1QL9A

Factor xa specific inhibitor in complex with rat trypsin mutant x99rt
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRETYNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-Induced Structural Plasticity
pubmed doi rcsb
source organism Rattus norvegicus
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ql9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ql9A02
2P16A 3VGCB 4JK6A 4KELA 3RXRA 2DE9A 3U1IB 1EP5A 4Y7AA 4YZUA 2VIWA 5DO4H 2WPHS 1O3IA 1PYTC 2CXVA 3RXAA 1AUTC 1OP0A 3HK6B 5K7RA 1OP8A 1UTOA 1OP2A 4TY6A 4Y76A 3DUXH 1FNIA 5HGGA 1ZPZA 5TCAA 2FI3E 4O9VA 1RTLA 4O97A 2HNTC 1GJ4H 3HKIB 4A5TS 6GCHF 3LGWA 4I8GA 1FY8E 3GCOA 4MPXA 4CR9A 4Y8XA 5L6NH 2NWNA 1TAWA 4IMZA 1WTHD 1TONA 1GPZA 1LDTT 1W0ZU 2G5VA 1IHTH 1GI6A 1O5FH 3M7UA 1C5OH 2AIQA 5T6FA 1LPZB 3LU9B 1VCWA 3QK1A 3ZVAA 3I77A 4SGAE 4ISIH 3SNAA 3RXLA 2ZEBA 1AWFH 1MKXH 2BY9X 1ZPBA 2J95A 2A7JA 1T4VH 1TGCA 1C1MA 1IHSH 3MI4A 1OWHA 3SU1A 4KGAA 2PTCE 4XDEA 1HXFH 2VH6A 1ZRKA 1TBQH 1GCDA 8KME2 1H9LB 4OS7A 4BOHA 1A61H 1AIXH 3MU0A 3VFEA 1Z1JA 4ABAA 4TWYA 3URCA 1T8LA 1KLTA 3STJA 1DPOA 1O2OA 1BMAA 1ELGA 3RXHA 4IN2A 3GY2A 1C1OA 5HMAA 2BQWB 1QBNA 4DT7B 1GI7B 3A7XA 2XTTB 3GDSA 4JZDH 1XM1A 1C1PA 1DSTA 1V2UT 1SOTA 4FUIA 1VJAU 2CHAC 1GVKB 2ZDVH 2P95A 3ATLA 2BD5A 2ZFTA 2ZTZA 1T8NA 1SLUB 5JDUB 2GVFA 1B0EA 1MBQA 4X6OA 5IDKA 4CH2B 1OYTH 1OWDA 2ZDAH 3RC6A 1AFEH 2BY8X 1NRRH 1H9HE 1BDAA 1MQ6A 2ANYA 3M37A 1GBIA 2C90B 1C2FA 1P2MA 3GISB 2AGGX 4KKDA 3UIRA 2D2DA 1TRMA 3D23A 2SNVA 1IQFA 1VJ9U 2TGPZ 1SLVB 1D6RA 2BTCE 5ESBA 5L2YH 1P2QA 1XUFA 2H2ZA 3RP2A 1YYY1 3T2NA 2C8YB 2F83A 2ZI2H 2WV5A 4K1SA 3OTJE 1WTGH 1A0JA 2PTNA 2Y5FA 3LH3A 1DX5M 1A5HA 1LQDB 3ZZAA 1O38A 1BHXB 1CHOG 1TQ0B 2G4TA 3NPSA 1P2NA 4DY7B 1O2JA 1XKBC 3TU7H 4GCHF 1GDQA 1WYKA 1V2QT 1Y5UT 5GWZA 1O2QA 1NFXA 2CF9H 1EB2A 2FTMA 3M7TA 4JYVH 3O8CA 2BM2A 1Z6JH 3IWMA 1W0YH 2QXHA 2BDAA 3BSQA 1O5AB 2OP9A 3S9CA 1QB9A 1H4WA 1F5RA 4J1YA 3RMMH 2Y5HA 2AIPA 3ZV8A 2FI5E 1LQEA 1HCGA 1AE8H 3QTOH 1AB9B 1GBJA 5GPIB 3P8FA 4H42U 1G2LA 1EJMA 3P95A 1EATA 5EU8A 4Y0YE 1C2JA 2BDBA 1O2SA 1HAGE 1Z7KA 1C5WB 4ZXXH 4ZHMU 1MBMA 2BDYA 1UTLM 2B9LA 5EXMA 1F92A 4JYUH 1N6YA 4ABDA 2Z9IA 1O3LA 3TLOA 1G3CA 1TRYA 1IQJA 3MH4A 3BTWE 2ZECA 3BIUH 4WJG2 3MO3A 3RXSA 1GBCA 4ZROA 1DLKB 2HGTH 1MU6B 2BLVA 2OUAA 4I8HA 3UR9A 3MTYA 1C5RA 4D76A 2OXSA 4NSVA 1V2NT 2VU8E 2ZGXH 3GCTF 5EGMA 4RKJB 1F0RA 1HJAC 2NU2E 2BVXH 3OY5U 2TIOA 1K9OE 1VITF 2ZGJA 3PWCA 4A7IB 1L4DA 1H8DH 1G30B 2AERH 2JETB 1JBUH 2VVCA 5LPRA 1OWJA 1ANBA 1NM6A 1C4Y2 2FM2A 7GCHG 1MTWA 1P05A 1O3NA 3SHCH 5EG4A 4DVAU 2Q6DA 1FY4A 3T25A 1O2WA 1Z8IB 4IC5A 1SL3A 3V3MA 4B76A 1ABIH 2AMPA 4AZ2B 2JH0D 1BTUA 1HAZB 3TJVA 3D65E 3C1KA 2QN5T 5DP7A 4NA8A 3CENA 1QR3E 2I6SA 2G5NA 2AMQA 3M3VA 3LJJA 3V12A 2OQUA 4WMEA 3JZ2B 1ZMLA 3UWJH 3UQOA 2XW9A 1GGDC 1GDNA 4RKOB 2BD9A 1DUAA 1ZJDA 2ZO3H 3ZVGA 3VXFH 5F8TA 3A88A 4KTSA 5E2OA 3RXCA 2PGBB 3DFLA 4WMFA 2F9PA 2A45B 3ZZCA 4BNRA 1QBVH 1O3FA 1FIWA 3ODFA 1NFWA 1EKBB 4XBDA 3EE0B 3EA8A 2WPMS 3ZZ9A 2AS9A 1H8IH 1GBKA 4X1NU 2FOAA 4CR5A 1AZ8A 3RXFA 1B5GH 1GJDB 1GBHA 3TK9A 4MNYA 3HGPA 3G01A 2JH5D 1E34B 2ZDLA 1TB6H 1UTMA 2B8OH 3M3TA 2H1UA 5DPAA 2IOTA 1VITH 4H4FA 2GCTC 1V2WT 3L33A 2ZFSA 5FAHA 1DWDH 3P6ZB 1MCVA 5CHAB 1HAOH 2ODYB 2GV6A 2ZGBH 5JBTA 4FUFA 2ZQ1A 4X1RU 1A3BH 4MNWA 4K1EA 1FY5A 2ANWA 1KYNA 2VGCB 2KAIB 1V3XA 1LHDH 2ODQA 1TPOA 3RXMA 1AY6H 1P12E 1SHHB 1O39A 3K65B 1YGCH 3UNQA 3SJOA 3UOUA 1O2YA 3LT3A 5E0GA 2A1DB 3LONA 1AO5A 1RFNA 1Y59T 5EPYA 1G32B 1MTVA 5C67A 1GJAB 4UFFH 3NWUA 1GI2A 3MH5A 8ESTE 4YM9A 2BB4A 2C93B 4ABBA 2ZF0H 1HNEE 1MD8A 2W3IA 1HRTH 1QJ7B 2BOKA 2A5IA 3PLBA 1JRSA 1ELEE 2FMJA 3M5MA 2A7CA 3U69H 1Y3VA 1A0LA 2PKAA 4F49A 1GJ5H 2BY6X 5J4SA 3EYDA 4Z0KA 1TPAE 4UFDH 2JKHA 3LKWA 5C1YA 3BTEE 1QL9A 2BX4A 5LGOA 1BRCE 1F5LA 2ZGCA 5ETXA 1IQNA 4E7RG 2G8TA 3A80A 3RLYH 2A31A 5AFYH 1EX3A 1GHYH 1LCYA 1P8VC 2BZ6H 3Q76A 2XBYA 2YNAA 3M5OA 1HAHH 2UWPA 2HALA 2ALPA 1NRQH 1ELFA 1K22H 1H9IE 2VINA 1K1MA 1K1IA 1QJ1B 5E8EH 1SGIB 4DIIH 1C2DA 5BRRE 3GYMA 2RA3A 5EPNA 5GDSH 2FWWA 1KLIH 2ZCKP 3MOCA 1HGTH 1TNKA 3PROA 5E0JA 1MUEB 5GXPA 1YPHC 2Q6FA 4LK4A 1O2TA 3AAVA 4WY3A 1T32A 1EPTB 1MH0A 3ZVEA 2ZP0H 3A83A 3EGKH 1TWXB 4NWLA 2BXUH 1CGJE 2C8XB 2C3SA 2P3UB 1QQUA 1G3DA 4E7NA 5K0HA 2AGIX 4LZ1H 2FYQA 1LHCH 2ANKH 2Y7ZA 3Q00A 1K1PA 4HTCH 1O5EH 1KTSB 4JCNA 4NSYA 4FUDA 1OWIA 2A4GA 4I7YH 3QWCH 1FPCH 1HAYB 1INCA 1Z8GA 4BAMB 2J38A 4JZEH 5JB8S 1KLJH 1AMHA 1HAXB 2DE8A 3AAUA 1GMDF 1Z6EA 1AKSB 1T8OA 2YNBA 3MFJA 3TH4H 4JMYA 2ANMH 1E36B 1UCYH 1GCTC 1LPKB 4FUEA 1OWEA 1P3CA 2FS9A 2CHAB 4JZIA 1BT7A 1P03A 3PMJA 3LGYA 2ZPRA 1W11U 2PW8H 5TCCA 1TALA 2FOCA 4B1TA 1W10U 1XXFA 3V7TA 2TGAA 1O2NA 1PYTD 3A84A 3U9AH 2VB0A 4NA7A 2A0QB 2ZHFH 1C2HA 2FLRH 1D3TB 1Y3XA 1UTNA 3F6UH 2FODA 3RLWH 3ZVBA 1C1NA 2PFEA 1SQOA 2J92A 2C8WB 1Z71A 2OQ5A 2Z3DA 4GPGA 2V35A 2A2QH 1UVTH 1DOJA 3PM3A 1SBWA 1J14A 1CGHA 2UWOA 5FCRA 3A7ZA 1C5VA 1XUKA 4X8UH 2GX4A 3LPRA 2R0KA 1S0QA 4Q7YA 4ZKNU 1UTPA 2J94A 1EAXA 4JYTA 1B7XB 1VCPA 4I8JA 2W26A 3EA9A 4YO9A 2ZFQH 2ZDMA 1K1LA 1EJNA 1MQ5A 1EASA 1SHYA 3QX5H 4BTUB 4XE4A 4NIVA 2VH0A 2J34A 3ZYEA 2J4IA 2QA9E 5FHTA 1J15A 3M61U 1T31A 3RXPA 2GDEH 2A2XH 1GJBB 3RU4D 3RXTA 3ZZDA 1SPJA 3MO9A 1LHFH 2QXGA 3KIDU 3MU1A 1EZXC 3BTDE 1C5XB 2ZDNA 1TBZH 3M35A 1RJXB 2QIQA 4X1QU 1MTUA 5EQQA 2WINI 3JZ1B 2EI7A 4YESB 2FOFA 3KQBA 3M7QA 1BQYA 1S83A 3U8TH 3K2UA 1CE5A 1IAUA 2WPLS 1ZPCA 1AZZA 3GY4A 4I31A 4I8LA 1C5PA 3D49H 1HPGA 1SFIA 2F9UA 1D4PB 1W7GH 1YPKH 1UK3A 4O03A 3FFGA 8GCHG 1WQSA 3PMAB 4OGXA 4ABFA 4H6TA 4NFFA 2SFAA 1DT2A 3S69A 2QXIA 2GGVB 2XWAA 2ZPSA 2FPZA 4JZ1A 1C2LA 3O8BA 5JPMH 3QUMP 4A1VA 1QRXA 2G81E 2HLCA 4X2VA 4XBCA 1GI1A 1HJAB 2PKAB 3RXUA 1O3AA 4NGAH 1YPJH 3H5CB 2VIPA 3SJIA 2GDDA 3FAOA 3I29A 4MQAA 2UUKB 1KIGH 2P93A 1GI3A 1THPB 4BTIB 2CF8H 4NZLA 2FOBA 2FESH 1YPLH 2IJOB 4BTTB 2EI8A 3SO3A 1O3PB 1UCYK 4FVBA 1NZQH 2BHGA 2R3UA 1P10A 4GHTA 1P04A 4ZH8A 4NFEA 4AYVB 1O37A 5EQRA 2VVUA 4Y10E 1TGBA 5T6DA 1AU8A 3KEEA 2BDHA 4AOQA 4B75A 4FUCA 1GGDB 3SV2H 4THNH 1C5QA 2GCHG 1UJ1A 1DFPA 1OPHB 2PR3A 3P8GA 1GMCG 4ZHAA 1CT0E 4U30A 1A0HB 2OTVA 1QJ6B 5FPYA 1O2KA 1XUIA 5FPSA 3P17H 2XNIA 2FX6A 1V2JT 1UCYE 2WV4A 2CN0H 4Y6DA 1TE0A 1EPTC 2D8WA 3UNRA 3IITA 1N1LA 2BMGB 1MCTA 1G36A 1SGNE 1O31A 2PWXA 2G51A 1PQ8A 1T7CA 4X6NA 3A8CA 2PGQB 2ZGHA 1GHAF 1ORFA 3EQ0H 4YTAA 1WCZA 2BDCA 2GV7A 5G4BA 3ATMA 1SGEE 2A7HA 1GBMA 2GCTB 4KTCA 1BCUH 1UO6A 1O3HA 2A5AA 1EAUA 1HAVB 1O3GA 4MDSA 4Q2KA 1XUHA 2BY5X 2IPHA 5FX6A 1W2KH 3SN8A 3F9HA 4HI3A 1C1RA 3P92A 3QDZB 1L2EA 2XWBI 1Z8RA 2BD2A 2FOHA 1C1SA 3BG4B 5EXLA 3U8RH 3VB4A 3A86A 4IS5A 4Y71A 1MAXA 3MNXA 1BRUP 1CHGA 1P3EA 2KAIA 3T5FH 1DE7H 1GBDA 2VWOA 4AGJA 1TNIA 1C5YB 1GJ8B 2FDAA 2R2MB 3RXGA 1IQKA 3F9FA 1DLEA 2GZ9A 1UMAH 1SQAA 2BDIA 3SGQE 4A92A 2AYWA 2AH4X 1V2ST 4GUXA 4IMQA 1O36A 3T26A 1C2EA 1GJ7B 2XBWA 5DP3A 1PPGE 1HJ8A 2Z94A 2ZHQH 2ESTE 1DANH 4GAWA 4KP0A 1TA6A 1PFXC 3BV9B 1EAWA 4DOQA 2W7UA 3M5LA 1W3CA 3TJNA 3RXEA 3GYLB 2FLBH 3QZRA 3UY9A 1TQ7B 1RGQA 3ZZ8A 5C5NA 4ABHA 1ARBA 4AG2A 3UFAA 3SNBA 1IQIA 1DWBH 3A7YA 1BRBE 3S7KB 4E05H 3D62A 2Y80A 5C2ZA 2ZFRH 3BIVH 3T29A 1DDJA 2XC0A 4HGCA 4R0IA 5AF9H 1LVOA 1V2KT 2BOHB 2GT7A 3MU8A 1C5NH 3OU0A 2VVVA 4FVDA 2A4OA 3DT0H 4R8TB 3BEUA 1NRPH 1D3DB 1UTQA 3V0XA 1BTYA 1MTSA 5EODA 3SBKA 2PSYA 4MPWA 1SR5C 5LPFA 1ANEA 2ZU4A 1GHWH 1A7SA 1BZXE 1C1UH 1GI5A 2PHBA 1ZMJA 2BDGA 3W95A 1ELTA 3KQCA 1EPTA 4MVNA 4B2AA 2PV9B 6GCHG 1PPFE 1O35A 3U98H 2Y81A 1MZAA 1GBBA 2F9BH 3GY6A 1SGTA 1HB0B 1Y8TA 3DA9B 1Q2WA 3SV6A 1QL7A 1LHEH 1CT4E 4MTBA 1UTKA 3E90B 1QL8A 4K5ZA 2BD8A 3ZYDA 2H9HA 1KXFA 2RCEA 3GCHB 3SU3A 1QBOA 1LVMA 4UD9H 1AKSA 2P59A 8LPRA 1DVAH 5A0BA 4AYYB 1Y3WA 1DS2E 1GCTB 1SB1H 4NIWA 2ASUB 4K2YA 4NIYA 5HM9A 1BBRK 4AX9H 3E1XB 2O8MA 2P94A 3A87A 4YT7H 2ZPQA 1ZTJA 1HAIH 4AB9A 1P01A 4HZHA 4CRGA 1CA0C 1DWCH 1UVSH 3VEQB 1BTWA 2ZDKA 1ZTKA 5IYTA 3SNCA 1GJCB 1TMTH 2XRCA 1C4U2 1E37B 1O3MA 1GBTA 4CH8B 3RM0H 4O3UA 3LC3A 3RMOH 3RXDA 4NZQA 1YKTA 5DP8A 3PYHA 2FP7B 1EOJA 1O2RA 4BANB 1BTHH 4UEHH 4I33A 4DIHH 1TFXA 5JBBS 2XYAA 2GKVE 3BTQE 3AASA 1GJ6A 2VIVA 1AGJA 2SNWA 1IQLA 2Z9KA 1BMMH 2O8WA 5L30H 4WH6A 4YOIA 2ALVA 4HFPB 2XCNA 4D7GA 3LOXA 4U01A 4FUBA 5DGJA 3T62A 1EXFA 1S5SA 4FU8A 1O2MA 4ISNA 4X8SH 3UQVA 1FLEE 2FYRA 1BRAA 1NN6A 3RMNH 3R3GB 1QB6A 1MD7A 4FUJA 1PPBH 2BZAA 3RUOA 1CO7E 3GY7A 2O8UA 3ZZ3A 1OWKA 4J2YB 4QT8C 2G52A 1RRKA 4NIXA 2H5DA 1C5MD 3FP8E 2H9EH 2HOBA 2BQ7B 1NY22 2BYAX 3TNTA 1CVWH 1UVUH 1J9CH 2V0BA 3R0FA 4GCHG 4NG9H 4IN1A 4MG3A 4UE7H 1NRSH 1XVMA 3BG4C 3KHVA 2OC0A 1JRTA 4BXWA 1C2MA 1TGNA 1ZMNA 4Q7XA 1C9PA 1E0FD 1SGPE 5LPEA 5FX5A 2GTBA 1ARCA 2WPKS 1O5GH 5FBEA 1BITA 5LH8A 1C1TA 3E3TA 5DKMA 1ANDA 3L6PA 5A09A 1PJPA 3GY5A 2QYIA 1G37A 1FAKH 2A5KA 4VGCB 2O9QA 2PLXA 1GMHG 2Z7FE 1GVZA 2B0FA 3KN2A 2F3CE 4DCDA 4ABJA 1P2KA 1XUGA 1HUTH 3KL6A 3CP7A 1VCQA 2WYJA 1GVLA 3SORA 1O2XA 4ESTE 1WAYB 1MU8B 3T28A 4FU9A 2LNCA 5BPEA 1J17T 1KXDA 1P9UA 1QGFA 1WU1A 1O2HA 5F03A 1DICA 1C5ZB 1BJUA 2QF3A 3VB3A 2QY0B 1FI8A 2AMDA 3NZIA 1MMJN 2HNTF 1BTZA 3AW0A 4A1TA 2EC9H 3T27A 1THRH 1AFQC 3LC5A 1DM4B 3TPIZ 1N8OB 1C4V2 3LGUA 4CHAB 5HM2A 3E91A 1ELCA 3SV8A 1PQAA 1QB1A 1V2RT 1TIOA 1TGSZ 1O3DA 1ZSJA 2FIRH 4B73A 3SJ9A 4GSOA 1ELAA 3ZVFA 3E16B 4IGDA 4X1SU 2ZIQH 4YT6H 3B8JA 1LVBA 2P8OC 3A89A 4XSKU 5CE1A 2M5TA 3EA7A 2CGAA 3PTBA 1TLDA 2Z6BD 2VWNA 3ZZBA 4MLFB 8GCHF 2Y7XA 2FOMB 1P2JA 3QZQA 1GL0E 2B7DH 1C2KA 1AHTH 3Q3YA 4JZFH 3MH6A 1NS3A 1UK4A 3S9BA 3OX7U 3GICB 1FMGA 1J16A 4OS6A 6CHAB 1ZOMA 2G4UA 2FS8A 2ZTXA 5DK1A 1PPHE 1EJAA 4MPVA 4NCYA 1EUFA 4B2CA 2UWLA 3SQHE 1CQQA 2QCYA 1SGQE 3TK6A 5C5OA 3GCHC 3ODDA 1HAVA 3UPEA 4INHA 3SU2A 5I46H 1N6XA 1NU7B 1RTFB 3SNDA 1EZUC 1SOZA 1CA8B 2CV3A 1V6DA 5GIBA 1IQMA 3E0PB 2V6NA 1S6FA 1JMOH 2F9VA 1MKWK 3EDXB 4X2XA 2O8LA 4K69A 1HV7A 3ATKA 1O3OA 2Z3CA 1W14U 1WV7H 2EI6A 1G9IE 3S0NA 1O2PA 1C2IA 1SVPA 3K9XB 3HATH 3PB1E 1C5LH 3A7VA 1KXBA 2R0LA 1S6HA 1P2IA 4JK5A 5GCHG 1GG6C 1P09A 1P06A 3TJUA 1KXCA 3HKJB 1ELVA 3KF2A 3PWBA 4DW2U 2Y5GA 1UVPA 2QXJA 2ZNKH 2YOLA 4ZHLU 1FY1A 2OC7A 2QV1A 5TJXA 1J8AA 2VJ1A 4UONA 3MMGA 3FP6E 1RXPA 2A32A 3WY8A 5C1UA 1FJSA 2XC4A 5C20A 5DP9A 1BB0B 1YF4A 2Z9GA 1KDQA 1SQTA 3M3SA 4NWKA 1EP6A 2BVSH 1MTNC 1ETRH 1XKAC 4OS4A 1ZRBA 1RS0A 2J2UA 2UUFB 4UFGH 4D8NA 4RN6A 2NU1E 1OS8A 3SOSA 2IN2A 1O2IA 1O3JA 1GI4A 1V2OT 1OXGA 2TBSA 4IBLH 2ZHWH 1YCPK 2ZZUH 1V2TT 1BTPA 1QA0A 3MO6A 3RC5A 3UR6A 1QA7A 4TYDA 3ZZ4A 5FBIA 1GHVH 2PUQH 3VB5A 4AB8A 1TA2A 4B74A 1DXPA 1Y3YA 3TIUA 2SGAA 4GVUA 1ESTA 3KGPA 7LPRA 1GBLA 1B0FA 1TNJA 1Y5AT 4YOGA 1O34A 1GHBG 4UFEH 3TGJE 1TNGA 3F9EA 4LXBH 3SU0A 2GD4B 3Q77A 3A85A 1HIAB 2XBXA 3ESTA 3P70B 3VPKA 1G3EA 4ZUHA 1OYQA 3LGTA 4VGCC 1LKAA 1FXYA 1GI0A 1D9IA 2Z9LA 2BLWA 3QTVH 1QTFA 3FZDA 3C27B 3ZZ6A 3BTGE 4Y8ZA 1CHOF 1ZGVA 2ODPA 4CRCA 3SNEA 1ZHMA 2ZA5A 3Q3KA 5A2MH 1IQHA 3A7WA 3ZZ5A 1DUEA 1QRZA 1ACBE 1GBAA 1SC8U 2H9TH 4ABIA 3GDVA 1ZYOA 1L4ZA 1JOUB 1TYNA 1EOLA 1LMWB 1L1NA 1YLCA 2QGRA 1HDTH 1PPZA 4BAHB 3BTTE 1CA0B 4YLQH 1L1JA 1Z8JB 3Q3XA 2TGDA 4AGKA 1GMDG 1SGCA 3TGIE 5JYIA 1SMFE 4K1TA 1HAPH 1S84A 1P2OA 1N8OC 1AWHB 2HWLB 1FUJA 1FN6A 1RIWC 4CHAC 3OSYA 2AEIH 1F0TA 1L1GA 2A4RA 1DY8A 5AVDA 1WSSH 3RU4T 3TJOA 3MNBA 1WBGB 5AHGH 1G3BA 3MWIU 2ZTYA 1O2VA 3STIA 1KTTB 2XCFA 1ELDE 5F6MA 2CJIA 1MZDA 2FOEA 4X2YA 1O3CA 3AW1A 4INLA 4X6PA 1W13U 3GY8A 1TGTA 4KTUA 2LPRA 1TPSA 4ZKOU 1TNLA 2HNTE 2K1QA 3SU4A 1BJVA 4Y0ZE 3TH3H 3L3TA 4A6LA 2B5TB 3RXKA 2OD3B 5A8YA 1O32A 2D1JA 3PO1B 1QY6A 3IG6B 6CHAC 4IC6A 4AORA 2ZU5A 5PTPA 1QHRB 4B2BA 2GT8A 1GL1A 3PLPA 2ZKSA 2SGDE 1TMUH 2C8ZB 3K6ZA 1QRWA 4Z6AH 7GCHF 2OC8A 4ZAEA 1BBRH 4D9RA 1TPPA 3RC4A 1GDUA 3SV7A 1S0RA 1FDPA 4U32A 3SI3H 2TPIZ 2Y82A 1NTPA 2R9PA 4XFQA 1O2ZA 3TH2H 2H6MA 1ZZZA 4X2WA 3A82A 3HK3B 4LOYH 3RXVA 1A3EH 3RU4E 1K1NA 4H6SB 1BTXA 1EZSC 3KQDA 1O3BA 1FV9A 3SUEA 2AGEX 3UOPA 4INKA 1PPEE 1C5UA 3QGNB 3LDXH 1SFQB 2BD3A 2HRVA 3H7TA 5F8ZA 2W7SA 3MHWU 2WPIS 2P3TB 3K6YA 2WPJS 3RXJA 2NU4E 3ATIA 2GMTB 3GCNA 1XVOA 3GDUA 1DXWA 2RG3A 1DITH 2BVRH 1O2GH 2ILNA 5DJ7A 5A0CA 6ESTA 1SGFA 2FXRA 1E38B 1BMNH 1BHXF 2GZ7A 4I8KA 3FVFB 7KMEH 1YC0A 3RXQA 1NFUA 1WQVH 1O0DH 1M9UA 1ZR0A 3U1JB 3SUDA 1G2MA 1ZJKA 1O33A 2D26C 2FTLE 2Q6GA 2OBQA 2SGEE 5B6OA 4TPYA 1JXPA 1UHBA 1KDQB 4Q7ZA 1LKBA 1QIXB 2WUBA 1F0UA 2FZZA 1K1JA 2PSXA 3VB7A 2WYGA 3FANA 1CT2E 3LJOA 5DP4A 1ZTLA 1H1BA 4CRBA 2WUCA 4ZMAH 2HPPH 3ATWA 4RSPA 1AFQB 1WOFA 2J9NA 3BTME 3VB6A 1CBWB 1BMLA 4GLYA 3A8DA 1OSSA 4BAOB 1AI8H 2O8TA 4X0WU 1TX7A 2Z9JA 2ZG0H 1TX8A 2P8OB 2OLGA 1XMNB 3V13A 1O3EA 1PQ7A 2PKSB 3PMHB 3UWIA 1S85A 1C2GA 2ZWLH 2QC2A 1ETSH 1OKXA 3CS7A 4WF8A 3PTNA 1NRNH 3RM2H 2EEKA 4MNXA 1NFYA 1UK2A 4GHQA 1ANCA 3UREA 1TOCB 3GOVB 1GMHF 3NXPA 3A8BA 3P8OA 2EA3A 1UVOA 1P0SH 4ZXYH 5HYOA 1FZZA 2OBOA 4X8VH 2VIDA 1JWTA 4SGBE 1MKXK 2FI4E 4UDWH 1VGCB 2OINA 1YP9A 1C1QA 3BTHE 4FUGA 1SGRE 3SUFA 3U8OH 1FPHH 1GHAG 1Y5BT 1K1OA 4FXGH 5JBCS 2ZU2A 1HLTH 5SGAE 1DWEH 1FN8A 4U2WA 5T6GA 3DFJA 1NC6A 2XC5A 3VGCC 1RTKA 5ESTE 3A8AA 5A8ZA 3E0NB 2VWMA 3B9FH 3TITA 1O5CB 1GG6B 4E06H 2RDLA 5JB9S 1QURH 1BBRE 9LPRA 3ENSB 3MU5A 2R2WU 1RD3B 1HYLA 3KQEA 3EAJA 4TPIZ 1A2CH 3RDZA 1GHXH 2ZFPH 2W5EA 3KCGH 4K3JA 4BXSA 1SGDE 1SLWB 3ZZ7A 3BN9A 4FU7A 3A7TA 1AVGH 3BEFB 1TNHA 1C1WH 1L0ZA 1LHGH 1Y3UA 5EW1H 4XOJA 2UUYA 2ZU1A 3PO1C 1T8MA 3VXEH 1SG8B 1MTNB 1O2UA 1IOEA 1GBFA 4I32A 2F91A 2AFQB 3SU5A 2NU0E 3MNSA 3QLPH 4WVPE 5FPTA 4ISLA 3OY6U 3MYWA 3ZVCA 2STBE 5T3HA 4FUHA 3TVJB 4F4OC 3LH1A 1MKWH 1KY9A 3SV9A 2STAE 1GWAA 2DUCA 4AFQA 1D3QB 1QCPA 2G00A 1V2LT 5ABWA 1V2MT 5FXLA 2FX4A 3B23B 2QF0A 2THFB 1BA8B 1P11E 2TRMA 1GHZA 4AG1A 3ELAH 3H7OA 3AVZA 2A4QA 2FO9A 2FOGA 5GCHF 1HIAA 2GMTC 1EB1H 1YBWA 1YPGH 4AN7A 2SGQE 3UUZA 1IQEA 2ZC9H 4TWWA 3BTKE 1ETTH 3O8DA 2W3KA 3HPTB 1MAYA 1C5TA 3A81A 4CRDA 4DGJA 4CBNA 4PROA 4DG4A 3BG8A 3SGBE 1HFDA 2GP9B 1A5GH 1ABJH 1AE5A 1UHBB 1TX6A 1EQ9A 4Q80A 1EZQA 1QQ4A 3GCTG 3RXBA 1GBEA 4MPUA 1A4WH 2G55A 1VITG 2Q1JA 2VNTA 3OYPA 1FONA 1W7XH 2BLOA 4ABEA 3SU6A 1EAIA 4ZKSU 1C5SA 1YM0A 1K2I1 1IQGA 1DY9A 1JIMA 3MU4A 4K8BA 1K28D 1C1VH 1YCPH 1ZHRA 4K60A 1NU9A 4OS5A 2GZ8A 3SQEE 3GY3A 1CBWC 4IW4E 1RIWB 1X7AC 4Y7BA 1KXAA 4LZ4B 3M36A 5JBAS 1K21H 3LGIA 3SUGA 1F0SA 3SJ8A 2BD7A 3F9GA 1DSUA 2ZCHP 1ESAA 4ISHH 7ESTE 4WMDA 1O5BB 1GHBF 4OS2A 2PKSC 1GI9B 3TGKE 4WH8A 1AB9C 1PQ5A 3PLKA 3QO6A 1AN1E 6LPRA 5E2PA 5AFZH 5DP5A 1YPHE 3FP7E 2F9OA 4YLUA 2F9NA 4YOJA 1LTOA 2ZFFH 4OGYA 4D9QA 1F7ZA 1GI8B 1CU1A 4NA9H 1KSNA 4DURA 5A0AE 1SSXA 2P3FH 4AFSA 3S9AA 2ZHEH 3KNXA 4CBOA 1UTJA 4WXVA 1VGCC 1Q3XA 2QAAA 5H4IB 1HBTH 3NK8A 3ITIA 1NROH 2BY7X 3MH7A 4B71A 4XBBA 1SLXB 3ZVDA 3NKKA 2VIOA 4OS1A 1TRNA 2JETC 5GJ4B 4AFUA 2CMYA 2SGPE 1NT1A 3LGVA 1O2LA 3HGNA 2UUJB 2GCHF 1W8BH 5CMXH 3S7HB 4CRFA 1YLDA 1P02A 1HJ9A 2RA0A 1GMCF 4BAQB 1WUNH 1SGFG 1O5DH 1XX9A 1TBRH 3PV4A 4X6MA 5L2ZH 4AFZA 4O3TA 1A46H 2Z3EA 5C3NA 1OX1A 3SI4H 1E35B 3BEIB 4A1XA 1Z1IA 1AUJA 2OCVB 4D7FA 1VZQH 2C4FH 1V2PT 1ZGIA 3TNSA 2I6QA 1QFKH 2VWLA 3N7OA 1F2SE 4MNVA 3BF6H 4WXIA 1GJ9B 5EQSA 1ELBA 1O3KA 3DD2H 5E0HA 1ESBA 1SI5H 5F8XA 1ZSLA 1BUIA 1D3PB 1F5KU 5I25A 3RXOA 3SJKA 4ISOA 1BIOA 2BLQA 1THSH 2NU3E 2SGFE 1CSOE 1ID5H 3SHAH 3SW2B 2ZQ2A 2V3OH 3QN7A 1D6WA 1S82A 3RMLH 1BOQA 2R3YA 3QGJA 1XXDA 4CREA 5FCKA 5A8XA 2PUXB 1NESE 3F1SB 3RXIA 2V3HH 1Q31A 4BAKB 5C1XA 1YPMH 2H5CA 3F68H 2HVXA 1TABE 4K8YA 3UNSA 1FAXA 1U6QA 5J4QA 1NPMA 1JIRA 3LIWA 5HXFA 1P9SA 1KXEA 3BTFE 1W12U 1FY3A 1SGYE 2BQ6B 3ZV9A 9ESTA 5EXNA 3NCLA 3O8RA 4X1PU 5CHAC 4CRAA 4WWYA 1ZSKA 2ULLA 4ASHA 3M5NA 1AQ7A 1FQ3A 1LPGB 1PPCE 2XXLA 3CS0A 1YCPM 5DG6A 3I78A 1NO9H 5DP6A 1P57B 3SGAE 1ZLRA 5EW2H 1CGIE 2VGCC 3FZZA 4Y11E 2XBVA 2VIQA 2ZCLP 1C9TA 2BXTH 2BD4A 1T4UH 2ZU3A 1V2VT 4ZKRU 3E8LA 1A1RA 1YPEH 4Y79A 4TY7A 2TGTA 3PMBB 3W94A 1S81A 1LVYA 1XUJA 2JH6D 1VR1H 4X8TH 2FEQH 1FIZA 1LO6A 3P8NA 4Y8YA 3UTUH 1AVXA 1ZHPA 1O30A 1A5IA 4ABGA 1QNJA 1TMBH 3E6PH 1TOMH 4M7GA 2Y6TA 3MNCA 3SZNA 1HXEH 3DHKH 5EOKA 3URDA 2OC1A 2ZHDA 2HPQH 3NUMA 1OOKB 1AD8H 2BX3A 3TK5A 1AVWA 4DJZB
chains in the Genus database with same CATH superfamily
2P16A 3VGCB 4JK6A 4KELA 3RXRA 2DE9A 3U1IB 1EP5A 4Y7AA 4YZUA 2VIWA 5DO4H 2WPHS 1O3IA 1PYTC 2CXVA 3RXAA 1AUTC 1OP0A 3HK6B 5K7RA 1OP8A 4Q63A 1UTOA 1OP2A 4TY6A 4Y76A 3DUXH 1FNIA 5HGGA 1ZPZA 5TCAA 2FI3E 4O9VA 1RTLA 4O97A 2HNTC 1GJ4H 3HKIB 4A5TS 6GCHF 3LGWA 4I8GA 1FY8E 3GCOA 4MPXA 4CR9A 4Y8XA 5L6NH 2NWNA 1TAWA 4IMZA 1WTHD 1TONA 1GPZA 1LDTT 1W0ZU 2G5VA 1IHTH 1GI6A 1O5FH 3M7UA 1C5OH 2AIQA 3PV2A 1LPZB 5T6FA 3LU9B 1VCWA 3QK1A 3ZVAA 3I77A 4SGAE 4ISIH 3SNAA 3RXLA 2ZEBA 1AWFH 1MKXH 2BY9X 1ZPBA 2J95A 2A7JA 1T4VH 1TGCA 1C1MA 1IHSH 3MI4A 1OWHA 3SU1A 4KGAA 2PTCE 4F48B 4XDEA 1HXFH 2VH6A 1ZRKA 1TBQH 1GCDA 8KME2 4Q4LA 1H9LB 4OS7A 4BOHA 1A61H 1AIXH 3MU0A 3VFEA 1Z1JA 4ABAA 4TWYA 3URCA 1T8LA 1KLTA 3STJA 1DPOA 1O2OA 1BMAA 1VKYA 1ELGA 3RXHA 4IN2A 3GY2A 1C1OA 5HMAA 2BQWB 1QBNA 3KYFA 1GI7B 4DT7B 3A7XA 2XTTB 3GDSA 4JZDH 1XM1A 1C1PA 1DSTA 1V2UT 1SOTA 4FUIA 1VJAU 2CHAC 1GVKB 2ZDVH 3DSPA 2P95A 3ATLA 2BD5A 2ZFTA 2ZTZA 1T8NA 1SLUB 5JDUB 2GVFA 1B0EA 1MBQA 2K8IA 4X6OA 4ACAA 5IDKA 4CH2B 1OYTH 1OWDA 2ZDAH 3RC6A 1AFEH 2BY8X 1NRRH 1H9HE 1BDAA 1MQ6A 2ANYA 3M37A 1GBIA 2C90B 1C2FA 1P2MA 3GISB 2AGGX 4KKDA 3UIRA 2D2DA 1TRMA 3D23A 2SNVA 1IQFA 1VJ9U 2TGPZ 1SLVB 1D6RA 2BTCE 5ESBA 5L2YH 1P2QA 1XUFA 2H2ZA 3RP2A 1YYY1 3T2NA 2C8YB 2F83A 2ZI2H 2WV5A 4K1SA 1W0JD 3OTJE 1WTGH 1A0JA 2PTNA 2Y5FA 2JDID 1DX5M 1A5HA 1LQDB 3LH3A 3ZZAA 1O38A 1BHXB 1CHOG 1TQ0B 2G4TA 3NPSA 1P2NA 4DY7B 1O2JA 1XKBC 3TU7H 4GCHF 4TSFD 1GDQA 1WYKA 1V2QT 1Y5UT 5GWZA 1O2QA 1NFXA 2CF9H 1EB2A 2FTMA 3M7TA 4JYVH 3O8CA 2BM2A 1Z6JH 3IWMA 1W0YH 2QXHA 2BDAA 3BSQA 1O5AB 1FX0B 2OP9A 3S9CA 1QB9A 1H4WA 1F5RA 4J1YA 3RMMH 2Y5HA 2AIPA 3ZV8A 2FI5E 4RT1A 1LQEA 1HCGA 1AE8H 3QTOH 1AB9B 1GBJA 5GPIB 3P8FA 4H42U 1G2LA 1EJMA 3P95A 1EATA 5EU8A 4Y0YE 1C2JA 2BDBA 3PRDA 1O2SA 1HAGE 1Z7KA 1C5WB 4ZXXH 4I86A 4ZHMU 1MBMA 2BDYA 3DSGA 1UTLM 2B9LA 5EXMA 1F92A 4JYUH 1N6YA 4ABDA 2Z9IA 1O3LA 3TLOA 1G3CA 1TRYA 1IQJA 3MH4A 3BTWE 2ZECA 3BIUH 4WJG2 3MO3A 3RXSA 1GBCA 4ZROA 1DLKB 2HGTH 1MABB 1MU6B 2BLVA 2J97A 2OUAA 4I8HA 3UR9A 3MTYA 1C5RA 4D76A 2OXSA 4NSVA 1V2NT 2VU8E 2ZGXH 3GCTF 4ASUD 5EGMA 4RKJB 1F0RA 1HJAC 2BVXH 2NU2E 3OY5U 2TIOA 1K9OE 1VITF 2ZGJA 3PWCA 4A7IB 1L4DA 1H8DH 1G30B 2AERH 2JETB 1JBUH 2VVCA 5LPRA 1OWJA 1ANBA 1NM6A 1C4Y2 2FM2A 7GCHG 1MTWA 1P05A 1O3NA 3SHCH 5EG4A 4DVAU 2Q6DA 1FY4A 3FKSD 3T25A 1O2WA 1Z8IB 4IC5A 1SL3A 3V3MA 4B76A 1ABIH 2AMPA 4AZ2B 2JH0D 5KGOA 1BTUA 1HAZB 3TJVA 3D65E 3C1KA 2QN5T 5DP7A 1E1RD 4NA8A 3CENA 1QR3E 2I6SA 2G5NA 2AMQA 3M3VA 3LJJA 3V12A 2OQUA 4WMEA 3JZ2B 1ZMLA 3UWJH 3UQOA 2XW9A 1GGDC 1GDNA 4RKOB 2BD9A 1DUAA 1W0KD 1ZJDA 2ZO3H 3ZVGA 3FN8A 3VXFH 5F8TA 3A88A 4KTSA 5E2OA 3RXCA 2PGBB 3DFLA 4WMFA 2F9PA 2A45B 3ZZCA 4BNRA 1QBVH 1O3FA 1FIWA 3ODFA 1NFWA 1EKBB 4XBDA 3EE0B 3EA8A 2WPMS 3ZZ9A 2AS9A 1H8IH 1GBKA 3CNRA 4X1NU 2FOAA 4CR5A 1AZ8A 3RXFA 1B5GH 1GJDB 1GBHA 3TK9A 4MNYA 3HGPA 3G01A 2JH5D 1E34B 2ZDLA 1TB6H 1UTMA 2B8OH 3M3TA 2H1UA 5DPAA 2IOTA 1VITH 4H4FA 2GCTC 1V2WT 3L33A 2ZFSA 5FAHA 1DWDH 3P6ZB 1MCVA 2XNDD 5CHAB 1HAOH 2ODYB 2GV6A 2ZGBH 4Z1MD 5JBTA 4FUFA 2ZQ1A 4X1RU 1A3BH 4MNWA 4K1EA 1FY5A 2KZ4A 2ANWA 1KYNA 2VGCB 2KAIB 1V3XA 1LHDH 2ODQA 1TPOA 3RXMA 1AY6H 1P12E 1SHHB 1O39A 3K65B 1YGCH 3UNQA 3SJOA 3UOUA 1O2YA 3LT3A 5E0GA 2A1DB 3LONA 1AO5A 1RFNA 1Y59T 5EPYA 1G32B 1MTVA 5C67A 1GJAB 4UFFH 3NWUA 1GI2A 3MH5A 8ESTE 4YM9A 2BB4A 2C93B 4ABBA 2ZF0H 1HNEE 1MD8A 2W3IA 4F55A 1HRTH 1QJ7B 2BOKA 2A5IA 3PLBA 1JRSA 1ELEE 1E79D 2FMJA 3M5MA 2A7CA 3U69H 1Y3VA 1A0LA 2PKAA 4F49A 1GJ5H 2BY6X 1WDIA 5J4SA 3EYDA 4Z0KA 1TPAE 4UFDH 2JKHA 3LKWA 4DT4A 5C1YA 3BTEE 1QL9A 2BX4A 5LGOA 1BRCE 1F5LA 2ZGCA 5ETXA 5C17A 1IQNA 4E7RG 2G8TA 3A80A 3RLYH 2A31A 5AFYH 1EX3A 1GHYH 1LCYA 1P8VC 2BZ6H 3Q76A 2XBYA 2YNAA 3M5OA 1HAHH 2UWPA 2HALA 2ALPA 2YMSB 1NRQH 1ELFA 3H09A 1K22H 1H9IE 2VINA 1K1MA 1K1IA 1QJ1B 5E8EH 1SGIB 4DIIH 1C2DA 5BRRE 3GYMA 2RA3A 5EPNA 5GDSH 3OE7D 2FWWA 1KLIH 2ZCKP 3MOCA 1HGTH 1TNKA 3PROA 5E0JA 1MUEB 5GXPA 1YPHC 2Q6FA 4LK4A 1O2TA 3AAVA 4WY3A 1T32A 1EPTB 1MH0A 3ZVEA 2ZP0H 3A83A 3EGKH 1TWXB 4NWLA 2BXUH 1CGJE 2C8XB 2C3SA 2P3UB 1QQUA 1G3DA 4E7NA 5K0HA 2AGIX 2EY4C 4XRNA 4LZ1H 2FYQA 1LHCH 2ANKH 2Y7ZA 3Q00A 1K1PA 4HTCH 1O5EH 1KTSB 5F53A 4JCNA 4NSYA 4FUDA 1OWIA 2A4GA 4I7YH 3QWCH 1FPCH 1HAYB 1INCA 1Z8GA 4BAMB 2J38A 4JZEH 5JB8S 1KLJH 1AMHA 1HAXB 2DE8A 3AAUA 1GMDF 1Z6EA 1AKSB 1T8OA 2YNBA 3MFJA 3TH4H 4XD7D 4JMYA 2ANMH 1E36B 1UCYH 1OHHD 1GCTC 4FETA 1LPKB 4FUEA 1OWEA 1P3CA 2JJ1D 2M2AA 2FS9A 2CHAB 4JZIA 1BT7A 1P03A 3PMJA 3LGYA 2ZPRA 5KECA 1W11U 5CDFE 2PW8H 5TCCA 1TALA 2FOCA 4B1TA 1W10U 1XXFA 3V7TA 2TGAA 1O2NA 1PYTD 3A84A 3U9AH 2VB0A 4NA7A 2A0QB 2ZHFH 4RT0A 1C2HA 2FLRH 1D3TB 1Y3XA 1UTNA 3F6UH 2FODA 3RLWH 3ZVBA 1C1NA 2PFEA 1SQOA 2J92A 2C8WB 1Z71A 2OQ5A 2Z3DA 4GPGA 2V35A 2A2QH 1UVTH 1YY3A 1DOJA 3PM3A 1SBWA 1J14A 1CGHA 2UWOA 5FCRA 3A7ZA 1C5VA 1XUKA 4X8UH 2GX4A 3LPRA 2R0KA 3SZEA 1S0QA 4Q7YA 2L6OA 1UTPA 2J94A 4ZKNU 1EAXA 4JYTA 1B7XB 1VCPA 4I8JA 3DSOA 2W26A 3EA9A 4YO9A 2ZFQH 2ZDMA 1K1LA 1EJNA 1MQ5A 1EASA 1SHYA 3QX5H 4BTUB 4XE4A 4NIVA 2VH0A 2J34A 2XOKD 3ZYEA 2J4IA 2QA9E 5FHTA 1J15A 3M61U 1T31A 3RXPA 2GDEH 2A2XH 1GJBB 2KX4A 3RU4D 3RXTA 3ZZDA 1SPJA 3MO9A 1LHFH 2QXGA 3KIDU 3MU1A 1EZXC 3BTDE 3FOAA 1C5XB 2ZDNA 1TBZH 3M35A 1RJXB 2QIQA 4X1QU 1MTUA 5EQQA 2WINI 3JZ1B 2EI7A 4YESB 2FOFA 3KQBA 3M7QA 1BQYA 1S83A 3U8TH 3K2UA 1CE5A 1IAUA 2WPLS 1ZPCA 1AZZA 3GY4A 4I31A 4I8LA 1C5PA 3D49H 1HPGA 1SFIA 2AHME 3OAAD 2F9UA 1D4PB 1W7GH 2KM0A 1YPKH 1UK3A 4O03A 3VG8A 3FFGA 8GCHG 1WQSA 3PMAB 4OGXA 4ABFA 4H6TA 4NFFA 4B6EA 5DN6D 2SFAA 1DT2A 3S69A 2QXIA 2GGVB 2XWAA 2ZPSA 2FPZA 4JZ1A 1C2LA 3O8BA 5JPMH 3QUMP 4A1VA 1QRXA 2G81E 2HLCA 4X2VA 4XBCA 1GI1A 1HJAB 2PKAB 3RXUA 1O3AA 4NGAH 1YPJH 3H5CB 1KMHB 2VIPA 3SJIA 2GDDA 3FAOA 3I29A 5C0UA 4MQAA 2UUKB 1KIGH 2P93A 1GI3A 1THPB 4BTIB 2CF8H 4NZLA 2FOBA 2FESH 1YPLH 1WXRA 2IJOB 4HG6A 4BTTB 2EI8A 3SO3A 1O3PB 1UCYK 4FVBA 1NZQH 2BHGA 2R3UA 1P10A 4GHTA 1P04A 4ZH8A 4NFEA 4AYVB 1O37A 5EQRA 2VVUA 4Y10E 1TGBA 5T6DA 1AU8A 3KEEA 2BDHA 4AOQA 2YMSC 3WW7A 4B75A 4FUCA 1GGDB 2CK3D 3SV2H 4THNH 1C5QA 2GCHG 2L74A 1UJ1A 1DFPA 1OPHB 2PR3A 3P8GA 5IK2D 1GMCG 4ZHAA 1CT0E 4U30A 1A0HB 2OTVA 2KCAA 1QJ6B 5GNDA 5FPYA 1O2KA 1XUIA 5FPSA 3P17H 2XNIA 2FX6A 1V2JT 1UCYE 2WV4A 2CN0H 4Y6DA 1TE0A 1EPTC 2D8WA 3UNRA 3IITA 1N1LA 2BMGB 1MCTA 1G36A 1SGNE 1O31A 2PWXA 2G51A 1PQ8A 1T7CA 4X6NA 3A8CA 2PGQB 2ZGHA 1GHAF 1ORFA 3EQ0H 4YTAA 1WCZA 2BDCA 2GV7A 5G4BA 3ATMA 1SGEE 2A7HA 1GBMA 2GCTB 4KTCA 1BCUH 1UO6A 1O3HA 2A5AA 1EAUA 1HAVB 1O3GA 4MDSA 2V3MA 4Q2KA 1XUHA 2BY5X 2IPHA 5FX6A 1W2KH 3SN8A 3F9HA 4HI3A 1C1RA 3P92A 3QDZB 1L2EA 2XWBI 1Z8RA 2BD2A 2FOHA 1NBMD 1C1SA 3BG4B 5EXLA 3U8RH 3VB4A 3A86A 4IS5A 4Y71A 1MAXA 3MNXA 1BRUP 1CHGA 1P3EA 2KAIA 3T5FH 1DE7H 1GBDA 2VWOA 4P00A 4AGJA 1TNIA 1C5YB 1GJ8B 2FDAA 2R2MB 3RXGA 1IQKA 3F9FA 1DLEA 2GZ9A 1UMAH 1SQAA 2BDIA 3SGQE 4A92A 2AYWA 2AH4X 1V2ST 4GUXA 4IMQA 1O36A 3T26A 1C2EA 1GJ7B 2XBWA 5DP3A 1PPGE 1HJ8A 2Z94A 2ZHQH 2ESTE 1DANH 4GAWA 4KP0A 1TA6A 1PFXC 3BV9B 1EAWA 4DOQA 2W7UA 3M5LA 1W3CA 3TJNA 3RXEA 3GYLB 2FLBH 3QZRA 3UY9A 1TQ7B 1RGQA 3ZZ8A 5C5NA 4ABHA 1ARBA 2W6ID 4AG2A 3UFAA 3SNBA 1IQIA 1DWBH 3A7YA 1BRBE 3S7KB 4E05H 3D62A 2Y80A 5C2ZA 2ZFRH 3BIVH 3T29A 1DDJA 2XC0A 4HGCA 4R0IA 5AF9H 1LVOA 1V2KT 2BOHB 2GT7A 3MU8A 1C5NH 3OU0A 2VVVA 4FVDA 2A4OA 3DT0H 4R8TB 3BEUA 1NRPH 1D3DB 1UTQA 3V0XA 1BTYA 1MTSA 5EODA 3SBKA 3OFND 2PSYA 4MPWA 1SR5C 5LPFA 1ANEA 2ZU4A 1GHWH 1A7SA 1BZXE 1C1UH 1GI5A 1E1QD 4ACBA 2PHBA 1ZMJA 2BDGA 3W95A 1ELTA 3KQCA 1EPTA 4MVNA 4B2AA 2PV9B 5EJLA 3F2HA 6GCHG 1PPFE 1O35A 3U98H 2Y81A 1MZAA 1GBBA 2F9BH 3GY6A 3U28C 1SGTA 2WZQA 1HB0B 1Y8TA 3DA9B 1Q2WA 3SV6A 1QL7A 1LHEH 1CT4E 4MTBA 1UTKA 3E90B 1QL8A 4K5ZA 2BD8A 3ZYDA 2H9HA 1KXFA 2RCEA 3GCHB 3SU3A 1QBOA 1LVMA 4UD9H 1AKSA 2P59A 8LPRA 1DVAH 3PRBA 5A0BA 4AYYB 1Y3WA 1DS2E 1GCTB 1SB1H 4NIWA 2ASUB 2WSSD 4K2YA 4NIYA 5HM9A 1BBRK 4AX9H 3E1XB 2O8MA 2P94A 3A87A 4YT7H 2ZPQA 1ZTJA 1HAIH 4AB9A 1P01A 4HZHA 4CRGA 1CA0C 3F2FA 1DWCH 1UVSH 3VEQB 1BTWA 2ZDKA 1ZTKA 5IYTA 3SNCA 1GJCB 1TMTH 2XRCA 3SYJA 1C4U2 1E37B 1O3MA 1GBTA 4CH8B 3RM0H 4O3UA 3LC3A 3RMOH 3RXDA 4NZQA 1YKTA 5DP8A 3PYHA 2FP7B 1EOJA 1O2RA 4BANB 1BTHH 4UEHH 4I33A 4DIHH 1TFXA 5JBBS 2XYAA 2GKVE 3BTQE 3AASA 1GJ6A 2VIVA 1AGJA 2SNWA 1IQLA 2Z9KA 1BMMH 2O8WA 5L30H 4WH6A 4YOIA 2ALVA 4HFPB 2XCNA 4D7GA 3LOXA 4U01A 4FUBA 5DGJA 3T62A 1EXFA 1S5SA 4FU8A 1O2MA 4ISNA 4X8SH 3UQVA 1FLEE 2F4LA 2FYRA 1BRAA 1NN6A 3RMNH 3R3GB 1QB6A 1MD7A 4FUJA 1PPBH 2BZAA 3RUOA 1CO7E 3GY7A 2O8UA 3ZZ3A 1OWKA 4J2YB 4QT8C 2G52A 1RRKA 4NIXA 2H5DA 1C5MD 3FP8E 2H9EH 2HOBA 2BQ7B 1NY22 2BYAX 3TNTA 1CVWH 1UVUH 1J9CH 2V0BA 3R0FA 4GCHG 4NG9H 3OTPA 4IN1A 4MG3A 4UE7H 5DSFA 5HKKD 1NRSH 1XVMA 3BG4C 3KHVA 2OC0A 1JRTA 4BXWA 1C2MA 1TGNA 1ZMNA 4Q7XA 1C9PA 1E0FD 1SGPE 5LPEA 5FX5A 2GTBA 1ARCA 2WPKS 1O5GH 5FBEA 1BITA 5LH8A 1C1TA 3E3TA 5DKMA 1ANDA 3L6PA 5A09A 1PJPA 3GY5A 5EIYA 2RFKC 2QYIA 1G37A 1FAKH 4OM9A 2A5KA 4VGCB 2O9QA 2PLXA 1GMHG 2Z7FE 1GVZA 2B0FA 3KN2A 2F3CE 4DCDA 4ABJA 1P2KA 1XUGA 1HUTH 3KL6A 3CP7A 2KR7A 1VCQA 2WYJA 1GVLA 3SORA 1O2XA 4ESTE 1WAYB 1MU8B 3T28A 2WHXA 4FU9A 2LNCA 2VBCA 5FL7D 5BPEA 1J17T 1KXDA 1P9UA 1QGFA 1WU1A 1O2HA 5F03A 1DICA 1C5ZB 1BJUA 2QF3A 4RI0A 3VB3A 2QY0B 1FI8A 5B6LA 2AMDA 3NZIA 1MMJN 2HNTF 1BTZA 3AW0A 4A1TA 2EC9H 3T27A 1THRH 1AFQC 3LC5A 1DM4B 3TPIZ 1N8OB 1C4V2 3LGUA 4CHAB 5HM2A 3E91A 1ELCA 3SV8A 1PQAA 1QB1A 1V2RT 1TIOA 1TGSZ 1O3DA 1ZSJA 2FIRH 4B73A 3SJ9A 4GSOA 1ELAA 3ZVFA 3E16B 4IGDA 4X1SU 2ZIQH 4YT6H 3B8JA 1LVBA 2P8OC 3A89A 4XSKU 5CE1A 2M5TA 3EA7A 2CGAA 3PTBA 1TLDA 2Z6BD 1COWD 2VWNA 3ZZBA 4MLFB 8GCHF 2Y7XA 2FOMB 1P2JA 3QZQA 1GL0E 2B7DH 1C2KA 1AHTH 3Q3YA 4JZFH 3MH6A 1NS3A 1UK4A 2RDEA 3S9BA 3OX7U 3GICB 1FMGA 1J16A 4OS6A 6CHAB 1ZOMA 2G4UA 2FS8A 2ZTXA 5DK1A 1PPHE 1EJAA 4MPVA 4NCYA 1EUFA 4B2CA 2UWLA 3SQHE 1CQQA 2QCYA 1SGQE 3TK6A 5C5OA 3GCHC 3ODDA 1HAVA 3UPEA 4INHA 3AK5A 3SU2A 5I46H 1N6XA 1NU7B 1RTFB 3SNDA 1EZUC 1SOZA 1CA8B 2CV3A 1V6DA 2JIZD 5GIBA 1IQMA 3E0PB 2V6NA 1S6FA 1JMOH 2F9VA 1MKWK 3EDXB 4X2XA 2O8LA 4K69A 1HV7A 3ATKA 1O3OA 2Z3CA 1W14U 1WV7H 2EI6A 3WWFA 1G9IE 3S0NA 1O2PA 1C2IA 1SVPA 3K9XB 3HATH 3PB1E 2YMSD 1C5LH 3A7VA 1KXBA 2R0LA 1S6HA 1P2IA 3PV5A 4JK5A 5GCHG 1GG6C 1P09A 1P06A 3TJUA 1KXCA 3HKJB 1ELVA 3KF2A 3PWBA 4DW2U 2Y5GA 1UVPA 2QXJA 2ZNKH 2YOLA 4ZHLU 1FY1A 2OC7A 2QV1A 5TJXA 1J8AA 2VJ1A 4UONA 3MMGA 3FP6E 1RXPA 2A32A 3WY8A 3KQ5A 5C1UA 1FJSA 2XC4A 5C20A 5DP9A 1BB0B 1YF4A 2Z9GA 1KDQA 1SQTA 3M3SA 4NWKA 1EP6A 2BVSH 1MTNC 1ETRH 1XKAC 4OS4A 1ZRBA 1RS0A 2J2UA 2UUFB 4UFGH 4D8NA 4RN6A 2NU1E 1OS8A 3SOSA 2IN2A 1O2IA 1O3JA 1GI4A 1V2OT 1OXGA 2TBSA 4IBLH 2ZHWH 1YCPK 2ZZUH 1V2TT 1BTPA 1QA0A 3MO6A 3RC5A 3UR6A 1QA7A 4TYDA 3ZZ4A 1SQRA 5FBIA 1GHVH 2PUQH 3VB5A 4AB8A 3OEHD 1TA2A 4B74A 1DXPA 1Y3YA 3TIUA 2SGAA 4GVUA 2GJGA 1ESTA 3KGPA 7LPRA 1GBLA 1B0FA 1TNJA 1Y5AT 4YOGA 1O34A 1GHBG 4UFEH 3TGJE 1TNGA 3F9EA 4LXBH 3SU0A 2GD4B 3Q77A 3A85A 1HIAB 1BMFD 2XBXA 3ESTA 3P70B 3VPKA 1G3EA 4B6FA 4ZUHA 1OYQA 3LGTA 4VGCC 1LKAA 1UW7A 1FXYA 1GI0A 1D9IA 2Z9LA 1H8HD 2BLWA 3QTVH 1QTFA 3FZDA 3C27B 3ZZ6A 3OEED 3BTGE 4Y8ZA 1CHOF 1ZGVA 2ODPA 4CRCA 3SNEA 1ZHMA 2ZA5A 3Q3KA 5A2MH 1IQHA 3A7WA 3ZZ5A 1DUEA 1QRZA 1ACBE 1GBAA 1SC8U 2H9TH 1SKYE 4ABIA 3GDVA 1ZYOA 1L4ZA 1JOUB 2W6JD 1TYNA 1EOLA 1LMWB 1L1NA 1YLCA 2QGRA 1HDTH 1PPZA 4BAHB 3BTTE 1CA0B 4YLQH 1L1JA 1Z8JB 3Q3XA 2TGDA 4AGKA 1GMDG 1SGCA 3TGIE 5JYIA 1S6LA 1SMFE 4K1TA 1HAPH 1S84A 1P2OA 1N8OC 1AWHB 2HWLB 1FUJA 1FN6A 1RIWC 4CHAC 3OSYA 2AEIH 1F0TA 1L1GA 2A4RA 1DY8A 5AVDA 1WSSH 3RU4T 3TJOA 3MNBA 1WBGB 5AHGH 1G3BA 3MWIU 2ZTYA 1O2VA 3STIA 1KTTB 2XCFA 1ELDE 5F6MA 2CJIA 1MZDA 2FOEA 2HVYB 4X2YA 1O3CA 3AW1A 4INLA 4X6PA 1W13U 3GY8A 1TGTA 1YLNA 4KTUA 2LPRA 1TPSA 4ZKOU 1TNLA 2HNTE 2K1QA 2EQNA 3SU4A 1BJVA 2KCPA 5EJ1A 4Y0ZE 3TH3H 2J98A 3L3TA 2B5TB 3RXKA 4A6LA 2OD3B 5A8YA 1O32A 2D1JA 3PO1B 1QY6A 3IG6B 6CHAC 4IC6A 4AORA 2ZU5A 5PTPA 1QHRB 4B2BA 2GT8A 1GL1A 3PLPA 2ZKSA 2SGDE 1TMUH 2C8ZB 3K6ZA 1QRWA 3N99A 4Z6AH 7GCHF 2OC8A 4ZAEA 1BBRH 4D9RA 1TPPA 3RC4A 1GDUA 3SV7A 2V7QD 1S0RA 1FDPA 4U32A 4FOUC 3SI3H 2TPIZ 2Y82A 1NTPA 2R9PA 4XFQA 1O2ZA 3TH2H 2H6MA 1ZZZA 3N7EA 4X2WA 3A82A 3HK3B 4LOYH 3RXVA 1A3EH 3RU4E 1K1NA 4H6SB 1BTXA 1EZSC 3KQDA 1O3BA 1FV9A 3SUEA 2AGEX 3UOPA 4INKA 5HIZA 1PPEE 1C5UA 3QGNB 3LDXH 1SFQB 2BD3A 2HRVA 3H7TA 5F8ZA 2W7SA 3MHWU 2WPIS 2P3TB 3K6YA 2WPJS 3RXJA 2NU4E 3ATIA 2GMTB 3GCNA 5CHBA 1XVOA 3GDUA 1DXWA 2RG3A 1DITH 2BVRH 1O2GH 2ILNA 5DJ7A 5A0CA 6ESTA 1SGFA 2PP6A 2FXRA 1E38B 1BMNH 1BHXF 2GZ7A 4I8KA 3FVFB 7KMEH 1YC0A 3RXQA 2F43B 1NFUA 1WQVH 1O0DH 1M9UA 1ZR0A 3U1JB 3SUDA 1G2MA 5KEDA 1ZJKA 1O33A 2D26C 2FTLE 2Q6GA 2OBQA 2SGEE 5B6OA 4TPYA 1JXPA 1UHBA 1KDQB 4Q7ZA 1LKBA 1QIXB 2WUBA 1F0UA 2FZZA 1K1JA 2PSXA 3VB7A 2WYGA 3FANA 1CT2E 3LJOA 5DP4A 1ZTLA 1H1BA 4CRBA 2WUCA 4ZMAH 2HPPH 2KFWA 3ATWA 4RSPA 1AFQB 1WOFA 2J9NA 3BTME 3VB6A 1CBWB 1BMLA 4GLYA 3A8DA 1OSSA 4BAOB 1AI8H 2O8TA 4X0WU 1TX7A 2Z9JA 2ZG0H 1TX8A 2P8OB 2OLGA 1XMNB 3V13A 1O3EA 1PQ7A 2QF4A 2PKSB 3PMHB 3UWIA 1S85A 1C2GA 2ZWLH 2QC2A 1ETSH 1OKXA 3CS7A 4WF8A 3PTNA 1NRNH 3RM2H 2EEKA 4MNXA 1NFYA 1UK2A 4GHQA 1ANCA 3UREA 1TOCB 3GOVB 1GMHF 3NXPA 3A8BA 3P8OA 2EA3A 1UVOA 1P0SH 4ZXYH 5HYOA 1FZZA 2OBOA 4X8VH 3F0PA 3ZIAD 2VIDA 1JWTA 4SGBE 5HIYA 1MKXK 2FI4E 4UDWH 1VGCB 2OINA 1YP9A 1C1QA 3BTHE 4FUGA 1SGRE 3SUFA 2J5UA 3U8OH 1FPHH 1GHAG 1Y5BT 2JJ2D 1K1OA 4FXGH 5JBCS 2IPQX 2ZU2A 1HLTH 5SGAE 2K0QA 1DWEH 1FN8A 4U2WA 5T6GA 1NBME 3DFJA 1NC6A 2XC5A 3VGCC 1RTKA 5ESTE 3A8AA 5A8ZA 3E0NB 2VWMA 3B9FH 2WPDD 3TITA 1O5CB 1GG6B 3F2GA 4E06H 1H8ED 2RDLA 5JB9S 1QURH 1BBRE 5T1VA 9LPRA 3EE7A 3ENSB 3MU5A 2R2WU 1RD3B 1HYLA 3KQEA 3EAJA 4TPIZ 1A2CH 3RDZA 1GHXH 2ZFPH 2W5EA 3KCGH 4K3JA 4BXSA 1SGDE 1SLWB 3ZZ7A 3BN9A 4FU7A 4TT3D 3A7TA 1AVGH 3BEFB 1TNHA 1C1WH 1L0ZA 2J98B 1LHGH 1Y3UA 5EW1H 4XOJA 2UUYA 2ZU1A 2HLDD 3PO1C 1T8MA 3VXEH 1SG8B 1MTNB 1O2UA 5C94A 1IOEA 1GBFA 4I32A 3F3BA 2F91A 2AFQB 3SU5A 2NU0E 3MNSA 3QLPH 4WVPE 3F0OA 5FPTA 4ISLA 3OY6U 3MYWA 3ZVCA 2STBE 5T3HA 4FUHA 3TVJB 4F4OC 3LH1A 1MKWH 1KY9A 3SV9A 2STAE 1GWAA 2DUCA 4AFQA 1D3QB 1QCPA 2G00A 1V2LT 5ABWA 1V2MT 5FXLA 2FX4A 3B23B 2QF0A 2THFB 2IJD1 1BA8B 1P11E 2TRMA 1GHZA 4AG1A 3ELAH 3H7OA 3AVZA 2QF5A 2A4QA 2FO9A 2FOGA 5GCHF 1YWUA 1HIAA 2GMTC 1EB1H 1YBWA 1YPGH 4AN7A 2SGQE 3UUZA 1IQEA 2ZC9H 4TWWA 3BTKE 3KYGA 1ETTH 3O8DA 2W3KA 3HPTB 1MAYA 1C5TA 3UB0A 3A81A 4CRDA 4DGJA 4CBNA 4PROA 4DG4A 3BG8A 3SGBE 4P02A 1EFRD 3FO8D 1HFDA 2GP9B 1A5GH 1ABJH 1AE5A 1UHBB 1TX6A 1EQ9A 4Q80A 1EZQA 1QQ4A 3GCTG 3RXBA 2LP6A 1GBEA 4MPUA 1A4WH 2G55A 1VITG 2Q1JA 2VNTA 3OYPA 1FONA 1W7XH 2BLOA 4ABEA 3SU6A 1EAIA 4ZKSU 1C5SA 1YM0A 1K2I1 1IQGA 1DY9A 1JIMA 3MU4A 4K8BA 5EJZA 1K28D 1C1VH 1YCPH 1ZHRA 4K60A 1NU9A 4OS5A 2GZ8A 3SQEE 3GY3A 1CBWC 4IW4E 1RIWB 1X7AC 5C0TA 4Y7BA 1KXAA 4LZ4B 3M36A 5JBAS 1K21H 3LGIA 3SUGA 1F0SA 3SJ8A 2BD7A 3F9GA 1DSUA 2ZCHP 1ESAA 4ISHH 7ESTE 4WMDA 1O5BB 1GHBF 3WWBA 4OS2A 2PKSC 1GI9B 3TGKE 4WH8A 1AB9C 1PQ5A 3PLKA 3QO6A 1AN1E 6LPRA 5E2PA 5AFZH 5DP5A 1YPHE 3FP7E 2F9OA 4YLUA 2F9NA 4YOJA 1LTOA 2ZFFH 4M9FA 4OGYA 4D9QA 1F7ZA 1GI8B 2WV9A 1CU1A 4NA9H 1KSNA 4DURA 5A0AE 1K0HA 1SSXA 2P3FH 4AFSA 3S9AA 2ZHEH 3KNXA 4CBOA 1UTJA 4WXVA 1VGCC 1Q3XA 2QAAA 5H4IB 3NRLA 1HBTH 3NK8A 3ITIA 1NROH 2BY7X 3MH7A 4B71A 4XBBA 1SLXB 3ZVDA 3NKKA 2VIOA 4OS1A 1TRNA 2JETC 5GJ4B 4AFUA 2CMYA 2SGPE 1NT1A 3LGVA 1O2LA 3HGNA 2UUJB 2GCHF 1W8BH 5CMXH 3S7HB 4CRFA 4ZCNA 1YLDA 1P02A 1HJ9A 2RA0A 1GMCF 4BAQB 1WUNH 4YXWD 1SGFG 1O5DH 1XX9A 1TBRH 3PV4A 4X6MA 5L2ZH 4AC9A 4AFZA 4O3TA 1A46H 2Z3EA 5C3NA 1OX1A 3SI4H 1E35B 3BEIB 4A1XA 1Z1IA 1AUJA 2OCVB 4D7FA 1VZQH 2C4FH 1V2PT 2OK5A 1ZGIA 3TNSA 2I6QA 1QFKH 2VWLA 3N7OA 1F2SE 4MNVA 3BF6H 4WXIA 3MQKC 1GJ9B 5EQSA 1ELBA 1O3KA 3N7DA 3DD2H 5E0HA 1ESBA 1SI5H 5F8XA 1ZSLA 1BUIA 1D3PB 1F5KU 5I25A 3RXOA 3SJKA 4ISOA 1BIOA 2BLQA 1THSH 2NU3E 3GS9A 2SGFE 1CSOE 1ID5H 3SHAH 3SW2B 2ZQ2A 2V3OH 3QN7A 1D6WA 1S82A 3RMLH 1BOQA 2R3YA 3QGJA 1XXDA 4CREA 5FCKA 5A8XA 2PUXB 3DCLA 1NESE 3F1SB 3RXIA 2V3HH 1Q31A 4BAKB 5C1XA 1YPMH 2H5CA 3F68H 2HVXA 1TABE 4K8YA 3UNSA 1FAXA 1U6QA 5J4QA 1NPMA 1JIRA 2KCYA 3LIWA 5HXFA 1P9SA 1KXEA 3BTFE 1W12U 1FY3A 1SGYE 2BQ6B 3ZV9A 9ESTA 5EXNA 3NCLA 3O8RA 4X1PU 1QZ8A 5CHAC 4CRAA 4WWYA 1ZSKA 2LELA 2ULLA 4ASHA 3M5NA 3W1EA 1AQ7A 1FQ3A 1LPGB 1PPCE 2XXLA 3CS0A 1YCPM 5DG6A 3I78A 1NO9H 5DP6A 1P57B 3SGAE 1ZLRA 5EW2H 1CGIE 2VGCC 3FZZA 4Y11E 2XBVA 3UAIC 2VIQA 2ZCLP 1C9TA 2BXTH 2BD4A 1T4UH 2ZU3A 1V2VT 4ZKRU 3E8LA 1A1RA 1YPEH 4Y79A 4TY7A 2TGTA 3PMBB 3W94A 1S81A 1LVYA 1XUJA 2JH6D 1VR1H 4X8TH 2FEQH 1FIZA 1LO6A 3P8NA 4Y8YA 3UTUH 1AVXA 1ZHPA 1O30A 1A5IA 4ABGA 1QNJA 1TMBH 3E6PH 1TOMH 4M7GA 2Y6TA 3MNCA 3SZNA 1HXEH 3DHKH 5EOKA 3URDA 2OC1A 2ZHDA 2HPQH 3NUMA 2QE7D 1OOKB 2KCOA 1AD8H 2BX3A 3TK5A 1AVWA 4DJZB
chains in the Genus database with same CATH topology
2P16A 3VGCB 4JK6A 4KELA 3RXRA 2DE9A 3U1IB 1EP5A 4Y7AA 4YZUA 2VIWA 5DO4H 2WPHS 1O3IA 1PYTC 2CXVA 3RXAA 1AUTC 1OP0A 3HK6B 5K7RA 1OP8A 1UTOA 1OP2A 4TY6A 4Y76A 3DUXH 1FNIA 5HGGA 1ZPZA 5TCAA 2FI3E 4O9VA 1RTLA 4O97A 2HNTC 1GJ4H 3HKIB 4A5TS 6GCHF 3LGWA 4I8GA 1FY8E 3GCOA 4MPXA 4CR9A 4Y8XA 5L6NH 2NWNA 1TAWA 4IMZA 1WTHD 1TONA 1GPZA 1LDTT 1W0ZU 2G5VA 1IHTH 1GI6A 1O5FH 3M7UA 1C5OH 2AIQA 5T6FA 1LPZB 3LU9B 1VCWA 3QK1A 3ZVAA 3I77A 4SGAE 4ISIH 3SNAA 3RXLA 2ZEBA 1AWFH 1MKXH 2BY9X 1ZPBA 2J95A 2A7JA 1T4VH 1TGCA 1C1MA 1IHSH 3MI4A 1OWHA 3SU1A 4KGAA 2PTCE 4XDEA 1HXFH 2VH6A 1ZRKA 1TBQH 1GCDA 8KME2 1H9LB 4OS7A 4BOHA 1A61H 1AIXH 3MU0A 3VFEA 1Z1JA 4ABAA 4TWYA 3URCA 1T8LA 1KLTA 3STJA 1DPOA 1O2OA 1BMAA 1ELGA 3RXHA 4IN2A 3GY2A 1C1OA 5HMAA 2BQWB 1QBNA 4DT7B 1GI7B 3A7XA 2XTTB 3GDSA 4JZDH 1XM1A 1C1PA 1DSTA 1V2UT 1SOTA 4FUIA 1VJAU 2CHAC 1GVKB 2ZDVH 2P95A 3ATLA 2BD5A 2ZFTA 2ZTZA 1T8NA 1SLUB 5JDUB 2GVFA 1B0EA 1MBQA 4X6OA 5IDKA 4CH2B 1OYTH 1OWDA 2ZDAH 3RC6A 1AFEH 2BY8X 1NRRH 1H9HE 1BDAA 1MQ6A 2ANYA 3M37A 1GBIA 2C90B 1C2FA 1P2MA 3GISB 2AGGX 4KKDA 3UIRA 2D2DA 1TRMA 3D23A 2SNVA 1IQFA 1VJ9U 2TGPZ 1SLVB 1D6RA 2BTCE 5ESBA 5L2YH 1P2QA 1XUFA 2H2ZA 3RP2A 1YYY1 3T2NA 2C8YB 2F83A 2ZI2H 2WV5A 4K1SA 3OTJE 1WTGH 1A0JA 2PTNA 2Y5FA 3LH3A 1DX5M 1A5HA 1LQDB 3ZZAA 1O38A 1BHXB 1CHOG 1TQ0B 2G4TA 3NPSA 1P2NA 4DY7B 1O2JA 1XKBC 3TU7H 4GCHF 1GDQA 1WYKA 1V2QT 1Y5UT 5GWZA 1O2QA 1NFXA 2CF9H 1EB2A 2FTMA 3M7TA 4JYVH 3O8CA 2BM2A 1Z6JH 3IWMA 1W0YH 2QXHA 2BDAA 3BSQA 1O5AB 2OP9A 3S9CA 1QB9A 1H4WA 1F5RA 4J1YA 3RMMH 2Y5HA 2AIPA 3ZV8A 2FI5E 1LQEA 1HCGA 1AE8H 3QTOH 1AB9B 1GBJA 5GPIB 3P8FA 4H42U 1G2LA 1EJMA 3P95A 1EATA 5EU8A 4Y0YE 1C2JA 2BDBA 1O2SA 1HAGE 1Z7KA 1C5WB 4ZXXH 4ZHMU 1MBMA 2BDYA 1UTLM 2B9LA 5EXMA 1F92A 4JYUH 1N6YA 4ABDA 2Z9IA 1O3LA 3TLOA 1G3CA 1TRYA 1IQJA 3MH4A 3BTWE 2ZECA 3BIUH 4WJG2 3MO3A 3RXSA 1GBCA 4ZROA 1DLKB 2HGTH 1MU6B 2BLVA 2OUAA 4I8HA 3UR9A 3MTYA 1C5RA 4D76A 2OXSA 4NSVA 1V2NT 2VU8E 2ZGXH 3GCTF 5EGMA 4RKJB 1F0RA 1HJAC 2NU2E 2BVXH 3OY5U 2TIOA 1K9OE 1VITF 2ZGJA 3PWCA 4A7IB 1L4DA 1H8DH 1G30B 2AERH 2JETB 1JBUH 2VVCA 5LPRA 1OWJA 1ANBA 1NM6A 1C4Y2 2FM2A 7GCHG 1MTWA 1P05A 1O3NA 3SHCH 5EG4A 4DVAU 2Q6DA 1FY4A 3T25A 1O2WA 1Z8IB 4IC5A 1SL3A 3V3MA 4B76A 1ABIH 2AMPA 4AZ2B 2JH0D 1BTUA 1HAZB 3TJVA 3D65E 3C1KA 2QN5T 5DP7A 4NA8A 3CENA 1QR3E 2I6SA 2G5NA 2AMQA 3M3VA 3LJJA 3V12A 2OQUA 4WMEA 3JZ2B 1ZMLA 3UWJH 3UQOA 2XW9A 1GGDC 1GDNA 4RKOB 2BD9A 1DUAA 1ZJDA 2ZO3H 3ZVGA 3VXFH 5F8TA 3A88A 4KTSA 5E2OA 3RXCA 2PGBB 3DFLA 4WMFA 2F9PA 2A45B 3ZZCA 4BNRA 1QBVH 1O3FA 1FIWA 3ODFA 1NFWA 1EKBB 4XBDA 3EE0B 3EA8A 2WPMS 3ZZ9A 2AS9A 1H8IH 1GBKA 4X1NU 2FOAA 4CR5A 1AZ8A 3RXFA 1B5GH 1GJDB 1GBHA 3TK9A 4MNYA 3HGPA 3G01A 2JH5D 1E34B 2ZDLA 1TB6H 1UTMA 2B8OH 3M3TA 2H1UA 5DPAA 2IOTA 1VITH 4H4FA 2GCTC 1V2WT 3L33A 2ZFSA 5FAHA 1DWDH 3P6ZB 1MCVA 5CHAB 1HAOH 2ODYB 2GV6A 2ZGBH 5JBTA 4FUFA 2ZQ1A 4X1RU 1A3BH 4MNWA 4K1EA 1FY5A 2ANWA 1KYNA 2VGCB 2KAIB 1V3XA 1LHDH 2ODQA 1TPOA 3RXMA 1AY6H 1P12E 1SHHB 1O39A 3K65B 1YGCH 3UNQA 3SJOA 3UOUA 1O2YA 3LT3A 5E0GA 2A1DB 3LONA 1AO5A 1RFNA 1Y59T 5EPYA 1G32B 1MTVA 5C67A 1GJAB 4UFFH 3NWUA 1GI2A 3MH5A 8ESTE 4YM9A 2BB4A 2C93B 4ABBA 2ZF0H 1HNEE 1MD8A 2W3IA 1HRTH 1QJ7B 2BOKA 2A5IA 3PLBA 1JRSA 1ELEE 2FMJA 3M5MA 2A7CA 3U69H 1Y3VA 1A0LA 2PKAA 4F49A 1GJ5H 2BY6X 5J4SA 3EYDA 4Z0KA 1TPAE 4UFDH 2JKHA 3LKWA 5C1YA 3BTEE 1QL9A 2BX4A 5LGOA 1BRCE 1F5LA 2ZGCA 5ETXA 1IQNA 4E7RG 2G8TA 3A80A 3RLYH 2A31A 5AFYH 1EX3A 1GHYH 1LCYA 1P8VC 2BZ6H 3Q76A 2XBYA 2YNAA 3M5OA 1HAHH 2UWPA 2HALA 2ALPA 1NRQH 1ELFA 1K22H 1H9IE 2VINA 1K1MA 1K1IA 1QJ1B 5E8EH 1SGIB 4DIIH 1C2DA 5BRRE 3GYMA 2RA3A 5EPNA 5GDSH 2FWWA 1KLIH 2ZCKP 3MOCA 1HGTH 1TNKA 3PROA 5E0JA 1MUEB 5GXPA 1YPHC 2Q6FA 4LK4A 1O2TA 3AAVA 4WY3A 1T32A 1EPTB 1MH0A 3ZVEA 2ZP0H 3A83A 3EGKH 1TWXB 4NWLA 2BXUH 1CGJE 2C8XB 2C3SA 2P3UB 1QQUA 1G3DA 4E7NA 5K0HA 2AGIX 4LZ1H 2FYQA 1LHCH 2ANKH 2Y7ZA 3Q00A 1K1PA 4HTCH 1O5EH 1KTSB 4JCNA 4NSYA 4FUDA 1OWIA 2A4GA 4I7YH 3QWCH 1FPCH 1HAYB 1INCA 1Z8GA 4BAMB 2J38A 4JZEH 5JB8S 1KLJH 1AMHA 1HAXB 2DE8A 3AAUA 1GMDF 1Z6EA 1AKSB 1T8OA 2YNBA 3MFJA 3TH4H 4JMYA 2ANMH 1E36B 1UCYH 1GCTC 1LPKB 4FUEA 1OWEA 1P3CA 2FS9A 2CHAB 4JZIA 1BT7A 1P03A 3PMJA 3LGYA 2ZPRA 1W11U 2PW8H 5TCCA 1TALA 2FOCA 4B1TA 1W10U 1XXFA 3V7TA 2TGAA 1O2NA 1PYTD 3A84A 3U9AH 2VB0A 4NA7A 2A0QB 2ZHFH 1C2HA 2FLRH 1D3TB 1Y3XA 1UTNA 3F6UH 2FODA 3RLWH 3ZVBA 1C1NA 2PFEA 1SQOA 2J92A 2C8WB 1Z71A 2OQ5A 2Z3DA 4GPGA 2V35A 2A2QH 1UVTH 1DOJA 3PM3A 1SBWA 1J14A 1CGHA 2UWOA 5FCRA 3A7ZA 1C5VA 1XUKA 4X8UH 2GX4A 3LPRA 2R0KA 1S0QA 4Q7YA 4ZKNU 1UTPA 2J94A 1EAXA 4JYTA 1B7XB 1VCPA 4I8JA 2W26A 3EA9A 4YO9A 2ZFQH 2ZDMA 1K1LA 1EJNA 1MQ5A 1EASA 1SHYA 3QX5H 4BTUB 4XE4A 4NIVA 2VH0A 2J34A 3ZYEA 2J4IA 2QA9E 5FHTA 1J15A 3M61U 1T31A 3RXPA 2GDEH 2A2XH 1GJBB 3RU4D 3RXTA 3ZZDA 1SPJA 3MO9A 1LHFH 2QXGA 3KIDU 3MU1A 1EZXC 3BTDE 1C5XB 2ZDNA 1TBZH 3M35A 1RJXB 2QIQA 4X1QU 1MTUA 5EQQA 2WINI 3JZ1B 2EI7A 4YESB 2FOFA 3KQBA 3M7QA 1BQYA 1S83A 3U8TH 3K2UA 1CE5A 1IAUA 2WPLS 1ZPCA 1AZZA 3GY4A 4I31A 4I8LA 1C5PA 3D49H 1HPGA 1SFIA 2F9UA 1D4PB 1W7GH 1YPKH 1UK3A 4O03A 3FFGA 8GCHG 1WQSA 3PMAB 4OGXA 4ABFA 4H6TA 4NFFA 2SFAA 1DT2A 3S69A 2QXIA 2GGVB 2XWAA 2ZPSA 2FPZA 4JZ1A 1C2LA 3O8BA 5JPMH 3QUMP 4A1VA 1QRXA 2G81E 2HLCA 4X2VA 4XBCA 1GI1A 1HJAB 2PKAB 3RXUA 1O3AA 4NGAH 1YPJH 3H5CB 2VIPA 3SJIA 2GDDA 3FAOA 3I29A 4MQAA 2UUKB 1KIGH 2P93A 1GI3A 1THPB 4BTIB 2CF8H 4NZLA 2FOBA 2FESH 1YPLH 2IJOB 4BTTB 2EI8A 3SO3A 1O3PB 1UCYK 4FVBA 1NZQH 2BHGA 2R3UA 1P10A 4GHTA 1P04A 4ZH8A 4NFEA 4AYVB 1O37A 5EQRA 2VVUA 4Y10E 1TGBA 5T6DA 1AU8A 3KEEA 2BDHA 4AOQA 4B75A 4FUCA 1GGDB 3SV2H 4THNH 1C5QA 2GCHG 1UJ1A 1DFPA 1OPHB 2PR3A 3P8GA 1GMCG 4ZHAA 1CT0E 4U30A 1A0HB 2OTVA 1QJ6B 5FPYA 1O2KA 1XUIA 5FPSA 3P17H 2XNIA 2FX6A 1V2JT 1UCYE 2WV4A 2CN0H 4Y6DA 1TE0A 1EPTC 2D8WA 3UNRA 3IITA 1N1LA 2BMGB 1MCTA 1G36A 1SGNE 1O31A 2PWXA 2G51A 1PQ8A 1T7CA 4X6NA 3A8CA 2PGQB 2ZGHA 1GHAF 1ORFA 3EQ0H 4YTAA 1WCZA 2BDCA 2GV7A 5G4BA 3ATMA 1SGEE 2A7HA 1GBMA 2GCTB 4KTCA 1BCUH 1UO6A 1O3HA 2A5AA 1EAUA 1HAVB 1O3GA 4MDSA 4Q2KA 1XUHA 2BY5X 2IPHA 5FX6A 1W2KH 3SN8A 3F9HA 4HI3A 1C1RA 3P92A 3QDZB 1L2EA 2XWBI 1Z8RA 2BD2A 2FOHA 1C1SA 3BG4B 5EXLA 3U8RH 3VB4A 3A86A 4IS5A 4Y71A 1MAXA 3MNXA 1BRUP 1CHGA 1P3EA 2KAIA 3T5FH 1DE7H 1GBDA 2VWOA 4AGJA 1TNIA 1C5YB 1GJ8B 2FDAA 2R2MB 3RXGA 1IQKA 3F9FA 1DLEA 2GZ9A 1UMAH 1SQAA 2BDIA 3SGQE 4A92A 2AYWA 2AH4X 1V2ST 4GUXA 4IMQA 1O36A 3T26A 1C2EA 1GJ7B 2XBWA 5DP3A 1PPGE 1HJ8A 2Z94A 2ZHQH 2ESTE 1DANH 4GAWA 4KP0A 1TA6A 1PFXC 3BV9B 1EAWA 4DOQA 2W7UA 3M5LA 1W3CA 3TJNA 3RXEA 3GYLB 2FLBH 3QZRA 3UY9A 1TQ7B 1RGQA 3ZZ8A 5C5NA 4ABHA 1ARBA 4AG2A 3UFAA 3SNBA 1IQIA 1DWBH 3A7YA 1BRBE 3S7KB 4E05H 3D62A 2Y80A 5C2ZA 2ZFRH 3BIVH 3T29A 1DDJA 2XC0A 4HGCA 4R0IA 5AF9H 1LVOA 1V2KT 2BOHB 2GT7A 3MU8A 1C5NH 3OU0A 2VVVA 4FVDA 2A4OA 3DT0H 4R8TB 3BEUA 1NRPH 1D3DB 1UTQA 3V0XA 1BTYA 1MTSA 5EODA 3SBKA 2PSYA 4MPWA 1SR5C 5LPFA 1ANEA 2ZU4A 1GHWH 1A7SA 1BZXE 1C1UH 1GI5A 2PHBA 1ZMJA 2BDGA 3W95A 1ELTA 3KQCA 1EPTA 4MVNA 4B2AA 2PV9B 6GCHG 1PPFE 1O35A 3U98H 2Y81A 1MZAA 1GBBA 2F9BH 3GY6A 1SGTA 1HB0B 1Y8TA 3DA9B 1Q2WA 3SV6A 1QL7A 1LHEH 1CT4E 4MTBA 1UTKA 3E90B 1QL8A 4K5ZA 2BD8A 3ZYDA 2H9HA 1KXFA 2RCEA 3GCHB 3SU3A 1QBOA 1LVMA 4UD9H 1AKSA 2P59A 8LPRA 1DVAH 5A0BA 4AYYB 1Y3WA 1DS2E 1GCTB 1SB1H 4NIWA 2ASUB 4K2YA 4NIYA 5HM9A 1BBRK 4AX9H 3E1XB 2O8MA 2P94A 3A87A 4YT7H 2ZPQA 1ZTJA 1HAIH 4AB9A 1P01A 4HZHA 4CRGA 1CA0C 1DWCH 1UVSH 3VEQB 1BTWA 2ZDKA 1ZTKA 5IYTA 3SNCA 1GJCB 1TMTH 2XRCA 1C4U2 1E37B 1O3MA 1GBTA 4CH8B 3RM0H 4O3UA 3LC3A 3RMOH 3RXDA 4NZQA 1YKTA 5DP8A 3PYHA 2FP7B 1EOJA 1O2RA 4BANB 1BTHH 4UEHH 4I33A 4DIHH 1TFXA 5JBBS 2XYAA 2GKVE 3BTQE 3AASA 1GJ6A 2VIVA 1AGJA 2SNWA 1IQLA 2Z9KA 1BMMH 2O8WA 5L30H 4WH6A 4YOIA 2ALVA 4HFPB 2XCNA 4D7GA 3LOXA 4U01A 4FUBA 5DGJA 3T62A 1EXFA 1S5SA 4FU8A 1O2MA 4ISNA 4X8SH 3UQVA 1FLEE 2FYRA 1BRAA 1NN6A 3RMNH 3R3GB 1QB6A 1MD7A 4FUJA 1PPBH 2BZAA 3RUOA 1CO7E 3GY7A