1JIRA

Crystal structure of trypsin complex with amylamine in cyclohexane
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-Trypsin
publication title Crystal Structure of beta-Trypsin Complex with Amylamine in Cyclohexane
rcsb
molecule tags Hydrolase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jirA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jirA02
5FPSA 1HAIH 1PFXC 1NPMA 1EP6A 2TPIZ 1G32B 4JZDH 1BJUA 3RXPA 5TCAA 1P04A 1GI7B 4XBBA 1GHAG 2ZHWH 1GBKA 2AGGX 2VIVA 8ESTE 2VWMA 1FAXA 1CA0C 1GHYH 5L6NH 1A5GH 4UFGH 1NT1A 2H1UA 1NM6A 3M5NA 1TBQH 1Z6EA 4HZHA 4D8NA 1P05A 1THRH 2HVXA 1G9IE 2Y7XA 1BRAA 1UVOA 2OQUA 3F9HA 3RXQA 2ZU5A 3PMHB 1IQGA 5ABWA 2AH4X 3BTHE 4DIHH 3ATMA 3TU7H 3PO1B 1LHGH 2EI8A 1C2JA 1GBIA 2CV3A 5FHTA 4Y8YA 1GHXH 3KL6A 5DP6A 5GCHF 2BY6X 3GCNA 4WVPE 2FX6A 1B5GH 2O8UA 1BITA 1ANCA 1TWXB 2IOTA 1KIGH 2R2WU 2AIPA 2EEKA 2QXGA 3B8JA 2OC8A 3QZRA 1UHBB 3EGKH 2BQ7B 1A5HA 3GISB 3G01A 2UWPA 3BV9B 1FI8A 4HTCH 3TITA 3SV9A 2UUYA 1GHZA 4BOHA 1UJ1A 1BMLA 3ZZ6A 1ZTKA 2FYQA 2QIQA 1HV7A 2XXLA 2TGAA 3SU3A 5FPYA 1EZUC 1HUTH 3V13A 4YESB 2G8TA 2H9HA 1SVPA 2PWXA 1DM4B 4YT7H 1NU7B 4A92A 5A8YA 3BTWE 5HMAA 1V2TT 1S0QA 1GDQA 4JYVH 1TNJA 1UCYE 2SGDE 2QV1A 2FDAA 2XTTB 3OSYA 1BRCE 1ELBA 2F9UA 8LPRA 2P3UB 3K2UA 1HDTH 2G5NA 5C1UA 1QRXA 1QGFA 1CQQA 1YP9A 1ZZZA 3LU9B 2VU8E 1CVWH 1GBJA 3S9CA 3PM3A 4Q80A 1IQIA 4IGDA 1TOMH 4K69A 2B7DH 1ELFA 1GJ4H 4X8SH 1A0LA 2XNIA 1YCPM 2ZEBA 2BOKA 1SGYE 1W2KH 1HBTH 1Z8RA 1FMGA 1Q2WA 1V2WT 4MPXA 1EZXC 5HM9A 5EW1H 2FOFA 3MNCA 1F0TA 1T31A 3P6ZB 2H5CA 3K6ZA 1ZPZA 2FOEA 2SFAA 2FM2A 1C1OA 2GZ9A 2SGAA 4MLFB 3BSQA 3I77A 5E0HA 2A7JA 3MMGA 1C5LH 3GYLB 3LIWA 1B0FA 2C93B 2FOHA 3MFJA 1E38B 1TABE 3P17H 3ZVFA 1PPEE 1TGNA 1A61H 2FP7B 4Q2KA 1A0HB 2GVFA 1TRMA 4WH6A 3S9BA 1DLEA 1Y5BT 1AIXH 1Z1JA 4ABIA 1V3XA 1P2KA 1O3IA 1Y3YA 2AMQA 2GX4A 3OY6U 2A4RA 4K5ZA 1S6FA 5EQSA 3NK8A 1V2JT 3FAOA 3SN8A 4Z6AH 4XBDA 1MQ5A 2HPQH 3F9EA 3KHVA 4AN7A 1AE8H 3ZZ7A 1SQOA 2A0QB 2FTMA 1TGBA 2XC0A 1SGRE 1LVYA 2AEIH 4O9VA 1P2QA 3K9XB 1KXDA 1GMDF 2FOBA 1JRTA 2M5TA 4INLA 1AGJA 4OS7A 3OTJE 1QL7A 2PW8H 2P95A 4K1SA 3EA7A 3SJOA 4CHAC 1D3DB 5ETXA 2WV5A 5CHAC 3SNAA 1IQEA 1K1NA 1HNEE 4AG1A 1HAVA 1XKBC 3SU4A 1O2HA 1ELCA 3RU4D 4FUHA 2WPKS 1FY5A 3F9FA 1T4VH 3UIRA 4UD9H 4IMQA 2OUAA 3F68H 3DT0H 1AE5A 3LC3A 2A4GA 4D9RA 1O2GH 3H7TA 1ZPCA 1T32A 4WF8A 2V0BA 3ATLA 3IG6B 1FN6A 1AD8H 2Z9GA 3P8FA 2FOMB 2F9OA 2ZDKA 2BD4A 2OQ5A 3RXDA 5J4SA 3C27B 1P06A 3ELAH 4FUEA 1O5DH 1W11U 2BM2A 1DY8A 5E8EH 1CBWB 2BDIA 1W13U 2FTLE 3E16B 1G36A 2I6SA 3A80A 3A7TA 1OP2A 1C2EA 2P16A 4LZ4B 1EAIA 3V3MA 1MTNB 2P3FH 5I46H 1ETTH 3UWJH 5CE1A 1S84A 1P9UA 1W10U 1BOQA 1DX5M 3D49H 1QL8A 1GDUA 2FOCA 4YO9A 1DY9A 2BDGA 3RMOH 2BLWA 2TRMA 5EPYA 2GCTC 1AFQC 1RD3B 2H9EH 3STJA 6CHAB 3MH5A 4B73A 1NESE 1RIWC 1LVMA 1C2HA 1GPZA 3HK3B 4LOYH 2WPLS 1QTFA 1XM1A 4RN6A 1DLKB 3TH3H 1EP5A 1VR1H 1VGCC 3GCTG 2NWNA 1MBQA 1MAYA 3SV8A 2JKHA 2ANYA 1W7GH 1PJPA 3BTQE 4OS6A 3M36A 1BHXB 1C2IA 4ABBA 2UUFB 2VVUA 2ODPA 4I8GA 5LPEA 1SGNE 2AYWA 3ZVGA 1GBTA 1C5MD 1O39A 1UTOA 4NIVA 1YCPH 1QBVH 1W0YH 4NWKA 5C2ZA 2OP9A 3DUXH 1S85A 2HNTC 1O3PB 3A82A 2BDYA 4GHTA 1F7ZA 4TPIZ 1IOEA 2GMTB 1JXPA 1OOKB 1X7AC 3A7WA 2ZU4A 4YZUA 2PKSB 2VIPA 3Q77A 2ZKSA 1GWAA 2Q6FA 1AQ7A 2W26A 3QTOH 2P3TB 5FXLA 5BRRE 1JOUB 2Z9KA 2D26C 4DT7B 1ANBA 4IMZA 2G4UA 4ISLA 1EJNA 1CSOE 4VGCC 3L33A 1C5ZB 1O2MA 4ZKNU 4WWYA 5GCHG 3A8DA 4AGJA 2ASUB 1XX9A 4B1TA 4WMEA 3KEEA 4X2YA 3H5CB 1BMNH 1UCYH 4UFDH 4ABJA 4ISIH 5T6FA 2ZG0H 1GI9B 1O3KA 2JETB 3DFJA 4JZ1A 4D9QA 2O8LA 1DITH 1EOLA 1QHRB 4FUFA 1UHBA 3A7XA 3TLOA 4K8BA 2ZGHA 4Y79A 3RC4A 4NA9H 3LONA 5C1YA 4LZ1H 2Y82A 4JZIA 1BTYA 2JH6D 4H4FA 1GL1A 1Y5UT 4OS2A 2Y80A 3TJOA 2EI6A 1JRSA 1CBWC 1BDAA 3KN2A 1UTNA 4SGBE 1ABIH 1IQHA 1FUJA 5GXPA 3C1KA 3MU4A 1GJ5H 3M5LA 1ZGVA 1C9TA 1SGCA 1MTNC 2VINA 4IC5A 1WUNH 2FESH 3NUMA 5GWZA 2BD7A 3GOVB 3I78A 3V0XA 1HAOH 2BHGA 2GP9B 4KTUA 1ZMLA 4B76A 3RMNH 3OX7U 3UOPA 4OS5A 4AB9A 1GGDC 2G5VA 3T25A 1VJ9U 4X8VH 2C8YB 1GG6C 4Q7ZA 1JWTA 3F9GA 5CMXH 1UMAH 1MTVA 4YT6H 1SGIB 1KTSB 3VB3A 5FCKA 3SI4H 1O5EH 3GY4A 4A6LA 1V2OT 4WH8A 3SJ8A 1IAUA 2ZIQH 1BBRE 1ZPBA 5EG4A 3MH4A 4X2XA 1CHOG 1XUJA 2LNCA 1MZAA 2V3OH 4ZUHA 2ZDAH 2OD3B 1ETRH 4MG3A 1WTHD 4YTAA 4KELA 3ZZCA 5LH8A 4NGAH 1W8BH 4GUXA 3KQDA 5C20A 3RXRA 1QRWA 4X0WU 2QYIA 1SOTA 5JPMH 1P2OA 1C5SA 1V6DA 3VGCB 1U6QA 5HM2A 3BIVH 2C8WB 3EYDA 2FPZA 4TY7A 1ESAA 3ZVDA 5A09A 2B5TB 1AVWA 1TALA 4JK5A 2SGQE 1TPPA 5AF9H 4FVBA 2HWLB 2VVVA 1CA0B 3JZ2B 1OWDA 3O8BA 2P94A 3SUGA 1CT4E 1H9IE 2PKSC 4TY6A 4X8UH 3UR9A 1QA0A 1KXEA 2QF0A 3PLPA 2DE9A 4FUBA 3TIUA 4I32A 3P8GA 1CGJE 4BAKB 4KKDA 3SUDA 1GI2A 3S7HB 3RXIA 4JYUH 2BY5X 1P12E 3PTBA 4H6SB 3RXJA 4KTCA 3MU5A 2D8WA 5DG6A 4YOJA 3Q76A 1OWIA 2A7HA 3E91A 1V2NT 1C1MA 2WYGA 2ZHDA 1DXWA 1GVZA 3GY3A 1LKBA 3MOCA 1TGTA 1LTOA 1V2PT 3SU6A 1EAUA 2ZTXA 2I6QA 1GCTC 3TGIE 3BEUA 2QXHA 3M3VA 3ZVCA 1GI3A 4INHA 2HNTE 1GDNA 2QAAA 4XE4A 1TFXA 3BN9A 1YKTA 4DW2U 1LHCH 3RP2A 4NG9H 3SGQE 1SBWA 1YC0A 4Q7XA 5T6GA 1FPHH 1P0SH 1LPZB 1K1LA 4SGAE 1A1RA 4X6MA 5JB9S 1FY4A 4M7GA 3ZZ5A 1TGSZ 1C5XB 4ZXYH 3WY8A 2BDAA 1KDQB 5E2OA 1XXFA 2G51A 1T8MA 7GCHG 3F6UH 2F91A 3UNQA 5J4QA 2ODYB 5AFZH 3MU8A 2WUCA 1VCPA 5K7RA 2ZGBH 4X1SU 3KQBA 1BA8B 1UTMA 4CBNA 1YPEH 4FU9A 4MTBA 1O5CB 2CHAC 3K65B 4CRBA 3ZVEA 3TPIZ 3L3TA 4IC6A 2HGTH 1S0RA 6GCHG 1MD7A 1N1LA 2ZDMA 5JDUB 3HKJB 1C5QA 5AHGH 4IN1A 3QUMP 2GCHG 1HGTH 1TMBH 3LT3A 3SOSA 4HFPB 4R0IA 1GHVH 3GYMA 2PGBB 4DOQA 4OGXA 2EI7A 3MO9A 1PPZA 3VGCC 1MKWH 1OKXA 1Y8TA 2B8OH 1Y5AT 3E1XB 1A46H 2QY0B 3AAUA 4NCYA 1OPHB 2AS9A 2CF8H 3T28A 1Y3WA 2W5EA 1YGCH 1O32A 1P2MA 1O3NA 1EAWA 1KY9A 1C2FA 3PMAB 5F8TA 1Y3XA 1EUFA 1ELAA 3ZV9A 1O37A 2GGVB 5EQRA 3KIDU 1O5AB 1TBZH 1QB9A 5A8ZA 1O2YA 2VIWA 4ZHMU 4AYYB 4BAQB 8GCHF 1LVBA 4ISHH 3M7QA 2ULLA 1ANDA 1TOCB 4GAWA 4XOJA 3T29A 1SGPE 3ZVBA 3RXHA 1GVKB 1CU1A 4FUGA 1K2I1 2C8XB 4NSYA 2Z9JA 3FZDA 1C2MA 4K2YA 2BVXH 1FY1A 2VWNA 5EU8A 4CHAB 1KLJH 4LK4A 2R3YA 4ZKOU 1W3CA 2FI4E 5CHAB 1NFWA 3RXEA 9ESTA 5FBEA 4UFFH 3MWIU 3A85A 3SU1A 4Y8XA 1RRKA 3BTME 4ZHAA 1Z8GA 2WV4A 4D7GA 1F5KU 3S9AA 3LGTA 3N7OA 1EJAA 1UK3A 3BEIB 3SU0A 1YPHC 3M5MA 1Y3VA 3LPRA 2VGCB 2UWLA 1THSH 1V2LT 2O8MA 1QURH 1MKWK 1V2MT 3TNSA 1E36B 1AVXA 1BRBE 5C5OA 2ZQ2A 1GJCB 2BLQA 1BBRH 3SV2H 1AVGH 3QWCH 2BD3A 2ZI2H 1D6WA 2J2UA 4RKOB 1BHXF 3EAJA 4B2BA 1B7XB 2F3CE 1KSNA 4AORA 1F5RA 3RC5A 4ZHLU 4JMYA 1RFNA 4CRGA 5AFYH 2G52A 3TJVA 4F4OC 3P95A 1GI5A 3TK9A 1B0EA 2AIQA 3ATKA 3LGIA 3UFAA 1AFEH 1O2VA 1LPGB 2RDLA 3ZV8A 1KXAA 1C9PA 4XFQA 2GCTB 5PTPA 1AFQB 1O2RA 3RXKA 5E0JA 4JK6A 4KGAA 1IQFA 2P8OB 2XC5A 1SGDE 1KLTA 2STAE 1CHOF 2A45B 3QZQA 1RIWB 3U8TH 5FAHA 3VB4A 1PQ8A 2Y7ZA 1KXCA 3VB6A 4X1RU 1DSTA 2PHBA 3PMJA 1C5RA 1GBEA 1VGCB 3SJIA 3LJOA 3Q00A 1K21H 3SGBE 1GI1A 1BZXE 1NTPA 1RS0A 1O2WA 1DFPA 1TB6H 1N8OC 5FBIA 3QDZB 4CRFA 1QY6A 1QJ1B 1GJDB 2ZA5A 1PPCE 2ILNA 1J14A 3W94A 1YLCA 1F0UA 1LO6A 3E3TA 3E0NB 5F6MA 1GBCA 2R2MB 1K1IA 1WCZA 1DUAA 1TAWA 1DICA 3RU4E 1FY8E 1MTUA 1NO9H 2FZZA 1SC8U 3RXOA 4FUJA 1TNKA 1QRZA 1AO5A 4U2WA 3LKWA 1YLDA 1O2QA 1TRYA 4MQAA 1Z8IB 2OC1A 1TA2A 1ZRKA 2GV6A 1ZJKA 1GCDA 1SOZA 2OBQA 4MNVA 1UTJA 1P2NA 2ANKH 1K28D 2GT7A 3W95A 1MU8B 1P57B 1J17T 1Y3UA 2V3HH 4VGCB 3A83A 1GBAA 3VFEA 2BVRH 1TRNA 1E35B 2OCVB 5DP5A 3PTNA 1TONA 3M7UA 2R9PA 1OXGA 4I31A 4I8LA 1DOJA 1HIAB 1ZHRA 1G2MA 3QX5H 2XCNA 5T6DA 1A3BH 1H9LB 3E6PH 1DVAH 1P2IA 4RKJB 1K1OA 1P9SA 3LGVA 1P03A 1O2UA 4K1TA 1UTPA 2FIRH 3T27A 4O97A 5EXNA 2BQWB 2GZ8A 1O3MA 1TA6A 2IN2A 3RU4T 3FZZA 4ABAA 3E0PB 3RXMA 2VGCC 1TBRH 1SLXB 1Z1IA 1QR3E 3P92A 3IWMA 5L30H 1O0DH 5ESBA 1UVPA 1EB1H 1G3DA 2V35A 5TCCA 1NU9A 3M61U 4ZKRU 1MKXH 5JBAS 4R8TB 2Z9IA 3S7KB 1O5GH 1O3EA 2H9TH 2TGPZ 4CH8B 4DURA 2D2DA 1XMNB 3VPKA 7GCHF 1XUFA 1GJ8B 1KDQA 3GDVA 1HAXB 1DT2A 1SG8B 4MVNA 3ZZBA 1T8OA 1QFKH 1BUIA 1QCPA 2A2QH 3RDZA 4B2CA 1GGDB 3KQCA 1ZHMA 4NFEA 1GG6B 3LH3A 1O2ZA 2VH6A 4NZLA 1J16A 1J8AA 6GCHF 1ZTJA 1ZRBA 1CHGA 3A89A 1GJ6A 2P8OC 3BG4C 3MU1A 1V2ST 4JCNA 4ZAEA 1SL3A 4A1VA 2ALPA 2J4IA 2VWOA 2GCHF 1DWBH 1BMMH 4GHQA 1YPHE 2EC9H 1DPOA 4ABEA 1ZMNA 3BTDE 2CN0H 2ZGJA 2G4TA 1G37A 3UUZA 1O3HA 1PPGE 4A1TA 1EPTB 4MNWA 1TPAE 3BTFE 3VXFH 2BTCE 5TJXA 3P8NA 2BD2A 2VNTA 1TIOA 1C5TA 2IPHA 2STBE 1A4WH 3MNBA 5A8XA 4NIYA 1L0ZA 4GSOA 2PTCE 1D3QB 2VB0A 1GBDA 1O3JA 2BLOA 3QLPH 8GCHG 1HYLA 1OWJA 1K22H 2C90B 4TYDA 4AB8A 1NRSH 3CS7A 1LHFH 3NPSA 1AB9C 2PR3A 2UWOA 4BAMB 9LPRA 2ANMH 5JYIA 3SZNA 3ZZ4A 3QN7A 1JIRA 3H7OA 1H1BA 3TK5A 2GV7A 3ZZ8A 1CGIE 1E37B 1MAXA 1EX3A 3FP7E 3KF2A 3RXVA 4GPGA 2J95A 3RXFA 1O2SA 4U32A 4ISOA 3PWCA 2ZFSA 3SBKA 3HPTB 1AUJA 2A5KA 1GCTB 4TWWA 1SB1H 2BD8A 3ZYDA 3A7YA 2F9PA 3QGNB 1S6HA 2YNAA 1O34A 2OC0A 3DA9B 4DG4A 1KYNA 3RXBA 4JZFH 1MQ6A 2O8TA 5L2ZH 3MI4A 1IHSH 2XC4A 1AI8H 7LPRA 1BCUH 3M5OA 2ZQ1A 3B23B 1C4Y2 3KQEA 2FLBH 1ID5H 1IQJA 3A88A 1YCPK 2BXUH 3ZZDA 3EA9A 1AHTH 3QO6A 1BQYA 1SGQE 2B9LA 1SFIA 1C1SA 3U8OH 4FUIA 4CR5A 3AAVA 2XWAA 4NIXA 3GCHC 3CS0A 5FPTA 1PPFE 2QGRA 4E05H 3UR6A 3M35A 1AKSB 2NU2E 3RLYH 1GMCG 2K1QA 1C4U2 2ZGCA 5DPAA 4XBCA 3UNRA 4CREA 1Z71A 2CHAB 1NROH 1C2DA 1L4DA 3NWUA 1VCQA 4B74A 3PLBA 1EKBB 2ZO3H 1GMHG 4LXBH 1GI4A 1ELDE 4NFFA 4E06H 1GBLA 1PYTD 1HXFH 1Q31A 4HI3A 1G2LA 1FJSA 2Q1JA 3LH1A 1TPSA 3A81A 2ODQA 1HLTH 5F03A 1P11E 1UCYK 3ZVAA 1Z8JB 2A2XH 3D23A 4WMDA 4YOIA 1EPTC 3MH6A 1HPGA 1XUKA 2BY9X 3RXAA 1TMTH 2BDHA 4U30A 1UO6A 4BXSA 4UONA 4OGYA 2ZZUH 3A8CA 2FMJA 1O2KA 5A0BA 3PMBB 2ZFFH 4XDEA 1EZQA 1T8NA 1ZOMA 3BTTE 4DVAU 1HJAC 4O3UA 2P93A 1BTPA 1OWEA 1O3BA 1VJAU 1Z7KA 2ZHEH 1D9IA 1P8VC 2G81E 3AASA 2BLVA 4FU8A 4AG2A 2NU3E 4CRAA 2BMGB 1C5VA 2ZGXH 1VZQH 2BX4A 3SJ9A 4B75A 1SPJA 3LGYA 5DJ7A 4I8JA 1O2XA 1YYY1 4IS5A 1DWCH 4AGKA 5EODA 2BQ6B 3SQEE 3TH2H 2OINA 1XKAC 5DO4H 1UVTH 4GCHG 2W7SA 3GY7A 3VB5A 4WXIA 3GDUA 5F8XA 3PB1E 1T8LA 2J94A 3MNSA 1BTHH 4K1EA 3AW1A 1HIAA 1FAKH 5LPFA 4BTTB 1MTSA 3L6PA 5JBBS 1P3EA 3MU0A 2GDEH 1C5OH 1ZYOA 1MMJN 1O3AA 3HK6B 1MZDA 3BTEE 1LQEA 1YPMH 3TGJE 2ZHQH 2PUQH 4I8HA 2NU4E 1N6YA 1XUHA 2A4OA 1O2IA 2GKVE 3MYWA 2ZDLA 2NU0E 1AZ8A 1O31A 2PSXA 1F92A 1VCWA 4PROA 3RM2H 2HLCA 3LC5A 7ESTE 3SHCH 1FY3A 1PPBH 1C1TA 1FQ3A 2ZPQA 1FN8A 1C5UA 2RA3A 5EQQA 3UTUH 2BDBA 1ELTA 1ZR0A 1D4PB 1K1PA 1C1UH 1GHWH 3HGPA 1BMAA 2HNTF 5E0GA 1BB0B 1NRRH 1O3FA 2QA9E 2A31A 3HGNA 5A0AE 5I25A 1HJ9A 2ANWA 1LQDB 2BX3A 1FV9A 1G30B 1K1MA 3SI3H 1JIMA 2FX4A 1CO7E 2BVSH 1UK4A 3T5FH 2RG3A 3VXEH 5E2PA 4WY3A 1K1JA 3UQVA 4O03A 1YPKH 4KTSA 5LGOA 5C3NA 2FEQH 3D62A 1QJ6B 2ZTYA 1YPJH 1SQAA 3FVFB 1O2OA 3O8DA 3RC6A 1KXFA 4QT8C 2R0LA 3F1SB 5GDSH 1V2UT 3TJNA 3RXSA 2PV9B 2FYRA 3VEQB 3A7VA 3SUEA 1P01A 3SV7A 3HATH 1EPTA 1HAHH 3RXCA 1QB6A 4CRDA 1N8OB 2TGDA 4X1PU 1C5NH 2GDDA 2ALVA 1FXYA 1QQ4A 4D7FA 1D3PB 5ESTE 4X6NA 2PKAB 4JYTA 4CH2B 5K0HA 4X1QU 5FX5A 2NU1E 3SNBA 1TX7A 3LGUA 4Y0YE 2JH5D 3A8AA 1ELGA 3RM0H 3ZYEA 1OSSA 1GHBG 3M37A 1VITH 3ODDA 2Z3CA 4NWLA 1JMOH 1C1NA 1O2TA 1WBGB 4NA7A 4UFEH 3CP7A 2R3UA 4CR9A 1AN1E 1GBHA 2A5AA 2XWBI 4FXGH 3V7TA 4A1XA 1IQKA 3QGJA 1IQLA 3OYPA 2FI3E 5BPEA 3MO3A 2ZCKP 1BJVA 3Q3KA 4RSPA 3S0NA 1RTLA 2BYAX 3QK1A 1QL9A 1P10A 1GJ7B 1C5WB 2PFEA 1WU1A 4ABGA 1DUEA 1TX6A 3GY6A 1HRTH 4A7IB 2KAIB 3SO3A 2VVCA 3SV6A 1NN6A 3UREA 3KNXA 1S83A 2W7UA 3ATIA 2W3KA 1QBOA 3PWBA 4A5TS 3P8OA 2ZWLH 3AW0A 5JBTA 1D6RA 2BB4A 2ZU3A 1CT0E 1UTLM 5IDKA 4Y76A 5IYTA 4X6PA 1BTXA 3T26A 2ZECA 1C4V2 2VH0A 5FCRA 3GY5A 2Y81A 2ZFPH 2Z7FE 1PPHE 1NFXA 1BT7A 2THFB 1RTKA 1BIOA 4BTIB 4UE7H 1CT2E 2FO9A 1BTUA 3GICB 2O9QA 4ABDA 3MNXA 1TNLA 1HXEH 4H42U 2EA3A 1DWEH 3SU2A 1GMCF 1VITG 2BD5A 2F83A 2WINI 2CGAA 5EGMA 4H6TA 3KCGH 1AKSA 1GBFA 1HFDA 6LPRA 1BTWA 1GVLA 1P3CA 4TPYA 2BD9A 3SNCA 1FLEE 1A3EH 1MH0A 1GMHF 3BG8A 4BAHB 1AWFH 3BG4B 3CENA 1H8DH 1KXBA 3T2NA 2YOLA 4GVUA 3GDSA 3EA8A 1LDTT 2WPJS 2Q6GA 1OWHA 3E8LA 4I8KA 1SI5H 2SNVA 1P2JA 1QBNA 3TK6A 3ZZAA 1O3CA 1DDJA 3BIUH 2XW9A 2R0KA 2Z6BD 3GY8A 2JH0D 1MCVA 1XXDA 1NFYA 1O35A 1HAYB 1SSXA 4ESTE 1SGFG 3RMMH 4NSVA 3Q3XA 5A2MH 3PLKA 3UWIA 1MTWA 4THNH 1H8IH 3ZZ9A 1GBMA 4NA8A 1OYTH 4YLQH 4UDWH 1FNIA 1ZMJA 4O3TA 1HAPH 3TJUA 1MU6B 3SW2B 2VIDA 4INKA 3SNDA 1NS3A 3MO6A 1WV7H 1L1GA 1W12U 2H2ZA 3URCA 2QF3A 1O2NA 3K6YA 3RXLA 1BBRK 4CBOA 1CGHA 1PYTC 1QA7A 2ZU2A 1ESBA 2UUKB 1ORFA 4TWYA 1SHHB 1H9HE 3FP6E 1ZSLA 2F9NA 2BY8X 2AMDA 2XRCA 1TPOA 4OS4A 1AB9B 4DJZB 1ARBA 1NRQH 2F9VA 1G3CA 3LGWA 4D76A 3A87A 1AMHA 4GCHF 2XCFA 1NY22 4AFQA 1TQ7B 3RXGA 1FIZA 2TBSA 3NZIA 1SLWB 1WQVH 4Y71A 4I7YH 3PO1C 1F0SA 4U01A 1C1RA 1H4WA 2WUBA 1TNIA 5FX6A 1T7CA 1G3BA 1C1QA 1K9OE 2AERH 1WYKA 5DP8A 4HGCA 3U9AH 3MHWU 1AZZA 1O3GA 2XBXA 4XSKU 1INCA 2A32A 1ABJH 1LVOA 2Q6DA 2RA0A 3FANA 4Q7YA 4X8TH 1CE5A 1C1PA 1C2KA 1LMWB 1OYQA 5HYOA 1RGQA 4B2AA 1EQ9A 5DK1A 1NFUA 1G3EA 3RLWH 1L1NA 4IW4E 2A4QA 3UQOA 4X6OA 3NCLA 1GJAB 1GI0A 1UVSH 1YF4A 2IJOB 5EW2H 1TX8A 3Q3YA 3STIA 2CMYA 1O3LA 2Y5HA 1RXPA 2FWWA 1ARCA 2PTNA 2WPMS 3DHKH 1TNGA 2QXJA 3URDA 1C5PA 3U98H 4BNRA 4ISNA 1FDPA 2VJ1A 3KGPA 3GCHB 3PV4A 1O30A 8KME2 2BZ6H 4X2VA 4Y7AA 1OX1A 5F8ZA 2DUCA 4YOGA 2HRVA 3O8CA 2SGFE 1F0RA 4FUCA 1HCGA 3BTKE 1PQ7A 2J92A 4BAOB 2A5IA 1W7XH 1YPGH 1HB0B 1O3OA 3SJKA 1SR5C 1P09A 2HALA 5EOKA 4E7NA 1MBMA 4Y6DA 1AU8A 6ESTA 4ASHA 2V6NA 1AWHB 1DWDH 1O5FH 1A7SA 2QCYA 3BF6H 4OS1A 1SLVB 2OLGA 2Y5FA 2UUJB 1QJ7B 1AY6H 5DKMA 3RMLH 1WQSA 4Z0KA 1LPKB 2ZU1A 2QC2A 2PUXB 2FXRA 1TLDA 2Z9LA 5EXMA 4Y11E 1SMFE 4ABHA 3NXPA 1ZGIA 2H6MA 1Z6JH 1BRUP 3TVJB 1XUIA 2FI5E 2HPPH 2ZCHP 7KMEH 1EJMA 3ENSB 2ESTE 4AZ2B 1RTFB 2W3IA 3SU5A 2CF9H 4WMFA 1YBWA 4BXWA 2AFQB 2F9BH 5GPIB 2PKAA 1HJAB 1L1JA 1MKXK 3U8RH 1GHBF 1F5LA 4K8YA 1GHAF 1ZHPA 2DE8A 1ESTA 3LDXH 3BTGE 4J2YB 3AVZA 1A2CH 2FODA 1EASA 1ETSH 2C8ZB 5DGJA 1N6XA 5JBCS 1EAXA 1FONA 1NRNH 3IITA 4BTUB 2BZAA 2ZHFH 1SHYA 4AFSA 3TGKE 2FLRH 3RXUA 4JZEH 3TNTA 3E90B 1DANH 1SGFA 1UTKA 3A86A 3ESTA 4KP0A 5H4IB 4J1YA 4FU7A 2ZTZA 2BOHB 1LCYA 1BTZA 3A84A 5AVDA 1P02A 2BY7X 3ODFA 2ZDVH 4I33A 1D3TB 1ZSKA 1IQMA 1ZLRA 2G00A 2KAIA 3SQHE 1L2EA 1O38A 3SGAE 5G4BA 1S5SA 3R3GB 1C2GA 2ZDNA 2FS8A 1WTGH 1SQTA 4AFZA 2OC7A 1GJ9B 4E7RG 1T4UH 3BEFB 4Y0ZE 2VIQA 4B71A 4ABFA 1QQUA 1UK2A 1L4ZA 3PYHA 1KLIH 1O2PA 3U1IB 3UY9A 4ZMAH 4DCDA 1AUTC 1O36A 2Z3DA 1IQNA 2PGQB 3EE0B 2ZC9H 2ZF0H 5C1XA 2LPRA 1NZQH 2SGPE 2A7CA 5GJ4B 1TQ0B 2YNBA 4MPUA 3OU0A 1V2VT 1VITF 3V12A 1S81A 4IN2A 4NIWA 2J34A 2ZP0H 3D65E 4IBLH 1HJ8A 1FPCH 4ZROA 4DY7B 2OTVA 4Y10E 3UOUA 2Z94A 2VWLA 1DE7H 1JBUH 1GBBA 1YM0A 1GL0E 2GT8A 2XBWA 2AMPA 3T62A 1EB2A 2HOBA 3GY2A 1ACBE 5HGGA 3R0FA 3P70B 1V2RT 2CJIA 1OP0A 4MNYA 3UNSA 1EZSC 1V2KT 2XBVA 2B0FA 3SORA 1O33A 1J9CH 2ZCLP 3EQ0H 6CHAC 1O5BB 1TNHA 2J9NA 3S69A 2RCEA 1EATA 5DP4A 3LOXA 1C2LA 1HAZB 1C5YB 2FOAA 1MD8A 3SHAH 1W0ZU 4WJG2 2QXIA 1O2JA 2Z3EA 4MPVA 1TMUH 2TIOA 1OWKA 2D1JA 4BANB 1LHEH 2ZFTA 1DXPA 1YPLH 4UEHH 2GZ7A 2J38A 2VIOA 2ZFRH 4Y7BA 1GI6A 1OS8A 1FIWA 2PLXA 2A1DB 1GJBB 2WYJA 3MTYA 1NRPH 2GMTC 4MDSA 4ZKSU 1CA8B 2ZFQH 4DGJA 1Y59T 3EDXB 2WPIS 2C4FH 4Y8ZA 1SFQB 4F49A 5T3HA 1UTQA 2BXTH 1NC6A 1SGTA 2XBYA 5EPNA 2ZPSA 5C67A 1RJXB 5DP7A 1WSSH 2OXSA 3OY5U 1E0FD 4GLYA 3VB7A 5LPRA 1S82A 1WOFA 4YM9A 3GCOA 2AGIX 1A0JA 1SGEE 3DFLA 3PROA 5SGAE 5HXFA 5DP9A 1WAYB 3LJJA 1W14U 3RXTA 1FZZA 2C3SA 2SGEE 1TYNA 3FFGA 3ITIA 1GMDG 5A0CA 3B9FH 1OP8A 4K3JA 3FP8E 1Q3XA 1SLUB 2O8WA 2PSYA 1ELVA 1ANEA 3M3TA 2Y6TA 3HKIB 1HAVB 1MCTA 4AFUA 2JETC 4X1NU 1THPB 5C5NA 2XYAA 2AGEX 4ZXXH 5GIBA 1V2QT 4WXVA 4K60A 1O2LA 1TGCA 1PQAA 3M3SA 3TH4H 1C1WH 1F2SE 5B6OA 2CXVA 4X2WA 1O3DA 3A7ZA 2P59A 1KTTB 1ZTLA 4MNXA 1M9UA 1MUEB 1GI8B 1ZSJA 1DSUA 1LKAA 3UPEA 2QN5T 1ZJDA 2OBOA 2ZPRA 5L2YH 2GTBA 5DP3A 5JB8S 3O8RA 3DD2H 2ZNKH 1EOJA 1XUGA 1QNJA 1HAGE 2WPHS 3ATWA 1UVUH 2Y5GA 1IHTH 1XVMA 4DIIH 4ZH8A 4AX9H 4MPWA 4AOQA 1PQ5A 4YLUA 3U1JB 2GD4B 3MH7A 1QB1A 3JZ1B 3NKKA 1DS2E 3U69H 4FUDA 1QIXB 4FVDA 1ELEE 3QTVH 5EXLA 1C1VH 3SUFA 1LHDH 1A5IA 2BDCA 2FOGA 4CRCA 2SNWA 3SNEA 1EXFA 3A8BA 1J15A 3RUOA 2H5DA 3ZZ3A 1E34B 1XVOA 2FS9A 2G55A 3GCTF 3M7TA 4AYVB 2TGTA 4NZQA 3I29A 1TE0A
chains in the Genus database with same CATH superfamily
5FPSA 1HAIH 1PFXC 1NPMA 1EP6A 2TPIZ 1G32B 4JZDH 1BJUA 2M2AA 3RXPA 5TCAA 3F2GA 1P04A 1GI7B 4XBBA 1GHAG 2ZHWH 1GBKA 2LP6A 2AGGX 2VIVA 8ESTE 2VWMA 1FAXA 1CA0C 1GHYH 5L6NH 1A5GH 1UW7A 4UFGH 1NT1A 2H1UA 1NM6A 3M5NA 1TBQH 1Z6EA 4HZHA 4D8NA 1P05A 1THRH 2HVXA 1G9IE 2Y7XA 4FOUC 1BRAA 1UVOA 2OQUA 3F9HA 3RXQA 2ZU5A 3PMHB 1IQGA 5ABWA 2AH4X 3BTHE 4DIHH 3ATMA 3TU7H 3PO1B 3EE7A 1LHGH 2EI8A 1C2JA 1GBIA 2CV3A 5FHTA 4Y8YA 1GHXH 3KL6A 5DP6A 5GCHF 2BY6X 3GCNA 4WVPE 2FX6A 1B5GH 2O8UA 1BITA 1ANCA 1TWXB 2IOTA 1KIGH 2R2WU 2AIPA 2EEKA 2QXGA 3B8JA 2OC8A 3QZRA 2KX4A 2YMSB 1UHBB 3EGKH 2BQ7B 2WHXA 1A5HA 3GISB 3G01A 2UWPA 3BV9B 1FI8A 4HTCH 3TITA 3SV9A 2UUYA 1GHZA 4BOHA 1UJ1A 1BMLA 3ZZ6A 1ZTKA 2FYQA 2QIQA 1HV7A 2XXLA 2TGAA 3SU3A 5FPYA 1EZUC 1HUTH 3V13A 5EIYA 4YESB 4ZCNA 2G8TA 1VKYA 5KECA 2H9HA 1SVPA 2PWXA 1DM4B 4YT7H 1NU7B 4A92A 5A8YA 3BTWE 5HMAA 1V2TT 5C17A 3FOAA 1S0QA 1GDQA 4JYVH 1TNJA 1UCYE 2SGDE 2QV1A 2FDAA 2XTTB 3OSYA 1BRCE 1ELBA 2F9UA 2QF5A 8LPRA 2P3UB 3K2UA 1HDTH 2G5NA 5C1UA 1QRXA 1QGFA 1CQQA 1YP9A 1ZZZA 1E1RD 2VU8E 3LU9B 1CVWH 1GBJA 3S9CA 3PM3A 4Q80A 1IQIA 4IGDA 1TOMH 4K69A 2B7DH 1ELFA 1GJ4H 4X8SH 1A0LA 2XNIA 1YCPM 2ZEBA 2BOKA 1SGYE 1W2KH 1HBTH 1Z8RA 1FMGA 1Q2WA 1V2WT 4MPXA 1EZXC 5HM9A 5EW1H 2FOFA 3MNCA 1F0TA 1T31A 3P6ZB 2H5CA 3K6ZA 1ZPZA 2FOEA 2SFAA 2FM2A 1C1OA 2GZ9A 2SGAA 4MLFB 3BSQA 3I77A 5E0HA 2A7JA 3MMGA 1C5LH 3GYLB 3LIWA 1B0FA 2C93B 2FOHA 3MFJA 1E38B 1TABE 3P17H 4AC9A 3ZVFA 1PPEE 1TGNA 3OEHD 1A61H 2FP7B 4Q2KA 1A0HB 2GVFA 1TRMA 4WH6A 3S9BA 1DLEA 1Y5BT 3KQ5A 2EQNA 1AIXH 1Z1JA 4ABIA 1V3XA 1P2KA 1O3IA 1Y3YA 2AMQA 2GX4A 3OY6U 2A4RA 4K5ZA 1S6FA 5EQSA 3NK8A 1V2JT 3FAOA 3SN8A 4Z6AH 4XBDA 1MQ5A 2JIZD 2HPQH 3F9EA 3KHVA 4AN7A 1AE8H 3ZZ7A 2J97A 4RI0A 1SQOA 2A0QB 2FTMA 1TGBA 2XC0A 1SGRE 1LVYA 2AEIH 4O9VA 4RT0A 1P2QA 3K9XB 1KXDA 1GMDF 2FOBA 4XD7D 1JRTA 2M5TA 4INLA 1AGJA 4OS7A 3OTJE 1QL7A 2PW8H 4ACBA 2P95A 4K1SA 3EA7A 3SJOA 4CHAC 1D3DB 5ETXA 2WV5A 5CHAC 3SNAA 1EFRD 1IQEA 1K1NA 1HNEE 4AG1A 1HAVA 3F2FA 1XKBC 3SU4A 1O2HA 5T1VA 1ELCA 3RU4D 4FUHA 2J98B 2WPKS 1FY5A 5DN6D 3F9FA 1T4VH 3UIRA 4UD9H 4IMQA 2OUAA 3F68H 3DT0H 1AE5A 3FO8D 3LC3A 3PV5A 2A4GA 4D9RA 1O2GH 3H7TA 1SKYE 1ZPCA 1T32A 2IJD1 2V0BA 4WF8A 3ATLA 3IG6B 1FN6A 1AD8H 2Z9GA 3P8FA 2FOMB 2F9OA 2ZDKA 2L74A 2BD4A 2OQ5A 3FN8A 3RXDA 5J4SA 3C27B 1P06A 3ELAH 3PRBA 2KCOA 4FUEA 1O5DH 1W11U 2BM2A 1DY8A 5E8EH 1CBWB 2BDIA 1W13U 2FTLE 3E16B 2V7QD 1G36A 2I6SA 3A80A 3A7TA 1OP2A 1C2EA 2P16A 4LZ4B 2WZQA 1EAIA 3V3MA 1MTNB 2P3FH 5I46H 1ETTH 3UWJH 5CE1A 1S84A 1P9UA 1W10U 1BOQA 1DX5M 3D49H 1QL8A 1GDUA 2FOCA 4YO9A 1DY9A 2BDGA 3RMOH 2BLWA 2TRMA 5EPYA 2GCTC 1AFQC 1RD3B 2H9EH 3STJA 6CHAB 3MH5A 4B73A 1NESE 1RIWC 1LVMA 1C2HA 1GPZA 3HK3B 4LOYH 2WPLS 3CNRA 1QTFA 1XM1A 4RN6A 1DLKB 3TH3H 3OTPA 1EP5A 1VR1H 1VGCC 3GCTG 2NWNA 1MBQA 1MAYA 3SV8A 2JKHA 2ANYA 1W7GH 1PJPA 3BTQE 4OS6A 3M36A 1BHXB 1C2IA 4ABBA 2UUFB 2VVUA 2ODPA 4I8GA 5LPEA 1OHHD 1SGNE 2AYWA 3ZVGA 1GBTA 1C5MD 1O39A 1UTOA 2WV9A 4NIVA 1YCPH 1QBVH 1W0YH 4NWKA 5C2ZA 2OP9A 3DUXH 1S85A 2HNTC 1O3PB 3A82A 2BDYA 4GHTA 1F7ZA 4TPIZ 1IOEA 2GMTB 1JXPA 1SQRA 1OOKB 4M9FA 1X7AC 3A7WA 2ZU4A 4YZUA 2PKSB 2VIPA 3Q77A 2ZKSA 1GWAA 2Q6FA 1AQ7A 2W26A 3QTOH 2P3TB 5FXLA 5BRRE 1JOUB 2Z9KA 2D26C 4DT7B 2F43B 5DSFA 1ANBA 4IMZA 2G4UA 4ISLA 1EJNA 1CSOE 4VGCC 3L33A 1C5ZB 1O2MA 4ZKNU 4WWYA 5GCHG 3A8DA 4AGJA 2ASUB 1XX9A 3UB0A 4B1TA 4WMEA 3KEEA 4X2YA 3H5CB 1BMNH 1UCYH 4UFDH 4ABJA 4ISIH 5T6FA 2ZG0H 1GI9B 1O3KA 2JETB 3DFJA 4JZ1A 4D9QA 2O8LA 1DITH 1EOLA 1QHRB 4FUFA 1UHBA 3A7XA 3TLOA 4K8BA 2ZGHA 4Y79A 3RC4A 4NA9H 3LONA 5C1YA 4LZ1H 2Y82A 4JZIA 1BTYA 2JH6D 4H4FA 1GL1A 1Y5UT 4OS2A 2Y80A 3TJOA 2EI6A 1JRSA 1CBWC 3H09A 1BDAA 3KN2A 1UTNA 4SGBE 1ABIH 1IQHA 1FUJA 5GXPA 3C1KA 3MU4A 4TSFD 1GJ5H 3M5LA 1ZGVA 1C9TA 1SGCA 1MTNC 2VINA 4IC5A 1WUNH 2FESH 3NUMA 5GWZA 2RDEA 2BD7A 3F0PA 3GOVB 3I78A 3V0XA 1HAOH 2BHGA 2GP9B 4KTUA 1ZMLA 4B76A 3RMNH 3OX7U 3UOPA 4OS5A 4AB9A 1GGDC 2G5VA 3T25A 1VJ9U 4X8VH 2C8YB 1GG6C 4Q7ZA 1JWTA 3F9GA 5CMXH 1UMAH 1MTVA 4YT6H 1SGIB 1KTSB 3VB3A 5FCKA 3SI4H 1O5EH 3GY4A 4A6LA 1V2OT 4WH8A 3SJ8A 1IAUA 2ZIQH 1BBRE 1ZPBA 5EG4A 3MH4A 4X2XA 1CHOG 1XUJA 2LNCA 1MZAA 2V3OH 4ZUHA 2ZDAH 2OD3B 1ETRH 4MG3A 1WTHD 4YTAA 4KELA 3ZZCA 5LH8A 4NGAH 1WXRA 1W8BH 4GUXA 3KQDA 5C20A 3RXRA 1QRWA 4X0WU 2QYIA 1SOTA 5JPMH 1P2OA 1C5SA 1V6DA 3VGCB 3OAAD 1U6QA 5HM2A 3BIVH 2C8WB 3EYDA 2FPZA 4TY7A 1ESAA 3ZVDA 5A09A 2B5TB 1AVWA 1TALA 4JK5A 2SGQE 1TPPA 5AF9H 4FVBA 2HWLB 2VVVA 1CA0B 3JZ2B 4F48B 1OWDA 3O8BA 2P94A 3SUGA 1CT4E 1H9IE 2PKSC 4TY6A 4X8UH 3UR9A 1QA0A 1KXEA 2QF0A 3PLPA 2DE9A 4FUBA 3TIUA 1K0HA 4I32A 3P8GA 1CGJE 4BAKB 4KKDA 3SUDA 1GI2A 3S7HB 4ACAA 3RXIA 4JYUH 2BY5X 1P12E 3PTBA 4H6SB 3RXJA 4KTCA 3MU5A 2D8WA 5DG6A 4YOJA 3Q76A 1OWIA 2A7HA 3E91A 1V2NT 1C1MA 2WYGA 2ZHDA 1DXWA 1GVZA 3GY3A 4F55A 1LKBA 3MOCA 1TGTA 1LTOA 1V2PT 2KFWA 3SU6A 1EAUA 3GS9A 2ZTXA 2I6QA 1GCTC 3TGIE 3BEUA 2QXHA 3M3VA 3ZVCA 1GI3A 4INHA 2HNTE 1GDNA 2QAAA 4XE4A 2JJ1D 1TFXA 3BN9A 2J98A 1YKTA 4DW2U 1LHCH 3RP2A 2WPDD 4NG9H 3SGQE 1SBWA 1YC0A 4Q7XA 5T6GA 1FPHH 1P0SH 1LPZB 1K1LA 4SGAE 1A1RA 4X6MA 1S6LA 5JB9S 1FY4A 4M7GA 3ZZ5A 1TGSZ 1C5XB 4ZXYH 3WY8A 2BDAA 1KDQB 5E2OA 1XXFA 2G51A 1T8MA 7GCHG 3F6UH 2F91A 3UNQA 5J4QA 2ODYB 5AFZH 3MU8A 2WUCA 1VCPA 5EJZA 2ZGBH 4X1SU 5K7RA 3KQBA 1BA8B 1UTMA 4CBNA 1YPEH 4FU9A 4MTBA 1O5CB 4Q63A 2CHAC 3K65B 4CRBA 3ZVEA 3TPIZ 3L3TA 1E79D 4IC6A 2HGTH 1S0RA 6GCHG 1MD7A 1N1LA 2ZDMA 5JDUB 3HKJB 1C5QA 3WWFA 5AHGH 4IN1A 3QUMP 2GCHG 1HGTH 1TMBH 3LT3A 3SOSA 4HFPB 4R0IA 1GHVH 3GYMA 2PGBB 4DOQA 4OGXA 2EI7A 3MO9A 1PPZA 3VGCC 1MKWH 2KCPA 1OKXA 1Y8TA 2B8OH 2XOKD 1Y5AT 3E1XB 1A46H 3F0OA 2QY0B 3AAUA 4NCYA 1OPHB 2AS9A 2CF8H 3T28A 1Y3WA 2W5EA 1YGCH 1O32A 1P2MA 1O3NA 1EAWA 1KY9A 1C2FA 3PMAB 5F8TA 1Y3XA 3WW7A 1EUFA 1ELAA 3ZV9A 1O37A 2GGVB 5EQRA 3KIDU 1O5AB 1TBZH 1QB9A 5A8ZA 1O2YA 2VIWA 4ZHMU 4AYYB 4BAQB 8GCHF 1LVBA 4ISHH 3M7QA 2ULLA 1ANDA 1TOCB 4GAWA 4XOJA 3T29A 1SGPE 3ZVBA 3RXHA 1GVKB 1CU1A 4FUGA 1K2I1 4P02A 2C8XB 4NSYA 2Z9JA 3FZDA 1C2MA 4K2YA 2BVXH 1FY1A 2VWNA 5EU8A 4CHAB 4YXWD 1KLJH 4LK4A 2R3YA 4ZKOU 1W3CA 2FI4E 5CHAB 1NFWA 3RXEA 9ESTA 5FBEA 4UFFH 3MWIU 3A85A 3SU1A 4Y8XA 4Z1MD 1RRKA 3BTME 4ZHAA 1Z8GA 2WV4A 4D7GA 1F5KU 3S9AA 3LGTA 3N7OA 1EJAA 1UK3A 3BEIB 3SU0A 1YPHC 3M5MA 1Y3VA 3LPRA 2VGCB 2UWLA 1THSH 1V2LT 2O8MA 1QURH 1MKWK 1V2MT 3TNSA 1E36B 1AVXA 1BRBE 5C5OA 2ZQ2A 1GJCB 2BLQA 1BBRH 3SV2H 1AVGH 3DCLA 3QWCH 2BD3A 2KZ4A 1D6WA 1W0JD 2J2UA 2ZI2H 1BHXF 3EAJA 4RKOB 4B2BA 1B7XB 2F3CE 1KSNA 4AORA 1F5RA 3RC5A 4ZHLU 4JMYA 1RFNA 4CRGA 5AFYH 2G52A 3TJVA 4F4OC 3P95A 1GI5A 3TK9A 1B0EA 2AIQA 3PRDA 3ATKA 3LGIA 3UFAA 1AFEH 1O2VA 1LPGB 2RDLA 3ZV8A 1KXAA 1C9PA 4XFQA 2GCTB 5PTPA 1AFQB 1O2RA 3RXKA 5E0JA 4JK6A 4KGAA 2PP6A 1IQFA 2P8OB 2XC5A 1SGDE 1KLTA 2STAE 1CHOF 2A45B 3QZQA 1RIWB 3U8TH 5FAHA 3VB4A 1PQ8A 2Y7ZA 1KXCA 3VB6A 4X1RU 1DSTA 2F4LA 2PHBA 3PMJA 1C5RA 1GBEA 1VGCB 3SJIA 3LJOA 3Q00A 1K21H 3SGBE 1GI1A 1BZXE 1NTPA 1RS0A 1O2WA 1DFPA 1TB6H 1N8OC 5FBIA 3QDZB 4CRFA 1QY6A 1QJ1B 1GJDB 2ZA5A 1PPCE 2ILNA 1J14A 3W94A 1YLCA 1F0UA 1LO6A 3E3TA 3E0NB 5F6MA 1GBCA 2R2MB 1K1IA 1WCZA 1DUAA 1TAWA 1DICA 3RU4E 1FY8E 1MTUA 1NO9H 2FZZA 1SC8U 3RXOA 4FUJA 1TNKA 1QRZA 1AO5A 4U2WA 3LKWA 1YLDA 1O2QA 1TRYA 4MQAA 1Z8IB 2OC1A 1TA2A 1ZRKA 2GV6A 1ZJKA 1GCDA 1SOZA 2OBQA 4MNVA 1UTJA 1P2NA 2ANKH 1K28D 2GT7A 3W95A 1MU8B 1P57B 1J17T 1Y3UA 2V3HH 4VGCB 3W1EA 3A83A 1GBAA 3VFEA 2BVRH 1TRNA 1E35B 2OCVB 5DP5A 3PTNA 1TONA 3M7UA 1YWUA 2R9PA 1OXGA 4I31A 4I8LA 1DOJA 1HIAB 1ZHRA 1G2MA 3QX5H 2XCNA 5T6DA 1A3BH 1H9LB 3E6PH 1DVAH 1P2IA 4RKJB 1K1OA 1P9SA 3LGVA 1P03A 1O2UA 4K1TA 1UTPA 2FIRH 2J5UA 3T27A 4O97A 5EXNA 2BQWB 2GZ8A 1O3MA 1TA6A 2IN2A 3RU4T 3FZZA 4ABAA 3E0PB 3RXMA 2VGCC 1TBRH 4ASUD 1SLXB 1Z1IA 1FX0B 1QR3E 3IWMA 3P92A 1O0DH 5L30H 5ESBA 1UVPA 4OM9A 1EB1H 1G3DA 2V35A 5TCCA 1NU9A 3M61U 4ZKRU 1MKXH 5JBAS 4R8TB 5C0TA 2Z9IA 3S7KB 1O5GH 1O3EA 2H9TH 2TGPZ 4CH8B 4DURA 2D2DA 1XMNB 3VPKA 7GCHF 1XUFA 1GJ8B 2HVYB 2HLDD 1KDQA 3GDVA 1HAXB 2RFKC 1DT2A 4HG6A 1SG8B 4MVNA 3ZZBA 1T8OA 1QFKH 1BUIA 1QCPA 2A2QH 3RDZA 4B2CA 1GGDB 3KQCA 1ZHMA 4NFEA 1GG6B 3LH3A 1O2ZA 2VH6A 4NZLA 1J16A 1J8AA 6GCHF 1ZTJA 1ZRBA 1CHGA 5F53A 3A89A 1GJ6A 2P8OC 3BG4C 4RT1A 3MU1A 1V2ST 4JCNA 4ZAEA 1SL3A 4A1VA 2ALPA 2J4IA 2VWOA 2GCHF 1DWBH 1BMMH 4GHQA 1YPHE 2EC9H 1DPOA 4ABEA 1ZMNA 3BTDE 2CN0H 2ZGJA 2G4TA 1G37A 3UUZA 1O3HA 1PPGE 4A1TA 1EPTB 2WSSD 4MNWA 1TPAE 3BTFE 3VXFH 2BTCE 5TJXA 3P8NA 2BD2A 2VNTA 1TIOA 1C5TA 2IPHA 2STBE 1A4WH 3MNBA 5A8XA 4NIYA 1L0ZA 4GSOA 2PTCE 1D3QB 2VB0A 3SZEA 1GBDA 2JJ2D 1O3JA 2KR7A 2BLOA 3QLPH 5HKKD 8GCHG 1HYLA 2K0QA 1OWJA 1K22H 4B6EA 2C90B 4TYDA 4AB8A 1NRSH 3CS7A 1LHFH 3NPSA 1AB9C 2PR3A 2UWOA 4BAMB 9LPRA 2ANMH 5JYIA 3SZNA 3ZZ4A 3QN7A 4P00A 1JIRA 3H7OA 1H1BA 3TK5A 2GV7A 3ZZ8A 1CGIE 1E37B 1MAXA 1EX3A 3FP7E 3KF2A 3RXVA 4GPGA 2J95A 3RXFA 1O2SA 4U32A 4ISOA 3PWCA 2ZFSA 3SBKA 3HPTB 1AUJA 2A5KA 1GCTB 4TWWA 1E1QD 1SB1H 2BD8A 3ZYDA 3A7YA 2F9PA 3QGNB 1S6HA 2YNAA 1O34A 2OC0A 3DA9B 4DG4A 1KYNA 3RXBA 4JZFH 1MQ6A 2O8TA 5L2ZH 3MI4A 1IHSH 2XC4A 1AI8H 7LPRA 1BCUH 3M5OA 2ZQ1A 3B23B 1C4Y2 3KQEA 2FLBH 1ID5H 1IQJA 1COWD 3A88A 1YCPK 2BXUH 3ZZDA 3EA9A 1AHTH 3QO6A 1BQYA 1SGQE 2B9LA 1SFIA 1C1SA 3U8OH 4FUIA 4CR5A 3AAVA 2XWAA 4NIXA 3GCHC 3CS0A 5FPTA 1PPFE 2QGRA 4E05H 3UR6A 3M35A 1AKSB 2NU2E 3RLYH 1GMCG 2K1QA 1C4U2 2ZGCA 5DPAA 4XBCA 3UNRA 4CREA 1Z71A 2CHAB 1NROH 1C2DA 1L4DA 3NWUA 1VCQA 4B74A 3PLBA 1EKBB 2ZO3H 1GMHG 4LXBH 1GI4A 1ELDE 4NFFA 4E06H 1GBLA 1PYTD 5EJ1A 1HXFH 1Q31A 4HI3A 1G2LA 1FJSA 2Q1JA 3LH1A 1TPSA 3A81A 2ODQA 1HLTH 5F03A 1P11E 1UCYK 3ZVAA 1Z8JB 2A2XH 3D23A 4WMDA 4YOIA 1EPTC 3MH6A 1HPGA 1XUKA 2BY9X 3RXAA 5GNDA 1TMTH 2BDHA 4U30A 1UO6A 4BXSA 4UONA 4OGYA 2ZZUH 3A8CA 2FMJA 1O2KA 5A0BA 3PMBB 2ZFFH 4XDEA 1EZQA 1T8NA 1ZOMA 3BTTE 4DVAU 1HJAC 4O3UA 2P93A 1BTPA 1OWEA 1O3BA 1VJAU 1Z7KA 2ZHEH 1D9IA 1P8VC 2G81E 3AASA 2BLVA 4FU8A 5HIYA 4AG2A 2NU3E 4CRAA 2BMGB 1C5VA 2ZGXH 1VZQH 2BX4A 3SJ9A 2YMSD 4B75A 2AHME 1SPJA 5IK2D 3LGYA 5DJ7A 4I8JA 1O2XA 1YYY1 4IS5A 1DWCH 4AGKA 5EODA 2BQ6B 3SQEE 3TH2H 5CDFE 2OINA 1XKAC 4XRNA 5DO4H 1UVTH 4GCHG 2W7SA 3GY7A 3VB5A 1NBMD 3FKSD 4WXIA 3GDUA 5F8XA 2OK5A 2EY4C 1H8ED 3PB1E 1T8LA 2J94A 3MNSA 1BTHH 4K1EA 2W6JD 3AW1A 1HIAA 1FAKH 5LPFA 4BTTB 1MTSA 3L6PA 5JBBS 1P3EA 3OE7D 3MU0A 2GDEH 1C5OH 1ZYOA 1MMJN 1O3AA 3HK6B 1MZDA 3BTEE 1LQEA 1YPMH 3TGJE 2ZHQH 2PUQH 4I8HA 2NU4E 1N6YA 1XUHA 2A4OA 1O2IA 2GKVE 3MYWA 2ZDLA 2NU0E 1AZ8A 1O31A 2PSXA 1F92A 1VCWA 4PROA 3RM2H 2HLCA 3LC5A 7ESTE 3SHCH 1FY3A 1PPBH 1C1TA 1FQ3A 2ZPQA 1FN8A 1C5UA 2RA3A 5EQQA 3UTUH 2BDBA 1ELTA 1ZR0A 1D4PB 1K1PA 1C1UH 1GHWH 3HGPA 1BMAA 2HNTF 5E0GA 1BB0B 1NRRH 1O3FA 2QA9E 2A31A 3HGNA 5A0AE 5I25A 1W0KD 1HJ9A 2ANWA 1LQDB 2BX3A 1FV9A 1G30B 1K1MA 3SI3H 1JIMA 2FX4A 1CO7E 2BVSH 1UK4A 3T5FH 2RG3A 3VXEH 5E2PA 4WY3A 1K1JA 3UQVA 4O03A 1YPKH 4KTSA 5LGOA 5C3NA 2FEQH 3D62A 1QJ6B 2ZTYA 1YPJH 1SQAA 3FVFB 1O2OA 3O8DA 3RC6A 1KXFA 4QT8C 2R0LA 3F1SB 5GDSH 1V2UT 3TJNA 3RXSA 2PV9B 2FYRA 3VEQB 3A7VA 3SUEA 1P01A 3SV7A 3HATH 1EPTA 1HAHH 3RXCA 1QB6A 4CRDA 1N8OB 2TGDA 4X1PU 1C5NH 2GDDA 2ALVA 1FXYA 1QQ4A 3NRLA 4D7FA 3DSGA 1D3PB 5ESTE 4X6NA 2PKAB 4JYTA 4CH2B 5K0HA 4X1QU 5FX5A 2NU1E 3SNBA 1TX7A 3LGUA 4Y0YE 2JH5D 2GJGA 3A8AA 1ELGA 3RM0H 3ZYEA 1OSSA 1GHBG 3M37A 1VITH 3ODDA 2Z3CA 4NWLA 1JMOH 1C1NA 1O2TA 1WBGB 4NA7A 4UFEH 3CP7A 2R3UA 4CR9A 1AN1E 1GBHA 2A5AA 2XWBI 4FXGH 3V7TA 4A1XA 1IQKA 3QGJA 1IQLA 3OYPA 2FI3E 5BPEA 3MO3A 2ZCKP 1BJVA 3Q3KA 4RSPA 3S0NA 1RTLA 2BYAX 3QK1A 1QL9A 1P10A 1GJ7B 1C5WB 2PFEA 1WU1A 4ABGA 1DUEA 1TX6A 3GY6A 1HRTH 4A7IB 2KAIB 3SO3A 2VVCA 3SV6A 1NN6A 3UREA 3KNXA 1S83A 3F2HA 2W7UA 3ATIA 2W3KA 1QBOA 3PWBA 4A5TS 3P8OA 2ZWLH 3AW0A 5JBTA 1D6RA 2BB4A 2ZU3A 1CT0E 1UTLM 5IDKA 4Y76A 4Q4LA 5IYTA 4X6PA 1BTXA 3T26A 2ZECA 1C4V2 2VH0A 5FCRA 3GY5A 2Y81A 2ZFPH 2Z7FE 1PPHE 1NFXA 1BT7A 2THFB 1RTKA 1BIOA 4BTIB 4UE7H 1CT2E 2FO9A 1BTUA 3GICB 2O9QA 4ABDA 3MNXA 1TNLA 1HXEH 4H42U 2EA3A 1DWEH 3SU2A 1GMCF 1VITG 2BD5A 2F83A 2WINI 2CGAA 5EGMA 4H6TA 3KCGH 1AKSA 1GBFA 1HFDA 6LPRA 1BTWA 1GVLA 1P3CA 4TPYA 2BD9A 3SNCA 1FLEE 1A3EH 1MH0A 1GMHF 3BG8A 4BAHB 1AWFH 3BG4B 3CENA 1H8DH 1KXBA 3T2NA 2YOLA 4GVUA 3GDSA 3EA8A 1LDTT 2L6OA 2WPJS 2Q6GA 1OWHA 3E8LA 4I8KA 1SI5H 2SNVA 3SYJA 1P2JA 1QBNA 3TK6A 3ZZAA 1O3CA 1DDJA 3BIUH 2XW9A 4B6FA 2R0KA 2Z6BD 3GY8A 2JH0D 1MCVA 1XXDA 1NFYA 5KEDA 1O35A 1HAYB 1SSXA 4ESTE 1SGFG 3OFND 3RMMH 4NSVA 3Q3XA 5A2MH 3PLKA 3UWIA 1MTWA 4THNH 1H8IH 3ZZ9A 1GBMA 4NA8A 1OYTH 4YLQH 4UDWH 1FNIA 1ZMJA 4O3TA 1HAPH 3TJUA 1MU6B 3SW2B 2VIDA 4INKA 3SNDA 1NS3A 3MO6A 1WV7H 1L1GA 1W12U 2H2ZA 3N7EA 3URCA 2QF3A 1O2NA 3K6YA 3RXLA 1BBRK 4CBOA 1CGHA 1PYTC 1QA7A 2ZU2A 1ESBA 5C0UA 2UUKB 1ORFA 4TWYA 1SHHB 1H9HE 3DSPA 3FP6E 1ZSLA 2F9NA 2BY8X 2AMDA 1YY3A 2XRCA 1TPOA 4OS4A 1AB9B 4DJZB 1ARBA 1NRQH 2F9VA 1G3CA 3LGWA 4D76A 3A87A 2LELA 1AMHA 4GCHF 2XCFA 1NY22 4AFQA 1TQ7B 3RXGA 1FIZA 2TBSA 3NZIA 3KYGA 1SLWB 1WQVH 4Y71A 4I7YH 3PO1C 3AK5A 1F0SA 4U01A 1C1RA 1H4WA 3DSOA 2WUBA 1TNIA 5FX6A 1T7CA 1G3BA 1C1QA 1K9OE 2AERH 1WYKA 5DP8A 4HGCA 5C94A 3U9AH 1MABB 3MHWU 1AZZA 1O3GA 2XBXA 4XSKU 1INCA 2A32A 1ABJH 1LVOA 2Q6DA 2RA0A 3FANA 4Q7YA 4X8TH 1WDIA 1CE5A 1C1PA 1C2KA 1LMWB 1OYQA 5HYOA 1RGQA 2YMSC 4B2AA 1EQ9A 5DK1A 3N99A 1NFUA 1G3EA 3RLWH 1L1NA 4IW4E 2A4QA 3UQOA 5FL7D 4X6OA 3NCLA 1GJAB 4I86A 1GI0A 1UVSH 1YF4A 2IJOB 5EW2H 1TX8A 3Q3YA 3STIA 2CMYA 1O3LA 2Y5HA 1RXPA 2FWWA 1ARCA 2PTNA 2WPMS 3DHKH 1TNGA 2QXJA 3URDA 1C5PA 3U98H 4BNRA 4ISNA 1FDPA 2VJ1A 3KGPA 3GCHB 3PV4A 1O30A 8KME2 2BZ6H 4X2VA 4Y7AA 1OX1A 5F8ZA 2DUCA 4YOGA 2HRVA 2K8IA 2SGFE 3O8CA 1F0RA 4FUCA 1HCGA 1H8HD 3BTKE 1PQ7A 5KGOA 2J92A 4BAOB 3WWBA 2A5IA 1W7XH 1YPGH 1HB0B 1O3OA 3SJKA 1SR5C 1P09A 2HALA 5EOKA 4E7NA 1MBMA 4Y6DA 4TT3D 1AU8A 6ESTA 4ASHA 2V6NA 1AWHB 1DWDH 1O5FH 1A7SA 2QCYA 3BF6H 4OS1A 1SLVB 2OLGA 2CK3D 2Y5FA 2UUJB 3N7DA 5EJLA 1QJ7B 1AY6H 5DKMA 3RMLH 1WQSA 2V3MA 4Z0KA 1LPKB 2ZU1A 2QC2A 2PUXB 2FXRA 1TLDA 2Z9LA 5EXMA 4Y11E 1SMFE 4ABHA 3NXPA 1ZGIA 2H6MA 1Z6JH 1BRUP 3TVJB 1XUIA 2FI5E 2HPPH 2ZCHP 7KMEH 1EJMA 3ENSB 2ESTE 4AZ2B 1RTFB 2W3IA 3SU5A 2CF9H 4WMFA 1YBWA 4BXWA 2AFQB 2F9BH 5GPIB 2PKAA 1HJAB 1L1JA 1MKXK 1YLNA 3VG8A 3U8RH 1GHBF 1F5LA 4K8YA 1GHAF 1ZHPA 2DE8A 1ESTA 3LDXH 3BTGE 4J2YB 3AVZA 1A2CH 2FODA 1EASA 1ETSH 2C8ZB 5DGJA 3U28C 1N6XA 5JBCS 1EAXA 1FONA 1NRNH 3IITA 4BTUB 2BZAA 2ZHFH 1SHYA 4AFSA 3TGKE 2FLRH 3RXUA 4JZEH 3TNTA 3E90B 1DANH 1SGFA 1UTKA 3A86A 3ESTA 4KP0A 5H4IB 4J1YA 4FU7A 2ZTZA 2BOHB 1LCYA 1BTZA 3A84A 5AVDA 1P02A 2BY7X 3ODFA 2ZDVH 4I33A 1D3TB 1ZSKA 1IQMA 1ZLRA 2G00A 2KAIA 3SQHE 1L2EA 1O38A 3SGAE 5G4BA 1S5SA 3R3GB 1C2GA 2ZDNA 2FS8A 1WTGH 1SQTA 4AFZA 3MQKC 2OC7A 1GJ9B 4E7RG 1T4UH 4FETA 3BEFB 4Y0ZE 2VIQA 4B71A 4ABFA 1QQUA 1UK2A 1L4ZA 3PYHA 1KLIH 1O2PA 2JDID 3U1IB 3UY9A 4ZMAH 4DCDA 1AUTC 1O36A 2Z3DA 1IQNA 2PGQB 3EE0B 1QZ8A 5CHBA 2ZC9H 2ZF0H 5C1XA 2LPRA 1NZQH 2SGPE 2A7CA 5GJ4B 1TQ0B 2YNBA 4MPUA 3OU0A 2XNDD 1V2VT 1VITF 3V12A 5B6LA 1S81A 4IN2A 4NIWA 2J34A 2ZP0H 3D65E 4IBLH 1HJ8A 1FPCH 4ZROA 4DY7B 2OTVA 4Y10E 3UOUA 2Z94A 2VWLA 1DE7H 1JBUH 1GBBA 1YM0A 1GL0E 2GT8A 2XBWA 2AMPA 3T62A 1EB2A 2HOBA 3GY2A 1ACBE 5HGGA 3R0FA 3P70B 1V2RT 2CJIA 1OP0A 4MNYA 3UNSA 1EZSC 1V2KT 2XBVA 2KCYA 2B0FA 3SORA 1O33A 1J9CH 2ZCLP 3EQ0H 6CHAC 1O5BB 1TNHA 2J9NA 3S69A 2RCEA 1EATA 5DP4A 3LOXA 1C2LA 1HAZB 1C5YB 2FOAA 1MD8A 3SHAH 1W0ZU 4WJG2 2QXIA 1O2JA 1NBME 1KMHB 1BMFD 2Z3EA 4MPVA 1TMUH 2TIOA 1OWKA 2D1JA 3F3BA 4BANB 1LHEH 2ZFTA 1DXPA 1YPLH 4UEHH 2GZ7A 5HIZA 2J38A 2VIOA 2ZFRH 4Y7BA 1GI6A 1OS8A 1FIWA 2PLXA 2A1DB 1GJBB 2WYJA 3MTYA 1NRPH 2GMTC 4MDSA 4ZKSU 1CA8B 2ZFQH 4DGJA 1Y59T 3EDXB 2WPIS 2C4FH 4Y8ZA 1SFQB 4F49A 5T3HA 1UTQA 2BXTH 1NC6A 1SGTA 2XBYA 5EPNA 2ZPSA 5C67A 1RJXB 5DP7A 1WSSH 2OXSA 3OY5U 1E0FD 4GLYA 3VB7A 5LPRA 1S82A 1WOFA 4YM9A 3GCOA 2AGIX 1A0JA 2W6ID 1SGEE 3DFLA 3PROA 5SGAE 5HXFA 5DP9A 1WAYB 3LJJA 1W14U 3RXTA 1FZZA 2C3SA 2SGEE 1TYNA 3FFGA 3ITIA 1GMDG 2IPQX 5A0CA 3B9FH 1OP8A 3OEED 4K3JA 3FP8E 1Q3XA 3PV2A 1SLUB 2O8WA 2PSYA 1ELVA 1ANEA 3M3TA 2Y6TA 3HKIB 1HAVB 1MCTA 4AFUA 2JETC 4X1NU 1THPB 2VBCA 5C5NA 2XYAA 2AGEX 4ZXXH 5GIBA 2QF4A 1V2QT 4WXVA 3ZIAD 4K60A 1O2LA 2KCAA 1TGCA 1PQAA 3M3SA 3TH4H 1C1WH 1F2SE 5B6OA 2CXVA 4X2WA 1O3DA 3A7ZA 2P59A 1KTTB 1ZTLA 4MNXA 1M9UA 1MUEB 1GI8B 1ZSJA 1DSUA 1LKAA 3UPEA 2QN5T 3KYFA 1ZJDA 2OBOA 2ZPRA 5L2YH 2GTBA 5DP3A 5JB8S 3O8RA 3DD2H 2ZNKH 1EOJA 1XUGA 1QNJA 1HAGE 2WPHS 3ATWA 1UVUH 2Y5GA 1IHTH 1XVMA 2QE7D 4DIIH 4ZH8A 4AX9H 4MPWA 4AOQA 1PQ5A 4YLUA 4DT4A 3U1JB 2GD4B 3MH7A 1QB1A 3JZ1B 3NKKA 1DS2E 3U69H 4FUDA 1QIXB 4FVDA 1ELEE 3QTVH 5EXLA 1C1VH 3SUFA 1LHDH 1A5IA 2KM0A 2BDCA 2FOGA 4CRCA 3UAIC 2SNWA 3SNEA 1EXFA 3A8BA 1J15A 3RUOA 2H5DA 3ZZ3A 1E34B 1XVOA 2FS9A 2G55A 3GCTF 3M7TA 4AYVB 2TGTA 4NZQA 3I29A 1TE0A
chains in the Genus database with same CATH topology
5FPSA 1HAIH 1PFXC 1NPMA 1EP6A 2TPIZ 1G32B 4JZDH 1BJUA 3RXPA 5TCAA 1P04A 1GI7B 4XBBA 1GHAG 2ZHWH 1GBKA 2AGGX 2VIVA 8ESTE 2VWMA 1FAXA 1CA0C 1GHYH 5L6NH 1A5GH 4UFGH 1NT1A 2H1UA 1NM6A 3M5NA 1TBQH 1Z6EA 4HZHA 4D8NA 1P05A 1THRH 2HVXA 1G9IE 2Y7XA 1BRAA 1UVOA 2OQUA 3F9HA 3RXQA 2ZU5A 3PMHB 1IQGA 5ABWA 2AH4X 3BTHE 4DIHH 3ATMA 3TU7H 3PO1B 1LHGH 2EI8A 1C2JA 1GBIA 2CV3A 5FHTA 4Y8YA 1GHXH 3KL6A 5DP6A 5GCHF 2BY6X 3GCNA 4WVPE 2FX6A 1B5GH 2O8UA 1BITA 1ANCA 1TWXB 2IOTA 1KIGH 2R2WU 2AIPA 2EEKA 2QXGA 3B8JA 2OC8A 3QZRA 1UHBB 3EGKH 2BQ7B 1A5HA 3GISB 3G01A 2UWPA 3BV9B 1FI8A 4HTCH 3TITA 3SV9A 2UUYA 1GHZA 4BOHA 1UJ1A 1BMLA 3ZZ6A 1ZTKA 2FYQA 2QIQA 1HV7A 2XXLA 2TGAA 3SU3A 5FPYA 1EZUC 1HUTH 3V13A 4YESB 2G8TA 2H9HA 1SVPA 2PWXA 1DM4B 4YT7H 1NU7B 4A92A 5A8YA 3BTWE 5HMAA 1V2TT 1S0QA 1GDQA 4JYVH 1TNJA 1UCYE 2SGDE 2QV1A 2FDAA 2XTTB 3OSYA 1BRCE 1ELBA 2F9UA 8LPRA 2P3UB 3K2UA 1HDTH 2G5NA 5C1UA 1QRXA 1QGFA 1CQQA 1YP9A 1ZZZA 3LU9B 2VU8E 1CVWH 1GBJA 3S9CA 3PM3A 4Q80A 1IQIA 4IGDA 1TOMH 4K69A 2B7DH 1ELFA 1GJ4H 4X8SH 1A0LA 2XNIA 1YCPM 2ZEBA 2BOKA 1SGYE 1W2KH 1HBTH 1Z8RA 1FMGA 1Q2WA 1V2WT 4MPXA 1EZXC 5HM9A 5EW1H 2FOFA 3MNCA 1F0TA 1T31A 3P6ZB 2H5CA 3K6ZA 1ZPZA 2FOEA 2SFAA 2FM2A 1C1OA 2GZ9A 2SGAA 4MLFB 3BSQA 3I77A 5E0HA 2A7JA 3MMGA 1C5LH 3GYLB 3LIWA 1B0FA 2C93B 2FOHA 3MFJA 1E38B 1TABE 3P17H 3ZVFA 1PPEE 1TGNA 1A61H 2FP7B 4Q2KA 1A0HB 2GVFA 1TRMA 4WH6A 3S9BA 1DLEA 1Y5BT 1AIXH 1Z1JA 4ABIA 1V3XA 1P2KA 1O3IA 1Y3YA 2AMQA 2GX4A 3OY6U 2A4RA 4K5ZA 1S6FA 5EQSA 3NK8A 1V2JT 3FAOA 3SN8A 4Z6AH 4XBDA 1MQ5A 2HPQH 3F9EA 3KHVA 4AN7A 1AE8H 3ZZ7A 1SQOA 2A0QB 2FTMA 1TGBA 2XC0A 1SGRE 1LVYA 2AEIH 4O9VA 1P2QA 3K9XB 1KXDA 1GMDF 2FOBA 1JRTA 2M5TA 4INLA 1AGJA 4OS7A 3OTJE 1QL7A 2PW8H 2P95A 4K1SA 3EA7A 3SJOA 4CHAC 1D3DB 5ETXA 2WV5A 5CHAC 3SNAA 1IQEA 1K1NA 1HNEE 4AG1A 1HAVA 1XKBC 3SU4A 1O2HA 1ELCA 3RU4D 4FUHA 2WPKS 1FY5A 3F9FA 1T4VH 3UIRA 4UD9H 4IMQA 2OUAA 3F68H 3DT0H 1AE5A 3LC3A 2A4GA 4D9RA 1O2GH 3H7TA 1ZPCA 1T32A 4WF8A 2V0BA 3ATLA 3IG6B 1FN6A 1AD8H 2Z9GA 3P8FA 2FOMB 2F9OA 2ZDKA 2BD4A 2OQ5A 3RXDA 5J4SA 3C27B 1P06A 3ELAH 4FUEA 1O5DH 1W11U 2BM2A 1DY8A 5E8EH 1CBWB 2BDIA 1W13U 2FTLE 3E16B 1G36A 2I6SA 3A80A 3A7TA 1OP2A 1C2EA 2P16A 4LZ4B 1EAIA 3V3MA 1MTNB 2P3FH 5I46H 1ETTH 3UWJH 5CE1A 1S84A 1P9UA 1W10U 1BOQA 1DX5M 3D49H 1QL8A 1GDUA 2FOCA 4YO9A 1DY9A 2BDGA 3RMOH 2BLWA 2TRMA 5EPYA 2GCTC 1AFQC 1RD3B 2H9EH 3STJA 6CHAB 3MH5A 4B73A 1NESE 1RIWC 1LVMA 1C2HA 1GPZA 3HK3B 4LOYH 2WPLS 1QTFA 1XM1A 4RN6A 1DLKB 3TH3H 1EP5A 1VR1H 1VGCC 3GCTG 2NWNA 1MBQA 1MAYA 3SV8A 2JKHA 2ANYA 1W7GH 1PJPA 3BTQE 4OS6A 3M36A 1BHXB 1C2IA 4ABBA 2UUFB 2VVUA 2ODPA 4I8GA 5LPEA 1SGNE 2AYWA 3ZVGA 1GBTA 1C5MD 1O39A 1UTOA 4NIVA 1YCPH 1QBVH 1W0YH 4NWKA 5C2ZA 2OP9A 3DUXH 1S85A 2HNTC 1O3PB 3A82A 2BDYA 4GHTA 1F7ZA 4TPIZ 1IOEA 2GMTB 1JXPA 1OOKB 1X7AC 3A7WA 2ZU4A 4YZUA 2PKSB 2VIPA 3Q77A 2ZKSA 1GWAA 2Q6FA 1AQ7A 2W26A 3QTOH 2P3TB 5FXLA 5BRRE 1JOUB 2Z9KA 2D26C 4DT7B 1ANBA 4IMZA 2G4UA 4ISLA 1EJNA 1CSOE 4VGCC 3L33A 1C5ZB 1O2MA 4ZKNU 4WWYA 5GCHG 3A8DA 4AGJA 2ASUB 1XX9A 4B1TA 4WMEA 3KEEA 4X2YA 3H5CB 1BMNH 1UCYH 4UFDH 4ABJA 4ISIH 5T6FA 2ZG0H 1GI9B 1O3KA 2JETB 3DFJA 4JZ1A 4D9QA 2O8LA 1DITH 1EOLA 1QHRB 4FUFA 1UHBA 3A7XA 3TLOA 4K8BA 2ZGHA 4Y79A 3RC4A 4NA9H 3LONA 5C1YA 4LZ1H 2Y82A 4JZIA 1BTYA 2JH6D 4H4FA 1GL1A 1Y5UT 4OS2A 2Y80A 3TJOA 2EI6A 1JRSA 1CBWC 1BDAA 3KN2A 1UTNA 4SGBE 1ABIH 1IQHA 1FUJA 5GXPA 3C1KA 3MU4A 1GJ5H 3M5LA 1ZGVA 1C9TA 1SGCA 1MTNC 2VINA 4IC5A 1WUNH 2FESH 3NUMA 5GWZA 2BD7A 3GOVB 3I78A 3V0XA 1HAOH 2BHGA 2GP9B 4KTUA 1ZMLA 4B76A 3RMNH 3OX7U 3UOPA 4OS5A 4AB9A 1GGDC 2G5VA 3T25A 1VJ9U 4X8VH 2C8YB 1GG6C 4Q7ZA 1JWTA 3F9GA 5CMXH 1UMAH 1MTVA 4YT6H 1SGIB 1KTSB 3VB3A 5FCKA 3SI4H 1O5EH 3GY4A 4A6LA 1V2OT 4WH8A 3SJ8A 1IAUA 2ZIQH 1BBRE 1ZPBA 5EG4A 3MH4A 4X2XA 1CHOG 1XUJA 2LNCA 1MZAA 2V3OH 4ZUHA 2ZDAH 2OD3B 1ETRH 4MG3A 1WTHD 4YTAA 4KELA 3ZZCA 5LH8A 4NGAH 1W8BH 4GUXA 3KQDA 5C20A 3RXRA 1QRWA 4X0WU 2QYIA 1SOTA 5JPMH 1P2OA 1C5SA 1V6DA 3VGCB 1U6QA 5HM2A 3BIVH 2C8WB 3EYDA 2FPZA 4TY7A 1ESAA 3ZVDA 5A09A 2B5TB 1AVWA 1TALA 4JK5A 2SGQE 1TPPA 5AF9H 4FVBA 2HWLB 2VVVA 1CA0B 3JZ2B 1OWDA 3O8BA 2P94A 3SUGA 1CT4E 1H9IE 2PKSC 4TY6A 4X8UH 3UR9A 1QA0A 1KXEA 2QF0A 3PLPA 2DE9A 4FUBA 3TIUA 4I32A 3P8GA 1CGJE 4BAKB 4KKDA 3SUDA 1GI2A 3S7HB 3RXIA 4JYUH 2BY5X 1P12E 3PTBA 4H6SB 3RXJA 4KTCA 3MU5A 2D8WA 5DG6A 4YOJA 3Q76A 1OWIA 2A7HA 3E91A 1V2NT 1C1MA 2WYGA 2ZHDA 1DXWA 1GVZA 3GY3A 1LKBA 3MOCA 1TGTA 1LTOA 1V2PT 3SU6A 1EAUA 2ZTXA 2I6QA 1GCTC 3TGIE 3BEUA 2QXHA 3M3VA 3ZVCA 1GI3A 4INHA 2HNTE 1GDNA 2QAAA 4XE4A 1TFXA 3BN9A 1YKTA 4DW2U 1LHCH 3RP2A 4NG9H 3SGQE 1SBWA 1YC0A 4Q7XA 5T6GA 1FPHH 1P0SH 1LPZB 1K1LA 4SGAE 1A1RA 4X6MA 5JB9S 1FY4A 4M7GA 3ZZ5A 1TGSZ 1C5XB 4ZXYH 3WY8A 2BDAA 1KDQB 5E2OA 1XXFA 2G51A 1T8MA 7GCHG 3F6UH 2F91A 3UNQA 5J4QA 2ODYB 5AFZH 3MU8A 2WUCA 1VCPA 5K7RA 2ZGBH 4X1SU 3KQBA 1BA8B 1UTMA 4CBNA 1YPEH 4FU9A 4MTBA 1O5CB 2CHAC 3K65B 4CRBA 3ZVEA 3TPIZ 3L3TA 4IC6A 2HGTH 1S0RA 6GCHG 1MD7A 1N1LA 2ZDMA 5JDUB 3HKJB 1C5QA 5AHGH 4IN1A 3QUMP 2GCHG 1HGTH 1TMBH 3LT3A 3SOSA 4HFPB 4R0IA 1GHVH 3GYMA 2PGBB 4DOQA 4OGXA 2EI7A 3MO9A 1PPZA 3VGCC 1MKWH 1OKXA 1Y8TA 2B8OH 1Y5AT 3E1XB 1A46H 2QY0B 3AAUA 4NCYA 1OPHB 2AS9A 2CF8H 3T28A 1Y3WA 2W5EA 1YGCH 1O32A 1P2MA 1O3NA 1EAWA 1KY9A 1C2FA 3PMAB 5F8TA 1Y3XA 1EUFA 1ELAA 3ZV9A 1O37A 2GGVB 5EQRA 3KIDU 1O5AB 1TBZH 1QB9A 5A8ZA 1O2YA 2VIWA 4ZHMU 4AYYB 4BAQB 8GCHF 1LVBA 4ISHH 3M7QA 2ULLA 1ANDA 1TOCB 4GAWA 4XOJA 3T29A 1SGPE 3ZVBA 3RXHA 1GVKB 1CU1A 4FUGA 1K2I1 2C8XB 4NSYA 2Z9JA 3FZDA 1C2MA 4K2YA 2BVXH 1FY1A 2VWNA 5EU8A 4CHAB 1KLJH 4LK4A 2R3YA 4ZKOU 1W3CA 2FI4E 5CHAB 1NFWA 3RXEA 9ESTA 5FBEA 4UFFH 3MWIU 3A85A 3SU1A 4Y8XA 1RRKA 3BTME 4ZHAA 1Z8GA 2WV4A 4D7GA 1F5KU 3S9AA 3LGTA 3N7OA 1EJAA 1UK3A 3BEIB 3SU0A 1YPHC 3M5MA 1Y3VA 3LPRA 2VGCB 2UWLA 1THSH 1V2LT 2O8MA 1QURH 1MKWK 1V2MT 3TNSA 1E36B 1AVXA 1BRBE 5C5OA 2ZQ2A 1GJCB 2BLQA 1BBRH 3SV2H 1AVGH 3QWCH 2BD3A 2ZI2H 1D6WA 2J2UA 4RKOB 1BHXF 3EAJA 4B2BA 1B7XB 2F3CE 1KSNA 4AORA 1F5RA 3RC5A 4ZHLU 4JMYA 1RFNA 4CRGA 5AFYH 2G52A 3TJVA 4F4OC 3P95A 1GI5A 3TK9A 1B0EA 2AIQA 3ATKA 3LGIA 3UFAA 1AFEH 1O2VA 1LPGB 2RDLA 3ZV8A 1KXAA 1C9PA 4XFQA 2GCTB 5PTPA 1AFQB 1O2RA 3RXKA 5E0JA 4JK6A 4KGAA 1IQFA 2P8OB 2XC5A 1SGDE 1KLTA 2STAE 1CHOF 2A45B 3QZQA 1RIWB 3U8TH 5FAHA 3VB4A 1PQ8A 2Y7ZA 1KXCA 3VB6A 4X1RU 1DSTA 2PHBA 3PMJA 1C5RA 1GBEA 1VGCB 3SJIA 3LJOA 3Q00A 1K21H 3SGBE 1GI1A 1BZXE 1NTPA 1RS0A 1O2WA 1DFPA 1TB6H 1N8OC 5FBIA 3QDZB 4CRFA 1QY6A 1QJ1B 1GJDB 2ZA5A 1PPCE 2ILNA 1J14A 3W94A 1YLCA 1F0UA 1LO6A 3E3TA 3E0NB 5F6MA 1GBCA 2R2MB 1K1IA 1WCZA 1DUAA 1TAWA 1DICA 3RU4E 1FY8E 1MTUA 1NO9H 2FZZA 1SC8U 3RXOA 4FUJA 1TNKA 1QRZA 1AO5A 4U2WA 3LKWA 1YLDA 1O2QA 1TRYA 4MQAA 1Z8IB 2OC1A 1TA2A 1ZRKA 2GV6A 1ZJKA 1GCDA 1SOZA 2OBQA 4MNVA 1UTJA 1P2NA 2ANKH 1K28D 2GT7A 3W95A 1MU8B 1P57B 1J17T 1Y3UA 2V3HH 4VGCB 3A83A 1GBAA 3VFEA 2BVRH 1TRNA 1E35B 2OCVB 5DP5A 3PTNA 1TONA 3M7UA 2R9PA 1OXGA 4I31A 4I8LA 1DOJA 1HIAB 1ZHRA 1G2MA 3QX5H 2XCNA 5T6DA 1A3BH 1H9LB 3E6PH 1DVAH 1P2IA 4RKJB 1K1OA 1P9SA 3LGVA 1P03A 1O2UA 4K1TA 1UTPA 2FIRH 3T27A 4O97A 5EXNA 2BQWB 2GZ8A 1O3MA 1TA6A 2IN2A 3RU4T 3FZZA 4ABAA 3E0PB 3RXMA 2VGCC 1TBRH 1SLXB 1Z1IA 1QR3E 3P92A 3IWMA 5L30H 1O0DH 5ESBA 1UVPA 1EB1H 1G3DA 2V35A 5TCCA 1NU9A 3M61U 4ZKRU 1MKXH 5JBAS 4R8TB 2Z9IA 3S7KB 1O5GH 1O3EA 2H9TH 2TGPZ 4CH8B 4DURA 2D2DA 1XMNB 3VPKA 7GCHF 1XUFA 1GJ8B 1KDQA 3GDVA 1HAXB 1DT2A 1SG8B 4MVNA 3ZZBA 1T8OA 1QFKH 1BUIA 1QCPA 2A2QH 3RDZA 4B2CA 1GGDB 3KQCA 1ZHMA 4NFEA 1GG6B 3LH3A 1O2ZA 2VH6A 4NZLA 1J16A 1J8AA 6GCHF 1ZTJA 1ZRBA 1CHGA 3A89A 1GJ6A 2P8OC 3BG4C 3MU1A 1V2ST 4JCNA 4ZAEA 1SL3A 4A1VA 2ALPA 2J4IA 2VWOA 2GCHF 1DWBH 1BMMH 4GHQA 1YPHE 2EC9H 1DPOA 4ABEA 1ZMNA 3BTDE 2CN0H 2ZGJA 2G4TA 1G37A 3UUZA 1O3HA 1PPGE 4A1TA 1EPTB 4MNWA 1TPAE 3BTFE 3VXFH 2BTCE 5TJXA 3P8NA 2BD2A 2VNTA 1TIOA 1C5TA 2IPHA 2STBE 1A4WH 3MNBA 5A8XA 4NIYA 1L0ZA 4GSOA 2PTCE 1D3QB 2VB0A 1GBDA 1O3JA 2BLOA 3QLPH 8GCHG 1HYLA 1OWJA 1K22H 2C90B 4TYDA