1OWIA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Identification of Novel Binding Interactions in the Development of Potent, Selective 2-Naphthamidine Inhibitors of Urokinase. Synthesis, Structural Analysis, and SAR of N-Phenyl Amide 6-Substitution.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owiA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owiA01
4HGCA 1C5SA 1EJMA 1TNHA 3E91A 4K69A 5C1UA 1QL7A 4CRFA 1AHTH 2ZDLA 1C1UH 5GIBA 1YC0A 1UCYH 3U9AH 3A85A 4IN2A 1VZQH 3E0NB 1FPHH 3PO1B 1LHDH 1IQIA 4MPVA 5DP4A 1EP6A 1BQYA 1A2CH 1D3DB 1TE0A 2JETC 5E8EH 1O2TA 3SI4H 3SNEA 2FI3E 1CQQA 3F9HA 5TJXA 4K5ZA 3LKWA 1RJXB 2BY8X 3GDVA 1W0ZU 2ZHDA 4F4OC 1QGFA 2GT7A 4UE7H 3PWCA 1XUJA 2V3OH 3CS0A 4YM9A 1QA0A 1V3XA 1DANH 1O38A 3SU1A 1TA2A 2BTCE 3RXUA 1MTVA 5LPRA 1O3CA 1MZDA 2QF0A 3ITIA 1QRXA 4I32A 4F49A 1AD8H 1NRQH 1O2WA 4O97A 3HKJB 1O2GH 3MWIU 2PKSC 3MH6A 4KTSA 5AFZH 2GT8A 1GHVH 1K1IA 1IHSH 1HCGA 2WPKS 3RXKA 1QCPA 3ELAH 4LK4A 2I6SA 2ZZUH 1U6QA 1GBFA 1BCUH 1Y3YA 5E2PA 1SFIA 1UVPA 1MTNB 4MTBA 4U2WA 1QR3E 1V2ST 4X8TH 3ZVDA 2VIVA 1FUJA 1Z6JH 4AFUA 4J2YB 1OP8A 5FPSA 2H2ZA 1CHGA 2ZDKA 1FAXA 1NS3A 2V3HH 7KMEH 2ZDVH 1K9OE 3BV9B 3SOSA 5T6DA 3EDXB 3L6PA 4ZKNU 2LPRA 3HK6B 2HNTF 1BTXA 1HXEH 1GG6B 1FZZA 4YT6H 1INCA 5EOKA 3U8TH 1H9LB 2QN5T 2ZPRA 1C5MD 1W2KH 1GI1A 2GCTC 4KELA 1OOKB 4FUDA 2VIQA 1QB1A 4JYUH 1G32B 1ZMJA 4XFQA 4ABIA 1THSH 1TPAE 1Y59T 1BOQA 2PLXA 3LGTA 1SVPA 2TGTA 1ZRBA 1C5NH 1SGEE 1GMDF 2FEQH 2ZU2A 1GVZA 1ZTJA 1SMFE 2UUJB 2Y80A 5HYOA 1A5HA 1MKWK 1C5YB 1F7ZA 1VCWA 3VXEH 2ZNKH 2UUYA 1HBTH 1T32A 3U1JB 3R3GB 1AVGH 1EATA 1GJ8B 3RXMA 4UFFH 3PV4A 2W7UA 1C1RA 1HAVA 1HIAA 2STBE 4X1PU 4K8BA 2C3SA 2NU4E 3SO3A 3KHVA 5GCHG 3S9BA 1DSTA 1O3BA 4KGAA 2H1UA 4FXGH 4JZ1A 4ZMAH 4YLQH 1O3KA 2FOCA 2CXVA 4GPGA 2AEIH 2Y6TA 3A7ZA 1GI6A 2HGTH 5JDUB 1GMDG 1NFUA 1EZUC 1FONA 2DE9A 3SN8A 2F9VA 1TQ7B 3TGKE 1SG8B 1OWJA 1ZMLA 1CGIE 5JYIA 3MH5A 1A3BH 1PJPA 1ELFA 4ESTE 2CMYA 2STAE 1AZZA 1O3MA 2XNIA 1T8OA 4KTCA 1LVYA 1KTSB 2VGCB 4RKJB 4MNYA 4NGAH 3EA7A 3FVFB 2OCVB 3K9XB 1IQHA 1CE5A 2BLWA 3QX5H 4DY7B 1IQJA 4I8JA 3PROA 4OS1A 2Y5GA 1QBNA 5DP6A 3VPKA 2FOEA 3F1SB 1GBDA 4PROA 2G4UA 3IITA 4AOQA 1YLCA 2ZGXH 3LGWA 4CHAB 1WCZA 3CENA 1Y3WA 3KQDA 1MQ6A 3SU0A 4Y76A 1GDUA 3SORA 4CRBA 1YPJH 1DWEH 1LPZB 2GD4B 3ZZBA 2A4RA 2AIQA 3MTYA 4NSYA 1L4DA 3NPSA 1P2IA 3RM0H 3GYLB 4ZHAA 4FU7A 2B9LA 2B5TB 1ZMNA 3RXHA 2VNTA 1MD8A 5EODA 1LMWB 1EUFA 1GI5A 1NRRH 1VGCB 1H9HE 1KXAA 1HJAC 4FUIA 3MU8A 1CT0E 3L3TA 1G36A 1O2JA 2EC9H 1TNJA 5LGOA 4THNH 1XUIA 4NIVA 1BRUP 5GWZA 3I29A 1O2UA 2QY0B 3VB5A 2P94A 2QA9E 3TH2H 1GMCF 5FBEA 1BRCE 1QURH 2QXGA 4DOQA 3BN9A 1O2SA 5ESBA 3SV7A 4B2CA 1NC6A 3NXPA 3VB6A 1ANDA 1YCPK 1BMAA 1MAXA 1UVUH 2QIQA 1A0JA 1O3NA 3MU4A 4OS7A 1WYKA 4DGJA 1AVWA 1C9PA 2OXSA 4FVDA 2J34A 4X1NU 3S0NA 2R0LA 2YOLA 2QV1A 1G30B 2PR3A 2HPPH 2PSYA 3W95A 3C1KA 1NU9A 3A82A 5DGJA 5E0JA 2HWLB 3QUMP 5A8ZA 2Z9JA 1GL1A 1V2PT 2VVVA 2XYAA 1SQAA 4Y79A 1VR1H 2GDEH 1NRPH 3NZIA 1PPFE 3M5OA 2ILNA 5FAHA 1HAIH 4MNVA 2GCHF 2PTCE 2Z6BD 3R0FA 1MD7A 1V2OT 1NFWA 3SNAA 1VITF 4A6LA 2C4FH 4OS6A 1O2QA 1K1NA 1DX5M 3M35A 3PLKA 3OTJE 2Y7ZA 1P2JA 1AZ8A 2ANMH 1QA7A 1CHOF 5ESTE 1TPPA 4O03A 1UMAH 5C2ZA 1TNGA 3N7OA 4I8HA 1FY3A 4Y11E 3GCTG 1HAGE 2HRVA 2O8TA 1ACBE 4Z6AH 1TRMA 2FX6A 4KTUA 3LONA 2B8OH 1DWBH 2PGQB 1ZR0A 5EG4A 4NA8A 5HMAA 5B6OA 1TALA 1GPZA 1PQ7A 1UTJA 4BAMB 1O2VA 1OS8A 1D3TB 3SBKA 2SFAA 1OP2A 2DUCA 1DOJA 2Z9KA 3ATLA 1C5QA 1PQ5A 2RG3A 3LGVA 3UR9A 3SV8A 1BTHH 2Y82A 3RM2H 2A5IA 3PLBA 1GHBF 4Y8XA 4WH8A 8GCHG 1N8OC 1H8IH 1CBWC 3SHCH 1CGHA 4I31A 1UK4A 1ZJDA 4HFPB 3KQBA 4AX9H 2PSXA 3DFJA 4R0IA 1DLEA 3T62A 2YNAA 3BG8A 4A1TA 2BDBA 1EOJA 1BMNH 1SLVB 2QGRA 3TH3H 3A8BA 3I78A 4YLUA 1HLTH 2EEKA 4BTUB 1GGDC 1KXEA 1FI8A 5FXLA 4BXSA 1A1RA 1P06A 4ZH8A 3UY9A 3EGKH 3KCGH 3FZZA 5EXLA 1C5WB 1ETTH 2P3FH 2XC0A 4U32A 1QBVH 3LGYA 4X1QU 1QB6A 1MBQA 5L6NH 1Z8IB 2B7DH 4Y71A 2GTBA 1C1TA 4ABDA 2FDAA 2XBXA 4CH2B 4I8KA 2F9PA 3BTKE 2W5EA 1A5GH 4NIWA 3O8RA 2KAIB 3BEFB 1YBWA 4SGBE 5HM9A 4INLA 1XVMA 2F91A 4ZXXH 1O33A 1C2IA 1OYQA 1O2KA 1D6RA 1FV9A 3QK1A 3PLPA 2HNTE 4VGCB 2XBWA 5ETXA 2BVSH 1ABIH 4K8YA 3SGAE 4MPXA 1TONA 3ZYDA 5CHAC 4HZHA 1UK3A 2FOBA 1W12U 4BNRA 5DP3A 3VB3A 2TGDA 4INKA 2TIOA 1HUTH 2AMDA 4K1TA 5TCAA 4FUGA 3PTBA 4CR5A 1MBMA 8LPRA 1GI0A 2ANWA 1IQEA 3K6YA 1WTHD 1EAIA 2VINA 1BJUA 1E37B 1W8BH 2ZC9H 1GMHG 4IBLH 3V12A 2FYQA 5LPEA 1C9TA 5EQQA 2XWAA 4LOYH 1TX6A 2OLGA 1T8MA 1MTWA 2O8LA 4MPWA 2A2QH 2ZECA 3HPTB 1O31A 2BY6X 1GJAB 2R2MB 2C8ZB 2JH5D 1IQLA 5PTPA 3BSQA 1O3EA 5E0GA 3TH4H 3UPEA 2BQ6B 3QLPH 3PTNA 1O2NA 4WVPE 4ABEA 1NROH 3ODDA 4CBOA 2A45B 3GCOA 1SLXB 1RD3B 1AN1E 4AZ2B 2A7JA 5FPTA 2BD4A 5GDSH 1UVTH 1TPOA 1FY4A 1QRWA 1MTSA 1ARCA 1SQOA 1ZGVA 1B7XB 1C5TA 4FVBA 3MI4A 1HV7A 2ZO3H 4GCHF 1Z1JA 1VCQA 2F9OA 2H9EH 1TGNA 7GCHG 1S0QA 1SHHB 2FOMB 3S7HB 1ORFA 5K0HA 3ZZ4A 1QRZA 2Z9GA 1C1MA 4WWYA 1M9UA 2OC1A 4NWKA 1UTLM 2BD2A 5A0CA 2ZU5A 4XBBA 2VWOA 1WBGB 4E06H 1HAVB 2F9BH 1UO6A 4K1SA 2ANYA 1FIWA 3GY6A 1Z8GA 2GKVE 2FTMA 1H1BA 1NN6A 1UVSH 2Z9IA 4R8TB 5F8XA 3ZVFA 3UQVA 3RC4A 3KEEA 3GY7A 2R3YA 1EPTC 4H4FA 1IQKA 2A4QA 4Y10E 1ANCA 2K1QA 1DXWA 2XCFA 1THRH 4UEHH 5T3HA 2ODQA 1CA0B 4AB9A 3GY3A 4FUJA 4ZHMU 2NU1E 1O3HA 1HB0B 3B23B 3W94A 1VCPA 1ELAA 3A87A 2SNWA 1P9UA 5EXNA 1DWDH 1UJ1A 4I33A 3DA9B 2HLCA 1C1SA 1DFPA 1C2LA 1GJ4H 2UUFB 3EA8A 1BB0B 2AGGX 1MKXK 4XSKU 3K65B 1GI8B 4HI3A 2ZFTA 2OUAA 3S69A 5L2YH 1CSOE 4OS2A 3FAOA 1IQGA 1HPGA 1TGTA 3BTQE 2VWLA 2C8WB 3S7KB 1BBRK 4D76A 3K2UA 1BHXF 4ZAEA 4JZIA 4ABFA 1P11E 3OX7U 3VXFH 4UFGH 2WUCA 5C67A 2P3TB 1N6YA 2FLBH 1O5EH 3MH4A 3CS7A 3E8LA 1LHFH 2Y5HA 1O3DA 3TLOA 3GCHC 3MH7A 1QHRB 2CV3A 4X2XA 3E6PH 2KAIA 1DICA 2J95A 2HOBA 3RC5A 4BOHA 4MDSA 1IQFA 4E7RG 1WQVH 3IWMA 1O32A 4TWYA 3RXBA 2O9QA 1AKSA 3KL6A 1TNLA 1H4WA 2H9TH 5EQSA 3P8NA 1AFQB 3S9AA 1P2OA 3P8GA 2BYAX 5C1YA 1YYY1 3V3MA 3BF6H 1DUAA 2OBQA 2UWLA 1XMNB 1ABJH 1GCTC 2I6QA 1W14U 1O2MA 2TRMA 4Y7BA 4ASHA 1P01A 1BIOA 1GI9B 4K3JA 4LZ1H 2AGEX 1C1NA 1KIGH 1O3OA 5I46H 3VGCB 2BXTH 1HAZB 2PWXA 2ZHFH 3AVZA 3UOPA 4GSOA 2FLRH 3TU7H 1FPCH 4ZKSU 4Q2KA 3HGNA 2ZGHA 5AVDA 2OBOA 4JCNA 2C93B 4BAKB 3O8DA 4O9VA 1G2MA 3RMMH 2CGAA 1GJ9B 1KSNA 2AERH 1C2MA 4INHA 4CR9A 5FX5A 1TABE 2WUBA 2P59A 1C1VH 1ESAA 1QY6A 2GDDA 3ZYEA 2GMTB 5FCKA 2W7SA 4Y7AA 1RRKA 3OY5U 5AF9H 1RFNA 3A7YA 5EPNA 1RIWC 1ZTLA 2ZHQH 4YO9A 4GAWA 4O3TA 5IDKA 1TX8A 1C1PA 1YKTA 1YP9A 3VEQB 5FHTA 2BD8A 1SLUB 2SGEE 1QJ7B 2QXHA 2ZDNA 3A7VA 3QO6A 1K21H 1WU1A 1BBRE 1XXDA 2BY9X 2G4TA 5JPMH 1C5PA 4ISHH 3TK9A 2Z9LA 4D7FA 4UDWH 5JB9S 3HKIB 1LVMA 1AB9B 4XOJA 5A09A 3ATWA 3TJOA 2ASUB 1YCPM 2ZQ2A 1SQTA 3MOCA 2VIOA 1MZAA 2BVRH 4YOIA 1WQSA 1XX9A 3BTHE 4Q7XA 3GOVB 4FUEA 3RXTA 3MO9A 3GY4A 1JIRA 2BD3A 2ALVA 1SFQB 1LVOA 2SGAA 1XKAC 2WYJA 3RMLH 1QL9A 3M3VA 4O3UA 1NZQH 4YOGA 8KME2 1GJ6A 3HGPA 1V2WT 1OYTH 3F9EA 2PHBA 2J4IA 3QGJA 1TBQH 6ESTA 1Y5BT 4E7NA 4WXIA 2HNTC 4LZ4B 2PGBB 3UIRA 4AGJA 4Y8YA 3TJNA 5EQRA 3RLYH 4E05H 1TOCB 4Q7YA 6CHAC 1O3GA 5T6GA 3QN7A 1BMLA 2ZKSA 1SR5C 1AI8H 1P2MA 1JWTA 1YPKH 1EJAA 3GY2A 2ZGJA 1KDQA 2VVUA 2BX3A 1QIXB 1LCYA 3RMNH 1YPLH 3ZZ9A 8ESTE 1AIXH 3U1IB 2XW9A 3ZZ5A 2VH0A 1C5RA 2FS9A 1KY9A 4D7GA 5BPEA 1C2HA 2P3UB 2FMJA 2XCNA 3PM3A 5H4IB 1S6HA 1XKBC 2F83A 2VWMA 1UTNA 3BTGE 3LOXA 5HXFA 2BD5A 4H6SB 3RXGA 3SW2B 1V2VT 5C1XA 2CHAC 1BMMH 1BUIA 3TJVA 4DIIH 1L4ZA 3SJ9A 2QCYA 2G55A 3BG4C 3SQEE 1DITH 1UVOA 1JXPA 1O2OA 2VIPA 3Q3XA 3LPRA 3SJOA 1TPSA 1F5LA 5HGGA 1Q3XA 2TBSA 1FY1A 1IAUA 1AE5A 1NT1A 3MO3A 1WV7H 3KF2A 5F03A 1DM4B 2ZWLH 4NFFA 1QFKH 1GI3A 3UTUH 3GISB 2ANKH 1A0HB 1YCPH 3HATH 5EU8A 3ODFA 4CRDA 1BRAA 3JZ2B 3GY5A 2JH6D 1TMUH 3E3TA 4WXVA 3T26A 1LPGB 3DFLA 3GDUA 3LGUA 4GVUA 4RSPA 2XBYA 3PO1C 1GBKA 2AMQA 1OXGA 2A1DB 4BTIB 4UONA 1ETRH 3A7TA 1VJ9U 1DY9A 1DY8A 1CGJE 3C27B 3TNTA 2R2WU 1MQ5A 4IGDA 5EPYA 4X6PA 3AASA 1SB1H 3MNBA 5AHGH 4D9RA 4X0WU 2ZCKP 1HGTH 2ZCLP 4ZXYH 1V2NT 1IOEA 2G81E 1KXCA 1F0SA 2FWWA 3RC6A 5DO4H 3LJJA 1GJBB 2BVXH 4I8LA 4MNWA 1O5CB 2WPJS 1GHXH 2BDCA 3M5MA 1SGYE 2ZP0H 3QWCH 3F68H 1EAXA 1K1JA 3ZVCA 3FP6E 1ZJKA 5C3NA 5JBTA 4B74A 1GJ7B 1TB6H 1O3LA 1KLJH 1SPJA 2W3KA 1C2GA 1TAWA 5FPYA 1AU8A 1EQ9A 3B8JA 1ZHRA 1G3DA 4MPUA 3U69H 1IQNA 1WSSH 1GMCG 3B9FH 4XBCA 1GHYH 3MU5A 1MTNC 2ZTZA 1UHBA 4XBDA 4K60A 1P12E 4ABHA 3GYMA 5I25A 1ANEA 1JRTA 4B71A 2GZ7A 2XWBI 3KQCA 2CJIA 1O2HA 3UQOA 2ZQ1A 3O8CA 4MVNA 1D9IA 5C5NA 2OD3B 3TK6A 1GG6C 2R9PA 1HAHH 5DP9A 3HK3B 4U01A 2GZ8A 5FCRA 4ABGA 2Z3DA 1OWKA 1O35A 3GY8A 2GV6A 1DPOA 2GGVB 3RXLA 3SV9A 4OS4A 4UFEH 1Y3UA 3U8RH 2P8OB 1GBCA 5C20A 2BLVA 2VB0A 2GCHG 3GCNA 2GV7A 3SNDA 2R3UA 2THFB 4JZFH 1VITG 4FUBA 3WY8A 1UTPA 1RGQA 3QDZB 1AMHA 2M5TA 3P6ZB 4B1TA 1C1QA 2XBVA 4CRAA 2PV9B 2F9UA 1CHOG 1NRSH 1LQEA 4MLFB 2VH6A 2Q1JA 1BTZA 3Q76A 3QGNB 3JZ1B 3ZVGA 5L2ZH 4I7YH 3M7QA 4AFZA 5J4SA 2SGFE 3EAJA 3SJIA 2ZU3A 4JZEH 1CVWH 2A7CA 1D3PB 1EJNA 1F92A 1Y3XA 3P8OA 4TY7A 4ABBA 3ZZ3A 2VIWA 2TPIZ 2ZDMA 1UK2A 2BOKA 1S5SA 1OWEA 2D2DA 1TRNA 3M3SA 1TLDA 3ATIA 1XVOA 3SU4A 4WMDA 1F0UA 1O39A 1Y5UT 3ZVAA 1RTFB 4Q7ZA 2NU3E 4OGYA 2OQUA 3URDA 2QXIA 1GBIA 1GHBG 1P3CA 1FIZA 1SGFG 3SU5A 3LU9B 3ATKA 2VGCC 3M7TA 1C4Y2 3P92A 5C5OA 4UFDH 9ESTA 5DG6A 3Q3YA 3A88A 1RTLA 3QZQA 3D23A 1TNKA 1LVBA 1PPHE 1QBOA 2NWNA 3RUOA 2G52A 2J9NA 4X6MA 3BTME 2JETB 1AKSB 2AH4X 2IOTA 2Z7FE 2SNVA 4CHAC 3QZRA 4X8UH 1MMJN 2AGIX 4OGXA 1LTOA 3FFGA 2ZFPH 1ZHMA 1O2LA 4JZDH 4NG9H 1O3JA 4NZQA 1GBAA 2FTLE 1MU8B 1Y8TA 2BLQA 2A5KA 1C1OA 1WTGH 5K7RA 1Y5AT 4X1RU 1EOLA 1V6DA 2R0KA 1BTUA 1SGDE 1HXFH 3V0XA 4GHQA 3TIUA 5HM2A 3V7TA 1C5ZB 1B0FA 1XUHA 1VGCC 4X8VH 1J9CH 4NIYA 2PKSB 4ZUHA 3SU3A 4KKDA 4BAOB 3LH1A 1FN8A 1XUKA 2BHGA 3RXAA 3ZVBA 4BXWA 2QAAA 1AFEH 2G00A 1MAYA 2O8UA 4BANB 1C5OH 1ESTA 1GI2A 1C2FA 1SGQE 3F6UH 1HFDA 1YPHC 1TQ0B 4FU8A 2C8YB 5A0AE 2BDYA 3RMOH 2XC4A 5F6MA 2WINI 1E35B 1Q31A 4DIHH 3GDSA 2WPLS 4A92A 3U98H 3KNXA 2SGPE 2GZ9A 3H5CB 1MTUA 1GWAA 4DVAU 1PPZA 4WY3A 4D8NA 5GXPA 1QJ6B 4X1SU 4GHTA 5E2OA 9LPRA 1P2QA 4NCYA 1C5LH 1QTFA 1QQUA 1MCTA 2GCTB 1NPMA 2BOHB 1O3FA 1SGTA 3QTVH 2OC8A 4DJZB 3M5LA 4JYVH 2XXLA 4NA9H 2BDHA 4DT7B 1P04A 1V2TT 1V2JT 5IYTA 1IQMA 2ZHEH 3QTOH 1LO6A 1O2PA 1T8NA 3UWJH 1ZOMA 2ZU1A 3ESTA 5EGMA 1DWCH 3A80A 1UTMA 3NWUA 4X6OA 1ID5H 1CU1A 1EASA 1G2LA 1MKXH 1O5BB 1V2UT 1S83A 2OINA 1OPHB 4DG4A 1ELEE 3KQEA 1P2KA 1E34B 1EB1H 1EPTA 2A32A 2ESTE 3SV2H 2BDIA 1O2IA 2G5VA 1P05A 2BM2A 2D26C 4GCHG 1HYLA 2ZFQH 2A7HA 3TPIZ 1O0DH 1E0FD 1K28D 1KDQB 1ZSKA 2WPMS 3F9GA 4NFEA 1F5RA 5GPIB 1GJDB 1O2ZA 4TY6A 1ZPCA 3P8FA 3P95A 1C5UA 1PYTD 1KXFA 2AS9A 1OWDA 4ZHLU 3LC3A 3AAVA 1XUFA 5AFYH 1V2RT 4BAHB 5CMXH 3M3TA 3PMJA 3ZZAA 3T5FH 3SHAH 3UREA 1O5DH 2G5NA 1C2DA 1JRSA 1OSSA 3FANA 4B73A 1G3CA 1DT2A 1FQ3A 2FODA 3OSYA 1O2XA 3EE0B 4CBNA 1C4V2 2F3CE 3TK5A 1EAUA 2W26A 1TMBH 2P93A 1ZHPA 4LXBH 4U30A 2VVCA 1V2QT 4X2YA 1ZPBA 2Z3CA 3EYDA 5JBBS 1YPGH 4B76A 3Q3KA 1GI4A 4AN7A 3D65E 1Z7KA 4MQAA 2JH0D 1GHAF 1L1JA 2H5CA 3TVJB 1K1OA 2C90B 3SQHE 1ZLRA 1BTYA 3G01A 1K1PA 3MNCA 1W10U 2QF3A 1KYNA 1HJAB 1AY6H 2GP9B 3T27A 1PQAA 3I77A 4NWLA 4CREA 2A31A 1YM0A 1P3EA 1O5FH 2ZPSA 4VGCC 1HJ8A 2A4OA 2RA0A 1AUTC 2BY5X 2FI5E 1T4UH 1EX3A 1G3BA 2BXUH 3RXFA 3BEUA 3SU6A 5A8XA 2J94A 1SSXA 1AVXA 3KIDU 3BTEE 1ZSJA 1DE7H 2CF9H 1GHAG 2QC2A 5DJ7A 1UCYK 1FMGA 1NM6A 2W3IA 3E0PB 1FAKH 4JMYA 2FOFA 1BTWA 6LPRA 2EI7A 3A8AA 4IC6A 1PPGE 1EZXC 5A0BA 1X7AC 3DD2H 1NFXA 4Y8ZA 1FLEE 1JOUB 1S6FA 2IN2A 2V35A 4J1YA 1MKWH 1XUGA 1ZYOA 4H42U 2H9HA 1H9IE 4B75A 4JK5A 1P0SH 1L2EA 4FUHA 3RXSA 1MUEB 1UHBB 1N1LA 1CO7E 3M61U 3KN2A 2EI6A 4ISLA 1F5KU 1FN6A 1HAOH 2ZI2H 5JB8S 1OX1A 1LHGH 2ZEBA 3ZZ7A 2FP7B 2WV5A 1K2I1 1NO9H 3CP7A 1AWFH 3BTDE 4WMEA 3UNSA 1GI7B 1RXPA 2AYWA 3BIUH 1LPKB 3FP7E 3K6ZA 3ZZDA 5LH8A 5GCHF 1YF4A 1HAXB 2FOAA 3D49H 4AYVB 7ESTE 5LPFA 1A61H 2RA3A 4ISIH 4DW2U 2B0FA 4FUFA 1DUEA 3MYWA 3Q77A 2OC7A 1P09A 1SI5H 1THPB 1Z8RA 2PW8H 1ELTA 2WPHS 4GUXA 1ELCA 1LQDB 3URCA 5JBAS 2Q6DA 1FNIA 2NU2E 4MNXA 1J8AA 3O8BA 1W11U 1N8OB 1YPHE 1BRBE 3OYPA 3LC5A 1CBWB 1TRYA 1G3EA 1NFYA 3RXQA 1YLDA 2PKAA 1GCDA 3E1XB 3FP8E 4NSVA 3RDZA 1ARBA 3FZDA 1BJVA 2Z3EA 1PQ8A 1PPEE 4Y0YE 1GBJA 1A5IA 1A3EH 2FM2A 2OC0A 3MU1A 1HAYB 1P02A 1EAWA 3OY6U 2ZG0H 4BAQB 2UUKB 1O3IA 3SV6A 2ZGBH 2ZHWH 3SUEA 1QJ1B 1Z8JB 1C1WH 1EXFA 5J4QA 1CA0C 1GJ5H 1SBWA 1SGIB 3RXCA 4JK6A 2A0QB 2ZGCA 3MNXA 1GGDB 3MFJA 2ZF0H 1C2EA 3A8CA 4XE4A 3ZV8A 1TBRH 1UCYE 2Y5FA 3A7XA 3DHKH 2BD7A 2SGDE 2PUQH 1K1LA 1NRNH 3M37A 1SGNE 2OP9A 5FX6A 1TYNA 4AG1A 1RTKA 1SGPE 1F0TA 3TJUA 1P57B 3SUFA 2G8TA 1TOMH 4A1XA 2BZAA 3A8DA 1GHWH 3SI3H 3P70B 2QYIA 4ISOA 1J17T 1O2RA 3SNBA 1CT2E 1FY5A 3M7UA 2V6NA 4MG3A 1GDQA 1LHCH 1A0LA 4RKOB 3LDXH 4WH6A 4B2AA 1GJCB 4IC5A 1FJSA 3LT3A 1A7SA 4IS5A 2BDAA 4ZKOU 1ANBA 5CHAB 2BB4A 3T29A 3RXOA 1KXBA 1BDAA 3PB1E 1A4WH 3A7WA 5T6FA 1UTOA 1P10A 4WJG2 4Y0ZE 1AGJA 1T31A 3TGIE 1CT4E 1TBZH 2IPHA 3MNSA 4FU9A 3TNSA 1AFQC 3RXEA 4NIXA 3VB7A 2CN0H 1LKBA 4BTTB 2HALA 3ZVEA 1JMOH 4IN1A 4YT7H 3S9CA 2VIDA 3UOUA 2ODPA 2XRCA 4K1EA 1OWHA 2FOGA 5A2MH 3D62A 3EA9A 1SGCA 2WV4A 1V2LT 2ZIQH 4X2WA 2FXRA 1DVAH 3DT0H 1BZXE 1ETSH 2ZA5A 3VGCC 2RDLA 4AGKA 1AE8H 1GVKB 5F8TA 1J15A 2FOHA 1AQ7A 4QT8C 1TX7A 1FY8E 1O30A 3LH3A 1DXPA 1ELVA 1F0RA 2FI4E 3VFEA 1W13U 2HPQH 2A2XH 3GCTF 4SGAE 1D3QB 1O5GH 1ZZZA 1QNJA 1A46H 1DLKB 1KTTB 3M5NA 2GMTC 3ATMA 1TFXA 3EQ0H 4WMFA 1GBEA 2OQ5A 2IJOB 5BRRE 2AMPA 5JBCS 1MH0A 1EP5A 1ZPZA 1S84A 5GJ4B 1NESE 4YTAA 1P8VC 5A8YA 5G4BA 3RXVA 1B5GH 2GX4A 1C5VA 3A81A 1BT7A 1GL0E 1PYTC 3BEIB 4AORA 1CA8B 3NCLA 4X8SH 4JYTA 3ZZCA 1T8LA 3T25A 8GCHF 1AB9C 5L30H 2BDGA 3RLWH 3PYHA 1ELDE 3MHWU 4A5TS 5DP8A 1OP0A 1DS2E 2HVXA 1AUJA 1Z71A 2Q6GA 1O3PB 1TGSZ 4K2YA 1ZGIA 2EI8A 5EXMA 1P03A 3TITA 1KXDA 1EPTB 4B2BA 1H8DH 3LIWA 1PPCE 4IMQA 3RXDA 1GHZA 1OKXA 2ZPQA 2ZTXA 1O5AB 2ULLA 2VU8E 1ZSLA 1DSUA 1HDTH 1SOTA 2VWNA 3SGQE 1ESBA 1EKBB 2BY7X 2ZFSA 2WPIS 3UWIA 1AWHB 2TGAA 4IW4E 4Q80A 2G51A 1UTQA 3Q00A 1AO5A 2D8WA 1IHTH 2Y81A 2VJ1A 3L33A 1RS0A 1EZSC 1K1MA 2BD9A 5DK1A 1T4VH 5F8ZA 4M7GA 2AIPA 2TGPZ 4FUCA 1WAYB 2ALPA 4ABAA 2FPZA 1W0YH 3OU0A 1O36A 1XM1A 1EZQA 2NU0E 2O8MA 2D1JA 2BZ6H 1SL3A 1WUNH 3IG6B 4HTCH 1E38B 1KLIH 4X2VA 5DP7A 1NU7B 1WOFA 1SGFA 3RU4D 2PTNA 4KP0A 3GCHB 4OS5A 2FIRH 3RXJA 2F9NA 3V13A 3SJKA 2XC5A 1G37A 4TYDA 1NTPA 5CE1A 6GCHF 5EW1H 3SUDA 1C2KA 2PUXB 3RXRA 2BMGB 2SGQE 2O8WA 1EB2A 3ZV9A 3UUZA 4YOJA 1N6XA 3AW0A 3ZZ6A 1QB9A 1Y3VA 3H7OA 2BQWB 3SU2A 1GMHF 1GBLA 1O3AA 2ZCHP 4CRCA 3A89A 1P9SA 1HAPH 2FZZA 1BHXB 1QQ4A 2ODYB 3RU4E 1GCTB 3RU4T 2J38A 5DPAA 4AFQA 1BITA 3PMHB 3RP2A 3MMGA 3LJOA 1Z6EA 1Z1IA 2FX4A 2ZTYA 4UD9H 3PMAB 1UTKA 3ENSB 1JIMA 3UNQA 5SGAE 3H7TA 2PFEA 1O37A 1W3CA 3U8OH 2OTVA 1BTPA 5E0HA 2ZFRH 3NUMA 1TGBA 1B0EA 6GCHG 4Z0KA 1GBTA 1ZTKA 1ELGA 4AYYB 3AAUA 1QL8A 3DUXH 1VJAU 3BTTE 2H6MA 1JBUH 3M36A 3UNRA 1TMTH 4GLYA 1SC8U 1VITH 1SOZA 1XXFA 1GBMA 2A4GA 2J2UA 1TIOA 3GICB 4IMZA 1NY22 2RCEA 4RN6A 1J14A 2YNBA 2J92A 3AW1A 3A84A 1RIWB 2ZU4A 3T2NA 3UFAA 7GCHF 2CF8H 4A1VA 1G9IE 2P95A 1SLWB 1T7CA 1O34A 1HNEE 2BX4A 1C4U2 1PPBH 3T28A 2XTTB 2EA3A 1SHYA 2JKHA 2C8XB 1FDPA 4AB8A 2Q6FA 3SJ8A 1YPEH 3P17H 3RXPA 2QXJA 1D6WA 2ZDAH 2V0BA 4TPIZ 2LNCA 1P2NA 1C5XB 3A86A 5EW2H 1C2JA 2Y7XA 1SGRE 3LGIA 1Q2WA 4X6NA 5DKMA 4AFSA 3E16B 1K22H 1GVLA 4CRGA 1W7GH 3E90B 4ZROA 5DP5A 2AFQB 4A7IB 3PWBA 2BLOA 1BBRH 1LDTT 3RXIA 3SNCA 1TGCA 1GBHA 4TWWA 1D4PB 4DURA 2FESH 1S0RA 4H6TA 1GBBA 5TCCA 1TNIA 3ZZ8A 6CHAB 2P8OC 4YESB 3MO6A 2PKAB 1HIAB 2FS8A 3BTWE 3UR6A 3PMBB 2FYRA 3SGBE 1L1NA 2GVFA 3MU0A 5ABWA 2Z94A 3A83A 1V2KT 4NA7A 1HJ9A 3SUGA 5FBIA 4AG2A 3SZNA 4YZUA 1GDNA 2ZFFH 1KLTA 1YGCH 3BTFE 1ZRKA 1O2YA 1PFXC 1HRTH 3VB4A 2BQ7B 3TGJE 3F9FA 4ABJA 4ZKRU 4D9QA 3NKKA 1S82A 2A5AA 2CHAB 1W7XH 1OWIA 7LPRA 1DDJA 1MU6B 1TA6A 1MCVA 1BA8B 1YPMH 3BG4B 1FXYA 1L1GA 1TWXB 2FO9A 2H5DA 1F2SE 2DE8A 2P16A 4XDEA 1V2MT 1J16A 4ISNA 1ELBA 4NZLA 4DCDA 4WF8A 1E36B 3KGPA 1S85A 3STJA 4I8GA 3STIA 3NK8A 3BIVH 2UWPA 2UWOA 4TPYA 4CH8B 1LKAA 1LHEH 1L0ZA 4Y6DA 2WYGA 1S81A
chains in the Genus database with same CATH superfamily
4HGCA 1C5SA 1EJMA 1TNHA 3E91A 4K69A 5C1UA 1SKYE 3PV2A 1QL7A 4CRFA 1AHTH 2ZDLA 1C1UH 5GIBA 1YC0A 1UCYH 3U9AH 3A85A 4IN2A 1VZQH 3E0NB 1FPHH 3PO1B 2KX4A 1LHDH 1IQIA 4MPVA 5DP4A 1EP6A 1BQYA 1A2CH 1D3DB 1TE0A 2JETC 5E8EH 1O2TA 3SI4H 3SNEA 2FI3E 5C94A 1CQQA 3F9HA 2WV9A 4HG6A 5TJXA 4K5ZA 3LKWA 1RJXB 2BY8X 3GDVA 1W0ZU 2ZHDA 4F4OC 1QGFA 2GT7A 4UE7H 3PWCA 1XUJA 2V3OH 3CS0A 4YM9A 1QA0A 1V3XA 1DANH 1O38A 3SU1A 1TA2A 2BTCE 3RXUA 1MTVA 5LPRA 1O3CA 1MZDA 2QF0A 3ITIA 1QRXA 4I32A 4F49A 2QF5A 1AD8H 1NRQH 1O2WA 4O97A 3HKJB 1O2GH 3MWIU 2PKSC 3MH6A 4KTSA 1E1QD 5AFZH 2GT8A 1GHVH 1K1IA 1IHSH 1HCGA 2WPKS 3RXKA 1QCPA 3ELAH 4LK4A 2I6SA 2ZZUH 1SQRA 1GBFA 1BCUH 1U6QA 1Y3YA 5E2PA 1SFIA 1UVPA 1MTNB 5GNDA 4MTBA 4U2WA 1QR3E 1V2ST 4RI0A 4X8TH 3ZVDA 2VIVA 1FUJA 1Z6JH 2AHME 4J2YB 1OP8A 4AFUA 5FPSA 2H2ZA 1CHGA 2ZDKA 1FAXA 1NS3A 2V3HH 7KMEH 2ZDVH 1K9OE 3BV9B 3SOSA 5T6DA 3EDXB 3L6PA 4ZKNU 2LPRA 3HK6B 2HNTF 1BTXA 3SYJA 3DSPA 1HXEH 1GG6B 1FZZA 4YT6H 1INCA 5EOKA 3U8TH 1H9LB 2QN5T 2ZPRA 1C5MD 1W2KH 3F0OA 1GI1A 2GCTC 4KELA 1OOKB 4FUDA 2VIQA 1QB1A 4JYUH 1G32B 1ZMJA 4XFQA 4ABIA 1THSH 1TPAE 1Y59T 1BOQA 2PLXA 3LGTA 1SVPA 2TGTA 1ZRBA 1C5NH 1SGEE 1GMDF 2FEQH 2ZU2A 5EJZA 1GVZA 1ZTJA 1SMFE 2UUJB 2Y80A 5HYOA 1A5HA 1MKWK 1C5YB 1F7ZA 1VCWA 3VXEH 2ZNKH 2UUYA 1HBTH 1T32A 3U1JB 3R3GB 1AVGH 1EATA 1GJ8B 3RXMA 4UFFH 3PV4A 2W7UA 1C1RA 1HAVA 1HIAA 2STBE 4X1PU 3N99A 4K8BA 4ZCNA 2C3SA 2NU4E 3SO3A 3KHVA 5GCHG 3S9BA 1DSTA 1O3BA 4KGAA 2H1UA 4FXGH 4JZ1A 4ZMAH 4YLQH 1O3KA 2FOCA 2CXVA 4GPGA 2AEIH 2Y6TA 3A7ZA 1GI6A 2HGTH 5JDUB 1GMDG 1NFUA 1EZUC 1FONA 2DE9A 3SN8A 2F9VA 1TQ7B 3TGKE 1SG8B 1OWJA 1ZMLA 1CGIE 5JYIA 3MH5A 1A3BH 1PJPA 1ELFA 4ESTE 2CMYA 2STAE 1AZZA 1O3MA 2XNIA 1T8OA 4KTCA 1LVYA 1KTSB 4P00A 2VGCB 4RKJB 4MNYA 4NGAH 3EA7A 3FVFB 2KCOA 2OCVB 3K9XB 1IQHA 1CE5A 2BLWA 3QX5H 4DY7B 3KYFA 1IQJA 4I8JA 3PROA 4OS1A 2Y5GA 1QBNA 5DP6A 3VPKA 2FOEA 3F1SB 1GBDA 4PROA 2G4UA 3FN8A 3IITA 4AOQA 1YLCA 2ZGXH 3LGWA 4CHAB 1WCZA 3CENA 1Y3WA 3KQDA 2KR7A 1MQ6A 3SU0A 4Y76A 1GDUA 3SORA 4CRBA 1YPJH 1DWEH 1LPZB 2GD4B 3ZZBA 2A4RA 2AIQA 3MTYA 4NSYA 1L4DA 3NPSA 1P2IA 3RM0H 3GYLB 4ZHAA 4FU7A 2B9LA 2B5TB 1ZMNA 3RXHA 2VNTA 1MD8A 5EODA 1LMWB 1EUFA 1GI5A 1NRRH 1VGCB 1H9HE 1KXAA 1HJAC 4FUIA 3MU8A 1CT0E 3L3TA 1G36A 1O2JA 2EC9H 1TNJA 5LGOA 4THNH 4TT3D 1XUIA 4NIVA 1BRUP 5GWZA 3OFND 3OAAD 3I29A 1O2UA 2QY0B 3VB5A 2P94A 2QA9E 3PRDA 3TH2H 1GMCF 5FBEA 1BRCE 1QURH 2QXGA 4DOQA 3BN9A 1O2SA 3WWFA 5ESBA 3SV7A 5KECA 4B2CA 1NC6A 3NXPA 3VB6A 1ANDA 1YCPK 1BMAA 1MAXA 1UVUH 2QIQA 1A0JA 1O3NA 3MU4A 4OS7A 1WYKA 4DGJA 1AVWA 1C9PA 2OXSA 3OEHD 4FVDA 2J34A 4X1NU 3S0NA 2R0LA 2YOLA 2QF4A 2QV1A 1G30B 2PR3A 2HPPH 2PSYA 3W95A 3C1KA 1NU9A 3A82A 5DGJA 5E0JA 2HWLB 3QUMP 5A8ZA 2Z9JA 1GL1A 1V2PT 2VVVA 2XYAA 1SQAA 4Y79A 1VR1H 2GDEH 1NRPH 3NZIA 1PPFE 3M5OA 2ILNA 5FAHA 1HAIH 4MNVA 2GCHF 2PTCE 2Z6BD 3R0FA 1MD7A 1V2OT 1NFWA 3SNAA 1VITF 4A6LA 2C4FH 4OS6A 1O2QA 1K1NA 1DX5M 3M35A 3PLKA 3OTJE 2Y7ZA 1P2JA 1AZ8A 2ANMH 1CHOF 1QA7A 5ESTE 1TPPA 4O03A 1UMAH 5C2ZA 1TNGA 3N7OA 4I8HA 1FY3A 4Y11E 3GCTG 1HAGE 2HRVA 2O8TA 1ACBE 4Z6AH 1TRMA 2FX6A 4KTUA 2VBCA 3LONA 2B8OH 1DWBH 2PGQB 1ZR0A 3EE7A 4P02A 5EG4A 1H8ED 4NA8A 2YMSD 5HMAA 3OEED 5B6OA 1TALA 3W1EA 1GPZA 1PQ7A 1UTJA 5KGOA 1O2VA 1OS8A 4BAMB 1D3TB 3SBKA 2SFAA 1OP2A 2DUCA 1DOJA 2Z9KA 3ATLA 1C5QA 3KQ5A 1PQ5A 2RG3A 3LGVA 3UR9A 3SV8A 1BTHH 2Y82A 3RM2H 2A5IA 3PLBA 1GHBF 4Y8XA 4WH8A 8GCHG 5EIYA 1N8OC 1H8IH 1CBWC 3SHCH 1CGHA 4I31A 1UK4A 1ZJDA 4HFPB 3KQBA 4AX9H 2PSXA 3DFJA 4R0IA 1DLEA 3T62A 2YNAA 3BG8A 3UB0A 4A1TA 2BDBA 1EOJA 1BMNH 1SLVB 2QGRA 3TH3H 3A8BA 3I78A 4YLUA 1HLTH 2EEKA 4BTUB 1GGDC 1KXEA 1FI8A 5FXLA 3VG8A 4BXSA 1A1RA 1P06A 4ZH8A 3UY9A 3EGKH 3KCGH 3FZZA 5EXLA 1C5WB 1ETTH 2P3FH 2XC0A 4U32A 1QBVH 4DT4A 3LGYA 4X1QU 1QB6A 4ACBA 1MBQA 5L6NH 1Z8IB 2B7DH 4Y71A 2GTBA 1C1TA 4ABDA 2FDAA 2XBXA 4CH2B 4I8KA 2F9PA 3BTKE 2W5EA 1A5GH 4NIWA 3O8RA 2KAIB 3BEFB 1YBWA 4SGBE 5HM9A 4INLA 1XVMA 2F91A 4ZXXH 1O33A 1C2IA 1OYQA 1O2KA 1D6RA 1FV9A 3QK1A 3PLPA 2HNTE 4VGCB 2XBWA 5ETXA 2BVSH 1ABIH 4K8YA 3SGAE 4MPXA 1TONA 3ZYDA 5CHAC 4HZHA 1UK3A 2FOBA 1W12U 4BNRA 5DP3A 3VB3A 2TGDA 4INKA 2TIOA 1HUTH 2AMDA 4K1TA 5TCAA 4FUGA 3PTBA 4CR5A 1MBMA 2J97A 8LPRA 1BMFD 1GI0A 2ANWA 1IQEA 3K6YA 1WTHD 5KEDA 1EAIA 2K0QA 2VINA 1BJUA 1E37B 1W8BH 2ZC9H 1GMHG 4IBLH 3V12A 2M2AA 2FYQA 5LPEA 1C9TA 5EQQA 2XWAA 4LOYH 1TX6A 2OLGA 1T8MA 1MTWA 2O8LA 4MPWA 5DN6D 2A2QH 2ZECA 3HPTB 1O31A 2BY6X 1GJAB 2R2MB 2C8ZB 2JH5D 1IQLA 5PTPA 3BSQA 1O3EA 5E0GA 3TH4H 3UPEA 5FL7D 1YY3A 2BQ6B 3QLPH 5C0TA 3PTNA 1O2NA 4WVPE 4Q63A 1NROH 4ABEA 3ODDA 4CBOA 2A45B 3GCOA 1SLXB 1RD3B 1AN1E 4AZ2B 2A7JA 5FPTA 2BD4A 5GDSH 1UVTH 1TPOA 1FY4A 1QRWA 1MTSA 1ARCA 1SQOA 1ZGVA 1NBMD 1B7XB 1C5TA 4FVBA 3MI4A 1HV7A 2ZO3H 4GCHF 1Z1JA 1VCQA 2F9OA 2H9EH 1TGNA 7GCHG 1S0QA 1SHHB 2FOMB 3S7HB 1ORFA 5K0HA 3ZZ4A 1QRZA 2Z9GA 1C1MA 4WWYA 1M9UA 2OC1A 4NWKA 1UW7A 1UTLM 2BD2A 5A0CA 2ZU5A 4XBBA 2VWOA 1WBGB 4E06H 1HAVB 2F9BH 1UO6A 4K1SA 2ANYA 1FIWA 3GY6A 1Z8GA 2GKVE 2FTMA 1H1BA 1NN6A 1UVSH 2Z9IA 4R8TB 5F8XA 3ZVFA 3UQVA 3RC4A 3KEEA 3GY7A 2R3YA 1EPTC 4H4FA 1IQKA 2A4QA 2KZ4A 4Y10E 1ANCA 2K1QA 1DXWA 2XCFA 1THRH 4UEHH 5T3HA 2ODQA 1CA0B 4AB9A 3GY3A 4FUJA 4ZHMU 2NU1E 1O3HA 1HB0B 3B23B 3W94A 1VCPA 1ELAA 3A87A 2SNWA 1P9UA 5EXNA 1DWDH 2KFWA 1UJ1A 4I33A 3DA9B 2HLCA 1C1SA 1DFPA 1C2LA 1GJ4H 2UUFB 2JDID 3EA8A 1BB0B 2AGGX 1MKXK 4XSKU 3K65B 1GI8B 4HI3A 2ZFTA 2OUAA 3S69A 5L2YH 1CSOE 4OS2A 3FAOA 1IQGA 1HPGA 1TGTA 2QE7D 3BTQE 4OM9A 2VWLA 2C8WB 3S7KB 1BBRK 4D76A 3K2UA 3DCLA 1BHXF 4ZAEA 4RT0A 4JZIA 4ABFA 1P11E 3OX7U 3VXFH 4UFGH 2WUCA 5C67A 2P3TB 1N6YA 2FLBH 1O5EH 3MH4A 3CS7A 3GS9A 3E8LA 1LHFH 2Y5HA 1O3DA 3TLOA 3GCHC 3MH7A 1QHRB 2CV3A 4X2XA 3E6PH 2KAIA 1DICA 2J95A 2WSSD 2HOBA 3RC5A 4BOHA 4MDSA 1IQFA 4E7RG 1WQVH 3IWMA 2WZQA 1O32A 4TWYA 3RXBA 2O9QA 1AKSA 3KL6A 1TNLA 1H4WA 2H9TH 5EQSA 3P8NA 1AFQB 3S9AA 1P2OA 3P8GA 2BYAX 5C1YA 1YYY1 3V3MA 3BF6H 1DUAA 2OBQA 2UWLA 1XMNB 1ABJH 1GCTC 2I6QA 1W14U 1O2MA 2TRMA 4Y7BA 3CNRA 4ASHA 1P01A 1BIOA 1GI9B 4K3JA 4LZ1H 2AGEX 1C1NA 1KIGH 1O3OA 5I46H 3VGCB 2BXTH 1HAZB 2PWXA 2ZHFH 3AVZA 3UOPA 4GSOA 4ASUD 2FLRH 3TU7H 1FPCH 4ZKSU 4Q2KA 3HGNA 2ZGHA 5AVDA 2OBOA 2RFKC 4JCNA 2C93B 4BAKB 3O8DA 4O9VA 1G2MA 3RMMH 2CGAA 1GJ9B 1KSNA 2AERH 1C2MA 4INHA 4CR9A 5FX5A 1TABE 2WUBA 2P59A 1C1VH 1ESAA 1S6LA 1QY6A 2GDDA 2YMSC 3ZYEA 2GMTB 5FCKA 2W7SA 4Y7AA 1OHHD 1RRKA 3OY5U 5AF9H 1RFNA 3A7YA 5EPNA 1RIWC 1ZTLA 2ZHQH 4YO9A 4GAWA 4O3TA 5IDKA 1TX8A 1C1PA 1YKTA 1YP9A 4FETA 5FHTA 2BD8A 3VEQB 1SLUB 2SGEE 1QJ7B 2QXHA 2ZDNA 3A7VA 3QO6A 1K21H 1WU1A 1BBRE 1XXDA 2BY9X 2G4TA 5JPMH 1C5PA 4ISHH 3TK9A 2Z9LA 4D7FA 2IPQX 4UDWH 5JB9S 3HKIB 1LVMA 1AB9B 4XOJA 5A09A 3ATWA 3TJOA 2ASUB 1YCPM 2ZQ2A 1SQTA 3MOCA 2VIOA 3F2HA 1MZAA 2BVRH 4YOIA 1WQSA 1XX9A 3BTHE 4Q7XA 3GOVB 4FUEA 3RXTA 3MO9A 3GY4A 1JIRA 2BD3A 4RT1A 2ALVA 1SFQB 1LVOA 2SGAA 1XKAC 2WYJA 3RMLH 1QL9A 3M3VA 4O3UA 1NZQH 4YOGA 8KME2 1GJ6A 3HGPA 1V2WT 3OTPA 1OYTH 1E1RD 2PHBA 2J4IA 3F9EA 3QGJA 1TBQH 6ESTA 1Y5BT 4E7NA 4WXIA 2HNTC 4LZ4B 2PGBB 3UIRA 4AGJA 4Y8YA 3TJNA 5EQRA 3RLYH 4E05H 1TOCB 4Q7YA 6CHAC 1O3GA 5T6GA 3QN7A 1BMLA 2ZKSA 1SR5C 1AI8H 1P2MA 1JWTA 1YPKH 1EJAA 3GY2A 2ZGJA 1KDQA 2EY4C 2VVUA 3MQKC 2BX3A 1QIXB 1LCYA 3RMNH 1YPLH 3ZZ9A 8ESTE 1AIXH 3U1IB 2XW9A 3ZZ5A 1YWUA 2VH0A 1C5RA 2FS9A 2PP6A 1KY9A 4D7GA 5BPEA 1C2HA 2P3UB 2FMJA 5HIYA 2XCNA 3PM3A 5H4IB 1S6HA 4YXWD 1XKBC 2F83A 2VWMA 1UTNA 3BTGE 3LOXA 5HXFA 2BD5A 4H6SB 3RXGA 3SW2B 1V2VT 5C1XA 2CHAC 1BMMH 1BUIA 3TJVA 4DIIH 1L4ZA 3SJ9A 2QCYA 2G55A 3BG4C 3SQEE 1DITH 1UVOA 1JXPA 1O2OA 1WXRA 2VIPA 3Q3XA 3LPRA 3SJOA 1TPSA 4ACAA 1F5LA 5HGGA 1Q3XA 2TBSA 5C17A 1FY1A 1IAUA 1AE5A 1NT1A 3MO3A 1WV7H 3KF2A 5F03A 1DM4B 2ZWLH 4NFFA 1QFKH 1GI3A 3UTUH 3GISB 2ANKH 1A0HB 1YCPH 3HATH 5EU8A 3ODFA 4CRDA 1BRAA 3JZ2B 3GY5A 2JH6D 1TMUH 3E3TA 4WXVA 3T26A 1LPGB 3DFLA 3GDUA 3LGUA 4GVUA 4RSPA 2XBYA 3PO1C 1GBKA 2AMQA 1OXGA 2A1DB 4BTIB 4UONA 1ETRH 3A7TA 1VJ9U 1DY9A 1DY8A 1CGJE 3C27B 3TNTA 2R2WU 1MQ5A 4IGDA 5EPYA 4X6PA 3AASA 1SB1H 3MNBA 5AHGH 4D9RA 4X0WU 2ZCKP 1HGTH 2ZCLP 4ZXYH 1V2NT 1IOEA 2G81E 1KXCA 1F0SA 2FWWA 3RC6A 5DO4H 3LJJA 1GJBB 2BVXH 4I8LA 4MNWA 1O5CB 2WPJS 1GHXH 2BDCA 3M5MA 1SGYE 2ZP0H 3QWCH 3F68H 1EAXA 1K1JA 3ZVCA 3FP6E 1ZJKA 5C3NA 5JBTA 4B74A 1GJ7B 1TB6H 1O3LA 1KLJH 1SPJA 2W3KA 2XNDD 1C2GA 1TAWA 1E79D 5FPYA 1AU8A 1EQ9A 3B8JA 1ZHRA 1G3DA 4MPUA 3U69H 1IQNA 1WSSH 1GMCG 3B9FH 4XBCA 1GHYH 2K8IA 3MU5A 1MTNC 2ZTZA 1UHBA 4XBDA 4K60A 1P12E 3OE7D 3GYMA 4ABHA 5I25A 1ANEA 1JRTA 4B71A 2GZ7A 3DSGA 2XWBI 3KQCA 2CJIA 1O2HA 1K0HA 3UQOA 2ZQ1A 3O8CA 4MVNA 1D9IA 5C5NA 2OD3B 3TK6A 1GG6C 2R9PA 1HAHH 5DP9A 3HK3B 4U01A 2GZ8A 5FCRA 4ABGA 2J5UA 2Z3DA 1OWKA 1O35A 3GY8A 2GV6A 1DPOA 2GGVB 4TSFD 3RXLA 3SV9A 4OS4A 4UFEH 1Y3UA 5EJ1A 3U8RH 2P8OB 1GBCA 5C20A 2BLVA 2VB0A 2GCHG 3GCNA 2GV7A 3SNDA 3F2FA 2R3UA 2THFB 4JZFH 1VITG 4FUBA 3WY8A 1UTPA 1RGQA 3QDZB 1AMHA 2M5TA 3P6ZB 4B1TA 1C1QA 2XBVA 4CRAA 2PV9B 2F9UA 1CHOG 3KYGA 1NRSH 1LQEA 4MLFB 2VH6A 2Q1JA 3FKSD 1BTZA 3Q76A 3QGNB 3JZ1B 3ZVGA 5L2ZH 4I7YH 3M7QA 4AFZA 5J4SA 2SGFE 3EAJA 3SJIA 2ZU3A 4JZEH 1CVWH 2A7CA 1D3PB 1EJNA 1F92A 1Y3XA 3P8OA 4TY7A 4ABBA 3ZZ3A 2VIWA 2TPIZ 2ZDMA 1UK2A 2BOKA 1S5SA 1OWEA 2D2DA 1TRNA 3M3SA 1TLDA 3ATIA 1XVOA 3SU4A 4WMDA 1F0UA 1O39A 1Y5UT 3ZVAA 1RTFB 4Q7ZA 2NU3E 4OGYA 2L6OA 2OQUA 3PV5A 3URDA 2QXIA 1GBIA 1GHBG 1P3CA 1FIZA 1SGFG 3SU5A 3LU9B 3ATKA 3FO8D 3N7DA 2VGCC 3M7TA 1C4Y2 3P92A 5C5OA 4UFDH 2JJ2D 9ESTA 5DG6A 3Q3YA 3A88A 1RTLA 3QZQA 3D23A 1TNKA 1LVBA 3F3BA 1PPHE 1QBOA 2NWNA 3RUOA 2G52A 2J9NA 4X6MA 2CK3D 3BTME 2JETB 1AKSB 2AH4X 2IOTA 2Z7FE 2SNVA 4CHAC 3QZRA 4X8UH 1MMJN 2AGIX 4OGXA 1LTOA 3FFGA 2ZFPH 2F43B 1ZHMA 1O2LA 4JZDH 4NG9H 1O3JA 2JIZD 4NZQA 1GBAA 2FTLE 1MU8B 1Y8TA 2BLQA 2A5KA 1C1OA 1WTGH 5K7RA 1Y5AT 4X1RU 1EOLA 1V6DA 2R0KA 1BTUA 1W0KD 1SGDE 1HXFH 3V0XA 4GHQA 3TIUA 5HM2A 3V7TA 1C5ZB 1B0FA 1XUHA 1WDIA 1VGCC 4X8VH 1J9CH 4NIYA 2PKSB 4ZUHA 3SU3A 4KKDA 4BAOB 3LH1A 1FN8A 1XUKA 2BHGA 3RXAA 3ZVBA 4BXWA 2QAAA 1AFEH 2G00A 1MAYA 2O8UA 4BANB 1C5OH 1ESTA 1GI2A 1C2FA 1SGQE 3F6UH 1HFDA 1YPHC 1TQ0B 4FU8A 2C8YB 4XD7D 5A0AE 2BDYA 3RMOH 2XC4A 5F6MA 2WINI 1E35B 1Q31A 4DIHH 3PRBA 3GDSA 2WPLS 4A92A 3U98H 3KNXA 2SGPE 2GZ9A 3H5CB 1MTUA 1GWAA 4DVAU 1PPZA 4WY3A 4D8NA 5GXPA 1QJ6B 4X1SU 4GHTA 5E2OA 9LPRA 1P2QA 4NCYA 1C5LH 1QTFA 1QQUA 1MCTA 2GCTB 1NPMA 2BOHB 1O3FA 3DSOA 1SGTA 3QTVH 1QZ8A 1YLNA 2OC8A 4B6EA 4DJZB 3M5LA 4JYVH 2XXLA 4NA9H 2BDHA 4DT7B 1P04A 1V2TT 1V2JT 1EFRD 5IYTA 1IQMA 2ZHEH 3QTOH 1LO6A 1O2PA 1T8NA 4XRNA 1ZOMA 2ZU1A 3ESTA 3UWJH 2HLDD 5EGMA 1DWCH 3A80A 1UTMA 3NWUA 4X6OA 1ID5H 1CU1A 1EASA 1G2LA 1MKXH 1O5BB 1V2UT 1S83A 2OINA 2WHXA 1OPHB 4DG4A 1ELEE 1NBME 3KQEA 1P2KA 1E34B 1EB1H 1EPTA 2A32A 2ESTE 3SV2H 2BDIA 1O2IA 2G5VA 1P05A 2BM2A 2D26C 4GCHG 1KMHB 1HYLA 2ZFQH 2A7HA 3TPIZ 1O0DH 1E0FD 1K28D 1KDQB 1ZSKA 2WPMS 3F9GA 4NFEA 1F5RA 5GPIB 1GJDB 1O2ZA 4TY6A 1ZPCA 3P8FA 2V3MA 3P95A 1C5UA 1PYTD 1KXFA 2AS9A 1OWDA 2KM0A 2V7QD 4ZHLU 3LC3A 3AAVA 1XUFA 5AFYH 1V2RT 4BAHB 5CMXH 5CHBA 3M3TA 3PMJA 3ZZAA 3T5FH 3SHAH 3UREA 1O5DH 2G5NA 1C2DA 1JRSA 1OSSA 3FANA 4B73A 1G3CA 1DT2A 5C0UA 1FQ3A 2FODA 3OSYA 1O2XA 3EE0B 4CBNA 1C4V2 2F3CE 3TK5A 1EAUA 2W26A 1TMBH 2P93A 1ZHPA 4LXBH 4U30A 3WW7A 2VVCA 1V2QT 4X2YA 1ZPBA 2Z3CA 3EYDA 5JBBS 1YPGH 4B76A 3Q3KA 4Q4LA 1GI4A 4AN7A 3D65E 1Z7KA 2GJGA 1H8HD 4MQAA 2JH0D 1GHAF 1L1JA 2H5CA 3TVJB 1K1OA 2C90B 3SQHE 1ZLRA 1BTYA 3G01A 4FOUC 1K1PA 3MNCA 4I86A 1W10U 2QF3A 1KYNA 1HJAB 1AY6H 1COWD 2GP9B 3T27A 1PQAA 5F53A 3I77A 4NWLA 4CREA 2A31A 1YM0A 1P3EA 1O5FH 2ZPSA 4VGCC 1HJ8A 2A4OA 2RA0A 1AUTC 2BY5X 2FI5E 1T4UH 1EX3A 1G3BA 2BXUH 3RXFA 3BEUA 3SU6A 5A8XA 2J94A 1SSXA 1AVXA 3KIDU 3BTEE 1ZSJA 1DE7H 2KCPA 2CF9H 1GHAG 2QC2A 5DJ7A 1UCYK 1FMGA 1NM6A 2W3IA 3E0PB 1FAKH 4JMYA 2FOFA 1BTWA 6LPRA 2EI7A 3A8AA 4IC6A 1PPGE 2HVYB 1EZXC 5A0BA 1X7AC 3DD2H 1NFXA 4Y8ZA 1FLEE 1JOUB 1S6FA 2IN2A 2V35A 4J1YA 1MKWH 1XUGA 1ZYOA 4H42U 2H9HA 1H9IE 4B75A 4JK5A 1P0SH 1L2EA 4FUHA 3RXSA 1MUEB 4AC9A 1UHBB 1N1LA 1CO7E 3M61U 3KN2A 2EI6A 4ISLA 1F5KU 1FN6A 1HAOH 2ZI2H 5JB8S 1OX1A 1LHGH 2ZEBA 3ZZ7A 2FP7B 2WV5A 1K2I1 1NO9H 3CP7A 1AWFH 3BTDE 4WMEA 3UNSA 1GI7B 1RXPA 2AYWA 3BIUH 1LPKB 3FP7E 3K6ZA 3ZZDA 5LH8A 5GCHF 1YF4A 1HAXB 2FOAA 3D49H 4AYVB 7ESTE 5LPFA 1A61H 2RA3A 4ISIH 4DW2U 2B0FA 4FUFA 1DUEA 3MYWA 3Q77A 3F0PA 2OC7A 1P09A 1SI5H 1THPB 1Z8RA 2PW8H 1ELTA 2WPHS 4GUXA 1ELCA 1LQDB 3URCA 1FX0B 5JBAS 2Q6DA 1FNIA 2NU2E 4MNXA 1W0JD 1J8AA 3O8BA 1W11U 1N8OB 1YPHE 1BRBE 3OYPA 3LC5A 1CBWB 1TRYA 1G3EA 2J98A 1NFYA 3RXQA 1YLDA 2PKAA 1GCDA 3E1XB 3FP8E 4NSVA 3RDZA 1ARBA 3FZDA 2IJD1 1BJVA 2Z3EA 1PQ8A 1PPEE 4Y0YE 1GBJA 1A5IA 1A3EH 2FM2A 2OC0A 3MU1A 1HAYB 1P02A 1EAWA 3OY6U 2ZG0H 4BAQB 2UUKB 1O3IA 3SV6A 2ZGBH 2ZHWH 1VKYA 1QJ1B 1Z8JB 3SUEA 1C1WH 1EXFA 5J4QA 1CA0C 1GJ5H 1SBWA 1SGIB 3RXCA 4JK6A 2A0QB 2ZGCA 3MNXA 1GGDB 3MFJA 2ZF0H 1C2EA 3A8CA 4XE4A 3ZV8A 1TBRH 1UCYE 5EJLA 2Y5FA 3A7XA 3DHKH 2BD7A 2SGDE 2PUQH 1K1LA 1NRNH 3M37A 1SGNE 2OP9A 5FX6A 1TYNA 5DSFA 1RTKA 4AG1A 1SGPE 1F0TA 3TJUA 1P57B 3SUFA 2G8TA 1TOMH 4A1XA 2BZAA 3A8DA 1GHWH 3SI3H 3P70B 2QYIA 4ISOA 1J17T 1O2RA 3SNBA 1CT2E 1FY5A 3M7UA 2V6NA 4MG3A 1GDQA 1LHCH 3WWBA 1A0LA 4RKOB 3LDXH 4WH6A 4B2AA 1GJCB 4IC5A 1FJSA 3LT3A 1A7SA 4IS5A 2BDAA 4ZKOU 1ANBA 5CHAB 2BB4A 3T29A 3RXOA 1KXBA 1BDAA 3PB1E 1A4WH 3A7WA 5T6FA 1UTOA 2JJ1D 1P10A 4WJG2 4Y0ZE 4B6FA 1AGJA 1T31A 3TGIE 1CT4E 2XOKD 1TBZH 2IPHA 3MNSA 4FU9A 3TNSA 1AFQC 3RXEA 4NIXA 3VB7A 2CN0H 2WPDD 1LKBA 4BTTB 2HALA 3ZVEA 1JMOH 4IN1A 4YT7H 3S9CA 2VIDA 3UOUA 3U28C 2ODPA 2XRCA 2OK5A 4K1EA 1OWHA 2FOGA 5A2MH 3D62A 3EA9A 1SGCA 2WV4A 1V2LT 2ZIQH 4X2WA 2FXRA 1DVAH 3DT0H 1BZXE 1ETSH 2ZA5A 3VGCC 2RDLA 4AGKA 1AE8H 1GVKB 5F8TA 1J15A 2FOHA 1AQ7A 4QT8C 1TX7A 1FY8E 1O30A 3LH3A 1DXPA 1ELVA 1F0RA 2FI4E 3VFEA 1W13U 2HPQH 3N7EA 2A2XH 3GCTF 4SGAE 5HKKD 1D3QB 2W6ID 1O5GH 1ZZZA 3ZIAD 1QNJA 1A46H 1DLKB 1KTTB 3M5NA 2W6JD 2GMTC 3ATMA 1TFXA 3EQ0H 4WMFA 1GBEA 2OQ5A 2IJOB 5BRRE 2AMPA 5JBCS 1MH0A 1EP5A 1ZPZA 1S84A 5GJ4B 1NESE 4YTAA 1P8VC 5A8YA 5G4BA 3RXVA 1B5GH 2GX4A 5HIZA 1C5VA 3A81A 2LELA 1GL0E 1BT7A 1PYTC 3BEIB 4AORA 1CA8B 3NCLA 4X8SH 4JYTA 3ZZCA 1T8LA 3T25A 8GCHF 1AB9C 2F4LA 5L30H 5T1VA 2BDGA 3RLWH 3PYHA 1ELDE 3MHWU 4A5TS 5DP8A 1OP0A 1DS2E 2HVXA 1AUJA 1Z71A 2Q6GA 1O3PB 2KCAA 1TGSZ 4K2YA 3FOAA 1ZGIA 2EI8A 5EXMA 1P03A 3TITA 1KXDA 1EPTB 4B2BA 1H8DH 3LIWA 1PPCE 4IMQA 3RXDA 1GHZA 1OKXA 2ZPQA 2ZTXA 1O5AB 2ULLA 2VU8E 1ZSLA 1DSUA 1HDTH 1SOTA 2VWNA 3SGQE 1ESBA 3AK5A 1EKBB 2BY7X 2ZFSA 2WPIS 5IK2D 3F2GA 3UWIA 1AWHB 2TGAA 4IW4E 4Q80A 2G51A 1UTQA 3Q00A 1AO5A 2D8WA 1IHTH 2Y81A 2VJ1A 3L33A 1RS0A 1EZSC 5CDFE 1K1MA 2BD9A 5DK1A 1T4VH 5F8ZA 4M7GA 2AIPA 2TGPZ 4FUCA 1WAYB 2ALPA 4ABAA 2FPZA 1W0YH 3OU0A 1O36A 1XM1A 1EZQA 2NU0E 3H09A 2O8MA 2D1JA 2BZ6H 1SL3A 1WUNH 3IG6B 4HTCH 1E38B 1KLIH 4X2VA 5DP7A 1NU7B 1WOFA 1SGFA 3RU4D 2PTNA 4KP0A 3GCHB 4OS5A 2FIRH 3RXJA 2F9NA 3V13A 3SJKA 2XC5A 1G37A 4TYDA 1NTPA 5CE1A 6GCHF 5EW1H 3SUDA 1C2KA 2PUXB 3RXRA 2BMGB 2SGQE 2O8WA 1EB2A 3ZV9A 3UUZA 3NRLA 4YOJA 1N6XA 3AW0A 3ZZ6A 1QB9A 1Y3VA 3H7OA 2BQWB 3SU2A 2EQNA 1GMHF 1GBLA 1O3AA 2ZCHP 4CRCA 4F55A 3A89A 1P9SA 1HAPH 2FZZA 1BHXB 1QQ4A 2ODYB 3RU4E 1GCTB 3RU4T 2J38A 5DPAA 5B6LA 4AFQA 1BITA 3PMHB 3RP2A 3MMGA 3LJOA 2LP6A 1Z6EA 1Z1IA 2FX4A 2ZTYA 4UD9H 3PMAB 1UTKA 3ENSB 1JIMA 3UNQA 4F48B 2RDEA 5SGAE 3H7TA 2PFEA 1O37A 1W3CA 3U8OH 2OTVA 1BTPA 5E0HA 2ZFRH 3NUMA 1TGBA 1B0EA 6GCHG 4Z0KA 1GBTA 1ZTKA 1ELGA 4AYYB 3AAUA 1QL8A 3DUXH 1VJAU 3BTTE 2H6MA 1JBUH 3M36A 3UNRA 1TMTH 4GLYA 1SC8U 1VITH 3UAIC 1SOZA 1XXFA 1GBMA 2YMSB 2A4GA 2J2UA 1TIOA 3GICB 4IMZA 1NY22 2RCEA 4RN6A 1J14A 2YNBA 2J92A 3AW1A 3A84A 1RIWB 2ZU4A 3T2NA 3UFAA 7GCHF 2CF8H 4A1VA 1G9IE 2P95A 1SLWB 1T7CA 1O34A 1HNEE 2BX4A 1C4U2 1PPBH 3T28A 2XTTB 2EA3A 1SHYA 2JKHA 2C8XB 1FDPA 4AB8A 2Q6FA 3SJ8A 1YPEH 3P17H 3RXPA 2QXJA 3SZEA 1D6WA 2ZDAH 2V0BA 4TPIZ 2LNCA 1P2NA 1C5XB 3A86A 1MABB 5EW2H 1C2JA 2Y7XA 1SGRE 3LGIA 1Q2WA 4X6NA 5DKMA 4AFSA 3E16B 1K22H 1GVLA 4CRGA 1W7GH 3E90B 4ZROA 5DP5A 2AFQB 4A7IB 3PWBA 2BLOA 1BBRH 1LDTT 3RXIA 3SNCA 1TGCA 1GBHA 4TWWA 1D4PB 4DURA 2FESH 1S0RA 4H6TA 1GBBA 5TCCA 1TNIA 3ZZ8A 6CHAB 2P8OC 4YESB 2J98B 3MO6A 2PKAB 1HIAB 2FS8A 3BTWE 3UR6A 3PMBB 2FYRA 3SGBE 1L1NA 2GVFA 3MU0A 5ABWA 2Z94A 3A83A 1V2KT 4NA7A 1HJ9A 3SUGA 5FBIA 4AG2A 3SZNA 4YZUA 1GDNA 2ZFFH 1KLTA 1YGCH 3BTFE 1ZRKA 1O2YA 1PFXC 1HRTH 3VB4A 2BQ7B 3TGJE 3F9FA 4ABJA 2L74A 4ZKRU 4D9QA 3NKKA 1S82A 2A5AA 2CHAB 1W7XH 1OWIA 7LPRA 1DDJA 1MU6B 1TA6A 1MCVA 1BA8B 1YPMH 3BG4B 1FXYA 1L1GA 1TWXB 2FO9A 2H5DA 1F2SE 2DE8A 2P16A 4XDEA 1V2MT 1J16A 4ISNA 1ELBA 4M9FA 4NZLA 4DCDA 4WF8A 1E36B 3KGPA 1S85A 3STJA 4I8GA 4Z1MD 3STIA 3NK8A 3BIVH 2UWPA 2KCYA 2UWOA 4TPYA 4CH8B 1LKAA 1LHEH 1L0ZA 4Y6DA 2WYGA 1S81A
chains in the Genus database with same CATH topology
4HGCA 1C5SA 1EJMA 1TNHA 3E91A 4K69A 5C1UA 1QL7A 4CRFA 1AHTH 2ZDLA 1C1UH 5GIBA 1YC0A 1UCYH 3U9AH 3A85A 4IN2A 1VZQH 3E0NB 1FPHH 3PO1B 1LHDH 1IQIA 4MPVA 5DP4A 1EP6A 1BQYA 1A2CH 1D3DB 1TE0A 2JETC 5E8EH 1O2TA 3SI4H 3SNEA 2FI3E 1CQQA 3F9HA 5TJXA 4K5ZA 3LKWA 1RJXB 2BY8X 3GDVA 1W0ZU 2ZHDA 4F4OC 1QGFA 2GT7A 4UE7H 3PWCA 1XUJA 2V3OH 3CS0A 4YM9A 1QA0A 1V3XA 1DANH 1O38A 3SU1A 1TA2A 2BTCE 3RXUA 1MTVA 5LPRA 1O3CA 1MZDA 2QF0A 3ITIA 1QRXA 4I32A 4F49A 1AD8H 1NRQH 1O2WA 4O97A 3HKJB 1O2GH 3MWIU 2PKSC 3MH6A 4KTSA 5AFZH 2GT8A 1GHVH 1K1IA 1IHSH 1HCGA 2WPKS 3RXKA 1QCPA 3ELAH 4LK4A 2I6SA 2ZZUH 1U6QA 1GBFA 1BCUH 1Y3YA 5E2PA 1SFIA 1UVPA 1MTNB 4MTBA 4U2WA 1QR3E 1V2ST 4X8TH 3ZVDA 2VIVA 1FUJA 1Z6JH 4AFUA 4J2YB 1OP8A 5FPSA 2H2ZA 1CHGA 2ZDKA 1FAXA 1NS3A 2V3HH 7KMEH 2ZDVH 1K9OE 3BV9B 3SOSA 5T6DA 3EDXB 3L6PA 4ZKNU 2LPRA 3HK6B 2HNTF 1BTXA 1HXEH 1GG6B 1FZZA 4YT6H 1INCA 5EOKA 3U8TH 1H9LB 2QN5T 2ZPRA 1C5MD 1W2KH 1GI1A 2GCTC 4KELA 1OOKB 4FUDA 2VIQA 1QB1A 4JYUH 1G32B 1ZMJA 4XFQA 4ABIA 1THSH 1TPAE 1Y59T 1BOQA 2PLXA 3LGTA 1SVPA 2TGTA 1ZRBA 1C5NH 1SGEE 1GMDF 2FEQH 2ZU2A 1GVZA 1ZTJA 1SMFE 2UUJB 2Y80A 5HYOA 1A5HA 1MKWK 1C5YB 1F7ZA 1VCWA 3VXEH 2ZNKH 2UUYA 1HBTH 1T32A 3U1JB 3R3GB 1AVGH 1EATA 1GJ8B 3RXMA 4UFFH 3PV4A 2W7UA 1C1RA 1HAVA 1HIAA 2STBE 4X1PU 4K8BA 2C3SA 2NU4E 3SO3A 3KHVA 5GCHG 3S9BA 1DSTA 1O3BA 4KGAA 2H1UA 4FXGH 4JZ1A 4ZMAH 4YLQH 1O3KA 2FOCA 2CXVA 4GPGA 2AEIH 2Y6TA 3A7ZA 1GI6A 2HGTH 5JDUB 1GMDG 1NFUA 1EZUC 1FONA 2DE9A 3SN8A 2F9VA 1TQ7B 3TGKE 1SG8B 1OWJA 1ZMLA 1CGIE 5JYIA 3MH5A 1A3BH 1PJPA 1ELFA 4ESTE 2CMYA 2STAE 1AZZA 1O3MA 2XNIA 1T8OA 4KTCA 1LVYA 1KTSB 2VGCB 4RKJB 4MNYA 4NGAH 3EA7A 3FVFB 2OCVB 3K9XB 1IQHA 1CE5A 2BLWA 3QX5H 4DY7B 1IQJA 4I8JA 3PROA 4OS1A 2Y5GA 1QBNA 5DP6A 3VPKA 2FOEA 3F1SB 1GBDA 4PROA 2G4UA 3IITA 4AOQA 1YLCA 2ZGXH 3LGWA 4CHAB 1WCZA 3CENA 1Y3WA 3KQDA 1MQ6A 3SU0A 4Y76A 1GDUA 3SORA 4CRBA 1YPJH 1DWEH 1LPZB 2GD4B 3ZZBA 2A4RA 2AIQA 3MTYA 4NSYA 1L4DA 3NPSA 1P2IA 3RM0H 3GYLB 4ZHAA 4FU7A 2B9LA 2B5TB 1ZMNA 3RXHA 2VNTA 1MD8A 5EODA 1LMWB 1EUFA 1GI5A 1NRRH 1VGCB 1H9HE 1KXAA 1HJAC 4FUIA 3MU8A 1CT0E 3L3TA 1G36A 1O2JA 2EC9H 1TNJA 5LGOA 4THNH 1XUIA 4NIVA 1BRUP 5GWZA 3I29A 1O2UA 2QY0B 3VB5A 2P94A 2QA9E 3TH2H 1GMCF 5FBEA 1BRCE 1QURH 2QXGA 4DOQA 3BN9A 1O2SA 5ESBA 3SV7A 4B2CA 1NC6A 3NXPA 3VB6A 1ANDA 1YCPK 1BMAA 1MAXA 1UVUH 2QIQA 1A0JA 1O3NA 3MU4A 4OS7A 1WYKA 4DGJA 1AVWA 1C9PA 2OXSA 4FVDA 2J34A 4X1NU 3S0NA 2R0LA 2YOLA 2QV1A 1G30B 2PR3A 2HPPH 2PSYA 3W95A 3C1KA 1NU9A 3A82A 5DGJA 5E0JA 2HWLB 3QUMP 5A8ZA 2Z9JA 1GL1A 1V2PT 2VVVA 2XYAA 1SQAA 4Y79A 1VR1H 2GDEH 1NRPH 3NZIA 1PPFE 3M5OA 2ILNA 5FAHA 1HAIH 4MNVA 2GCHF 2PTCE 2Z6BD 3R0FA 1MD7A 1V2OT 1NFWA 3SNAA 1VITF 4A6LA 2C4FH 4OS6A 1O2QA 1K1NA 1DX5M 3M35A 3PLKA 3OTJE 2Y7ZA 1P2JA 1AZ8A 2ANMH 1QA7A 1CHOF 5ESTE 1TPPA 4O03A 1UMAH 5C2ZA 1TNGA 3N7OA 4I8HA 1FY3A 4Y11E 3GCTG 1HAGE 2HRVA 2O8TA 1ACBE 4Z6AH 1TRMA 2FX6A 4KTUA 3LONA 2B8OH 1DWBH 2PGQB 1ZR0A 5EG4A 4NA8A 5HMAA 5B6OA 1TALA 1GPZA 1PQ7A 1UTJA 4BAMB 1O2VA 1OS8A 1D3TB 3SBKA 2SFAA 1OP2A 2DUCA 1DOJA 2Z9KA 3ATLA 1C5QA 1PQ5A 2RG3A 3LGVA 3UR9A 3SV8A 1BTHH 2Y82A 3RM2H 2A5IA 3PLBA 1GHBF 4Y8XA 4WH8A 8GCHG 1N8OC 1H8IH 1CBWC 3SHCH 1CGHA 4I31A 1UK4A 1ZJDA 4HFPB 3KQBA 4AX9H 2PSXA 3DFJA 4R0IA 1DLEA 3T62A 2YNAA 3BG8A 4A1TA 2BDBA 1EOJA 1BMNH 1SLVB 2QGRA 3TH3H 3A8BA 3I78A 4YLUA 1HLTH 2EEKA 4BTUB 1GGDC 1KXEA 1FI8A 5FXLA 4BXSA 1A1RA 1P06A 4ZH8A 3UY9A 3EGKH 3KCGH 3FZZA 5EXLA 1C5WB 1ETTH 2P3FH 2XC0A 4U32A 1QBVH 3LGYA 4X1QU 1QB6A 1MBQA 5L6NH 1Z8IB 2B7DH 4Y71A 2GTBA 1C1TA 4ABDA 2FDAA 2XBXA 4CH2B 4I8KA 2F9PA 3BTKE 2W5EA 1A5GH 4NIWA 3O8RA 2KAIB 3BEFB 1YBWA 4SGBE 5HM9A 4INLA 1XVMA 2F91A 4ZXXH 1O33A 1C2IA 1OYQA 1O2KA 1D6RA 1FV9A 3QK1A 3PLPA 2HNTE 4VGCB 2XBWA 5ETXA 2BVSH 1ABIH 4K8YA 3SGAE 4MPXA 1TONA 3ZYDA 5CHAC 4HZHA 1UK3A 2FOBA 1W12U 4BNRA 5DP3A 3VB3A 2TGDA 4INKA 2TIOA 1HUTH 2AMDA 4K1TA 5TCAA 4FUGA 3PTBA 4CR5A 1MBMA 8LPRA 1GI0A 2ANWA 1IQEA 3K6YA 1WTHD 1EAIA 2VINA 1BJUA 1E37B 1W8BH 2ZC9H 1GMHG 4IBLH 3V12A 2FYQA 5LPEA 1C9TA 5EQQA 2XWAA 4LOYH 1TX6A 2OLGA 1T8MA 1MTWA 2O8LA 4MPWA 2A2QH 2ZECA 3HPTB 1O31A 2BY6X 1GJAB 2R2MB 2C8ZB 2JH5D 1IQLA 5PTPA 3BSQA 1O3EA 5E0GA 3TH4H 3UPEA 2BQ6B 3QLPH 3PTNA 1O2NA 4WVPE 4ABEA 1NROH 3ODDA 4CBOA 2A45B 3GCOA 1SLXB 1RD3B 1AN1E 4AZ2B 2A7JA 5FPTA 2BD4A 5GDSH 1UVTH 1TPOA 1FY4A 1QRWA 1MTSA 1ARCA 1SQOA 1ZGVA 1B7XB 1C5TA 4FVBA 3MI4A 1HV7A 2ZO3H 4GCHF 1Z1JA 1VCQA 2F9OA 2H9EH 1TGNA 7GCHG 1S0QA 1SHHB 2FOMB 3S7HB 1ORFA 5K0HA 3ZZ4A 1QRZA 2Z9GA 1C1MA 4WWYA 1M9UA 2OC1A 4NWKA 1UTLM 2BD2A 5A0CA 2ZU5A 4XBBA 2VWOA 1WBGB 4E06H 1HAVB 2F9BH 1UO6A 4K1SA 2ANYA 1FIWA 3GY6A 1Z8GA 2GKVE 2FTMA 1H1BA 1NN6A 1UVSH 2Z9IA 4R8TB 5F8XA 3ZVFA 3UQVA 3RC4A 3KEEA 3GY7A 2R3YA 1EPTC 4H4FA 1IQKA 2A4QA 4Y10E 1ANCA 2K1QA 1DXWA 2XCFA 1THRH 4UEHH 5T3HA 2ODQA 1CA0B 4AB9A 3GY3A 4FUJA 4ZHMU 2NU1E 1O3HA 1HB0B 3B23B 3W94A 1VCPA 1ELAA 3A87A 2SNWA 1P9UA 5EXNA 1DWDH 1UJ1A 4I33A 3DA9B 2HLCA 1C1SA 1DFPA 1C2LA 1GJ4H 2UUFB 3EA8A 1BB0B 2AGGX 1MKXK 4XSKU 3K65B 1GI8B 4HI3A 2ZFTA 2OUAA 3S69A 5L2YH 1CSOE 4OS2A 3FAOA 1IQGA 1HPGA 1TGTA 3BTQE 2VWLA 2C8WB 3S7KB 1BBRK 4D76A 3K2UA 1BHXF 4ZAEA 4JZIA 4ABFA 1P11E 3OX7U 3VXFH 4UFGH 2WUCA 5C67A 2P3TB 1N6YA 2FLBH 1O5EH 3MH4A 3CS7A 3E8LA 1LHFH 2Y5HA 1O3DA 3TLOA 3GCHC 3MH7A 1QHRB 2CV3A 4X2XA 3E6PH 2KAIA 1DICA 2J95A 2HOBA 3RC5A 4BOHA 4MDSA 1IQFA 4E7RG 1WQVH 3IWMA 1O32A 4TWYA 3RXBA 2O9QA 1AKSA 3KL6A 1TNLA 1H4WA 2H9TH 5EQSA 3P8NA 1AFQB 3S9AA 1P2OA 3P8GA 2BYAX 5C1YA 1YYY1 3V3MA 3BF6H 1DUAA 2OBQA 2UWLA 1XMNB 1ABJH 1GCTC 2I6QA 1W14U 1O2MA 2TRMA 4Y7BA 4ASHA 1P01A 1BIOA 1GI9B 4K3JA 4LZ1H 2AGEX 1C1NA 1KIGH 1O3OA 5I46H 3VGCB 2BXTH 1HAZB 2PWXA 2ZHFH 3AVZA 3UOPA 4GSOA 2FLRH 3TU7H 1FPCH 4ZKSU 4Q2KA 3HGNA 2ZGHA 5AVDA 2OBOA 4JCNA 2C93B 4BAKB 3O8DA 4O9VA 1G2MA 3RMMH 2CGAA 1GJ9B 1KSNA 2AERH 1C2MA 4INHA 4CR9A 5FX5A 1TABE 2WUBA 2P59A 1C1VH 1ESAA 1QY6A 2GDDA 3ZYEA 2GMTB 5FCKA 2W7SA 4Y7AA 1RRKA 3OY5U 5AF9H 1RFNA 3A7YA 5EPNA 1RIWC 1ZTLA 2ZHQH 4YO9A 4GAWA 4O3TA 5IDKA 1TX8A 1C1PA 1YKTA 1YP9A 3VEQB 5FHTA 2BD8A 1SLUB 2SGEE 1QJ7B 2QXHA 2ZDNA 3A7VA 3QO6A 1K21H 1WU1A 1BBRE 1XXDA 2BY9X 2G4TA 5JPMH 1C5PA 4ISHH 3TK9A 2Z9LA 4D7FA 4UDWH 5JB9S 3HKIB 1LVMA 1AB9B 4XOJA 5A09A 3ATWA 3TJOA 2ASUB 1YCPM 2ZQ2A 1SQTA 3MOCA 2VIOA 1MZAA 2BVRH 4YOIA 1WQSA 1XX9A 3BTHE 4Q7XA 3GOVB 4FUEA 3RXTA 3MO9A 3GY4A 1JIRA 2BD3A 2ALVA 1SFQB 1LVOA 2SGAA 1XKAC 2WYJA 3RMLH 1QL9A 3M3VA 4O3UA 1NZQH 4YOGA 8KME2 1GJ6A 3HGPA 1V2WT 1OYTH 3F9EA 2PHBA 2J4IA 3QGJA 1TBQH 6ESTA 1Y5BT 4E7NA 4WXIA 2HNTC 4LZ4B 2PGBB 3UIRA 4AGJA 4Y8YA 3TJNA 5EQRA 3RLYH 4E05H 1TOCB 4Q7YA 6CHAC 1O3GA 5T6GA 3QN7A 1BMLA 2ZKSA 1SR5C 1AI8H 1P2MA 1JWTA 1YPKH 1EJAA 3GY2A 2ZGJA 1KDQA 2VVUA 2BX3A 1QIXB 1LCYA 3RMNH 1YPLH 3ZZ9A 8ESTE 1AIXH 3U1IB 2XW9A 3ZZ5A 2VH0A 1C5RA 2FS9A 1KY9A 4D7GA 5BPEA 1C2HA 2P3UB 2FMJA 2XCNA 3PM3A 5H4IB 1S6HA 1XKBC 2F83A 2VWMA 1UTNA 3BTGE 3LOXA 5HXFA 2BD5A 4H6SB 3RXGA 3SW2B 1V2VT 5C1XA 2CHAC 1BMMH 1BUIA 3TJVA 4DIIH 1L4ZA 3SJ9A 2QCYA 2G55A 3BG4C 3SQEE 1DITH 1UVOA 1JXPA 1O2OA 2VIPA 3Q3XA 3LPRA 3SJOA 1TPSA 1F5LA 5HGGA 1Q3XA 2TBSA 1FY1A 1IAUA 1AE5A 1NT1A 3MO3A 1WV7H 3KF2A 5F03A 1DM4B 2ZWLH 4NFFA 1QFKH 1GI3A 3UTUH 3GISB 2ANKH 1A0HB 1YCPH 3HATH 5EU8A 3ODFA 4CRDA 1BRAA 3JZ2B 3GY5A 2JH6D 1TMUH 3E3TA 4WXVA 3T26A 1LPGB 3DFLA 3GDUA 3LGUA 4GVUA 4RSPA 2XBYA 3PO1C 1GBKA 2AMQA 1OXGA 2A1DB 4BTIB 4UONA 1ETRH 3A7TA 1VJ9U 1DY9A 1DY8A 1CGJE 3C27B 3TNTA 2R2WU 1MQ5A 4IGDA 5EPYA 4X6PA 3AASA 1SB1H 3MNBA 5AHGH 4D9RA 4X0WU 2ZCKP 1HGTH 2ZCLP 4ZXYH 1V2NT 1IOEA 2G81E 1KXCA 1F0SA 2FWWA 3RC6A 5DO4H 3LJJA 1GJBB 2BVXH 4I8LA 4MNWA 1O5CB 2WPJS 1GHXH 2BDCA 3M5MA 1SGYE 2ZP0H 3QWCH 3F68H 1EAXA 1K1JA 3ZVCA 3FP6E 1ZJKA 5C3NA 5JBTA 4B74A 1GJ7B 1TB6H 1O3LA 1KLJH 1SPJA 2W3KA 1C2GA 1TAWA 5FPYA 1AU8A 1EQ9A 3B8JA 1ZHRA 1G3DA 4MPUA 3U69H 1IQNA 1WSSH 1GMCG 3B9FH 4XBCA 1GHYH 3MU5A 1MTNC 2ZTZA 1UHBA 4XBDA 4K60A 1P12E 4ABHA 3GYMA 5I25A 1ANEA 1JRTA 4B71A 2GZ7A</