2NU0E

Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i, and tyr18i
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
b'ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B, Protease B
publication title Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I, and Tyr18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu0E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu0E01
1F5KU 3LGWA 4FUBA 1S0RA 1XUFA 1KXFA 3M5OA 1O36A 2ZKSA 3ATMA 3MMGA 3UFAA 4FVBA 1QURH 2ZDAH 1KDQA 2FPZA 2GT7A 2ZO3H 1MD8A 5GJ4B 3RLWH 1DM4B 2VVCA 1DY8A 2EC9H 4ZH8A 2PKAA 3MU0A 2HPQH 4GSOA 3LONA 3ZVFA 5EPNA 3OTJE 2DE8A 5FX5A 3T62A 3TK5A 1CT0E 2OC1A 1GHVH 1HAYB 4GHQA 1IQEA 1ZMLA 4TYDA 1D4PB 1F0SA 1HAVB 4BNRA 1LVOA 1IQHA 5DKMA 1KLTA 5C5NA 2R3UA 3ZVAA 3H5CB 2ANMH 1GMDF 2C8WB 4TWYA 3RXUA 1S0QA 3VXEH 2BDYA 2TIOA 1WU1A 1ABIH 2ZNKH 5FXLA 3ATKA 2XCFA 1H9HE 1DUAA 1QBNA 1AUTC 1EXFA 2HALA 1SLVB 5EPYA 2OBOA 4K1SA 1OWHA 3RXPA 4DY7B 2Z6BD 2BYAX 1ANBA 2B7DH 1K28D 1QFKH 2FDAA 2VIPA 1TX7A 4ZUHA 1Q2WA 2THFB 2ZHFH 1Y5BT 1DXPA 5JB8S 1MCTA 1O2IA 1AVGH 2OTVA 1O5CB 1LPGB 1BRBE 5CE1A 4AG1A 2BZAA 3SNAA 3RP2A 1GCTB 1LKAA 1IOEA 5ABWA 1GMDG 1XUGA 4CH2B 3R3GB 4MPUA 2P94A 1AWHB 1GBLA 1ZSKA 4O9VA 1WOFA 2A31A 3FZDA 2C93B 4B2AA 1A1RA 2GVFA 4MPVA 5EXNA 8GCHF 1IQNA 3SN8A 1VR1H 3A7VA 1E0FD 2BTCE 3SO3A 3SV9A 4B75A 1HAPH 3SU4A 4BAKB 3PLPA 3P17H 4X1RU 1EQ9A 1EX3A 1JWTA 1D6RA 1BB0B 3ZZCA 1NZQH 1AI8H 2PKSC 4X2WA 1P09A 4FXGH 4TWWA 1FNIA 1AFQB 1O2ZA 1UCYH 1B7XB 3ZZ8A 2F9BH 5TJXA 2FOGA 1F7ZA 3Q77A 3GCNA 1O3FA 1SGEE 5DPAA 1NU9A 2FLBH 1G3BA 1NM6A 4CR9A 1TPOA 1AGJA 1QNJA 3RXMA 1IQJA 1KIGH 4WH8A 5LPRA 2D2DA 1RJXB 3STIA 1O2HA 1CSOE 8GCHG 1YLCA 2FLRH 1ZTKA 2OXSA 3F68H 2WUBA 5BRRE 3LH1A 5E0JA 1TNKA 2BD9A 3B9FH 1BOQA 3SBKA 2LNCA 4JYUH 1G30B 3RMLH 1HJAC 2A2QH 4JZEH 7GCHF 1O2PA 4ABEA 4FUJA 1OYTH 4ZKOU 4Y8YA 1O3HA 1DICA 2XC0A 4U32A 1BIOA 3BG4B 1WBGB 3QGNB 3DD2H 2W5EA 2BDGA 2C90B 3UUZA 2P93A 2ZHQH 1SGTA 2FX6A 2VINA 2NU1E 1VITF 1C1WH 3MTYA 1QL7A 1EZQA 2ZU3A 1TWXB 2TBSA 1WCZA 5B6OA 2ZDVH 2PV9B 1G2LA 2FOHA 1THRH 1C1SA 4NZLA 1Y8TA 3SUFA 2G5VA 6CHAC 2XXLA 3A7ZA 5F8ZA 2BDCA 1GHWH 4NIYA 2PR3A 3GCTF 4XE4A 2H2ZA 1UTMA 1KXCA 7GCHG 4B2BA 1XUJA 2F3CE 1GPZA 4B73A 4UEHH 1C5UA 4FU8A 4ZROA 1BHXB 1SB1H 2G4TA 1F0RA 1FIWA 1FY5A 1DLKB 1OWJA 1C4V2 1J17T 1EJNA 3EQ0H 1FXYA 1VITG 3BG8A 3TVJB 2W3IA 1BRCE 2NU3E 2WPHS 3D65E 3QO6A 1Z1JA 3LJOA 1JBUH 3GDSA 1MTNC 4NFEA 3URDA 1O3LA 4E7RG 5JBTA 1IQFA 2AIPA 1DX5M 2ZGCA 2ZGJA 5FPSA 2ZHWH 3VB5A 2KAIB 1C5RA 3RXIA 1DXWA 1C1QA 5FX6A 3QN7A 2O8MA 3Q76A 2SGPE 3SU2A 4X2VA 3SNDA 1AWFH 2ZDMA 1BZXE 1SOTA 1CU1A 1CHGA 2HLCA 1EKBB 5DGJA 3SGAE 1ARCA 2FI4E 4AN7A 4KGAA 1C9PA 1O5EH 4GLYA 2G51A 1C2HA 1UTQA 1NTPA 2F9VA 3O8RA 1MU6B 1WUNH 2SGQE 4BAHB 4K8BA 2AH4X 3OYPA 1Z1IA 2OC0A 3BTDE 3S0NA 2A4GA 3PTBA 4A6LA 2A5KA 1K1LA 5FHTA 1T8LA 4ZKNU 3ZVBA 3LGIA 1GDQA 1SLXB 4A92A 1O3EA 2R9PA 3ESTA 4NG9H 3EA7A 5LH8A 1A5GH 1O3MA 1FQ3A 3SU3A 5LPFA 1OPHB 4JZIA 1O5GH 3QLPH 1GI3A 5A8XA 2GP9B 1W8BH 3KQCA 1O3PB 1GL1A 4X8UH 2BY5X 2Q6GA 1YCPK 3HK6B 3NCLA 3BEIB 1C2MA 1CE5A 1ETTH 3UOUA 3ZZ7A 2HVXA 5H4IB 1ZPCA 4AYVB 1OP2A 1HAVA 3F9FA 1O3OA 4ISHH 3Q3XA 2TRMA 1LQDB 1FAXA 3BTGE 1YYY1 4DVAU 4KP0A 3D49H 4B2CA 1CA0C 1P01A 3SGBE 4INHA 5JB9S 1XVOA 1C1RA 1ZMNA 1FDPA 1C1OA 1C1UH 1TBQH 2PWXA 2AERH 1MKXH 1EZXC 3RLYH 3D23A 5A0CA 1DS2E 3MFJA 5EQSA 2PUXB 2ZI2H 3GY4A 1SVPA 2VH0A 3A7XA 3GY7A 4NA7A 1G3CA 2BX3A 3OY5U 2FO9A 1GI5A 3A80A 5C20A 1CGJE 2BQ6B 1VGCB 5DP4A 1WSSH 3FZZA 4UD9H 1HBTH 1QRZA 3LOXA 1JIRA 2UWOA 4X1QU 8KME2 4YTAA 5DJ7A 1S5SA 1SQOA 4DIIH 4IW4E 4JZFH 3PWBA 2VVUA 3FP6E 2Z9LA 4WXIA 4Q7ZA 4MPWA 4B74A 2RDLA 1EAXA 5A2MH 4UFFH 4JZ1A 3SQHE 2AEIH 1BCUH 2H9TH 4MNXA 5PTPA 5C1UA 1GHXH 1OSSA 1GGDB 4D76A 1GBMA 5ETXA 3A89A 4XFQA 1GMHF 3RC5A 1UMAH 1B0FA 4DW2U 2A4RA 1GI9B 1GJAB 2BLWA 1UTOA 2J95A 3OX7U 3VB4A 3UPEA 4ZHMU 1TGNA 4R8TB 1VCQA 1Y3YA 1KTSB 3E16B 3EGKH 1YP9A 4CBNA 4CRCA 3QDZB 4UDWH 5T6GA 3A88A 1TYNA 3T5FH 3TH3H 2IN2A 3QWCH 1MCVA 2FM2A 1UTLM 1N8OC 3AAVA 1GJCB 2RA0A 3LC5A 1MKWH 1SGDE 3VB6A 1TPSA 1O2OA 2BOHB 1LVMA 4CHAC 2ALVA 4ZKRU 1P0SH 1GMHG 1O3AA 1QR3E 1A61H 4IC6A 1GBKA 1THPB 3ZV9A 1XMNB 3PLBA 2VWMA 3ODDA 3M7QA 1ELFA 1VCWA 3AAUA 2YNBA 1Z8JB 1P2MA 1T31A 1V2JT 3ZYDA 3UNSA 1DFPA 1QQ4A 3SNBA 5A0AE 1W13U 1GL0E 2SGDE 1VZQH 3NWUA 1Y59T 3V0XA 1NT1A 1O30A 2DE9A 1Y3UA 4FUHA 1DANH 2GCHF 1LCYA 3QX5H 4AFSA 2JH5D 2Z94A 1TGCA 2J9NA 5FPYA 1ETSH 2D1JA 4ZAEA 1QA0A 5E2OA 1EB1H 4NIXA 2CJIA 2GZ7A 3A7YA 1WV7H 1O5AB 1BUIA 2F9PA 1P8VC 3P8OA 1TMBH 3K9XB 1CQQA 2A7CA 5AFZH 2TGPZ 5GCHF 4WMEA 1UK4A 1T4VH 1U6QA 4X0WU 4Y7AA 3P92A 1DDJA 4UFDH 1CT2E 4ABHA 2VH6A 1HV7A 1CT4E 3TGIE 1HGTH 3FAOA 2FS8A 2GCHG 1NROH 2J2UA 1DLEA 2CHAB 1L1NA 1P57B 1SC8U 1QRWA 4ABBA 3RXAA 3RM2H 1EUFA 2QXJA 2ZIQH 3UREA 1OWKA 2B5TB 2W3KA 1SQTA 1V2RT 1GBHA 3PV4A 3TK6A 3T29A 1BJVA 4NWKA 1Z6EA 3PROA 3TK9A 1EOJA 2ODPA 5GCHG 4D9RA 2KAIA 1YKTA 3SJKA 1FN8A 1NO9H 3CS0A 3BTWE 1S85A 2ZGHA 3P6ZB 4GUXA 3OSYA 4JZDH 3MHWU 3PMHB 5GXPA 4IMZA 4GVUA 4IS5A 3NUMA 5TCAA 3MU8A 1QGFA 2Q1JA 3B23B 3SU1A 1P03A 2PKSB 4O97A 1AB9C 2FOMB 3CP7A 1C2DA 3S9BA 3V12A 1CGIE 3IWMA 4WVPE 3ZVCA 1C1TA 1J8AA 1TRNA 4A5TS 2ZCLP 2QXHA 1EASA 2AMPA 2H5CA 4IN2A 1FIZA 2XNIA 3SJ9A 4OS1A 1O38A 4I32A 3SW2B 3ZZ9A 3M3TA 3RXVA 2EI8A 3H7TA 3ZYEA 3CS7A 4YO9A 2VVVA 1GJ4H 1P10A 1ZYOA 3W94A 1MZDA 5IYTA 1T32A 4Y76A 1HYLA 1GBEA 1O33A 1BJUA 2JETB 1QY6A 4B76A 4JYVH 2BXTH 2FODA 1OWDA 1FPHH 1MAXA 2ZEBA 1ZHMA 1AE5A 1F5RA 1IQIA 2AS9A 1SGIB 3BF6H 3PLKA 1GI0A 3MNBA 3HKIB 3RXBA 3UNQA 4YOGA 3TPIZ 1JRSA 1BMNH 5EQQA 5K7RA 1FY8E 2BHGA 3UWJH 2UUFB 4HGCA 4KTSA 1G3EA 3LGTA 3GY2A 1LHFH 2GDEH 2VIDA 3PMBB 2OLGA 1GJ6A 4ABFA 2TGDA 1GI6A 2CF9H 5EGMA 6CHAB 1VJ9U 1YGCH 5E0GA 3LT3A 3MNCA 2BQ7B 1S6FA 4NFFA 4SGAE 4JYTA 4NZQA 1HAOH 3R0FA 4CREA 2G4UA 1XKBC 1GVKB 4X1NU 2LPRA 1TA2A 2QY0B 2Y7ZA 3ZVGA 1TFXA 2OC8A 5FCRA 1H9IE 1BHXF 1HJ9A 1GG6C 3S7HB 1O2SA 3K65B 1W3CA 3KF2A 4X2YA 1FUJA 4TPIZ 2SGEE 3RXTA 3M7UA 3EAJA 1GCDA 4KKDA 5CHAB 3O8DA 2ALPA 2AFQB 3KIDU 3SUGA 1FMGA 3MO9A 1A5IA 1SOZA 2FS9A 2ZU2A 2ZDNA 3A8BA 1ELGA 4D7GA 4FUDA 2GT8A 2SNWA 5A09A 3SV2H 2VIQA 1O5DH 4Y7BA 1TRMA 1EP5A 1TX6A 2GMTB 3BIUH 1UVSH 1BQYA 1GVZA 2BLVA 1CGHA 1P2NA 1V2WT 5C67A 1O39A 1NS3A 1T8OA 3SNEA 1C5QA 1K1NA 3VPKA 1HXFH 3E8LA 4D8NA 1WAYB 4ABGA 4XOJA 1PJPA 1ZGIA 3E91A 5C1YA 3S69A 1C5OH 3EA9A 3O8CA 5JDUB 2C3SA 1TABE 1NRQH 4YOJA 4BAQB 1K21H 5C3NA 2B9LA 5A8YA 4BXWA 1YCPM 3RXJA 3RXOA 2A4OA 1BITA 1JMOH 5I46H 3A87A 1W10U 4ISOA 2QV1A 1ZJDA 4ISIH 2EA3A 3PYHA 4Q80A 1E38B 2G8TA 1QQUA 1DT2A 4K69A 2RCEA 2BY6X 2Z9JA 1HDTH 2A7JA 1Z7KA 1GBJA 3K2UA 3LPRA 1UVUH 1YCPH 3TNTA 3RXLA 2P16A 5HM2A 1H4WA 1QL8A 5ESBA 4ABJA 2J94A 3SJ8A 4YM9A 1LMWB 3U69H 2ZPSA 2OP9A 1W12U 4AYYB 3UQOA 3IG6B 4IBLH 1MBMA 1ZRKA 1TQ0B 4Q2KA 3VFEA 1O3BA 1RD3B 4BOHA 2A7HA 1TBRH 2XBWA 2Q6DA 3HATH 1GHZA 1HAZB 3TH4H 1HAHH 1QJ1B 4CRDA 4YLUA 3M3VA 3LIWA 1KLJH 1K1IA 2A5AA 1C9TA 1GBBA 5F8XA 1RIWB 3QGJA 1LHCH 4CRBA 1DWCH 1RTFB 4OGYA 2OINA 4H4FA 4Y8XA 1YPEH 1ZRBA 1PPBH 7KMEH 5GIBA 2A4QA 1Y3WA 1DE7H 2Y5HA 3BSQA 2ULLA 2PGBB 2VWNA 1WTGH 3RC6A 1HJ8A 2ZFFH 2A5IA 1NPMA 2BDBA 1G37A 3PWCA 4MQAA 3RXHA 2BXUH 4WY3A 2NWNA 1MUEB 2BD4A 5JBCS 1DOJA 1Z8RA 2WPIS 1C2IA 4WJG2 2H5DA 2BDAA 4YLQH 5AF9H 9LPRA 3UY9A 1L4DA 5EOKA 2I6SA 2CV3A 1Z6JH 4WXVA 2ZQ2A 3SV6A 3SHCH 3P70B 1ZZZA 5EW1H 1C2FA 3GCHB 2P8OB 3U9AH 1YPMH 1O0DH 5DP7A 1H8DH 4YT7H 8ESTE 4X8VH 4NA9H 1AY6H 5EW2H 3SV8A 2UWLA 5CMXH 2ZGBH 5EXLA 3KQBA 2ZU4A 1N8OB 1RXPA 1OS8A 1MZAA 1AKSB 1C5SA 4BAMB 1EP6A 1RTLA 4U30A 3UWIA 5FCKA 2Z7FE 2WPJS 4A1XA 3GCTG 1HFDA 4UE7H 3UOPA 3MOCA 1V2PT 2ZHDA 3S7KB 3DUXH 3LC3A 1NRSH 3M5NA 5LPEA 5JYIA 1TX8A 1VJAU 3URCA 3FFGA 2WPKS 1BDAA 3U98H 3RU4T 1QJ7B 2AGEX 4IGDA 1K1JA 3ODFA 3SU0A 1SGYE 1DWDH 3U1JB 1ID5H 1O3CA 1TLDA 1ZSLA 6LPRA 1O5FH 4BXSA 3S9AA 1LVYA 3NKKA 1YPKH 4D7FA 1IQKA 1Y5UT 1O2NA 5J4SA 5DP9A 3V3MA 2VJ1A 1GJDB 3B8JA 4Y8ZA 1QCPA 4AOQA 1GBIA 2H6MA 2ZECA 3OY6U 4ZXXH 1DPOA 4Y11E 3P8GA 1OYQA 2STBE 4X6OA 4F49A 1GWAA 1LPZB 1OP0A 1NY22 2BD3A 4O3TA 1SGFA 2ZDLA 2FTLE 1FAKH 1EZUC 1GBFA 1QA7A 2ZCHP 2OC7A 4AFZA 1P2JA 2XBVA 2GZ8A 1CHOF 2BQWB 1GCTC 1FONA 3RDZA 1CBWB 1GDNA 1JXPA 3A86A 1LPKB 2IJOB 3F9HA 1BTUA 3TJUA 4INKA 1HAGE 4UFGH 3GY5A 2FOCA 1K1OA 2JKHA 5TCCA 4TY7A 3SHAH 1ZLRA 3NXPA 2OQUA 1XM1A 4RN6A 2VIOA 3MWIU 3E0PB 1ACBE 3TJOA 1FY1A 1OWEA 2VB0A 3FVFB 1EAWA 3VXFH 1QBVH 1SBWA 3U8TH 3UQVA 1BT7A 2UUKB 1TE0A 1AFQC 3UIRA 1CHOG 3TU7H 1P3CA 1NN6A 4OS6A 1EPTB 1GHYH 1J16A 5F03A 1DITH 1L0ZA 4A1VA 1NFWA 1C4Y2 1PQ8A 4ABDA 1LHEH 1RS0A 1IHTH 1IQGA 1BBRE 3OU0A 3SI4H 1GVLA 1UK2A 1GJBB 2XWBI 2VGCC 3VGCC 1A0HB 1ELAA 1HPGA 5L2ZH 3TNSA 4RKOB 4X6PA 5E8EH 1LDTT 2FESH 2WYGA 1EZSC 2Z9KA 2XBXA 1A2CH 3SV7A 2BD8A 1OKXA 1UVTH 1P04A 3BG4C 5DP3A 1ANDA 1YPHC 1KXEA 1P2IA 1A0LA 1ELVA 4LOYH 4AGJA 1V2LT 3T26A 1KXAA 1L2EA 1Q3XA 3GY6A 4KTUA 1G36A 1N6YA 4ISNA 4D9QA 1QRXA 1C5LH 1XUIA 1SFQB 2VU8E 1C4U2 2QN5T 4MLFB 1DSUA 1YM0A 4MPXA 5IDKA 1W2KH 3QTVH 3KNXA 5J4QA 2NU0E 1TOMH 4UONA 1XUHA 3LGVA 2W26A 1G32B 1C5WB 1YPJH 2ZGXH 2BVXH 3KQDA 3ZZAA 2H9EH 1GI7B 4NSYA 3NPSA 1O32A 1KTTB 2PSXA 1TNGA 2A1DB 1YPHE 4I7YH 1J14A 3MU5A 1SL3A 1ELEE 1V2KT 2NU2E 1FY4A 1O5BB 3BEFB 1E36B 5FAHA 1P9SA 3M35A 2K1QA 3NK8A 3A8AA 1TOCB 2QXIA 4YOIA 2Q6FA 1XUKA 2CMYA 1WYKA 3UR6A 2JH0D 2ZFPH 3RUOA 1ESTA 1L1GA 1C5VA 3SNCA 2J34A 1D3QB 4I8KA 3RMMH 1DY9A 1AIXH 3MU1A 1AVWA 4ZKSU 3GICB 2ODYB 3L6PA 2UWPA 2XCNA 1O35A 1RTKA 2GCTC 3V13A 4I31A 1K1MA 1PPCE 4XBBA 1AD8H 4J2YB 2ZWLH 4ASHA 1YF4A 4XBCA 6GCHF 4QT8C 1BTXA 1SGFG 4NSVA 1M9UA 2BMGB 1SLUB 3PMAB 3BV9B 2OUAA 3BIVH 2BX4A 3SOSA 5EG4A 5DP6A 2WINI 3SJIA 2AMDA 1BTWA 4Y10E 4Y79A 4GCHF 4I8LA 3AW0A 1F5LA 2AGGX 2ZG0H 4Q7XA 2D8WA 3E90B 2FP7B 3ZVDA 4OS5A 1W7GH 2VNTA 5JBBS 1AKSA 1O2YA 4AFQA 1FLEE 2WV4A 3BTTE 3RXRA 4H6SB 2SNVA 4DT7B 5A8ZA 2ASUB 3DA9B 4LXBH 4MVNA 3M7TA 3A81A 3C27B 1C2KA 2W7UA 1THSH 2O9QA 1AN1E 2G00A 1V2QT 3TGKE 1UCYE 1C2GA 3SU6A 3T27A 3PTNA 2AYWA 1QIXB 4JK5A 1EOLA 3GY8A 4TY6A 3E0NB 1NFUA 1G9IE 3MH7A 4GCHG 1O34A 1B0EA 2P3FH 1ELCA 1QBOA 4X8TH 1GI4A 2ZZUH 3RMOH 2HGTH 2OQ5A 3RU4E 1SI5H 4Z6AH 1NFYA 4THNH 3M5MA 1MAYA 3TH2H 2WUCA 2FEQH 3L3TA 1ZHPA 3GYMA 1GI1A 1PQ5A 4R0IA 1NESE 1ANEA 1XXDA 2QYIA 3ZZ4A 2BD2A 2ILNA 1UTNA 1DVAH 1KXBA 1MTVA 1VGCC 1Y3XA 1AE8H 1PQAA 5GDSH 1SGNE 4ABAA 2O8LA 1UTPA 4HZHA 1GBTA 1HJAB 4IMQA 1SFIA 2ZFQH 1MTUA 3V7TA 1C5PA 1HNEE 4MTBA 1XVMA 3ZZBA 1PFXC 3A8CA 2R2WU 5C1XA 3SJOA 2QCYA 1K2I1 2BD5A 2ZPRA 2Z9IA 1GGDC 4BTTB 3NZIA 1GMCF 3JZ1B 4NWLA 1NC6A 4XBDA 4FUCA 5F8TA 3MI4A 4KELA 1A46H 2BM2A 3KN2A 1K1PA 4M7GA 3HKJB 4LZ1H 3GDUA 2R0KA 1GDUA 1HXEH 2V0BA 3G01A 3RXFA 1V2OT 1DWEH 4MNWA 1BTZA 4E7NA 3KEEA 2GZ9A 1MMJN 2HOBA 1EPTA 4SGBE 1TA6A 3EYDA 4I33A 4BANB 5EXMA 1T4UH 1V6DA 1HAIH 4TPYA 2FOAA 2FOEA 4DG4A 1C2LA 2WPLS 2Y6TA 1TNHA 1EB2A 1P06A 3QZQA 4AGKA 1HLTH 1MU8B 4I8HA 2A32A 1O37A 1O3NA 1C5MD 1ETRH 1YPLH 5T3HA 4B71A 1GMCG 1MKWK 2ZDKA 1X7AC 1OOKB 4AORA 4VGCC 1E34B 1SLWB 3S9CA 4NIWA 1GBCA 2PTNA 4U2WA 3A8DA 2AIQA 1ZR0A 2VIWA 3RM0H 2R0LA 3VB7A 2FIRH 4CH8B 2FYQA 1MTNB 3IITA 3RMNH 3RU4D 1QB6A 4F4OC 1PYTD 1TMUH 1LHGH 1BTYA 1W0ZU 1BMAA 3M5LA 3JZ2B 3PO1C 4X1SU 3ELAH 1O2XA 2HPPH 3LDXH 4X8SH 5FBEA 1SGPE 3M3SA 1O3DA 1D9IA 1EAIA 2PHBA 2YOLA 2CF8H 2ZFTA 3GDVA 1W14U 3F9EA 2VWLA 5EQRA 1WTHD 1O2KA 5DG6A 3PMJA 2G55A 1OXGA 1EJAA 2C4FH 1FY3A 3Q3KA 1PQ7A 1AZ8A 2Y7XA 4FVDA 2RG3A 1S6HA 1MTWA 1SG8B 3MNXA 4UFEH 1Y5AT 5DO4H 2BLQA 2SGFE 1P2OA 1QTFA 3F9GA 2PUQH 4U01A 1QB9A 4AZ2B 1G3DA 5JBAS 1SPJA 2CHAC 2RA3A 4B1TA 4YESB 1O2WA 1O3IA 2ANWA 1ELTA 5DK1A 3TLOA 1ZHRA 5FBIA 5HMAA 4FU7A 3M37A 2Z3EA 1O3JA 3QTOH 3UTUH 2IOTA 1TONA 1ORFA 2GX4A 2XBYA 3TJVA 4HFPB 2FX4A 5AFYH 1Z71A 1H9LB 1KY9A 3N7OA 1O2MA 2PFEA 4A7IB 3E3TA 2STAE 2FWWA 1O31A 2ESTE 2UUYA 3LU9B 3BTKE 1C1MA 3H7OA 3ITIA 1TNLA 1CA0B 4O3UA 1TPAE 5AHGH 3D62A 2BZ6H 3ATWA 1BMLA 1E35B 4IC5A 1EJMA 1KSNA 1SSXA 3WY8A 1AVXA 1H1BA 3A7TA 1ZOMA 2ZHEH 3ZZDA 5HGGA 7LPRA 1W0YH 1K9OE 1C5XB 4GHTA 3M61U 4MNYA 1O2TA 1D3TB 1AZZA 2F83A 2GD4B 3LKWA 4FU9A 1HB0B 3GISB 1D3DB 1AUJA 1GI2A 5A0BA 1TNJA 1P12E 1A0JA 1PPFE 1SR5C 5L30H 2HNTF 4JCNA 4X2XA 1O2VA 2G52A 2FI5E 2VGCB 1MD7A 3VGCB 2JETC 5F6MA 2WV5A 1H8IH 2ZPQA 2TGAA 1GBAA 5AVDA 1BBRK 1AFEH 1QHRB 2GTBA 1T8MA 8LPRA 1YC0A 4PROA 1NFXA 1UVPA 3RXEA 2V3OH 2W7SA 2AMQA 4DOQA 3SGQE 1O2RA 2WYJA 2ZTXA 3MO6A 5T6DA 1MQ6A 1RRKA 2WPMS 4K1TA 2CGAA 2ZC9H 1KYNA 4E05H 4K60A 4I8JA 1C2EA 1O3KA 1TAWA 2GDDA 2ZU1A 3FP7E 3W95A 1AMHA 2BD7A 2CXVA 2BVSH 4ZHAA 3P95A 1LKBA 4AX9H 3I29A 4BAOB 1UVOA 4KTCA 5ESTE 5I25A 2P59A 1SQAA 1C1VH 1DWBH 2H9HA 1GJ7B 1FZZA 5BPEA 3T25A 3F6UH 2BVRH 4CRAA 1WQSA 1TPPA 1SHHB 4CHAB 1XXFA 3U1IB 2ZF0H 1AU8A 2CN0H 3CENA 2G5NA 4Y0ZE 1HRTH 1GHAF 3QUMP 4AB9A 5C2ZA 1KXDA 3LH3A 5CHAC 1DUEA 1UO6A 2XWAA 1HIAB 1F2SE 4WH6A 4GPGA 2Y80A 5L6NH 1VITH 3L33A 2FTMA 2TPIZ 4DURA 2GMTC 1GHBF 1TIOA 2NU4E 3ENSB 2B8OH 2FXRA 2J92A 1WQVH 2QC2A 2XC4A 1ARBA 1RGQA 4MNVA 4OS7A 4IN1A 2GCTB 2I6QA 2J4IA 2PLXA 1N1LA 1P9UA 1TRYA 1UHBB 1F0UA 3LGYA 2EI6A 1F92A 1C2JA 4ZMAH 1BRAA 1GHAG 2V6NA 3EDXB 1O3GA 2SGAA 4ISLA 3SZNA 3Q00A 1NU7B 1ABJH 1L4ZA 2ZTZA 4AG2A 4Y0YE 2O8WA 1EATA 3P8NA 3A7WA 1TMTH 5SGAE 3MO3A 1C5NH 2BY8X 1B5GH 3GY3A 3K6YA 3MH6A 5C5OA 1L1JA 1G2MA 1P02A 1INCA 1YBWA 2EEKA 1BRUP 1O2LA 1NRPH 2O8TA 3AVZA 1GHBG 1ZTJA 3ZVEA 1LTOA 4O03A 4Y6DA 1S84A 3EA8A 2OD3B 1UTKA 1Z8IB 2BB4A 2Y5GA 1K22H 1V2ST 1XX9A 1ZJKA 1ZSJA 1W11U 1BMMH 4K1EA 2BY9X 3MH4A 1ZTLA 1AQ7A 1GJ8B 1PPHE 2BDIA 1V2VT 3MU4A 3FP8E 1TGBA 5G4BA 1ANCA 5DP8A 1SGCA 1F0TA 1OP8A 4MG3A 2QF0A 3FANA 1GI8B 1FV9A 2C8ZB 1P2QA 2ZTYA 4GAWA 4FUFA 1UCYK 5HM9A 1ZPZA 4NA8A 4NCYA 3QZRA 1CA8B 1KLIH 2FOFA 3HK3B 2UUJB 1AB9B 2D26C 1C1NA 2ZFRH 2PTCE 4BTUB 1OWIA 3BTEE 4OGXA 3DFJA 5FPTA 3VB3A 3ZZ3A 3RXGA 4HTCH 1Q31A 1N6XA 1RIWC 1EAUA 1ELBA 1V2TT 1UK3A 2ZFSA 2B0FA 4WWYA 2Z9GA 1TNIA 3SORA 2SFAA 4LK4A 1KDQB 3RXKA 3RXSA 1E37B 1J9CH 3O8BA 3ATLA 4CRFA 3E6PH 1OX1A 2PKAB 1SGRE 4A1TA 2Y82A 4X1PU 1JIMA 3BTFE 3KHVA 1IAUA 4WMFA 2QXGA 3ZZ5A 3DHKH 2BLOA 1A5HA 3A85A 1LHDH 1BTHH 2XW9A 2ZQ1A 1A7SA 1S83A 3MYWA 1CO7E 4INLA 4WF8A 3EE0B 2A0QB 2GV7A 4HI3A 4ZHLU 1DSTA 1ESBA 1AO5A 3BN9A 1V2NT 3VEQB 1T8NA 3A83A 4RSPA 1QL9A 2VWOA 4CRGA 3GCHC 4WMDA 2P8OC 1A3BH 4J1YA 3PM3A 4X6NA 4FUEA 3KGPA 4RKJB 3SUDA 1YPGH 3HGNA 1IQMA 2H1UA 3RXCA 4JK6A 2FOBA 3MNSA 2M5TA 3ATIA 1RFNA 3GCOA 2BDHA 1C5TA 1AHTH 3HGPA 1W7XH 2F9OA 3F1SB 3U8OH 1BTPA 2F9UA 2Z3DA 1GG6B 1S82A 3LGUA 2HWLB 4K3JA 2XRCA 1P2KA 3I77A 5HYOA 2TGTA 4E06H 9ESTA 4VGCB 2FYRA 1P05A 2A2XH 1SGQE 2PW8H 1HAXB 3RXDA 1D6WA 2BOKA 3GOVB 4Y71A 4CBOA 2F9NA 4DJZB 2HRVA 2PSYA 3ZZ6A 1UTJA 4NGAH 5EODA 2C8YB 4H42U 4ABIA 1D3PB 1VCPA 4XSKU 3KCGH 3PO1B 1ESAA 1O2JA 3BTQE 3A82A 2ZP0H 4JMYA 4ZXYH 2Z3CA 1FPCH 2AGIX 1GJ5H 1O2GH 2GGVB 3AW1A 4LZ4B 1C5ZB 1QJ6B 4BTIB 2OCVB 3T28A 1GBDA 2VIVA 5GPIB 1TGSZ 2GKVE 4AFUA 2P3TB 4NIVA 4K2YA 4OS2A 3QK1A 1J15A 2A45B 4Q7YA 4I8GA 4XDEA 1FI8A 2QA9E 3TIUA 1PYTC 1TGTA 2ODQA 3P8FA 1TB6H 3A84A 2GV6A 1CBWC 4DGJA 5GWZA 1C5YB 1PPZA 6GCHG 7ESTE 3DFLA 1BA8B 3PB1E 2XTTB 2ANYA 1Y3VA 3SI3H 3U8RH 3Q3YA 1HIAA 1P3EA 1TBZH 3RXQA 1ELDE 2JH6D 1FJSA 2QF3A 1MQ5A 4FUGA 1HCGA 3TGJE 1MBQA 3RC4A 5L2YH 4MDSA 5HXFA 4YT6H 2G81E 3DT0H 2XYAA 2ANKH 2PGQB 3C1KA 2V3HH 2J38A 3BEUA 1V2MT 1ZPBA 2R3YA 1V3XA 4YZUA 1A3EH 1P11E 2IPHA 1ZGVA 1LVBA 2FMJA 1O2UA 3K6ZA 3SQEE 3M36A 1UHBA 1EPTC 2ZCKP 5K0HA 2P95A 1CVWH 1MKXK 3BTME 5EU8A 3HPTB 1Z8GA 1T7CA 1SHYA 2R2MB 1S81A 2C8XB 1TALA 2BY7X 1IHSH 1NRNH 5DP5A 1MH0A 2QGRA 2HNTC 3SUEA 2FZZA 5LGOA 1TQ7B 3I78A 2DUCA 3LJJA 4H6TA 2P3UB 1V2UT 4AB8A 3AASA 2QIQA 1LQEA 4Z0KA 2EI7A 3SU5A 1IQLA 1MTSA 2ZA5A 1BBRH 1XKAC 4FUIA 3KQEA 3TJNA 2Y5FA 1JRTA 5E0HA 2F91A 3BTHE 3E1XB 5E2PA 1JOUB 1UJ1A 4ESTE 4X6MA 3UR9A 1SMFE 1ZMJA 3STJA 3KL6A 1C1PA 1QB1A 1PPEE 1A4WH 6ESTA 3UNRA 3MH5A 2Y81A 2V35A 4K5ZA 1GJ9B 3ZV8A 2XC5A 3GYLB 3T2NA 2HNTE 4DCDA 1O2QA 1YLDA 2FI3E 1NRRH 5JPMH 4DIHH 1HUTH 1FN6A 4K8YA 3TITA 5T6FA 2YNAA 4CR5A 1LO6A 2QAAA 2O8UA 1PPGE 2ZU5A 2OBQA 4OS4A
chains in the Genus database with same CATH superfamily
1F5KU 2KFWA 3LGWA 4FUBA 1S0RA 1XUFA 2HLDD 1KXFA 3M5OA 3KYGA 1O36A 2ZKSA 3ATMA 3MMGA 3UFAA 4FVBA 1QURH 2ZDAH 1KDQA 2FPZA 2GT7A 2ZO3H 1MD8A 5GJ4B 3RLWH 1DM4B 2VVCA 4OM9A 1DY8A 2EC9H 1YWUA 4ZH8A 2PKAA 3MU0A 2HPQH 4GSOA 3LONA 3ZVFA 5EPNA 3OTJE 2DE8A 5FX5A 3T62A 3TK5A 1CT0E 1NBMD 2OC1A 1GHVH 1HAYB 4GHQA 1IQEA 1ZMLA 4TYDA 1D4PB 1F0SA 1HAVB 4BNRA 1LVOA 1IQHA 5DKMA 1KLTA 2AHME 5C5NA 2R3UA 3ZVAA 3H5CB 2ANMH 1GMDF 2C8WB 4TWYA 3RXUA 1S0QA 3VXEH 2BDYA 2TIOA 1WU1A 1ABIH 2ZNKH 5FXLA 3ATKA 2XCFA 1H9HE 1DUAA 1QBNA 1AUTC 1EXFA 2HALA 1SLVB 5EPYA 2OBOA 4K1SA 1OWHA 3RXPA 4DY7B 2Z6BD 2BYAX 1ANBA 2B7DH 1K28D 4RT0A 1QFKH 2FDAA 2VIPA 1TX7A 4ZUHA 1Q2WA 2THFB 2ZHFH 1Y5BT 1DXPA 5JB8S 1MCTA 1O2IA 1AVGH 2W6ID 2OTVA 1O5CB 1LPGB 1BRBE 5CE1A 4AG1A 2BZAA 3SNAA 3RP2A 2WHXA 1GCTB 1LKAA 1IOEA 5ABWA 1GMDG 1XUGA 4CH2B 3R3GB 4MPUA 2P94A 1AWHB 1GBLA 1ZSKA 4O9VA 1WOFA 2A31A 3FZDA 2C93B 4B2AA 1A1RA 2GVFA 4MPVA 3KYFA 5EXNA 8GCHF 1IQNA 3SN8A 1VR1H 3A7VA 1E0FD 2BTCE 3SO3A 3SV9A 2YMSB 4B75A 1HAPH 3SU4A 4BAKB 3PLPA 3P17H 4X1RU 1EQ9A 1EX3A 1JWTA 1D6RA 1BB0B 3ZZCA 1NZQH 1AI8H 2PKSC 4X2WA 1P09A 4FXGH 4TWWA 1FNIA 1AFQB 1YY3A 1O2ZA 1UCYH 1B7XB 3ZZ8A 2F9BH 5TJXA 2FOGA 1F7ZA 3Q77A 3GCNA 1O3FA 1SGEE 5DPAA 1NU9A 2FLBH 1G3BA 1NM6A 4CR9A 1TPOA 1AGJA 1QNJA 3RXMA 1IQJA 1KIGH 4WH8A 5LPRA 2D2DA 1RJXB 3STIA 1O2HA 1CSOE 8GCHG 1YLCA 2FLRH 1ZTKA 2OXSA 3F68H 2WUBA 5EJLA 2XNDD 5BRRE 3LH1A 5E0JA 1TNKA 2BD9A 3B9FH 1BOQA 3SBKA 2LNCA 4JYUH 1G30B 3RMLH 1HJAC 2A2QH 4JZEH 7GCHF 1O2PA 4ABEA 4FUJA 1OYTH 4ZKOU 4Y8YA 1O3HA 1DICA 2XC0A 4U32A 1BIOA 3PV2A 3BG4B 1WBGB 3QGNB 3DD2H 2W5EA 2BDGA 2C90B 3UUZA 2P93A 2ZHQH 1SGTA 4B6FA 2FX6A 2VINA 2NU1E 1VITF 1C1WH 3MTYA 1QL7A 1EZQA 2ZU3A 1TWXB 2TBSA 1WCZA 5B6OA 2ZDVH 2PV9B 1G2LA 2FOHA 1THRH 1C1SA 3KQ5A 4NZLA 1Y8TA 3SUFA 2G5VA 3PRBA 6CHAC 5EJ1A 2XXLA 3A7ZA 5F8ZA 2BDCA 1GHWH 4NIYA 2PR3A 3GCTF 4XE4A 2H2ZA 1UTMA 1KXCA 7GCHG 4B2BA 1XUJA 2F3CE 1GPZA 4B73A 4UEHH 1C5UA 4FU8A 4ZROA 1BHXB 1SB1H 2G4TA 1F0RA 1FIWA 1FY5A 1DLKB 1OWJA 1C4V2 1J17T 1EJNA 3EQ0H 1FXYA 1VITG 3BG8A 3TVJB 2W3IA 1BRCE 2NU3E 2WPHS 3D65E 3QO6A 4Q63A 1Z1JA 3LJOA 1JBUH 3GDSA 1MTNC 4NFEA 3URDA 1O3LA 4E7RG 5JBTA 1IQFA 2AIPA 1DX5M 2ZGCA 2ZGJA 5FPSA 2ZHWH 3VB5A 2KAIB 1C5RA 3RXIA 1DXWA 1C1QA 5FX6A 3QN7A 2O8MA 3NRLA 2SGPE 3Q76A 3SU2A 4X2VA 3SNDA 1AWFH 2ZDMA 1BZXE 1SOTA 1CU1A 1CHGA 2HLCA 1EKBB 2W6JD 5DGJA 3SGAE 1ARCA 1K0HA 2FI4E 4AN7A 4KGAA 1C9PA 1O5EH 4GLYA 2G51A 1C2HA 1UTQA 1NTPA 2F9VA 3O8RA 1MU6B 1WUNH 2SGQE 2KX4A 4BAHB 4K8BA 2AH4X 3OYPA 1Z1IA 2OC0A 3BTDE 3S0NA 2A4GA 3PTBA 4A6LA 4OS4A 2A5KA 1K1LA 5FHTA 1T8LA 4ZKNU 3ZVBA 3LGIA 1GDQA 1SLXB 4A92A 1O3EA 2R9PA 3ESTA 4NG9H 3EA7A 5LH8A 1A5GH 1O3MA 1FQ3A 3SU3A 5LPFA 1OPHB 2JIZD 4JZIA 1O5GH 1WXRA 3QLPH 1GI3A 5A8XA 2GP9B 1W8BH 3KQCA 1O3PB 2J98B 1GL1A 4X8UH 2BY5X 2Q6GA 1YCPK 3HK6B 3NCLA 3BEIB 1C2MA 1CE5A 1ETTH 3UOUA 2HVYB 3ZZ7A 3H09A 2HVXA 5H4IB 1ZPCA 4AYVB 1OP2A 1HAVA 3F9FA 1O3OA 4ISHH 3Q3XA 2TRMA 1LQDB 1FAXA 3BTGE 3ZIAD 1YYY1 4DVAU 4KP0A 3D49H 4B2CA 1CA0C 2LP6A 1P01A 3SGBE 4INHA 4HG6A 5JB9S 1XVOA 1C1RA 1ZMNA 1FDPA 4F48B 1C1OA 1C1UH 1TBQH 2PWXA 2AERH 1MKXH 1EZXC 3RLYH 3D23A 5A0CA 1DS2E 3MFJA 5EQSA 2PUXB 2ZI2H 3GY4A 1SVPA 2VH0A 3A7XA 3GY7A 4NA7A 1G3CA 2BX3A 3OY5U 2FO9A 1GI5A 3A80A 5C20A 1CGJE 2BQ6B 1VGCB 5DP4A 1WSSH 3FZZA 4UD9H 1HBTH 1QRZA 3LOXA 1JIRA 1QZ8A 2UWOA 4X1QU 8KME2 4YTAA 5DJ7A 1S5SA 1SQOA 2IPQX 4DIIH 4IW4E 4JZFH 3PWBA 2VVUA 2XOKD 3FP6E 2Z9LA 4WXIA 4Q7ZA 4MPWA 4B74A 2RDLA 1EAXA 5A2MH 2WZQA 4UFFH 3U28C 4JZ1A 3SQHE 2AEIH 1BCUH 2H9TH 4MNXA 5PTPA 5C1UA 1GHXH 1E1QD 1OSSA 1GGDB 4D76A 1GBMA 5ETXA 3A89A 4XFQA 1GMHF 3RC5A 1UMAH 1B0FA 4DW2U 2A4RA 1GI9B 1GJAB 2BLWA 1UTOA 2J95A 2KCYA 3OX7U 3VB4A 3UPEA 4ZHMU 1TGNA 4R8TB 1VCQA 1Y3YA 1KTSB 3E16B 3EGKH 1YP9A 4CBNA 4CRCA 3QDZB 4UDWH 5T6GA 3A88A 1TYNA 2GJGA 3T5FH 3TH3H 2IN2A 3QWCH 1MCVA 3FO8D 2FM2A 1UTLM 1N8OC 3AAVA 1GJCB 2RA0A 3LC5A 1MKWH 1SGDE 3PV5A 3VB6A 1TPSA 1O2OA 2BOHB 1LVMA 4CHAC 2ALVA 4ZKRU 1P0SH 3N7EA 1QR3E 1GMHG 1O3AA 1A61H 4IC6A 1GBKA 1THPB 3ZV9A 1XMNB 3PLBA 2VWMA 3ODDA 3M7QA 1ELFA 1VCWA 3AAUA 2YNBA 1Z8JB 1P2MA 1T31A 1V2JT 3ZYDA 3UNSA 1DFPA 1QQ4A 3SNBA 5A0AE 1W13U 1GL0E 2SGDE 1VZQH 3NWUA 1Y59T 4TT3D 3V0XA 1NT1A 5IK2D 1O30A 2DE9A 1Y3UA 4FUHA 1DANH 2GCHF 1LCYA 3QX5H 4AFSA 2JH5D 2Z94A 1TGCA 2J9NA 5FPYA 1ETSH 3DSOA 2D1JA 4ZAEA 3W1EA 1QA0A 5E2OA 1EB1H 4NIXA 5C0TA 2CJIA 2GZ7A 3A7YA 1WV7H 1O5AB 1BUIA 2F9PA 1P8VC 3P8OA 1TMBH 3K9XB 1CQQA 2A7CA 5AFZH 2YMSD 2TGPZ 5GCHF 4WMEA 1UK4A 5FL7D 2CK3D 1T4VH 1U6QA 4X0WU 4Y7AA 3P92A 1DDJA 4UFDH 1CT2E 4ABHA 2VH6A 1HV7A 1CT4E 3TGIE 1HGTH 3FAOA 2FS8A 2GCHG 1NROH 2J2UA 1DLEA 2CHAB 1L1NA 1P57B 1SC8U 4Q4LA 1QRWA 4ABBA 3RXAA 3RM2H 1EUFA 2QXJA 2ZIQH 3UREA 1OWKA 2B5TB 2W3KA 1SQTA 1V2RT 1GBHA 3PV4A 3TK6A 3T29A 1BJVA 4NWKA 1Z6EA 3PROA 4FOUC 2KZ4A 1EOJA 3TK9A 2ODPA 5GCHG 4D9RA 2KAIA 1YKTA 3SJKA 1FN8A 1NO9H 3CS0A 3BTWE 1S85A 2LELA 2ZGHA 3P6ZB 4GUXA 3OSYA 4JZDH 3MHWU 3PMHB 5GXPA 4IMZA 4GVUA 4IS5A 3NUMA 5TCAA 3MU8A 1QGFA 2Q1JA 3B23B 2JJ2D 3SU1A 1P03A 2PKSB 4O97A 1AB9C 2FOMB 1WDIA 3CP7A 2V3MA 1C2DA 3S9BA 3V12A 1CGIE 3IWMA 3OE7D 4WVPE 1C1TA 3ZVCA 1J8AA 1TRNA 4A5TS 2ZCLP 2QXHA 1EASA 2AMPA 2H5CA 4IN2A 1FIZA 2XNIA 3SJ9A 4OS1A 1O38A 4I32A 3SW2B 3WWFA 1W0JD 3ZZ9A 3M3TA 3RXVA 2EI8A 3H7TA 3ZYEA 3CS7A 4YO9A 2VVVA 5DSFA 1GJ4H 1P10A 1ZYOA 3W94A 1MZDA 5IYTA 1T32A 4Y76A 1HYLA 1GBEA 1O33A 1BJUA 1SKYE 2JETB 1QY6A 4B76A 4JYVH 2BXTH 2FODA 1OWDA 2J98A 1FPHH 1MAXA 2ZEBA 1ZHMA 1AE5A 1F5RA 1IQIA 2AS9A 1SGIB 3BF6H 3PLKA 1GI0A 3MNBA 3HKIB 3RXBA 3UNQA 4YOGA 3TPIZ 1JRSA 1BMNH 5EQQA 5K7RA 1FY8E 2BHGA 3UWJH 2UUFB 4HGCA 4KTSA 1G3EA 5F53A 3MQKC 3LGTA 3GY2A 2VBCA 1LHFH 2GDEH 2VIDA 3PMBB 2OLGA 3OAAD 1GJ6A 4ABFA 2TGDA 1GI6A 2CF9H 5EGMA 6CHAB 1VJ9U 1YGCH 5E0GA 3LT3A 3MNCA 2BQ7B 1S6FA 4NFFA 4SGAE 4JYTA 4NZQA 1HAOH 3R0FA 4CREA 2G4UA 1XKBC 1GVKB 4X1NU 3F2HA 2LPRA 1TA2A 2QY0B 2Y7ZA 3ZVGA 1TFXA 2OC8A 5FCRA 1H9IE 1BHXF 1E1RD 1HJ9A 1GG6C 2WPDD 3S7HB 1O2SA 3K65B 1W3CA 3KF2A 4X2YA 1FUJA 4TPIZ 2SGEE 3RXTA 3M7UA 3EAJA 1GCDA 4KKDA 5CHAB 3O8DA 2ALPA 2AFQB 3KIDU 3SUGA 1FMGA 3MO9A 5HIZA 1A5IA 1SOZA 2FS9A 2ZU2A 2ZDNA 5C17A 3A8BA 1ELGA 2RDEA 4FUDA 4D7GA 2GT8A 2SNWA 5A09A 3SV2H 2VIQA 1O5DH 4Y7BA 1TRMA 1EP5A 1TX6A 2GMTB 3BIUH 1UVSH 1BQYA 1GVZA 2BLVA 1CGHA 1P2NA 1V2WT 5C67A 1O39A 1NS3A 3OFND 1T8OA 3SNEA 1C5QA 1K1NA 3VPKA 1HXFH 3E8LA 4D8NA 1WAYB 4Z1MD 4ABGA 4XOJA 1PJPA 1ZGIA 3E91A 5C1YA 3S69A 1C5OH 1OHHD 3EA9A 3O8CA 5JDUB 2C3SA 3FOAA 1TABE 1NRQH 4YOJA 4BAQB 1K21H 5C3NA 2B9LA 5A8YA 4BXWA 1YCPM 3RXJA 3RXOA 2J97A 2A4OA 1BITA 1JMOH 5I46H 3A87A 1W10U 4ISOA 2QV1A 1ZJDA 4ISIH 2EA3A 3PYHA 4Q80A 1E38B 2G8TA 1QQUA 1DT2A 4K69A 2RCEA 2BY6X 2QE7D 2Z9JA 1HDTH 2A7JA 1Z7KA 1GBJA 3K2UA 3LPRA 1UVUH 1YCPH 3TNTA 3RXLA 2P16A 5HM2A 1H4WA 1QL8A 5ESBA 4ABJA 2J94A 3SJ8A 4YM9A 1LMWB 5DN6D 3U69H 1W0KD 2ZPSA 2OP9A 1W12U 4AYYB 3UQOA 3IG6B 4IBLH 1MBMA 1ZRKA 1TQ0B 4Q2KA 3VFEA 1O3BA 1RD3B 4BOHA 2A7HA 1TBRH 2L6OA 2XBWA 2Q6DA 4B6EA 3HATH 1GHZA 1HAZB 3TH4H 1HAHH 1QJ1B 4CRDA 4YLUA 3M3VA 3LIWA 2KCAA 3CNRA 1KLJH 1K1IA 2A5AA 1C9TA 1GBBA 5F8XA 1RIWB 2PP6A 3QGJA 1LHCH 4CRBA 1DWCH 1RTFB 4OGYA 2OINA 4H4FA 4Y8XA 1YPEH 1ZRBA 2QF4A 1PPBH 7KMEH 5GIBA 2A4QA 1Y3WA 1DE7H 2Y5HA 3BSQA 3OEHD 2ULLA 2PGBB 2VWNA 1WTGH 3RC6A 1HJ8A 2ZFFH 2L74A 2A5IA 1NPMA 2BDBA 1G37A 3PWCA 4MQAA 3RXHA 2BXUH 4WY3A 2NWNA 2BD4A 1MUEB 1KMHB 5JBCS 1DOJA 1Z8RA 2WPIS 1C2IA 4WJG2 5HIYA 2H5DA 2BDAA 4YLQH 5AF9H 9LPRA 3UY9A 1L4DA 5EOKA 2I6SA 3DSGA 2CV3A 1Z6JH 4WXVA 2ZQ2A 3SV6A 3SHCH 2KCPA 3P70B 1ZZZA 5EW1H 1C2FA 3GCHB 2P8OB 3SYJA 3U9AH 3VG8A 1YPMH 1O0DH 5DP7A 1H8DH 4YT7H 8ESTE 4X8VH 4NA9H 1AY6H 5EW2H 3SV8A 2UWLA 5CMXH 2ZGBH 5EXLA 3KQBA 2ZU4A 1N8OB 1RXPA 1OS8A 1MZAA 1AKSB 1C5SA 4BAMB 1EP6A 1RTLA 2KM0A 4U30A 3UWIA 5FCKA 2Z7FE 2WPJS 4A1XA 3GCTG 1HFDA 4UE7H 3UOPA 3MOCA 1V2PT 2ZHDA 3S7KB 3DUXH 3LC3A 1NRSH 3M5NA 5LPEA 5JYIA 1TX8A 1VJAU 3URCA 3FFGA 2WPKS 1BDAA 3U98H 3RU4T 1QJ7B 2AGEX 4IGDA 1K1JA 3ODFA 3SU0A 1SGYE 1DWDH 3U1JB 1SQRA 1ID5H 1O3CA 1TLDA 1ZSLA 6LPRA 1O5FH 3F0PA 4BXSA 3S9AA 1LVYA 3NKKA 1YPKH 3PRDA 1IQKA 1Y5UT 3UAIC 4D7FA 1O2NA 5J4SA 5DP9A 3V3MA 2VJ1A 1GJDB 3B8JA 4Y8ZA 1QCPA 4AOQA 2JDID 1GBIA 2H6MA 2ZECA 3OY6U 4ZXXH 4ACBA 1DPOA 4Y11E 3P8GA 1OYQA 2STBE 4X6OA 4F49A 1GWAA 1LPZB 1OP0A 1NY22 2BD3A 4O3TA 1SGFA 5C0UA 2ZDLA 2FTLE 1FAKH 1EZUC 2EY4C 1GBFA 1QA7A 2ZCHP 2OC7A 4AFZA 1P2JA 2XBVA 2GZ8A 1CHOF 2BQWB 1GCTC 1FONA 3RDZA 4F55A 1CBWB 1GDNA 1JXPA 3A86A 1LPKB 2IJOB 3F9HA 1BTUA 3TJUA 4INKA 5GNDA 1HAGE 4UFGH 3GY5A 2FOCA 1K1OA 2JKHA 5TCCA 4TY7A 3SHAH 1ZLRA 3NXPA 2OQUA 5HKKD 2YMSC 1XM1A 4RN6A 2VIOA 3MWIU 3E0PB 1ACBE 3TJOA 1FY1A 1OWEA 2VB0A 3FVFB 4AC9A 1EAWA 3VXFH 1QBVH 1SBWA 3U8TH 3UQVA 1BT7A 2UUKB 1TE0A 1AFQC 2K8IA 3UIRA 1CHOG 3TU7H 1P3CA 1NN6A 4OS6A 1EPTB 1GHYH 1J16A 5F03A 1DITH 1L0ZA 4A1VA 1NFWA 1C4Y2 1PQ8A 4ABDA 1LHEH 1RS0A 1UW7A 1IHTH 1IQGA 1BBRE 3OU0A 3SI4H 1GVLA 1UK2A 2J5UA 1GJBB 2XWBI 2VGCC 3VGCC 1A0HB 3F0OA 1ELAA 1HPGA 5L2ZH 3TNSA 4RKOB 4X6PA 5E8EH 1LDTT 2FESH 2WYGA 1EZSC 2Z9KA 2XBXA 1A2CH 3SV7A 2BD8A 1OKXA 1UVTH 1P04A 3BG4C 5DP3A 1ANDA 1YPHC 1KXEA 1P2IA 1A0LA 1ELVA 4LOYH 4AGJA 1V2LT 3T26A 1KXAA 1L2EA 1Q3XA 3GY6A 4KTUA 1G36A 1N6YA 4ISNA 4D9QA 1QRXA 3OTPA 1C5LH 1XUIA 4ACAA 1SFQB 2VU8E 1C4U2 2QN5T 4MLFB 1DSUA 1YM0A 4MPXA 5IDKA 1W2KH 3QTVH 3KNXA 5KEDA 5J4QA 2NU0E 1TOMH 4UONA 1XUHA 3LGVA 2W26A 1G32B 1C5WB 1YPJH 2ZGXH 5T1VA 2BVXH 3KQDA 3ZZAA 2H9EH 1GI7B 4NSYA 3NPSA 5EIYA 3FKSD 1O32A 1KTTB 2PSXA 1TNGA 2A1DB 1YPHE 4I7YH 1J14A 3MU5A 1SL3A 1ELEE 4TSFD 1V2KT 2NU2E 1FY4A 1O5BB 3BEFB 1E36B 5FAHA 1P9SA 3M35A 2K1QA 3NK8A 3A8AA 1TOCB 2QXIA 4YOIA 2Q6FA 1XUKA 2CMYA 1WYKA 3UR6A 2JH0D 2ZFPH 3RUOA 1ESTA 1L1GA 1C5VA 3SNCA 2J34A 1D3QB 4I8KA 3RMMH 1DY9A 1AIXH 5EJZA 3MU1A 1AVWA 4ZKSU 3GICB 2ODYB 3L6PA 2UWPA 2XCNA 1O35A 1RTKA 2GCTC 3V13A 4I31A 1K1MA 1PPCE 4XBBA 1AD8H 4J2YB 2ZWLH 4ASHA 1YF4A 4XBCA 6GCHF 4QT8C 1BTXA 1SGFG 4NSVA 1M9UA 2BMGB 1SLUB 3PMAB 3BV9B 2OUAA 3BIVH 3N7DA 2BX4A 3SOSA 3WWBA 5EG4A 5DP6A 2WINI 3SJIA 2AMDA 1BTWA 4Y10E 4Y79A 4GCHF 4I8LA 3AW0A 1F5LA 2AGGX 2ZG0H 4Q7XA 2D8WA 3E90B 2FP7B 3ZVDA 3F2FA 5KGOA 4OS5A 1W7GH 2VNTA 5JBBS 1AKSA 1O2YA 4AFQA 1FLEE 2WV4A 3BTTE 3RXRA 4H6SB 2SNVA 4DT7B 5A8ZA 2ASUB 3DA9B 4LXBH 4MVNA 3M7TA 3A81A 3C27B 1C2KA 2W7UA 1THSH 2O9QA 1AN1E 2G00A 1V2QT 3TGKE 1UCYE 1C2GA 3SU6A 3T27A 3PTNA 2AYWA 1QIXB 4JK5A 1EOLA 3GY8A 4TY6A 3E0NB 1NFUA 1G9IE 3MH7A 4GCHG 1O34A 1B0EA 2P3FH 1ELCA 1QBOA 4X8TH 1GI4A 2ZZUH 2K0QA 3RMOH 3SZEA 2HGTH 2OQ5A 3RU4E 1SI5H 4Z6AH 1NFYA 4THNH 3M5MA 1MAYA 3TH2H 2WUCA 2FEQH 3L3TA 1ZHPA 3GYMA 1GI1A 1PQ5A 4R0IA 1NESE 1ANEA 1XXDA 2QYIA 3ZZ4A 2BD2A 2ILNA 1UTNA 1DVAH 1KXBA 1MTVA 1VGCC 1Y3XA 1AE8H 1PQAA 5GDSH 5KECA 1SGNE 4XD7D 4ABAA 2O8LA 1UTPA 4HZHA 1GBTA 1HJAB 4IMQA 1SFIA 2ZFQH 1MTUA 3V7TA 1C5PA 1HNEE 4MTBA 1XVMA 3ZZBA 1PFXC 3A8CA 2R2WU 5C1XA 3SJOA 2QCYA 1K2I1 2BD5A 2ZPRA 2Z9IA 1GGDC 4BTTB 3NZIA 1GMCF 3JZ1B 4NWLA 1NC6A 4XBDA 4FUCA 5F8TA 3MI4A 4KELA 1A46H 2BM2A 1BMFD 1K1PA 3KN2A 3HKJB 4M7GA 3GDUA 2R0KA 4LZ1H 1GDUA 1HXEH 2V0BA 3G01A 3RXFA 1V2OT 1DWEH 1VKYA 4MNWA 1BTZA 4E7NA 4ZCNA 3KEEA 2GZ9A 1MMJN 2HOBA 1EPTA 4SGBE 1TA6A 3EYDA 4I33A 4BANB 5EXMA 1T4UH 1V6DA 1HAIH 4TPYA 2FOAA 2FOEA 4DG4A 1C2LA 2WPLS 2Y6TA 1TNHA 1EB2A 1P06A 3QZQA 4AGKA 1HLTH 1MU8B 4I8HA 2A32A 1O37A 1O3NA 1C5MD 1ETRH 1YPLH 5T3HA 4B71A 1GMCG 1MKWK 2ZDKA 1X7AC 1OOKB 4AORA 4VGCC 1E34B 1SLWB 3S9CA 4NIWA 1GBCA 2PTNA 4U2WA 3A8DA 2AIQA 1ZR0A 2VIWA 3RM0H 2R0LA 3VB7A 2FIRH 4CH8B 2FYQA 1MTNB 3IITA 3RMNH 3RU4D 1QB6A 4F4OC 1PYTD 1TMUH 1LHGH 1BTYA 1W0ZU 1BMAA 3M5LA 3JZ2B 3PO1C 4X1SU 3ELAH 1O2XA 2HPPH 3LDXH 4X8SH 5FBEA 1SGPE 3M3SA 1O3DA 1D9IA 1EAIA 2PHBA 2YOLA 2CF8H 2ZFTA 1EFRD 3GDVA 1W14U 3F9EA 2VWLA 5EQRA 1WTHD 1O2KA 5DG6A 3PMJA 2G55A 1OXGA 1EJAA 2C4FH 1FY3A 3Q3KA 1PQ7A 1AZ8A 2Y7XA 1YLNA 4FVDA 2RG3A 1S6HA 1MTWA 1SG8B 5B6LA 3MNXA 4UFEH 1Y5AT 3GS9A 5DO4H 2BLQA 4YXWD 2SGFE 1P2OA 1QTFA 3F9GA 4DT4A 2PUQH 4U01A 1QB9A 4AZ2B 1G3DA 4I86A 2WSSD 5JBAS 1SPJA 2CHAC 2RA3A 4B1TA 4YESB 1O2WA 1O3IA 2ANWA 1ELTA 5DK1A 3TLOA 1ZHRA 5FBIA 5HMAA 4FU7A 3M37A 2Z3EA 1O3JA 2M2AA 3QTOH 3UTUH 2IOTA 1TONA 1ORFA 2GX4A 2XBYA 3TJVA 4HFPB 2FX4A 5AFYH 1Z71A 1H9LB 1KY9A 3N7OA 1O2MA 2PFEA 4A7IB 3E3TA 2STAE 1FX0B 1MABB 2FWWA 1O31A 2ESTE 2UUYA 3LU9B 3BTKE 1C1MA 3H7OA 3ITIA 1TNLA 1CA0B 4O3UA 1TPAE 5AHGH 3D62A 2BZ6H 3ATWA 1BMLA 1E35B 4IC5A 1EJMA 1KSNA 1SSXA 3WY8A 1AVXA 1H1BA 3A7TA 1ZOMA 2ZHEH 3ZZDA 5HGGA 7LPRA 1W0YH 1K9OE 1C5XB 4GHTA 3M61U 4MNYA 1O2TA 1D3TB 1AZZA 2F83A 2GD4B 3LKWA 4FU9A 1HB0B 3GISB 1D3DB 1AUJA 1GI2A 5A0BA 1TNJA 1P12E 1A0JA 1PPFE 1SR5C 5L30H 2HNTF 4JCNA 5C94A 4X2XA 1O2VA 2G52A 2FI5E 2VGCB 1MD7A 3VGCB 2JETC 5F6MA 2WV5A 1H8IH 2ZPQA 2TGAA 1GBAA 5AVDA 1BBRK 1AFEH 1QHRB 2GTBA 1T8MA 8LPRA 1YC0A 4PROA 1NFXA 1UVPA 3RXEA 2V3OH 2W7SA 2AMQA 4DOQA 3SGQE 1O2RA 2WYJA 4FETA 2ZTXA 3MO6A 5T6DA 1MQ6A 1RRKA 2WPMS 4K1TA 2CGAA 2ZC9H 1KYNA 4E05H 4K60A 4I8JA 1C2EA 1O3KA 3AK5A 1TAWA 2GDDA 2ZU1A 3FP7E 3W95A 1AMHA 2BD7A 2CXVA 2BVSH 4ZHAA 3P95A 1LKBA 4AX9H 3I29A 4BAOB 1UVOA 4KTCA 5ESTE 5I25A 2P59A 1SQAA 1C1VH 1DWBH 2H9HA 1GJ7B 1FZZA 5BPEA 3OEED 3T25A 3F6UH 2BVRH 4CRAA 1WQSA 1TPPA 1SHHB 2WV9A 4CHAB 1XXFA 3U1IB 2ZF0H 1AU8A 2CN0H 3CENA 2G5NA 4Y0ZE 1HRTH 1GHAF 3QUMP 4AB9A 5C2ZA 1KXDA 3LH3A 5CHAC 1DUEA 1UO6A 2XWAA 1HIAB 1F2SE 4WH6A 4GPGA 3WW7A 2Y80A 5L6NH 1VITH 3L33A 2FTMA 2TPIZ 4DURA 2GMTC 1GHBF 1TIOA 2NU4E 3ENSB 2B8OH 2FXRA 2J92A 1WQVH 2QC2A 2XC4A 1ARBA 1RGQA 4MNVA 4OS7A 4IN1A 2GCTB 2I6QA 2J4IA 2PLXA 1N1LA 1P9UA 1TRYA 1UHBB 1F0UA 3LGYA 2EI6A 1F92A 1C2JA 4ZMAH 1BRAA 1GHAG 2V6NA 3EDXB 1O3GA 2SGAA 4ISLA 3SZNA 3Q00A 1NU7B 1ABJH 1L4ZA 2ZTZA 4AG2A 4Y0YE 2O8WA 1EATA 4XRNA 3P8NA 3A7WA 1TMTH 5SGAE 3MO3A 1C5NH 3DSPA 2BY8X 1B5GH 3GY3A 3K6YA 3MH6A 5C5OA 1L1JA 1G2MA 1P02A 1INCA 1YBWA 2EEKA 1BRUP 1O2LA 1NRPH 2O8TA 3AVZA 1GHBG 1ZTJA 3ZVEA 1LTOA 4O03A 4Y6DA 1S84A 3EA8A 2OD3B 1UTKA 1Z8IB 2BB4A 2Y5GA 1K22H 1V2ST 1XX9A 2IJD1 1ZJKA 4RT1A 1ZSJA 1W11U 1BMMH 4K1EA 2BY9X 3MH4A 1ZTLA 1AQ7A 1GJ8B 1PPHE 2BDIA 1V2VT 3MU4A 3FP8E 1TGBA 5G4BA 1ANCA 5DP8A 1SGCA 1F0TA 1OP8A 4MG3A 2QF0A 3FANA 1GI8B 1FV9A 2C8ZB 1P2QA 2ZTYA 4GAWA 4FUFA 1UCYK 5HM9A 1ZPZA 4NA8A 4NCYA 3QZRA 1CA8B 1KLIH 2FOFA 3HK3B 2UUJB 1AB9B 2D26C 1C1NA 2ZFRH 2PTCE 4BTUB 1OWIA 3BTEE 4OGXA 3DFJA 4M9FA 5FPTA 3VB3A 3ZZ3A 3RXGA 4HTCH 1Q31A 1N6XA 1RIWC 1EAUA 1ELBA 1V2TT 1UK3A 2ZFSA 3DCLA 2B0FA 4WWYA 2Z9GA 1TNIA 3F2GA 3SORA 4P00A 2SFAA 4LK4A 1KDQB 3RXKA 3RXSA 1E37B 1J9CH 3O8BA 3ATLA 4CRFA 3E6PH 1OX1A 2PKAB 1SGRE 4A1TA 2Y82A 4X1PU 1JIMA 3BTFE 3KHVA 1IAUA 4WMFA 2QXGA 3ZZ5A 3DHKH 2BLOA 2OK5A 1A5HA 3A85A 1LHDH 1BTHH 2KCOA 2XW9A 2ZQ1A 3F3BA 1A7SA 1S83A 3MYWA 1CO7E 4INLA 4WF8A 3EE0B 2A0QB 2GV7A 4HI3A 4ZHLU 1DSTA 2V7QD 1ESBA 1AO5A 3BN9A 1V2NT 3VEQB 1T8NA 3A83A 4RSPA 1QL9A 2VWOA 4CRGA 3GCHC 4WMDA 2P8OC 1A3BH 4J1YA 3PM3A 4X6NA 4FUEA 3KGPA 4RKJB 3SUDA 4ASUD 1YPGH 3HGNA 1IQMA 2H1UA 3RXCA 4JK6A 2FOBA 3MNSA 2M5TA 3ATIA 1RFNA 3GCOA 2BDHA 1C5TA 1AHTH 3HGPA 1W7XH 2F9OA 3F1SB 3U8OH 1BTPA 2F9UA 2Z3DA 1GG6B 1S82A 3LGUA 2HWLB 4K3JA 2XRCA 1P2KA 3I77A 5HYOA 2TGTA 4E06H 9ESTA 4VGCB 2FYRA 1P05A 2EQNA 2A2XH 1SGQE 2PW8H 1HAXB 3RXDA 1D6WA 2BOKA 3GOVB 4Y71A 4CBOA 2F9NA 2KR7A 3N99A 4DJZB 2HRVA 2PSYA 3ZZ6A 1UTJA 4NGAH 5EODA 2C8YB 4H42U 4ABIA 1D3PB 1VCPA 3EE7A 4XSKU 3KCGH 3PO1B 1ESAA 1O2JA 3BTQE 3A82A 2ZP0H 4JMYA 4ZXYH 1E79D 2Z3CA 1FPCH 2AGIX 2F43B 1GJ5H 1O2GH 2GGVB 3AW1A 4LZ4B 1C5ZB 1QJ6B 4BTIB 3FN8A 2OCVB 3T28A 1GBDA 2VIVA 5GPIB 1TGSZ 2GKVE 4AFUA 2P3TB 4NIVA 4K2YA 4OS2A 3QK1A 1J15A 2A45B 4Q7YA 4I8GA 4XDEA 1FI8A 2QA9E 3TIUA 1PYTC 1S6LA 1TGTA 2ODQA 3P8FA 1TB6H 3A84A 2GV6A 1CBWC 4DGJA 5GWZA 1C5YB 1PPZA 6GCHG 7ESTE 3DFLA 1H8ED 1BA8B 3PB1E 2XTTB 2ANYA 1Y3VA 3SI3H 3U8RH 3Q3YA 1HIAA 1P3EA 1TBZH 3RXQA 1ELDE 2JH6D 1FJSA 2QF5A 2QF3A 4P02A 1MQ5A 4FUGA 1HCGA 3TGJE 1MBQA 3RC4A 5L2YH 4MDSA 5HXFA 4YT6H 2G81E 3DT0H 2XYAA 2ANKH 2PGQB 3C1KA 2V3HH 2J38A 3BEUA 1V2MT 1ZPBA 2R3YA 1V3XA 4YZUA 1A3EH 2RFKC 1P11E 2IPHA 1ZGVA 1LVBA 2FMJA 1O2UA 3K6ZA 3SQEE 3M36A 1UHBA 1EPTC 2ZCKP 5K0HA 1NBME 2P95A 1CVWH 1MKXK 3BTME 5EU8A 3HPTB 1Z8GA 1T7CA 1H8HD 1SHYA 2R2MB 1S81A 2C8XB 3UB0A 1TALA 2BY7X 1IHSH 1NRNH 5DP5A 1MH0A 2QGRA 2HNTC 3SUEA 2FZZA 5LGOA 1TQ7B 3I78A 2DUCA 3LJJA 4RI0A 4H6TA 2P3UB 1V2UT 4AB8A 3AASA 2QIQA 1LQEA 4Z0KA 2EI7A 5CDFE 3SU5A 1IQLA 5CHBA 1MTSA 2ZA5A 1BBRH 1XKAC 4FUIA 3KQEA 3TJNA 2Y5FA 2F4LA 1JRTA 1COWD 5E0HA 2F91A 3BTHE 3E1XB 5E2PA 1JOUB 1UJ1A 4ESTE 4X6MA 3UR9A 1SMFE 1ZMJA 3STJA 3KL6A 1C1PA 1QB1A 1PPEE 1A4WH 6ESTA 3UNRA 3MH5A 2Y81A 2V35A 4K5ZA 1GJ9B 3ZV8A 2XC5A 3GYLB 3T2NA 2HNTE 4DCDA 1O2QA 1YLDA 2FI3E 1NRRH 5JPMH 4DIHH 1HUTH 1FN6A 4K8YA 3TITA 5T6FA 2YNAA 4CR5A 1LO6A 2QAAA 2O8UA 1PPGE 2ZU5A 2OBQA 2JJ1D
chains in the Genus database with same CATH topology
1F5KU 3LGWA 4FUBA 1S0RA 1XUFA 1KXFA 3M5OA 1O36A 2ZKSA 3ATMA 3MMGA 3UFAA 4FVBA 1QURH 2ZDAH 1KDQA 2FPZA 2GT7A 2ZO3H 1MD8A 5GJ4B 3RLWH 1DM4B 2VVCA 1DY8A 2EC9H 4ZH8A 2PKAA 3MU0A 2HPQH 4GSOA 3LONA 3ZVFA 5EPNA 3OTJE 2DE8A 5FX5A 3T62A 3TK5A 1CT0E 2OC1A 1GHVH 1HAYB 4GHQA 1IQEA 1ZMLA 4TYDA 1D4PB 1F0SA 1HAVB 4BNRA 1LVOA 1IQHA 5DKMA 1KLTA 5C5NA 2R3UA 3ZVAA 3H5CB 2ANMH 1GMDF 2C8WB 4TWYA 3RXUA 1S0QA 3VXEH 2BDYA 2TIOA 1WU1A 1ABIH 2ZNKH 5FXLA 3ATKA 2XCFA 1H9HE 1DUAA 1QBNA 1AUTC 1EXFA 2HALA 1SLVB 5EPYA 2OBOA 4K1SA 1OWHA 3RXPA 4DY7B 2Z6BD 2BYAX 1ANBA 2B7DH 1K28D 1QFKH 2FDAA 2VIPA 1TX7A 4ZUHA 1Q2WA 2THFB 2ZHFH 1Y5BT 1DXPA 5JB8S 1MCTA 1O2IA 1AVGH 2OTVA 1O5CB 1LPGB 1BRBE 5CE1A 4AG1A 2BZAA 3SNAA 3RP2A 1GCTB 1LKAA 1IOEA 5ABWA 1GMDG 1XUGA 4CH2B 3R3GB 4MPUA 2P94A 1AWHB 1GBLA 1ZSKA 4O9VA 1WOFA 2A31A 3FZDA 2C93B 4B2AA 1A1RA 2GVFA 4MPVA 5EXNA 8GCHF 1IQNA 3SN8A 1VR1H 3A7VA 1E0FD 2BTCE 3SO3A 3SV9A 4B75A 1HAPH 3SU4A 4BAKB 3PLPA 3P17H 4X1RU 1EQ9A 1EX3A 1JWTA 1D6RA 1BB0B 3ZZCA 1NZQH 1AI8H 2PKSC 4X2WA 1P09A 4FXGH 4TWWA 1FNIA 1AFQB 1O2ZA 1UCYH 1B7XB 3ZZ8A 2F9BH 5TJXA 2FOGA 1F7ZA 3Q77A 3GCNA 1O3FA 1SGEE 5DPAA 1NU9A 2FLBH 1G3BA 1NM6A 4CR9A 1TPOA 1AGJA 1QNJA 3RXMA 1IQJA 1KIGH 4WH8A 5LPRA 2D2DA 1RJXB 3STIA 1O2HA 1CSOE 8GCHG 1YLCA 2FLRH 1ZTKA 2OXSA 3F68H 2WUBA 5BRRE 3LH1A 5E0JA 1TNKA 2BD9A 3B9FH 1BOQA 3SBKA 2LNCA 4JYUH 1G30B 3RMLH 1HJAC 2A2QH 4JZEH 7GCHF 1O2PA 4ABEA 4FUJA 1OYTH 4ZKOU 4Y8YA 1O3HA 1DICA 2XC0A 4U32A 1BIOA 3BG4B 1WBGB 3QGNB 3DD2H 2W5EA 2BDGA 2C90B 3UUZA 2P93A 2ZHQH 1SGTA 2FX6A 2VINA 2NU1E 1VITF 1C1WH 3MTYA 1QL7A 1EZQA 2ZU3A 1TWXB 2TBSA 1WCZA 5B6OA 2ZDVH 2PV9B 1G2LA 2FOHA 1THRH 1C1SA 4NZLA 1Y8TA 3SUFA 2G5VA 6CHAC 2XXLA 3A7ZA 5F8ZA 2BDCA 1GHWH 4NIYA 2PR3A 3GCTF 4XE4A 2H2ZA 1UTMA 1KXCA 7GCHG 4B2BA 1XUJA 2F3CE 1GPZA 4B73A 4UEHH 1C5UA 4FU8A 4ZROA 1BHXB 1SB1H 2G4TA 1F0RA 1FIWA 1FY5A 1DLKB 1OWJA 1C4V2 1J17T 1EJNA 3EQ0H 1FXYA 1VITG 3BG8A 3TVJB 2W3IA 1BRCE 2NU3E 2WPHS 3D65E 3QO6A 1Z1JA 3LJOA 1JBUH 3GDSA 1MTNC 4NFEA 3URDA 1O3LA 4E7RG 5JBTA 1IQFA 2AIPA 1DX5M 2ZGCA 2ZGJA 5FPSA 2ZHWH 3VB5A 2KAIB 1C5RA 3RXIA 1DXWA 1C1QA 5FX6A 3QN7A 2O8MA 3Q76A 2SGPE 3SU2A 4X2VA 3SNDA 1AWFH 2ZDMA 1BZXE 1SOTA 1CU1A 1CHGA 2HLCA 1EKBB 5DGJA 3SGAE 1ARCA 2FI4E 4AN7A 4KGAA 1C9PA 1O5EH 4GLYA 2G51A 1C2HA 1UTQA 1NTPA 2F9VA 3O8RA 1MU6B 1WUNH 2SGQE 4BAHB 4K8BA 2AH4X 3OYPA 1Z1IA 2OC0A 3BTDE 3S0NA 2A4GA 3PTBA 4A6LA 2A5KA 1K1LA 5FHTA 1T8LA 4ZKNU 3ZVBA 3LGIA 1GDQA 1SLXB 4A92A 1O3EA 2R9PA 3ESTA 4NG9H 3EA7A 5LH8A 1A5GH 1O3MA 1FQ3A 3SU3A 5LPFA 1OPHB 4JZIA 1O5GH 3QLPH 1GI3A 5A8XA 2GP9B 1W8BH 3KQCA 1O3PB 1GL1A 4X8UH 2BY5X 2Q6GA 1YCPK 3HK6B 3NCLA 3BEIB 1C2MA 1CE5A 1ETTH 3UOUA 3ZZ7A 2HVXA 5H4IB 1ZPCA 4AYVB 1OP2A 1HAVA 3F9FA 1O3OA 4ISHH 3Q3XA 2TRMA 1LQDB 1FAXA 3BTGE 1YYY1 4DVAU 4KP0A 3D49H 4B2CA 1CA0C 1P01A 3SGBE 4INHA 5JB9S 1XVOA 1C1RA 1ZMNA 1FDPA 1C1OA 1C1UH 1TBQH 2PWXA 2AERH 1MKXH 1EZXC 3RLYH 3D23A 5A0CA 1DS2E 3MFJA 5EQSA 2PUXB 2ZI2H 3GY4A 1SVPA 2VH0A 3A7XA 3GY7A 4NA7A 1G3CA 2BX3A 3OY5U 2FO9A 1GI5A 3A80A 5C20A 1CGJE 2BQ6B 1VGCB 5DP4A 1WSSH 3FZZA 4UD9H 1HBTH 1QRZA 3LOXA 1JIRA 2UWOA 4X1QU 8KME2 4YTAA 5DJ7A 1S5SA 1SQOA 4DIIH 4IW4E 4JZFH 3PWBA 2VVUA 3FP6E 2Z9LA 4WXIA 4Q7ZA 4MPWA 4B74A 2RDLA 1EAXA 5A2MH 4UFFH 4JZ1A 3SQHE 2AEIH 1BCUH 2H9TH 4MNXA 5PTPA 5C1UA 1GHXH 1OSSA 1GGDB 4D76A 1GBMA 5ETXA 3A89A 4XFQA 1GMHF 3RC5A 1UMAH 1B0FA 4DW2U 2A4RA 1GI9B 1GJAB 2BLWA 1UTOA 2J95A 3OX7U 3VB4A 3UPEA 4ZHMU 1TGNA 4R8TB 1VCQA 1Y3YA 1KTSB 3E16B 3EGKH 1YP9A 4CBNA 4CRCA 3QDZB 4UDWH 5T6GA 3A88A 1TYNA 3T5FH 3TH3H 2IN2A 3QWCH 1MCVA 2FM2A 1UTLM 1N8OC 3AAVA 1GJCB 2RA0A 3LC5A 1MKWH 1SGDE 3VB6A 1TPSA 1O2OA 2BOHB 1LVMA 4CHAC 2ALVA 4ZKRU 1P0SH 1GMHG 1O3AA 1QR3E 1A61H 4IC6A 1GBKA 1THPB 3ZV9A 1XMNB 3PLBA 2VWMA 3ODDA 3M7QA 1ELFA 1VCWA 3AAUA 2YNBA 1Z8JB 1P2MA 1T31A 1V2JT 3ZYDA 3UNSA 1DFPA 1QQ4A 3SNBA 5A0AE 1W13U 1GL0E 2SGDE 1VZQH 3NWUA 1Y59T 3V0XA 1NT1A 1O30A 2DE9A 1Y3UA 4FUHA 1DANH 2GCHF 1LCYA 3QX5H 4AFSA 2JH5D 2Z94A 1TGCA 2J9NA 5FPYA 1ETSH 2D1JA 4ZAEA 1QA0A 5E2OA 1EB1H 4NIXA 2CJIA 2GZ7A 3A7YA 1WV7H 1O5AB 1BUIA 2F9PA 1P8VC 3P8OA 1TMBH 3K9XB 1CQQA 2A7CA 5AFZH 2TGPZ 5GCHF 4WMEA 1UK4A 1T4VH 1U6QA 4X0WU 4Y7AA 3P92A 1DDJA 4UFDH 1CT2E 4ABHA 2VH6A 1HV7A 1CT4E 3TGIE 1HGTH 3FAOA 2FS8A 2GCHG 1NROH 2J2UA 1DLEA 2CHAB 1L1NA 1P57B 1SC8U 1QRWA 4ABBA 3RXAA 3RM2H 1EUFA 2QXJA 2ZIQH 3UREA 1OWKA 2B5TB 2W3KA 1SQTA 1V2RT 1GBHA 3PV4A 3TK6A 3T29A 1BJVA 4NWKA 1Z6EA 3PROA 3TK9A 1EOJA 2ODPA 5GCHG 4D9RA 2KAIA 1YKTA 3SJKA 1FN8A 1NO9H 3CS0A 3BTWE 1S85A 2ZGHA 3P6ZB 4GUXA 3OSYA 4JZDH 3MHWU 3PMHB 5GXPA 4IMZA 4GVUA 4IS5A 3NUMA 5TCAA 3MU8A 1QGFA 2Q1JA 3B23B 3SU1A 1P03A 2PKSB 4O97A 1AB9C 2FOMB 3CP7A 1C2DA 3S9BA 3V12A 1CGIE 3IWMA 4WVPE 3ZVCA 1C1TA 1J8AA 1TRNA 4A5TS 2ZCLP 2QXHA 1EASA 2AMPA 2H5CA 4IN2A 1FIZA 2XNIA 3SJ9A 4OS1A 1O38A 4I32A 3SW2B 3ZZ9A 3M3TA 3RXVA 2EI8A 3H7TA 3ZYEA 3CS7A 4YO9A 2VVVA 1GJ4H 1P10A 1ZYOA 3W94A 1MZDA 5IYTA 1T32A 4Y76A 1HYLA 1GBEA 1O33A 1BJUA 2JETB 1QY6A 4B76A 4JYVH 2BXTH 2FODA 1OWDA 1FPHH 1MAXA 2ZEBA 1ZHMA 1AE5A 1F5RA 1IQIA 2AS9A 1SGIB 3BF6H 3PLKA 1GI0A 3MNBA 3HKIB 3RXBA 3UNQA 4YOGA 3TPIZ 1JRSA 1BMNH 5EQQA 5K7RA 1FY8E 2BHGA 3UWJH 2UUFB 4HGCA 4KTSA 1G3EA 3LGTA 3GY2A 1LHFH 2GDEH 2VIDA 3PMBB 2OLGA 1GJ6A 4ABFA 2TGDA 1GI6A 2CF9H 5EGMA 6CHAB 1VJ9U 1YGCH 5E0GA 3LT3A 3MNCA 2BQ7B 1S6FA 4NFFA 4SGAE 4JYTA 4NZQA 1HAOH 3R0FA 4CREA 2G4UA 1XKBC 1GVKB 4X1NU 2LPRA 1TA2A 2QY0B 2Y7ZA 3ZVGA 1TFXA 2OC8A 5FCRA 1H9IE 1BHXF 1HJ9A 1GG6C 3S7HB 1O2SA 3K65B 1W3CA 3KF2A 4X2YA 1FUJA 4TPIZ 2SGEE 3RXTA 3M7UA 3EAJA 1GCDA 4KKDA 5CHAB 3O8DA 2ALPA 2AFQB 3KIDU 3SUGA 1FMGA 3MO9A 1A5IA 1SOZA 2FS9A 2ZU2A 2ZDNA 3A8BA 1ELGA 4D7GA 4FUDA 2GT8A 2SNWA 5A09A 3SV2H 2VIQA 1O5DH 4Y7BA 1TRMA 1EP5A 1TX6A 2GMTB 3BIUH 1UVSH 1BQYA 1GVZA 2BLVA 1CGHA 1P2NA 1V2WT 5C67A 1O39A 1NS3A 1T8OA 3SNEA 1C5QA 1K1NA 3VPKA 1HXFH 3E8LA 4D8NA 1WAYB 4ABGA 4XOJA 1PJPA 1ZGIA 3E91A 5C1YA 3S69A 1C5OH 3EA9A 3O8CA 5JDUB 2C3SA 1TABE 1NRQH 4YOJA 4BAQB 1K21H 5C3NA 2B9LA 5A8YA 4BXWA 1YCPM 3RXJA 3RXOA 2A4OA 1BITA 1JMOH 5I46H 3A87A 1W10U 4ISOA 2QV1A 1ZJDA 4ISIH 2EA3A 3PYHA 4Q80A 1E38B 2G8TA 1QQUA 1DT2A 4K69A 2RCEA 2BY6X 2Z9JA 1HDTH 2A7JA 1Z7KA 1GBJA 3K2UA 3LPRA 1UVUH 1YCPH 3TNTA 3RXLA 2P16A 5HM2A 1H4WA 1QL8A 5ESBA 4ABJA 2J94A 3SJ8A 4YM9A 1LMWB 3U69H 2ZPSA 2OP9A 1W12U 4AYYB 3UQOA 3IG6B 4IBLH 1MBMA 1ZRKA 1TQ0B 4Q2KA 3VFEA 1O3BA 1RD3B 4BOHA 2A7HA 1TBRH 2XBWA 2Q6DA 3HATH 1GHZA 1HAZB 3TH4H 1HAHH 1QJ1B 4CRDA 4YLUA 3M3VA 3LIWA 1KLJH 1K1IA 2A5AA 1C9TA 1GBBA 5F8XA 1RIWB 3QGJA 1LHCH 4CRBA 1DWCH 1RTFB 4OGYA 2OINA 4H4FA 4Y8XA 1YPEH 1ZRBA 1PPBH 7KMEH 5GIBA 2A4QA 1Y3WA 1DE7H 2Y5HA 3BSQA 2ULLA 2PGBB 2VWNA 1WTGH 3RC6A 1HJ8A 2ZFFH 2A5IA 1NPMA 2BDBA 1G37A 3PWCA 4MQAA 3RXHA 2BXUH 4WY3A 2NWNA 1MUEB 2BD4A 5JBCS 1DOJA 1Z8RA 2WPIS 1C2IA 4WJG2 2H5DA 2BDAA 4YLQH 5AF9H 9LPRA 3UY9A 1L4DA 5EOKA 2I6SA 2CV3A 1Z6JH 4WXVA 2ZQ2A 3SV6A 3SHCH 3P70B 1ZZZA 5EW1H 1C2FA 3GCHB 2P8OB 3U9AH 1YPMH 1O0DH 5DP7A 1H8DH 4YT7H 8ESTE 4X8VH 4NA9H 1AY6H 5EW2H 3SV8A 2UWLA 5CMXH 2ZGBH 5EXLA 3KQBA 2ZU4A 1N8OB 1RXPA 1OS8A 1MZAA 1AKSB 1C5SA 4BAMB 1EP6A 1RTLA 4U30A 3UWIA 5FCKA 2Z7FE 2WPJS 4A1XA 3GCTG 1HFDA 4UE7H 3UOPA 3MOCA 1V2PT 2ZHDA 3S7KB 3DUXH 3LC3A 1NRSH 3M5NA 5LPEA 5JYIA 1TX8A 1VJAU 3URCA 3FFGA 2WPKS 1BDAA 3U98H 3RU4T 1QJ7B 2AGEX 4IGDA 1K1JA 3ODFA 3SU0A 1SGYE 1DWDH 3U1JB 1ID5H 1O3CA 1TLDA 1ZSLA 6LPRA 1O5FH 4BXSA 3S9AA 1LVYA 3NKKA 1YPKH 4D7FA 1IQKA 1Y5UT 1O2NA 5J4SA 5DP9A 3V3MA 2VJ1A 1GJDB 3B8JA 4Y8ZA 1QCPA 4AOQA 1GBIA 2H6MA 2ZECA 3OY6U 4ZXXH 1DPOA 4Y11E 3P8GA 1OYQA 2STBE 4X6OA 4F49A 1GWAA 1LPZB 1OP0A 1NY22 2BD3A 4O3TA 1SGFA 2ZDLA 2FTLE 1FAKH 1EZUC 1GBFA 1QA7A 2ZCHP 2OC7A 4AFZA 1P2JA 2XBVA 2GZ8A 1CHOF 2BQWB 1GCTC 1FONA 3RDZA 1CBWB 1GDNA 1JXPA 3A86A 1LPKB 2IJOB 3F9HA 1BTUA 3TJUA 4INKA 1HAGE 4UFGH 3GY5A 2FOCA 1K1OA 2JKHA 5TCCA 4TY7A 3SHAH 1ZLRA 3NXPA 2OQUA 1XM1A 4RN6A 2VIOA 3MWIU 3E0PB 1ACBE 3TJOA 1FY1A 1OWEA 2VB0A 3FVFB 1EAWA <