2NU0E

Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i, and tyr18i
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B, Protease B
publication title Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I, and Tyr18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu0E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu0E01
1XUKA 3TIUA 1AUTC 2ZA5A 1ZOMA 2ZPSA 4ZHMU 2NU2E 1WCZA 1TE0A 1KXAA 1ZSJA 1W11U 1MU8B 2GD4B 1V2MT 3A7TA 1RS0A 2G4UA 1ZJDA 4TWYA 1YPGH 1HAZB 1VITG 2WPHS 4YLQH 4AFQA 2CMYA 5A0BA 1L1JA 1O2MA 3QLPH 3A7ZA 4FXGH 3M7QA 1Y3YA 8LPRA 4ISIH 3EDXB 4AG2A 1NZQH 1LDTT 1GVKB 8KME2 5F8ZA 5FBEA 1C1RA 1CT4E 1F5KU 2DUCA 5JPMH 1QB6A 1O3CA 2HNTE 3NUMA 3SGBE 1TNGA 1ZGIA 3FAOA 2AIPA 3P8FA 1YGCH 2BLVA 2HRVA 3VB5A 3A80A 4OS2A 1C1OA 1O35A 5DP7A 3K6ZA 4X1SU 1IAUA 1G2LA 1GI7B 4WMDA 3Q76A 1LQDB 2QCYA 1GBKA 5AHGH 3QX5H 3MMGA 2J4IA 1L1NA 5E0JA 5L2ZH 3HKJB 2CHAC 3MNCA 1N6YA 2B5TB 2P3UB 1YP9A 1HXFH 1BA8B 1LVBA 1TBZH 1C5PA 2ZTYA 3V3MA 1CHOF 1GCTB 1XUHA 1W8BH 5FAHA 5T3HA 1PFXC 1GI2A 1UCYK 1Y59T 3V13A 3H7TA 6GCHF 4HI3A 2XC5A 3RXIA 4U01A 3TJNA 3GY2A 4WH6A 1WTHD 1ETTH 1FY1A 4TPYA 5GPIB 2PFEA 3SUFA 4ZHLU 1RTFB 3U69H 1HAVA 1S84A 2BD7A 3SW2B 1GBEA 3BIUH 2R0LA 2ZGCA 1JBUH 1GDUA 1BRUP 3E6PH 4LZ4B 1O39A 1F0SA 2YOLA 3QO6A 1EZUC 2O8TA 1O2PA 1G36A 3UOPA 4K1SA 3P70B 1W14U 1GBIA 1QGFA 1AB9C 2DE8A 2GT7A 3BTME 4Y0YE 2XBYA 2QYIA 3RXMA 3RU4D 1Z8GA 1NS3A 4I33A 4BAMB 1WOFA 2PV9B 2ALPA 4ABAA 2Z3CA 2NU0E 5A8ZA 1SGTA 1C5OH 2Y7XA 2GP9B 4KTCA 4BOHA 2KAIB 3ATLA 1BB0B 2VIDA 5F8XA 3BTQE 1M9UA 1V2WT 4DW2U 1TNJA 5F03A 3EGKH 4IC6A 4X1NU 1UCYE 2BVXH 1A61H 1FAXA 1E38B 1JIMA 2BD4A 1GJ7B 1LHFH 1QL9A 1O3GA 5JBAS 1ZRBA 3S7HB 1C5LH 1ZRKA 4JK6A 3QK1A 1VR1H 2HOBA 4K3JA 5C1UA 2WYGA 3RMMH 6ESTA 2FYRA 3U98H 1GBAA 1UO6A 3D62A 1BHXB 2BLQA 1TPSA 4YESB 2XC4A 1AKSB 1C2GA 1TMBH 3OU0A 4NCYA 4HZHA 1FV9A 3MI4A 1ANBA 1XMNB 3UQOA 1AVXA 4ABGA 1ARBA 3PO1C 3S9AA 2ODYB 3PLBA 3QTVH 1O3EA 2ZU2A 3MU5A 4FUBA 2ZPRA 2SGAA 1BRAA 1HIAA 5JBTA 3P6ZB 1NM6A 3LONA 1Y5AT 2ZDKA 1O3KA 1TGCA 4AFUA 1TPPA 2C8XB 3L33A 1OOKB 2JKHA 4LK4A 1ZR0A 4A5TS 1CU1A 5DPAA 4UFGH 4Y8YA 3GY7A 3VGCB 2FM2A 1VJAU 3OSYA 2AGGX 1EATA 1E37B 1IQMA 4BXSA 4X6MA 1DANH 4O97A 5C5OA 1XVOA 2PKSC 1A7SA 2GMTB 3GY5A 1C9TA 1XXDA 1AHTH 4XBCA 3ZYEA 3ZZ6A 2FPZA 3KQDA 1T8MA 2W7SA 5EPYA 1TGNA 5F6MA 1LTOA 1SGIB 2ZECA 3F6UH 4X2VA 5F8TA 3O8BA 4FUIA 2Q6DA 1AZ8A 1T7CA 2F91A 2F83A 1GI0A 4JCNA 1CQQA 2C8YB 5T6DA 5I46H 5IDKA 2FESH 2D26C 1WYKA 3SV7A 3Q77A 1TRYA 1DE7H 3ZVEA 1OXGA 2BDYA 3O8DA 4JYTA 2BDIA 3UWJH 1C1WH 1Z8JB 1T8NA 4MNYA 1EJAA 2SGDE 3OYPA 3SGAE 2QAAA 2F9NA 1FQ3A 1Y5UT 4MVNA 1C5SA 4SGBE 4GSOA 3SNEA 4NG9H 3HPTB 1G37A 1NRSH 4KTUA 3RU4T 1ARCA 1GL0E 4FU9A 1B0FA 1QNJA 8GCHF 3A8CA 1ABIH 3RMOH 3FZDA 1O34A 1U6QA 1UVTH 2I6SA 1AZZA 1HJ8A 1INCA 1GBCA 1C4V2 3S9CA 4LZ1H 1GHBG 4Q7XA 3DD2H 2ZFPH 1GHAF 1F92A 2ZTZA 4A6LA 1J8AA 1NC6A 1XM1A 3TH2H 1TOMH 3U1IB 1C5MD 3A86A 2QIQA 4H6TA 3F9FA 4BAQB 1DLKB 2OTVA 1C1VH 3BTWE 3SU6A 4IS5A 4GAWA 9LPRA 3U9AH 3VB3A 5PTPA 3UIRA 1BHXF 3M5OA 4FUFA 3T62A 3LGYA 1T8OA 1C9PA 1GJDB 3SOSA 3P8GA 1HJAC 3FFGA 1MCVA 1Y8TA 1IHSH 2FXRA 1KYNA 3GYMA 4WVPE 2BY9X 4AYVB 1GBDA 5FX6A 2ZC9H 2QV1A 5DP9A 1NTPA 1QBVH 1Y3UA 2ZCLP 4TY7A 4BAHB 1PQ8A 1A0LA 4Y6DA 1GVZA 1AU8A 2Y7ZA 1GWAA 1Y3VA 1V2NT 1K1LA 3QGJA 4Y71A 5GJ4B 1G3EA 4ABJA 1G9IE 4WMFA 4B75A 2KAIA 2GX4A 4I8JA 1GBTA 1ZMJA 4WMEA 1C2LA 4KTSA 1TGBA 4ZXXH 1GJ9B 2PGBB 4VGCB 2BVSH 4I8LA 3RXLA 2V35A 1ZTKA 2FOCA 3LGWA 5DP8A 1SSXA 3SNCA 1P02A 2ANWA 1DY9A 1UTJA 1GGDB 1HAYB 1L2EA 1P9UA 1H8IH 3A7YA 2A7CA 5C3NA 5DG6A 1DT2A 1MKXH 2ZHEH 1TFXA 4AGJA 1O3FA 2J9NA 4CH8B 1CGHA 1E34B 1C2KA 2OD3B 1AKSA 1ELDE 3SU0A 5A8YA 5EQRA 1QRZA 1QY6A 1KLJH 3HK6B 3RP2A 1TYNA 4DT7B 3ELAH 4NWLA 4RKOB 4UFEH 1IQLA 1PPGE 1TB6H 3KQBA 4OGXA 1C1TA 3T2NA 5LH8A 1P04A 3M61U 5EODA 5HMAA 1EQ9A 4XFQA 4K69A 5EGMA 1ID5H 5EU8A 3SJIA 3SU2A 3E1XB 4MPUA 1J15A 2Y80A 4XBBA 4B2CA 1YBWA 1NRPH 2GCTC 1HV7A 1AIXH 1SGYE 1DSTA 2FOFA 1IQGA 1RRKA 2Z3DA 4GHTA 2M5TA 3AASA 5EG4A 1EJMA 1W0YH 2GCHG 1GMCG 3H5CB 1T32A 2VVCA 1ZPBA 3S9BA 5G4BA 4I8GA 4NIWA 4ZAEA 2AIQA 1AE5A 5GWZA 1CA0C 1BRCE 4BANB 3SZNA 2HNTF 4TWWA 3PWBA 5J4SA 2XTTB 1W7GH 3M7TA 1QCPA 1KSNA 1C2MA 2H1UA 3KEEA 6LPRA 1P11E 2SFAA 1O2KA 1BJUA 1ELVA 1DVAH 1THSH 3SJKA 3CP7A 5TCCA 1ZPCA 2V0BA 1IOEA 2Y5HA 3MH5A 1TWXB 2VGCC 3KN2A 4ZKOU 1PYTC 2OQUA 5L30H 2ZG0H 5DKMA 1DXPA 2EI8A 2GGVB 3C1KA 2WPKS 2AGIX 1W13U 1AUJA 1RTLA 3MWIU 1QHRB 5DP5A 1TQ7B 2ZCKP 1O3BA 1C1SA 1EZQA 3MH4A 1P09A 1O2IA 3D65E 1MTUA 2QXIA 1UMAH 1GJ8B 2PUQH 3MO6A 3BEIB 3QDZB 2P16A 4JZFH 3D49H 3RXVA 3LGTA 2Z3EA 1IQIA 2A7JA 2Y5GA 2Z7FE 4NFEA 1MTNC 2ZHDA 1P3EA 2QXHA 2XBVA 3Q00A 3MTYA 1TBQH 1SMFE 1C4U2 1UK2A 3M5LA 3MU0A 1SL3A 1AMHA 2UUFB 3K9XB 2GVFA 4CRCA 1NFUA 1DUEA 1QBOA 2ZNKH 1KTTB 2VIVA 3EA8A 3F68H 4NGAH 1G2MA 1V2KT 2BX3A 1E35B 1RGQA 1EPTC 1A46H 1FI8A 2TGTA 1KXDA 4ABHA 3RXGA 1P10A 1WUNH 1W2KH 3GICB 4Y10E 3B23B 1O5DH 4D7FA 4OS4A 4XOJA 2Z6BD 3S69A 2QXJA 4NIVA 5EQQA 1C5NH 4F49A 1GJ6A 1GG6C 2XBWA 1K2I1 3KNXA 2XXLA 2QA9E 2A4GA 4YT7H 5JYIA 5BRRE 2OUAA 4IBLH 1RD3B 3GDUA 1ANDA 4B2BA 2AS9A 1O2OA 1PQ5A 2XW9A 1J17T 5DP6A 4CHAB 1Z71A 2ZDMA 2SNWA 1Z1IA 2BQWB 4Y7AA 3RXTA 1SLXB 1MAYA 1Y3XA 3UY9A 2NWNA 1QQ4A 1ABJH 3K65B 1O2HA 1A3BH 3URCA 2EA3A 1DWEH 2HVXA 1AFQB 3PTBA 5JB8S 2JH5D 2VIQA 2J95A 2H5CA 1UHBB 2G51A 2PLXA 2BX4A 3RC6A 3ZZ8A 3SJ9A 3VEQB 1AY6H 3RXHA 1GVLA 2UUYA 3MHWU 3FZZA 1ELTA 4X6NA 1TGTA 1K9OE 6CHAB 4ZKSU 1VITH 4ZHAA 2WPIS 3TVJB 2W5EA 4AB9A 1MQ5A 1VCPA 1G3BA 4CRAA 1AI8H 3BEFB 1GMHF 3JZ1B 4LXBH 4OGYA 3BSQA 1GI9B 5T6FA 3SV8A 1BMNH 3RXJA 4IN1A 1HRTH 3PMBB 4X8UH 2PHBA 5JBBS 3UOUA 4B1TA 1ACBE 5GCHF 1GBLA 1BTZA 4DY7B 1WSSH 1HAPH 1S0RA 7KMEH 3MNBA 2QC2A 2A2XH 4YLUA 1FXYA 4CH2B 1L1GA 4THNH 3SJ8A 1G3CA 3A7XA 3A82A 1LKBA 1A5HA 3URDA 2W7UA 4AOQA 1ELEE 4Z0KA 2ZIQH 2STAE 5TCAA 1CT2E 2ZFFH 1ANEA 1DDJA 3RU4E 1TA2A 2O8WA 1QTFA 4YOJA 1DSUA 4NFFA 3ATIA 1THRH 1MKXK 5AFYH 1S6HA 2FTMA 3LH1A 4HTCH 4E05H 1UJ1A 1YCPH 1QFKH 1ZJKA 4ISOA 1NESE 1ZZZA 1OWJA 1HAGE 5E0HA 8ESTE 2SGPE 1PJPA 2ZHQH 3A88A 2AMPA 3T27A 4DCDA 3FP8E 4WXVA 4XBDA 1QIXB 3AAUA 2OP9A 1BITA 5ESBA 3T28A 2PKAB 1K1MA 2VIWA 4X6PA 3RXUA 2RA0A 3VB4A 1QRWA 2JH0D 1GHZA 3GCHC 4GHQA 4UFFH 2CHAB 4DIHH 1ZSLA 1H8DH 3GYLB 4GCHG 3NCLA 1YPKH 3SBKA 2A5AA 2G5VA 2FOBA 1JWTA 1NT1A 4DJZB 1UTPA 5GXPA 5C1XA 2BD8A 1GHVH 3EQ0H 4X1PU 3B8JA 1O0DH 1LHGH 1P8VC 4GLYA 5AVDA 3AW0A 2STBE 3KHVA 1FIZA 1UVOA 2BD2A 1G3DA 4KP0A 1QJ1B 1FY4A 1V2TT 1GJBB 2FOAA 1FMGA 1D6RA 2QXGA 1JOUB 1YM0A 1O3PB 2EI7A 1ZTJA 3MOCA 1Z7KA 3TNSA 4OS6A 1FJSA 2R0KA 5FCRA 2H6MA 1UVUH 1SQAA 2A32A 3L6PA 1DX5M 1P05A 1FY5A 1AGJA 1QA0A 4FVDA 1AB9B 4A1TA 2ZP0H 2F3CE 2B9LA 2NU3E 2DE9A 3SUEA 2A0QB 2FS8A 2WPMS 2BLWA 1QRXA 1O5CB 1YF4A 1DLEA 4PROA 5E2PA 4I7YH 2J94A 4B74A 2Z9KA 1TIOA 3LH3A 4NZLA 4AX9H 2ODQA 4X8SH 1Q3XA 4YZUA 3SQHE 2HLCA 1O2NA 2RCEA 2VB0A 5L6NH 1V2QT 1HAXB 3RLWH 3M36A 1TRMA 1DM4B 3MNXA 1JRSA 1D4PB 2TGPZ 1UVPA 2TBSA 2JETC 2HWLB 1A1RA 3U8TH 2VWMA 1HGTH 1A4WH 3S0NA 1V6DA 1O2SA 1WAYB 1GMDF 4DOQA 5AF9H 1AD8H 1H9LB 1C1NA 2PSYA 1C5XB 4WWYA 3TPIZ 1MKWH 2FEQH 1F0TA 1SLUB 1C1MA 1AQ7A 3LGIA 3VPKA 2BQ6B 4MQAA 4DIIH 2OLGA 1TMTH 3GCTG 1VITF 4B73A 2BDBA 1BTHH 1EZXC 1FN8A 3AVZA 1CE5A 4Y8ZA 1TAWA 1WQSA 2G00A 2XWBI 1K1PA 1L4ZA 1JRTA 1NROH 3PO1B 2UUKB 2VINA 1P2KA 4H6SB 1HDTH 4FUGA 1C2JA 1F7ZA 3DUXH 3LC5A 1S85A 1O2GH 2R9PA 4Q7YA 1Y3WA 4Y76A 1UHBA 3P8NA 4BXWA 4K1EA 2H9EH 4BAOB 4A7IB 1K1NA 3BF6H 1KDQB 2HNTC 3TLOA 5GDSH 1OP8A 2J2UA 1HNEE 1OYTH 4JZIA 2AEIH 3VXFH 3SNAA 3RXKA 3D23A 3LU9B 1VJ9U 3BN9A 3M35A 2ZQ1A 1O2XA 4Q80A 1A3EH 1V2OT 1XUJA 4X8VH 2PKSB 2BD3A 3CS0A 1XUGA 1DITH 4DVAU 1QL7A 1C2IA 1O38A 3DHKH 1RIWC 3OY6U 5FPSA 1O2ZA 4Y7BA 3VFEA 2BXTH 3UNRA 2QN5T 1PYTD 1XKBC 1CSOE 4MPXA 2P8OC 2ZTXA 2O9QA 2VNTA 4IW4E 2XC0A 1V2JT 5EW2H 4IMZA 2LPRA 5LPRA 1CBWC 2ODPA 2ZU4A 1OP2A 4ZMAH 5ABWA 2OBOA 2FOMB 1GBFA 1KXBA 3VB7A 2H2ZA 5C2ZA 2LNCA 3W95A 1SI5H 2XNIA 2ZDLA 1NFWA 1ZHMA 1AE8H 1BJVA 1UTNA 2A2QH 3UNQA 3KIDU 3ZV9A 1UTQA 5FCKA 2GT8A 1LHCH 1MBQA 1V2ST 3LIWA 3RXFA 3QUMP 3GCOA 1C5VA 2AH4X 1D3TB 3E3TA 2BDAA 1O2TA 3T26A 3B9FH 1HAHH 1A2CH 2PKAA 1GI3A 2FP7B 3ZZAA 5HYOA 5JDUB 2ZU3A 5HM9A 2ZPQA 1SHYA 3DFJA 2IJOB 1AVWA 4DURA 4AN7A 2ZDAH 1QBNA 5LPEA 1MBMA 3UWIA 3KCGH 2J38A 3T5FH 2NU4E 1PPBH 1MQ6A 3LKWA 2BHGA 2RA3A 3QWCH 4BTTB 1O31A 1SOTA 1TGSZ 5EQSA 5T6GA 1YC0A 1UTKA 7LPRA 1TBRH 4YT6H 4O9VA 2FX4A 1O5BB 2A4RA 3UREA 1DXWA 1KIGH 2VJ1A 3FVFB 3SUGA 1MTSA 2HPPH 4ABDA 2FMJA 2F9OA 3RUOA 5HGGA 1OKXA 3SI3H 1J16A 4RN6A 1GJCB 2BY5X 4JK5A 4F4OC 1BTXA 2ANKH 2ZFSA 3SORA 2WYJA 4NWKA 1TRNA 3AW1A 1BTUA 1VGCC 2HGTH 1ORFA 1E36B 3U1JB 1YCPK 4Y79A 3PMAB 4MPWA 4B76A 1OWEA 4J2YB 1C5ZB 2J92A 1HAOH 1C2FA 1G30B 5J4QA 2THFB 1S83A 3ZZ4A 1ELBA 2FOEA 3ZZ9A 2H5DA 3LGVA 3GY3A 4RSPA 3TK6A 3GCNA 2FOHA 1ETRH 1AWHB 1QA7A 5B6OA 2K1QA 2W3KA 4Q2KA 1A0JA 3F1SB 4AYYB 5CHAC 1B5GH 3ZZ3A 2EC9H 3A89A 1C2EA 1TX8A 1UVSH 2GV6A 3M3VA 1XUFA 1F2SE 3PYHA 1HLTH 1VZQH 3ZV8A 2V3OH 4Y0ZE 2BTCE 2FI4E 1QL8A 4YOIA 1SQTA 1T4UH 1YPEH 3MU1A 1SHHB 3MO3A 3SU3A 1OWDA 3CENA 3NWUA 1TPAE 4Y8XA 1LPKB 2A5KA 3SO3A 2FYQA 4X8TH 4ZKRU 1BBRH 1C4Y2 4I8HA 1BZXE 2BDHA 1C5YB 3NPSA 2A1DB 3M37A 1IQNA 3K6YA 3TK9A 3RXEA 1KXFA 1G32B 3K2UA 3Q3YA 3RC5A 1ZYOA 2FTLE 3FP7E 1TLDA 1B0EA 4Q7ZA 3LGUA 1SFIA 1CHOG 1C1PA 1GBMA 1ANCA 2ZCHP 4KKDA 3RC4A 1ZMLA 3RXOA 3MH6A 1SLWB 2YNAA 3RLYH 1O3LA 1JMOH 6GCHG 3BTKE 5JBCS 1YPMH 5I25A 3W94A 3E8LA 1YYY1 2ZGBH 2A4QA 4FVBA 1TX7A 2Y82A 1NPMA 1O2QA 2GCTB 1AO5A 1KDQA 1O3NA 2ZI2H 1BCUH 3DFLA 5DGJA 1P2NA 2FWWA 1O5GH 3KQEA 2Q6FA 3PTNA 1WV7H 1KTSB 2R2WU 1FPHH 3QZRA 1N8OC 2VU8E 2VWOA 3PWCA 1HXEH 1ZGVA 3SU5A 1O3OA 1CA0B 1WQVH 1D3PB 2BM2A 1MKWK 4J1YA 1QURH 1GHBF 2CF8H 2OC8A 4CR9A 2ZGHA 5FPTA 1P0SH 2UWPA 2P94A 2ZGJA 7ESTE 2G4TA 3H7OA 3OX7U 2AERH 4X0WU 2VWLA 1LCYA 1PQAA 1Q2WA 1IHTH 2ZKSA 3MFJA 2ZFQH 1K22H 1C5UA 1GHYH 1YPHE 2ULLA 1P2IA 1LQEA 2VGCB 2Z94A 3RXCA 3TH3H 1RXPA 1EOJA 1O3HA 2B0FA 4INHA 1HYLA 1V2VT 1WU1A 1K1JA 4K5ZA 1ZPZA 3EA9A 3NZIA 3BG4C 2ILNA 2ZFRH 2EI6A 4JZ1A 3L3TA 1O2JA 3RXRA 2VH6A 1DWCH 2CF9H 1DWDH 3I77A 1MMJN 1KY9A 2AGEX 3DA9B 2OXSA 2C93B 4TY6A 2IPHA 2GV7A 5HXFA 3A85A 2FX6A 5H4IB 1SFQB 4X6OA 4UONA 1ELGA 2IN2A 1P03A 1THPB 1BMMH 4HGCA 3KF2A 2FI3E 3EAJA 1V2RT 2OC1A 4NA8A 5EW1H 3O8RA 7GCHF 1O37A 1YPLH 1S6FA 1O3IA 1FAKH 3C27B 1NN6A 3M3SA 1XVMA 1ELCA 2GTBA 3ATMA 4WY3A 4OS7A 4CRBA 4U30A 4D7GA 2Y5FA 1MZAA 1Z1JA 4NA7A 2A4OA 2SGEE 1PQ7A 1QB9A 2FO9A 1BUIA 1IQJA 5FXLA 3SU1A 1EPTB 4M7GA 1SPJA 1OWHA 1SC8U 2ZZUH 1NRNH 2G81E 4NSYA 2Y81A 3P17H 1S82A 1UTMA 1LVOA 5DK1A 4A1VA 3SHCH 4XDEA 3ZZ5A 1C5RA 3MU8A 4CR5A 3RM2H 1GMDG 1GL1A 1DWBH 4WF8A 2D8WA 4AG1A 2GZ7A 3ZZ7A 1TA6A 1GG6B 1DY8A 4ABEA 1BDAA 1SGCA 2OC0A 3IWMA 4MNVA 4ZROA 2PW8H 2O8MA 1P9SA 1BMLA 4NIXA 1LVYA 1ELAA 3N7OA 3VB6A 1GCTC 3KGPA 3KQCA 3NXPA 4IN2A 1W7XH 4FU8A 3E90B 1SGQE 1GHXH 1O2UA 1NU9A 2HALA 1TNLA 2TIOA 4CBNA 1C2HA 2PUXB 3MNSA 2EEKA 3E16B 2W3IA 2XBXA 3BTFE 5AFZH 4YOGA 3A83A 2Z9GA 3G01A 2AMDA 4KGAA 2CJIA 2V3HH 1SG8B 2GCHF 1GMCF 3GDVA 2GDDA 3A7VA 3M7UA 3WY8A 1EB2A 4OS5A 1XUIA 1XXFA 3LJOA 5EXLA 4D9QA 1O2LA 2F9UA 2GKVE 1KXCA 1LPGB 3T25A 2BQ7B 3LJJA 4GUXA 4XSKU 4BTIB 1AVGH 2BB4A 4KELA 1K21H 2BMGB 2A31A 4ZH8A 4JZEH 1SB1H 1FY8E 1ETSH 3HATH 1TALA 3SU4A 1O5FH 1PPHE 4A92A 3TGKE 1K1OA 4E06H 2GZ9A 1LO6A 3P8OA 8GCHG 1YLCA 2Z9JA 1P2QA 4DG4A 1GBHA 5ETXA 4WXIA 1SGDE 2GZ8A 2BDGA 1IQFA 1CVWH 1PPCE 4NSVA 1GI6A 1TPOA 5BPEA 1K1IA 3RXAA 5A0AE 3GDSA 1RFNA 1GHAG 4IMQA 3PLKA 1BTYA 3RXQA 1HCGA 1W3CA 1EAXA 2AYWA 3A7WA 1OWKA 4NA9H 1O30A 3QZQA 5EOKA 1HAIH 3OY5U 4E7RG 3RXDA 1P3CA 5A09A 1N1LA 1LKAA 4O3TA 2FLBH 4WH8A 1NFYA 4R0IA 2BD5A 1SLVB 4ZKNU 5A2MH 2BYAX 1X7AC 3SV6A 2ESTE 2QY0B 3ZVDA 1O36A 3LDXH 1E0FD 1OP0A 5C5NA 1SGRE 1GI4A 2PTNA 1YLDA 1O2YA 2FI5E 3BEUA 1O3JA 1VCQA 1Z6EA 1O32A 4K8BA 4QT8C 1FZZA 4FUJA 1SVPA 3TK5A 1ZHRA 1LPZB 2G52A 1TNHA 3M3TA 2VIPA 3ENSB 1SOZA 1BBRK 4CRDA 1EZSC 1C1UH 2ZDVH 3I29A 4YTAA 1Q31A 2C4FH 1NY22 2RDLA 1QJ7B 3P95A 4D8NA 3SUDA 1SR5C 1O3AA 3Q3XA 1YPHC 5E8EH 2BOKA 4R8TB 2VWNA 3R3GB 3GCHB 4ABFA 4AFSA 1D6WA 3MYWA 1KLTA 3GOVB 1DOJA 3VGCC 2IOTA 2GDEH 1TX6A 1QQUA 1IQHA 2O8UA 4H42U 1SGFG 5C20A 3LC3A 1HFDA 2GMTC 3OTJE 2VH0A 1DS2E 1IQEA 1Z8IB 1DICA 3SQEE 3BG8A 3GY8A 4HFPB 2ZWLH 4ABBA 1EUFA 2H9TH 5TJXA 2FODA 4YO9A 4JYVH 1SGPE 4X1QU 3SGQE 2WUCA 3P92A 2WPJS 3HGNA 4BAKB 4YM9A 1A0HB 1D9IA 2ZHFH 2D1JA 3QTOH 4I8KA 4MG3A 2W26A 1BBRE 1O5AB 4FUDA 2XCFA 3SNDA 2QGRA 2FDAA 1SGEE 2ZQ2A 2F9BH 2BY8X 2F9VA 3TH4H 2P95A 4K1TA 3F9EA 2FS9A 1Z6JH 3E0NB 1MZDA 3A8BA 1SQOA 1NFXA 2H9HA 1CT0E 3RM0H 3TJOA 4E7NA 3TITA 2OQ5A 1TMUH 4JZDH 1EPTA 2G55A 4Y11E 2Q6GA 3O8CA 1KLIH 3ATWA 3ITIA 3UQVA 1VCWA 3EYDA 1S5SA 3LOXA 1K28D 3I78A 1F0UA 4K2YA 3UR9A 5K0HA 3CS7A 3GISB 4MLFB 2CXVA 1H1BA 4RKJB 1GI1A 1BOQA 4FUCA 2P59A 4X2YA 1DUAA 4WJG2 5CMXH 1HPGA 2JETB 2QF0A 5FBIA 2BY6X 2SGQE 3U8OH 3ESTA 3QGNB 3QN7A 4ASHA 1YCPM 5EPNA 2FLRH 3RMLH 3RDZA 1MCTA 2P3TB 4D9RA 3GY6A 2OBQA 3MU4A 2OC7A 2ZO3H 1FIWA 1HBTH 2TGDA 3LT3A 3STJA 1F5RA 2XCNA 3BTEE 4JYUH 3TGIE 1EP5A 1P2JA 1PPEE 1ZLRA 1OSSA 2BOHB 3V7TA 2SNVA 3ZZDA 2UUJB 1V2PT 4NZQA 1P01A 3M5MA 3TJVA 3A8DA 1CGIE 1BQYA 1P2OA 2TGAA 4ISLA 1FN6A 5DO4H 3SV9A 1H9IE 1ESTA 2ZU1A 5FX5A 3VXEH 4O03A 1BT7A 1C1QA 2V6NA 3RMNH 3IG6B 1CGJE 1ZTLA 2TPIZ 3ODFA 1AFEH 4XE4A 1NU7B 3BTGE 3KL6A 5LPFA 1MD8A 5JB9S 1P2MA 4GPGA 2OINA 1DPOA 3S7KB 2WPLS 1EXFA 2CGAA 1GI8B 4INKA 4U32A 2ZU5A 2PGQB 4BNRA 1BIOA 4VGCC 4GCHF 2G5NA 1HJ9A 4AFZA 1GJ5H 2CV3A 1GBBA 1CA8B 5DP4A 2UWOA 4AORA 3EE0B 1JXPA 2AMQA 3NK8A 1GDQA 3SN8A 1TQ0B 1GGDC 1RIWB 1N6XA 1KXEA 4Z6AH 2XYAA 4MPVA 4I31A 3M5NA 3PV4A 5ESTE 4MNWA 1Z8RA 1OS8A 2P8OB 1EOLA 1SGNE 3TU7H 1L0ZA 2Z9LA 4FUHA 9ESTA 1C2DA 1J9CH 1CBWB 4FU7A 1FUJA 2OCVB 3BTDE 3LPRA 2R2MB 4H4FA 2VVUA 1PPZA 1FDPA 1TONA 2XWAA 4ISNA 4INLA 4TYDA 1BTWA 1BTPA 2BVRH 2TRMA 3PLPA 1FONA 4FUEA 2ZEBA 1P06A 1TABE 1EB1H 1EX3A 2VVVA 2ZFTA 1HJAB 2WINI 5SGAE 2A45B 1MTVA 2BY7X 7GCHG 3Q3KA 2FIRH 1MU6B 1D3DB 2AFQB 1UCYH 5L2YH 5DJ7A 1BRBE 1ESAA 5C1YA 2BZAA 1A5IA 1O5EH 3E0PB 4DGJA 1AN1E 5HM2A 5LGOA 4CRGA 1LHEH 2ANYA 2I6QA 4ISHH 1H4WA 3ZZCA 2ASUB 2BZ6H 4UFDH 1XKAC 2ZF0H 1GHWH 3ZVBA 1OYQA 2CN0H 3BTHE 1ELFA 3TNTA 2BD9A 1CO7E 2ZHWH 3PMJA 3F9GA 1GJAB 4I32A 4K8YA 4X2XA 3HK3B 1J14A 1Y5BT 3SNBA 3RXSA 4MNXA 3A81A 4B71A 1L4DA 1EASA 3ODDA 1UTOA 1T8LA 3FP6E 3PMHB 2O8LA 5A8XA 2C3SA 3GCTF 1RTKA 2QF3A 4NIYA 3V12A 5K7RA 1QJ6B 4D76A 3ZZBA 4LOYH 4K60A 3MH7A 2B8OH 1VGCB 1GMHG 4BTUB 3UNSA 3ZVAA 2VIOA 1C5TA 4X2WA 2Q1JA 1O2VA 1P57B 3E91A 3TJUA 3TGJE 3GY4A 1MD7A 1DFPA 1T4VH 1MUEB 4UEHH 4OS1A 5GCHG 3PM3A 3UFAA 1F5LA 1C5WB 2G8TA 2FOGA 1YPJH 2UWLA 4CRFA 1XX9A 2SGFE 1O3DA 3F9HA 2WV5A 1H9HE 2P93A 3EA7A 1EKBB 4X1RU 3STIA 2R3YA 5IYTA 1HAVB 5CHAB 3V0XA 1YKTA 1UK3A 3FANA 1SGFA 3NKKA 1UTLM 5FHTA 3A84A 5GIBA 1GCDA 4AGKA 1FNIA 2ZGXH 1LMWB 1O2WA 1C5QA 2Z9IA 3UTUH 1S81A 2ZDNA 3PB1E 3SV2H 1HUTH 1O33A 1ZHPA 1EAWA 1RJXB 4TPIZ 2PR3A 4MDSA 4B2AA 3IITA 1MTWA 2P3FH 3ZVCA 4A1XA 1GI5A 1QR3E 1UK4A 4JMYA 1GBJA 1QB1A 5FPYA 2J34A 2XRCA 1ZSKA 1D3QB 4UD9H 1LHDH 4UDWH 3A8AA 2WUBA 3RXPA 3R0FA 1O3MA 4ABIA 2A5IA 1BMAA 1NRQH 3T29A 3HKIB 2HPQH 3AAVA 3PROA 4IC5A 4AZ2B 2C90B 4IGDA 1LVMA 5CE1A 2BDCA 1HB0B 2C8ZB 2A7HA 2FZZA 1AWFH 3UUZA 5C67A 3ZYDA 2JH6D 1B7XB 3ZVFA 1NO9H 5E0GA 1GPZA 5EXNA 2F9PA 2PTCE 2Y6TA 1TNKA 3MO9A 2WV4A 4O3UA 1V2UT 1EP6A 3SI4H 1O2RA 2YNBA 2BLOA 2RG3A 1W12U 4ESTE 1FLEE 1GJ4H 4CHAC 1OWIA 3UR6A 4CREA 3JZ2B 2R3UA 2D2DA 1EAIA 2BXUH 1EAUA 2NU1E 2PSXA 1P12E 4ZUHA 2PWXA 5A0CA 2C8WB 1MH0A 1ZMNA 3UPEA 3BV9B 1MAXA 5E2OA 1N8OB 1F0RA 1TNIA 3U8RH 3SHAH 1OX1A 1A5GH 1WBGB 4UE7H 1AFQC 5EXMA 1MTNB 2ALVA 1HIAB 1WTGH 3SJOA 3BIVH 3HGPA 4U2WA 1NRRH 3RXBA 3BTTE 4SGAE 2ANMH 1EJNA 1IQKA 3A87A 1T31A 5DP3A 4ZXYH 1GDNA 6CHAC 1SBWA 1JIRA 1S0QA 1PPFE 1FY3A 4CBOA 1ESBA 1TOCB 1OPHB 4GVUA 3ATKA 1W0ZU 1W10U 1V3XA 1FPCH 4AB8A 3ZVGA 3BG4B 4MTBA 2B7DH 1CHGA 3DT0H 1V2LT
chains in the Genus database with same CATH superfamily
1XUKA 3DSGA 1AUTC 2ZA5A 3TIUA 1ZOMA 2ZPSA 4ZHMU 2NU2E 1WCZA 1TE0A 1KXAA 1ZSJA 1W11U 1MU8B 2GD4B 1V2MT 3A7TA 1RS0A 2G4UA 1ZJDA 4TWYA 1YPGH 1HAZB 1VITG 2WPHS 4YLQH 1E1RD 4AFQA 2CMYA 5A0BA 1L1JA 1O2MA 3QLPH 3A7ZA 4FXGH 3M7QA 1Y3YA 8LPRA 4ISIH 3EDXB 4AG2A 1NZQH 5KECA 1LDTT 1GVKB 8KME2 5F8ZA 5FBEA 1C1RA 1CT4E 1F5KU 2DUCA 5JPMH 1QB6A 1O3CA 2HNTE 3NUMA 3SGBE 1TNGA 1ZGIA 3FAOA 4Z1MD 2AIPA 3P8FA 1YGCH 2BLVA 2HRVA 3VB5A 3A80A 4P02A 4OS2A 1C1OA 1O35A 5DP7A 3K6ZA 4X1SU 1IAUA 1G2LA 1GI7B 4WMDA 3Q76A 1LQDB 2QCYA 1GBKA 5AHGH 3QX5H 3MMGA 2J4IA 1L1NA 5E0JA 5L2ZH 3HKJB 2CHAC 3MNCA 1N6YA 2B5TB 2P3UB 1YP9A 1HXFH 1BA8B 1LVBA 1TBZH 5KGOA 1C5PA 2ZTYA 3V3MA 1CHOF 1GCTB 1XUHA 1W8BH 5FAHA 5T3HA 1PFXC 3OE7D 1GI2A 1UCYK 1Y59T 3V13A 3H7TA 6GCHF 4HI3A 2XC5A 3RXIA 4U01A 3TJNA 3GY2A 4WH6A 1WTHD 1ETTH 1FY1A 4TPYA 5GPIB 2PFEA 3SUFA 4ZHLU 1RTFB 3U69H 1HAVA 1S84A 2BD7A 3SW2B 1GBEA 3BIUH 2R0LA 2ZGCA 1JBUH 1GDUA 1BRUP 3E6PH 4LZ4B 1O39A 1F0SA 2YOLA 3QO6A 1EZUC 2O8TA 1O2PA 1G36A 3UOPA 4K1SA 3P70B 1W14U 1GBIA 1QGFA 1AB9C 2DE8A 2GT7A 3BTME 4Y0YE 3PV5A 5EJ1A 2XBYA 2QYIA 3RXMA 3RU4D 1Z8GA 1NS3A 4I33A 4BAMB 1WOFA 2PV9B 2ALPA 4ABAA 2Z3CA 2NU0E 5A8ZA 1SGTA 1C5OH 2Y7XA 2GP9B 4KTCA 4BOHA 2KAIB 3ATLA 1BB0B 2VIDA 5F8XA 3BTQE 1M9UA 1V2WT 4DW2U 4ZCNA 1TNJA 5F03A 3EGKH 4IC6A 4X1NU 1UCYE 2BVXH 1A61H 1FAXA 1E38B 1JIMA 2BD4A 1GJ7B 1LHFH 1QL9A 1O3GA 5JBAS 1ZRBA 1W0KD 3S7HB 1C5LH 1ZRKA 4JK6A 3QK1A 1VR1H 2HOBA 4K3JA 5C1UA 2WYGA 3RMMH 6ESTA 2FYRA 3U98H 1GBAA 1UO6A 3D62A 1BHXB 2BLQA 2JDID 1TPSA 4YESB 2XC4A 5C17A 1AKSB 1C2GA 4RT1A 1TMBH 3OU0A 4NCYA 4HZHA 3GS9A 1FV9A 3MI4A 1ANBA 1XMNB 3UQOA 1AVXA 4ABGA 1ARBA 3PO1C 3S9AA 2ODYB 3PLBA 3N99A 3QTVH 1O3EA 2ZU2A 3MU5A 4FUBA 2ZPRA 2SGAA 1BRAA 1HIAA 5JBTA 2JIZD 3P6ZB 1NM6A 3LONA 1Y5AT 2ZDKA 1O3KA 1TGCA 4AFUA 1TPPA 2C8XB 3L33A 1OOKB 2JKHA 4LK4A 1ZR0A 4A5TS 1CU1A 2KR7A 5DPAA 4UFGH 4Y8YA 3GY7A 3VGCB 2FM2A 1VJAU 3OSYA 2AGGX 1EATA 1E37B 1IQMA 3DSOA 4BXSA 4X6MA 1DANH 4O97A 5C5OA 1XVOA 2PKSC 1A7SA 2GMTB 3GY5A 1C9TA 1XXDA 1AHTH 4XBCA 3ZYEA 3ZZ6A 4P00A 2FPZA 3KQDA 1T8MA 2W7SA 5EPYA 1TGNA 5F6MA 1LTOA 1SGIB 2ZECA 3F6UH 4X2VA 5F8TA 3O8BA 4FUIA 2Q6DA 1AZ8A 1T7CA 2F91A 2F83A 1GI0A 4JCNA 1CQQA 2C8YB 5T6DA 5I46H 2HVYB 5IDKA 2FESH 2D26C 1WYKA 3SV7A 3Q77A 1TRYA 1DE7H 3ZVEA 1OXGA 2BDYA 3O8DA 4JYTA 2BDIA 3UWJH 1C1WH 3WW7A 1Z8JB 1T8NA 4MNYA 1EJAA 2SGDE 3OYPA 3SGAE 2V7QD 2QAAA 2F9NA 1FQ3A 1Y5UT 4MVNA 1C5SA 4SGBE 3UB0A 4GSOA 3SNEA 4M9FA 3HPTB 4NG9H 1G37A 1NRSH 4KTUA 3RU4T 1ARCA 1GL0E 4FU9A 1B0FA 1QNJA 8GCHF 3A8CA 1ABIH 3RMOH 3FZDA 1O34A 1U6QA 1UVTH 2I6SA 1AZZA 1HJ8A 1INCA 1GBCA 1C4V2 3F2HA 3S9CA 4LZ1H 1GHBG 4Q7XA 3DD2H 2ZFPH 1GHAF 1F92A 2ZTZA 4A6LA 1J8AA 1NC6A 1XM1A 3TH2H 1TOMH 3U1IB 1C5MD 3A86A 2QIQA 4H6TA 3F9FA 4BAQB 1DLKB 2OTVA 1C1VH 3BTWE 3SU6A 4IS5A 4GAWA 9LPRA 3U9AH 3VB3A 5PTPA 3UIRA 3VG8A 1BHXF 3M5OA 4FUFA 3T62A 3LGYA 1T8OA 1C9PA 1GJDB 3SOSA 2JJ1D 3P8GA 1HJAC 3FFGA 1MCVA 1Y8TA 2XNDD 1IHSH 2FXRA 1KYNA 1W0JD 3GYMA 4WVPE 2BY9X 4AYVB 1GBDA 5FX6A 2ZC9H 2QV1A 5DP9A 1NTPA 1QBVH 1Y3UA 2ZCLP 4TY7A 4BAHB 1PQ8A 1A0LA 4Y6DA 1GVZA 1AU8A 2Y7ZA 1GWAA 1Y3VA 1V2NT 1K1LA 3QGJA 4Y71A 5GJ4B 1G3EA 4ABJA 1G9IE 4WMFA 4B75A 2KAIA 2GX4A 4I8JA 1GBTA 1ZMJA 4WMEA 1H8HD 1C2LA 4KTSA 1TGBA 4ZXXH 1GJ9B 2PGBB 4VGCB 2BVSH 4I8LA 3RXLA 2V35A 1ZTKA 2FOCA 3LGWA 5DP8A 1SSXA 3SNCA 1P02A 2ANWA 1DY9A 5EIYA 1UTJA 1GGDB 1HAYB 1L2EA 1P9UA 1H8IH 3A7YA 2A7CA 5C3NA 5DG6A 1DT2A 1MKXH 2ZHEH 1TFXA 4AGJA 1O3FA 2J9NA 4CH8B 1CGHA 1E34B 1C2KA 2OD3B 1AKSA 1ELDE 3SU0A 5A8YA 5EQRA 1QRZA 1QY6A 1KLJH 3HK6B 1YLNA 3RP2A 1TYNA 4DT7B 3ELAH 4NWLA 4RKOB 4UFEH 1IQLA 1PPGE 1TB6H 3KQBA 4OGXA 1C1TA 3T2NA 5LH8A 1P04A 3M61U 3NRLA 5EODA 1EQ9A 4XFQA 4K69A 5EGMA 1ID5H 5EU8A 5HMAA 3SJIA 3E1XB 4MPUA 1J15A 2Y80A 4XBBA 4B2CA 1YBWA 1NRPH 2GCTC 1HV7A 1AIXH 2KZ4A 5F53A 1SGYE 1DSTA 2FOFA 1IQGA 1RRKA 1SQRA 2Z3DA 4GHTA 2M5TA 3AASA 5EG4A 1EJMA 1W0YH 2GCHG 1GMCG 3H5CB 1T32A 2VVCA 1ZPBA 3S9BA 5G4BA 2K0QA 4I8GA 4NIWA 2AIQA 1AE5A 4ZAEA 5GWZA 1CA0C 1BRCE 4BANB 3SZNA 2HNTF 2AHME 4TWWA 3PWBA 5J4SA 2XTTB 1W7GH 3M7TA 1QCPA 1KSNA 1C2MA 2H1UA 3KEEA 6LPRA 3W1EA 1P11E 2SFAA 1O2KA 1BJUA 1ELVA 1DVAH 1THSH 3SJKA 3CP7A 5TCCA 1ZPCA 2V0BA 1IOEA 2Y5HA 3MH5A 1TWXB 2VGCC 3KN2A 4ZKOU 1PYTC 2OQUA 5L30H 2ZG0H 2M2AA 5DKMA 1DXPA 2EI8A 2GGVB 3C1KA 2WPKS 2AGIX 4RT0A 1W13U 1AUJA 1RTLA 3MWIU 1QHRB 5DP5A 1TQ7B 2ZCKP 4YXWD 1O3BA 1C1SA 1EZQA 3MH4A 2IPQX 1P09A 1O2IA 3D65E 1MTUA 2QXIA 1UMAH 1GJ8B 2PUQH 3MO6A 3BEIB 3QDZB 2P16A 4JZFH 3D49H 3RXVA 3LGTA 2QE7D 2Z3EA 1IQIA 2A7JA 2Y5GA 2Z7FE 4NFEA 1MTNC 2ZHDA 1P3EA 2QXHA 2XBVA 3Q00A 3MTYA 1TBQH 1SMFE 1C4U2 1UK2A 3M5LA 3MU0A 1SL3A 1AMHA 2UUFB 3K9XB 2GVFA 4CRCA 4B6EA 1NFUA 1DUEA 1QBOA 2ZNKH 1KTTB 2VIVA 3EA8A 3F68H 4NGAH 1G2MA 1V2KT 2BX3A 1E35B 1RGQA 1EPTC 1A46H 5C0UA 1FI8A 2TGTA 1KXDA 4ABHA 2YMSC 3RXGA 1P10A 1WUNH 1W2KH 3GICB 4Y10E 3B23B 1O5DH 4D7FA 3SU2A 4OS4A 4XOJA 2Z6BD 3S69A 2QXJA 4NIVA 5EQQA 1C5NH 4F49A 1GJ6A 1GG6C 2XBWA 1K2I1 3KNXA 2XXLA 2QA9E 2A4GA 4YT7H 5JYIA 5BRRE 2OUAA 4IBLH 4Q4LA 1RD3B 3GDUA 1ANDA 4B2BA 2AS9A 1O2OA 1PQ5A 2XW9A 1J17T 5DP6A 5FL7D 4CHAB 1S6LA 4FOUC 1Z71A 2ZDMA 2SNWA 1Z1IA 2BQWB 4Y7AA 3RXTA 1SLXB 1MAYA 1Y3XA 5IK2D 3UY9A 2NWNA 1QQ4A 1QZ8A 1ABJH 3K65B 1O2HA 1A3BH 3URCA 2EA3A 1DWEH 2HVXA 1AFQB 3PTBA 5JB8S 2JH5D 2VIQA 2J95A 2H5CA 1UHBB 2G51A 2PLXA 2L74A 2BX4A 3RC6A 3ZZ8A 3SJ9A 3VEQB 1K0HA 1AY6H 3RXHA 1GVLA 2UUYA 3MHWU 3FZZA 1ELTA 4X6NA 1TGTA 1K9OE 3OEHD 6CHAB 4ZKSU 1VITH 4ZHAA 2WPIS 1BMFD 3TVJB 2W5EA 4AB9A 1MQ5A 1VCPA 1G3BA 4CRAA 1AI8H 3BEFB 1GMHF 3JZ1B 4LXBH 4OGYA 3BSQA 1GI9B 5T6FA 3SV8A 3H09A 1BMNH 3RXJA 4IN1A 1HRTH 2KFWA 3PMBB 4X8UH 2PHBA 5JBBS 3UOUA 4B1TA 1ACBE 5GCHF 1GBLA 1BTZA 4DY7B 1WSSH 1HAPH 1S0RA 7KMEH 3MNBA 2QC2A 2A2XH 4YLUA 1FXYA 4CH2B 1L1GA 4THNH 3N7EA 3F0OA 4B6FA 3SJ8A 2IJD1 1G3CA 3A7XA 3A82A 1LKBA 1A5HA 3URDA 2W7UA 4AOQA 1ELEE 4Z0KA 2ZIQH 2STAE 5TCAA 1CT2E 2ZFFH 1ANEA 1DDJA 3RU4E 1TA2A 2O8WA 1QTFA 4YOJA 1DSUA 4NFFA 3ATIA 1THRH 2WHXA 2V3MA 1MKXK 5AFYH 1S6HA 2FTMA 3LH1A 4HTCH 4E05H 1UJ1A 1YCPH 1QFKH 1ZJKA 4ISOA 1NESE 1ZZZA 1OWJA 1HAGE 5E0HA 8ESTE 2SGPE 1PJPA 2ZHQH 3A88A 2AMPA 3T27A 4DCDA 3FP8E 4WXVA 4XBDA 1QIXB 3AAUA 2OP9A 1BITA 5ESBA 3T28A 2PKAB 1K1MA 2VIWA 4X6PA 3RXUA 2RA0A 3VB4A 1QRWA 2JH0D 1GHZA 3GCHC 4GHQA 4UFFH 2CHAB 4DIHH 1ZSLA 1H8DH 3GYLB 4GCHG 3NCLA 1YPKH 1MABB 3SBKA 2A5AA 2G5VA 2FOBA 1JWTA 1NT1A 4DJZB 1UTPA 5GXPA 5C1XA 2BD8A 1GHVH 3EQ0H 4X1PU 3B8JA 3PRBA 1O0DH 1LHGH 1P8VC 4GLYA 5AVDA 3AW0A 2STBE 3KHVA 1FIZA 1UVOA 2BD2A 1G3DA 4KP0A 1QJ1B 1FY4A 3OEED 1V2TT 1GJBB 2FOAA 1FMGA 1D6RA 2QXGA 1JOUB 1YM0A 1SKYE 1O3PB 2EI7A 2WPDD 1ZTJA 2WZQA 2KCAA 3MOCA 1Z7KA 3TNSA 4OS6A 1FJSA 2R0KA 5FCRA 2H6MA 1UVUH 1SQAA 2A32A 3L6PA 1DX5M 1P05A 1FY5A 1AGJA 1QA0A 4FVDA 1AB9B 2W6JD 4A1TA 2ZP0H 2F3CE 2KCYA 2B9LA 2NU3E 2DE9A 3SUEA 2A0QB 2FS8A 2WPMS 2BLWA 1QRXA 1O5CB 1YF4A 1DLEA 4PROA 5E2PA 4I7YH 2J94A 4B74A 2Z9KA 1TIOA 3LH3A 4NZLA 4AX9H 2ODQA 4X8SH 1Q3XA 2OK5A 4YZUA 3SQHE 2HLCA 1O2NA 2RCEA 2VB0A 5L6NH 1V2QT 1HAXB 3RLWH 3M36A 1TRMA 1DM4B 3MNXA 1JRSA 1D4PB 5DN6D 2TGPZ 1UVPA 2TBSA 4TSFD 2JETC 2HWLB 1A1RA 3U8TH 2VWMA 1HGTH 1A4WH 3S0NA 1V6DA 1O2SA 1NBMD 1GMDF 1WAYB 4DOQA 5AF9H 1AD8H 1H9LB 1C1NA 2PSYA 1C5XB 4WWYA 3TPIZ 1MKWH 2FEQH 1F0TA 1SLUB 1C1MA 1AQ7A 3LGIA 3VPKA 2BQ6B 4MQAA 4DIIH 2OLGA 1TMTH 3GCTG 1VITF 4B73A 2BDBA 1BTHH 1EZXC 1FN8A 3AVZA 1CE5A 4Y8ZA 1TAWA 1WQSA 2G00A 2XWBI 1K1PA 1L4ZA 1JRTA 1NROH 1UW7A 3PO1B 2UUKB 2VINA 1P2KA 4H6SB 1HDTH 4FUGA 1C2JA 1F7ZA 3DUXH 3LC5A 1S85A 1O2GH 2R9PA 4Q7YA 1Y3WA 4Y76A 5C0TA 1UHBA 3P8NA 4BXWA 4K1EA 2H9EH 4BAOB 4A7IB 1K1NA 3BF6H 1KDQB 2HNTC 3TLOA 5GDSH 1OP8A 2J2UA 1HNEE 1OYTH 4JZIA 2AEIH 3VXFH 3SNAA 3RXKA 3D23A 3LU9B 1VJ9U 3BN9A 2L6OA 3M35A 2ZQ1A 1O2XA 4Q80A 4ASUD 1A3EH 1V2OT 1XUJA 4X8VH 2PKSB 2BD3A 3CS0A 1XUGA 1DITH 4DVAU 1QL7A 1C2IA 1O38A 3DHKH 1RIWC 3OY6U 5FPSA 1O2ZA 4Y7BA 3VFEA 2BXTH 3UNRA 5HIZA 2QN5T 1PYTD 1XKBC 1CSOE 4MPXA 2P8OC 2ZTXA 2O9QA 2VNTA 4IW4E 2XC0A 1V2JT 5EW2H 4IMZA 2LPRA 5LPRA 1CBWC 2ODPA 2ZU4A 1OP2A 4ZMAH 5ABWA 4Q63A 2OBOA 2FOMB 1GBFA 1KXBA 2KX4A 3VB7A 2H2ZA 5C2ZA 2LNCA 3W95A 1SI5H 2XNIA 2ZDLA 1NFWA 1ZHMA 1AE8H 1BJVA 1UTNA 2A2QH 3UNQA 3KIDU 3ZV9A 1UTQA 5FCKA 2GT8A 1LHCH 1MBQA 1V2ST 3LIWA 3RXFA 3QUMP 3GCOA 1C5VA 2AH4X 1D3TB 3E3TA 2BDAA 1O2TA 5B6LA 3T26A 3B9FH 1HAHH 1A2CH 3UAIC 2PKAA 1GI3A 2FP7B 3ZZAA 5HYOA 5JDUB 2ZU3A 1FX0B 5HM9A 2J97A 2ZPQA 1SHYA 3DFJA 2IJOB 1AVWA 4DURA 4AN7A 2ZDAH 1QBNA 5LPEA 1MBMA 3UWIA 3KCGH 2J38A 3T5FH 5EJZA 2NU4E 1PPBH 1MQ6A 3LKWA 2BHGA 2RA3A 3QWCH 4BTTB 1O31A 1SOTA 1TGSZ 5EQSA 5T6GA 3FKSD 2YMSD 1YC0A 1UTKA 7LPRA 2W6ID 1TBRH 4YT6H 4O9VA 2FX4A 1O5BB 2A4RA 3UREA 1DXWA 1KIGH 2VJ1A 3FVFB 3SUGA 1MTSA 2HPPH 4ABDA 2FMJA 2F9OA 3RUOA 5HGGA 1OKXA 3SI3H 1J16A 4RN6A 1GJCB 2BY5X 4JK5A 4F4OC 1BTXA 2ANKH 2ZFSA 3SORA 2WYJA 4NWKA 1TRNA 3AW1A 1BTUA 1VGCC 2HGTH 1ORFA 1E36B 2J5UA 3F0PA 2K8IA 3U1JB 1YCPK 4Y79A 3PMAB 4MPWA 4B76A 1OWEA 4J2YB 1C5ZB 2J92A 1HAOH 1C2FA 1G30B 5J4QA 2THFB 1S83A 3ZZ4A 1ELBA 2FOEA 3ZZ9A 2H5DA 3LGVA 3GY3A 4RSPA 5DSFA 3GCNA 2FOHA 1ETRH 3TK6A 1AWHB 1QA7A 5B6OA 2K1QA 2W3KA 4Q2KA 1A0JA 3F1SB 4AYYB 5CHAC 3MQKC 1B5GH 3ZZ3A 1COWD 2EC9H 1C2EA 3A89A 1TX8A 1UVSH 3F2FA 2GV6A 3M3VA 1XUFA 4XRNA 1F2SE 3PYHA 1HLTH 1VZQH 3ZV8A 2V3OH 4Y0ZE 2BTCE 2FI4E 2PP6A 1QL8A 4YOIA 1SQTA 1T4UH 1YPEH 3MU1A 4ACAA 1SHHB 3MO3A 3SU3A 1OWDA 3CENA 3NWUA 1TPAE 4Y8XA 1LPKB 2A5KA 4AC9A 3SO3A 2FYQA 4X8TH 4ZKRU 1BBRH 1C4Y2 4I8HA 1BZXE 2BDHA 1C5YB 3NPSA 2A1DB 3M37A 1IQNA 3K6YA 3TK9A 3RXEA 1KXFA 1G32B 3K2UA 3Q3YA 3RC5A 1ZYOA 2FTLE 3FP7E 1TLDA 1B0EA 4Q7ZA 3LGUA 1SFIA 1CHOG 1C1PA 1GBMA 1ANCA 2ZCHP 4KKDA 3RC4A 1ZMLA 3RXOA 3MH6A 1SLWB 2YNAA 3RLYH 1O3LA 1JMOH 6GCHG 3BTKE 5JBCS 1YPMH 5I25A 3W94A 3E8LA 1YYY1 2ZGBH 2A4QA 4FVBA 1TX7A 2Y82A 2GCTB 1NPMA 1O2QA 3U28C 1AO5A 1KDQA 1O3NA 2ZI2H 1BCUH 3DFLA 5DGJA 1P2NA 2FWWA 1WXRA 1O5GH 3KQEA 2Q6FA 3PTNA 1WV7H 1KTSB 2R2WU 1FPHH 3QZRA 1N8OC 2VU8E 2VWOA 3PWCA 1HXEH 1ZGVA 3SU5A 1O3OA 1CA0B 1WQVH 1D3PB 2BM2A 1MKWK 4J1YA 1QURH 1GHBF 2CF8H 2OC8A 4CR9A 2ZGHA 5FPTA 1P0SH 2UWPA 2P94A 2ZGJA 3EE7A 2G4TA 3H7OA 3OX7U 2AERH 4X0WU 7ESTE 2VWLA 1LCYA 3SYJA 1PQAA 1Q2WA 1IHTH 2ZKSA 3MFJA 3ZIAD 2ZFQH 1K22H 1C5UA 1GHYH 1YPHE 2ULLA 1P2IA 1LQEA 2VGCB 2Z94A 3RXCA 3TH3H 1RXPA 1EOJA 1O3HA 2B0FA 4INHA 1HYLA 1V2VT 1WU1A 1K1JA 4K5ZA 1ZPZA 3EA9A 3NZIA 2VBCA 2ILNA 3BG4C 2ZFRH 2EI6A 4JZ1A 1YWUA 3L3TA 1O2JA 3RXRA 2VH6A 1H8ED 1DWCH 2CF9H 1DWDH 3I77A 1MMJN 1KY9A 2AGEX 3DA9B 2OXSA 2C93B 4TY6A 2IPHA 2GV7A 5HXFA 3A85A 2FX6A 5H4IB 1SFQB 4X6OA 4UONA 1ELGA 2IN2A 1P03A 1THPB 1BMMH 4HGCA 3KF2A 2FI3E 3EAJA 1V2RT 2OC1A 4NA8A 5EW1H 3O8RA 7GCHF 1O37A 1YPLH 1S6FA 1O3IA 1FAKH 3C27B 1NN6A 3M3SA 1XVMA 1ELCA 2GTBA 3ATMA 4WY3A 4OS7A 4CRBA 4U30A 4D7GA 2Y5FA 1MZAA 1Z1JA 4NA7A 2A4OA 3AK5A 2SGEE 1PQ7A 1QB9A 2FO9A 1BUIA 1IQJA 5FXLA 3SU1A 1EPTB 4M7GA 1SPJA 1OWHA 1SC8U 2ZZUH 2YMSB 1NRNH 2G81E 4NSYA 2Y81A 3P17H 1S82A 1UTMA 1LVOA 5DK1A 4A1VA 3SHCH 4XDEA 3ZZ5A 1C5RA 3MU8A 4CR5A 1WDIA 3RM2H 1GMDG 1GL1A 1DWBH 4WF8A 2D8WA 4AG1A 2GZ7A 3ZZ7A 1TA6A 2RFKC 1GG6B 1DY8A 4F48B 4ABEA 1BDAA 1SGCA 2OC0A 3IWMA 4MNVA 4ZROA 2PW8H 2O8MA 1P9SA 1BMLA 4NIXA 1LVYA 1ELAA 3N7OA 3VB6A 1GCTC 3KGPA 3KQCA 3NXPA 4IN2A 1W7XH 4FU8A 3E90B 1SGQE 1GHXH 1O2UA 1NU9A 2HALA 1TNLA 2TIOA 4CBNA 1C2HA 2PUXB 3MNSA 2QF4A 2EEKA 3E16B 2W3IA 2XBXA 3BTFE 5AFZH 4YOGA 3A83A 2Z9GA 3G01A 2AMDA 4KGAA 2CJIA 2V3HH 1SG8B 2GCHF 1GMCF 3GDVA 2GDDA 3A7VA 3M7UA 3WY8A 1EB2A 4FETA 4OS5A 3OTPA 1XUIA 1XXFA 3LJOA 5EXLA 4D9QA 1O2LA 2F9UA 2GKVE 1KXCA 1LPGB 3T25A 2BQ7B 3LJJA 4GUXA 4XSKU 4BTIB 1AVGH 2BB4A 4KELA 1K21H 2BMGB 2A31A 4ZH8A 4JZEH 1SB1H 1FY8E 1ETSH 3HATH 1TALA 3SU4A 1O5FH 1PPHE 4A92A 3TGKE 4F55A 1K1OA 4E06H 2GZ9A 1LO6A 3P8OA 8GCHG 1YLCA 2Z9JA 1P2QA 4DG4A 1GBHA 2LELA 5ETXA 4WXIA 1SGDE 3DSPA 2GZ8A 2BDGA 1IQFA 1CVWH 1PPCE 4NSVA 1GI6A 1TPOA 5BPEA 1K1IA 3RXAA 5A0AE 3GDSA 1RFNA 1GHAG 4IMQA 3PLKA 1BTYA 3RXQA 1HCGA 1W3CA 1EAXA 2AYWA 3A7WA 1OWKA 4NA9H 1O30A 3QZQA 5EOKA 1HAIH 3OY5U 2KCOA 4E7RG 3RXDA 5CHBA 1P3CA 5A09A 1N1LA 1LKAA 4O3TA 3F3BA 2FLBH 4WH8A 1NFYA 4R0IA 2BD5A 1SLVB 4ZKNU 5A2MH 2BYAX 1X7AC 3SV6A 2ESTE 2QY0B 3ZVDA 1O36A 3LDXH 1E0FD 1OP0A 5C5NA 1SGRE 1GI4A 2PTNA 1E79D 1YLDA 1O2YA 2QF5A 2FI5E 3BEUA 1O3JA 1VCQA 1Z6EA 1O32A 4K8BA 4QT8C 1FZZA 4FUJA 1SVPA 3TK5A 1ZHRA 1LPZB 2G52A 1TNHA 3M3TA 2VIPA 3KYGA 3ENSB 1SOZA 1BBRK 4CRDA 1EZSC 1C1UH 2ZDVH 3I29A 4YTAA 1Q31A 2C4FH 1NY22 1KMHB 2RDLA 1QJ7B 3P95A 4D8NA 2F43B 3SUDA 1SR5C 1O3AA 3Q3XA 1YPHC 5E8EH 2BOKA 4R8TB 2VWNA 3R3GB 3GCHB 4ABFA 4AFSA 3F2GA 1D6WA 3MYWA 1KLTA 3GOVB 1DOJA 3OAAD 3VGCC 2IOTA 1NBME 2WSSD 2GDEH 1TX6A 1QQUA 1IQHA 2O8UA 4H42U 1SGFG 5C20A 3LC3A 1HFDA 2GMTC 3OTJE 2VH0A 1DS2E 1IQEA 1Z8IB 1DICA 4I86A 3SQEE 3BG8A 3GY8A 4HFPB 2ZWLH 4ABBA 1EUFA 2H9TH 5TJXA 2FODA 3PV2A 2J98B 4YO9A 4JYVH 1SGPE 4X1QU 3SGQE 2WUCA 4HG6A 3P92A 2WPJS 3HGNA 4BAKB 4YM9A 1A0HB 1D9IA 2ZHFH 3KYFA 2D1JA 3QTOH 4I8KA 4MG3A 2W26A 1BBRE 1O5AB 4FUDA 2XCFA 3SNDA 2QGRA 2FDAA 1SGEE 2ZQ2A 2F9BH 2BY8X 2F9VA 3TH4H 2P95A 4K1TA 3F9EA 2FS9A 1Z6JH 3E0NB 1MZDA 3A8BA 2KM0A 1SQOA 1NFXA 2H9HA 1CT0E 3RM0H 3TJOA 4E7NA 3TITA 2OQ5A 1TMUH 4JZDH 1EPTA 2G55A 4Y11E 2Q6GA 3KQ5A 5CDFE 3O8CA 1KLIH 3ATWA 3ITIA 3UQVA 1VCWA 3EYDA 2EQNA 1S5SA 3LOXA 1K28D 3I78A 1F0UA 4K2YA 3UR9A 5K0HA 3CS7A 3GISB 4MLFB 2CXVA 1H1BA 4RKJB 1GI1A 1BOQA 4FUCA 2P59A 4X2YA 1DUAA 1E1QD 4WJG2 5CMXH 1HPGA 2JETB 2QF0A 5FBIA 2BY6X 2SGQE 3U8OH 3ESTA 3QGNB 3QN7A 4ACBA 4ASHA 1YCPM 5EPNA 2FLRH 3RMLH 3RDZA 1MCTA 2P3TB 4D9RA 3GY6A 2OBQA 3MU4A 1VKYA 2OC7A 2ZO3H 1FIWA 1HBTH 2TGDA 3LT3A 3STJA 3WWFA 1F5RA 2XCNA 3BTEE 4JYUH 5T1VA 3TGIE 1EP5A 1P2JA 1PPEE 1ZLRA 1OSSA 2BOHB 3V7TA 2SNVA 3ZZDA 2UUJB 1V2PT 4NZQA 1P01A 3M5MA 3TJVA 3A8DA 1CGIE 1BQYA 1P2OA 2TGAA 3FN8A 4ISLA 4TT3D 1FN6A 5GNDA 5DO4H 3SV9A 1H9IE 1ESTA 2ZU1A 5FX5A 3VXEH 4O03A 1BT7A 1C1QA 2V6NA 3RMNH 3IG6B 1CGJE 1ZTLA 2TPIZ 3ODFA 1AFEH 4XE4A 1NU7B 3BTGE 3KL6A 5LPFA 1MD8A 5JB9S 1P2MA 4GPGA 2OINA 1DPOA 3S7KB 2WPLS 1EXFA 2CGAA 1GI8B 4INKA 4U32A 2ZU5A 2PGQB 4BNRA 1BIOA 3WWBA 4VGCC 4GCHF 2G5NA 1HJ9A 4AFZA 2GJGA 1GJ5H 2CV3A 1GBBA 1CA8B 5DP4A 2UWOA 4AORA 3EE0B 1JXPA 2AMQA 3NK8A 1GDQA 3SN8A 1TQ0B 1GGDC 1RIWB 1N6XA 1KXEA 4Z6AH 2XYAA 4MPVA 4I31A 3M5NA 3PV4A 3FO8D 5ESTE 4MNWA 1Z8RA 1OS8A 1EOLA 2P8OB 1SGNE 3TU7H 1L0ZA 2Z9LA 4FUHA 9ESTA 1C2DA 1J9CH 1CBWB 4FU7A 1FUJA 5C94A 2OCVB 3BTDE 3LPRA 2R2MB 4H4FA 2VVUA 1PPZA 2WV9A 1FDPA 1TONA 2XWAA 4ISNA 4INLA 4TYDA 1BTWA 1BTPA 2BVRH 2TRMA 3SZEA 3PLPA 1FONA 4FUEA 2ZEBA 1P06A 1TABE 1EB1H 1EX3A 2VVVA 2ZFTA 1HJAB 2WINI 5SGAE 2A45B 1MTVA 2BY7X 7GCHG 3Q3KA 2FIRH 1MU6B 1D3DB 2AFQB 1UCYH 5L2YH 5DJ7A 1BRBE 1ESAA 5C1YA 2BZAA 1A5IA 1O5EH 3E0PB 4DGJA 2KCPA 1AN1E 5HM2A 5LGOA 3N7DA 4CRGA 5HIYA 1LHEH 2ANYA 2I6QA 4ISHH 1H4WA 3ZZCA 2ASUB 2BZ6H 4UFDH 1XKAC 2ZF0H 1GHWH 3ZVBA 3DCLA 1OYQA 2CN0H 3BTHE 1ELFA 3TNTA 2BD9A 1CO7E 2ZHWH 3PMJA 3F9GA 1GJAB 4I32A 4K8YA 1OHHD 4X2XA 3HK3B 5HKKD 1J14A 1Y5BT 3SNBA 3RXSA 4MNXA 3A81A 5EJLA 4B71A 2J98A 1L4DA 1EASA 3ODDA 1UTOA 1T8LA 3FP6E 3PMHB 2O8LA 5A8XA 2C3SA 3GCTF 1RTKA 2QF3A 4NIYA 3V12A 5K7RA 1QJ6B 4D76A 3ZZBA 4LOYH 4K60A 3MH7A 2B8OH 1VGCB 1GMHG 4BTUB 3UNSA 3ZVAA 2VIOA 1C5TA 4X2WA 2Q1JA 1O2VA 1P57B 3E91A 3TJUA 3TGJE 3GY4A 1MD7A 1DFPA 1T4VH 1MUEB 4UEHH 4XD7D 4OS1A 5GCHG 3PM3A 3UFAA 1F5LA 1C5WB 2G8TA 2RDEA 2FOGA 1YPJH 2UWLA 4CRFA 1XX9A 2SGFE 1O3DA 3F9HA 1EFRD 1H9HE 2WV5A 2P93A 3EA7A 1EKBB 4X1RU 3STIA 2R3YA 5IYTA 1HAVB 5CHAB 3V0XA 1YKTA 1UK3A 3FANA 1SGFA 2LP6A 1UTLM 3NKKA 3A84A 5FHTA 5GIBA 1GCDA 4AGKA 1FNIA 2ZGXH 1LMWB 1O2WA 1C5QA 2Z9IA 3UTUH 1S81A 2ZDNA 3PB1E 3SV2H 1HUTH 1O33A 1ZHPA 1EAWA 1RJXB 4TPIZ 2PR3A 3CNRA 4MDSA 4B2AA 5KEDA 3IITA 1MTWA 2P3FH 3ZVCA 4A1XA 1GI5A 1QR3E 1UK4A 4JMYA 1GBJA 1QB1A 5FPYA 2J34A 2EY4C 2XRCA 1ZSKA 1D3QB 4UD9H 1LHDH 4UDWH 3A8AA 2WUBA 3RXPA 3R0FA 1O3MA 4ABIA 2A5IA 1BMAA 1NRQH 3T29A 3HKIB 2HPQH 3AAVA 3PROA 4IC5A 4AZ2B 2C90B 4IGDA 1LVMA 5CE1A 2BDCA 1HB0B 2C8ZB 2A7HA 4OM9A 2FZZA 1AWFH 3UUZA 5C67A 3OFND 3ZYDA 2JH6D 1B7XB 3ZVFA 1NO9H 5E0GA 1GPZA 5EXNA 2F9PA 2PTCE 2Y6TA 1TNKA 3MO9A 2WV4A 4O3UA 1V2UT 1EP6A 2CK3D 3SI4H 1O2RA 2YNBA 2BLOA 2RG3A 1W12U 4ESTE 1FLEE 1GJ4H 4CHAC 1OWIA 3UR6A 4CREA 3PRDA 3JZ2B 2R3UA 2D2DA 1EAIA 2BXUH 1EAUA 2NU1E 2PSXA 1P12E 4RI0A 4ZUHA 2PWXA 5A0CA 2C8WB 1MH0A 1ZMNA 3UPEA 2HLDD 3BV9B 1MAXA 5E2OA 1N8OB 1F0RA 1TNIA 3U8RH 3SHAH 1OX1A 1A5GH 1WBGB 4UE7H 1AFQC 5EXMA 1MTNB 2ALVA 1HIAB 2JJ2D 1WTGH 3SJOA 2F4LA 3BIVH 3HGPA 4U2WA 1NRRH 3RXBA 3BTTE 4SGAE 2ANMH 3FOAA 1EJNA 1IQKA 3A87A 1T31A 5DP3A 2XOKD 4ZXYH 1GDNA 6CHAC 1SBWA 1JIRA 1S0QA 1PPFE 1FY3A 4CBOA 1ESBA 1TOCB 4DT4A 1OPHB 4GVUA 3ATKA 1W0ZU 1W10U 1V3XA 1FPCH 4AB8A 3ZVGA 3BG4B 4MTBA 2B7DH 1YY3A 1CHGA 3DT0H 1V2LT
chains in the Genus database with same CATH topology
1XUKA 3TIUA 1AUTC 2ZA5A 1ZOMA 2ZPSA 4ZHMU 2NU2E 1WCZA 1TE0A 1KXAA 1ZSJA 1W11U 1MU8B 2GD4B 1V2MT 3A7TA 1RS0A 2G4UA 1ZJDA 4TWYA 1YPGH 1HAZB 1VITG 2WPHS 4YLQH 4AFQA 2CMYA 5A0BA 1L1JA 1O2MA 3QLPH 3A7ZA 4FXGH 3M7QA 1Y3YA 8LPRA 4ISIH 3EDXB 4AG2A 1NZQH 1LDTT 1GVKB 8KME2 5F8ZA 5FBEA 1C1RA 1CT4E 1F5KU 2DUCA 5JPMH 1QB6A 1O3CA 2HNTE 3NUMA 3SGBE 1TNGA 1ZGIA 3FAOA 2AIPA 3P8FA 1YGCH 2BLVA 2HRVA 3VB5A 3A80A 4OS2A 1C1OA 1O35A 5DP7A 3K6ZA 4X1SU 1IAUA 1G2LA 1GI7B 4WMDA 3Q76A 1LQDB 2QCYA 1GBKA 5AHGH 3QX5H 3MMGA 2J4IA 1L1NA 5E0JA 5L2ZH 3HKJB 2CHAC 3MNCA 1N6YA 2B5TB 2P3UB 1YP9A 1HXFH 1BA8B 1LVBA 1TBZH 1C5PA 2ZTYA 3V3MA 1CHOF 1GCTB 1XUHA 1W8BH 5FAHA 5T3HA 1PFXC 1GI2A 1UCYK 1Y59T 3V13A 3H7TA 6GCHF 4HI3A 2XC5A 3RXIA 4U01A 3TJNA 3GY2A 4WH6A 1WTHD 1ETTH 1FY1A 4TPYA 5GPIB 2PFEA 3SUFA 4ZHLU 1RTFB 3U69H 1HAVA 1S84A 2BD7A 3SW2B 1GBEA 3BIUH 2R0LA 2ZGCA 1JBUH 1GDUA 1BRUP 3E6PH 4LZ4B 1O39A 1F0SA 2YOLA 3QO6A 1EZUC 2O8TA 1O2PA 1G36A 3UOPA 4K1SA 3P70B 1W14U 1GBIA 1QGFA 1AB9C 2DE8A 2GT7A 3BTME 4Y0YE 2XBYA 2QYIA 3RXMA 3RU4D 1Z8GA 1NS3A 4I33A 4BAMB 1WOFA 2PV9B 2ALPA 4ABAA 2Z3CA 2NU0E 5A8ZA 1SGTA 1C5OH 2Y7XA 2GP9B 4KTCA 4BOHA 2KAIB 3ATLA 1BB0B 2VIDA 5F8XA 3BTQE 1M9UA 1V2WT 4DW2U 1TNJA 5F03A 3EGKH 4IC6A 4X1NU 1UCYE 2BVXH 1A61H 1FAXA 1E38B 1JIMA 2BD4A 1GJ7B 1LHFH 1QL9A 1O3GA 5JBAS 1ZRBA 3S7HB 1C5LH 1ZRKA 4JK6A 3QK1A 1VR1H 2HOBA 4K3JA 5C1UA 2WYGA 3RMMH 6ESTA 2FYRA 3U98H 1GBAA 1UO6A 3D62A 1BHXB 2BLQA 1TPSA 4YESB 2XC4A 1AKSB 1C2GA 1TMBH 3OU0A 4NCYA 4HZHA 1FV9A 3MI4A 1ANBA 1XMNB 3UQOA 1AVXA 4ABGA 1ARBA 3PO1C 3S9AA 2ODYB 3PLBA 3QTVH 1O3EA 2ZU2A 3MU5A 4FUBA 2ZPRA 2SGAA 1BRAA 1HIAA 5JBTA 3P6ZB 1NM6A 3LONA 1Y5AT 2ZDKA 1O3KA 1TGCA 4AFUA 1TPPA 2C8XB 3L33A 1OOKB 2JKHA 4LK4A 1ZR0A 4A5TS 1CU1A 5DPAA 4UFGH 4Y8YA 3GY7A 3VGCB 2FM2A 1VJAU 3OSYA 2AGGX 1EATA 1E37B 1IQMA 4BXSA 4X6MA 1DANH 4O97A 5C5OA 1XVOA 2PKSC 1A7SA 2GMTB 3GY5A 1C9TA 1XXDA 1AHTH 4XBCA 3ZYEA 3ZZ6A 2FPZA 3KQDA 1T8MA 2W7SA 5EPYA 1TGNA 5F6MA 1LTOA 1SGIB 2ZECA 3F6UH 4X2VA 5F8TA 3O8BA 4FUIA 2Q6DA 1AZ8A 1T7CA 2F91A 2F83A 1GI0A 4JCNA 1CQQA 2C8YB 5T6DA 5I46H 5IDKA 2FESH 2D26C 1WYKA 3SV7A 3Q77A 1TRYA 1DE7H 3ZVEA 1OXGA 2BDYA 3O8DA 4JYTA 2BDIA 3UWJH 1C1WH 1Z8JB 1T8NA 4MNYA 1EJAA 2SGDE 3OYPA 3SGAE 2QAAA 2F9NA 1FQ3A 1Y5UT 4MVNA 1C5SA 4SGBE 4GSOA 3SNEA 4NG9H 3HPTB 1G37A 1NRSH 4KTUA 3RU4T 1ARCA 1GL0E 4FU9A 1B0FA 1QNJA 8GCHF 3A8CA 1ABIH 3RMOH 3FZDA 1O34A 1U6QA 1UVTH 2I6SA 1AZZA 1HJ8A 1INCA 1GBCA 1C4V2 3S9CA 4LZ1H 1GHBG 4Q7XA 3DD2H 2ZFPH 1GHAF 1F92A 2ZTZA 4A6LA 1J8AA 1NC6A 1XM1A 3TH2H 1TOMH 3U1IB 1C5MD 3A86A 2QIQA 4H6TA 3F9FA 4BAQB 1DLKB 2OTVA 1C1VH 3BTWE 3SU6A 4IS5A 4GAWA 9LPRA 3U9AH 3VB3A 5PTPA 3UIRA 1BHXF 3M5OA 4FUFA 3T62A 3LGYA 1T8OA 1C9PA 1GJDB 3SOSA 3P8GA 1HJAC 3FFGA 1MCVA 1Y8TA 1IHSH 2FXRA 1KYNA 3GYMA 4WVPE 2BY9X 4AYVB 1GBDA 5FX6A 2ZC9H 2QV1A 5DP9A 1NTPA 1QBVH 1Y3UA 2ZCLP 4TY7A 4BAHB 1PQ8A 1A0LA 4Y6DA 1GVZA 1AU8A 2Y7ZA 1GWAA 1Y3VA 1V2NT 1K1LA 3QGJA 4Y71A 5GJ4B 1G3EA 4ABJA 1G9IE 4WMFA 4B75A 2KAIA 2GX4A 4I8JA 1GBTA 1ZMJA 4WMEA 1C2LA 4KTSA 1TGBA 4ZXXH 1GJ9B 2PGBB 4VGCB 2BVSH 4I8LA 3RXLA 2V35A 1ZTKA 2FOCA 3LGWA 5DP8A 1SSXA 3SNCA 1P02A 2ANWA 1DY9A 1UTJA 1GGDB 1HAYB 1L2EA 1P9UA 1H8IH 3A7YA 2A7CA 5C3NA 5DG6A 1DT2A 1MKXH 2ZHEH 1TFXA 4AGJA 1O3FA 2J9NA 4CH8B 1CGHA 1E34B 1C2KA 2OD3B 1AKSA 1ELDE 3SU0A 5A8YA 5EQRA 1QRZA 1QY6A 1KLJH 3HK6B 3RP2A 1TYNA 4DT7B 3ELAH 4NWLA 4RKOB 4UFEH 1IQLA 1PPGE 1TB6H 3KQBA 4OGXA 1C1TA 3T2NA 5LH8A 1P04A 3M61U 5EODA 5HMAA 1EQ9A 4XFQA 4K69A 5EGMA 1ID5H 5EU8A 3SJIA 3SU2A 3E1XB 4MPUA 1J15A 2Y80A 4XBBA 4B2CA 1YBWA 1NRPH 2GCTC 1HV7A 1AIXH 1SGYE 1DSTA 2FOFA 1IQGA 1RRKA 2Z3DA 4GHTA 2M5TA 3AASA 5EG4A 1EJMA 1W0YH 2GCHG 1GMCG 3H5CB 1T32A 2VVCA 1ZPBA 3S9BA 5G4BA 4I8GA 4NIWA 4ZAEA 2AIQA 1AE5A 5GWZA 1CA0C 1BRCE 4BANB 3SZNA 2HNTF 4TWWA 3PWBA 5J4SA 2XTTB 1W7GH 3M7TA 1QCPA 1KSNA 1C2MA 2H1UA 3KEEA 6LPRA 1P11E 2SFAA 1O2KA 1BJUA 1ELVA 1DVAH 1THSH 3SJKA 3CP7A 5TCCA 1ZPCA 2V0BA 1IOEA 2Y5HA 3MH5A 1TWXB 2VGCC 3KN2A 4ZKOU 1PYTC 2OQUA 5L30H 2ZG0H 5DKMA 1DXPA 2EI8A 2GGVB 3C1KA 2WPKS 2AGIX 1W13U 1AUJA 1RTLA 3MWIU 1QHRB 5DP5A 1TQ7B 2ZCKP 1O3BA 1C1SA 1EZQA 3MH4A 1P09A 1O2IA 3D65E 1MTUA 2QXIA 1UMAH 1GJ8B 2PUQH 3MO6A 3BEIB 3QDZB 2P16A 4JZFH 3D49H 3RXVA 3LGTA 2Z3EA 1IQIA 2A7JA 2Y5GA 2Z7FE 4NFEA 1MTNC 2ZHDA 1P3EA 2QXHA 2XBVA 3Q00A 3MTYA 1TBQH 1SMFE 1C4U2 1UK2A 3M5LA 3MU0A 1SL3A 1AMHA 2UUFB 3K9XB 2GVFA 4CRCA 1NFUA 1DUEA 1QBOA 2ZNKH 1KTTB 2VIVA 3EA8A 3F68H 4NGAH 1G2MA 1V2KT 2BX3A 1E35B 1RGQA 1EPTC 1A46H 1FI8A 2TGTA 1KXDA 4ABHA 3RXGA 1P10A 1WUNH 1W2KH 3GICB 4Y10E 3B23B 1O5DH 4D7FA 4OS4A 4XOJA 2Z6BD 3S69A 2QXJA 4NIVA 5EQQA 1C5NH 4F49A 1GJ6A 1GG6C 2XBWA 1K2I1 3KNXA 2XXLA 2QA9E 2A4GA 4YT7H 5JYIA 5BRRE 2OUAA 4IBLH 1RD3B 3GDUA 1ANDA 4B2BA 2AS9A 1O2OA 1PQ5A 2XW9A 1J17T 5DP6A 4CHAB 1Z71A 2ZDMA 2SNWA 1Z1IA 2BQWB 4Y7AA 3RXTA 1SLXB 1MAYA 1Y3XA 3UY9A 2NWNA 1QQ4A 1ABJH 3K65B 1O2HA 1A3BH 3URCA 2EA3A 1DWEH 2HVXA 1AFQB 3PTBA 5JB8S 2JH5D 2VIQA 2J95A 2H5CA 1UHBB 2G51A 2PLXA 2BX4A 3RC6A 3ZZ8A 3SJ9A 3VEQB 1AY6H 3RXHA 1GVLA 2UUYA 3MHWU 3FZZA 1ELTA 4X6NA 1TGTA 1K9OE 6CHAB 4ZKSU 1VITH 4ZHAA 2WPIS 3TVJB 2W5EA 4AB9A 1MQ5A 1VCPA 1G3BA 4CRAA 1AI8H 3BEFB 1GMHF 3JZ1B 4LXBH 4OGYA 3BSQA 1GI9B 5T6FA 3SV8A 1BMNH 3RXJA 4IN1A 1HRTH 3PMBB 4X8UH 2PHBA 5JBBS 3UOUA 4B1TA 1ACBE 5GCHF 1GBLA 1BTZA 4DY7B 1WSSH 1HAPH 1S0RA 7KMEH 3MNBA 2QC2A 2A2XH 4YLUA 1FXYA 4CH2B 1L1GA 4THNH 3SJ8A 1G3CA 3A7XA 3A82A 1LKBA 1A5HA 3URDA 2W7UA 4AOQA 1ELEE 4Z0KA 2ZIQH 2STAE 5TCAA 1CT2E 2ZFFH 1ANEA 1DDJA 3RU4E 1TA2A 2O8WA 1QTFA 4YOJA 1DSUA 4NFFA 3ATIA 1THRH 1MKXK 5AFYH 1S6HA 2FTMA 3LH1A 4HTCH 4E05H 1UJ1A 1YCPH 1QFKH 1ZJKA 4ISOA 1NESE 1ZZZA 1OWJA 1HAGE 5E0HA 8ESTE 2SGPE 1PJPA 2ZHQH 3A88A 2AMPA 3T27A 4DCDA 3FP8E 4WXVA 4XBDA 1QIXB 3AAUA 2OP9A 1BITA 5ESBA 3T28A 2PKAB 1K1MA 2VIWA 4X6PA 3RXUA 2RA0A 3VB4A 1QRWA 2JH0D 1GHZA 3GCHC 4GHQA 4UFFH 2CHAB 4DIHH 1ZSLA 1H8DH 3GYLB 4GCHG 3NCLA 1YPKH 3SBKA 2A5AA 2G5VA 2FOBA 1JWTA 1NT1A 4DJZB 1UTPA 5GXPA 5C1XA 2BD8A 1GHVH 3EQ0H 4X1PU 3B8JA 1O0DH 1LHGH 1P8VC 4GLYA 5AVDA 3AW0A 2STBE 3KHVA 1FIZA 1UVOA 2BD2A 1G3DA 4KP0A 1QJ1B 1FY4A 1V2TT 1GJBB 2FOAA 1FMGA 1D6RA 2QXGA 1JOUB 1YM0A 1O3PB 2EI7A 1ZTJA 3MOCA 1Z7KA 3TNSA 4OS6A 1FJSA 2R0KA 5FCRA 2H6MA 1UVUH 1SQAA 2A32A 3L6PA 1DX5M 1P05A 1FY5A 1AGJA 1QA0A 4FVDA 1AB9B 4A1TA 2ZP0H 2F3CE 2B9LA 2NU3E 2DE9A 3SUEA 2A0QB 2FS8A 2WPMS 2BLWA 1QRXA 1O5CB 1YF4A 1DLEA 4PROA 5E2PA 4I7YH 2J94A 4B74A 2Z9KA 1TIOA 3LH3A 4NZLA 4AX9H 2ODQA 4X8SH 1Q3XA 4YZUA 3SQHE 2HLCA 1O2NA 2RCEA 2VB0A 5L6NH 1V2QT 1HAXB 3RLWH 3M36A 1TRMA 1DM4B 3MNXA 1JRSA 1D4PB 2TGPZ 1UVPA 2TBSA 2JETC 2HWLB 1A1RA 3U8TH 2VWMA 1HGTH 1A4WH 3S0NA 1V6DA 1O2SA 1WAYB 1GMDF 4DOQA 5AF9H 1AD8H 1H9LB 1C1NA 2PSYA 1C5XB 4WWYA 3TPIZ 1MKWH 2FEQH 1F0TA 1SLUB 1C1MA 1AQ7A 3LGIA 3VPKA 2BQ6B 4MQAA 4DIIH 2OLGA 1TMTH 3GCTG 1VITF 4B73A 2BDBA 1BTHH 1EZXC 1FN8A 3AVZA 1CE5A 4Y8ZA 1TAWA 1WQSA 2G00A 2XWBI 1K1PA 1L4ZA 1JRTA 1NROH 3PO1B 2UUKB 2VINA 1P2KA 4H6SB 1HDTH 4FUGA 1C2JA 1F7ZA 3DUXH 3LC5A 1S85A 1O2GH 2R9PA 4Q7YA 1Y3WA 4Y76A 1UHBA 3P8NA 4BXWA 4K1EA 2H9EH 4BAOB 4A7IB 1K1NA 3BF6H 1KDQB 2HNTC 3TLOA 5GDSH 1OP8A 2J2UA 1HNEE 1OYTH 4JZIA 2AEIH 3VXFH 3SNAA 3RXKA 3D23A 3LU9B 1VJ9U 3BN9A 3M35A 2ZQ1A 1O2XA 4Q80A 1A3EH 1V2OT 1XUJA 4X8VH 2PKSB 2BD3A 3CS0A 1XUGA 1DITH 4DVAU 1QL7A 1C2IA 1O38A 3DHKH 1RIWC 3OY6U 5FPSA 1O2ZA 4Y7BA 3VFEA 2BXTH 3UNRA 2QN5T 1PYTD 1XKBC 1CSOE 4MPXA 2P8OC 2ZTXA 2O9QA 2VNTA 4IW4E 2XC0A 1V2JT 5EW2H 4IMZA 2LPRA 5LPRA 1CBWC 2ODPA 2ZU4A 1OP2A 4ZMAH 5ABWA 2OBOA 2FOMB 1GBFA 1KXBA 3VB7A 2H2ZA 5C2ZA 2LNCA 3W95A 1SI5H 2XNIA 2ZDLA 1NFWA 1ZHMA 1AE8H 1BJVA 1UTNA 2A2QH 3UNQA 3KIDU 3ZV9A 1UTQA 5FCKA 2GT8A 1LHCH 1MBQA 1V2ST 3LIWA 3RXFA 3QUMP 3GCOA 1C5VA 2AH4X 1D3TB 3E3TA 2BDAA 1O2TA 3T26A 3B9FH 1HAHH 1A2CH 2PKAA 1GI3A 2FP7B 3ZZAA 5HYOA 5JDUB 2ZU3A 5HM9A 2ZPQA 1SHYA 3DFJA 2IJOB 1AVWA 4DURA 4AN7A 2ZDAH 1QBNA 5LPEA 1MBMA 3UWIA 3KCGH 2J38A 3T5FH 2NU4E 1PPBH 1MQ6A 3LKWA