1UVOA

Structure of the complex of porcine pancreatic elastase in complex with cadmium refined at 1.85 a resolution (crystal a)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ELASTASE 1
publication title On the Influence of the Incident Photon Energy on the Radiation Damage in Crystalline Biological Samples
pubmed doi rcsb
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uvoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uvoA01
2O8MA 3UIRA 1SOTA 2FIRH 5A09A 3K9XB 1Y5AT 1KTSB 1LKAA 2TGPZ 2XNIA 3Q76A 4K1EA 4ZKRU 1GI1A 3QUMP 1BRUP 3LGVA 2XWAA 1HB0B 3RXVA 1E36B 3O8CA 4MPUA 2VIOA 3C1KA 2OC0A 4J2YB 1BTPA 2OBOA 4ZHLU 1C1SA 2BQ6B 3U9AH 4H42U 4Y8ZA 1J15A 2H6MA 1N8OB 1O2MA 4B2BA 1O2TA 1EPTA 1RS0A 3ATMA 3LGIA 3RC4A 4ZMAH 2ZF0H 1MH0A 1W10U 1AB9B 1H9IE 1GJ5H 3RXOA 3OX7U 1UCYE 1ZJDA 4XBDA 4I8KA 3KHVA 1T8NA 5EPNA 2SGFE 3TPIZ 3CP7A 3A7ZA 5GCHG 2GD4B 2B8OH 3P8FA 1IQEA 1FNIA 1A0HB 4XDEA 1ELEE 1LHGH 2PUQH 1PYTC 1SGCA 4I8LA 1Z8JB 3GCNA 3GY7A 1K1MA 1C2EA 4D9QA 2PTCE 2VNTA 1C2GA 3Q77A 1NN6A 1THRH 2Y6TA 4D9RA 1C9TA 4CRDA 3GY3A 2BD7A 1HLTH 1O34A 2BOKA 3RXPA 1AFQC 1DWDH 4CHAB 2C8ZB 1O31A 5EXLA 2ZGCA 5DP5A 3UTUH 2V3OH 1SGRE 9ESTA 1C5MD 1HAXB 3MNSA 5C20A 5JYIA 1G30B 3UR6A 1G32B 3VXFH 2VVUA 2UWPA 4NWKA 1F7ZA 3SU2A 1EZQA 3T25A 1O3PB 1C5VA 1GDQA 4YLUA 2ANKH 3W94A 1T4VH 2G00A 1V2MT 1VZQH 3EDXB 1F0UA 3LGTA 2A4QA 5FCRA 3I78A 1YPEH 4MTBA 4AYVB 3K2UA 1Z7KA 3HKIB 2VU8E 1KXAA 2BDGA 3BG4C 1MKXK 1UTJA 1D6RA 1JOUB 1SQAA 3L3TA 3EQ0H 1GG6C 1IAUA 2ZIQH 1BMMH 1AWFH 1WAYB 1QRZA 4FUHA 2G5VA 1O2ZA 2BTCE 1GHVH 1ZTKA 4ABAA 3FAOA 1QQUA 1ARBA 1HXEH 5EG4A 2PFEA 5EQQA 1BTUA 1GBKA 4LZ4B 5GIBA 1NZQH 1A0JA 5EXNA 3TIUA 3A88A 2FOHA 3U1JB 1QQ4A 1C1VH 1P09A 1HAIH 3LKWA 1QL9A 1HJAB 1YGCH 1DFPA 4BAKB 4X8SH 2DUCA 3RXLA 1QBNA 5AF9H 2ZP0H 4CH2B 4U32A 1C1TA 2RG3A 2EI6A 1TLDA 2IPHA 3RMNH 1O2QA 3SV9A 1GVKB 2BVXH 4B2CA 4K1TA 5EPYA 1E34B 2FMJA 1C1PA 3S7KB 4Y76A 1XM1A 2AIQA 4TY6A 4VGCC 5K0HA 1DDJA 2OC7A 1AUTC 1UTKA 3BV9B 1O5DH 3F1SB 2ZFQH 6CHAC 4MPXA 2BDYA 1OP2A 1FN8A 1XMNB 3BG8A 1NPMA 4B2AA 2V6NA 5I25A 2BVRH 1GI3A 4NCYA 1L2EA 5E8EH 1FUJA 2STBE 1PQ7A 4X6MA 4A1TA 4GCHG 4TPYA 3GCOA 1H8IH 1EPTC 3AVZA 2OC1A 1QJ6B 5FHTA 5EQSA 3A83A 4E05H 1BOQA 1AQ7A 2C90B 1EASA 2VIDA 3A7TA 3V3MA 1V2ST 1P9UA 1UVOA 3D49H 1ETTH 3OU0A 4YM9A 3RUOA 1GBAA 3NCLA 3ODFA 1P03A 4NSYA 5L2ZH 5DKMA 3LH1A 1O2JA 4I8GA 4OS5A 1ESAA 1MZAA 1S0QA 2OBQA 5DP3A 2J94A 3KQDA 1QA0A 3M7UA 3CENA 2ZHDA 5C2ZA 1EJAA 1BTWA 5ETXA 1GJDB 3DUXH 1M9UA 1TOMH 1Z1IA 4OS7A 3LU9B 4Y7AA 5HGGA 1NRNH 1OX1A 1SR5C 1V6DA 4INHA 1ZR0A 4ZROA 4ISIH 3RXDA 2GZ7A 2QGRA 1GWAA 1W13U 2UWLA 3KCGH 3VB6A 4Y0YE 1BCUH 3MNCA 3EGKH 4FUGA 3Q3KA 1LQEA 2BLWA 4NIWA 1TNJA 4TWYA 3ZZCA 3TU7H 5A0BA 1SG8B 4ASHA 3FZZA 3RLYH 1EB1H 2A5KA 1K1JA 3ZZ4A 4BAHB 1JXPA 3E16B 4ZUHA 2FXRA 1EP6A 1UMAH 3A85A 3MU4A 1S82A 3BEUA 1KY9A 1VITF 2OXSA 3F9EA 1XUHA 1BRBE 1X7AC 5SGAE 1QGFA 3M3SA 3SUFA 3AW0A 1J17T 4NGAH 8KME2 4U01A 1RJXB 1WCZA 3UNQA 5DP8A 1KDQB 3MOCA 1AVGH 4WMFA 2Z3CA 1F2SE 1L1NA 3PMHB 4F49A 2Z94A 2XCFA 4BOHA 2QXGA 8GCHF 2JKHA 2OCVB 3NPSA 2Y80A 3M7TA 5DP9A 2Q6DA 3ITIA 1S85A 1TA2A 2FI3E 3A87A 4Q80A 3BIVH 2EI8A 3T26A 1SHHB 2Z6BD 2G4UA 4MNWA 1OWHA 1CO7E 2HNTC 3KIDU 3Q3YA 1DM4B 1DSTA 3T2NA 2ZU4A 2GZ8A 4Q7XA 2NU1E 1ZTJA 1EZSC 1O0DH 1C5TA 2GP9B 3SJOA 1G2MA 4HGCA 2BOHB 1BDAA 1DX5M 1YCPM 1QJ7B 5AHGH 3ZVBA 4NA8A 3H7TA 2HVXA 1XVOA 1HJ9A 1SGQE 2WYGA 1NFUA 1WYKA 1W2KH 3BN9A 1PPFE 4X6OA 4UDWH 5T3HA 2ZEBA 1GHXH 1HXFH 1MZDA 1TIOA 1C2KA 2Y5FA 5JBCS 1SI5H 3PO1C 4NZLA 1BZXE 1QB1A 5C1XA 1NRSH 1BITA 1CGJE 1THSH 3RM0H 1P2IA 2ZU2A 1A5HA 5FX6A 7LPRA 1DANH 5HYOA 1SGYE 2OQ5A 1GJ4H 3PLPA 4JZDH 5AVDA 1VITH 3A84A 1EX3A 1ZHPA 1GI2A 1Z8IB 2EC9H 3AW1A 4X8TH 4FVBA 4GHTA 2HNTF 2H9HA 1BJUA 1EATA 1GCTC 3QWCH 2ZFFH 4XBBA 2AEIH 1HV7A 3UNRA 3KL6A 1C1WH 1D3TB 1H8DH 2TIOA 2C8YB 5A0AE 1V2PT 1HAHH 2CHAC 3A80A 3CS7A 4JZFH 2NU0E 1ZHRA 1HUTH 2VVVA 3RC6A 2FOMB 1V3XA 2H9TH 3ZYDA 4FU8A 3L33A 3SO3A 1SSXA 1CQQA 2BYAX 2QY0B 3UY9A 1Y3VA 2J2UA 2W7SA 1XUGA 2F9PA 1HAVA 4JK5A 1ANDA 3RU4E 4H6SB 5C1YA 3P70B 4Y11E 4YOGA 2BD8A 4IC5A 2WUCA 4J1YA 2PKAA 1BMAA 3MMGA 4BAOB 1IOEA 3F6UH 3RC5A 2EEKA 3G01A 2WPHS 3V12A 2KAIA 2RA3A 1G3BA 3VGCC 4K8YA 3QGJA 1FLEE 5GJ4B 3TK5A 2FTLE 1C5YB 1G37A 2P3UB 1C9PA 4KELA 4JZ1A 3C27B 1QY6A 2DE9A 2Y82A 1AY6H 1SLUB 3GDSA 3UUZA 5A2MH 3LT3A 4NG9H 3VEQB 1UVPA 1NS3A 3BTEE 4QT8C 3RU4D 3SI4H 1YPHC 5LH8A 4ZH8A 1IHSH 1QIXB 1F5LA 4KGAA 4GUXA 2VWLA 2ZFRH 1N6YA 1UVUH 1MQ5A 4MVNA 4UE7H 1TABE 1B7XB 3RXSA 3K6ZA 3SQEE 4AGJA 1O3IA 4JZIA 2BDAA 1O5EH 1F0SA 3DFLA 1RIWC 2Y5GA 3BTHE 1SGFA 4Y0ZE 3V13A 2QF0A 1SLWB 1F5KU 4ABGA 2ODPA 2FODA 1CSOE 1O36A 2GCTC 2V35A 3UWJH 3SNDA 4X2YA 1UTNA 1YC0A 1FN6A 1DXPA 1HNEE 5F03A 3T29A 1C2FA 3VB7A 1ZPZA 5FAHA 3MTYA 2P8OB 3QTOH 1NFWA 2GT7A 4YTAA 4UFFH 1VCWA 1O3AA 7GCHF 1SQTA 1P11E 3KQEA 2VGCC 1DT2A 4ISLA 1K1IA 1SGFG 4LOYH 4FXGH 3ZZ3A 1N1LA 5JPMH 2XYAA 4Y8YA 1H9HE 3SNAA 4I8JA 1NFYA 2XBXA 3BTKE 1TA6A 3P8GA 4ESTE 1OWIA 1VJ9U 1INCA 1SQOA 2XW9A 4NA7A 1C4U2 1TBZH 4B73A 4YT7H 3MHWU 2BD9A 2QCYA 2ZDKA 5E2OA 4DJZB 2VIWA 3KN2A 3UREA 5E0JA 4CREA 2R3UA 1FY5A 1GMCF 1P0SH 3HGNA 2HWLB 3BSQA 1ESBA 2H5CA 1FY1A 4X2WA 1TONA 5IYTA 2BQWB 3BTQE 1IQNA 1O3HA 2OTVA 2ZC9H 3GCHB 2FO9A 1C5UA 3RMOH 1C5NH 2A45B 1CHOF 1LPKB 1TB6H 5LPRA 1O39A 2PKSB 3I29A 2BD3A 4KTUA 4Q7ZA 4I7YH 4PROA 5CHAB 2TPIZ 1K21H 2B5TB 4E7RG 3M7QA 1A3EH 4Y7BA 1O5CB 1FAKH 1ELVA 3UQOA 3KNXA 3E1XB 3ATWA 2NWNA 1YPKH 3OTJE 5C5NA 2ANYA 2FOBA 4OGYA 5DGJA 4CH8B 3SJKA 4LZ1H 3STIA 5L30H 4DW2U 4DIIH 4IN1A 2ZGXH 1DUAA 1P2KA 2ZPSA 2I6SA 2Q1JA 1OSSA 3H7OA 4IC6A 2K1QA 1EAWA 1T4UH 3PYHA 2SFAA 2QF3A 1YPLH 2FX6A 1MCVA 1HCGA 2NU3E 3SGQE 4UONA 3ZZ5A 1UK4A 4R8TB 1K1OA 1ANCA 1WQSA 2ODQA 1XUFA 1BTZA 1Z6EA 4FUIA 2AIPA 1UHBA 1EB2A 1SB1H 1O2UA 1BTHH 3IG6B 3Q00A 1Y59T 1ZLRA 2A4RA 3E90B 2PW8H 1MU8B 2HPQH 4Z6AH 3IWMA 1EJNA 1OWJA 3M35A 1ELTA 4MNVA 3JZ1B 1O5AB 4IMQA 5JBAS 2TGTA 1E38B 3RMMH 3U8RH 4NFFA 2BDIA 1MU6B 1UTPA 1GVLA 1W7XH 1HAOH 1O5FH 1TNIA 1CHGA 1SGNE 7ESTE 4I32A 3NXPA 3ZZBA 1O32A 4MG3A 1A46H 1LVMA 1RTLA 4ABDA 1XVMA 1VITG 1AO5A 1O2VA 3SU3A 1A5IA 2BQ7B 1PPBH 1WQVH 2XBWA 3VB5A 3SJ9A 1F92A 4A92A 4CHAC 5HM2A 1W11U 1QNJA 2ZPQA 1BUIA 2W26A 1VJAU 5E2PA 1NM6A 3TGKE 1JIRA 3SV6A 1L1GA 1QJ1B 1ZZZA 2BX4A 1KXEA 1ACBE 2VINA 2ZCHP 4X6NA 1SGTA 1O2LA 5BPEA 3ATIA 1MTNC 1QB6A 4BTIB 2FS9A 1AFQB 1F0RA 3FVFB 8GCHG 4NWLA 5L2YH 5EGMA 2C3SA 2ZPRA 1MQ6A 1PJPA 4FU7A 3TK9A 2CF9H 1K1PA 4YT6H 1V2OT 2WPJS 1BBRH 4DT7B 1T8MA 3ZVCA 2GMTB 4D7GA 1FMGA 4X2VA 1D3PB 3P95A 3RXMA 1G2LA 2SNVA 1YYY1 1YF4A 3A8DA 4FU9A 1N6XA 2AGGX 1O3OA 3STJA 4BXSA 3SW2B 1P9SA 1BBRE 1IQLA 1ZHMA 2XTTB 3MU5A 1SLVB 1DUEA 4AN7A 2FTMA 3BG4B 1C4V2 1OP8A 1XKAC 1YLCA 1GG6B 5FXLA 2D8WA 2ZDVH 2Z9JA 1AVXA 2IOTA 1ETRH 1TGNA 1Z8GA 5GWZA 2BDBA 3GY2A 3MU1A 4CR5A 1XXDA 4K60A 2HPPH 2XXLA 2F91A 3MH5A 1MMJN 3RLWH 1EZXC 1OPHB 2PHBA 3UNSA 1GJ6A 4IN2A 1CE5A 2UUFB 4IMZA 2DE8A 2QA9E 4XFQA 1FQ3A 2BD5A 4IW4E 4OS4A 1QBOA 1ZSLA 2PSYA 4JYTA 2YNBA 1OWKA 2A2XH 2V0BA 2P16A 3U8TH 3TJNA 4R0IA 1GL1A 1P2QA 3T28A 2G4TA 2ZI2H 2Y5HA 2A31A 1HAYB 4A5TS 1E0FD 3ZVGA 1GJ7B 1GMDF 1O38A 1TPAE 1O2OA 1C5RA 1PPHE 1S5SA 5GPIB 1P3CA 1ABIH 2ZHQH 4MPWA 1ELGA 4XSKU 3QZRA 1V2WT 1T7CA 2BXUH 1MD7A 8ESTE 5HXFA 3LC5A 1DLKB 1HBTH 3O8BA 1UK2A 2ZG0H 3GYLB 1O5GH 4NIXA 4WJG2 3SGBE 3LGYA 3WY8A 1QTFA 2GVFA 1DICA 1S6HA 1NRQH 3EA9A 1TGSZ 2A7CA 1TNKA 3QGNB 1GGDC 3M5LA 1IQKA 1LPZB 3CS0A 1LVOA 1P57B 4WF8A 1MBQA 1GL0E 1EPTB 1DXWA 1A7SA 2FX4A 1AKSA 1UHBB 1AU8A 2F9OA 2PV9B 2VIPA 1GJBB 4AYYB 2ZDMA 5J4QA 2AS9A 3ESTA 2YNAA 4JMYA 1CA0C 2VH6A 5DO4H 2UUKB 1Y3YA 4X8VH 1JWTA 1LVYA 4O3UA 1YM0A 1C1UH 2CF8H 2M5TA 5FPTA 3MNXA 5JBBS 2XRCA 2A1DB 3PMJA 4ABFA 2ZDAH 1GHBF 1C2MA 4B76A 4H6TA 1SGPE 1C2IA 1XUJA 3KF2A 3SNEA 1MD8A 1C1RA 2CN0H 1V2RT 3R0FA 3S9AA 4E7NA 2CXVA 5A8YA 1GJ9B 3UQVA 4I31A 1PYTD 1SOZA 3F9GA 2Z3DA 3URDA 5F8TA 2RA0A 2CGAA 1O2IA 3RDZA 2R0KA 3SV2H 1QL8A 1TGBA 2ANWA 5EODA 1SGIB 3SZNA 2GCHG 2W5EA 4BAMB 1AI8H 3RXAA 1O3EA 3M36A 1P8VC 1OWDA 3ZZAA 3GY4A 1OYQA 1E35B 1NRPH 1YP9A 4HTCH 4BNRA 1QBVH 1WOFA 1GMHF 2AGEX 3TVJB 5F8ZA 3FFGA 1O5BB 3RXJA 7GCHG 4WMEA 5HM9A 1H9LB 3LH3A 1DSUA 3SQHE 5I46H 1IQJA 1ANBA 4K3JA 3RMLH 3S0NA 4FUEA 4FUBA 1HFDA 1GI6A 1C5WB 1QHRB 1PQ8A 2AH4X 2RCEA 1G3EA 1OXGA 4O97A 1ESTA 1C2HA 1WUNH 2QC2A 3A8AA 2VVCA 3V0XA 3A8BA 5IDKA 3K6YA 3QX5H 3TH2H 1K1LA 1OWEA 4UEHH 2CV3A 2FLBH 1O3KA 3AAUA 1IQMA 1LTOA 1O3CA 4RKOB 4DCDA 3RP2A 2VIVA 1FZZA 2ZQ2A 4NFEA 2NU2E 2Z9GA 4YOIA 5JBTA 3O8DA 2AFQB 1YPMH 1GMCG 4FUCA 2A7HA 2BMGB 3F68H 2FI5E 2OP9A 1C5LH 1YLDA 4B71A 1FJSA 2ZGBH 3PMBB 2O9QA 2OUAA 3TK6A 1S84A 1FONA 3DHKH 4DG4A 4JZEH 1CHOG 1JRTA 1LCYA 1B0EA 2G52A 4AG2A 2ZO3H 4GSOA 4BTTB 1SMFE 3P6ZB 1FAXA 3MO9A 1ELFA 1PPCE 2G81E 1HYLA 8LPRA 4AFQA 1XUKA 4NIYA 2HOBA 2C4FH 2Z3EA 3BEIB 1VGCC 3PO1B 3SUEA 4YO9A 2QYIA 1UTOA 2P93A 2C8XB 3BTTE 1EP5A 2JH5D 1GBEA 1C1MA 5F6MA 4TY7A 1Z6JH 3DA9B 2UUJB 4CRAA 5GXPA 3MFJA 4LK4A 3T27A 3LONA 3UR9A 1C5XB 1V2VT 2J95A 1ANEA 1HAZB 1S6FA 4CBNA 5CMXH 1BIOA 1DPOA 4K2YA 2Q6FA 1D6WA 2BZAA 1A1RA 2HRVA 4DVAU 2TGAA 1GCTB 2ZGHA 4GLYA 4ABBA 5EW1H 1ZOMA 1GDUA 1ZJKA 4UFEH 1OOKB 4GPGA 2FI4E 2FOEA 2BY8X 2CHAB 1Z1JA 4AB8A 4AOQA 1V2QT 3E3TA 1TQ0B 1EZUC 2ZU3A 3MH4A 3FP8E 1AKSB 2ZA5A 1RTKA 2OD3B 1HPGA 1OS8A 3MO3A 1TMUH 4INKA 1K1NA 2F9NA 3TH4H 1NESE 4YESB 3LPRA 5A0CA 4B1TA 3BEFB 1J14A 2XBYA 2Z7FE 3GYMA 5A8XA 3RM2H 1DE7H 5T6DA 5FBEA 2PGBB 4OGXA 1K9OE 2BB4A 4Q7YA 4RSPA 3SOSA 1AFEH 4A7IB 1SBWA 4O9VA 3RU4T 2JETB 2GZ9A 2QXIA 3SJIA 3M5MA 4FUFA 2O8TA 3AASA 1F0TA 3FP7E 2IJOB 3UFAA 1D4PB 3A7WA 2VWMA 5LGOA 4ISHH 2ZECA 2ZU1A 3VGCB 1O3NA 1S81A 1O3DA 2BY6X 2H5DA 2FEQH 1K2I1 1S83A 3AAVA 1DITH 1GBMA 5J4SA 1AE5A 1TNLA 1MTSA 2ALPA 3A7XA 2FYQA 2NU4E 1SVPA 1UTQA 3M3VA 4K8BA 4NIVA 3SBKA 2JH0D 3RXTA 2D2DA 5JB8S 3LIWA 1ABJH 3PMAB 1BBRK 4X1NU 2VJ1A 3ODDA 2BZ6H 1PPZA 1AN1E 2GCHF 4X1PU 3S69A 3GCTF 4UFGH 3B9FH 1TOCB 1HJ8A 1BB0B 1GI9B 1ZTLA 2J34A 1WU1A 2HNTE 3M5OA 1G3DA 2ESTE 1EQ9A 3R3GB 3KQCA 4CRGA 1RIWB 4I33A 2Y7ZA 1SFIA 1MKWH 2P59A 2D26C 1L4DA 1PPGE 3RXHA 2AYWA 4ABJA 1BHXF 2PGQB 4HZHA 1C2JA 3ZVFA 2GCTB 2TGDA 1NC6A 9LPRA 1NU7B 3HATH 2TBSA 4XE4A 1BTXA 3MI4A 1QRXA 3A7YA 3ZZ8A 1C5ZB 3JZ2B 3T62A 3EE0B 1WBGB 3OY6U 6GCHF 2ZFPH 2R9PA 4ISOA 4JK6A 1A3BH 5BRRE 3M37A 5EOKA 1SGDE 3OY5U 3SU0A 1V2KT 2Z9IA 1C4Y2 2PLXA 3RXCA 2SGPE 3VFEA 4IS5A 3BTDE 4M7GA 1AWHB 1DS2E 1BQYA 1YPJH 2C8WB 1T8LA 1TALA 1GBTA 1O2SA 4UFDH 3GY5A 1QCPA 1O37A 2OC8A 1CBWC 2IN2A 2WV4A 4X1QU 2G51A 2Z9LA 2A0QB 2P94A 1CT2E 3A8CA 2A32A 3UPEA 1NT1A 3GCHC 2GV7A 4FUDA 2P3TB 4SGAE 1MAYA 3GICB 1GVZA 2R0LA 3HK6B 4WMDA 1H1BA 1GMDG 2BVSH 3RXUA 2GV6A 2PKSC 1GI4A 1ELBA 3OYPA 1C1OA 5C3NA 1TQ7B 2SGAA 1P2NA 5G4BA 1XKBC 3SU6A 2A5AA 3RXGA 2QIQA 5K7RA 3M3TA 3QTVH 4WVPE 3O8RA 2OLGA 4ZXYH 3E6PH 1UTLM 1MAXA 1GI0A 1OYTH 1Q2WA 4CBOA 3MNBA 3BTGE 4YOJA 1SC8U 2VB0A 1W0ZU 2WUBA 1TAWA 1Y8TA 1KSNA 1AD8H 1SLXB 2FZZA 3QN7A 1FPCH 7KMEH 3PTBA 1IQGA 1O2WA 1SL3A 2G5NA 4AFUA 3MU8A 1SGEE 2BLQA 3F9FA 3MU0A 4ABEA 2OQUA 1EXFA 2J4IA 1GBJA 3SHAH 1A61H 3IITA 3PV4A 1N8OC 3L6PA 4BTUB 1O3LA 2PWXA 4INLA 4SGBE 1GI7B 3GDVA 2CMYA 1HAVB 1AB9C 3NZIA 1HAGE 3W95A 4DY7B 2OINA 3T5FH 1ZRKA 4I8HA 1PQ5A 1Z71A 2BY7X 2O8UA 2VWOA 1GBCA 2BXTH 2PKAB 3BTFE 4MPVA 1W12U 5PTPA 1UCYH 2QXJA 3GOVB 1YPHE 5E0GA 3LJOA 1CGIE 2WPMS 1BA8B 3A7VA 1G3CA 2HLCA 3ZZ9A 3SUDA 1T31A 2Y81A 1P04A 2KAIB 1GBBA 1GHBG 3TJOA 4RKJB 1VCPA 1HAPH 1FPHH 4AG1A 4U2WA 4ZKOU 1BRCE 1V2UT 3ZVDA 4KP0A 1OP0A 3MYWA 3E8LA 1LDTT 3SV7A 1IQIA 1C2DA 1AZZA 1EOLA 2BY9X 1TPPA 3RXRA 1UTMA 3NUMA 5DJ7A 1GHAG 4TYDA 2FOCA 1HIAA 3ATLA 1AHTH 2BLOA 3ZV8A 5FBIA 3PB1E 5AFYH 3PWCA 1ELCA 1TGTA 2XBVA 1EAUA 5C1UA 2Y7XA 5JB9S 2PTNA 3PM3A 5DP7A 1NU9A 1WTHD 5TJXA 2SGDE 1EAXA 1J8AA 5F8XA 3SGAE 1GMHG 5DPAA 1LQDB 1V2TT 1L0ZA 3E0PB 1ZMNA 3E91A 4JYUH 3EA7A 2EA3A 1EKBB 1O35A 5EW2H 2SGEE 1O2NA 1Y3XA 3QK1A 1P01A 4ZHAA 1FDPA 2GKVE 2AERH 2V3HH 1O33A 1BTYA 3NWUA 1PFXC 1TMTH 1K22H 2O8LA 3A82A 2TRMA 1AVWA 2GMTC 1GJAB 1FV9A 1KDQA 1QB9A 2AMPA 4Y6DA 1QURH 2PUXB 1MTNB 2FOFA 4WXIA 1O3MA 1XX9A 4X8UH 3VB3A 2STAE 5FX5A 2O8WA 5ESTE 2EI7A 1AGJA 1EJMA 1GBFA 1O2KA 1O3GA 1DOJA 1PQAA 1KLJH 4FVDA 1GBDA 2WINI 2FLRH 4BANB 1PPEE 1QR3E 1YBWA 3B8JA 5FCKA 1FIZA 1IQHA 1HJAC 2F9UA 1IHTH 1MTWA 2BD2A 4JCNA 1DWCH 3D62A 3RXBA 2BHGA 3HPTB 1GBIA 2J92A 6ESTA 1GCDA 1GDNA 1V2NT 4A1VA 2F83A 3MWIU 4D76A 2B9LA 2LPRA 1FIWA 1RTFB 1C5SA 4ZAEA 4F4OC 3MH7A 1KXCA 2ZFTA 3D65E 1VCQA 3HKJB 2G55A 1BJVA 4KKDA 3RXQA 1JRSA 2F9BH 2XC5A 3QLPH 3SORA 1CU1A 3BF6H 2R3YA 1OKXA 4YLQH 1SFQB 1O2PA 4IGDA 5FPSA 3PROA 4K5ZA 3F9HA 1MUEB 3PLBA 1RFNA 5TCAA 2H9EH 2BX3A 4X0WU 3LGUA 1KXBA 3S9BA 1S0RA 4VGCB 3UWIA 4BAQB 1A4WH 1P2JA 3S7HB 5TCCA 6CHAB 1BRAA 1TBRH 1HRTH 1TMBH 4KTCA 2ZFSA 2GT8A 1YCPH 3RXFA 1GBHA 3U8OH 1P12E 2VIQA 2BLVA 1WSSH 3P8NA 4HFPB 2ZHEH 1TWXB 3SU4A 1WV7H 4ABHA 1O2YA 1ID5H 1D3DB 2ZQ1A 1LHDH 3PLKA 2G8TA 1A0LA 3MH6A 2ZGJA 1EUFA 2ZCLP 5JDUB 1GGDB 2WYJA 1NROH 2VWNA 4ZXXH 4Y71A 4YZUA 1AMHA 3ENSB 2LNCA 2BDCA 1ELAA 1GI8B 1ZPBA 2AMQA 5DG6A 1QA7A 4LXBH 2Z9KA 2P95A 1E37B 1TX6A 3ATKA 1EOJA 1Y3UA 2ULLA 1C5QA 1L4ZA 2D1JA 4MQAA 1FY4A 5ESBA 3V7TA 2ZTZA 3GISB 2GDEH 4DIHH 5C5OA 1CA0B 3KEEA 1TGCA 2FOGA 3NK8A 4GAWA 3EYDA 1HIAB 1BMNH 2ZZUH 5GCHF 3P17H 2ZKSA 2A7JA 1GHAF 4WH8A 4CR9A 1ZRBA 1BMLA 1ZGVA 2QAAA 4ABIA 1V2LT 2XC4A 3TGIE 2UWOA 1TRMA 3PTNA 4Y10E 3GCTG 1LVBA 4WH6A 1P06A 3BTME 1TNGA 5A8ZA 1MKWK 1FI8A 1F5RA 4Z0KA 4CRCA 3A89A 5EXMA 1G9IE 1XUIA 3VPKA 1YPGH 4NSVA 1RRKA 4AFZA 2WPIS 1CGHA 1C5OH 2BY5X 2QV1A 1L1JA 2ZNKH 2THFB 3NKKA 4FUJA 3GY8A 3LOXA 1O2RA 3I77A 1GHZA 3P92A 2ZDLA 3QZQA 2R2MB 4K1SA 4U30A 2QN5T 5DP4A 4MLFB 3RXEA 1J9CH 5AFZH 6GCHG 1LPGB 1DVAH 1Q31A 1DWBH 1B5GH 3SV8A 1C5PA 5DP6A 3TGJE 1TE0A 1O2HA 1TPSA 1LMWB 1TPOA 2FDAA 5H4IB 2CJIA 2F3CE 1Z8RA 1KLTA 1W0YH 2GGVB 3U69H 3SNCA 1LHFH 2ZHWH 3GDUA 3P8OA 1TRYA 1IQFA 1TRNA 1KTTB 1DY8A 2H1UA 2ASUB 4XOJA 1NFXA 1TFXA 2UUYA 3H5CB 2JH6D 2PSXA 1MKXH 4KTSA 2W3IA 1TX7A 3FANA 3GY6A 2SGQE 4X1SU 4WWYA 4AORA 4IBLH 1LHCH 1O2XA 1O3FA 4JYVH 2W7UA 4AZ2B 4ZKNU 1H4WA 4H4FA 1D9IA 3ZYEA 5LPEA 1EAIA 3D23A 1U6QA 3LDXH 2FM2A 6LPRA 3QO6A 1MCTA 4MNYA 2FWWA 1LO6A 1UO6A 2A5IA 1ZYOA 2HALA 4XBCA 2A4OA 1FY8E 3UOUA 4A6LA 1KYNA 1DWEH 1QFKH 4NA9H 2A4GA 4HI3A 1O30A 1GI5A 1A2CH 1ZGIA 2XWBI 1VGCB 2QXHA 2ZWLH 4O03A 4THNH 4AB9A 1A5GH 3QDZB 5CE1A 4AGKA 3DFJA 3ZZ6A 1VR1H 4DGJA 2A2QH 5B6OA 2GDDA 4DURA 2ANMH 1UCYK 2F9VA 1THPB 1TNHA 2HGTH 3SUGA 3KQBA 4GCHF 5LPFA 1GPZA 3SI3H 1C1NA 1CA8B 1LHEH 1UVSH 1P3EA 3TJVA 1GJ8B 4D8NA 2ODYB 4WY3A 1AUJA 3DD2H 3K65B 5T6FA 4X2XA 3OSYA 2ZDNA 1Y5BT 1FXYA 3SU5A 5DK1A 1GHWH 1TX8A 3ZV9A 1HDTH 1MTVA 1ZSKA 1KXDA 2FYRA 5L6NH 2XC0A 2XCNA 4NZQA 2W3KA 4OS6A 5EQRA 4X6PA 1T32A 1P2MA 1CVWH 4K69A 4E06H 1GBLA 3TNTA 2JETC 1GJCB 1UVTH 1NRRH 4GVUA 3HK3B 5FPYA 1C2LA 2YOLA 4B75A 2I6QA 1ARCA 4AX9H 3KGPA 1TBQH 1BHXB 4ZKSU 2ZHFH 3EA8A 1V2JT 3FP6E 4Y79A 1J16A 1GHYH 1RGQA 3E0NB 4B74A 4DOQA 1NO9H 3BIUH 3ZZDA 1G36A 3LGWA 3RXIA 1AE8H 3U98H 3LC3A 4TWWA 3ZVAA 3UOPA 2SNWA 2WV5A 4OS1A 3SJ8A 1ZMJA 2BDHA 2ALVA 1LKBA 3A81A 1KXFA 3TLOA 2P8OC 3TH3H 3MO6A 1B0FA 1JMOH 1ELDE 3TJUA 4GHQA 3DT0H 3M61U 3N7OA 5T6GA 1W3CA 4MDSA 3LJJA 3HGPA 2B0FA 3ZVEA 4ISNA 3U1IB 1D3QB 2B7DH 1UJ1A 1UK3A 2BM2A 1W8BH 1RD3B 1FY3A 1P05A 1P2OA 1ZSJA 2FOAA 4UD9H 1CT0E 1NY22 3SHCH 3S9CA 1W14U 1XXFA 3TITA 2C93B 2VGCB 4OS2A 5E0HA 4TPIZ 2J38A 1O3BA 2VH0A 2H2ZA 1P10A 1K28D 4MNXA 2FESH 2RDLA 4RN6A 4ZHMU 1DY9A 1KLIH 2J9NA 3URCA 4CRBA 1AZ8A 4CRFA 1ETSH 1ZPCA 1SHYA 1KIGH 1TYNA 3A86A 4Y8XA 4D7FA 1MBMA 1Y5UT 2PR3A 4X1RU 1DLEA 3ELAH 3ZZ7A 3TNSA 4WXVA 2FPZA 2WPLS 3FZDA 1BT7A 1P02A 2FS8A 2Q6GA 1NTPA 1QRWA 1JBUH 3EAJA 2AMDA 1MTUA 3RXKA 3Q3XA 5CHAC 1Q3XA 1SPJA 4O3TA 1CBWB 1W7GH 2ZCKP 2P3FH 5C67A 1CT4E 1C1QA 3B23B 1QL7A 1YCPK 2GTBA 3BTWE 2WPKS 3VB4A 1ZMLA 2R2WU 3SU1A 5ABWA 1O2GH 3SNBA 1O3JA 4A1XA 5EU8A 1AIXH 1YKTA 2BD4A 4BXWA 3VXEH 1HGTH 5HMAA 1JIMA 5GDSH 2FP7B 3SN8A 4Q2KA 2ZTXA 1WTGH 4AFSA 3PWBA 2ZTYA 3M5NA 2GX4A 2ZU5A 1T8OA 1ORFA 2ILNA 1RXPA 1Y3WA 2AGIX
chains in the Genus database with same CATH superfamily
2O8MA 3UIRA 1SOTA 2FIRH 5A09A 3K9XB 1Y5AT 1KTSB 1LKAA 2TGPZ 2XNIA 3Q76A 4K1EA 4ZKRU 1GI1A 3QUMP 1BRUP 3LGVA 2XWAA 1HB0B 2RFKC 3RXVA 1E36B 3O8CA 4MPUA 2VIOA 3C1KA 2OC0A 4J2YB 1BTPA 2OBOA 4ZHLU 1C1SA 2BQ6B 3U9AH 4H42U 4Y8ZA 1J15A 2H6MA 1N8OB 1O2MA 4B2BA 1O2TA 1EPTA 1RS0A 5EJ1A 3ATMA 3LGIA 3RC4A 4ZMAH 2ZF0H 1MH0A 1W10U 1AB9B 3PRDA 1H9IE 1GJ5H 3RXOA 3OX7U 1UCYE 1ZJDA 4XBDA 4I8KA 3KHVA 1T8NA 5EPNA 2SGFE 3TPIZ 3CP7A 3A7ZA 5GCHG 5GNDA 2GD4B 2B8OH 3P8FA 1IQEA 1FNIA 1A0HB 4XDEA 1ELEE 1LHGH 2PUQH 1PYTC 1SGCA 2RDEA 4I8LA 1Z8JB 3GCNA 3GY7A 1K1MA 1C2EA 4D9QA 2PTCE 2VNTA 1C2GA 3Q77A 4YXWD 1NN6A 1THRH 2Y6TA 4D9RA 1C9TA 4CRDA 3GY3A 2BD7A 1HLTH 1O34A 2BOKA 3RXPA 1AFQC 1DWDH 4CHAB 2C8ZB 1O31A 5EXLA 2K8IA 2ZGCA 5DP5A 3UTUH 2V3OH 1SGRE 9ESTA 1C5MD 1HAXB 3MNSA 5C20A 5JYIA 1G30B 3UR6A 1G32B 3VXFH 2VVUA 2UWPA 4NWKA 1F7ZA 3SU2A 1EZQA 3T25A 1O3PB 1C5VA 2XNDD 1GDQA 4YLUA 2ANKH 3W94A 1T4VH 2G00A 1V2MT 1VZQH 3EDXB 1F0UA 2J98A 3LGTA 2A4QA 5FCRA 3I78A 1YPEH 3GS9A 4MTBA 4AYVB 3K2UA 1Z7KA 3HKIB 2VU8E 1KXAA 2KCYA 2BDGA 2GJGA 3BG4C 1MKXK 1UTJA 1D6RA 1JOUB 1SQAA 3L3TA 3EQ0H 1GG6C 1IAUA 2ZIQH 1BMMH 1AWFH 1WAYB 1QRZA 4FUHA 2G5VA 1O2ZA 2BTCE 1GHVH 1ZTKA 1YWUA 4ABAA 3FAOA 1QQUA 1ARBA 1HXEH 5EG4A 2PFEA 5EQQA 1BTUA 1GBKA 4LZ4B 5GIBA 1NZQH 1A0JA 5EXNA 4F55A 3TIUA 3A88A 2FOHA 3U1JB 1QQ4A 1C1VH 1P09A 1HAIH 3LKWA 1QL9A 1HJAB 1YGCH 1DFPA 4BAKB 4X8SH 2DUCA 3RXLA 1QBNA 5AF9H 2ZP0H 4CH2B 4U32A 1C1TA 2RG3A 2EI6A 1TLDA 2IPHA 3RMNH 1O2QA 3SV9A 1GVKB 2BVXH 1COWD 4B2CA 4K1TA 5EPYA 1E34B 2FMJA 1C1PA 3S7KB 4Y76A 1XM1A 2AIQA 4TY6A 4VGCC 5K0HA 1DDJA 2OC7A 1AUTC 1UTKA 3BV9B 1O5DH 3F1SB 2ZFQH 6CHAC 4MPXA 2BDYA 1OP2A 1FN8A 1XMNB 3BG8A 1NPMA 4B2AA 2V6NA 5I25A 2BVRH 1GI3A 4NCYA 1L2EA 5E8EH 1FUJA 2STBE 1PQ7A 4X6MA 4A1TA 4GCHG 4TPYA 3GCOA 1H8IH 1EPTC 3AVZA 2OC1A 1QJ6B 5FHTA 5EQSA 3A83A 4E05H 1BOQA 4OM9A 1AQ7A 2C90B 1EASA 2VIDA 3A7TA 3V3MA 1V2ST 1P9UA 1UVOA 3D49H 1ETTH 3OU0A 4YM9A 3RUOA 1GBAA 3NCLA 3ODFA 1P03A 4NSYA 5L2ZH 5DKMA 3LH1A 1O2JA 4I8GA 4OS5A 1ESAA 1MZAA 4ZCNA 1S0QA 2OBQA 5DP3A 2J94A 3KQDA 1QA0A 3M7UA 3CENA 2ZHDA 5C2ZA 1EJAA 1BTWA 5ETXA 1GJDB 3DUXH 1M9UA 1TOMH 1Z1IA 4OS7A 3LU9B 4Y7AA 5HGGA 1NRNH 1OX1A 1SR5C 1V6DA 4INHA 1ZR0A 4ZROA 4ISIH 3RXDA 5T1VA 2GZ7A 2QGRA 1GWAA 1W13U 2UWLA 3KCGH 4Q4LA 3VB6A 4Y0YE 1BCUH 3MNCA 1H8ED 3EGKH 4FUGA 2YMSC 3Q3KA 1LQEA 2BLWA 1YLNA 1TNJA 4NIWA 4TWYA 3ZZCA 3TU7H 2KZ4A 5A0BA 1SG8B 4ASHA 3FZZA 3RLYH 1EB1H 2A5KA 1K1JA 3ZZ4A 4BAHB 1JXPA 3E16B 4ZUHA 2FXRA 1EP6A 1UMAH 3A85A 3MU4A 1S82A 3BEUA 3N7DA 1KY9A 1VITF 2KCPA 2OXSA 3F9EA 1XUHA 1BRBE 1X7AC 5SGAE 1QGFA 3M3SA 3SUFA 3AW0A 1J17T 4NGAH 8KME2 4U01A 1RJXB 1WCZA 3UNQA 4F48B 5DP8A 1KDQB 3MOCA 1AVGH 4WMFA 2Z3CA 1F2SE 1L1NA 3PMHB 4F49A 2KCAA 2Z94A 2XCFA 4BOHA 2J98B 2QXGA 8GCHF 2JKHA 2OCVB 3NPSA 2Y80A 2WZQA 3M7TA 5DP9A 2Q6DA 3ITIA 1S85A 1TA2A 2FI3E 3A87A 4Q80A 3BIVH 2EI8A 3OE7D 3T26A 1SHHB 2L6OA 2Z6BD 2G4UA 4MNWA 1OWHA 1CO7E 2HNTC 3KIDU 3Q3YA 1DM4B 1DSTA 3T2NA 2ZU4A 2GZ8A 4Q7XA 2NU1E 1ZTJA 1EZSC 1O0DH 1C5TA 2GP9B 3SJOA 1G2MA 4HGCA 2AHME 2HVYB 1H8HD 2BOHB 1BDAA 1DX5M 1YCPM 1QJ7B 5AHGH 3UB0A 3ZVBA 4NA8A 3H7TA 2HVXA 1XVOA 1HJ9A 1SGQE 2WYGA 1NFUA 2HLDD 1WYKA 1W2KH 3BN9A 1PPFE 4X6OA 4UDWH 5T3HA 2ZEBA 1GHXH 1HXFH 1MZDA 1TIOA 1C2KA 2Y5FA 5JBCS 1SI5H 3PO1C 4NZLA 1BZXE 1QB1A 1BMFD 2JJ2D 5C1XA 1NRSH 1BITA 1CGJE 1THSH 3RM0H 1P2IA 2ZU2A 1A5HA 5FX6A 7LPRA 1DANH 5HYOA 1SGYE 2OQ5A 1GJ4H 3PLPA 4JZDH 5AVDA 1VITH 3A84A 1EX3A 1ZHPA 1GI2A 1Z8IB 2EC9H 3AW1A 4X8TH 4FVBA 4GHTA 2HNTF 2H9HA 1BJUA 1EATA 1GCTC 3QWCH 2ZFFH 4XBBA 2AEIH 1HV7A 3UNRA 3KL6A 1C1WH 1D3TB 5KEDA 1H8DH 2TIOA 2C8YB 5A0AE 1V2PT 1HAHH 2CHAC 3A80A 3CS7A 4JZFH 2NU0E 4P02A 4XD7D 1ZHRA 1HUTH 2VVVA 3DSPA 3RC6A 2FOMB 1V3XA 2H9TH 3ZYDA 4FU8A 3L33A 3SO3A 1SSXA 1CQQA 2BYAX 2QY0B 5C94A 3UY9A 3H09A 1Y3VA 2J2UA 2W7SA 1XUGA 2F9PA 1HAVA 4JK5A 1ANDA 3RU4E 4H6SB 5C1YA 3P70B 4Y11E 4YOGA 2BD8A 4IC5A 1W0JD 2WUCA 4J1YA 2PKAA 1BMAA 3MMGA 4BAOB 1IOEA 3F6UH 3RC5A 2EEKA 3G01A 2WPHS 3V12A 2KAIA 2RA3A 1G3BA 3VGCC 4K8YA 3QGJA 1FLEE 5GJ4B 3TK5A 2FTLE 1C5YB 1G37A 2P3UB 1C9PA 4KELA 5DSFA 4JZ1A 3C27B 1QY6A 2DE9A 2Y82A 1AY6H 1SLUB 1FX0B 3GDSA 3UUZA 5A2MH 3LT3A 4NG9H 3VEQB 1UVPA 1NS3A 3BTEE 4QT8C 3RU4D 3SI4H 1YPHC 5LH8A 4ZH8A 1MABB 1IHSH 1QIXB 4AC9A 1F5LA 4KGAA 4GUXA 2VWLA 2ZFRH 1N6YA 1UVUH 1MQ5A 4MVNA 4UE7H 1TABE 1B7XB 4P00A 3RXSA 3K6ZA 3SQEE 4AGJA 1O3IA 4JZIA 2BDAA 1O5EH 1F0SA 3DFLA 1RIWC 2Y5GA 3BTHE 1SGFA 4Y0ZE 3V13A 2QF0A 1SLWB 1F5KU 4ABGA 3KQ5A 1YY3A 2ODPA 2FODA 1CSOE 1O36A 2GCTC 2V35A 3UWJH 3SNDA 4X2YA 1UTNA 1YC0A 1FN6A 1DXPA 1HNEE 5F03A 3T29A 5EIYA 1C2FA 3VB7A 1ZPZA 5FAHA 3MTYA 2P8OB 3QTOH 1NFWA 3ZIAD 5HKKD 2GT7A 4YTAA 4UFFH 1VCWA 1O3AA 7GCHF 1SQTA 1P11E 3KQEA 2VGCC 1DT2A 4ISLA 1K1IA 3W1EA 1SGFG 4LOYH 4FXGH 3ZZ3A 1N1LA 5JPMH 2XYAA 4Y8YA 1H9HE 3SNAA 4I8JA 1NFYA 2XBXA 3BTKE 4XRNA 1TA6A 3P8GA 4ESTE 1OWIA 1VJ9U 1INCA 1SQOA 2XW9A 4NA7A 1C4U2 1TBZH 3F2GA 4B73A 4YT7H 3MHWU 2BD9A 2QCYA 2ZDKA 5E2OA 4DJZB 2VIWA 3KN2A 3UREA 5E0JA 4CREA 2R3UA 1FY5A 1GMCF 1P0SH 3HGNA 2HWLB 3BSQA 1ESBA 2H5CA 1FY1A 4X2WA 1TONA 5IYTA 2BQWB 3BTQE 1IQNA 2KR7A 1O3HA 2OTVA 2ZC9H 2WV9A 3AK5A 3GCHB 2FO9A 1C5UA 3RMOH 1C5NH 2A45B 1CHOF 1LPKB 1TB6H 5LPRA 1O39A 2PKSB 3I29A 2BD3A 4KTUA 4Q7ZA 4I7YH 4PROA 5CHAB 2TPIZ 1K21H 2B5TB 4E7RG 3M7QA 1A3EH 4Y7BA 1O5CB 1FAKH 1ELVA 3UQOA 3KNXA 3E1XB 3ATWA 2NWNA 1YPKH 3OTJE 5C5NA 2ANYA 2FOBA 4OGYA 5DGJA 4CH8B 3SJKA 4LZ1H 3STIA 5L30H 4DW2U 4DIIH 4IN1A 2ZGXH 1DUAA 1P2KA 2ZPSA 2I6SA 2Q1JA 1OSSA 3H7OA 4IC6A 2K1QA 1EAWA 1T4UH 3PYHA 2SFAA 2QF3A 1YPLH 2FX6A 1MCVA 1HCGA 2NU3E 3SGQE 4UONA 3ZZ5A 1UK4A 4R8TB 1K1OA 1ANCA 3CNRA 3FO8D 1WQSA 2ODQA 1XUFA 1BTZA 1Z6EA 4FUIA 2AIPA 3PV2A 2WPDD 1UHBA 1EB2A 1SB1H 1O2UA 1BTHH 3IG6B 3Q00A 1Y59T 1ZLRA 2A4RA 3DSOA 2PW8H 1MU8B 2HPQH 3E90B 3WWFA 4Z6AH 3IWMA 1EJNA 1OWJA 3M35A 1ELTA 4MNVA 3JZ1B 1O5AB 4IMQA 5JBAS 2TGTA 1E38B 3RMMH 3U8RH 4NFFA 2BDIA 1MU6B 1UTPA 1GVLA 1W7XH 1HAOH 1O5FH 1TNIA 1CHGA 1SGNE 7ESTE 4I32A 3NXPA 3ZZBA 1O32A 4MG3A 1A46H 1LVMA 1RTLA 4ABDA 1XVMA 1S6LA 1VITG 1AO5A 1O2VA 3SU3A 3OEHD 4B6FA 1A5IA 2BQ7B 1PPBH 1WQVH 2XBWA 3VB5A 3SJ9A 1F92A 4A92A 4CHAC 5HM2A 4TSFD 1W11U 2KM0A 1QNJA 2ZPQA 1BUIA 2W26A 1VJAU 5E2PA 1NM6A 3TGKE 1JIRA 3SV6A 1L1GA 1QJ1B 1ZZZA 2BX4A 1KXEA 1ACBE 2VINA 2ZCHP 4X6NA 1SGTA 1O2LA 5BPEA 3ATIA 1MTNC 1QB6A 4BTIB 2FS9A 1AFQB 1F0RA 3FVFB 8GCHG 4NWLA 5L2YH 5EGMA 2C3SA 3PV5A 2ZPRA 1MQ6A 1PJPA 4FU7A 3TK9A 2CF9H 1K1PA 4YT6H 1SQRA 1V2OT 2WPJS 1BBRH 4DT7B 1T8MA 3ZVCA 2GMTB 4D7GA 1FMGA 4X2VA 1E79D 1D3PB 3P95A 3RXMA 1G2LA 2SNVA 1YYY1 1YF4A 3A8DA 4FU9A 1N6XA 2AGGX 1O3OA 3STJA 4BXSA 3SW2B 1P9SA 1BBRE 1IQLA 1ZHMA 2XTTB 3MU5A 1SLVB 2J97A 1DUEA 4AN7A 2FTMA 1OHHD 3BG4B 1C4V2 1OP8A 1XKAC 1YLCA 1GG6B 5FXLA 2D8WA 2ZDVH 2Z9JA 1AVXA 2IOTA 1ETRH 1TGNA 1Z8GA 5GWZA 2BDBA 3GY2A 3MU1A 4CR5A 1XXDA 4K60A 2HPPH 2XXLA 2F91A 3MH5A 1MMJN 3RLWH 1EZXC 1OPHB 2PHBA 2CK3D 1GJ6A 4IN2A 3UNSA 1CE5A 2UUFB 4IMZA 3KYFA 2DE8A 2QA9E 4XFQA 1FQ3A 2BD5A 4IW4E 4OS4A 1QBOA 1ZSLA 2PSYA 4JYTA 2YNBA 1OWKA 2A2XH 2V0BA 2P16A 3U8TH 3F0OA 3TJNA 4R0IA 5EJZA 1GL1A 1P2QA 3T28A 2G4TA 2ZI2H 2Y5HA 2A31A 1HAYB 4A5TS 1E0FD 3VG8A 3ZVGA 1GJ7B 1GMDF 1O38A 1TPAE 1O2OA 1C5RA 1PPHE 1S5SA 5GPIB 1P3CA 1ABIH 2ZHQH 4MPWA 1ELGA 4XSKU 3QZRA 1V2WT 1T7CA 2BXUH 1MD7A 8ESTE 5HXFA 3LC5A 1DLKB 3F0PA 1HBTH 3O8BA 1UK2A 3EE7A 2ZG0H 3GYLB 1O5GH 3F2FA 4NIXA 4WJG2 3SZEA 3SGBE 3LGYA 3WY8A 1QTFA 1E1QD 2GVFA 2KCOA 1DICA 1S6HA 1NRQH 3EA9A 1TGSZ 2A7CA 1TNKA 3DSGA 3QGNB 1GGDC 3M5LA 1IQKA 1LPZB 3CS0A 1LVOA 1P57B 4WF8A 1MBQA 1GL0E 1EPTB 1DXWA 1A7SA 2FX4A 1AKSA 2L74A 1UHBB 1AU8A 2F9OA 2PV9B 2VIPA 1GJBB 4AYYB 2ZDMA 5J4QA 2AS9A 3MQKC 3ESTA 2YNAA 4JMYA 1CA0C 2VH6A 5DO4H 2UUKB 1Y3YA 4X8VH 1JWTA 1LVYA 4ACAA 4O3UA 1YM0A 1C1UH 2CF8H 2M5TA 5FPTA 3MNXA 5JBBS 2XRCA 2A1DB 3PMJA 4ABFA 2ZDAH 1GHBF 1C2MA 4B76A 4H6TA 1SGPE 1C2IA 1XUJA 3KF2A 3SNEA 1MD8A 1C1RA 2CN0H 1V2RT 3R0FA 1QZ8A 3S9AA 4E7NA 2CXVA 5A8YA 1GJ9B 3UQVA 4I31A 1PYTD 1SOZA 3F9GA 2Z3DA 3URDA 5F8TA 2RA0A 2CGAA 1O2IA 3RDZA 2R0KA 2YMSB 3SV2H 1QL8A 1TGBA 2ANWA 5EODA 1SGIB 3SZNA 2GCHG 2W5EA 4BAMB 1AI8H 3RXAA 1O3EA 3M36A 1P8VC 1OWDA 3ZZAA 3GY4A 1OYQA 4RT0A 1E35B 1NRPH 1YP9A 4HTCH 4BNRA 1QBVH 1WOFA 1GMHF 2AGEX 3TVJB 5F8ZA 3FFGA 1O5BB 3RXJA 7GCHG 4WMEA 5CHBA 5HM9A 1H9LB 3LH3A 1DSUA 3SQHE 5I46H 1IQJA 1ANBA 4K3JA 3RMLH 3S0NA 4FUEA 4FUBA 1HFDA 1GI6A 1C5WB 1QHRB 1PQ8A 2AH4X 2RCEA 1G3EA 1OXGA 4O97A 1KMHB 1ESTA 2F43B 3KYGA 1C2HA 1WUNH 2QC2A 3A8AA 5C0TA 2VVCA 3V0XA 3A8BA 5IDKA 3K6YA 3QX5H 3TH2H 1K1LA 1OWEA 4UEHH 2CV3A 2FLBH 1O3KA 3AAUA 1IQMA 1LTOA 1O3CA 4RKOB 4DCDA 3RP2A 2VIVA 1FZZA 2ZQ2A 4NFEA 2NU2E 2Z9GA 4YOIA 5JBTA 3O8DA 1K0HA 2AFQB 1YPMH 1GMCG 4FUCA 3SYJA 2A7HA 2BMGB 3F68H 2FI5E 2OP9A 1C5LH 1YLDA 4B71A 1UW7A 1FJSA 2ZGBH 3PMBB 2O9QA 2OUAA 3TK6A 1S84A 2EY4C 1FONA 3DHKH 4DG4A 4JZEH 1CHOG 1JRTA 1LCYA 1B0EA 2G52A 4AG2A 2ZO3H 4GSOA 4BTTB 1SMFE 3P6ZB 2QE7D 1FAXA 3MO9A 1ELFA 1PPCE 2G81E 1HYLA 8LPRA 4AFQA 1XUKA 4NIYA 2HOBA 2C4FH 2Z3EA 3BEIB 1VGCC 3PO1B 3SUEA 4YO9A 2QYIA 1UTOA 2P93A 2C8XB 3BTTE 1EP5A 2JH5D 1GBEA 1C1MA 5F6MA 4TY7A 1Z6JH 3DA9B 3F2HA 2UUJB 4CRAA 5GXPA 3MFJA 4LK4A 3T27A 3LONA 3UR9A 1C5XB 1V2VT 2J95A 1ANEA 1HAZB 1S6FA 4CBNA 5CMXH 1BIOA 1DPOA 4K2YA 2Q6FA 1D6WA 2BZAA 1A1RA 2HRVA 4DVAU 2TGAA 1GCTB 2ZGHA 5HIZA 4GLYA 4ABBA 5EW1H 1ZOMA 1GDUA 1ZJKA 4UFEH 1OOKB 4GPGA 4ASUD 2FI4E 2FOEA 2BY8X 2CHAB 1Z1JA 4AB8A 4AOQA 1E1RD 1V2QT 3E3TA 1TQ0B 1EZUC 2ZU3A 3MH4A 3FP8E 1AKSB 2ZA5A 1RTKA 2OD3B 1HPGA 1OS8A 2WHXA 3MO3A 1TMUH 4INKA 1K1NA 2F9NA 3TH4H 1NESE 4YESB 3LPRA 5A0CA 4B1TA 3BEFB 1J14A 2XBYA 2Z7FE 3GYMA 5A8XA 3RM2H 1DE7H 5T6DA 5FBEA 2PGBB 4OGXA 1K9OE 2BB4A 4Q7YA 4RSPA 3SOSA 1AFEH 4A7IB 1SBWA 4O9VA 3RU4T 2JETB 2GZ9A 2QXIA 3SJIA 3M5MA 4FUFA 2O8TA 3AASA 1F0TA 3FP7E 2IJOB 3UFAA 1D4PB 3A7WA 2VWMA 5LGOA 4ISHH 2ZECA 2ZU1A 3VGCB 1O3NA 1S81A 1O3DA 2BY6X 2H5DA 2FEQH 1K2I1 1S83A 2YMSD 1DITH 1GBMA 3AAVA 5J4SA 1AE5A 1TNLA 1MTSA 2ALPA 3A7XA 2FYQA 2NU4E 1SVPA 1UTQA 3M3VA 4K8BA 4NIVA 3SBKA 2JH0D 3N7EA 3RXTA 2D2DA 3U28C 2M2AA 5JB8S 3LIWA 1ABJH 3PMAB 1BBRK 4X1NU 2VJ1A 3ODDA 2BZ6H 1PPZA 1AN1E 2GCHF 4X1PU 3S69A 3GCTF 4UFGH 3B9FH 3FKSD 1TOCB 1HJ8A 1BB0B 1GI9B 1ZTLA 5CDFE 2J34A 1WU1A 2HNTE 3M5OA 1G3DA 2ESTE 1EQ9A 3R3GB 3KQCA 4CRGA 1RIWB 4I33A 2Y7ZA 1SFIA 1MKWH 2P59A 2D26C 1L4DA 1PPGE 3RXHA 2AYWA 4ABJA 1BHXF 2PGQB 4HZHA 2W6JD 1C2JA 3ZVFA 2GCTB 2TGDA 1NC6A 2IJD1 1NU7B 9LPRA 3HATH 2TBSA 4XE4A 1BTXA 3MI4A 3FOAA 1QRXA 3A7YA 3ZZ8A 1C5ZB 3JZ2B 3T62A 3EE0B 1WBGB 3OY6U 6GCHF 2ZFPH 2R9PA 4ISOA 4JK6A 1A3BH 5BRRE 3M37A 5EOKA 1SGDE 3OY5U 3SU0A 1V2KT 2Z9IA 1C4Y2 2PLXA 3RXCA 2SGPE 5EJLA 3VFEA 4IS5A 3BTDE 4M7GA 1AWHB 1DS2E 1BQYA 1YPJH 2C8WB 1T8LA 5C17A 1TALA 1GBTA 1O2SA 4UFDH 3GY5A 1QCPA 1O37A 2OC8A 1CBWC 2IN2A 2WV4A 4X1QU 2G51A 2Z9LA 2A0QB 2P94A 1CT2E 3A8CA 2A32A 3UPEA 1NT1A 3GCHC 2GV7A 4FUDA 2P3TB 4SGAE 1MAYA 3GICB 1GVZA 1NBME 2R0LA 3HK6B 4WMDA 1H1BA 1GMDG 2BVSH 3RXUA 2GV6A 2PKSC 1GI4A 1ELBA 3OYPA 1C1OA 5C3NA 1TQ7B 2SGAA 1P2NA 2K0QA 5G4BA 1XKBC 3SU6A 2A5AA 3RXGA 2QIQA 5K7RA 3M3TA 3QTVH 4WVPE 3O8RA 2OLGA 4ZXYH 3E6PH 1UTLM 1MAXA 1GI0A 1OYTH 3PRBA 1Q2WA 4CBOA 3MNBA 3BTGE 4YOJA 1SC8U 2VB0A 1W0ZU 2WUBA 1TAWA 1Y8TA 1KSNA 1AD8H 1SLXB 2FZZA 3QN7A 1FPCH 7KMEH 3PTBA 1IQGA 1O2WA 1SL3A 2G5NA 4AFUA 3MU8A 1SGEE 2BLQA 3F9FA 3MU0A 4ABEA 2OQUA 1EXFA 2J4IA 1GBJA 1NBMD 3SHAH 1A61H 3IITA 3PV4A 1N8OC 5KECA 3L6PA 4BTUB 1O3LA 2PWXA 4INLA 4SGBE 1GI7B 3GDVA 2CMYA 1HAVB 1AB9C 4Z1MD 3NZIA 1HAGE 3W95A 4DY7B 2OK5A 2OINA 3T5FH 1ZRKA 4I8HA 1PQ5A 1Z71A 1VKYA 2BY7X 2O8UA 2VWOA 1GBCA 2BXTH 2PKAB 3BTFE 4MPVA 1W12U 5PTPA 1UCYH 2QXJA 3GOVB 1YPHE 5E0GA 3LJOA 1CGIE 2WPMS 1BA8B 3A7VA 1G3CA 2HLCA 3ZZ9A 3SUDA 1T31A 2Y81A 1P04A 2KAIB 1GBBA 1GHBG 3TJOA 4RKJB 1VCPA 1HAPH 1FPHH 4AG1A 4U2WA 4ZKOU 1BRCE 1V2UT 3ZVDA 4KP0A 1OP0A 3MYWA 3E8LA 1LDTT 3SV7A 1IQIA 1C2DA 1AZZA 1EOLA 2BY9X 1TPPA 3RXRA 1UTMA 2J5UA 3NUMA 5DJ7A 3OEED 1GHAG 4FOUC 2FOCA 4TYDA 1HIAA 3ATLA 1AHTH 2BLOA 3ZV8A 5FBIA 3PB1E 5AFYH 3PWCA 1ELCA 1TGTA 1WXRA 2XBVA 1EAUA 5C1UA 2Y7XA 5JB9S 2PTNA 3PM3A 5DP7A 2JIZD 1NU9A 1WTHD 5TJXA 2SGDE 1EAXA 1J8AA 3WW7A 5F8XA 3SGAE 1GMHG 5DPAA 1LQDB 1V2TT 1L0ZA 3E0PB 1ZMNA 3E91A 4JYUH 3EA7A 2EA3A 1EKBB 1O35A 5EW2H 2SGEE 1O2NA 1Y3XA 3QK1A 1P01A 4ZHAA 1FDPA 2GKVE 2AERH 2V3HH 1O33A 1BTYA 3NWUA 1PFXC 1TMTH 1K22H 2O8LA 1SKYE 3A82A 2TRMA 1AVWA 2GMTC 2IPQX 1GJAB 1FV9A 1KDQA 1QB9A 2AMPA 4Y6DA 1QURH 2PUXB 1MTNB 2FOFA 4WXIA 1O3MA 1XX9A 4X8UH 3VB3A 2STAE 5FX5A 2O8WA 5ESTE 2EI7A 1AGJA 1EJMA 1GBFA 1O2KA 1O3GA 1DOJA 1PQAA 1KLJH 4FVDA 1GBDA 2WINI 2FLRH 4BANB 1PPEE 1QR3E 1YBWA 3B8JA 5FCKA 1FIZA 3N99A 1IQHA 1HJAC 2F9UA 1IHTH 1MTWA 2BD2A 4JCNA 1DWCH 3D62A 3RXBA 2BHGA 3HPTB 1GBIA 2J92A 5FL7D 6ESTA 1GCDA 1GDNA 1V2NT 4A1VA 2F83A 3MWIU 4D76A 2B9LA 2LPRA 1FIWA 1RTFB 1C5SA 4ZAEA 4F4OC 3MH7A 1KXCA 2ZFTA 3D65E 1VCQA 3HKJB 2G55A 1BJVA 4KKDA 3RXQA 4RT1A 1JRSA 2F9BH 2XC5A 3QLPH 3SORA 1CU1A 3BF6H 2R3YA 1OKXA 4YLQH 2JJ1D 1SFQB 1O2PA 4IGDA 5FPSA 3PROA 4K5ZA 3F9HA 1MUEB 3PLBA 1RFNA 5TCAA 2H9EH 2BX3A 4X0WU 3LGUA 1KXBA 3S9BA 1S0RA 2KFWA 4VGCB 3UWIA 4BAQB 4DT4A 1A4WH 1P2JA 3S7HB 5TCCA 6CHAB 1BRAA 1TBRH 1HRTH 4TT3D 1TMBH 4KTCA 2ZFSA 2GT8A 1YCPH 3RXFA 1GBHA 3U8OH 1P12E 2VIQA 2BLVA 1WSSH 3P8NA 4HFPB 2ZHEH 1TWXB 2LP6A 5B6LA 3SU4A 3NRLA 1WV7H 4ABHA 1O2YA 1ID5H 1D3DB 2ZQ1A 1LHDH 1W0KD 3PLKA 2G8TA 1A0LA 3MH6A 2ZGJA 1EUFA 2ZCLP 5JDUB 1GGDB 2WYJA 1NROH 2VWNA 4ZXXH 4Y71A 4YZUA 1AMHA 3ENSB 2LNCA 2BDCA 1ELAA 1GI8B 1ZPBA 2AMQA 5DG6A 1QA7A 4LXBH 2Z9KA 2P95A 1E37B 1TX6A 3ATKA 1EOJA 1Y3UA 2ULLA 1C5QA 1L4ZA 2D1JA 4MQAA 1FY4A 5ESBA 3V7TA 2ZTZA 3GISB 2GDEH 4DIHH 5C5OA 1CA0B 3KEEA 1TGCA 4ACBA 2FOGA 3NK8A 4GAWA 3EYDA 1HIAB 1BMNH 2ZZUH 5GCHF 3P17H 2ZKSA 2A7JA 1GHAF 4WH8A 4CR9A 1ZRBA 1BMLA 1ZGVA 2QAAA 4ABIA 1V2LT 2XC4A 3TGIE 2UWOA 1TRMA 3PTNA 4Y10E 3GCTG 1LVBA 4WH6A 1P06A 3BTME 1TNGA 5A8ZA 1MKWK 1FI8A 1F5RA 4Z0KA 4CRCA 3A89A 5EXMA 1G9IE 1XUIA 3VPKA 1YPGH 4NSVA 1RRKA 4AFZA 2WPIS 1CGHA 1C5OH 2BY5X 2QV1A 1L1JA 2ZNKH 2THFB 3NKKA 4FUJA 3GY8A 3LOXA 1O2RA 3I77A 1GHZA 3P92A 2ZDLA 3QZQA 2R2MB 4K1SA 4U30A 2QN5T 5DP4A 2WSSD 4MLFB 3RXEA 1J9CH 5AFZH 6GCHG 1LPGB 1DVAH 1Q31A 1DWBH 1B5GH 3SV8A 1C5PA 5DP6A 3TGJE 1TE0A 1O2HA 1TPSA 1LMWB 1TPOA 2FDAA 5H4IB 2CJIA 2F3CE 1Z8RA 1KLTA 1W0YH 2VBCA 2EQNA 2GGVB 3U69H 3SNCA 1LHFH 2ZHWH 3GDUA 3P8OA 1TRYA 1IQFA 1TRNA 1KTTB 1DY8A 2H1UA 2ASUB 3DCLA 4XOJA 1NFXA 1TFXA 2UUYA 3H5CB 4B6EA 2JH6D 2PSXA 1MKXH 4KTSA 2W3IA 1TX7A 3FANA 3OAAD 3GY6A 2SGQE 4X1SU 4WWYA 4AORA 4IBLH 1LHCH 1O2XA 1O3FA 4JYVH 2W7UA 4AZ2B 4ZKNU 5KGOA 1H4WA 4H4FA 1D9IA 3ZYEA 5LPEA 1EAIA 3D23A 1U6QA 3LDXH 2FM2A 6LPRA 3QO6A 1MCTA 2KX4A 2FWWA 4MNYA 1LO6A 1UO6A 2A5IA 1ZYOA 2HALA 4XBCA 2A4OA 1FY8E 3UOUA 4A6LA 1KYNA 1DWEH 1QFKH 4NA9H 2A4GA 4HI3A 1O30A 1GI5A 1A2CH 1WDIA 1ZGIA 2XWBI 1VGCB 2QXHA 2ZWLH 4O03A 4THNH 4AB9A 1A5GH 3QDZB 5CE1A 4AGKA 3DFJA 3ZZ6A 1VR1H 4DGJA 2A2QH 5B6OA 2GDDA 4DURA 2ANMH 1UCYK 2F9VA 1THPB 1TNHA 2HGTH 3SUGA 3KQBA 4GCHF 5LPFA 1GPZA 3SI3H 1C1NA 1CA8B 1LHEH 1UVSH 1P3EA 3TJVA 1GJ8B 4D8NA 1EFRD 2ODYB 4WY3A 1AUJA 3DD2H 3K65B 5T6FA 4X2XA 3OSYA 2ZDNA 1Y5BT 3F3BA 1FXYA 3SU5A 5DK1A 1GHWH 1TX8A 4I86A 3ZV9A 1HDTH 1MTVA 5C0UA 1ZSKA 1KXDA 2FYRA 5L6NH 2XC0A 2XCNA 3OTPA 4FETA 4RI0A 4NZQA 2W3KA 4OS6A 5EQRA 4X6PA 1T32A 1P2MA 1CVWH 4K69A 4E06H 1GBLA 3TNTA 5DN6D 2JETC 1GJCB 1UVTH 1NRRH 4GVUA 3HK3B 5FPYA 1C2LA 2YOLA 4M9FA 2I6QA 4B75A 2F4LA 1ARCA 4AX9H 3KGPA 1TBQH 1BHXB 4ZKSU 3UAIC 2ZHFH 3EA8A 1V2JT 3FP6E 4Y79A 1J16A 1GHYH 1RGQA 3E0NB 4B74A 4DOQA 1NO9H 3BIUH 3ZZDA 1G36A 3LGWA 3RXIA 1AE8H 3U98H 3LC3A 4TWWA 3ZVAA 5F53A 3UOPA 2W6ID 2SNWA 2WV5A 4OS1A 3SJ8A 1ZMJA 2XOKD 3OFND 2BDHA 3FN8A 2ALVA 1LKBA 3A81A 1KXFA 3TLOA 4HG6A 2P8OC 3TH3H 3MO6A 1B0FA 1JMOH 1ELDE 3TJUA 4GHQA 3DT0H 3M61U 3N7OA 5T6GA 1W3CA 5HIYA 4MDSA 3LJJA 3HGPA 2B0FA 3ZVEA 4ISNA 3U1IB 1D3QB 2B7DH 1UJ1A 1UK3A 2BM2A 1W8BH 1RD3B 1FY3A 1P05A 1P2OA 1ZSJA 2FOAA 4UD9H 1CT0E 1NY22 2LELA 3SHCH 3S9CA 1W14U 1XXFA 3TITA 2C93B 2QF4A 2JDID 2VGCB 4OS2A 5E0HA 4TPIZ 2J38A 2V7QD 1O3BA 2VH0A 2H2ZA 1P10A 1K28D 4MNXA 2FESH 2RDLA 4RN6A 4ZHMU 1DY9A 3WWBA 1KLIH 2V3MA 2J9NA 3URCA 4CRBA 1AZ8A 4CRFA 1ETSH 1ZPCA 1SHYA 1KIGH 1TYNA 3A86A 4Y8XA 4D7FA 1MBMA 1Y5UT 2PR3A 4X1RU 1DLEA 3ELAH 3ZZ7A 3TNSA 4WXVA 2FPZA 2WPLS 3FZDA 2QF5A 1BT7A 1P02A 2FS8A 2Q6GA 1NTPA 1QRWA 1JBUH 3EAJA 2AMDA 1MTUA 3RXKA 3Q3XA 5CHAC 1Q3XA 4Q63A 1SPJA 5IK2D 4O3TA 1CBWB 1W7GH 2ZCKP 2P3FH 5C67A 1CT4E 1C1QA 3B23B 1QL7A 1YCPK 2GTBA 3BTWE 2WPKS 3VB4A 1ZMLA 2R2WU 3SU1A 5ABWA 1O2GH 3SNBA 1O3JA 4A1XA 5EU8A 1AIXH 1YKTA 2BD4A 4BXWA 3VXEH 1HGTH 5HMAA 1JIMA 5GDSH 2FP7B 3SN8A 4Q2KA 2ZTXA 1WTGH 4AFSA 3PWBA 2ZTYA 3M5NA 2GX4A 2ZU5A 1T8OA 1ORFA 2ILNA 1RXPA 1Y3WA 2PP6A 2AGIX
chains in the Genus database with same CATH topology
2O8MA 3UIRA 1SOTA 2FIRH 5A09A 3K9XB 1Y5AT 1KTSB 1LKAA 2TGPZ 2XNIA 3Q76A 4K1EA 4ZKRU 1GI1A 3QUMP 1BRUP 3LGVA 2XWAA 1HB0B 3RXVA 1E36B 3O8CA 4MPUA 2VIOA 3C1KA 2OC0A 4J2YB 1BTPA 2OBOA 4ZHLU 1C1SA 2BQ6B 3U9AH 4H42U 4Y8ZA 1J15A 2H6MA 1N8OB 1O2MA 4B2BA 1O2TA 1EPTA 1RS0A 3ATMA 3LGIA 3RC4A 4ZMAH 2ZF0H 1MH0A 1W10U 1AB9B 1H9IE 1GJ5H 3RXOA 3OX7U 1UCYE 1ZJDA 4XBDA 4I8KA 3KHVA 1T8NA 5EPNA 2SGFE 3TPIZ 3CP7A 3A7ZA 5GCHG 2GD4B 2B8OH 3P8FA 1IQEA 1FNIA 1A0HB 4XDEA 1ELEE 1LHGH 2PUQH 1PYTC 1SGCA 4I8LA 1Z8JB 3GCNA 3GY7A 1K1MA 1C2EA 4D9QA 2PTCE 2VNTA 1C2GA 3Q77A 1NN6A 1THRH 2Y6TA 4D9RA 1C9TA 4CRDA 3GY3A 2BD7A 1HLTH 1O34A 2BOKA 3RXPA 1AFQC 1DWDH 4CHAB 2C8ZB 1O31A 5EXLA 2ZGCA 5DP5A 3UTUH 2V3OH 1SGRE 9ESTA 1C5MD 1HAXB 3MNSA 5C20A 5JYIA 1G30B 3UR6A 1G32B 3VXFH 2VVUA 2UWPA 4NWKA 1F7ZA 3SU2A 1EZQA 3T25A 1O3PB 1C5VA 1GDQA 4YLUA 2ANKH 3W94A 1T4VH 2G00A 1V2MT 1VZQH 3EDXB 1F0UA 3LGTA 2A4QA 5FCRA 3I78A 1YPEH 4MTBA 4AYVB 3K2UA 1Z7KA 3HKIB 2VU8E 1KXAA 2BDGA 3BG4C 1MKXK 1UTJA 1D6RA 1JOUB 1SQAA 3L3TA 3EQ0H 1GG6C 1IAUA 2ZIQH 1BMMH 1AWFH 1WAYB 1QRZA 4FUHA 2G5VA 1O2ZA 2BTCE 1GHVH 1ZTKA 4ABAA 3FAOA 1QQUA 1ARBA 1HXEH 5EG4A 2PFEA 5EQQA 1BTUA 1GBKA 4LZ4B 5GIBA 1NZQH 1A0JA 5EXNA 3TIUA 3A88A 2FOHA 3U1JB 1QQ4A 1C1VH 1P09A 1HAIH 3LKWA 1QL9A 1HJAB 1YGCH 1DFPA 4BAKB 4X8SH 2DUCA 3RXLA 1QBNA 5AF9H 2ZP0H 4CH2B 4U32A 1C1TA 2RG3A 2EI6A 1TLDA 2IPHA 3RMNH 1O2QA 3SV9A 1GVKB 2BVXH 4B2CA 4K1TA 5EPYA 1E34B 2FMJA 1C1PA 3S7KB 4Y76A 1XM1A 2AIQA 4TY6A 4VGCC 5K0HA 1DDJA 2OC7A 1AUTC 1UTKA 3BV9B 1O5DH 3F1SB 2ZFQH 6CHAC 4MPXA 2BDYA 1OP2A 1FN8A 1XMNB 3BG8A 1NPMA 4B2AA 2V6NA 5I25A 2BVRH 1GI3A 4NCYA 1L2EA 5E8EH 1FUJA 2STBE 1PQ7A 4X6MA 4A1TA 4GCHG 4TPYA 3GCOA 1H8IH 1EPTC 3AVZA 2OC1A 1QJ6B 5FHTA 5EQSA 3A83A 4E05H 1BOQA 1AQ7A 2C90B 1EASA 2VIDA 3A7TA 3V3MA 1V2ST 1P9UA 1UVOA 3D49H 1ETTH 3OU0A 4YM9A 3RUOA 1GBAA 3NCLA 3ODFA 1P03A 4NSYA 5L2ZH 5DKMA 3LH1A 1O2JA 4I8GA 4OS5A 1ESAA 1MZAA 1S0QA 2OBQA 5DP3A 2J94A 3KQDA 1QA0A 3M7UA 3CENA 2ZHDA 5C2ZA 1EJAA 1BTWA 5ETXA 1GJDB 3DUXH 1M9UA 1TOMH 1Z1IA 4OS7A 3LU9B 4Y7AA 5HGGA 1NRNH 1OX1A 1SR5C 1V6DA 4INHA 1ZR0A 4ZROA 4ISIH 3RXDA 2GZ7A 2QGRA 1GWAA 1W13U 2UWLA 3KCGH 3VB6A 4Y0YE 1BCUH 3MNCA 3EGKH 4FUGA 3Q3KA 1LQEA 2BLWA 4NIWA 1TNJA 4TWYA 3ZZCA 3TU7H 5A0BA 1SG8B 4ASHA 3FZZA 3RLYH 1EB1H 2A5KA 1K1JA 3ZZ4A 4BAHB 1JXPA 3E16B 4ZUHA 2FXRA 1EP6A 1UMAH 3A85A 3MU4A 1S82A 3BEUA 1KY9A 1VITF 2OXSA 3F9EA 1XUHA 1BRBE 1X7AC 5SGAE 1QGFA 3M3SA 3SUFA 3AW0A 1J17T 4NGAH 8KME2 4U01A 1RJXB 1WCZA 3UNQA 5DP8A 1KDQB 3MOCA 1AVGH 4WMFA 2Z3CA 1F2SE 1L1NA 3PMHB 4F49A 2Z94A 2XCFA 4BOHA 2QXGA 8GCHF 2JKHA 2OCVB 3NPSA 2Y80A 3M7TA 5DP9A 2Q6DA 3ITIA 1S85A 1TA2A 2FI3E 3A87A 4Q80A 3BIVH 2EI8A 3T26A 1SHHB 2Z6BD 2G4UA 4MNWA 1OWHA 1CO7E 2HNTC 3KIDU 3Q3YA 1DM4B 1DSTA 3T2NA 2ZU4A 2GZ8A 4Q7XA 2NU1E 1ZTJA 1EZSC 1O0DH 1C5TA 2GP9B 3SJOA 1G2MA 4HGCA 2BOHB 1BDAA 1DX5M 1YCPM 1QJ7B 5AHGH 3ZVBA 4NA8A 3H7TA 2HVXA 1XVOA 1HJ9A 1SGQE 2WYGA 1NFUA 1WYKA 1W2KH 3BN9A 1PPFE 4X6OA 4UDWH 5T3HA 2ZEBA 1GHXH 1HXFH 1MZDA 1TIOA 1C2KA 2Y5FA 5JBCS 1SI5H 3PO1C 4NZLA 1BZXE 1QB1A 5C1XA 1NRSH 1BITA 1CGJE 1THSH 3RM0H 1P2IA 2ZU2A 1A5HA 5FX6A 7LPRA 1DANH 5HYOA 1SGYE 2OQ5A 1GJ4H 3PLPA 4JZDH 5AVDA 1VITH 3A84A 1EX3A 1ZHPA 1GI2A 1Z8IB 2EC9H 3AW1A 4X8TH 4FVBA 4GHTA 2HNTF 2H9HA 1BJUA 1EATA 1GCTC 3QWCH 2ZFFH 4XBBA 2AEIH 1HV7A 3UNRA 3KL6A 1C1WH 1D3TB 1H8DH 2TIOA 2C8YB 5A0AE 1V2PT 1HAHH 2CHAC 3A80A 3CS7A 4JZFH 2NU0E 1ZHRA 1HUTH 2VVVA 3RC6A 2FOMB 1V3XA 2H9TH 3ZYDA 4FU8A 3L33A 3SO3A 1SSXA 1CQQA 2BYAX 2QY0B 3UY9A 1Y3VA 2J2UA 2W7SA 1XUGA 2F9PA 1HAVA 4JK5A 1ANDA 3RU4E 4H6SB 5C1YA 3P70B 4Y11E 4YOGA 2BD8A 4IC5A 2WUCA 4J1YA 2PKAA 1BMAA 3MMGA 4BAOB 1IOEA 3F6UH 3RC5A 2EEKA 3G01A 2WPHS 3V12A 2KAIA 2RA3A 1G3BA 3VGCC 4K8YA 3QGJA 1FLEE 5GJ4B 3TK5A 2FTLE 1C5YB 1G37A 2P3UB 1C9PA 4KELA 4JZ1A 3C27B 1QY6A 2DE9A 2Y82A 1AY6H 1SLUB 3GDSA 3UUZA 5A2MH 3LT3A 4NG9H 3VEQB 1UVPA 1NS3A 3BTEE 4QT8C 3RU4D 3SI4H 1YPHC 5LH8A 4ZH8A 1IHSH 1QIXB 1F5LA 4KGAA 4GUXA 2VWLA 2ZFRH 1N6YA 1UVUH 1MQ5A 4MVNA 4UE7H 1TABE 1B7XB 3RXSA 3K6ZA 3SQEE 4AGJA 1O3IA 4JZIA 2BDAA 1O5EH 1F0SA 3DFLA 1RIWC 2Y5GA 3BTHE 1SGFA 4Y0ZE 3V13A 2QF0A 1SLWB 1F5KU 4ABGA 2ODPA 2FODA 1CSOE 1O36A 2GCTC 2V35A 3UWJH 3SNDA 4X2YA 1UTNA 1YC0A 1FN6A 1DXPA 1HNEE 5F03A 3T29A 1C2FA 3VB7A 1ZPZA 5FAHA 3MTYA 2P8OB 3QTOH 1NFWA 2GT7A 4YTAA 4UFFH 1VCWA 1O3AA 7GCHF 1SQTA 1P11E 3KQEA 2VGCC 1DT2A 4ISLA 1K1IA 1SGFG 4LOYH 4FXGH 3ZZ3A 1N1LA 5JPMH 2XYAA 4Y8YA 1H9HE 3SNAA 4I8JA 1NFYA 2XBXA 3BTKE 1TA6A 3P8GA 4ESTE 1OWIA 1VJ9U 1INCA 1SQOA 2XW9A 4NA7A 1C4U2 1TBZH 4B73A 4YT7H 3MHWU 2BD9A 2QCYA 2ZDKA 5E2OA 4DJZB 2VIWA 3KN2A 3UREA 5E0JA 4CREA 2R3UA 1FY5A 1GMCF 1P0SH 3HGNA 2HWLB 3BSQA 1ESBA 2H5CA 1FY1A 4X2WA 1TONA 5IYTA 2BQWB 3BTQE 1IQNA 1O3HA 2OTVA 2ZC9H 3GCHB 2FO9A 1C5UA 3RMOH 1C5NH 2A45B 1CHOF 1LPKB 1TB6H 5LPRA 1O39A 2PKSB 3I29A 2BD3A 4KTUA 4Q7ZA 4I7YH 4PROA 5CHAB 2TPIZ 1K21H 2B5TB 4E7RG 3M7QA 1A3EH 4Y7BA 1O5CB 1FAKH 1ELVA 3UQOA 3KNXA 3E1XB 3ATWA 2NWNA 1YPKH 3OTJE 5C5NA 2ANYA 2FOBA 4OGYA 5DGJA 4CH8B 3SJKA 4LZ1H 3STIA 5L30H 4DW2U 4DIIH 4IN1A 2ZGXH 1DUAA 1P2KA 2ZPSA 2I6SA 2Q1JA 1OSSA 3H7OA 4IC6A 2K1QA 1EAWA 1T4UH 3PYHA 2SFAA 2QF3A 1YPLH 2FX6A 1MCVA 1HCGA 2NU3E 3SGQE 4UONA 3ZZ5A 1UK4A 4R8TB 1K1OA 1ANCA 1WQSA 2ODQA 1XUFA 1BTZA 1Z6EA 4FUIA 2AIPA 1UHBA 1EB2A 1SB1H 1O2UA 1BTHH 3IG6B 3Q00A 1Y59T 1ZLRA 2A4RA 3E90B 2PW8H 1MU8B 2HPQH 4Z6AH 3IWMA 1EJNA 1OWJA 3M35A 1ELTA 4MNVA 3JZ1B 1O5AB 4IMQA 5JBAS 2TGTA 1E38B 3RMMH 3U8RH 4NFFA 2BDIA 1MU6B 1UTPA 1GVLA 1W7XH 1HAOH 1O5FH 1TNIA 1CHGA 1SGNE 7ESTE 4I32A 3NXPA 3ZZBA 1O32A 4MG3A 1A46H 1LVMA 1RTLA 4ABDA 1XVMA 1VITG 1AO5A 1O2VA 3SU3A 1A5IA 2BQ7B 1PPBH 1WQVH 2XBWA 3VB5A 3SJ9A 1F92A 4A92A 4CHAC 5HM2A 1W11U 1QNJA 2ZPQA 1BUIA 2W26A 1VJAU 5E2PA 1NM6A 3TGKE 1JIRA 3SV6A 1L1GA 1QJ1B 1ZZZA 2BX4A 1KXEA 1ACBE 2VINA 2ZCHP 4X6NA 1SGTA 1O2LA 5BPEA 3ATIA 1MTNC 1QB6A 4BTIB 2FS9A 1AFQB 1F0RA 3FVFB 8GCHG 4NWLA 5L2YH 5EGMA 2C3SA 2ZPRA 1MQ6A 1PJPA 4FU7A 3TK9A 2CF9H 1K1PA 4YT6H 1V2OT 2WPJS 1BBRH 4DT7B 1T8MA 3ZVCA 2GMTB 4D7GA 1FMGA 4X2VA 1D3PB 3P95A 3RXMA 1G2LA 2SNVA 1YYY1 1YF4A 3A8DA 4FU9A 1N6XA 2AGGX 1O3OA 3STJA 4BXSA 3SW2B 1P9SA 1BBRE 1IQLA 1ZHMA 2XTTB 3MU5A 1SLVB 1DUEA 4AN7A 2FTMA 3BG4B 1C4V2 1OP8A 1XKAC 1YLCA 1GG6B 5FXLA 2D8WA 2ZDVH 2Z9JA 1AVXA 2IOTA 1ETRH 1TGNA 1Z8GA 5GWZA 2BDBA 3GY2A 3MU1A 4CR5A 1XXDA 4K60A 2HPPH 2XXLA 2F91A 3MH5A 1MMJN 3RLWH 1EZXC 1OPHB 2PHBA 3UNSA 1GJ6A 4IN2A 1CE5A 2UUFB 4IMZA 2DE8A 2QA9E 4XFQA 1FQ3A 2BD5A 4IW4E 4OS4A 1QBOA 1ZSLA 2PSYA 4JYTA 2YNBA 1OWKA 2A2XH 2V0BA 2P16A 3U8TH 3TJNA 4R0IA 1GL1A 1P2QA 3T28A 2G4TA 2ZI2H 2Y5HA 2A31A 1HAYB 4A5TS 1E0FD 3ZVGA 1GJ7B 1GMDF 1O38A 1TPAE 1O2OA 1C5RA 1PPHE 1S5SA 5GPIB 1P3CA 1ABIH 2ZHQH 4MPWA 1ELGA 4XSKU 3QZRA 1V2WT 1T7CA 2BXUH 1MD7A 8ESTE 5HXFA 3LC5A 1DLKB 1HBTH 3O8BA 1UK2A 2ZG0H 3GYLB 1O5GH 4NIXA 4WJG2 3SGBE 3LGYA 3WY8A 1QTFA 2GVFA 1DICA 1S6HA 1NRQH 3EA9A 1TGSZ 2A7CA 1TNKA 3QGNB 1GGDC 3M5LA 1IQKA 1LPZB 3CS0A 1LVOA 1P57B 4WF8A 1MBQA 1GL0E 1EPTB 1DXWA 1A7SA 2FX4A 1AKSA 1UHBB 1AU8A 2F9OA 2PV9B 2VIPA 1GJBB 4AYYB 2ZDMA 5J4QA 2AS9A 3ESTA 2YNAA 4JMYA 1CA0C 2VH6A 5DO4H 2UUKB 1Y3YA 4X8VH 1JWTA 1LVYA 4O3UA 1YM0A 1C1UH 2CF8H 2M5TA 5FPTA 3MNXA 5JBBS 2XRCA 2A1DB 3PMJA 4ABFA 2ZDAH 1GHBF 1C2MA 4B76A 4H6TA 1SGPE 1C2IA 1XUJA 3KF2A 3SNEA 1MD8A 1C1RA 2CN0H 1V2RT 3R0FA 3S9AA 4E7NA 2CXVA 5A8YA 1GJ9B 3UQVA 4I31A 1PYTD 1SOZA 3F9GA 2Z3DA 3URDA 5F8TA 2RA0A 2CGAA 1O2IA 3RDZA 2R0KA 3SV2H 1QL8A 1TGBA 2ANWA 5EODA 1SGIB 3SZNA 2GCHG 2W5EA 4BAMB 1AI8H 3RXAA 1O3EA 3M36A 1P8VC 1OWDA 3ZZAA 3GY4A 1OYQA 1E35B 1NRPH 1YP9A 4HTCH 4BNRA 1QBVH 1WOFA 1GMHF 2AGEX 3TVJB 5F8ZA 3FFGA 1O5BB 3RXJA 7GCHG 4WMEA 5HM9A 1H9LB 3LH3A 1DSUA 3SQHE 5I46H 1IQJA 1ANBA 4K3JA 3RMLH 3S0NA 4FUEA 4FUBA 1HFDA 1GI6A 1C5WB 1QHRB 1PQ8A 2AH4X 2RCEA 1G3EA 1OXGA 4O97A 1ESTA 1C2HA 1WUNH 2QC2A 3A8AA 2VVCA 3V0XA 3A8BA 5IDKA 3K6YA 3QX5H 3TH2H 1K1LA 1OWEA 4UEHH 2CV3A 2FLBH 1O3KA 3AAUA 1IQMA 1LTO<