55A 3F9GA 5E0JA 3SJOA 4B2BA 2ZEBA 4X8SH 1GHVH 1FDPA 1P01A 4B6FA 1ANEA 2VWLA 2F9NA 1TPOA 4FUFA 4IMZA 2WPKS 2GT8A 4WJG2 1EFRD 3PO1B 1KDQA 2A7HA 2K8IA 1TWXB 1O2UA 4Y6DA 3QDZB 4X2WA 2H1UA 1CE5A 1EB2A 2VIQA 3FZZA 5FPTA 3K6ZA 3I78A 1WYKA 3S0NA 1TB6H 2PV9B 1GG6C 1ANCA 1V2OT 1NS3A 3E8LA 4JZDH 2H5DA 2FOHA 2ZFFH 2QF3A 3RXBA 1LO6A 1KY9A 1OX1A 5E2PA 5C17A 2FTLE 3URDA 2PKAB 2RFKC 3MO9A 1XM1A 2QE7D 3HPTB 1S0RA 3SV9A 1MKXH 4O3UA 2ANYA 1ZSLA 2BD2A 2G4UA 3TJVA 1BTUA 3QLPH 4UEHH 1HAGE 2L74A 3GY3A 3SU6A 5IYTA 4AN7A 3DT0H 2BD3A 2H9TH 1KXEA 1THPB 1UVSH 1UJ1A 2C4FH 1KMHB 4INHA 2JH0D 4HFPB 2FMJA 2A5KA 3A84A 2C3SA 1ELEE 3KIDU 3U9AH 4Y7BA 4Q7XA 4WMFA 1GCTC 3KCGH 4AYYB 1B0FA 1W0YH 3BV9B 3EA7A 1OHHD 2RDEA 1VKYA 3OY5U 1PYTC 1O2SA 1D3PB 1NESE 3LJJA 4CRAA 2Z7FE 1Z8RA 1AVWA 3QZRA 1E79D 1SMFE 1GL0E 1HAVA 2FP7B 4KELA 2OP9A 1SKYE 1AWHB 4WH6A 1TABE 1HJ9A 2IN2A 2FS9A 3ATWA 1QL8A 1IHTH 3H7TA 1INCA 1E38B 2HNTC 3SV8A 3MOCA 3ZZ6A 1GJ9B 5C0TA 3UOUA 2KCPA 3M36A 3U8OH 1UHBB 2BXTH 3E91A 3ITIA 3OFND 3T28A 2GZ9A 1WTHD 3SU3A 5AVDA 1ZOMA 2AERH 4IN1A 5FPSA 3E3TA 1NFXA 3RXMA 3RXCA 2YMSC 4MNWA 1YP9A 1DSUA 1ZSKA 5F03A 1GJ5H 1FV9A 4K2YA 2NU1E 1ZMJA 4BAQB 3F1SB 4H4FA 1BBRE 1V2JT 1IQFA 2ZGCA 2FX6A 3MU8A 3RXVA 2AGIX 1GCTB 4NIWA 1DUAA 3MHWU 1TNKA 1GBHA 3SU2A 1THRH 4BOHA 1UK3A 5CHAB 2OBOA 2ASUB 1MTWA 3EQ0H 3A7TA 1GBTA 4B74A 4Q4LA 3TNSA 1TNGA 4K1SA 4A5TS 2ZPRA 4MPUA 1BTYA 1HDTH 2ZDMA 3GY7A 4J2YB 4QT8C 5EJZA 3QN7A 4ABAA 3GY4A 4ESTE 1EJAA 5G4BA 3ZV9A 5KEDA 1WCZA 1BMLA 1CO7E 4YM9A 1ZLRA 1KIGH 4D76A 2H2ZA 5F8TA 3KN2A 2C8WB 1O3JA 3PV2A 2ODQA 1J16A 1TX7A 2J34A 1BTXA 4GAWA 3LU9B 3UWIA 3I77A 1YPHC 2L6OA 1ANDA 1OWKA 2OD3B 1XMNB 4F55A 4IN2A 3ZVCA 2BOKA 2YMSB 3TGJE 4ZXXH 3UQVA 1FPHH 1HGTH 1F0UA 4RKJB 4GUXA 5F53A 1UTPA 2HPPH 1EJMA 1MTSA 1MH0A 1XKBC 1F0RA 1CHOF 1HLTH 1HV7A 3NWUA 2XC4A 5I46H 1UW7A 2ZCHP 1MU8B 4HG6A 3MYWA 6GCHG 2AMDA 4MPWA 1C5LH 1KSNA 1O5CB 4NA7A 1J17T 1SQRA 1FI8A 1V2PT 1P04A 1JIMA 4P00A 1SR5C 2EI8A 2J95A 4YOGA 5HIZA 2STBE 2VJ1A 4AOQA 1K2I1 4BNRA 5F6MA 2C8XB 3HKIB 4ACAA 2QV1A 2Z9IA 3RU4T 4XSKU 4ZKOU 1AVGH 1OP0A 1J14A 3D65E 1GBEA 2Z6BD 3OX7U 1C4Y2 3KNXA 1Y5UT 2Q6FA 1O2LA 2ZTZA 1AU8A 3LIWA 4CRFA 2GKVE 7ESTE 3PV5A 1ANBA 5C2ZA 1O5AB 2RCEA 2ZTYA 1EZUC 2ULLA 3U1IB 3UY9A 1FN6A 3SI4H 3HKJB 3KQDA 3O8BA 1O2WA 1WV7H 2GP9B 2PFEA 1DLKB 4OS7A 6ESTA
chains in the Genus database with same CATH topology
4AORA 5DP8A 1SGFA 1PJPA 1C2LA 3BEIB 1EASA 3A89A 2O8MA 2PGBB 1UK4A 2BY8X 1C2EA 2EA3A 2CGAA 2IJOB 1DFPA 3PYHA 1OKXA 1MBQA 1YCPH 1P2MA 1ZHPA 3VEQB 4ABGA 4A92A 4CRGA 3A86A 1OOKB 1SGIB 2ZFQH 1HFDA 2ZNKH 3QO6A 3PMAB 2A5IA 1M9UA 2OBQA 3A7XA 3SQHE 3ZZ7A 2ZU3A 3GCOA 1JBUH 1O2VA 1AB9C 3P8OA 1PPHE 4M7GA 3PB1E 3SHAH 2VVCA 4UFGH 4UDWH 2BDBA 4TWWA 2A1DB 2HALA 1CA0C 4X8UH 4THNH 1MAYA 3RXIA 3OYPA 1GI4A 2TGAA 2WPHS 5A09A 2GDEH 1O5EH 3IWMA 4CH2B 1JXPA 3RXJA 5L2ZH 1VJAU 4HGCA 1O2YA 3AW1A 4ZHMU 1NU7B 1GDQA 4LK4A 4B2CA 3V12A 5AF9H 3HGPA 1C2GA 2GTBA 4HZHA 1WOFA 1GBFA 4ZMAH 2C90B 2P3FH 3RLWH 2GCTC 1LVOA 1YLCA 4Z6AH 2XWBI 1V2ST 4O9VA 1G37A 1SQTA 1ZZZA 2CF8H 4WXIA 1BBRH 5EXMA 4IGDA 1TMUH 3KQCA 4DIIH 4ABJA 1HIAA 1K1IA 1B0EA 1TQ0B 4H6TA 2BB4A 2OXSA 1NRQH 1J15A 1AB9B 2FLRH 3I29A 4IC6A 4LZ1H 4U30A 4E7NA 1AQ7A 4MTBA 3ENSB 4X8VH 1C5ZB 1TAWA 1S6FA 1DS2E 1GHXH 5EXNA 2EI7A 1JIRA 2GDDA 1EKBB 1HYLA 1H9HE 2FOEA 2Z9LA 3SHCH 1NY22 5GCHG 3SW2B 2QCYA 1XUKA 4X2XA 3DHKH 2FI5E 3TK5A 3BTHE 5ETXA 1DWCH 1LCYA 3M37A 1ZTJA 3SGAE 2PHBA 4RSPA 2YOLA 3SQEE 1IQGA 1SLWB 2P59A 3PLBA 4WMEA 3O8CA 2GCHG 4VGCC 1HAXB 3ZVGA 1TRMA 1EXFA 1RIWB 2Q1JA 1GDNA 3Q3XA 4MLFB 5DP4A 1YBWA 2BXUH 3A7ZA 3WY8A 1FPCH 3A88A 4CRCA 1P2IA 2ZDNA 3LOXA 3EA9A 7GCHG 5EODA 1N8OC 2XYAA 1GHAG 5F8ZA 4X0WU 2ZU4A 1JWTA 2VWMA 4YLQH 5FPYA 4Q80A 3VXEH 3U69H 3DA9B 1O3BA 2Z3EA 1TPAE 1BRBE 1ZPCA 4D9QA 5JB9S 3VB6A 4GCHG 4NIVA 1BCUH 1K1NA 1MTNC 3R0FA 1SC8U 1XKAC 2HNTF 1O2HA 5DO4H 1AZZA 1K28D 2AGGX 4WXVA 4PROA 3ZZCA 2WPMS 2PKSC 3GCHC 2P3UB 1MZAA 3FP6E 7LPRA 2Z3DA 1O32A 1O2JA 4DY7B 2VH0A 3L33A 3LGYA 2W26A 1NZQH 1BB0B 1CVWH 1WBGB 2AIPA 1OWJA 1O2NA 1VITF 3VB4A 1ZRBA 1AGJA 2FLBH 2FS8A 2DE8A 3A80A 3PV4A 4SGBE 2I6SA 3GY8A 4FUHA 4VGCB 1DSTA 1GJDB 3QX5H 1C2IA 1YF4A 3VXFH 3A83A 1BDAA 1HXFH 3W95A 1TRYA 1FAKH 5A8XA 1UTKA 1KDQB 2VB0A 4MPVA 4CBNA 3FAOA 1SGYE 4WY3A 1O3LA 1W14U 2O9QA 1N8OB 2QY0B 3EGKH 3UOPA 1O39A 1C5MD 2HLCA 1P03A 3A8BA 1XUIA 2R9PA 1AY6H 5JDUB 1LDTT 1FIZA 2VIDA 1IQEA 2J38A 3RUOA 1FLEE 5HXFA 1LHCH 2R3UA 1L2EA 4GSOA 1KXBA 3ATLA 4J1YA 1TGNA 5E2OA 1L1NA 3ZVDA 3MWIU 3H5CB 1K9OE 2OCVB 3LGIA 2HGTH 3IITA 2PUQH 3MNCA 2OUAA 1MAXA 5C3NA 5HM9A 5FBEA 1QA0A 1G30B 1P11E 3SJ8A 1HAZB 1RTLA 4B71A 1GJ4H 1BT7A 4X1RU 1TIOA 1O3PB 1YKTA 3B8JA 1BA8B 1HB0B 1W7GH 2P93A 4NIXA 1IQJA 5T6FA 3PWBA 2BTCE 1K22H 1GVZA 1TFXA 2P95A 4CRBA 1CA8B 2WUBA 2EC9H 4BAHB 1HAVB 1O2OA 4OS5A 2V0BA 3EA8A 2CV3A 3PTNA 3T25A 1ELDE 4ZKSU 3RXTA 4ABDA 3OSYA 3BTEE 2RDLA 1GBMA 1C2MA 4JYTA 3RC5A 4ZROA 1QQ4A 3RU4E 4ZKRU 3BTME 1IAUA 3L3TA 2BVSH 5SGAE 3LH1A 1ZYOA 1H8DH 2FIRH 2XBXA 3TJUA 1GMDF 1S81A 4F49A 3GY6A 1WAYB 1GHBF 3RXKA 4I7YH 3SUDA 3T5FH 4FUIA 2UUJB 2R2MB 3SN8A 4AYVB 5JB8S 1S84A 4X2YA 1MUEB 1DWDH 3SNBA 1T8OA 2SNVA 1D6WA 2IOTA 4TWYA 4JK5A 1ZSJA 1THSH 1C2DA 4UONA 2PTNA 3A8DA 4IC5A 1DY8A 2TGPZ 1SGNE 1G2LA 1GBLA 1Z6JH 2HVXA 1CHGA 1DM4B 4Y0YE 4DG4A 1NTPA 1VCQA 1P9SA 1DOJA 5DGJA 3B9FH 1CHOG 1V6DA 2OTVA 2SGFE 1K1OA 3K2UA 2BM2A 4A1VA 1UTOA 4MQAA 1SLXB 1GJ6A 4UFFH 1LVBA 4NFEA 2QXIA 1FQ3A 1DX5M 3VB7A 4TYDA 1MU6B 2DE9A 2SGPE 1O2TA 5JBTA 1G9IE 4I32A 1K1PA 2D2DA 1GHWH 3PROA 1PPBH 2RA3A 4IS5A 2FESH 5JYIA 1RTFB 3N7OA 4BAMB 3PWCA 4NFFA 3U1JB 1GHYH 1GBDA 2EI6A 2VNTA 3T26A 3VGCC 1GJAB 1BRAA 1L4DA 1FZZA 1CGHA 1WUNH 1A3EH 3QGNB 3UQOA 1HAHH 3SZNA 3TH3H 1DDJA 5EQQA 4H42U 4YT6H 2G5VA 3M5MA 1AE8H 1D6RA 2BMGB 3SU0A 2Y7ZA 2VGCB 4YT7H 1H8IH 3Q3YA 1MKWK 2ANKH 4I8JA 5AFYH 2BLVA 1ELVA 1B5GH 2O8UA 5EW2H 3ZZ8A 1W7XH 5TJXA 1VR1H 1O3KA 1O2ZA 2GVFA 3S69A 2FODA 1TONA 2ILNA 1FY3A 2B8OH 3GDUA 1SPJA 5C1XA 3LGUA 2BZAA 1V3XA 8GCHF 4BXWA 5CHAC 2G5NA 2BZ6H 2XC5A 3AAVA 1OYQA 2ZGHA 1EOLA 2JETC 3PM3A 2CHAC 2RG3A 2P94A 1MTVA 3RMMH 3K6YA 5GJ4B 3VGCB 4GPGA 2BDGA 1FAXA 5F8XA 1Z8JB 2J4IA 1S82A 1LMWB 2QAAA 1NROH 1O3EA 3ELAH 1P06A 2ZHFH 2ODYB 1FY8E 1VGCC 2KAIB 5A0AE 3P8NA 1GMCF 1ZR0A 4MDSA 1SGPE 3E1XB 3RMLH 2TPIZ 1Q3XA 1ZMNA 1QJ1B 3BG4B 1AO5A 3CS0A 5DK1A 1F5RA 3K65B 1EP6A 2GD4B 1O2IA 1SGFG 3NK8A 3SU1A 4F4OC 4ISHH 1AKSA 4ZH8A 2SNWA 2STAE 3BSQA 1C1QA 1U6QA 4GHQA 2BDCA 1O31A 1LHGH 2XBWA 4X8TH 3SOSA 4ABEA 1C5NH 1H1BA 3STIA 1JRSA 1GBJA 1HAYB 1VJ9U 2JETB 2CHAB 5FHTA 1F0TA 1V2QT 1UMAH 1KXDA 3MU0A 1EZQA 1V2RT 1O2RA 8LPRA 3SJIA 1AI8H 3QK1A 2FI4E 3ZVBA 3SUGA 1NRRH 2ZF0H 5J4SA 4KP0A 3M61U 5PTPA 1BIOA 3RXSA 1BJVA 5TCCA 1VGCB 1A0JA 2NWNA 1A1RA 1A5GH 1S0QA 1S85A 1UK2A 1SFIA 1FY4A 1DWEH 3RP2A 2H9HA 1TGTA 1A46H 3FVFB 4ABHA 1TRNA 4GHTA 1ELFA 3RDZA 1AVXA 5LPRA 2A0QB 2FX4A 2Y5FA 3GYMA 4ISLA 3UUZA 1SHYA 1V2MT 2FOCA 5EXLA 3TGIE 5C5NA 1Y3XA 1TPSA 1V2VT 3ATKA 4Y79A 3RXRA 1BRCE 1S83A 1O35A 1W3CA 3A7VA 1GVKB 1XX9A 1W13U 1UTLM 3RMNH 4FU9A 3PMHB 1O3HA 4R8TB 2ZC9H 1EAWA 1HNEE 1GMHF 1HCGA 1HAIH 4BXSA 2AYWA 3E16B 4JZ1A 1PPEE 2QYIA 1FY1A 3SJ9A 1QY6A 2BOHB 1TNIA 2HOBA 2BVRH 1Y3VA 1K1LA 3GDVA 3Q77A 4NCYA 1C5OH 3D62A 2FOFA 1GBAA 1C2JA 1C2FA 1VCWA 1T8NA 1GBCA 4BAKB 2ZHDA 1GDUA 4KTCA 4NG9H 1MQ5A 2BD9A 1TGCA 1LTOA 1DANH 1ESTA 3DUXH 2OC1A 3U98H 1A5HA 1ZTKA 1P12E 4GLYA 2ZFRH 5C67A 1BITA 2A31A 2B7DH 3SO3A 1C1PA 2VIOA 1XXFA 1EX3A 3DFLA 1LPGB 1VITG 3TNTA 1ELGA 1Z71A 5I25A 7KMEH 2PSXA 1IQMA 2Y5HA 3CP7A 3AVZA 4FVDA 1GJBB 3BTDE 1ZJDA 3OU0A 4Y76A 1G2MA 1E37B 2A32A 5EOKA 1RXPA 5FX5A 4YLUA 4Q7ZA 3RXFA 4B76A 1NFWA 2BX3A 5LPFA 1O2XA 1ABJH 3TH2H 3BTKE 4MG3A 1Q31A 1QB1A 3GDSA 1O5GH 4R0IA 1FN8A 2H5CA 2TIOA 2ZDLA 1V2TT 1ZHRA 4FXGH 5JPMH 3JZ1B 3RXGA 2F9BH 1QRZA 2DUCA 1MQ6A 2BDYA 2VIVA 3TJOA 4U01A 1C5SA 2FDAA 2HNTE 3GYLB 4Y8YA 1HAPH 1ETRH 3MH4A 2BD8A 5DP3A 3C1KA 1Z6EA 3KEEA 3LPRA 2BLQA 1P02A 1TBRH 1LHDH 1MKXK 1UHBA 2W5EA 2JH5D 3BEUA 3T29A 3P92A 4WWYA 3D49H 4ISIH 1TA6A 5EG4A 2GZ7A 1DVAH 4X6PA 2ZP0H 4NGAH 1KLTA 1TALA 3P70B 1MD8A 1UTJA 1IQNA 2WYGA 2XC0A 3E6PH 1SL3A 3MNXA 1O3IA 1G3CA 3RXDA 2QC2A 1BMAA 2Y81A 1BRUP 1L0ZA 4AFUA 3DD2H 5K7RA 2G81E 1P05A 1RIWC 4BAOB 2CXVA 3KGPA 1E36B 3NUMA 2XW9A 5E0HA 1OWHA 1GJ8B 3A82A 1OSSA 3L6PA 1SQOA 4KKDA 4DOQA 4NSVA 1GI2A 1C5VA 1IQLA 2NU2E 1GWAA 2V6NA 3SORA 1CT2E 1FMGA 4IBLH 5A8YA 1C1VH 2WPJS 1A5IA 5HMAA 1EATA 3BEFB 1YPHE 2VVUA 2NU4E 2A45B 1N6XA 3U8RH 3RXPA 3P8FA 1NRPH 4Q2KA 4JYVH 3UPEA 2YNAA 1QL7A 4GVUA 4K60A 5T3HA 3SUFA 1PQ8A 2HPQH 1QBVH 1MCVA 5HGGA 4TPYA 3TVJB 1Z1IA 1EPTB 3TK6A 3BTWE 2PR3A 1BHXB 2BLOA 1LVYA 1W12U 4UE7H 5ESBA 2XXLA 2SGAA 3T27A 1KYNA 1WSSH 1MZDA 1FONA 5EGMA 3V7TA 1OPHB 3ZV8A 3F9HA 4MNVA 1GI8B 1IQIA 1TE0A 2W3IA 4X1SU 2OC8A 1AHTH 1UTQA 2OC0A 6GCHF 2QIQA 4A6LA 4Y8ZA 3ESTA 5EQRA 3HATH 1C5XB 3SNAA 1O3FA 3TIUA 4ABIA 3E90B 4JZIA 4WF8A 1A0LA 1F2SE 2OLGA 4JCNA 1PQAA 3MU1A 1AUJA 1GGDC 2R0LA 1O3CA 1P10A 2GZ8A 1QL9A 1TMTH 1ZGVA 3ATMA 1ELCA 2P8OC 1O2PA 1TBQH 5A0BA 2TBSA 3C27B 1EAIA 1MKWH 1VZQH 1XUHA 1N1LA 4NWLA 1AIXH 4AZ2B 1DICA 1A0HB 1FNIA 4AFQA 1QB6A 1TBZH 4DCDA 1TQ7B 1K21H 1EUFA 1WU1A 2A5AA 3KF2A 4K1TA 1NFUA 1W10U 2BHGA 1SSXA 1O2GH 3TITA 3SGBE 1PPCE 1CBWC 1OWEA 2A4RA 4I31A 3KQEA 6LPRA 1NPMA 1O2KA 2A2QH 1KTTB 1YPJH 4MVNA 2J9NA 2QN5T 4JYUH 3GCTF 2XNIA 2CF9H 2C93B 1DWBH 2AGEX 2ZQ2A 1HBTH 3UR6A 3NKKA 1P2OA 5HM2A 4Z0KA 1GGDB 1W2KH 1SVPA 1Y3UA 1T32A 1BUIA 1A61H 2P8OB 1IQHA 5E0GA 4ZAEA 1O34A 3UREA 4B75A 1OS8A 1GI3A 1N6YA 1EOJA 3LC5A 2FYQA 3NXPA 1HJ8A 3M5NA 1YC0A 4X1PU 3MMGA 1AWFH 1VITH 1LVMA 4DIHH 2AEIH 1GI7B 1O37A 1YPEH 2HRVA 3S7HB 1ACBE 1GBIA 1CBWB 4X1NU 1G3DA 5FCKA 4KTUA 1BMNH 1Q2WA 2QA9E 1TNHA 3Q3KA 1UVTH 1TNJA 3LDXH 3GY5A 4K1EA 3LJOA 4I8LA 1C5TA 1ORFA 3UTUH 2GT7A 2Z3CA 2G4TA 1OP8A 2Y82A 4BTTB 1TMBH 3S7KB 1HUTH 1UCYK 5LH8A 2ZECA 1HXEH 2ZPSA 4JZFH 4AGJA 1ZMLA 3T2NA 2ZDAH 1OWDA 1HJAC 2ZPQA 4TY7A 1YLDA 2B9LA 2SFAA 4AG1A 1SGEE 1RTKA 2F9PA 5DKMA 1KTSB 1D4PB 4CRDA 3AASA 2BDHA 1O30A 1OYTH 3ZZ3A 5K0HA 5H4IB 3PTBA 1C1MA 2ZCLP 5GCHF 2V35A 2Y5GA 4NIYA 2EEKA 1G3EA 1QRWA 1GJ7B 3M35A 4X1QU 2H9EH 3KL6A 3CENA 4I33A 1KXAA 3SNEA 3LGWA 4D7FA 4DGJA 4D9RA 4OS2A 1O5DH 4ASHA 2GV6A 3M5LA 1O3AA 2XRCA 4ZKNU 1AE5A 3NZIA 3LGVA 2YNBA 5L30H 2VGCC 2C8YB 4CREA 2THFB 2PLXA 4CR5A 4AX9H 4CR9A 2ZG0H 1ABIH