1UVOA

Structure of the complex of porcine pancreatic elastase in complex with cadmium refined at 1.85 a resolution (crystal a)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the Influence of the Incident Photon Energy on the Radiation Damage in Crystalline Biological Samples
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ELASTASE 1
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uvoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uvoA01
1FQ3A 2JH5D 4ZH8A 1AE8H 2ZEBA 1DUEA 2JETB 1ZGVA 2IOTA 4A1VA 1HAVA 1H9HE 2XWBI 1D3QB 2F91A 2ZHEH 4D9QA 1BBRK 3MI4A 2FTMA 1OOKB 2XCNA 1FLEE 1HFDA 5DK1A 3SU1A 3DT0H 4UE7H 3T26A 4D8NA 1XVOA 2BVRH 3T27A 1Z8IB 1XX9A 1PQ5A 5AHGH 1DSUA 2O8TA 4X6MA 1J8AA 5E0JA 1OSSA 4AN7A 1SOTA 3D23A 2PV9B 1V3XA 3RXTA 2A0QB 3EGKH 1HJAB 1V2NT 4XSKU 5AVDA 1K9OE 5C1UA 3P95A 3P6ZB 4YT6H 3SHCH 1O2IA 3QN7A 1FUJA 1EZXC 1F2SE 1WQVH 3DHKH 1P57B 2Z9JA 1XKAC 1BTPA 1L4DA 3A7VA 4I8HA 4BAQB 1TNGA 2A4GA 2FWWA 1FMGA 3UQOA 3NK8A 2BOHB 1FZZA 1W8BH 2P93A 2SGPE 1GG6C 1C5MD 2FYRA 2M5TA 3UWIA 3LKWA 4DCDA 1AKSB 2SGAA 4A1XA 2BY5X 4IGDA 2V3OH 4XBDA 1PYTC 3ZZ3A 3U1JB 1QB9A 2LPRA 3T62A 5GXPA 3SUFA 2BD4A 3UPEA 1QQ4A 2BDYA 1L2EA 1GMHG 3RMLH 3KNXA 4ZHMU 3GY6A 2P3FH 2AIQA 1OP8A 2ZGBH 5C1XA 4IS5A 4YLQH 4LXBH 1TPSA 1NC6A 2SNWA 4WWYA 4TY7A 1GMCF 1WOFA 3MNBA 3TPIZ 2FP7B 1IQFA 2BVSH 1E37B 1LHCH 4NWKA 3LH1A 4AFZA 1LPKB 3MNSA 3K65B 2ZU1A 4UEHH 2PSYA 4A7IB 2LNCA 2GZ9A 1J16A 3SNDA 4A92A 1DS2E 1SI5H 3OYPA 4Y76A 3E16B 5T6DA 1GJAB 4YTAA 5A8YA 3RM0H 2GDEH 3ITIA 1UTLM 5A2MH 1QRXA 1CT0E 1P03A 1VGCB 2WPJS 1W10U 1PPEE 2PKSB 5DP9A 1GHXH 4GCHG 3SU4A 1AKSA 2CGAA 4MPWA 3SGQE 4I8JA 3OX7U 4MVNA 1ZMLA 3ZZ4A 1S83A 3SV6A 1UTKA 5JBTA 3PMBB 5EXLA 1QRZA 1QB6A 2BY9X 3AASA 5FPSA 1NU9A 3SNAA 1HIAB 1ANBA 3I77A 2PKAA 1IQKA 4IBLH 3ZZ7A 4DG4A 2OXSA 3EQ0H 1FV9A 3SU3A 1UVPA 3ENSB 1QGFA 1J9CH 2DUCA 1GHBF 4MNYA 2ZFSA 1YKTA 1ZLRA 2TPIZ 2UWPA 1NFYA 4B76A 4TPYA 1BQYA 1K28D 2FDAA 2NU0E 2FOAA 4CR9A 4NA9H 3GCOA 3LGVA 4X1NU 2FO9A 3GY7A 1TBQH 2OBQA 1IQHA 1S6HA 1Y5UT 1AB9B 4ASHA 1FPCH 2O8WA 4K1SA 4Y10E 1BMNH 1TAWA 1SGRE 2R3UA 3RM2H 1IOEA 3GY5A 5GCHF 3EDXB 5CE1A 1QRWA 4AB9A 4X1QU 1TNIA 1N6XA 4AYYB 1DFPA 4JZIA 7GCHG 2AEIH 1BMMH 3SJOA 5EG4A 5TJXA 3E90B 3M5OA 4HI3A 1ZGIA 3GISB 3TK9A 3DUXH 3PMJA 1MTSA 1Y3WA 5JBCS 1DXWA 1WTHD 2OC8A 4HTCH 1PQ8A 2PTCE 1TALA 3MHWU 1FI8A 3SZNA 1SGDE 3SUEA 2H9EH 2EA3A 2ILNA 1TNKA 5I46H 1A3BH 4I7YH 3RXHA 5DP3A 3FP6E 5GCHG 1AVWA 2ZF0H 1C1VH 1BBRE 1RXPA 1HJ9A 4INLA 1G3EA 3FFGA 3GY4A 4NCYA 3SQHE 2QV1A 3BG4B 3TJUA 2NU4E 2P59A 1CGJE 1V2WT 4KKDA 3NWUA 9LPRA 4Q2KA 5F03A 3KCGH 1LQDB 4FVDA 1L1JA 4WH6A 2WV5A 2R3YA 2B7DH 1EPTA 1ELEE 1MTNC 4K2YA 1T31A 1BOQA 2ZNKH 1IQMA 3PWBA 1O3HA 3M7UA 3HKJB 1GBBA 4AG1A 5FPTA 1FNIA 2FS9A 3LC3A 2TIOA 4J2YB 2XYAA 4NIWA 1UTQA 2QXGA 1WU1A 1LHDH 5JDUB 2PSXA 4Q7XA 1QY6A 1G9IE 1SGYE 1S6FA 5A0AE 3VXEH 3ATKA 1O3OA 2GT7A 1O3GA 1K1IA 1KSNA 1YPHE 2Y82A 2QXHA 3ZVDA 6CHAB 1YYY1 2O8UA 1MKXH 3RXBA 2NU3E 1VJAU 4AORA 2BOKA 3SO3A 1XUJA 1BZXE 3QLPH 1Y5AT 2W26A 4ZUHA 3TGJE 1QIXB 5C20A 4X1RU 3Q3XA 5CMXH 1BMLA 1GHAF 2XC0A 2CJIA 1D3DB 2C8YB 1GBTA 3RC5A 5FHTA 1YPLH 1D3TB 2VINA 1TYNA 3NCLA 1GI2A 1ACBE 1T4VH 3BTEE 5EW1H 1BRBE 4IN2A 2A2QH 2QY0B 4FUDA 3UOUA 5EQSA 2BLQA 2C4FH 4DVAU 1YLCA 2GZ7A 8ESTE 1QHRB 2PUXB 4OS7A 2ZDNA 3RXMA 3QGJA 3SU5A 1HXFH 3V3MA 3MO6A 1TGBA 1D3PB 3OSYA 3EYDA 1WTGH 1MTWA 5DJ7A 1O31A 1Y3UA 2B8OH 3EE0B 4ZKSU 2WINI 1EAIA 4Y7BA 1LPGB 1MD7A 1W11U 1KXFA 3M36A 1GVKB 1O3DA 1Z1IA 1CU1A 1GMCG 2C3SA 3GCHB 3A89A 2SNVA 3SNBA 1Y3YA 2ZFFH 1V2PT 1D9IA 1TLDA 2Z3EA 3QK1A 3RXKA 1DSTA 2F9OA 1ANEA 3PV4A 1TX6A 5DKMA 1C2EA 2BY6X 1O2LA 1AVXA 2ZU2A 5JYIA 3M5NA 1A0JA 1DICA 3TK5A 1DVAH 4NWLA 1CHGA 1JXPA 5J4SA 1SLXB 5FBEA 1PPBH 4AFQA 1F92A 2C90B 3E3TA 2OTVA 2QXJA 4Y7AA 1OYQA 3LJJA 2R2WU 2CV3A 1THRH 3GY2A 4IMZA 2GT8A 4UFFH 3GYLB 1HJAC 1TGCA 4Y79A 1HAXB 3ZZCA 1YPEH 2PFEA 2ZDVH 3GDUA 1YCPM 3S7HB 1BRAA 4GVUA 5GJ4B 1GBDA 4FU8A 1MMJN 2ANKH 3QTOH 2H2ZA 2FESH 1E35B 2VJ1A 2R0LA 1QA7A 3A8AA 4TPIZ 5JPMH 1TRNA 3W95A 1P11E 1RTLA 1CGIE 1TWXB 3RXJA 5G4BA 1XUIA 1O34A 5EW2H 2XNIA 3SJIA 1DITH 2V0BA 5LGOA 1SG8B 4FXGH 4ZROA 3CP7A 3GY3A 3HGPA 2BDAA 4WF8A 2RG3A 5F8ZA 5TCAA 1ZOMA 1EOJA 4X6NA 1AUJA 1C2DA 4MNVA 2FOGA 2RA3A 5F8XA 5F8TA 5GPIB 1ZSJA 1TPPA 3S9CA 1UMAH 5FCRA 4Y6DA 4I8KA 1MBMA 3GICB 3P17H 1C1UH 2ANYA 3ZVGA 2C8XB 4UFGH 3BEFB 1ETSH 4Y71A 1PJPA 4X2XA 4KTCA 3LGYA 3KN2A 3HKIB 4X2VA 4KELA 5DO4H 1A0HB 3VB3A 1GBEA 2P94A 3TJNA 1P3CA 1AD8H 4XBBA 1C1QA 2QF3A 1KLIH 1O2KA 1SGFA 1TQ7B 2ZQ1A 2ZCLP 1O5EH 4ISNA 2ZPRA 1F0SA 1ANCA 1QQUA 2SGFE 1VCQA 1XUKA 2OBOA 3RXDA 4ZXXH 3AW0A 3IWMA 3TIUA 4O9VA 1C4V2 1AZZA 2P3UB 2F9PA 1EXFA 2AMQA 4UFEH 4H6TA 1T7CA 1Y8TA 4FUCA 3SGAE 2C8ZB 4DGJA 1UO6A 4Y0ZE 4CH2B 4UONA 2PLXA 5A8ZA 2GCTB 3RLYH 3U69H 3P8OA 3TGKE 3RUOA 3O8DA 5EOKA 2HNTE 1P12E 2A5AA 1DLKB 4NIYA 1H4WA 3Q76A 4BAHB 1NT1A 1C1MA 3VEQB 1G36A 4AZ2B 2Z3CA 5H4IB 5JBBS 1NRPH 1GBHA 1GBCA 2VVVA 3RXGA 2Q6DA 1HNEE 1B7XB 4Y8YA 1BCUH 1NRQH 1OWEA 4I31A 3RP2A 2ZI2H 3KF2A 4GSOA 3A84A 3HPTB 1ZJKA 2D1JA 2ZCKP 3TITA 1ETTH 1OKXA 1W12U 1O2ZA 1ELVA 2W7UA 1K1OA 3DFJA 4U2WA 4VGCC 4ZHLU 1EP5A 9ESTA 1FAXA 3RMOH 2ZPSA 1YCPH 2BLWA 5A0CA 5DP6A 5C1YA 1KLJH 1QJ1B 5T6GA 2BDIA 2ZKSA 1HB0B 1NS3A 1JIRA 5EPNA 1JIMA 1HDTH 1ARCA 1D6RA 3BG8A 1JBUH 3VPKA 1GJDB 1N8OC 3ESTA 4X1SU 4ABJA 1HPGA 4CBOA 1O5CB 4ZMAH 1LPZB 1O0DH 3FANA 1UVSH 2QIQA 1YGCH 1K1MA 4KP0A 1XM1A 3HGNA 4KGAA 1C1WH 1P2JA 2ZQ2A 4UDWH 3ZYDA 3PB1E 3TGIE 1HV7A 2DE9A 1OP2A 1QTFA 2GV6A 4WY3A 2BXTH 2H9HA 2BD3A 3LJOA 3NXPA 3TH2H 2YNAA 1AUTC 1MUEB 3A83A 3ODFA 2G8TA 2BXUH 2ZWLH 4FUIA 5GIBA 3URCA 2BD8A 3OY5U 1SGEE 1XUGA 2H5CA 4FUGA 3PO1C 6GCHG 2ALVA 4ISIH 1F0UA 1GDNA 4GAWA 1RTFB 4LK4A 2CF8H 1UCYE 3RU4T 1MH0A 2VGCC 1C2MA 2AH4X 3TNTA 2ZFTA 3F9FA 2F3CE 1OS8A 5EXNA 4F49A 2PUQH 4NSYA 2BY7X 2ZU3A 4GHQA 2ZHFH 3LGTA 3A7ZA 1O2RA 3L33A 4X2WA 1ABIH 1AN1E 1EJAA 2ZG0H 4BAMB 1O2MA 1P01A 4JYTA 3UWJH 1F0TA 3BTKE 5BPEA 1C5RA 1ZR0A 2GP9B 1HRTH 2V35A 3M61U 2G4UA 4XE4A 3VB5A 1GCTB 2PWXA 8LPRA 3Q77A 3SN8A 3UIRA 1Q2WA 3MTYA 7KMEH 3LGIA 5C5NA 1C5XB 3MNXA 2FXRA 4MQAA 1UTMA 2G4TA 1FONA 1TA2A 5K0HA 4NZLA 1IQGA 1GWAA 2C93B 3U8RH 4I32A 2VGCB 3RXSA 3ODDA 1P0SH 2P3TB 1AMHA 1E38B 3RXOA 1DWCH 1GI6A 1SB1H 1P10A 2QCYA 3BEIB 1GBKA 3ZVFA 4BTIB 1F5RA 2SGEE 1YP9A 3E91A 4ABIA 1FY3A 3P8GA 4ZAEA 1IQNA 2AYWA 1KXBA 3MO9A 4WMFA 3ZVEA 3VFEA 3KL6A 2HRVA 2VWOA 2UUJB 3ZVAA 5FX6A 3AVZA 3O8RA 3UTUH 1C5WB 2G52A 3RU4D 4X2YA 3RDZA 2WPIS 4H42U 1XVMA 4MNXA 4OS2A 2ZZUH 4WMDA 2F9UA 4BANB 1CHOF 4OGYA 1GPZA 3T2NA 4O3UA 3DA9B 3F6UH 3UOPA 1H8IH 1C2KA 4CBNA 3GCHC 1BDAA 3SI4H 3V0XA 2XC5A 3EA7A 1YC0A 1W0ZU 2UWOA 1TOMH 4KTSA 1TIOA 1Z8JB 3O8BA 3G01A 1KTSB 1V2ST 3I78A 1O35A 2VWNA 5EODA 1O2NA 2BQ7B 2JH6D 3BF6H 2GMTB 4K60A 3GDVA 1EB2A 1PPGE 4THNH 1DY9A 1BBRH 3RMNH 3ZZ5A 4R8TB 1L1NA 3LGWA 4RKJB 1AZ8A 5EGMA 2ZGHA 2GTBA 5A0BA 1GMHF 4Y8XA 1K2I1 3SORA 2A7CA 1HAOH 1TMTH 4JMYA 3A88A 5E0HA 2ULLA 1QBOA 2P95A 4NIVA 1XXDA 2AIPA 5DGJA 2QA9E 1DE7H 1W7XH 1S81A 8KME2 5IDKA 1BTWA 3MO3A 3PLBA 1ZHRA 3UNQA 2QF0A 1SR5C 3T29A 1RFNA 2ODPA 1L4ZA 1T32A 4E05H 2Z9IA 3MU1A 3A81A 1DXPA 1MCVA 5JBAS 2OD3B 1SSXA 1TRYA 5ETXA 3QZRA 3FZZA 3OU0A 3FAOA 3V7TA 2BD7A 1HAZB 4MTBA 1V2MT 1ETRH 1V2VT 3ATWA 4I8GA 1LO6A 2HGTH 4DT7B 6CHAC 2Y7XA 4AG2A 2A4QA 4E7NA 3B9FH 1XUHA 2VWLA 2UUKB 1O2GH 2B0FA 4NA7A 1C5NH 3IG6B 1TE0A 1FJSA 3SJ8A 3MU4A 1NRNH 2HNTC 1FN8A 1AWHB 1SFQB 2FZZA 1O3CA 3UR6A 2TGPZ 1UVOA 2XBYA 1E36B 2WPKS 3MH6A 1FPHH 1K1NA 1O3NA 1MCTA 1C5TA 3URDA 1WQSA 1GBAA 1QBVH 3D62A 2ZDAH 3UNSA 4DURA 2TGDA 1ESBA 1C2GA 3JZ1B 5LH8A 1A46H 4F4OC 8GCHG 1PQ7A 5LPEA 3M3TA 4BOHA 1AI8H 1KXDA 1N6YA 3P92A 1VCWA 4MLFB 5FCKA 2GCHF 2J2UA 1INCA 2FI4E 3MFJA 1O5DH 1NZQH 1DY8A 1U6QA 2GX4A 1BJVA 2VVUA 1A1RA 4K5ZA 1DWBH 1GDQA 1VZQH 3TH4H 3E0NB 1GMDG 3QUMP 3BTTE 1DWEH 1YF4A 1MZAA 2TGAA 3ZZBA 1O36A 3MNCA 1KXAA 2Y5FA 3L6PA 3AAVA 3EA8A 5C3NA 2J95A 1ZSKA 5EXMA 2GCHG 1EAXA 3GY8A 1SOZA 1LVOA 1TABE 1ZPZA 4AB8A 1NN6A 1ZYOA 1DX5M 1BTXA 1TNLA 3SUDA 1MKWH 1TPOA 2BVXH 2ZGXH 4B74A 3UQVA 1ELAA 3MH7A 2Y81A 5ABWA 1HAPH 4O3TA 2HNTF 3K2UA 5AF9H 1S5SA 1DPOA 1AO5A 2Y7ZA 3ZVBA 2FX4A 4WJG2 1ZTLA 1SHYA 1TNHA 4YOJA 1XKBC 4K8BA 4Z6AH 5L2YH 1ZPCA 1HCGA 1J15A 2K1QA 2VB0A 4Q7YA 3E1XB 4Y11E 1HAIH 1QJ6B 4B71A 2FLBH 5ESTE 1BA8B 2A2XH 3ELAH 4TWWA 2H9TH 5E2PA 4D76A 4FUBA 3K6YA 4ZKNU 1LTOA 2J92A 4D7GA 1TQ0B 1L0ZA 7ESTE 2FOMB 2NU1E 4OS4A 5HM9A 1GJ4H 1GL0E 5C2ZA 1J14A 1J17T 4ESTE 1EB1H 3RXEA 1PFXC 1CQQA 1O2XA 3CS0A 4ABHA 5ESBA 5TCCA 5I25A 1OYTH 1GL1A 3U8OH 2FODA 4CH8B 1ELTA 4Y0YE 1RS0A 2Z6BD 2ZC9H 1SQTA 3KQEA 3SU6A 1P05A 2BQWB 4WMEA 4AFSA 2EC9H 1SGNE 1O2OA 1CE5A 1UK3A 1LQEA 3PROA 1RTKA 2VIWA 2SFAA 3S9BA 2J4IA 5DG6A 1B0FA 1P2MA 2FOBA 3RXIA 4YM9A 1RIWB 3FZDA 1FDPA 1THPB 1A0LA 2ZO3H 1CGHA 2EI6A 3HATH 4YO9A 4BTUB 4ZKOU 2YNBA 1NTPA 4O03A 1AFQB 1ELFA 1P3EA 1Y59T 2BZ6H 3KGPA 5HYOA 1P2KA 1EKBB 4DIIH 1ZHPA 1V2QT 1ELBA 1T8NA 4JK5A 1GI5A 2GGVB 4IW4E 4I8LA 3LONA 2W5EA 3DFLA 1GG6B 1A5HA 4A1TA 3EA9A 3PLPA 1P2QA 2Y5GA 4RSPA 1EOLA 5FBIA 4BXWA 4CREA 1ZTJA 2ZIQH 1MTUA 3A82A 3BSQA 1TA6A 2Z94A 1ZRBA 3O8CA 2VIVA 4CR5A 1IHSH 3S0NA 1FIWA 1PPHE 2FI3E 3CENA 3PTBA 4GCHF 2FI5E 1TPAE 2EI8A 2G00A 1GBLA 3SNEA 3SNCA 3UNRA 3D65E 4ABGA 3RXVA 2I6SA 1QL8A 1SGPE 3P8FA 2A7JA 3SW2B 1CBWB 3STJA 3LH3A 3MWIU 1G2MA 2PKSC 3TH3H 1G3DA 4QT8C 1G3CA 4YOIA 2F83A 4HGCA 1SMFE 2UUYA 1C1PA 1ELCA 3BTHE 3RXRA 1C4U2 1YLDA 1WSSH 3F1SB 3ZZAA 2ZTYA 3SU2A 2PW8H 1EZSC 2BDHA 1SLWB 1H9LB 1TX7A 2CN0H 1C5OH 2Q6GA 1V2KT 1VR1H 4IMQA 1MKXK 2VWMA 1YCPK 1TGTA 1N1LA 4JK6A 3BTGE 1OWHA 4ABEA 3UREA 3A7TA 3FVFB 1QA0A 1O2YA 2AFQB 4B2BA 1Z8RA 1QCPA 1C1SA 3QDZB 2EEKA 2Z7FE 1N8OB 3M7TA 5C5OA 1TB6H 2ZCHP 3VGCB 1SLUB 1ZSLA 2AS9A 1BIOA 1O30A 4LOYH 3V12A 1ELGA 1GI0A 2FX6A 2FLRH 4DOQA 4CRCA 1H9IE 2BMGB 1S82A 1TNJA 1GHZA 3NKKA 2ZPQA 4MNWA 1YPGH 3BIVH 1UTPA 4OS1A 4CHAC 2WUCA 2RDLA 1SL3A 2AGGX 1BTUA 3FP7E 6LPRA 3MH5A 3TLOA 1LVYA 4A5TS 1GI3A 2VIDA 1TGSZ 1W3CA 2P8OC 1C2FA 3LT3A 1H1BA 4RKOB 3ZZ9A 2P16A 2STAE 4MDSA 1MU6B 3H7TA 2WPMS 1VITF 2Z9LA 1LKBA 1GHBG 1GHYH 2WUBA 3KQCA 3RXFA 3UUZA 2RCEA 1EASA 1PPFE 1NFUA 6ESTA 1KDQA 1F0RA 1P2NA 3ZZ6A 5F6MA 2AGEX 3UFAA 1SBWA 1X7AC 4D9RA 1UTNA 1ID5H 1BB0B 2BTCE 5DPAA 4JCNA 2G81E 4I33A 1CA0B 2GV7A 1BMAA 4CHAB 1CHOG 1Y3VA 1AE5A 1WV7H 1M9UA 4ISLA 1UTOA 1DT2A 1Z6JH 3ZZDA 5IYTA 1T8OA 1D4PB 3FP8E 1FY4A 4ZXYH 1C5VA 1ABJH 1OX1A 1NU7B 1UCYH 1BITA 3HK3B 2VH0A 4JZFH 4YESB 3SQEE 1ZRKA 4JYUH 2NU2E 1C1RA 2BDCA 3S9AA 4IC6A 1UCYK 1GHAG 2BHGA 4D7FA 4ZHAA 3TJVA 2AMPA 1NRRH 3Q3YA 2ZFRH 1BTZA 4FUHA 3LC5A 1AFQC 3KIDU 4NSVA 1G3BA 1GI9B 1MZDA 2XTTB 2EI7A 5LPFA 2H5DA 3F9GA 3BTDE 2OQUA 1NFXA 1THSH 2A31A 1DOJA 1C5YB 5FX5A 1KYNA 1S0RA 1T8LA 1OWJA 2J94A 5CHAB 5A09A 1TRMA 2D2DA 4XFQA 3RXLA 1EUFA 1GJCB 3GCTG 1EQ9A 1ANDA 4NIXA 1O2WA 1ZTKA 1EAUA 3A8DA 4AYVB 4DW2U 2ALPA 3E0PB 1HGTH 1B0EA 2A7HA 1OWIA 3PMHB 1BJUA 2J9NA 4ISOA 1G30B 1O2HA 3SV9A 3VB7A 4OGXA 1GJ6A 1O2VA 4X8SH 1HAVB 2PTNA 2ZFPH 3BN9A 3C1KA 3PWCA 2A45B 3F68H 1YPHC 1E0FD 1C2IA 3MU8A 2QGRA 1KIGH 1Q3XA 4FU7A 1LDTT 1BRUP 2QXIA 1C4Y2 1OXGA 1TX8A 1DUAA 4TWYA 5J4QA 1NRSH 1LHGH 2Y80A 4INKA 1C9TA 1SGCA 1MAYA 2FOFA 2FS8A 2BQ6B 1HAYB 3RXPA 1ZHMA 2QYIA 3NPSA 2XCFA 3N7OA 3LGUA 1SGIB 2ANMH 3F9HA 3MU5A 1BHXF 1SVPA 2PGQB 4U01A 4NGAH 1Z71A 2IN2A 2VIPA 1QL9A 2HPPH 3RC6A 1CVWH 4ABBA 1AY6H 1W7GH 4K1TA 5C67A 1KXCA 3PYHA 1O3FA 3SU0A 1V2LT 2FPZA 2STBE 3HK6B 1UK4A 1XXFA 3M3VA 2HWLB 3IITA 4H4FA 3MYWA 2VH6A 4VGCB 2OCVB 5T3HA 1O3MA 2TRMA 4O97A 1O33A 1EZQA 3VGCC 8GCHF 3RC4A 5SGAE 2OINA 1AVGH 2CXVA 3GYMA 3LIWA 1HLTH 1LKAA 1GI8B 2WPLS 2P8OB 2F9BH 1ELDE 3U9AH 3TU7H 1GHVH 2A5IA 1BUIA 1S84A 2B9LA 4GUXA 4B2AA 3QO6A 2VU8E 3AW1A 1K1PA 4A6LA 4B1TA 1KTTB 4XDEA 1VJ9U 4UD9H 1TFXA 2FOEA 5E0GA 3UY9A 2PGBB 2R9PA 1SHHB 3SV2H 5GDSH 2OC1A 3B23B 1OWKA 5EQQA 1YPMH 1C1TA 1C5LH 2F9VA 3B8JA 1GBMA 2FYQA 3H5CB 4LZ4B 1E34B 1UVTH 3MH4A 1SGFG 1NM6A 1UK2A 4ZKRU 4WH8A 3BTME 4Q80A 5HXFA 1HJ8A 3R3GB 1TMUH 1O5GH 1QBNA 1Z1JA 1O32A 1ESTA 3PO1B 2Z9GA 1CT4E 3K6ZA 4BAOB 2OC0A 5HGGA 1CA0C 4WXIA 2OC7A 1MTVA 1EPTB 3M3SA 2XBWA 1Z7KA 3E6PH 1EP6A 4AOQA 1PPCE 3V13A 4ABDA 2FM2A 3GCNA 3OY6U 1HXEH 2FMJA 1HUTH 3SJKA 1AIXH 1O39A 1SQAA 2AERH 1PPZA 2IJOB 2GCTC 1MKWK 2H1UA 3MOCA 2CHAC 3RLWH 2AGIX 1AGJA 2FTLE 3L3TA 4INHA 2ANWA 3U8TH 1XMNB 1GI4A 2BY8X 1TBZH 1HYLA 3C27B 2Y6TA 1GBJA 1F5KU 1Y5BT 1FY1A 3T28A 5L2ZH 1A61H 1EPTC 1H8DH 1HBTH 2BDGA 1JOUB 1ZMNA 4YOGA 1O5BB 1K1JA 1BRCE 1GJ9B 4ISHH 4R0IA 1LHFH 3TK6A 3PM3A 2BB4A 1LMWB 2ZTXA 4FUFA 5HMAA 1C5ZB 3SOSA 1ZPBA 1ARBA 2UWLA 2D26C 1FY5A 1EATA 1IQJA 1FN6A 2BD9A 3MMGA 2RA0A 2I6QA 1GJ5H 1MAXA 1O2QA 3VXFH 5EQRA 3M37A 2ODYB 3RXQA 1P02A 4ABAA 1B5GH 3VB4A 3CS7A 3I29A 5E2OA 2G5NA 2ZP0H 3RU4E 1AQ7A 2JH0D 1C2JA 1C2HA 5T6FA 4CRGA 1P8VC 1FY8E 1MBQA 2ZA5A 4SGAE 3P8NA 1JMOH 1GHWH 1ESAA 2VIOA 4K3JA 1GJ7B 4B75A 1UVUH 2YOLA 1C1NA 1BHXB 1YM0A 3BIUH 5A8XA 3ATIA 5GWZA 1AFEH 1V2JT 2A32A 1NO9H 1O3BA 1V2TT 3DD2H 3A7XA 1WBGB 2O8LA 1GJ8B 3SV8A 3Q00A 4IN1A 4CRBA 1UTJA 2D8WA 1TGNA 4JYVH 3ZZ8A 5EPYA 3P70B 2JETC 1BTHH 2GMTC 4FUEA 3SGBE 3OTJE 1QR3E 1Y3XA 4JZ1A 4AFUA 2NWNA 1WYKA 4HFPB 4FVBA 1W14U 1GVZA 2VIQA 1LCYA 5EU8A 4AGKA 3LDXH 1TONA 4K8YA 2Q1JA 3BTQE 1GMDF 1T8MA 1ORFA 1P04A 5E8EH 4X6PA 1T4UH 2GVFA 4NG9H 4UFDH 1A7SA 3SI3H 2R2MB 4M7GA 2H6MA 2THFB 4TYDA 1SQOA 1SC8U 1UJ1A 4NFEA 1MD8A 1GGDB 4YT7H 1MU8B 2ASUB 3E8LA 3RXUA 1ZJDA 5JB9S 2ZTZA 1GBIA 4HZHA 2C8WB 1CO7E 3RMMH 1AU8A 1P2IA 1MQ5A 2BX3A 2OLGA 1W0YH 3ZYEA 2ZHDA 5CHAC 1RRKA 5JB8S 2O9QA 4DJZB 3VB6A 2J38A 1Z8GA 2PR3A 3M35A 3PLKA 3ZV9A 6GCHF 1VCPA 1EJMA 3BG4C 1F7ZA 1EX3A 2F9NA 1O2SA 1ZMJA 2CMYA 1CSOE 2WV4A 1EJNA 2Q6FA 4J1YA 3ZV8A 4DY7B 1OPHB 2KAIA 3Q3KA 1JRSA 4GLYA 3MU0A 2ZFQH 1O5AB 3QTVH 1OWDA 1SGTA 2HVXA 3SV7A 1GVLA 3ATLA 2G5VA 2HPQH 5DP8A 1GBFA 3QWCH 1SFIA 2XRCA 3AAUA 1KDQB 2XXLA 4BXSA 3D49H 2QC2A 2SGDE 2A4RA 4LZ1H 1C5SA 3H7OA 2BDBA 1O3JA 3M5MA 1DANH 4WXVA 1YBWA 1C2LA 4X6OA 1P9SA 5PTPA 2QAAA 3ZVCA 2BX4A 4U32A 1P9UA 1G37A 1YPJH 3M7QA 2HOBA 3QZQA 1GI1A 2Y5HA 3A7WA 1GI7B 1OP0A 1P06A 1S85A 1K1LA 1O38A 1QNJA 1DLEA 1TOCB 2R0KA 2CHAB 3T25A 3A80A 4SGBE 2JKHA 4MPUA 4E06H 4B2CA 1O2UA 1VGCC 2Z3DA 1NROH 1WCZA 2UUFB 1CA8B 3TNSA 1UHBA 1KY9A 3SHAH 2A4OA 3GOVB 2TBSA 1IAUA 3K9XB 1SPJA 1O5FH 2WYJA 2J34A 1W2KH 1A5IA 1V6DA 4NFFA 4OS6A 3NUMA 1QL7A 2XBXA 3KQDA 3GCTF 5FPYA 2ZU5A 2IPHA 3KQBA 2XBVA 1C5QA 3TVJB 1ZZZA 3RXCA 2ZDKA 2PHBA 1AWFH 1IQIA 1BTYA 1O3LA 3A8CA 5AFZH 5L6NH 2VNTA 3GDSA 1Z6EA 2HLCA 1A2CH 1C9PA 4PROA 1FAKH 1D6WA 1C1OA 4RN6A 3A7YA 4K1EA 3RXAA 1EZUC 1O3EA 3PMAB 2OP9A 3A8BA 1G32B 3ATMA 4AX9H 3R0FA 4X8UH 3W94A 1SLVB 1L1GA 4FUJA 5FAHA 4X8VH 5LPRA 2BYAX 1V2UT 2OQ5A 2A1DB 2B5TB 1S0QA 3PTNA 1CT2E 1PQAA 2ZDLA 1HAGE 5DP5A 7LPRA 3BTFE 3A86A 1QB1A 2W7SA 1P09A 3NZIA 2FOHA 2G51A 5DP7A 5B6OA 1O2TA 2XC4A 4YLUA 1DWDH 4BAKB 4X1PU 4H6SB 2XWAA 4GHTA 1SGQE 4BNRA 4Z0KA 3M5LA 1KXEA 2GDDA 2VVCA 1K22H 3KHVA 1C5PA 1FXYA 3QX5H 1A4WH 1GCTC 3BTWE 1LVMA 3F9EA 2G55A 2BZAA 4WVPE 1TMBH 1V2OT 1KLTA 2HALA 2GD4B 4TY6A 2AMDA 1O37A 3EAJA 2SGQE 1RIWC 1A3EH 1C5UA 4CRDA 2CF9H 2ZHQH 1GDUA 1DM4B 1IQEA 2BLVA 3SBKA 1IHTH 4ABFA 1AHTH 1RD3B 5AFYH 1V2RT 1NPMA 1O2PA 1MTNB 4DIHH 3LPRA 1GGDC 1P2OA 3SJ9A 3LOXA 3TJOA 3SUGA 4XBCA 4CRAA 3BEUA 1RGQA 1O3PB 3UR9A 1G2LA 1DDJA 2BD5A 4MPXA 2A5KA 4AGJA 1K21H 1LVBA 1TBRH 4Q7ZA 2V3HH 1JRTA 2BD2A 3S69A 4BTTB 2GZ8A 1IQLA 2ZU4A 2DE8A 3BV9B 4U30A 3U98H 1VITH 2KAIB 4OS5A 2ZHWH 1O3IA 1UHBB 1VITG 2OUAA 2WPHS 1QJ7B 4Y8ZA 3LU9B 5DP4A 2Z9KA 2ZGJA 1HAHH 1F5LA 2ESTE 1FIZA 1EAWA 2WYGA 4X0WU 2QN5T 1LHEH 4CRFA 2ZECA 1NFWA 2XW9A 1CBWC 4MG3A 5K7RA 1A5GH 2BLOA 7GCHF 4NZQA 4K69A 1Q31A 2ODQA 1MQ6A 1XUFA 4JZEH 4XOJA 2FEQH 1JWTA 3U1IB 4FU9A 1BT7A 3T5FH 4E7RG 3A87A 2W3IA 1HIAA 1WAYB 3KEEA 1WUNH 4B73A 1NY22 4MPVA 1W13U 1GJBB 1O2JA 1YPKH 3STIA 2TGTA 1PYTD 2W3KA 1NESE 1QURH 4GPGA 1AB9C 2GKVE 4X8TH 5L30H 3S7KB 4KTUA 1GCDA 4IC5A 3A85A 1QFKH 5FXLA 4JZDH 3JZ2B 1O3KA 2O8MA 1O3AA 2FIRH 2ZDMA 2FOCA 2BM2A 4YZUA 2V6NA 1RJXB 4NA8A 5BRRE 2PKAB 3WY8A 3QGNB 2ZGCA 5HM2A
chains in the Genus database with same CATH superfamily
1FQ3A 2JH5D 4ZH8A 1AE8H 2ZEBA 1DUEA 2JETB 1ZGVA 2IOTA 4A1VA 1HAVA 1H9HE 2XWBI 1D3QB 2F91A 2ZHEH 4D9QA 1BBRK 3MI4A 2FTMA 2J98A 1OOKB 2XCNA 1FLEE 1HFDA 5DK1A 3SU1A 3DT0H 4UE7H 3T26A 4D8NA 1XVOA 2BVRH 3T27A 1Z8IB 1XX9A 1PQ5A 5AHGH 1DSUA 2O8TA 4X6MA 1J8AA 5E0JA 1OSSA 4AN7A 1SOTA 2EY4C 3D23A 2PV9B 1V3XA 3RXTA 2A0QB 3EGKH 1HJAB 1V2NT 4XSKU 5AVDA 1K9OE 5C1UA 3P95A 3P6ZB 4YT6H 3SHCH 1O2IA 3QN7A 1FUJA 1EZXC 1F2SE 1WQVH 3DHKH 1P57B 2Z9JA 1XKAC 1BTPA 1L4DA 3A7VA 4I8HA 2KR7A 4BAQB 1TNGA 2A4GA 2FWWA 1FMGA 3UQOA 3NK8A 2BOHB 1FZZA 1W8BH 2P93A 2SGPE 1GG6C 1C5MD 2FYRA 2M5TA 3UWIA 3LKWA 4DCDA 1AKSB 2SGAA 4A1XA 2BY5X 4IGDA 2V3OH 4XBDA 1PYTC 3ZZ3A 3SZEA 3U1JB 1QB9A 2LPRA 3T62A 5GXPA 3SUFA 2BD4A 3UPEA 1QQ4A 2BDYA 1L2EA 1GMHG 3RMLH 3KNXA 4ZHMU 3GY6A 2P3FH 2AIQA 1OP8A 2ZGBH 5C1XA 4IS5A 4YLQH 4LXBH 1TPSA 1NC6A 2SNWA 4WWYA 4TY7A 1GMCF 1WOFA 3MNBA 3TPIZ 2FP7B 1IQFA 2BVSH 1E37B 1LHCH 4NWKA 2AHME 3LH1A 4AFZA 1LPKB 3MNSA 3K65B 2ZU1A 4UEHH 2PSYA 4A7IB 2LNCA 2GZ9A 1J16A 3SNDA 4A92A 1DS2E 1SI5H 3OYPA 4Y76A 3E16B 5T6DA 1GJAB 4YTAA 5A8YA 3RM0H 2GDEH 3ITIA 1UTLM 5A2MH 1QRXA 3F2HA 1CT0E 1P03A 1VGCB 2WPJS 1W10U 1PPEE 2PKSB 5DP9A 1GHXH 4GCHG 3SU4A 1AKSA 2CGAA 4MPWA 2CK3D 3SGQE 4I8JA 3OX7U 4MVNA 1ZMLA 3ZZ4A 1S83A 3SV6A 1UTKA 5JBTA 3PMBB 1NBMD 5EXLA 1QRZA 1QB6A 2BY9X 3AASA 5FPSA 5KECA 1NU9A 3SNAA 1H8ED 1HIAB 1ANBA 3I77A 2PKAA 2WZQA 1IQKA 4IBLH 3ZZ7A 4DG4A 2OXSA 3EQ0H 1FV9A 3DSPA 3SU3A 1UVPA 3ENSB 1SKYE 1QGFA 1J9CH 2DUCA 1GHBF 4MNYA 2ZFSA 1YKTA 1ZLRA 2TPIZ 2UWPA 1NFYA 4B76A 4TPYA 1BQYA 1K28D 2FDAA 2NU0E 3DSGA 2FOAA 4CR9A 4NA9H 3GCOA 3LGVA 4X1NU 2FO9A 3GY7A 1TBQH 1QZ8A 2OBQA 5HIYA 1IQHA 1S6HA 1Y5UT 1AB9B 4ASHA 1FPCH 2O8WA 4K1SA 4Y10E 1BMNH 1TAWA 1SGRE 2R3UA 3RM2H 1IOEA 3GY5A 5GCHF 3EDXB 5CE1A 1QRWA 4AB9A 4X1QU 1TNIA 1N6XA 4AYYB 1DFPA 4JZIA 7GCHG 2AEIH 1BMMH 3SJOA 5EG4A 3WWBA 5TJXA 3E90B 3M5OA 4HI3A 1ZGIA 3GISB 3TK9A 3PRBA 3DUXH 3PMJA 1MTSA 1Y3WA 5JBCS 1DXWA 1WTHD 2OC8A 4HTCH 1PQ8A 2PTCE 1TALA 3MHWU 1FI8A 3SZNA 1SGDE 3SUEA 2H9EH 2EA3A 2ILNA 1TNKA 5I46H 1A3BH 4I7YH 3RXHA 5DP3A 3FP6E 5GCHG 1AVWA 2ZF0H 1C1VH 1BBRE 1RXPA 1HJ9A 4INLA 5EJZA 1G3EA 3FFGA 3GY4A 4NCYA 3SQHE 2QV1A 3BG4B 3TJUA 2NU4E 2P59A 1CGJE 1V2WT 4KKDA 3NWUA 9LPRA 4Q2KA 5F03A 3KCGH 1LQDB 4FVDA 1L1JA 4WH6A 2WV5A 2R3YA 2B7DH 1EPTA 1ELEE 1MTNC 4K2YA 1T31A 1BOQA 2ZNKH 1IQMA 3PWBA 1O3HA 3M7UA 3HKJB 1GBBA 4AG1A 5FPTA 1FNIA 2FS9A 3LC3A 2TIOA 4J2YB 2XYAA 4NIWA 1UTQA 2QXGA 1WU1A 1LHDH 5JDUB 2PSXA 4Q7XA 1QY6A 1G9IE 1SGYE 1S6FA 5A0AE 3VXEH 3ATKA 1O3OA 2GT7A 1O3GA 1K1IA 1KSNA 1YPHE 2Y82A 2QXHA 3W1EA 3ZVDA 6CHAB 1YYY1 2O8UA 1MKXH 3RXBA 1EFRD 2NU3E 3CNRA 1VJAU 4AORA 2BOKA 3SO3A 1XUJA 1BZXE 3QLPH 1Y5AT 2W26A 4ZUHA 3TGJE 1QIXB 5C20A 4X1RU 3Q3XA 5CMXH 1BMLA 1GHAF 2XC0A 2CJIA 1D3DB 2C8YB 1GBTA 3RC5A 5FHTA 1YPLH 1D3TB 2VINA 1TYNA 3NCLA 1GI2A 1ACBE 1T4VH 3BTEE 5EW1H 1BRBE 4IN2A 2A2QH 2QY0B 4FUDA 3UOUA 3NRLA 5EQSA 2BLQA 2C4FH 4DVAU 1YLCA 2GZ7A 8ESTE 1QHRB 2PUXB 4OS7A 2ZDNA 3RXMA 3QGJA 3SU5A 1HXFH 1W0KD 3V3MA 3MO6A 1TGBA 1D3PB 3OSYA 3EYDA 1WTGH 1MTWA 4RT1A 5DJ7A 1O31A 1Y3UA 2B8OH 3EE0B 4ZKSU 2WINI 4FOUC 1EAIA 4Y7BA 1LPGB 1MD7A 1W11U 1KXFA 3M36A 1GVKB 1O3DA 4F55A 1Z1IA 1CU1A 1GMCG 2C3SA 3GCHB 3A89A 2SNVA 3SNBA 1Y3YA 2ZFFH 1V2PT 1D9IA 1TLDA 2Z3EA 3QK1A 3RXKA 1DSTA 2F9OA 1ANEA 3PV4A 1TX6A 3FO8D 5GNDA 5DKMA 1C2EA 2BY6X 1O2LA 1AVXA 2ZU2A 5JYIA 3M5NA 1A0JA 1DICA 3TK5A 3OAAD 1DVAH 4NWLA 1CHGA 1JXPA 5J4SA 1SLXB 5FBEA 1PPBH 4AFQA 1F92A 2C90B 3E3TA 2OTVA 2QXJA 4Y7AA 1OYQA 2J5UA 3LJJA 2R2WU 2CV3A 1THRH 3GY2A 4IMZA 2GT8A 4UFFH 3GYLB 1HJAC 2F43B 1TGCA 4Y79A 1HAXB 3ZZCA 4B6EA 1YPEH 2PFEA 2ZDVH 3GDUA 1YCPM 3S7HB 1BRAA 4GVUA 5GJ4B 1GBDA 4FU8A 1MMJN 2ANKH 3QTOH 2H2ZA 2FESH 1E35B 2R0LA 2VJ1A 1QA7A 3A8AA 4TPIZ 5JPMH 1TRNA 3W95A 3DSOA 1P11E 1RTLA 1CGIE 1TWXB 3RXJA 5G4BA 1XUIA 4P02A 1O34A 5EW2H 2XNIA 3SJIA 1DITH 2V0BA 5LGOA 1SG8B 4FXGH 4ZROA 3CP7A 3GY3A 3HGPA 2BDAA 4WF8A 2RG3A 3VG8A 5F8ZA 5TCAA 1ZOMA 1EOJA 2JDID 4X6NA 1AUJA 1C2DA 5B6LA 4MNVA 2FOGA 2RA3A 5F8XA 5F8TA 5GPIB 1ZSJA 1TPPA 3S9CA 1UMAH 5FCRA 4Y6DA 4I8KA 1MBMA 3GICB 3P17H 1C1UH 2ANYA 3ZVGA 2C8XB 4UFGH 3BEFB 1ETSH 4Y71A 1PJPA 4X2XA 4KTCA 2QF5A 3LGYA 3KN2A 3HKIB 4X2VA 4KELA 5DO4H 1A0HB 1E1RD 3VB3A 1GBEA 2P94A 3TJNA 1P3CA 1AD8H 4XBBA 1C1QA 2QF3A 1KLIH 2IPQX 1O2KA 1SGFA 1TQ7B 2ZQ1A 2ZCLP 3KYGA 1O5EH 3UB0A 4ISNA 2ZPRA 1F0SA 1ANCA 1QQUA 2SGFE 1VCQA 1XUKA 2OBOA 3RXDA 3H09A 4ZXXH 3AW0A 3IWMA 3TIUA 4O9VA 1C4V2 1AZZA 2P3UB 2F9PA 1EXFA 2AMQA 4UFEH 4H6TA 1T7CA 1Y8TA 4FUCA 3SGAE 2C8ZB 4DGJA 1UO6A 4Y0ZE 4CH2B 4UONA 2PLXA 3U28C 5A8ZA 2GCTB 3RLYH 3U69H 3P8OA 3TGKE 3RUOA 3O8DA 5EOKA 2HNTE 5KGOA 1P12E 2A5AA 1DLKB 4NIYA 1H4WA 3Q76A 4BAHB 1NT1A 1C1MA 3VEQB 1G36A 4AZ2B 2Z3CA 5H4IB 5JBBS 1NRPH 1GBHA 1GBCA 2VVVA 3RXGA 2Q6DA 1HNEE 1B7XB 4Y8YA 1BCUH 1NRQH 1OWEA 4I31A 5CHBA 3RP2A 2ZI2H 4OM9A 3KF2A 4GSOA 3A84A 3HPTB 1ZJKA 2D1JA 1VKYA 2ZCKP 3TITA 1ETTH 1OKXA 1W12U 1O2ZA 1ELVA 2W7UA 1K1OA 3DFJA 4U2WA 4VGCC 4ZHLU 1EP5A 9ESTA 1FAXA 3RMOH 2ZPSA 1YCPH 2BLWA 5A0CA 4ASUD 5DP6A 5C1YA 1KLJH 1QJ1B 5T6GA 2BDIA 2ZKSA 1HB0B 1NS3A 2JIZD 1JIRA 5EPNA 3UAIC 1JIMA 1HDTH 1ARCA 1D6RA 3BG8A 1JBUH 3VPKA 1GJDB 1N8OC 3ESTA 4X1SU 4ABJA 1HPGA 4CBOA 1O5CB 4ZMAH 1LPZB 1O0DH 3FANA 1UVSH 2QIQA 1YGCH 1K1MA 4KP0A 1XM1A 3HGNA 4KGAA 4FETA 1C1WH 1P2JA 2ZQ2A 4UDWH 3ZYDA 3PB1E 3TGIE 1HV7A 2DE9A 1NBME 1OP2A 1QTFA 2GV6A 4WY3A 1KMHB 2BXTH 2H9HA 2BD3A 3LJOA 3NXPA 3TH2H 2YNAA 1AUTC 5EJ1A 1MUEB 3A83A 3ODFA 2G8TA 2BXUH 2ZWLH 4FUIA 5GIBA 3URCA 2BD8A 3OY5U 1SGEE 1XUGA 2H5CA 4FUGA 1WXRA 3PO1C 6GCHG 2ALVA 4ISIH 1F0UA 1GDNA 4GAWA 1RTFB 4LK4A 2CF8H 1UCYE 3RU4T 1MH0A 2VGCC 1C2MA 2AH4X 3TNTA 2ZFTA 3F9FA 1COWD 2F3CE 1OS8A 5EXNA 5F53A 4F49A 2PUQH 4NSYA 2BY7X 2ZU3A 4GHQA 2ZHFH 3LGTA 3A7ZA 1O2RA 3L33A 4X2WA 5HKKD 1ABIH 1AN1E 1EJAA 2ZG0H 4BAMB 4HG6A 1O2MA 1P01A 4RT0A 4JYTA 3ZIAD 3UWJH 1F0TA 3BTKE 5BPEA 1C5RA 2OK5A 1ZR0A 2GP9B 1HRTH 2V35A 3M61U 2G4UA 4XE4A 3VB5A 1GCTB 2PWXA 8LPRA 3Q77A 3SN8A 3UIRA 1Q2WA 3MTYA 7KMEH 3LGIA 3N7DA 5C5NA 1C5XB 3MNXA 2FXRA 4MQAA 1UTMA 2G4TA 1FONA 1TA2A 5K0HA 4NZLA 1IQGA 1GWAA 2C93B 3U8RH 4I32A 2VGCB 3RXSA 3ODDA 1P0SH 2P3TB 1AMHA 1E38B 2RFKC 3RXOA 2GJGA 1DWCH 1GI6A 1SB1H 1P10A 2QCYA 3BEIB 1GBKA 3ZVFA 4BTIB 1F5RA 2SGEE 1YP9A 3E91A 4ABIA 1FY3A 3P8GA 4ZAEA 1IQNA 2AYWA 1KXBA 2V3MA 3MO9A 4WMFA 3ZVEA 4Q63A 3VFEA 3KL6A 2HRVA 2VWOA 2UUJB 2LP6A 3ZVAA 5FX6A 3AVZA 3O8RA 3UTUH 1C5WB 2G52A 3RU4D 2W6ID 4X2YA 3RDZA 2WPIS 4H42U 1XVMA 4MNXA 4OS2A 2ZZUH 4WMDA 2F9UA 4BANB 1CHOF 4OGYA 1GPZA 3T2NA 4O3UA 3DA9B 3F6UH 3UOPA 1H8IH 5DSFA 1C2KA 4CBNA 3GCHC 1BDAA 3SI4H 3V0XA 2XC5A 3EA7A 1YC0A 1W0ZU 2UWOA 1TOMH 4KTSA 1TIOA 1Z8JB 3O8BA 3G01A 1KTSB 1V2ST 3I78A 1O35A 2VWNA 5EODA 1O2NA 2BQ7B 2JH6D 3BF6H 2GMTB 4K60A 3GDVA 1EB2A 1PPGE 4THNH 1DY9A 1BBRH 3RMNH 3ZZ5A 4R8TB 1L1NA 3LGWA 4RKJB 3OE7D 1AZ8A 5EGMA 4TSFD 2ZGHA 2GTBA 5A0BA 1GMHF 4Y8XA 1K2I1 3SORA 2A7CA 1HAOH 3OFND 1TMTH 4JMYA 3A88A 5E0HA 2ULLA 1QBOA 2P95A 4NIVA 1XXDA 2AIPA 5DGJA 2QA9E 1DE7H 3OTPA 1W7XH 1S81A 3FN8A 8KME2 5IDKA 1BTWA 3MO3A 3PLBA 1ZHRA 3UNQA 2QF0A 1SR5C 3T29A 1RFNA 2ODPA 1L4ZA 1T32A 4E05H 2Z9IA 3MU1A 2QE7D 3A81A 1DXPA 1MCVA 5JBAS 2OD3B 1SSXA 1TRYA 5ETXA 3QZRA 3FZZA 3OU0A 4F48B 3FAOA 3V7TA 2BD7A 1HAZB 4MTBA 1V2MT 1ETRH 1V2VT 3ATWA 4I8GA 1LO6A 2HGTH 4DT7B 6CHAC 2Y7XA 4AG2A 2A4QA 4E7NA 3B9FH 1XUHA 2VWLA 2UUKB 1O2GH 1OHHD 2B0FA 4NA7A 1C5NH 3IG6B 1TE0A 3PV5A 1FJSA 3SJ8A 3MU4A 1NRNH 2HNTC 1FN8A 1AWHB 1SFQB 2FZZA 1O3CA 3UR6A 2TGPZ 1UVOA 2XBYA 1E36B 2WPKS 3MH6A 1FPHH 1K1NA 1O3NA 1MCTA 1C5TA 3URDA 1WQSA 1GBAA 1QBVH 3D62A 2ZDAH 3UNSA 4DURA 2TGDA 1ESBA 3AK5A 1C2GA 2WV9A 3JZ1B 5LH8A 1A46H 4F4OC 8GCHG 1PQ7A 5LPEA 3M3TA 4BOHA 1AI8H 1KXDA 1N6YA 3P92A 1VCWA 4MLFB 1YLNA 5FCKA 2GCHF 2J2UA 1INCA 2FI4E 3MFJA 1O5DH 1NZQH 1DY8A 1U6QA 2GX4A 1BJVA 2VVUA 1A1RA 4K5ZA 1DWBH 1GDQA 1VZQH 3TH4H 3E0NB 1GMDG 3QUMP 3BTTE 1DWEH 1YF4A 1MZAA 2TGAA 3WWFA 3ZZBA 1O36A 3MNCA 1KXAA 2Y5FA 3L6PA 3AAVA 3EA8A 5C3NA 2J95A 1ZSKA 5EXMA 2GCHG 1EAXA 3GY8A 1SOZA 5C0UA 1LVOA 1TABE 1ZPZA 4AB8A 1NN6A 1ZYOA 1DX5M 1BTXA 1TNLA 3SUDA 1MKWH 1TPOA 2BVXH 2ZGXH 4B74A 2EQNA 3UQVA 1ELAA 3MH7A 2Y81A 5ABWA 1HAPH 4O3TA 2HNTF 3PV2A 3K2UA 5AF9H 3F2GA 1S5SA 1DPOA 1AO5A 2Y7ZA 3ZVBA 2FX4A 4WJG2 1ZTLA 1SHYA 1TNHA 4YOJA 2KFWA 1XKBC 2KCAA 4K8BA 4Z6AH 5L2YH 1ZPCA 1HCGA 1J15A 2K1QA 2VB0A 4Q7YA 3E1XB 4Y11E 1HAIH 1QJ6B 2W6JD 4B71A 2FLBH 5ESTE 1BA8B 2A2XH 3ELAH 4TWWA 2H9TH 5E2PA 4D76A 4FUBA 3K6YA 4ZKNU 1LTOA 2J92A 4D7GA 1TQ0B 1L0ZA 7ESTE 2FOMB 2NU1E 4OS4A 5HM9A 1GJ4H 1GL0E 5C2ZA 4Z1MD 1J14A 1J17T 4ESTE 1EB1H 3RXEA 1PFXC 1CQQA 1O2XA 3CS0A 4ABHA 5ESBA 5TCCA 5I25A 1OYTH 1GL1A 3U8OH 2FODA 4Q4LA 4CH8B 1ELTA 4Y0YE 1RS0A 2Z6BD 2ZC9H 1SQTA 3KQEA 3SU6A 1P05A 2BQWB 4WMEA 4AFSA 2EC9H 1SGNE 1O2OA 1CE5A 1UK3A 1LQEA 3PROA 1RTKA 2VIWA 2SFAA 2KCYA 3S9BA 2J4IA 5DG6A 1B0FA 1P2MA 2FOBA 3RXIA 4YM9A 1RIWB 3FZDA 1FDPA 1THPB 1A0LA 2ZO3H 1CGHA 2EI6A 3HATH 4YO9A 4BTUB 4ZKOU 2YNBA 1NTPA 4O03A 3OEED 1AFQB 1ELFA 1P3EA 1Y59T 2BZ6H 3KGPA 5HYOA 1P2KA 1EKBB 4DIIH 1ZHPA 1V2QT 1ELBA 1T8NA 4JK5A 1GI5A 2GGVB 4IW4E 4I8LA 3LONA 2W5EA 3DFLA 1GG6B 1A5HA 4A1TA 3EA9A 3PLPA 1P2QA 2HLDD 2Y5GA 4RSPA 1EOLA 5FBIA 4BXWA 4CREA 1ZTJA 2ZIQH 1MTUA 2IJD1 3A82A 4ACBA 3BSQA 1TA6A 2Z94A 1ZRBA 5C0TA 3O8CA 2VIVA 4CR5A 1IHSH 3S0NA 1FIWA 1PPHE 2FI3E 3CENA 3PTBA 4GCHF 2FI5E 1TPAE 2EI8A 2G00A 1GBLA 3SNEA 3OEHD 3SNCA 3UNRA 3D65E 4ABGA 3RXVA 2I6SA 1QL8A 1SGPE 3P8FA 2A7JA 3SW2B 1CBWB 3STJA 3LH3A 3MWIU 1G2MA 2PKSC 3TH3H 1G3DA 4QT8C 1G3CA 4YOIA 2F83A 4HGCA 1SMFE 2UUYA 1C1PA 1ELCA 3BTHE 3RXRA 1C4U2 1YLDA 1WSSH 3F1SB 3ZZAA 2ZTYA 3SU2A 2PW8H 1EZSC 2BDHA 1SLWB 1H9LB 1TX7A 2CN0H 1C5OH 2Q6GA 1V2KT 1VR1H 4IMQA 1MKXK 2VWMA 1YCPK 1TGTA 1N1LA 4JK6A 3BTGE 1OWHA 4ABEA 3UREA 4XD7D 3A7TA 3FVFB 1QA0A 1O2YA 2AFQB 4B2BA 1Z8RA 3KQ5A 1QCPA 1C1SA 3QDZB 2EEKA 3N7EA 2Z7FE 1N8OB 3M7TA 5C5OA 1TB6H 2ZCHP 3VGCB 1SLUB 1ZSLA 2AS9A 1BIOA 1O30A 4LOYH 3V12A 1ELGA 4TT3D 1GI0A 2FX6A 2FLRH 4DOQA 4CRCA 1H9IE 2BMGB 2YMSC 1S82A 1TNJA 1GHZA 3NKKA 2ZPQA 4MNWA 5T1VA 1YPGH 3BIVH 2HVYB 1UTPA 2VBCA 4OS1A 4CHAC 2WUCA 2RDLA 1SL3A 2AGGX 1BTUA 3FP7E 6LPRA 3MH5A 3N99A 3TLOA 1LVYA 4A5TS 1GI3A 2VIDA 1TGSZ 1W3CA 2P8OC 1C2FA 3LT3A 2KM0A 1H1BA 4RKOB 3ZZ9A 2P16A 2STAE 4MDSA 1MU6B 3H7TA 2JJ2D 2WPMS 1VITF 2Z9LA 1LKBA 1GHBG 1GHYH 2WUBA 3KQCA 3RXFA 3UUZA 2RCEA 1EASA 1PPFE 1NFUA 6ESTA 1KDQA 1F0RA 1P2NA 3ZZ6A 5F6MA 2AGEX 3UFAA 1SBWA 1X7AC 4D9RA 1UTNA 1ID5H 1BB0B 2BTCE 5DPAA 4JCNA 2G81E 4I33A 1CA0B 2GV7A 1BMAA 4CHAB 1CHOG 2F4LA 1Y3VA 1AE5A 1WV7H 1M9UA 4ISLA 1UTOA 1DT2A 1Z6JH 2KCPA 3ZZDA 5IYTA 1T8OA 1D4PB 3FP8E 1FY4A 4ZXYH 1C5VA 2M2AA 1ABJH 1OX1A 1NU7B 1UCYH 1BITA 3HK3B 2VH0A 4JZFH 4YESB 3SQEE 2V7QD 1ZRKA 4JYUH 2NU2E 1C1RA 2BDCA 3S9AA 4IC6A 1UCYK 1GHAG 2BHGA 4D7FA 4ZHAA 3TJVA 2AMPA 1NRRH 3Q3YA 2ZFRH 1BTZA 4FUHA 3LC5A 1AFQC 3KIDU 4NSVA 1G3BA 1GI9B 1MZDA 2XTTB 2EI7A 5LPFA 2H5DA 3F9GA 3BTDE 2OQUA 1NFXA 1THSH 2A31A 1DOJA 3FKSD 1C5YB 3FOAA 5FX5A 1KYNA 1S0RA 1T8LA 1OWJA 3KYFA 2J94A 5CHAB 5A09A 1TRMA 2D2DA 4XFQA 3RXLA 1EUFA 5FL7D 1GJCB 3GCTG 1EQ9A 1ANDA 4NIXA 1O2WA 1ZTKA 1EAUA 1BMFD 3A8DA 4AYVB 4DW2U 2ALPA 3E0PB 1HGTH 1B0EA 2A7HA 1OWIA 3PMHB 1BJUA 2J9NA 4ISOA 1G30B 1O2HA 3SV9A 3VB7A 4OGXA 1GJ6A 1O2VA 4X8SH 1HAVB 2PTNA 2ZFPH 3BN9A 3C1KA 3PWCA 2A45B 3F68H 1YPHC 1E0FD 1C2IA 3MU8A 2QGRA 1KIGH 1SQRA 1Q3XA 4FU7A 1LDTT 1BRUP 2QXIA 1C4Y2 1OXGA 1TX8A 1DUAA 1FX0B 4TWYA 5J4QA 1NRSH 1LHGH 2Y80A 4INKA 1C9TA 1SGCA 1MAYA 2FOFA 2FS8A 2RDEA 2BQ6B 1HAYB 3RXPA 1ZHMA 2QYIA 3NPSA 2XCFA 3N7OA 3LGUA 1SGIB 2ANMH 3F9HA 3MU5A 1BHXF 1SVPA 2PGQB 4U01A 4NGAH 1Z71A 2IN2A 2VIPA 1QL9A 2HPPH 3RC6A 1CVWH 4ABBA 1AY6H 1W7GH 4K1TA 5C67A 1KXCA 3PYHA 2YMSB 2QF4A 1O3FA 3SU0A 1V2LT 2FPZA 2STBE 3HK6B 1UK4A 1XXFA 3M3VA 2HWLB 3IITA 4H4FA 3MYWA 2VH6A 4VGCB 2OCVB 5T3HA 1O3MA 2TRMA 4O97A 1O33A 1EZQA 3VGCC 8GCHF 3RC4A 5SGAE 2OINA 1AVGH 2CXVA 3GYMA 3LIWA 1HLTH 1LKAA 4YXWD 1GI8B 2L74A 2WPLS 2P8OB 2F9BH 1ELDE 3U9AH 3TU7H 2JJ1D 1GHVH 2A5IA 1BUIA 1S84A 2B9LA 4GUXA 4B2AA 3QO6A 2VU8E 3AW1A 1K1PA 4A6LA 4B1TA 1KTTB 4XDEA 1VJ9U 4UD9H 1TFXA 2FOEA 5E0GA 3UY9A 2PGBB 2R9PA 1SHHB 3SV2H 5GDSH 2OC1A 3B23B 1OWKA 1K0HA 5EQQA 1YPMH 1C1TA 1C5LH 2F9VA 3B8JA 1GBMA 2YMSD 2FYQA 3H5CB 4LZ4B 1E34B 1UVTH 3MH4A 1SGFG 1NM6A 1UK2A 3PRDA 4ZKRU 3DCLA 4WH8A 3BTME 4Q80A 4M9FA 5HXFA 1HJ8A 3R3GB 1TMUH 1O5GH 1QBNA 1Z1JA 1O32A 2PP6A 4XRNA 1ESTA 3PO1B 2Z9GA 1CT4E 3K6ZA 2KCOA 4BAOB 2OC0A 5HGGA 1CA0C 4WXIA 2OC7A 1MTVA 1EPTB 3M3SA 2XBWA 1Z7KA 3E6PH 1EP6A 4AOQA 1PPCE 3V13A 4ABDA 2FM2A 3GCNA 3OY6U 1HXEH 2FMJA 1HUTH 3SJKA 1AIXH 1O39A 1SQAA 2AERH 1PPZA 2IJOB 2GCTC 3EE7A 1MKWK 2H1UA 3MOCA 2CHAC 3RLWH 2AGIX 1E79D 1AGJA 5DN6D 2FTLE 4AC9A 3L3TA 4INHA 2ANWA 1H8HD 3U8TH 1XMNB 1GI4A 2BY8X 1TBZH 1HYLA 3C27B 2Y6TA 1GBJA 1F5KU 1Y5BT 1FY1A 3T28A 5L2ZH 1A61H 1EPTC 1H8DH 1HBTH 2BDGA 1JOUB 1ZMNA 4YOGA 1O5BB 1K1JA 1BRCE 1GJ9B 4ISHH 4R0IA 1LHFH 3TK6A 3PM3A 2BB4A 1LMWB 2ZTXA 4FUFA 5HMAA 1C5ZB 3SOSA 1ZPBA 1ARBA 2UWLA 2D26C 1FY5A 1EATA 1IQJA 1FN6A 1UW7A 2BD9A 3MMGA 2RA0A 2I6QA 1GJ5H 1MAXA 5EJLA 5C94A 1O2QA 3VXFH 5EQRA 3M37A 2ODYB 3RXQA 1P02A 4ABAA 1B5GH 3VB4A 3CS7A 3I29A 5E2OA 2G5NA 1WDIA 2ZP0H 3RU4E 1AQ7A 2JH0D 1C2JA 1C2HA 5T6FA 4CRGA 1P8VC 1FY8E 1MBQA 2ZA5A 4SGAE 3P8NA 1JMOH 1GHWH 1ESAA 2VIOA 4K3JA 1GJ7B 3F0PA 4B75A 1UVUH 2YOLA 1C1NA 1BHXB 1YM0A 3BIUH 5A8XA 3ATIA 5GWZA 2L6OA 1AFEH 4ACAA 1V2JT 2A32A 1NO9H 1O3BA 1V2TT 3DD2H 3A7XA 1WBGB 2O8LA 1GJ8B 3SV8A 5CDFE 3Q00A 4IN1A 4CRBA 1UTJA 2D8WA 1TGNA 4JYVH 3ZZ8A 5EPYA 3P70B 2JETC 1BTHH 2GMTC 4FUEA 3SGBE 3OTJE 1QR3E 1Y3XA 4JZ1A 4AFUA 2NWNA 1WYKA 4HFPB 4FVBA 1W14U 1GVZA 2VIQA 1LCYA 5EU8A 4AGKA 3LDXH 1TONA 4K8YA 2Q1JA 3WW7A 3BTQE 1GMDF 1T8MA 1ORFA 1P04A 5E8EH 4X6PA 1T4UH 2GVFA 4NG9H 4UFDH 1A7SA 3SI3H 2R2MB 4M7GA 2H6MA 2THFB 4TYDA 1SQOA 1YWUA 1SC8U 1UJ1A 4NFEA 1MD8A 4I86A 1GGDB 4YT7H 1MU8B 2ASUB 3E8LA 3RXUA 1ZJDA 5JB9S 2ZTZA 1GBIA 4HZHA 2C8WB 1CO7E 3F3BA 3RMMH 1AU8A 1P2IA 1MQ5A 2BX3A 2OLGA 1W0YH 2WHXA 3ZYEA 2ZHDA 5CHAC 1RRKA 5JB8S 2O9QA 4DJZB 3VB6A 3SYJA 2J38A 1Z8GA 2PR3A 3M35A 3PLKA 4B6FA 3ZV9A 6GCHF 1VCPA 1EJMA 3BG4C 1F7ZA 1EX3A 2F9NA 1O2SA 1ZMJA 2CMYA 1CSOE 2WV4A 1EJNA 2Q6FA 4J1YA 3ZV8A 2J98B 4DY7B 1OPHB 2KAIA 3Q3KA 1JRSA 2XNDD 4GLYA 3MU0A 1YY3A 1O5AB 2ZFQH 3QTVH 1OWDA 1SGTA 2HVXA 3SV7A 1GVLA 3ATLA 2G5VA 1S6LA 2HPQH 5DP8A 1GBFA 3QWCH 1SFIA 2XRCA 3AAUA 1KDQB 2XXLA 3F0OA 4BXSA 3D49H 2QC2A 5C17A 2SGDE 2A4RA 4LZ1H 1C5SA 3H7OA 2K0QA 2BDBA 1O3JA 3M5MA 1DANH 4WXVA 1YBWA 1C2LA 4X6OA 1P9SA 5PTPA 2QAAA 3ZVCA 2BX4A 4U32A 1P9UA 1G37A 1W0JD 1YPJH 3M7QA 2HOBA 3QZQA 1GI1A 2Y5HA 3A7WA 1GI7B 1OP0A 1P06A 1S85A 1K1LA 1O38A 1QNJA 1DLEA 1TOCB 2R0KA 2CHAB 3T25A 3A80A 4SGBE 2JKHA 4MPUA 4E06H 4B2CA 1O2UA 2KZ4A 1VGCC 2Z3DA 1NROH 1WCZA 2UUFB 1CA8B 3TNSA 1UHBA 1KY9A 3SHAH 2A4OA 3GOVB 2TBSA 1IAUA 3K9XB 1SPJA 5EIYA 1O5FH 2WYJA 2J34A 1W2KH 1A5IA 1V6DA 4NFFA 4OS6A 3NUMA 2KX4A 1QL7A 2XBXA 3KQDA 3GCTF 5FPYA 2ZU5A 2IPHA 3KQBA 2XBVA 1C5QA 3TVJB 1ZZZA 3RXCA 2ZDKA 2PHBA 1AWFH 1IQIA 1BTYA 1O3LA 3A8CA 5AFZH 5L6NH 2VNTA 3GDSA 1Z6EA 2HLCA 1A2CH 1C9PA 4PROA 1FAKH 1D6WA 5IK2D 1C1OA 4RN6A 3A7YA 4K1EA 3RXAA 1EZUC 1O3EA 3PMAB 2OP9A 3A8BA 2K8IA 1G32B 3ATMA 4AX9H 3R0FA 4X8UH 3W94A 1SLVB 1L1GA 4FUJA 5FAHA 4X8VH 5LPRA 2BYAX 1V2UT 2OQ5A 2A1DB 2B5TB 1S0QA 3PTNA 1CT2E 1PQAA 2ZDLA 1HAGE 5DP5A 7LPRA 3BTFE 3A86A 1QB1A 2LELA 2W7SA 1P09A 3NZIA 2FOHA 2G51A 5DP7A 5B6OA 1O2TA 2XC4A 4YLUA 1DWDH 4BAKB 4X1PU 4H6SB 2XWAA 4GHTA 1SGQE 4BNRA 4Z0KA 3M5LA 1KXEA 2GDDA 1MABB 2J97A 2VVCA 1K22H 3KHVA 1C5PA 1FXYA 3QX5H 1A4WH 1GCTC 3BTWE 1LVMA 3F9EA 2G55A 2BZAA 4WVPE 1TMBH 1V2OT 1KLTA 2HALA 2GD4B 4TY6A 2AMDA 1O37A 3EAJA 2SGQE 1RIWC 1A3EH 1C5UA 4CRDA 2CF9H 2ZHQH 1GDUA 1DM4B 4P00A 1IQEA 2BLVA 3SBKA 1IHTH 4ABFA 1AHTH 1RD3B 5AFYH 1V2RT 1NPMA 1O2PA 1MTNB 4DIHH 3LPRA 1GGDC 1P2OA 3SJ9A 3LOXA 3TJOA 3SUGA 4XBCA 4CRAA 3BEUA 1RGQA 1O3PB 3UR9A 1G2LA 1DDJA 2BD5A 4MPXA 5HIZA 2XOKD 2A5KA 4AGJA 1K21H 1LVBA 1TBRH 4Q7ZA 1JRTA 2V3HH 2BD2A 3S69A 4BTTB 2GZ8A 1IQLA 2ZU4A 2DE8A 3BV9B 4U30A 2WSSD 3U98H 1VITH 2KAIB 4OS5A 4DT4A 2ZHWH 1O3IA 1UHBB 1VITG 2OUAA 2WPHS 1QJ7B 4Y8ZA 3LU9B 5DP4A 2Z9KA 2ZGJA 1HAHH 1F5LA 2ESTE 1FIZA 1EAWA 2WYGA 5KEDA 4X0WU 2QN5T 1LHEH 4CRFA 2ZECA 1NFWA 2XW9A 1CBWC 4MG3A 5K7RA 1A5GH 2BLOA 7GCHF 4NZQA 4K69A 1Q31A 2ODQA 3GS9A 1MQ6A 1XUFA 4JZEH 4XOJA 2FEQH 1JWTA 3U1IB 4FU9A 1BT7A 3T5FH 4E7RG 4ZCNA 3A87A 2W3IA 1HIAA 2WPDD 1WAYB 3KEEA 1WUNH 4B73A 1NY22 4MPVA 1W13U 1GJBB 1O2JA 1YPKH 4RI0A 3STIA 2TGTA 1PYTD 2W3KA 1NESE 1QURH 4GPGA 1AB9C 1E1QD 2GKVE 4X8TH 5L30H 3S7KB 4KTUA 1GCDA 4IC5A 3A85A 1QFKH 5FXLA 4JZDH 3JZ2B 1O3KA 2O8MA 1O3AA 3F2FA 2FIRH 2ZDMA 2FOCA 2BM2A 4YZUA 2V6NA 1RJXB 4NA8A 5BRRE 2PKAB 3WY8A 3QGNB 2ZGCA 5HM2A 3MQKC
chains in the Genus database with same CATH topology
1FQ3A 2JH5D 4ZH8A 1AE8H 2ZEBA 1DUEA 2JETB 1ZGVA 2IOTA 4A1VA 1HAVA 1H9HE 2XWBI 1D3QB 2F91A 2ZHEH 4D9QA 1BBRK 3MI4A 2FTMA 1OOKB 2XCNA 1FLEE 1HFDA 5DK1A 3SU1A 3DT0H 4UE7H 3T26A 4D8NA 1XVOA 2BVRH 3T27A 1Z8IB 1XX9A 1PQ5A 5AHGH 1DSUA 2O8TA 4X6MA 1J8AA 5E0JA 1OSSA 4AN7A 1SOTA 3D23A 2PV9B 1V3XA 3RXTA 2A0QB 3EGKH 1HJAB 1V2NT 4XSKU 5AVDA 1K9OE 5C1UA 3P95A 3P6ZB 4YT6H 3SHCH 1O2IA 3QN7A 1FUJA 1EZXC 1F2SE 1WQVH 3DHKH 1P57B 2Z9JA 1XKAC 1BTPA 1L4DA 3A7VA 4I8HA 4BAQB 1TNGA 2A4GA 2FWWA 1FMGA 3UQOA 3NK8A 2BOHB 1FZZA 1W8BH 2P93A 2SGPE 1GG6C 1C5MD 2FYRA 2M5TA 3UWIA 3LKWA 4DCDA 1AKSB 2SGAA 4A1XA 2BY5X 4IGDA 2V3OH 4XBDA 1PYTC 3ZZ3A 3U1JB 1QB9A 2LPRA 3T62A 5GXPA 3SUFA 2BD4A 3UPEA 1QQ4A 2BDYA 1L2EA 1GMHG 3RMLH 3KNXA 4ZHMU 3GY6A 2P3FH 2AIQA 1OP8A 2ZGBH 5C1XA 4IS5A 4YLQH 4LXBH 1TPSA 1NC6A 2SNWA 4WWYA 4TY7A 1GMCF 1WOFA 3MNBA 3TPIZ 2FP7B 1IQFA 2BVSH 1E37B 1LHCH 4NWKA 3LH1A 4AFZA 1LPKB 3MNSA 3K65B 2ZU1A 4UEHH 2PSYA 4A7IB 2LNCA 2GZ9A 1J16A 3SNDA 4A92A 1DS2E 1SI5H 3OYPA 4Y76A 3E16B 5T6DA 1GJAB 4YTAA 5A8YA 3RM0H 2GDEH 3ITIA 1UTLM 5A2MH 1QRXA 1CT0E 1P03A 1VGCB 2WPJS 1W10U 1PPEE 2PKSB 5DP9A 1GHXH 4GCHG 3SU4A 1AKSA 2CGAA 4MPWA 3SGQE 4I8JA 3OX7U 4MVNA 1ZMLA 3ZZ4A 1S83A 3SV6A 1UTKA 5JBTA 3PMBB 5EXLA 1QRZA 1QB6A 2BY9X 3AASA 5FPSA 1NU9A 3SNAA 1HIAB 1ANBA 3I77A 2PKAA 1IQKA 4IBLH 3ZZ7A 4DG4A 2OXSA 3EQ0H 1FV9A 3SU3A 1UVPA 3ENSB 1QGFA 1J9CH 2DUCA 1GHBF 4MNYA 2ZFSA 1YKTA 1ZLRA 2TPIZ 2UWPA 1NFYA 4B76A 4TPYA 1BQYA 1K28D 2FDAA 2NU0E 2FOAA 4CR9A 4NA9H 3GCOA 3LGVA 4X1NU 2FO9A 3GY7A 1TBQH 2OBQA 1IQHA 1S6HA 1Y5UT 1AB9B 4ASHA 1FPCH 2O8WA 4K1SA 4Y10E 1BMNH 1TAWA 1SGRE 2R3UA 3RM2H 1IOEA 3GY5A 5GCHF 3EDXB 5CE1A 1QRWA 4AB9A 4X1QU 1TNIA 1N6XA 4AYYB 1DFPA 4JZIA 7GCHG 2AEIH 1BMMH 3SJOA 5EG4A 5TJXA 3E90B 3M5OA 4HI3A 1ZGIA 3GISB 3TK9A 3DUXH 3PMJA 1MTSA 1Y3WA 5JBCS 1DXWA 1WTHD 2OC8A 4HTCH 1PQ8A 2PTCE 1TALA 3MHWU 1FI8A 3SZNA 1SGDE 3SUEA 2H9EH 2EA3A 2ILNA 1TNKA 5I46H 1A3BH 4I7YH 3RXHA 5DP3A 3FP6E 5GCHG 1AVWA 2ZF0H 1C1VH 1BBRE 1RXPA 1HJ9A 4INLA 1G3EA 3FFGA 3GY4A 4NCYA 3SQHE 2QV1A 3BG4B 3TJUA 2NU4E 2P59A 1CGJE 1V2WT 4KKDA 3NWUA 9LPRA 4Q2KA 5F03A 3KCGH 1LQDB 4FVDA 1L1JA 4WH6A 2WV5A 2R3YA 2B7DH 1EPTA 1ELEE 1MTNC 4K2YA 1T31A 1BOQA 2ZNKH 1IQMA 3PWBA 1O3HA 3M7UA 3HKJB 1GBBA 4AG1A 5FPTA 1FNIA 2FS9A 3LC3A 2TIOA 4J2YB 2XYAA 4NIWA 1UTQA 2QXGA 1WU1A 1LHDH 5JDUB 2PSXA 4Q7XA 1QY6A 1G9IE 1SGYE 1S6FA 5A0AE 3VXEH 3ATKA 1O3OA 2GT7A 1O3GA 1K1IA 1KSNA 1YPHE 2Y82A 2QXHA 3ZVDA 6CHAB 1YYY1 2O8UA 1MKXH 3RXBA 2NU3E 1VJAU 4AORA 2BOKA 3SO3A 1XUJA 1BZXE 3QLPH 1Y5AT 2W26A 4ZUHA 3TGJE 1QIXB 5C20A 4X1RU 3Q3XA 5CMXH 1BMLA 1GHAF 2XC0A 2CJIA 1D3DB 2C8YB 1GBTA 3RC5A 5FHTA 1YPLH 1D3TB 2VINA 1TYNA 3NCLA 1GI2A 1ACBE 1T4VH 3BTEE 5EW1H 1BRBE 4IN2A 2A2QH 2QY0B 4FUDA 3UOUA 5EQSA 2BLQA 2C4FH 4DVAU 1YLCA 2GZ7A 8ESTE 1QHRB 2PUXB 4OS7A 2ZDNA 3RXMA 3QGJA 3SU5A 1HXFH 3V3MA 3MO6A 1TGBA 1D3PB 3OSYA 3EYDA 1WTGH 1MTWA 5DJ7A 1O31A 1Y3UA 2B8OH 3EE0B 4ZKSU 2WINI 1EAIA 4Y7BA 1LPGB 1MD7A 1W11U 1KXFA 3M36A 1GVKB 1O3DA 1Z1IA 1CU1A 1GMCG 2C3SA 3GCHB 3A89A 2SNVA 3SNBA 1Y3YA 2ZFFH 1V2PT 1D9IA 1TLDA 2Z3EA 3QK1A 3RXKA 1DSTA 2F9OA 1ANEA 3PV4A 1TX6A 5DKMA 1C2EA 2BY6X 1O2LA 1AVXA 2ZU2A 5JYIA 3M5NA 1A0JA 1DICA 3TK5A 1DVAH 4NWLA 1CHGA 1JXPA 5J4SA 1SLXB 5FBEA 1PPBH 4AFQA 1F92A 2C90B 3E3TA 2OTVA 2QXJA 4Y7AA 1OYQA 3LJJA 2R2WU 2CV3A 1THRH 3GY2A 4IMZA 2GT8A 4UFFH 3GYLB 1HJAC 1TGCA 4Y79A 1HAXB 3ZZCA 1YPEH 2PFEA 2ZDVH 3GDUA 1YCPM 3S7HB 1BRAA 4GVUA 5GJ4B 1GBDA 4FU8A 1MMJN 2ANKH 3QTOH 2H2ZA 2FESH 1E35B 2VJ1A 2R0LA 1QA7A 3A8AA 4TPIZ 5JPMH 1TRNA 3W95A 1P11E 1RTLA 1CGIE 1TWXB 3RXJA 5G4BA 1XUIA 1O34A 5EW2H 2XNIA 3SJIA 1DITH 2V0BA 5LGOA 1SG8B 4FXGH 4ZROA 3CP7A 3GY3A 3HGPA 2BDAA 4WF8A 2RG3A 5F8ZA 5TCAA 1ZOMA 1EOJA 4X6NA 1AUJA 1C2DA 4MNVA 2FOGA 2RA3A 5F8XA 5F8TA 5GPIB 1ZSJA 1TPPA 3S9CA 1UMAH 5FCRA 4Y6DA 4I8KA 1MBMA 3GICB 3P17H 1C1UH 2ANYA 3ZVGA 2C8XB 4UFGH 3BEFB 1ETSH 4Y71A 1PJPA 4X2XA 4KTCA 3LGYA 3KN2A 3HKIB 4X2VA 4KELA 5DO4H 1A0HB 3VB3A 1GBEA 2P94A 3TJNA 1P3CA 1AD8H 4XBBA 1C1QA 2QF3A 1KLIH 1O2KA 1SGFA 1TQ7B 2ZQ1A 2ZCLP 1O5EH 4ISNA 2ZPRA 1F0SA 1ANCA 1QQUA 2SGFE 1VCQA 1XUKA 2OBOA 3RXDA 4ZXXH 3AW0A 3IWMA 3TIUA 4O9VA 1C4V2 1AZZA 2P3UB 2F9PA 1EXFA 2AMQA 4UFEH 4H6TA 1T7CA 1Y8TA 4FUCA 3SGAE 2C8ZB 4DGJA 1UO6A 4Y0ZE 4CH2B 4UONA 2PLXA 5A8ZA 2GCTB 3RLYH 3U69H 3P8OA 3TGKE 3RUOA 3O8DA 5EOKA 2HNTE 1P12E 2A5AA 1DLKB 4NIYA 1H4WA 3Q76A 4BAHB 1NT1A 1C1MA 3VEQB 1G36A 4AZ2B 2Z3CA 5H4IB 5JBBS 1NRPH 1GBHA 1GBCA 2VVVA 3RXGA 2Q6DA 1HNEE 1B7XB 4Y8YA 1BCUH 1NRQH 1OWEA 4I31A 3RP2A 2ZI2H 3KF2A 4GSOA 3A84A 3HPTB 1ZJKA 2D1JA 2ZCKP 3TITA 1ETTH 1OKXA 1W12U 1O2ZA 1ELVA 2W7UA 1K1OA 3DFJA 4U2WA 4VGCC 4ZHLU 1EP5A 9ESTA 1FAXA 3RMOH 2ZPSA 1YCPH 2BLWA 5A0CA 5DP6A 5C1YA 1KLJH 1QJ1B 5T6GA 2BDIA 2ZKSA 1HB0B 1NS3A 1JIRA 5EPNA 1JIMA 1HDTH 1ARCA 1D6RA 3BG8A 1JBUH 3VPKA 1GJDB 1N8OC 3ESTA 4X1SU 4ABJA 1HPGA 4CBOA 1O5CB 4ZMAH 1LPZB 1O0DH 3FANA 1UVSH 2QIQA 1YGCH 1K1MA 4KP0A 1XM1A 3HGNA 4KGAA 1C1WH 1P2JA 2ZQ2A 4UDWH 3ZYDA 3PB1E 3TGIE 1HV7A 2DE9A 1OP2A 1QTFA 2GV6A 4WY3A 2BXTH 2H9HA 2BD3A 3LJOA 3NXPA 3TH2H 2YNAA 1AUTC 1MUEB 3A83A 3ODFA 2G8TA 2BXUH 2ZWLH 4FUIA 5GIBA 3URCA 2BD8A 3OY5U 1SGEE 1XUGA 2H5CA 4FUGA 3PO1C 6GCHG 2ALVA 4ISIH 1F0UA 1GDNA 4GAWA 1RTFB 4LK4A 2CF8H 1UCYE 3RU4T 1MH0A 2VGCC 1C2MA 2AH4X 3TNTA 2ZFTA 3F9FA 2F3CE 1OS8A 5EXNA 4F49A 2PUQH 4NSYA 2BY7X 2ZU3A 4GHQA 2ZHFH 3LGTA 3A7ZA 1O2RA 3L33A 4X2WA 1ABIH 1AN1E 1EJAA 2ZG0H 4BAMB 1O2MA 1P01A 4JYTA 3UWJH 1F0TA 3BTKE 5BPEA 1C5RA 1ZR0A 2GP9B 1HRTH 2V35A 3M61U 2G4UA 4XE4A 3VB5A 1GCTB 2PWXA 8LPRA 3Q77A 3SN8A 3UIRA 1Q2WA 3MTYA 7KMEH 3LGIA 5C5NA 1C5XB 3MNXA 2FXRA 4MQAA 1UTMA 2G4TA 1FONA 1TA2A 5K0HA 4NZLA 1IQGA 1GWAA 2C93B 3U8RH 4I32A 2VGCB 3RXSA 3ODDA 1P0SH 2P3TB 1AMHA 1E38B 3RXOA 1DWCH 1GI6A 1SB1H 1P10A 2QCYA 3BEIB 1GBKA 3ZVFA 4BTIB 1F5RA 2SGEE 1YP9A 3E91A 4ABIA 1FY3A 3P8GA 4ZAEA 1IQNA 2AYWA 1KXBA 3MO9A 4WMFA 3ZVEA 3VFEA 3KL6A 2HRVA 2VWOA 2UUJB 3ZVAA 5FX6A 3AVZA 3O8RA 3UTUH 1C5WB 2G52A 3RU4D 4X2YA 3RDZA 2WPIS 4H42U 1XVMA 4MNXA 4OS2A 2ZZUH 4WMDA 2F9UA 4BANB 1CHOF 4OGYA 1GPZA 3T2NA 4O3UA 3DA9B 3F6UH 3UOPA 1H8IH 1C2KA 4CBNA 3GCHC 1BDAA 3SI4H 3V0XA 2XC5A 3EA7A 1YC0A 1W0ZU 2UWOA 1TOMH 4KTSA 1TIOA 1Z8JB 3O8BA 3G01A 1KTSB 1V2ST 3I78A 1O35A 2VWNA 5EODA 1O2NA 2BQ7B 2JH6D 3BF6H 2GMTB 4K60A 3GDVA 1EB2A 1PPGE 4THNH 1DY9A 1BBRH 3RMNH 3ZZ5A 4R8TB 1L1NA 3LGWA 4RKJB 1AZ8A 5EGMA 2ZGHA 2GTBA 5A0BA 1GMHF 4Y8XA 1K2I1 3SORA 2A7CA 1HAOH 1TMTH 4JMYA 3A88A 5E0HA 2ULLA 1QBOA 2P95A 4NIVA 1XXDA 2AIPA 5DGJA 2QA9E 1DE7H 1W7XH 1S81A 8KME2 5IDKA 1BTWA 3MO3A 3PLBA 1ZHRA 3UNQA 2QF0A 1SR5C 3T29A 1RFNA 2ODPA 1L4ZA 1T32A 4E05H 2Z9IA 3MU1A 3A81A 1DXPA 1MCVA 5JBAS 2OD3B 1SSXA 1TRYA 5ETXA 3QZRA 3FZZA 3OU0A 3FAOA 3V7TA 2BD7A 1HAZB 4MTBA 1V2MT 1ETRH 1V2VT 3ATWA 4I8GA 1LO6A 2HGTH 4DT7B 6CHAC 2Y7XA 4AG2A 2A4QA 4E7NA 3B9FH 1XUHA 2VWLA 2UUKB 1O2GH 2B0FA 4NA7A 1C5NH 3IG6B 1TE0A 1FJSA 3SJ8A 3MU4A 1NRNH 2HNTC 1FN8A 1AWHB 1SFQB 2FZZA 1O3CA 3UR6A 2TGPZ 1UVOA 2XBYA 1E36B 2WPKS 3MH6A 1FPHH 1K1NA 1O3NA 1MCTA 1C5TA 3URDA 1WQSA 1GBAA 1QBVH 3D62A 2ZDAH 3UNSA 4DURA 2TGDA 1ESBA 1C2GA 3JZ1B 5LH8A 1A46H 4F4OC 8GCHG 1PQ7A 5LPEA 3M3TA 4BOHA 1AI8H 1KXDA 1N6YA 3P92A 1VCWA 4MLFB 5FCKA 2GCHF 2J2UA 1INCA 2FI4E 3MFJA 1O5DH 1NZQH 1DY8A 1U6QA 2GX4A 1BJVA 2VVUA 1A1RA 4K5ZA 1DWBH 1GDQA 1VZQH 3TH4H 3E0NB 1GMDG 3QUMP 3BTTE 1DWEH 1YF4A 1MZAA 2TGAA 3ZZBA 1O36A 3MNCA 1KXAA 2Y5FA 3L6PA 3AAVA 3EA8A 5C3NA 2J95A 1ZSKA 5EXMA 2GCHG 1EAXA 3GY8A 1SOZA 1LVOA 1TABE 1ZPZA 4AB8A 1NN6A 1ZYOA 1DX5M 1BTXA 1TNLA 3SUDA 1MKWH 1TPOA 2BVXH 2ZGXH 4B74A 3UQVA 1ELAA 3MH7A 2Y81A 5ABWA 1HAPH 4O3TA 2HNTF 3K2UA 5AF9H 1S5SA 1DPOA 1AO5A 2Y7ZA 3ZVBA 2FX4A 4WJG2 1ZTLA 1SHYA 1TNHA 4YOJA 1XKBC 4K8BA 4Z6AH 5L2YH 1ZPCA 1HCGA 1J15A 2K1QA 2VB0A 4Q7YA 3E1XB 4Y11E 1HAIH 1QJ6B 4B71A 2FLBH 5ESTE 1BA8B 2A2XH 3ELAH 4TWWA 2H9TH 5E2PA 4D76A 4FUBA 3K6YA 4ZKNU 1LTOA 2J92A 4D7GA 1TQ0B 1L0ZA 7ESTE 2FOMB 2NU1E 4OS4A 5HM9A 1GJ4H 1GL0E