1UVOA

Structure of the complex of porcine pancreatic elastase in complex with cadmium refined at 1.85 a resolution (crystal a)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title On the Influence of the Incident Photon Energy on the Radiation Damage in Crystalline Biological Samples
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uvoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uvoA01
1RRKA 4B2BA 2QF0A 1TYNA 1XKBC 1B0EA 1E37B 1YBWA 1OPHB 5E2OA 1HAOH 1QB6A 2BZ6H 2BVXH 5DGJA 1F5KU 1AZ8A 1W2KH 4K8BA 4F49A 2ZF0H 1RXPA 2UUYA 1PYTC 3TJNA 2CN0H 3RXGA 2FOCA 1L0ZA 2TGDA 3E0PB 5A2MH 1JMOH 1XUFA 3DA9B 4B71A 1P8VC 2VVCA 1KSNA 1SGIB 3O8BA 1XUKA 1C1MA 3SUDA 1GBFA 3PYHA 5HGGA 2FLBH 1NU9A 4GHQA 1NRPH 1AKSA 1GCTC 2BOHB 1O2JA 1NFXA 3OYPA 3RXRA 3FANA 2M5TA 2PV9B 4JZFH 1BRAA 4FU9A 1B7XB 5DO4H 4BXWA 1MKWK 1YCPM 1OYTH 4NA9H 3JZ1B 3SNCA 1U6QA 3F9HA 1C1VH 1ZJDA 3SU3A 4X6OA 2H5DA 2A2QH 3DD2H 1CHGA 1GBHA 2ZC9H 4UFDH 2ZI2H 1O0DH 1C5VA 2FZZA 2H6MA 3B8JA 3LPRA 1VITF 2GVFA 2ZO3H 4DW2U 1SGFA 3BG4B 1GI6A 5H4IB 4ISNA 5GDSH 1AGJA 3GY6A 1DLKB 1IQHA 1SGFG 2CMYA 3AAVA 4JYUH 1DXPA 1FONA 1C1OA 3IG6B 1UCYK 3GY7A 5DP9A 3GY3A 5DJ7A 4BAMB 1KTTB 1DVAH 2J9NA 1KLIH 1G3EA 1UTMA 3F9FA 1O2HA 1GBCA 1SGNE 2ZDMA 1G36A 2NU3E 3TH2H 2FM2A 2J94A 3CP7A 2SGDE 3E3TA 1ELFA 4BAOB 4O3UA 1SQOA 3U9AH 1KDQA 2LPRA 1G3DA 3HATH 4IN1A 1HAVA 2KAIA 4X6PA 5E2PA 2WPJS 2WYGA 1SGCA 1XXDA 4AYYB 2GMTB 3F9EA 3OSYA 2ZCKP 1GL0E 2A4OA 5JPMH 2W5EA 1O3FA 1HDTH 1V2RT 2VH6A 3TIUA 5J4QA 4FUCA 4IBLH 1HJ9A 5JBCS 2O8UA 4HZHA 4FUDA 5EXLA 2BD4A 2ZECA 4AFSA 1TX7A 1UK3A 5FPTA 1DFPA 3MHWU 1BMMH 2FWWA 1EB1H 2WINI 3RXUA 3W94A 1Z71A 1SGQE 2Z9LA 1H9LB 1AWHB 2BB4A 1CSOE 1P2NA 2G4UA 3AW0A 1SGDE 3TGJE 1XMNB 9ESTA 2H9EH 3BTEE 3ITIA 2FLRH 3SGAE 2QXJA 2G52A 3LDXH 3E16B 3U98H 1MTSA 1AVWA 3SGQE 3M7UA 1G32B 1K28D 1QB1A 4IMQA 4R0IA 1GBBA 1MKXK 4B2AA 1PPFE 1HRTH 4ABAA 3B9FH 4D76A 3MTYA 3GCHB 2A45B 4Q2KA 4ZHAA 1JIRA 3P8NA 5JB9S 3MU1A 1A46H 1DLEA 4X2VA 3S7HB 3FP7E 1O31A 2ULLA 3SU6A 1AQ7A 2VGCC 1EOLA 1E35B 2CF8H 1WAYB 5DG6A 4H6SB 1XUIA 3C27B 3T27A 2ZPRA 3UTUH 1YPHE 3QZQA 1C5TA 1GMHF 1O2QA 5EGMA 1MQ5A 1BTHH 1N6XA 4MTBA 4LOYH 5FCKA 1GJCB 3GISB 5A8YA 1LHDH 1ZMNA 1F0TA 2SGEE 4U01A 2W3KA 1FY1A 4U32A 3VXFH 1TONA 1CE5A 3M3SA 4JZ1A 1C2EA 1VCWA 3O8CA 3T28A 3QX5H 2F3CE 3SU1A 2ZCHP 4ABBA 2A4GA 1P2MA 6CHAB 1QJ7B 1ELVA 4GAWA 5JBAS 1IQNA 2XCFA 1KDQB 2FX6A 1G3BA 2GZ8A 1HAVB 4PROA 2JH6D 4ZKOU 2KAIB 1YPJH 3ZZBA 4DOQA 2HALA 1P04A 2BTCE 1S84A 1RTKA 1A0LA 4Q80A 3TK9A 3ZVCA 2THFB 1WCZA 3M61U 1D3TB 1AFEH 1CU1A 4ABEA 2ZFQH 3SUEA 5LH8A 1SSXA 4THNH 1P9UA 1WUNH 2Y7XA 1YPEH 1AVGH 1DITH 1ZRBA 1FAKH 1ANCA 2F91A 4MDSA 1C5LH 1L4DA 2VWMA 2SGAA 1UK4A 1P10A 1G3CA 2PTCE 2BQ7B 2XWBI 2BLOA 3HGPA 3BG4C 3MU5A 4IC5A 2O8WA 1C2GA 1LQDB 3SUGA 1ZHMA 3MO3A 1WV7H 3CS0A 3NKKA 2C8ZB 3U1IB 3KF2A 1ESTA 2A7JA 3SJKA 1HV7A 2B8OH 1VJAU 3MNSA 1KYNA 2BDBA 1VCQA 1G2LA 2RCEA 4WMFA 1ZTLA 1B5GH 1HCGA 1XVMA 5E0GA 2NU1E 5F8XA 2CV3A 1TQ0B 3MNXA 4XBCA 3UWJH 3TLOA 1TNLA 4K69A 1Y5UT 4Q7YA 1LKAA 1PQ8A 4XDEA 1BTXA 4BTUB 1O2RA 1OWKA 2Q6FA 4NWKA 1KXEA 3PLPA 2BQWB 5DPAA 4OS5A 2OC8A 3LT3A 4XSKU 1C2IA 1T4VH 1LMWB 1GJAB 2BDYA 2BY5X 4ZAEA 1AE5A 4I8KA 5TJXA 2ANKH 2ODYB 2ZIQH 3RMMH 1O34A 3D65E 4FU7A 1D6RA 1P02A 1EAIA 1PQ7A 2Z3EA 3MH4A 3QZRA 4FUFA 4J2YB 2UWOA 4AGJA 2R3YA 3RXQA 1XKAC 1O3EA 3PMHB 4JK6A 5E0HA 2Z6BD 5EXNA 4LZ4B 1QCPA 1VITG 2BX3A 1HJ8A 1XM1A 2W7SA 1EP5A 2BXUH 1ZSJA 1C5NH 3LGVA 4I8HA 1CVWH 1PPZA 2SFAA 1E0FD 1TA6A 2G81E 3K6YA 1EJMA 1O35A 4XBDA 1T8LA 2VVVA 1GVZA 4NGAH 1AB9C 1XUJA 2BD7A 4WJG2 1L4ZA 4OS2A 3STIA 2D26C 5FHTA 2ZHDA 3LC5A 2EA3A 4XE4A 4H42U 1RFNA 3GDUA 4NG9H 4CR9A 1RS0A 4E05H 1KLJH 1P57B 2VINA 4Y6DA 4HFPB 4Y8ZA 1O37A 3A8BA 1TGNA 1SOZA 1Y3VA 2QYIA 1GL1A 4Z6AH 2ZDVH 5C1XA 3GCHC 2OXSA 3T29A 1S6FA 2A0QB 1W8BH 1SR5C 2QXGA 4FXGH 2AERH 5AFZH 3S7KB 1GJ9B 2A7CA 3MOCA 1C5RA 1SGEE 4K1EA 1HXEH 2FOFA 1A5GH 2HRVA 3QK1A 4BAQB 5EQQA 1QNJA 3TGIE 2TBSA 2XC4A 4B74A 2NWNA 2PGBB 6GCHF 3MWIU 4CHAC 2AGIX 1ANBA 1N1LA 4UONA 1Z6JH 1AU8A 4BAHB 2G8TA 1O5GH 2VIPA 3MU4A 4AORA 2BD9A 2HWLB 2Y80A 2UWPA 3V0XA 2HPQH 1BTPA 4MNWA 1C5ZB 2J34A 2H5CA 1D3PB 3V7TA 1BRCE 1NY22 3C1KA 3A7YA 1TNHA 2Z7FE 2HNTF 4YO9A 1Y8TA 4K2YA 3KIDU 1C2MA 1ABJH 1MU8B 1TA2A 1TRNA 1Z8JB 5EW1H 1DY8A 5I46H 4A1XA 2F9BH 1XVOA 3F1SB 1Z6EA 2OQ5A 1V2OT 1Y3UA 1TGTA 1DOJA 1GBKA 5T6DA 1WYKA 2H1UA 4SGBE 2BHGA 2IN2A 4CRFA 4OGYA 2ZDLA 2ZWLH 5LGOA 1GG6C 2Y6TA 4ZKRU 1SOTA 4K5ZA 5DP4A 3URCA 1OKXA 4ZMAH 1BIOA 2ZEBA 2IPHA 1AZZA 2R3UA 3R0FA 4GUXA 4TWWA 2ANWA 1MD8A 1FY8E 3M3VA 2CJIA 1M9UA 2FYQA 2RG3A 2TPIZ 1ACBE 1MD7A 2ALPA 1LTOA 1PQAA 1MZDA 4YOIA 1NRSH 1L1NA 4ZUHA 1TMUH 4ZXXH 1HNEE 2Q1JA 2OTVA 4JCNA 1LCYA 4INHA 1GJ8B 2TGPZ 1TPSA 2BDIA 2EEKA 4MNYA 1HFDA 1PQ5A 3E8LA 3GDVA 1SLWB 2FX4A 4IMZA 5BRRE 3W95A 2FXRA 3UFAA 2F9PA 2GGVB 1KIGH 4K8YA 2ZU5A 1TX6A 2Z9GA 3RXIA 3ZVEA 1RIWB 1YYY1 2C8XB 5EQSA 3SV2H 1UVSH 4Y8YA 4FUEA 1IQJA 3S9AA 3BN9A 2GKVE 4I8LA 1C1TA 1KXCA 4OS7A 4K60A 1BBRK 1VGCB 1SPJA 2ZGJA 3RU4D 5A09A 5DP7A 2XNIA 4ABHA 3QN7A 1ETRH 3AW1A 4X1PU 4MPWA 2GCHG 2V0BA 1SC8U 1QBVH 2BYAX 2J2UA 1A5IA 3A85A 4HGCA 1TE0A 4X6NA 3O8RA 1P3EA 3TVJB 8GCHF 2OP9A 4BXSA 4CREA 1Q31A 1CGHA 2OBQA 7KMEH 1RTLA 1ELTA 4MQAA 2QN5T 3SQHE 4D9RA 3K6ZA 3UQVA 1C5YB 1J15A 3GCTF 5BPEA 5JYIA 2SGPE 5AHGH 2ZGXH 2ZGHA 1SLXB 1JRSA 5HMAA 3QDZB 3A87A 1O3HA 1UTLM 2XYAA 2BDHA 2PSXA 1ZMJA 5A0AE 2V3OH 2ZFPH 1GHAF 3S9CA 1QJ6B 1ZLRA 1EX3A 1GHZA 1PPCE 1YP9A 1O5BB 2FOAA 3KQEA 2A5KA 1S81A 3P6ZB 4ZXYH 2VWLA 3EDXB 2BY7X 4NSVA 3HKIB 2V3HH 3TNSA 5AVDA 3GCNA 1EJNA 1CHOF 1GBDA 4I33A 1Q2WA 6LPRA 1K2I1 3PLBA 2ZHWH 3BTFE 1QFKH 4AFQA 2H2ZA 1VR1H 1JOUB 2SNVA 3RUOA 1BUIA 1GHBF 4YM9A 5FAHA 3WY8A 3MMGA 3VEQB 2ZU3A 1MTVA 1GJ4H 5F8ZA 1UVTH 1GHYH 1O2GH 3A7XA 2H9TH 1GBTA 4ISLA 3U1JB 2BY8X 3QTVH 2OBOA 4KTUA 3GCOA 3D23A 1NESE 1SB1H 4MNXA 5L2ZH 4QT8C 3H7OA 1W12U 1LPKB 5I25A 4Q7ZA 2Q6DA 5C67A 4J1YA 1FAXA 1DE7H 3UPEA 2R0KA 4X8VH 2ZFFH 3UWIA 1QGFA 4GVUA 1EP6A 1SFQB 2NU0E 3BTHE 1EPTA 2TGAA 3RU4T 1IHTH 4OS1A 2F83A 4GPGA 3ZZDA 1YCPH 4IW4E 1S5SA 2R0LA 3EE0B 1O3KA 3BTDE 1J9CH 4WF8A 5EG4A 1TPOA 3U8OH 3V3MA 3A84A 4AB8A 2W3IA 2GDDA 2VU8E 1MBQA 1DUEA 3PWCA 3SHCH 2XWAA 1QL9A 1V2QT 4BAKB 3PWBA 4DIIH 1S83A 4R8TB 4ZH8A 1EQ9A 4IGDA 1O2PA 3L3TA 3O8DA 4X1QU 1UTJA 2BX4A 4LK4A 4B2CA 1J16A 1HAGE 2PKSC 4Y0YE 1MH0A 2HOBA 1YPHC 1DWEH 3RXJA 3MO9A 1O3CA 1ETTH 2WPMS 3D49H 3N7OA 3BTME 6GCHG 2P3UB 1BOQA 1AVXA 1FIWA 1QA0A 1C5MD 3ZYDA 1QURH 2V6NA 1GJ7B 2FOHA 2XC0A 3QUMP 5C20A 1MCTA 2B9LA 1QR3E 3EYDA 5DP8A 3LOXA 3OTJE 1C1RA 4X8UH 3VB5A 5ETXA 1TOMH 1TBZH 1PPBH 1HAPH 1ZPBA 4ABDA 4DJZB 2WPLS 3FP8E 1GMDF 5GCHF 1L1GA 3LGYA 5DP6A 3UOUA 4CBOA 1SFIA 4FUHA 5GJ4B 3SNEA 2JH0D 4XOJA 2YNBA 2I6QA 3RC5A 2OQUA 2R2WU 1WBGB 1O5FH 1QL7A 4K1TA 2FO9A 4CRDA 1P01A 1TBRH 1WTGH 1S0QA 1EZUC 2D2DA 1V6DA 2BDAA 3HPTB 1G9IE 1O2MA 1GVLA 4ZKNU 1LVBA 1HJAC 4X2XA 1INCA 1EUFA 1AMHA 2HPPH 2Z9IA 4AG2A 1GI4A 5FX6A 1MAYA 1P0SH 2QF3A 4YLQH 3UREA 1FJSA 3BTQE 1O2LA 1UTOA 4U30A 3RP2A 1PPEE 2VIQA 1LHEH 1W0ZU 3ESTA 4X1SU 5SGAE 2ZQ2A 2B5TB 3ZVGA 2F9OA 4MLFB 3PMBB 1T8MA 1WQVH 3SU0A 3SW2B 2PTNA 3FFGA 1THPB 3OX7U 3SHAH 4OGXA 2G00A 3RU4E 4ABIA 1EPTB 4I31A 3S9BA 5C1UA 1PPGE 3RXKA 1F92A 3EAJA 2BMGB 2Z9KA 1MQ6A 1QRZA 3ATLA 3ZZ7A 1V3XA 2JH5D 2PW8H 4XBBA 2QXIA 2ALVA 4KGAA 1TMBH 1TWXB 3PROA 1GVKB 4D9QA 3UY9A 3M37A 1ZZZA 1DPOA 1EOJA 2CHAC 1JBUH 1AFQC 2UWLA 4X1NU 1PPHE 1YC0A 3RM2H 4X2WA 2JKHA 4KKDA 1A4WH 2GZ7A 3VB3A 2BM2A 4WY3A 3TU7H 4NZLA 3RXEA 2Q6GA 1LVMA 2A5AA 1C5PA 2VVUA 3A81A 1MTNB 2Y81A 1BTYA 1FN8A 2QA9E 4ABJA 3BEFB 1QIXB 1O3BA 1CGJE 3AVZA 3DFLA 4FUIA 1Z8RA 4NA8A 3VGCB 1P12E 1AUJA 1F0UA 1GMCF 2F9NA 4FUBA 3T2NA 3TK6A 1UTQA 1FLEE 1IQLA 1TGBA 2AMDA 3QTOH 5CMXH 2SGQE 3KQBA 1L2EA 1O2NA 3BTKE 1BQYA 3ZVAA 1O2VA 4O9VA 4A1VA 3MNBA 1YPMH 3GCTG 2ZFTA 2VIWA 2A5IA 5E0JA 1O38A 3MH7A 2PUXB 3M5LA 1THSH 3NPSA 1TNKA 5TCAA 1SMFE 1ZGVA 3SV7A 2VIVA 4JZEH 3FAOA 2G5NA 2VB0A 3EA8A 1GHAG 1C5QA 3LIWA 3PMJA 4YTAA 1MTWA 4GCHG 4CRCA 4MPUA 1NFWA 1K1NA 4GHTA 3HK6B 1KXBA 4NZQA 2BY6X 1LPGB 1CHOG 4RKOB 4U2WA 1LO6A 1T4UH 3VB6A 2J92A 4AYVB 1V2WT 7GCHG 3DT0H 1GI9B 5ESTE 2PUQH 1CO7E 4B75A 3DUXH 2O9QA 1G37A 5EPNA 1SGTA 1GJ5H 1O3JA 1NROH 1UVPA 1TPAE 1IQMA 2XBVA 1ZPCA 1AUTC 2O8TA 4DGJA 5EQRA 2W7UA 1DT2A 2BDGA 1NTPA 1GBAA 1CBWB 1C2DA 4YZUA 2HVXA 3STJA 1O2TA 1MKWH 1WOFA 1O30A 3URDA 1TRMA 3ATWA 3FZDA 4UE7H 1SQTA 2C8YB 2BZAA 3FZZA 3TH4H 2XRCA 1DDJA 1NN6A 4DT7B 3PTNA 3UIRA 1SGRE 1JWTA 1TNIA 1K1OA 3F68H 1O36A 3ATKA 1BMAA 1XUHA 2ZGCA 4CRAA 1GI2A 3PO1B 1DY9A 1O2ZA 2GCTB 2GMTC 3ZZ6A 2NU2E 1EAWA 3NUMA 1F0SA 1UVUH 1YKTA 1N8OB 3M36A 3KL6A 4WH8A 1FZZA 4MG3A 1OP2A 2XBXA 1YPLH 1ESAA 1TALA 1LQEA 3RXTA 3T26A 3A7TA 2BD5A 1EZQA 3I78A 1UCYH 3LH3A 2AEIH 1T7CA 3ZZAA 4ISHH 2QAAA 5PTPA 2DUCA 2DE9A 4WH6A 3QGJA 2TIOA 1NRQH 3A7ZA 3BEIB 3QWCH 4ZHLU 1BBRE 1P2KA 1HXFH 1RD3B 4TY7A 1A7SA 1NPMA 3GDSA 4CH8B 1V2UT 5HM9A 2OC1A 2P93A 3MO6A 1O3AA 3ZZ3A 1UO6A 3ELAH 1C2FA 1MBMA 2ZDKA 1EB2A 1HYLA 1GBIA 2Z3DA 5ABWA 3M5NA 1EPTC 2QC2A 3HGNA 2FOMB 3ZVBA 2JETB 1UTNA 2Y5GA 3RXSA 5B6OA 1TOCB 3NWUA 2GT7A 4FVDA 2ZKSA 5GCHG 2PFEA 2GD4B 3A7VA 1GWAA 1C1PA 1LVOA 2A7HA 3SOSA 1CQQA 1C1NA 3G01A 4Y7BA 2ZPQA 1Y5BT 2ZHFH 2G55A 4ISOA 1EAUA 3ATIA 2FPZA 2XBYA 1MTNC 1QL8A 5G4BA 1DANH 1C5XB 1QBOA 3MH5A 3BTTE 1XX9A 1HLTH 1C2KA 4LXBH 4KP0A 2VIDA 3VGCC 5LPRA 2ZU4A 1O5AB 4UFEH 2PGQB 1UVOA 4E7NA 2FMJA 2WPKS 3SBKA 2ZHQH 2ESTE 3ATMA 4X8TH 1P2OA 3SV6A 3I77A 1QQUA 1MKXH 1K9OE 4O97A 6CHAC 2HNTC 1Z7KA 1KXAA 2FDAA 1C5SA 3ZZ4A 1C4V2 5GPIB 1TPPA 1P9SA 2EC9H 5FPSA 4AFZA 1NFUA 1AN1E 3TPIZ 2WPIS 3HK3B 1P03A 1T32A 1UHBA 4B76A 1EATA 5DK1A 4UDWH 1BTZA 4BTTB 1L1JA 2AIPA 3ZV8A 1OSSA 2K1QA 3RXPA 1YLCA 4RSPA 1V2LT 4GSOA 2CF9H 2C4FH 1NRNH 1TMTH 1V2TT 1P3CA 2XCNA 3UOPA 3GY8A 2GTBA 2PLXA 4AZ2B 1GMHG 3R3GB 4DURA 1O3LA 4YESB 3IWMA 2IOTA 1WQSA 2FYRA 2GX4A 3Q76A 2OCVB 1V2KT 1C1QA 3FP6E 3M3TA 3RC6A 2FI3E 1C2JA 1FI8A 1T31A 1HAHH 3GY2A 3HKJB 4Y79A 3T5FH 3MYWA 2Z3CA 1NRRH 4MVNA 3RXDA 4AG1A 2WUBA 2XXLA 1OWHA 3SU4A 3A8DA 3PMAB 4I8JA 1JRTA 1ELGA 2J38A 1C5OH 2HGTH 2QXHA 3SNBA 4WWYA 2GCTC 1SI5H 3P8GA 4JYTA 4NA7A 3MFJA 1O2KA 2J4IA 4H6TA 1P11E 2P95A 4NFFA 2OUAA 1O3GA 4Y8XA 1BJUA 3LJJA 1D9IA 2OINA 1FMGA 2OD3B 5L30H 2RA0A 3RDZA 4A5TS 1NU7B 2Y7ZA 3I29A 3E91A 3RMNH 1DS2E 4GLYA 1C1WH 3JZ2B 2BOKA 3D62A 4KTCA 1IQFA 1IQKA 1BMNH 1RJXB 1TFXA 2G5VA 2WYJA 1Z8GA 2ASUB 2ZZUH 1O2UA 5HM2A 1HAXB 1O2WA 1LVYA 2HNTE 5DP3A 1GDQA 1S0RA 1K21H 4Z0KA 2O8LA 2VIOA 4A7IB 5L2YH 3KCGH 3VB7A 1TNJA 2FESH 1GGDB 4NSYA 1FUJA 4X0WU 1QQ4A 5K0HA 1HB0B 4ASHA 5FBEA 1P2QA 3SORA 1KXDA 1OWDA 1ID5H 1SGYE 2QIQA 4CBNA 5EXMA 2WPHS 3A86A 2D8WA 1ORFA 1N6YA 1UHBB 3BTGE 3PB1E 2R9PA 3SZNA 1VZQH 1UMAH 5CHAB 1AY6H 3A82A 1V2VT 3SNAA 1O3NA 1QTFA 1S82A 2BXTH 3V12A 3BF6H 1DSTA 1FPHH 1G2MA 1Y3XA 1O2SA 1W7GH 5F03A 2XW9A 4YT7H 3LJOA 2BD8A 1MMJN 2VNTA 1DSUA 1KTSB 4D7GA 3RXLA 1ARCA 3TGKE 4DG4A 2QCYA 2FTMA 1QA7A 3A89A 1NFYA 4KTSA 2D1JA 1IQGA 2C90B 2AH4X 2UUFB 3LONA 3RC4A 1VITH 3RXVA 1BCUH 1O2IA 1QY6A 5AFYH 5GWZA 1D3DB 4Y11E 3A8CA 2XBWA 4AFUA 3K2UA 1E38B 1K22H 3KQCA 2PKAA 1OP8A 2ZDAH 4INLA 1OX1A 1O32A 4DY7B 1BJVA 4O3TA 1YF4A 3ODDA 2B0FA 2EI6A 2NU4E 2STAE 1IAUA 1ESBA 2BLVA 1Z1JA 1FIZA 4UFGH 5T3HA 1GI5A 3GYMA 4NIWA 1FXYA 1SBWA 5FBIA 3T25A 2J95A 1ELDE 1QJ1B 1MTUA 3EGKH 1S6HA 1AE8H 2ZG0H 5GIBA 4RKJB 2VJ1A 1ZSKA 3RXMA 1V2PT 1GI1A 4JZDH 4WVPE 2STBE 5JDUB 3T62A 1XUGA 1K1PA 3BEUA 2LNCA 4HTCH 2GT8A 2O8MA 3SV8A 1GPZA 3TK5A 4TWYA 1DWCH 3F6UH 5LPEA 1ZR0A 9LPRA 4MPVA 1BTUA 2BD3A 2C8WB 1HAZB 3P17H 2H9HA 2UUJB 2W26A 3EA9A 1EXFA 1HPGA 1ZGIA 1NZQH 1A3BH 3SU2A 5J4SA 1TQ7B 1D4PB 4KELA 1RIWC 1QB9A 3NCLA 1BB0B 1OXGA 3SN8A 5HYOA 1A61H 1BHXF 4BANB 5EOKA 2G4TA 1EAXA 2C93B 3SJOA 1VGCC 4NIYA 4NIVA 1TGCA 2A4RA 1OOKB 4I32A 3AASA 3M7QA 1H9IE 3LKWA 1W13U 5JBBS 1QRXA 5A8ZA 3A80A 2EI7A 1W7XH 1O3MA 1FY4A 1SQAA 4NCYA 8LPRA 3UR6A 1JIMA 1B0FA 1WTHD 1ZYOA 3UUZA 1F2SE 4DCDA 3QLPH 1XXFA 1C9TA 1YM0A 3A88A 5CE1A 4M7GA 1GBMA 1BDAA 2FIRH 1HAYB 1O3DA 1KY9A 3TJOA 4INKA 3K9XB 1BTWA 4B73A 1EASA 2TGTA 2WUCA 3NK8A 5GXPA 1H4WA 3IITA 3RXCA 1UK2A 4Y7AA 2OC7A 1BRUP 1TAWA 1F7ZA 4FUJA 5FX5A 1MAXA 3M5OA 7ESTE 4VGCB 2BDCA 1CGIE 1O3OA 2PKAB 5EPYA 2ZTXA 1GGDC 3UQOA 2AMPA 1BBRH 1AB9B 1J8AA 3MU8A 2VH0A 1P09A 3CS7A 1AKSB 2ZPSA 1Y3WA 5FPYA 1CT2E 1HGTH 1EJAA 1ZTKA 2FI4E 4ZROA 4E7RG 5CHAC 1NT1A 1K1MA 2QV1A 4JK5A 2AIQA 3M7TA 3Q3YA 2GZ9A 3RXOA 1GCDA 2G51A 1LHFH 1W3CA 7LPRA 1SHYA 2EI8A 3MNCA 2GDEH 2PR3A 3KN2A 1C2HA 1F0RA 2P3TB 1GDNA 5C2ZA 2OC0A 3ODFA 1O33A 1IOEA 1V2NT 1H8DH 3A8AA 2A32A 1DICA 8GCHG 2FODA 4H4FA 3QO6A 2VWOA 3A83A 4CHAB 2FP7B 1Y5AT 1S85A 5JB8S 1YLDA 5T6GA 5EW2H 4YT6H 1GJDB 3ZZ5A 3BTWE 1DWDH 1P05A 3SGBE 3UNRA 4LZ1H 4FVBA 1FN6A 1P2IA 1NC6A 3DFJA 4AOQA 1TLDA 5FCRA 3VFEA 3TJVA 3MU0A 3RXHA 2YOLA 4WXIA 3LGTA 2PWXA 3P95A 6ESTA 1ZTJA 1D3QB 2VWNA 2ZU2A 3PTBA 3V13A 1C5WB 3BIVH 1ANDA 4Y10E 3VPKA 1C4U2 1GI7B 2Z9JA 1AHTH 3ZZ8A 2P8OB 2FOBA 3E90B 1C5UA 1CT0E 1GG6B 4FU8A 4DIHH 1GHBG 5C1YA 1ZSLA 3SO3A 2GCHF 1BITA 4O03A 3SI3H 1AWFH 1FDPA 4ABFA 1ANEA 3ZV9A 1ELBA 4UD9H 1ZRKA 1O2YA 1EZSC 2FEQH 3ENSB 5DKMA 3E6PH 3M35A 3Q77A 4ZHMU 4Y76A 2ZFRH 4SGAE 1W11U 1MUEB 2FS8A 2IJOB 5EU8A 1IHSH 2ZQ1A 1K1LA 8KME2 4K3JA 3MI4A 2BD2A 2ZHEH 1MZAA 2FTLE 1FQ3A 1P2JA 1OS8A 4AB9A 1TABE 2WV4A 1Z8IB 1TNGA 1VJ9U 4JZIA 1Y59T 1YGCH 1T8NA 4CRGA 2A31A 2QGRA 4NWLA 3H7TA 3RLWH 2I6SA 1K1JA 2BY9X 1H1BA 2BQ6B 2HLCA 2ZNKH 1C1UH 3VB4A 4UEHH 1CA8B 2Z94A 3ZZ9A 3SJIA 2BLQA 1DXWA 4Y0ZE 1Y3YA 1O5DH 3GYLB 2Y5HA 4A1TA 4MPXA 3TH3H 1RGQA 3RXAA 1OP0A 1OWIA 3VXEH 3L33A 1H8IH 1TX8A 1OWEA 2BLWA 3LH1A 3SJ9A 1W14U 2A1DB 3KNXA 3SUFA 3BSQA 1KXFA 3TNTA 1GI3A 1FV9A 1OYQA 1PFXC 1PJPA 3UR9A 3NZIA 1FPCH 3H5CB 5C3NA 2WV5A 1SG8B 2TRMA 1V2MT 1IQIA 1C9PA 1ZHRA 1EZXC 1C4Y2 3RMOH 1CA0B 2GV6A 3P8FA 1BRBE 1OWJA 2F9UA 3BG8A 1WU1A 3BIUH 4VGCC 2AFQB 1WSSH 1IQEA 2GP9B 2FI5E 5JBTA 1GHWH 4CRBA 4A92A 1D6WA 4X8SH 3P92A 1GMDG 3Q00A 2ODQA 2ANMH 1VCPA 1C1SA 1FY5A 3L6PA 3P8OA 1DM4B 1O5EH 1J14A 1SL3A 1ZPZA 3F9GA 5F8TA 3LGIA 3S0NA 5T6FA 3A7WA 1GI0A 2BVSH 5HXFA 5LPFA 5K7RA 4TPYA 1GBLA 4BTIB 1YCPK 4AX9H 3GOVB 1UTKA 3LGUA 3RMLH 3Q3XA 3SU5A 5A8XA 1TRYA 3EQ0H 1G30B 1K1IA 4D8NA 8ESTE 1LPZB 4DVAU 1O5CB 4TYDA 3RXFA 3UNQA 4WMDA 1JXPA 2ZTZA 4A6LA 3SNDA 1NS3A 3SV9A 2AMQA 5C5OA 3TJUA 1A2CH 3OY6U 1HUTH 1HBTH 4X2YA 1SGPE 1RTFB 2CGAA 1HAIH 1AO5A 4XFQA 4ZKSU 1T8OA 4CR5A 1QRWA 2BVRH 2FOEA 5AF9H 1E34B 4TPIZ 1BMLA 3LGWA 1LHGH 5IYTA 2ZA5A 5FXLA 1QBNA 3TITA 3EA7A 4Q7XA 2ZCLP 4X1RU 1SHHB 1GCTB 1DWBH 1Q3XA 2XC5A 4AGKA 1UJ1A 4YLUA 2YNAA 2Y5FA 4JYVH 1BZXE 2ZU1A 4RN6A 3SI4H 1V2ST 2P8OC 1O39A 2P59A 3QGNB 3GY4A 1P06A 4BOHA 1TB6H 2GV7A 4YOGA 1MCVA 1HIAA 2AYWA 3ZYEA 1A1RA 1A3EH 1AD8H 2R2MB 1DX5M 1X7AC 2ODPA 1GJBB 1DUAA 2B7DH 4E06H 4OS4A 2DE8A 3SQEE 1O3PB 1C2LA 4UFFH 1ZMLA 3PV4A 3KQDA 4ISIH 3B23B 3DHKH 2PKSB 3FVFB 4K1SA 4I8GA 4D7FA 1BT7A 1GMCG 3U8TH 1ETSH 3UNSA 4B1TA 4BNRA 1F5LA 2P94A 1FNIA 2A2XH 1CBWC 3GICB 4WMEA 4ESTE 5A0CA 3MH6A 4FUGA 4TY6A 2AS9A 1ZOMA 3U8RH 3ZVDA 2UUKB 4JMYA 3GY5A 5E8EH 1PYTD 3PLKA 4I7YH 2P3FH 1ARBA 3K65B 2ILNA 4IN2A 1SVPA 3E1XB 1F5RA 1ELAA 1A5HA 2XTTB 2CXVA 1BHXB 1GHVH 2AGGX 3PO1C 1LHCH 1N8OC 1GI8B 4F4OC 3PM3A 4Y71A 5EODA 4X6MA 1SLUB 2FOGA 5TCCA 1UCYE 2A4QA 2RA3A 1KLTA 3Q3KA 1ZJKA 2ANYA 4HI3A 1GJ6A 1ABIH 1O3IA 1E36B 4ABGA 2AGEX 1Z1IA 3ZZCA 2ZTYA 1MU6B 2SNWA 5A0BA 5L6NH 2F9VA 4CH2B 2C3SA 1THRH 1A0JA 5C5NA 1AIXH 1CT4E 1SLVB 4MNVA 1HJAB 1LDTT 4YOJA 3AAUA 5ESBA 3RM0H 1O2XA 4WXVA 3U69H 4IC6A 2ZGBH 4NFEA 1GDUA 2ZP0H 1AI8H 3RLYH 3KHVA 1TGSZ 2ZDNA 4IS5A 4OS6A 3OU0A 2SGFE 1ELEE 1H9HE 1J17T 1NM6A 2ZFSA 3P70B 3ZVFA 1A0HB 1CA0C 3LC3A 3NXPA 1GHXH 1W0YH 1YPGH 4NIXA 3S69A 2P16A 2RDLA 3LU9B 5DP5A 2JETC 1TBQH 1BA8B 1EKBB 1NO9H 2QY0B 1TIOA 3CENA 5IDKA 1YPKH 3BV9B 3SJ8A 1ZHPA 2PSYA 4AN7A 2PHBA 3OY5U 3RXBA 1V2JT 1ELCA 2FS9A 4GCHF 5F6MA 1QHRB 3KEEA 3KGPA 2V35A 3M5MA 1LKBA 3E0NB 2Y82A 1O2OA 1W10U 1HIAB 2CHAB 1AFQB 1FY3A 1GBJA 2VGCB 1GBEA 1UTPA 7GCHF 2OLGA
chains in the Genus database with same CATH superfamily
1RRKA 3NRLA 2QF0A 4B2BA 1TYNA 1UW7A 1XKBC 1B0EA 2GJGA 1E37B 1YBWA 1OPHB 5E2OA 1HAOH 1QB6A 2BZ6H 2BVXH 5DGJA 1F5KU 1AZ8A 1W2KH 4K8BA 4F49A 2ZF0H 1RXPA 2UUYA 1PYTC 3TJNA 2CN0H 3RXGA 2FOCA 1L0ZA 2TGDA 3E0PB 5A2MH 1JMOH 1XUFA 3DA9B 4B71A 1P8VC 2VVCA 3UB0A 1KSNA 1SGIB 2RFKC 3O8BA 1XUKA 1C1MA 3SUDA 1GBFA 3PYHA 5HGGA 2FLBH 1NU9A 4GHQA 1NRPH 1AKSA 1GCTC 2BOHB 1O2JA 1NFXA 3OYPA 3RXRA 3FANA 2M5TA 2PV9B 4JZFH 1BRAA 4FU9A 1K0HA 1B7XB 5DO4H 4BXWA 1MKWK 1YCPM 1OYTH 4NA9H 3JZ1B 3SNCA 1U6QA 3F9HA 1C1VH 1ZJDA 3SU3A 4X6OA 2H5DA 2A2QH 4P00A 3DD2H 1CHGA 1GBHA 2ZC9H 4UFDH 2ZI2H 1O0DH 1C5VA 2FZZA 2H6MA 3B8JA 3LPRA 1VITF 2GVFA 2ZO3H 4DW2U 1SGFA 3BG4B 4HG6A 1GI6A 5H4IB 4ISNA 5GDSH 1AGJA 3GY6A 1DLKB 1IQHA 1SGFG 2CMYA 3AAVA 4JYUH 1DXPA 1FONA 1C1OA 3IG6B 1UCYK 3GY7A 5DP9A 3GY3A 5DJ7A 4BAMB 1KTTB 5DN6D 1DVAH 2J9NA 1KLIH 1G3EA 1UTMA 3F9FA 1O2HA 1GBCA 1SGNE 2ZDMA 1G36A 2NU3E 3TH2H 2FM2A 2J94A 3CP7A 2SGDE 3E3TA 1ELFA 4BAOB 4O3UA 1SQOA 3U9AH 1KDQA 2LPRA 1G3DA 3HATH 4IN1A 1HAVA 2KAIA 4X6PA 5E2PA 2WPJS 2WYGA 1SGCA 1XXDA 3F3BA 4AYYB 2GMTB 3F9EA 3OSYA 2ZCKP 1GL0E 2A4OA 5JPMH 2W5EA 1O3FA 1HDTH 1V2RT 2VH6A 3TIUA 5J4QA 4FUCA 4IBLH 1HJ9A 5JBCS 2O8UA 4HZHA 4FUDA 5EXLA 2BD4A 2ZECA 4AFSA 1TX7A 1UK3A 5FPTA 1DFPA 3MHWU 1BMMH 2FWWA 1EB1H 2WINI 3RXUA 3W94A 1Z71A 1SGQE 2Z9LA 3W1EA 3N7EA 1H9LB 1AWHB 2BB4A 1CSOE 3ZIAD 1P2NA 2G4UA 3AW0A 1SGDE 3TGJE 1XMNB 9ESTA 2H9EH 3BTEE 3ITIA 2FLRH 3SGAE 2QXJA 2G52A 4TT3D 3LDXH 3E16B 3U98H 1MTSA 1AVWA 3SGQE 3M7UA 1G32B 1K28D 1QB1A 4IMQA 4R0IA 1GBBA 1MKXK 4B2AA 1PPFE 1FX0B 1HRTH 4ABAA 3B9FH 4D76A 3MTYA 3GCHB 2A45B 4ACBA 4Q2KA 4ZHAA 1JIRA 3P8NA 5JB9S 3MU1A 1A46H 1DLEA 4X2VA 3S7HB 3FP7E 1O31A 2ULLA 3SU6A 1AQ7A 2VGCC 1EOLA 1E35B 2CF8H 1WAYB 5DG6A 4H6SB 1XUIA 3C27B 3T27A 2ZPRA 3UTUH 1YPHE 5C94A 3QZQA 1C5TA 1GMHF 1O2QA 5EGMA 1MQ5A 1BTHH 1N6XA 4MTBA 4LOYH 5FCKA 1GJCB 3GISB 5A8YA 1LHDH 1ZMNA 1F0TA 2SGEE 4U01A 2W3KA 1FY1A 4U32A 3VXFH 1TONA 2VBCA 1CE5A 3M3SA 4JZ1A 1C2EA 1VCWA 3O8CA 3T28A 3QX5H 2F3CE 3SU1A 2ZCHP 4ABBA 2A4GA 1P2MA 6CHAB 1QJ7B 1ELVA 4GAWA 1COWD 5JBAS 1IQNA 2XCFA 1KDQB 2FX6A 1G3BA 2GZ8A 1HAVB 4PROA 2JH6D 4ZKOU 2KAIB 1YPJH 3ZZBA 4DOQA 2HALA 1P04A 2BTCE 1S84A 1RTKA 1A0LA 4Q80A 3TK9A 3ZVCA 2THFB 1WCZA 3M61U 3FOAA 1D3TB 1AFEH 1CU1A 4ABEA 2ZFQH 3SUEA 5LH8A 1SSXA 4THNH 1P9UA 1WUNH 2Y7XA 1YPEH 1AVGH 1DITH 1ZRBA 1FAKH 1ANCA 2F91A 4MDSA 1C5LH 1L4DA 2VWMA 2SGAA 2KCAA 1UK4A 1P10A 1G3CA 2PTCE 2BQ7B 2XWBI 2BLOA 3HGPA 3BG4C 3MU5A 4IC5A 2O8WA 1C2GA 1LQDB 3SUGA 1QZ8A 1ZHMA 3MO3A 1WV7H 3OAAD 3CS0A 3AK5A 3NKKA 2L6OA 2C8ZB 3U1IB 3KF2A 1ESTA 2A7JA 3SJKA 1HV7A 2B8OH 1VJAU 3MNSA 1KYNA 2BDBA 1VCQA 1G2LA 2RCEA 4WMFA 1ZTLA 1B5GH 1HCGA 1XVMA 5E0GA 2NU1E 5F8XA 2CV3A 1TQ0B 3MNXA 4XBCA 3UWJH 3TLOA 1TNLA 4K69A 1Y5UT 4Q7YA 1LKAA 1PQ8A 4XDEA 1BTXA 2EQNA 4BTUB 1O2RA 1OWKA 2Q6FA 4NWKA 1KXEA 3PLPA 2BQWB 5DPAA 3FN8A 4OS5A 2OC8A 3LT3A 4XSKU 1C2IA 1T4VH 1LMWB 1GJAB 2BDYA 2BY5X 4ZAEA 1AE5A 4I8KA 5TJXA 2ANKH 2ODYB 2ZIQH 3RMMH 1O34A 3D65E 4FU7A 4ACAA 1D6RA 1P02A 1EAIA 1PQ7A 2Z3EA 3MH4A 3QZRA 4FUFA 4J2YB 2UWOA 4AGJA 2R3YA 3RXQA 4DT4A 1XKAC 1O3EA 3PMHB 4JK6A 5E0HA 2Z6BD 5EXNA 4LZ4B 4TSFD 1QCPA 1VITG 2BX3A 1HJ8A 1XM1A 2W7SA 1EP5A 2BXUH 1ZSJA 1C5NH 3LGVA 4I8HA 1CVWH 1PPZA 2SFAA 1E0FD 1TA6A 2G81E 3K6YA 1EJMA 1O35A 4XBDA 1T8LA 2VVVA 1GVZA 4NGAH 1AB9C 1XUJA 2BD7A 4WJG2 1L4ZA 4OS2A 3STIA 2D26C 5FHTA 2HVYB 2ZHDA 3LC5A 2EA3A 4XE4A 4H42U 1RFNA 3GDUA 4NG9H 4CR9A 1RS0A 4E05H 1KLJH 1P57B 2VINA 4Y6DA 4HFPB 4Y8ZA 1O37A 3A8BA 1TGNA 1SOZA 2K0QA 1Y3VA 2QYIA 1GL1A 4Z6AH 2ZDVH 3PV2A 5C1XA 3GCHC 2OXSA 3T29A 1S6FA 2A0QB 1W8BH 1SR5C 2QXGA 4FXGH 2AERH 5AFZH 3S7KB 1GJ9B 2A7CA 3MOCA 1C5RA 1SGEE 4K1EA 1HXEH 2FOFA 1A5GH 2HRVA 3QK1A 4BAQB 2IJD1 5EQQA 1QNJA 3TGIE 2TBSA 2XC4A 4B74A 2NWNA 2PGBB 6GCHF 3MWIU 4CHAC 2AGIX 1ANBA 4Q63A 1N1LA 2JDID 4UONA 1Z6JH 1AU8A 4BAHB 2G8TA 1O5GH 2VIPA 3MU4A 5HIZA 4AORA 2BD9A 2HWLB 2Y80A 2UWPA 3V0XA 3N99A 2HPQH 1BTPA 4MNWA 1C5ZB 2J34A 2H5CA 1D3PB 3V7TA 1BRCE 1NY22 3C1KA 2J5UA 1TNHA 3A7YA 2Z7FE 2HNTF 4YO9A 1Y8TA 4K2YA 3KIDU 1C2MA 1ABJH 1MU8B 1TA2A 1TRNA 1Z8JB 5EW1H 1DY8A 5I46H 4A1XA 2F9BH 3F0OA 1XVOA 3F1SB 1Z6EA 1V2OT 1Y3UA 1TGTA 2OQ5A 1DOJA 1GBKA 5T6DA 1WYKA 3FO8D 2H1UA 4SGBE 2BHGA 2IN2A 4CRFA 4OGYA 2ZDLA 2ZWLH 5LGOA 1GG6C 2Y6TA 4ZKRU 1SOTA 4K5ZA 4M9FA 5DP4A 3URCA 1OKXA 4ZMAH 1BIOA 2ZEBA 2IPHA 1AZZA 2R3UA 3R0FA 4GUXA 4TWWA 2ANWA 1MD8A 1FY8E 3M3VA 2CJIA 2WSSD 1M9UA 1YLNA 2FYQA 2RG3A 2TPIZ 1ACBE 1MD7A 2ALPA 1LTOA 1PQAA 1MZDA 4YOIA 1NRSH 1L1NA 4ZUHA 1TMUH 4ZXXH 1HNEE 2Q1JA 2OTVA 4JCNA 1LCYA 4INHA 1GJ8B 4RT1A 2TGPZ 1TPSA 2BDIA 2EEKA 4MNYA 1HFDA 1PQ5A 3E8LA 3GDVA 1SLWB 2FX4A 4IMZA 5BRRE 3W95A 2FXRA 2V3MA 2F9PA 3UFAA 2GGVB 1KIGH 4K8YA 2ZU5A 1TX6A 2Z9GA 3RXIA 3ZVEA 3N7DA 1RIWB 1YYY1 3FKSD 2C8XB 5EQSA 3SV2H 1UVSH 4Y8YA 4FUEA 1IQJA 3S9AA 3BN9A 1EFRD 2GKVE 4I8LA 1C1TA 1KXCA 4OS7A 4K60A 1BBRK 1VGCB 3KYFA 1SPJA 2ZGJA 3RU4D 5A09A 5DP7A 2XNIA 4ABHA 3QN7A 1ETRH 3AW1A 4X1PU 4MPWA 2GCHG 2V0BA 1SC8U 1QBVH 2BYAX 2J2UA 1A5IA 3A85A 4HGCA 1TE0A 4X6NA 3O8RA 1P3EA 3TVJB 1NBME 3OTPA 8GCHF 2OP9A 4BXSA 4CREA 1Q31A 1CGHA 2OBQA 7KMEH 3H09A 1RTLA 1ELTA 4MQAA 2QN5T 3SQHE 4D9RA 3K6ZA 3UQVA 1C5YB 1J15A 3GCTF 4OM9A 5BPEA 5JYIA 2SGPE 5AHGH 2ZGXH 5FL7D 2ZGHA 1SLXB 1JRSA 5HMAA 3QDZB 3A87A 1O3HA 1UTLM 2XYAA 2BDHA 3F2GA 2PSXA 1ZMJA 5A0AE 2QE7D 2V3OH 2ZFPH 1GHAF 1E79D 5F53A 3S9CA 3KYGA 1QJ6B 1ZLRA 1EX3A 1GHZA 1PPCE 1YP9A 1O5BB 2FOAA 3KQEA 2A5KA 1S81A 3P6ZB 4ZXYH 2VWLA 3EDXB 2BY7X 4NSVA 3HKIB 2V3HH 3TNSA 5AVDA 3GCNA 1EJNA 1CHOF 1GBDA 4I33A 1Q2WA 6LPRA 1K2I1 3PLBA 2ZHWH 3BTFE 1QFKH 4AFQA 2H2ZA 1VR1H 1JOUB 2SNVA 3RUOA 1BUIA 1GHBF 4YM9A 4AC9A 5FAHA 3WY8A 3MMGA 3VEQB 2ZU3A 2KM0A 1MTVA 1GJ4H 5F8ZA 1UVTH 1GHYH 1O2GH 3A7XA 2H9TH 1GBTA 4ISLA 3U1JB 2BY8X 3QTVH 2OBOA 4KTUA 3GCOA 3D23A 1NESE 1SB1H 4MNXA 5L2ZH 3OEED 4QT8C 3H7OA 1W12U 1LPKB 5I25A 4Q7ZA 2Q6DA 5C67A 4J1YA 1FAXA 1DE7H 3UPEA 2R0KA 4X8VH 2F4LA 2ZFFH 2LP6A 3UWIA 3F2FA 1WDIA 1QGFA 4GVUA 5EIYA 1EP6A 1SFQB 4FETA 2NU0E 3BTHE 1EPTA 2YMSB 2TGAA 3RU4T 1IHTH 4OS1A 2F83A 4GPGA 3ZZDA 1YCPH 4IW4E 1S5SA 2R0LA 3EE0B 1O3KA 3VG8A 3BTDE 3DSGA 1J9CH 4WF8A 5EG4A 1TPOA 3U8OH 4F48B 3V3MA 3A84A 4AB8A 2W3IA 2GDDA 2VU8E 1MBQA 1DUEA 3PWCA 3SHCH 2XWAA 1QL9A 1V2QT 4BAKB 3PWBA 4DIIH 1S83A 4R8TB 4ZH8A 1EQ9A 4IGDA 1O2PA 3L3TA 3O8DA 4X1QU 1UTJA 2BX4A 4LK4A 4B2CA 1J16A 1HAGE 2PKSC 4Y0YE 1MH0A 2HOBA 2IPQX 1YPHC 1DWEH 3RXJA 3MO9A 1O3CA 1ETTH 2WPMS 3D49H 3N7OA 3BTME 6GCHG 2P3UB 1BOQA 1AVXA 1FIWA 1QA0A 1C5MD 3ZYDA 1QURH 2V6NA 1GJ7B 2FOHA 2XC0A 5CHBA 3QUMP 5C20A 1MCTA 2B9LA 1QR3E 3EYDA 5DP8A 3LOXA 3OTJE 1C1RA 4X8UH 3VB5A 5ETXA 3PRDA 1TOMH 1TBZH 1PPBH 1HAPH 1ZPBA 4ABDA 4DJZB 1SQRA 2WPLS 3FP8E 1GMDF 5GCHF 1L1GA 3LGYA 5DP6A 3UOUA 4CBOA 1SFIA 4FUHA 5GJ4B 3SNEA 2JH0D 4XOJA 2YNBA 2I6QA 3RC5A 2KCYA 3OEHD 2OQUA 2YMSD 2F43B 2R2WU 1WBGB 1O5FH 1QL7A 4K1TA 2FO9A 4CRDA 1P01A 1TBRH 1WTGH 1S0QA 1EZUC 2JJ1D 2D2DA 1V6DA 2BDAA 3HPTB 1G9IE 1O2MA 1GVLA 4ZKNU 1LVBA 1HJAC 4X2XA 1INCA 1EUFA 1AMHA 2HPPH 2Z9IA 4AG2A 1GI4A 5FX6A 1MAYA 1P0SH 2QF3A 4XRNA 4YLQH 3UREA 1FJSA 3BTQE 1O2LA 1UTOA 4U30A 3RP2A 1PPEE 2VIQA 1LHEH 1W0ZU 3ESTA 4X1SU 5SGAE 2ZQ2A 2B5TB 3ZVGA 2F9OA 4XD7D 4MLFB 3PMBB 1T8MA 1WQVH 3SU0A 3SW2B 5EJLA 3PRBA 2PTNA 3FFGA 1THPB 3OX7U 3SHAH 4OGXA 3UAIC 3WWBA 2G00A 3RU4E 3CNRA 4ABIA 1EPTB 4F55A 4I31A 3S9BA 5C1UA 1PPGE 3RXKA 1F92A 3EAJA 2BMGB 2Z9KA 1MQ6A 1QRZA 3ATLA 3ZZ7A 1V3XA 2JH5D 2PW8H 4XBBA 2QXIA 2ALVA 4KGAA 1TMBH 1TWXB 3PROA 1GVKB 4D9QA 3UY9A 3M37A 1ZZZA 1DPOA 1EOJA 2CHAC 1JBUH 1AFQC 2UWLA 4X1NU 1PPHE 1YC0A 3RM2H 4X2WA 2JKHA 4KKDA 1A4WH 2GZ7A 3VB3A 2BM2A 4WY3A 3TU7H 4NZLA 4ZCNA 5C17A 3RXEA 2Q6GA 1LVMA 2A5AA 1C5PA 2VVUA 3A81A 3PV5A 1MTNB 2Y81A 1BTYA 1FN8A 2QA9E 4ABJA 1WXRA 3BEFB 1QIXB 1O3BA 1CGJE 3AVZA 3DFLA 4FUIA 1Z8RA 4NA8A 3VGCB 1P12E 1AUJA 1F0UA 1GMCF 2F9NA 4FUBA 3T2NA 3TK6A 1UTQA 1FLEE 1IQLA 1TGBA 2AMDA 3QTOH 5CMXH 2SGQE 3KQBA 1L2EA 1O2NA 3BTKE 1BQYA 3ZVAA 1O2VA 3SZEA 4O9VA 1VKYA 4A1VA 3MNBA 1YPMH 3GCTG 2ZFTA 2VIWA 2A5IA 5E0JA 1O38A 3MH7A 2PUXB 3M5LA 1THSH 3NPSA 2YMSC 1TNKA 5TCAA 1SMFE 1ZGVA 3SV7A 2VIVA 4JZEH 3FAOA 2G5NA 2VB0A 3EA8A 1GHAG 1C5QA 3LIWA 3PMJA 4YTAA 1MTWA 4GCHG 4CRCA 4MPUA 1NFWA 1K1NA 4GHTA 3HK6B 1KXBA 3OE7D 4NZQA 2BY6X 1LPGB 2QF5A 1CHOG 4RKOB 4U2WA 1LO6A 1T4UH 3VB6A 2J92A 4AYVB 1V2WT 7GCHG 3DT0H 1GI9B 5ESTE 2PUQH 1CO7E 4B75A 3DUXH 2O9QA 1G37A 5EPNA 1SGTA 1GJ5H 1O3JA 1NROH 1UVPA 1TPAE 1IQMA 2XBVA 1ZPCA 1AUTC 2XNDD 2O8TA 4DGJA 3DSOA 1NBMD 5EQRA 2W7UA 1DT2A 2BDGA 1NTPA 1GBAA 1CBWB 1C2DA 4B6EA 4YZUA 2HVXA 3STJA 1O2TA 1MKWH 1WOFA 1O30A 3URDA 1TRMA 3ATWA 3FZDA 4UE7H 1SQTA 2C8YB 2BZAA 3FZZA 3TH4H 2XRCA 1DDJA 1NN6A 4DT7B 3PTNA 2K8IA 1SGRE 1JWTA 1TNIA 3UIRA 1K1OA 3F68H 1O36A 3ATKA 1BMAA 1XUHA 2ZGCA 4CRAA 1GI2A 3PO1B 1DY9A 1O2ZA 2GCTB 2GMTC 3ZZ6A 2NU2E 1EAWA 3NUMA 1F0SA 1UVUH 1YKTA 1N8OB 3M36A 3KL6A 4WH8A 1FZZA 4MG3A 1OP2A 2XBXA 1YPLH 1ESAA 2EY4C 3KQ5A 1TALA 1LQEA 3RXTA 3T26A 3A7TA 5CDFE 2BD5A 1EZQA 3I78A 1UCYH 3LH3A 1YY3A 2AEIH 1T7CA 3ZZAA 4ISHH 2QAAA 5PTPA 2DUCA 2DE9A 4WH6A 3QGJA 2TIOA 1NRQH 3A7ZA 3BEIB 3QWCH 4ZHLU 1BBRE 5HIYA 1P2KA 1HXFH 1RD3B 4TY7A 1A7SA 1NPMA 3GDSA 4CH8B 1V2UT 5HM9A 2OC1A 2P93A 3MO6A 1O3AA 3ZZ3A 1UO6A 3ELAH 1C2FA 1MBMA 2ZDKA 1EB2A 1HYLA 1GBIA 2Z3DA 5ABWA 3M5NA 1EPTC 2QC2A 3HGNA 2FOMB 3ZVBA 2JETB 1UTNA 2Y5GA 3RXSA 5B6OA 1TOCB 3NWUA 2GT7A 4FVDA 2ZKSA 3DSPA 5GCHG 2PFEA 2GD4B 3A7VA 1GWAA 1C1PA 1LVOA 2A7HA 3SOSA 5KECA 1CQQA 1SKYE 1C1NA 3G01A 4Y7BA 2ZPQA 1Y5BT 2ZHFH 2G55A 4ISOA 1EAUA 5KGOA 3ATIA 2FPZA 2XBYA 4B6FA 1MTNC 1QL8A 5G4BA 1DANH 1C5XB 1QBOA 3MH5A 5GNDA 3BTTE 2AHME 1XX9A 1HLTH 1C2KA 4LXBH 4KP0A 2VIDA 3VGCC 5LPRA 2ZU4A 5HKKD 1O5AB 4UFEH 2PGQB 1UVOA 4E7NA 2FMJA 2HLDD 2WPKS 3SBKA 2ZHQH 2ESTE 3ATMA 4X8TH 1P2OA 3SV6A 3I77A 1QQUA 1MKXH 1K9OE 4O97A 6CHAC 2HNTC 1Z7KA 1KXAA 2FDAA 1C5SA 3ZZ4A 1C4V2 5GPIB 1TPPA 1P9SA 2EC9H 5FPSA 4AFZA 1NFUA 1AN1E 2JIZD 3TPIZ 2LELA 2WPIS 3HK3B 1P03A 1T32A 1UHBA 4B76A 1EATA 5DK1A 4UDWH 1BTZA 4BTTB 1L1JA 2AIPA 3ZV8A 1OSSA 2K1QA 3RXPA 1YLCA 4RSPA 1V2LT 4GSOA 2CF9H 2C4FH 1NRNH 1TMTH 1V2TT 2KCPA 1P3CA 2XCNA 3UOPA 3GY8A 2GTBA 2PLXA 4AZ2B 1GMHG 3R3GB 4DURA 1O3LA 4YESB 5KEDA 3IWMA 2IOTA 1WQSA 2FYRA 2GX4A 3Q76A 2OCVB 1V2KT 1C1QA 3FP6E 3M3TA 3RC6A 2FI3E 1C2JA 1FI8A 1T31A 1HAHH 3GY2A 3HKJB 4Y79A 3T5FH 3MYWA 5EJZA 2Z3CA 1NRRH 4MVNA 3RXDA 4AG1A 2WUBA 2XXLA 1OWHA 5C0UA 3SU4A 3A8DA 3PMAB 4I8JA 1JRTA 1ELGA 2J38A 1C5OH 2HGTH 2QXHA 3SNBA 4WWYA 2GCTC 1SI5H 3P8GA 4JYTA 4NA7A 3MFJA 1O2KA 2J4IA 4H6TA 1P11E 2P95A 4NFFA 2OUAA 1O3GA 4Y8XA 1BJUA 3LJJA 1D9IA 2OINA 1FMGA 2OD3B 5L30H 2RA0A 3RDZA 4A5TS 1NU7B 2Y7ZA 3I29A 3E91A 3RMNH 1DS2E 4GLYA 1C1WH 3JZ2B 2BOKA 3D62A 4KTCA 1IQFA 1IQKA 1BMNH 1RJXB 1TFXA 1E1RD 2G5VA 2WYJA 1Z8GA 2ASUB 2ZZUH 1O2UA 5HM2A 1HAXB 1O2WA 1LVYA 2HNTE 5DP3A 1GDQA 1S0RA 1K21H 4Z0KA 3SYJA 2O8LA 2VIOA 4A7IB 5L2YH 3KCGH 3VB7A 1TNJA 2FESH 1GGDB 4NSYA 1FUJA 4X0WU 1QQ4A 5K0HA 1HB0B 4ASHA 5FBEA 1P2QA 3SORA 1KXDA 1OWDA 1ID5H 1SGYE 2QIQA 4CBNA 5EXMA 2WPHS 3A86A 2D8WA 1ORFA 1N6YA 1UHBB 3BTGE 3PB1E 2R9PA 3SZNA 1VZQH 1UMAH 5CHAB 1AY6H 3A82A 1V2VT 3SNAA 1BMFD 1O3NA 1QTFA 1S82A 2BXTH 3V12A 3BF6H 1DSTA 1FPHH 1G2MA 1Y3XA 5EJ1A 1O2SA 1W7GH 5F03A 2XW9A 4YT7H 3LJOA 2BD8A 1MMJN 5IK2D 2VNTA 1DSUA 1KTSB 4D7GA 3RXLA 1ARCA 3TGKE 4DG4A 2QCYA 2FTMA 1QA7A 3A89A 1NFYA 4KTSA 2D1JA 1IQGA 2C90B 2AH4X 2UUFB 3LONA 3RC4A 1VITH 3RXVA 1BCUH 1O2IA 1QY6A 5AFYH 5GWZA 1S6LA 1D3DB 4Y11E 3A8CA 2XBWA 4AFUA 3K2UA 1E38B 1K22H 3KQCA 2PKAA 1OP8A 2ZDAH 4INLA 1OX1A 1O32A 4DY7B 1BJVA 4O3TA 1YF4A 3ODDA 2B0FA 2EI6A 2NU4E 2STAE 1IAUA 1ESBA 2BLVA 1Z1JA 1FIZA 4UFGH 5T3HA 1GI5A 3GYMA 4NIWA 1FXYA 1SBWA 5FBIA 3T25A 2J95A 1ELDE 1QJ1B 1MTUA 3EGKH 1S6HA 1AE8H 2ZG0H 5GIBA 4RKJB 4RT0A 2VJ1A 1ZSKA 3RXMA 1V2PT 1GI1A 4JZDH 3WW7A 4WVPE 2STBE 5JDUB 3T62A 1XUGA 1K1PA 3BEUA 2LNCA 4HTCH 2GT8A 2O8MA 3SV8A 1GPZA 3TK5A 4TWYA 1DWCH 3F6UH 5LPEA 1ZR0A 9LPRA 4MPVA 1BTUA 2BD3A 2C8WB 1HAZB 3P17H 2H9HA 4ASUD 3OFND 2UUJB 2W26A 3EA9A 1EXFA 1HPGA 1ZGIA 1NZQH 1A3BH 3SU2A 5J4SA 2KCOA 1TQ7B 1D4PB 4KELA 1RIWC 1QB9A 3NCLA 3DCLA 1BB0B 1OXGA 3SN8A 5HYOA 1A61H 1BHXF 4BANB 5EOKA 2G4TA 1EAXA 2C93B 3SJOA 1VGCC 4NIYA 4NIVA 1TGCA 2A4RA 1OOKB 4I32A 3AASA 3M7QA 1H9IE 3LKWA 1W13U 5JBBS 1QRXA 5A8ZA 3A80A 2EI7A 1W7XH 1O3MA 1FY4A 1SQAA 4NCYA 8LPRA 3UR6A 1JIMA 1B0FA 1WTHD 1ZYOA 3UUZA 1F2SE 4DCDA 3QLPH 1XXFA 1C9TA 1YM0A 3A88A 5CE1A 4M7GA 1GBMA 1BDAA 2FIRH 1HAYB 1O3DA 1KY9A 3TJOA 4INKA 3K9XB 1BTWA 4B73A 1EASA 2TGTA 2WUCA 3NK8A 5GXPA 1H4WA 3IITA 3RXCA 1UK2A 4Y7AA 2OC7A 1BRUP 1TAWA 1F7ZA 2J98A 4FUJA 5FX5A 3WWFA 2M2AA 1MAXA 3M5OA 7ESTE 4VGCB 2BDCA 1CGIE 1O3OA 2PKAB 5EPYA 2ZTXA 1GGDC 3UQOA 2AMPA 1BBRH 1AB9B 1J8AA 3MU8A 2J97A 2VH0A 1P09A 1W0KD 3CS7A 1AKSB 2ZPSA 1Y3WA 5FPYA 1CT2E 1HGTH 1EJAA 1ZTKA 2FI4E 4ZROA 4E7RG 5CHAC 1NT1A 1K1MA 2QV1A 4JK5A 2AIQA 3M7TA 3Q3YA 2GZ9A 3RXOA 1GCDA 2G51A 1LHFH 1W3CA 7LPRA 1SHYA 2EI8A 3MNCA 2GDEH 2PR3A 3KN2A 1C2HA 1F0RA 2P3TB 1GDNA 5C2ZA 2OC0A 3ODFA 1O33A 1IOEA 1V2NT 1H8DH 3A8AA 3GS9A 2A32A 1DICA 8GCHG 2FODA 4H4FA 3QO6A 2VWOA 3A83A 4CHAB 2FP7B 1Y5AT 1S85A 5JB8S 1YLDA 5T6GA 5EW2H 4YT6H 2RDEA 1GJDB 3ZZ5A 3BTWE 1DWDH 1P05A 2WZQA 3SGBE 2OK5A 4YXWD 3UNRA 4LZ1H 4FVBA 1FN6A 1P2IA 1NC6A 3DFJA 4AOQA 5C0TA 1TLDA 5FCRA 3VFEA 2W6ID 3TJVA 3MU0A 3RXHA 2YOLA 4WXIA 3LGTA 2PWXA 3P95A 6ESTA 1ZTJA 1D3QB 2L74A 2VWNA 2ZU2A 3PTBA 4FOUC 3V13A 1C5WB 3BIVH 1ANDA 4Y10E 3VPKA 1C4U2 1GI7B 2Z9JA 1AHTH 3ZZ8A 2P8OB 2FOBA 3E90B 1C5UA 3U28C 1CT0E 1GG6B 4FU8A 4DIHH 1GHBG 5C1YA 1ZSLA 3SO3A 2GCHF 1BITA 4O03A 3SI3H 1AWFH 1FDPA 4ABFA 1ANEA 3ZV9A 1ELBA 4UD9H 1ZRKA 1O2YA 1EZSC 2FEQH 3ENSB 5DKMA 3E6PH 3M35A 3Q77A 4ZHMU 4Y76A 3MQKC 2ZFRH 4SGAE 1W11U 5B6LA 1MUEB 2FS8A 2IJOB 5EU8A 1IHSH 2ZQ1A 1K1LA 8KME2 4K3JA 3MI4A 2BD2A 2J98B 2ZHEH 1MZAA 2FTLE 1FQ3A 1P2JA 1OS8A 4AB9A 1TABE 2WV4A 1Z8IB 1TNGA 1VJ9U 4JZIA 1Y59T 1YGCH 1T8NA 4CRGA 2A31A 2QGRA 4NWLA 3H7TA 3RLWH 2I6SA 3F2HA 1K1JA 2BY9X 1H1BA 2BQ6B 2HLCA 2ZNKH 1C1UH 3VB4A 4UEHH 1CA8B 2Z94A 3ZZ9A 3SJIA 2BLQA 1DXWA 4Y0ZE 1Y3YA 1O5DH 3GYLB 2Y5HA 4A1TA 4MPXA 3TH3H 1RGQA 3RXAA 1OP0A 1OWIA 3VXEH 3L33A 1H8IH 1TX8A 1OWEA 2BLWA 3LH1A 3SJ9A 1W14U 2A1DB 3KNXA 3SUFA 3BSQA 1KXFA 2CK3D 2QF4A 3TNTA 1GI3A 1FV9A 1OYQA 1PFXC 1PJPA 3UR9A 3NZIA 1FPCH 3H5CB 5C3NA 2WV5A 1SG8B 2TRMA 1V2MT 1IQIA 2KR7A 1C9PA 1ZHRA 1EZXC 1C4Y2 1MABB 3RMOH 5DSFA 1CA0B 2GV6A 5T1VA 3P8FA 1BRBE 1OWJA 2F9UA 3BG8A 1WU1A 3BIUH 4VGCC 2AFQB 1WSSH 1IQEA 2GP9B 2FI5E 5JBTA 1GHWH 1W0JD 4CRBA 1YWUA 2XOKD 4A92A 1D6WA 1H8HD 2V7QD 4X8SH 3P92A 1GMDG 3Q00A 2ODQA 2ANMH 1VCPA 1C1SA 1FY5A 3L6PA 3P8OA 1DM4B 1O5EH 1J14A 1SL3A 1ZPZA 3F9GA 5F8TA 3LGIA 3S0NA 5T6FA 3A7WA 1GI0A 2BVSH 5HXFA 5LPFA 5K7RA 4TPYA 1GBLA 4BTIB 1YCPK 4AX9H 3GOVB 1UTKA 3LGUA 3RMLH 3Q3XA 3SU5A 5A8XA 1TRYA 3EQ0H 1G30B 1K1IA 4D8NA 8ESTE 4Q4LA 1LPZB 4DVAU 1O5CB 3EE7A 4TYDA 3RXFA 3UNQA 4WMDA 1JXPA 2ZTZA 4A6LA 3SNDA 1NS3A 2PP6A 3SV9A 2AMQA 5C5OA 3TJUA 1A2CH 3OY6U 1HUTH 1HBTH 4X2YA 1SGPE 1RTFB 2CGAA 1HAIH 1AO5A 4XFQA 4ZKSU 2KFWA 1T8OA 4CR5A 1QRWA 2BVRH 2FOEA 5AF9H 1E34B 4TPIZ 1BMLA 3LGWA 1LHGH 5IYTA 2ZA5A 5FXLA 4Z1MD 1QBNA 3TITA 3EA7A 4Q7XA 2ZCLP 4X1RU 1SHHB 1GCTB 1DWBH 1Q3XA 2XC5A 4AGKA 1UJ1A 4YLUA 2YNAA 4P02A 2Y5FA 4JYVH 1BZXE 2ZU1A 4RN6A 3SI4H 1V2ST 2P8OC 1O39A 2P59A 3F0PA 3QGNB 3GY4A 1P06A 4BOHA 1TB6H 2GV7A 4YOGA 1H8ED 1KMHB 1MCVA 1HIAA 2AYWA 3ZYEA 1A1RA 1A3EH 1AD8H 2R2MB 1DX5M 1X7AC 2ODPA 1GJBB 1DUAA 2B7DH 4E06H 4OS4A 2DE8A 3SQEE 1O3PB 1C2LA 4UFFH 1ZMLA 3PV4A 3KQDA 4ISIH 3B23B 3DHKH 2PKSB 3FVFB 4K1SA 4I8GA 4D7FA 1BT7A 1GMCG 3U8TH 1ETSH 3UNSA 4B1TA 4BNRA 1F5LA 2P94A 1FNIA 2A2XH 1CBWC 3GICB 4WMEA 4ESTE 2KZ4A 5A0CA 3MH6A 4FUGA 4TY6A 2AS9A 1ZOMA 3U8RH 3ZVDA 2UUKB 4JMYA 3GY5A 5E8EH 1PYTD 3PLKA 4I7YH 2P3FH 1ARBA 3K65B 2ILNA 4IN2A 1SVPA 3E1XB 1F5RA 1ELAA 1A5HA 2XTTB 2CXVA 1BHXB 1GHVH 2AGGX 3PO1C 1LHCH 1N8OC 1GI8B 4F4OC 3PM3A 2W6JD 4Y71A 5EODA 4X6MA 1SLUB 2FOGA 5TCCA 1UCYE 2A4QA 2RA3A 1KLTA 3Q3KA 1ZJKA 2ANYA 4I86A 4HI3A 1GJ6A 1ABIH 1O3IA 1E36B 4ABGA 2AGEX 1Z1IA 3ZZCA 2ZTYA 4RI0A 1MU6B 2SNWA 5A0BA 5L6NH 2F9VA 4CH2B 2C3SA 1THRH 1A0JA 5C5NA 1AIXH 1CT4E 1SLVB 4MNVA 1HJAB 1LDTT 4YOJA 3AAUA 5ESBA 2WPDD 1O2XA 4WXVA 3RM0H 3U69H 4IC6A 2ZGBH 4NFEA 1GDUA 2ZP0H 1AI8H 3RLYH 3KHVA 1TGSZ 2ZDNA 4IS5A 4OS6A 3OU0A 2SGFE 1ELEE 1H9HE 1J17T 1NM6A 2ZFSA 3P70B 3ZVFA 1A0HB 1CA0C 3LC3A 3NXPA 1GHXH 1W0YH 1YPGH 4NIXA 3S69A 2WV9A 2P16A 2RDLA 3LU9B 5DP5A 2JETC 1TBQH 1BA8B 1EKBB 1NO9H 2QY0B 2JJ2D 1TIOA 3CENA 5IDKA 1YPKH 2WHXA 1E1QD 3BV9B 3SJ8A 1ZHPA 2PSYA 4AN7A 2KX4A 2PHBA 3OY5U 3RXBA 1V2JT 1ELCA 2FS9A 4GCHF 5F6MA 1QHRB 3KEEA 3KGPA 2V35A 3M5MA 1LKBA 3E0NB 2Y82A 1O2OA 1W10U 1HIAB 2CHAB 1AFQB 1FY3A 1GBJA 2VGCB 1OHHD 1GBEA 1UTPA 7GCHF 2OLGA
chains in the Genus database with same CATH topology
1RRKA 4B2BA 2QF0A 1TYNA 1XKBC 1B0EA 1E37B 1YBWA 1OPHB 5E2OA 1HAOH 1QB6A 2BZ6H 2BVXH 5DGJA 1F5KU 1AZ8A 1W2KH 4K8BA 4F49A 2ZF0H 1RXPA 2UUYA 1PYTC 3TJNA 2CN0H 3RXGA 2FOCA 1L0ZA 2TGDA 3E0PB 5A2MH 1JMOH 1XUFA 3DA9B 4B71A 1P8VC 2VVCA 1KSNA 1SGIB 3O8BA 1XUKA 1C1MA 3SUDA 1GBFA 3PYHA 5HGGA 2FLBH 1NU9A 4GHQA 1NRPH 1AKSA 1GCTC 2BOHB 1O2JA 1NFXA 3OYPA 3RXRA 3FANA 2M5TA 2PV9B 4JZFH 1BRAA 4FU9A 1B7XB 5DO4H 4BXWA 1MKWK 1YCPM 1OYTH 4NA9H 3JZ1B 3SNCA 1U6QA 3F9HA 1C1VH 1ZJDA 3SU3A 4X6OA 2H5DA 2A2QH 3DD2H 1CHGA 1GBHA 2ZC9H 4UFDH 2ZI2H 1O0DH 1C5VA 2FZZA 2H6MA 3B8JA 3LPRA 1VITF 2GVFA 2ZO3H 4DW2U 1SGFA 3BG4B 1GI6A 5H4IB 4ISNA 5GDSH 1AGJA 3GY6A 1DLKB 1IQHA 1SGFG 2CMYA 3AAVA 4JYUH 1DXPA 1FONA 1C1OA 3IG6B 1UCYK 3GY7A 5DP9A 3GY3A 5DJ7A 4BAMB 1KTTB 1DVAH 2J9NA 1KLIH 1G3EA 1UTMA 3F9FA 1O2HA 1GBCA 1SGNE 2ZDMA 1G36A 2NU3E 3TH2H 2FM2A 2J94A 3CP7A 2SGDE 3E3TA 1ELFA 4BAOB 4O3UA 1SQOA 3U9AH 1KDQA 2LPRA 1G3DA 3HATH 4IN1A 1HAVA 2KAIA 4X6PA 5E2PA 2WPJS 2WYGA 1SGCA 1XXDA 4AYYB 2GMTB 3F9EA 3OSYA 2ZCKP 1GL0E 2A4OA 5JPMH 2W5EA 1O3FA 1HDTH 1V2RT 2VH6A 3TIUA 5J4QA 4FUCA 4IBLH 1HJ9A 5JBCS 2O8UA 4HZHA 4FUDA 5EXLA 2BD4A 2ZECA 4AFSA 1TX7A 1UK3A 5FPTA 1DFPA 3MHWU 1BMMH 2FWWA 1EB1H 2WINI 3RXUA 3W94A 1Z71A 1SGQE 2Z9LA 1H9LB 1AWHB 2BB4A 1CSOE 1P2NA 2G4UA 3AW0A 1SGDE 3TGJE 1XMNB 9ESTA 2H9EH 3BTEE 3ITIA 2FLRH 3SGAE 2QXJA 2G52A 3LDXH 3E16B 3U98H 1MTSA 1AVWA 3SGQE 3M7UA 1G32B 1K28D 1QB1A 4IMQA 4R0IA 1GBBA 1MKXK 4B2AA 1PPFE 1HRTH 4ABAA 3B9FH 4D76A 3MTYA 3GCHB 2A45B 4Q2KA 4ZHAA 1JIRA 3P8NA 5JB9S 3MU1A 1A46H 1DLEA 4X2VA 3S7HB 3FP7E 1O31A 2ULLA 3SU6A 1AQ7A 2VGCC 1EOLA 1E35B 2CF8H 1WAYB 5DG6A 4H6SB 1XUIA 3C27B 3T27A 2ZPRA 3UTUH 1YPHE 3QZQA 1C5TA 1GMHF 1O2QA 5EGMA 1MQ5A 1BTHH 1N6XA 4MTBA 4LOYH 5FCKA 1GJCB 3GISB 5A8YA 1LHDH 1ZMNA 1F0TA 2SGEE 4U01A 2W3KA 1FY1A 4U32A 3VXFH 1TONA 1CE5A 3M3SA 4JZ1A 1C2EA 1VCWA 3O8CA 3T28A 3QX5H 2F3CE 3SU1A 2ZCHP 4ABBA 2A4GA 1P2MA 6CHAB 1QJ7B 1ELVA 4GAWA 5JBAS 1IQNA 2XCFA 1KDQB 2FX6A 1G3BA 2GZ8A 1HAVB 4PROA 2JH6D 4ZKOU 2KAIB 1YPJH 3ZZBA 4DOQA 2HALA 1P04A 2BTCE 1S84A 1RTKA 1A0LA 4Q80A 3TK9A 3ZVCA 2THFB 1WCZA 3M61U 1D3TB 1AFEH 1CU1A 4ABEA 2ZFQH 3SUEA 5LH8A 1SSXA 4THNH 1P9UA 1WUNH 2Y7XA 1YPEH 1AVGH 1DITH 1ZRBA 1FAKH 1ANCA 2F91A 4MDSA 1C5LH 1L4DA 2VWMA 2SGAA 1UK4A 1P10A 1G3CA 2PTCE 2BQ7B 2XWBI 2BLOA 3HGPA 3BG4C 3MU5A 4IC5A 2O8WA 1C2GA 1LQDB 3SUGA 1ZHMA 3MO3A 1WV7H 3CS0A 3NKKA 2C8ZB 3U1IB 3KF2A 1ESTA 2A7JA 3SJKA 1HV7A 2B8OH 1VJAU 3MNSA 1KYNA 2BDBA 1VCQA 1G2LA 2RCEA 4WMFA 1ZTLA 1B5GH 1HCGA 1XVMA 5E0GA 2NU1E 5F8XA 2CV3A 1TQ0B 3MNXA 4XBCA 3UWJH 3TLOA 1TNLA 4K69A 1Y5UT 4Q7YA 1LKAA 1PQ8A 4XDEA 1BTXA 4BTUB 1O2RA 1OWKA 2Q6FA 4NWKA 1KXEA 3PLPA 2BQWB 5DPAA 4OS5A 2OC8A 3LT3A 4XSKU 1C2IA 1T4VH 1LMWB 1GJAB 2BDYA 2BY5X 4ZAEA 1AE5A 4I8KA 5TJXA 2ANKH 2ODYB 2ZIQH 3RMMH 1O34A 3D65E 4FU7A 1D6RA 1P02A 1EAIA 1PQ7A 2Z3EA 3MH4A 3QZRA 4FUFA 4J2YB 2UWOA 4AGJA 2R3YA 3RXQA 1XKAC 1O3EA 3PMHB 4JK6A 5E0HA 2Z6BD 5EXNA 4LZ4B 1QCPA 1VITG 2BX3A 1HJ8A 1XM1A 2W7SA 1EP5A 2BXUH 1ZSJA 1C5NH 3LGVA 4I8HA 1CVWH 1PPZA 2SFAA 1E0FD 1TA6A 2G81E 3K6YA 1EJMA 1O35A 4XBDA 1T8LA 2VVVA 1GVZA 4NGAH 1AB9C 1XUJA 2BD7A 4WJG2 1L4ZA 4OS2A 3STIA 2D26C 5FHTA 2ZHDA 3LC5A 2EA3A 4XE4A 4H42U 1RFNA 3GDUA 4NG9H 4CR9A 1RS0A 4E05H 1KLJH 1P57B 2VINA 4Y6DA 4HFPB 4Y8ZA 1O37A 3A8BA 1TGNA 1SOZA 1Y3VA 2QYIA 1GL1A 4Z6AH 2ZDVH 5C1XA 3GCHC 2OXSA 3T29A 1S6FA 2A0QB 1W8BH 1SR5C 2QXGA 4FXGH 2AERH 5AFZH 3S7KB 1GJ9B 2A7CA 3MOCA 1C5RA 1SGEE 4K1EA 1HXEH 2FOFA 1A5GH 2HRVA 3QK1A 4BAQB 5EQQA 1QNJA 3TGIE 2TBSA 2XC4A 4B74A 2NWNA 2PGBB 6GCHF 3MWIU 4CHAC 2AGIX 1ANBA 1N1LA 4UONA 1Z6JH 1AU8A 4BAHB 2G8TA 1O5GH 2VIPA 3MU4A 4AORA 2BD9A 2HWLB 2Y80A 2UWPA 3V0XA 2HPQH 1BTPA 4MNWA 1C5ZB 2J34A 2H5CA 1D3PB 3V7TA 1BRCE 1NY22 3C1KA 3A7YA 1TNHA 2Z7FE 2HNTF 4YO9A 1Y8TA 4K2YA 3KIDU 1C2MA 1ABJH 1MU8B 1TA2A 1TRNA 1Z8JB 5EW1H 1DY8A 5I46H 4A1XA 2F9BH 1XVOA 3F1SB 1Z6EA 2OQ5A 1V2OT 1Y3UA 1TGTA 1DOJA 1GBKA 5T6DA 1WYKA 2H1UA 4SGBE 2BHGA 2IN2A 4CRFA 4OGYA 2ZDLA 2ZWLH 5LGOA 1GG6C 2Y6TA 4ZKRU 1SOTA 4K5ZA 5DP4A 3URCA 1OKXA 4ZMAH 1BIOA 2ZEBA 2IPHA 1AZZA 2R3UA 3R0FA 4GUXA 4TWWA 2ANWA 1MD8A 1FY8E 3M3VA 2CJIA 1M9UA 2FYQA 2RG3A 2TPIZ 1ACBE 1MD7A 2ALPA 1LTOA 1PQAA 1MZDA 4YOIA 1NRSH 1L1NA 4ZUHA 1TMUH 4ZXXH 1HNEE 2Q1JA 2OTVA 4JCNA 1LCYA 4INHA 1GJ8B 2TGPZ 1TPSA 2BDIA 2EEKA 4MNYA 1HFDA 1PQ5A 3E8LA 3GDVA 1SLWB 2FX4A 4IMZA 5BRRE 3W95A 2FXRA 3UFAA 2F9PA 2GGVB 1KIGH 4K8YA 2ZU5A 1TX6A 2Z9GA 3RXIA 3ZVEA 1RIWB 1YYY1 2C8XB 5EQSA 3SV2H 1UVSH 4Y8YA 4FUEA 1IQJA 3S9AA 3BN9A 2GKVE 4I8LA 1C1TA 1KXCA 4OS7A 4K60A 1BBRK 1VGCB 1SPJA 2ZGJA 3RU4D 5A09A 5DP7A 2XNIA 4ABHA 3QN7A 1ETRH 3AW1A 4X1PU 4MPWA 2GCHG 2V0BA 1SC8U 1QBVH 2BYAX 2J2UA 1A5IA 3A85A 4HGCA 1TE0A 4X6NA 3O8RA 1P3EA 3TVJB 8GCHF 2OP9A 4BXSA 4CREA 1Q31A 1CGHA 2OBQA 7KMEH 1RTLA 1ELTA 4MQAA 2QN5T 3SQHE 4D9RA 3K6ZA 3UQVA 1C5YB 1J15A 3GCTF 5BPEA 5JYIA 2SGPE 5AHGH 2ZGXH 2ZGHA 1SLXB 1JRSA 5HMAA 3QDZB 3A87A 1O3HA 1UTLM 2XYAA 2BDHA 2PSXA 1ZMJA 5A0AE 2V3OH 2ZFPH 1GHAF 3S9CA 1QJ6B 1ZLRA 1EX3A 1GHZA 1PPCE 1YP9A 1O5BB 2FOAA 3KQEA 2A5KA 1S81A 3P6ZB 4ZXYH 2VWLA 3EDXB 2BY7X 4NSVA 3HKIB 2V3HH 3TNSA 5AVDA 3GCNA 1EJNA 1CHOF 1GBDA 4I33A 1Q2WA 6LPRA 1K2I1 3PLBA 2ZHWH 3BTFE 1QFKH 4AFQA 2H2ZA 1VR1H 1JOUB 2SNVA 3RUOA 1BUIA 1GHBF 4YM9A 5FAHA 3WY8A 3MMGA 3VEQB 2ZU3A 1MTVA 1GJ4H 5F8ZA 1UVTH 1GHYH 1O2GH 3A7XA 2H9TH 1GBTA 4ISLA 3U1JB 2BY8X 3QTVH 2OBOA 4KTUA 3GCOA 3D23A 1NESE 1SB1H 4MNXA 5L2ZH 4QT8C 3H7OA 1W12U 1LPKB 5I25A 4Q7ZA 2Q6DA 5C67A 4J1YA 1FAXA 1DE7H 3UPEA 2R0KA 4X8VH 2ZFFH 3UWIA 1QGFA 4GVUA 1EP6A 1SFQB 2NU0E 3BTHE 1EPTA 2TGAA 3RU4T 1IHTH 4OS1A 2F83A 4GPGA 3ZZDA 1YCPH 4IW4E 1S5SA 2R0LA 3EE0B 1O3KA 3BTDE 1J9CH 4WF8A 5EG4A 1TPOA 3U8OH 3V3MA 3A84A 4AB8A 2W3IA 2GDDA 2VU8E 1MBQA 1DUEA 3PWCA 3SHCH 2XWAA 1QL9A 1V2QT 4BAKB 3PWBA 4DIIH 1S83A 4R8TB 4ZH8A 1EQ9A 4IGDA 1O2PA 3L3TA 3O8DA 4X1QU 1UTJA 2BX4A 4LK4A 4B2CA 1J16A 1HAGE 2PKSC 4Y0YE 1MH0A 2HOBA 1YPHC 1DWEH 3RXJA 3MO9A 1O3CA 1ETTH 2WPMS 3D49H 3N7OA 3BTME 6GCHG 2P3UB 1BOQA 1AVXA 1FIWA 1QA0A 1C5MD 3ZYDA 1QURH 2V6NA 1GJ7B 2FOHA 2XC0A 3QUMP 5C20A 1MCTA 2B9LA 1QR3E 3EYDA 5DP8A 3LOXA 3OTJE 1C1RA 4X8UH 3VB5A 5ETXA 1TOMH 1TBZH 1PPBH 1HAPH 1ZPBA 4ABDA 4DJZB 2WPLS 3FP8E 1GMDF 5GCHF 1L1GA 3LGYA 5DP6A 3UOUA 4CBOA 1SFIA 4FUHA 5GJ4B 3SNEA 2JH0D 4XOJA 2YNBA 2I6QA 3RC5A 2OQUA 2R2WU 1WBGB 1O5FH 1QL7A 4K1TA 2FO9A 4CRDA 1P01A 1TBRH 1WTGH 1S0QA 1EZUC 2D2DA 1V6DA 2BDAA 3HPTB 1G9IE 1O2MA 1GVLA 4ZKNU 1LVBA 1HJAC 4X2XA 1INCA 1EUFA 1AMHA 2HPPH 2Z9IA 4AG2A 1GI4A 5FX6A 1MAYA 1P0SH 2QF3A 4YLQH 3UREA 1FJSA 3BTQE 1O2LA 1UTOA 4U30A 3RP2A 1PPEE 2VIQA 1LHEH 1W0ZU 3ESTA 4X1SU 5SGAE 2ZQ2A 2B5TB 3ZVGA 2F9OA 4MLFB 3PMBB 1T8MA 1WQVH 3SU0A 3SW2B 2PTNA 3FFGA 1THPB 3OX7U 3SHAH 4OGXA 2G00A 3RU4E 4ABIA 1EPTB 4I31A 3S9BA 5C1UA 1PPGE 3RXKA 1F92A 3EAJA 2BMGB 2Z9KA 1MQ6A 1QRZA 3ATLA 3ZZ7A 1V3XA 2JH5D 2PW8H 4XBBA 2QXIA 2ALVA 4KGAA 1TMBH 1TWXB 3PROA 1GVKB 4D9QA 3UY9A 3M37A 1ZZZA 1DPOA 1EOJA 2CHAC 1JBUH 1AFQC 2UWLA 4X1NU 1PPHE 1YC0A 3RM2H 4X2WA 2JKHA 4KKDA 1A4WH 2GZ7A 3VB3A 2BM2A 4WY3A 3TU7H 4NZLA 3RXEA 2Q6GA 1LVMA 2A5AA 1C5PA 2VVUA 3A81A 1MTNB 2Y81A 1BTYA 1FN8A 2QA9E 4ABJA 3BEFB 1QIXB 1O3BA 1CGJE 3AVZA 3DFLA 4FUIA 1Z8RA 4NA8A 3VGCB 1P12E 1AUJA 1F0UA 1GMCF 2F9NA 4FUBA 3T2NA 3TK6A 1UTQA 1FLEE 1IQLA 1TGBA 2AMDA 3QTOH 5CMXH 2SGQE 3KQBA 1L2EA 1O2NA 3BTKE 1BQYA 3ZVAA 1O2VA 4O9VA 4A1VA 3MNBA 1YPMH 3GCTG 2ZFTA 2VIWA 2A5IA 5E0JA 1O38A 3MH7A 2PUXB 3M5LA 1THSH 3NPSA 1TNKA 5TCAA 1SMFE 1ZGVA 3SV7A 2VIVA 4JZEH 3FAOA 2G5NA 2VB0A 3EA8A 1GHAG 1C5QA 3LIWA 3PMJA 4YTAA 1MTWA 4GCHG 4CRCA 4MPUA 1NFWA 1K1NA 4GHTA 3HK6B 1KXBA 4NZQA 2BY6X 1LPGB 1CHOG 4RKOB 4U2WA 1LO6A 1T4UH 3VB6A 2J92A 4AYVB 1V2WT 7GCHG 3DT0H 1GI9B 5ESTE 2PUQH 1CO7E 4B75A 3DUXH 2O9QA 1G37A 5EPNA 1SGTA 1GJ5H 1O3JA 1NROH 1UVPA 1TPAE 1IQMA 2XBVA 1ZPCA 1AUTC 2O8TA 4DGJA 5EQRA 2W7UA 1DT2A 2BDGA 1NTPA 1GBAA 1CBWB 1C2DA 4YZUA 2HVXA 3STJA 1O2TA 1MKWH 1WOFA 1O30A 3URDA 1TRMA 3ATWA