2B9LA

Crystal structure of prophenoloxidase activating factor-ii from the beetle holotrichia diomphalia
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
394
structure length
372
Chain Sequence
GHMAVVNIFGNASEYIPPGYEAPLGALTALPRCGTGADQGKKVCIVYHRCDGVTNTVTPEEVINTTGEGIFDIRENANECESYLDVCCGLPPVVPVLKPSFCGIRNERGLDFKITGQTNEAEYGEFPWMVAVLKANEEQLVCGGSLIAPSVVLTGAHCVNSYQSNLDAIKIRAGEWDTLTEKERLPYQERKIRQVIIHSNFNPKTVVNDVALLLLDRPLVQADNIGTICLPQQSQIFDSTECFASGWGKKEFGSRHRYSNILKKIQLPTVDRDKCQADLRNTRLGLKFVLDQTFVCAGGEQGKDTCTGDGGSPLFCPDPRNPSRYMQMGIVAWGIGCGDENVPGVYANVAHFRNWIDQEMQAKGLSTTPYVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords prophenoloxidase activating factor
publication title Crystal structure of a clip-domain serine protease and functional roles of the clip domains.
pubmed doi rcsb
source organism Holotrichia diomphalia
molecule tags Immune system/protein binding
total genus 88
structure length 372
sequence length 394
ec nomenclature
pdb deposition date 2005-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF18322 CLIP_1 Serine protease Clip domain PPAF-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2b9lA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2b9lA01
3ZZ7A 2A31A 4BTTB 1T31A 2XW9A 4CBNA 1P2OA 2F3CE 1P10A 1GMCG 1UVUH 3SV9A 1O2GH 3A85A 2WINI 5K7RA 5JBCS 5GDSH 2A45B 1NRSH 5EGMA 2OC1A 7LPRA 1YLDA 2BLWA 2VIWA 1DE7H 3AVZA 2IN2A 2HNTC 3V7TA 1BRUP 2C93B 1HAXB 1MCTA 1S83A 1AGJA 1C4V2 2FZZA 3SN8A 3GY6A 1O3OA 4GLYA 1O5BB 1P02A 5DP7A 2PKAA 5A09A 2NU0E 2TGDA 4IMZA 1OS8A 2QV1A 4ZROA 4Y0YE 1AFQB 1GVLA 2P95A 3ITIA 5JYIA 2GVFA 1O2XA 3MHWU 5HM2A 2OCVB 1J15A 4IN2A 2QYIA 4ZXXH 1FN8A 4TPIZ 3GICB 1J14A 5JBBS 2VU8E 1C1SA 1GHVH 2BY6X 5AVDA 3ZZBA 4Y79A 1UJ1A 1O3NA 1C5SA 4CRDA 2GZ9A 1RGQA 2BD4A 1JIMA 1UTJA 3F6UH 3MU8A 1ELBA 1V2KT 2AS9A 6GCHF 4B73A 2FX4A 4AFUA 3SU0A 1BHXB 1Z7KA 1DXWA 3A8CA 2G55A 1IQKA 4KKDA 2VB0A 4XBDA 2ZKSA 5GPIB 1EZXC 1O3KA 2RA3A 3UQOA 3U98H 2BY7X 1TMUH 3E91A 2ZC9H 3BTEE 1CU1A 1SMFE 1UMAH 1ZRKA 3LKWA 4X2XA 2GP9B 3EA8A 3MH6A 1O2LA 3E0PB 1NZQH 1DFPA 2CMYA 3UREA 5DP3A 1JMOH 1OPHB 3RC4A 1Y3UA 5EG4A 4XBCA 4ABIA 3T5FH 4K1SA 4ZKRU 3LT3A 2CV3A 4A92A 1L2EA 3OX7U 3SV7A 4K8BA 1J16A 1DY9A 2BY9X 1ZPBA 1V2LT 1LHFH 1QRXA 2OUAA 3S9BA 1P2QA 3BG4B 4RN6A 4R8TB 1TABE 7GCHF 1C4Y2 2ZDAH 3SNBA 1AUTC 1SOTA 3QTVH 3RXLA 1P06A 1GBHA 1NRNH 1NRRH 1ZJDA 1EATA 2ANMH 2IJOB 4GCHG 1XUKA 1UVPA 4WVPE 5C67A 1VGCC 3UNSA 4CR5A 1G3EA 3GISB 4DVAU 1FIZA 1O2PA 2IPHA 2BB4A 4ABBA 2C8YB 4O97A 2TIOA 3SGQE 4YESB 8GCHG 4MG3A 1QIXB 2AGEX 1YPJH 4DURA 2C8XB 4BTUB 4XOJA 1AWHB 1HGTH 1GDUA 1O36A 1YBWA 4MPUA 2PWXA 1H8DH 4X8SH 1UVSH 1OXGA 1NN6A 1S6HA 3SBKA 4X2WA 1EP5A 3R3GB 4JZDH 4KTUA 1THRH 2FM2A 2OC7A 3KQBA 3ODFA 3MNBA 1WOFA 3E8LA 1DWDH 1YP9A 4FUGA 1VCPA 3TH3H 3GY5A 1LHCH 3JZ2B 1AN1E 2FEQH 3KF2A 3RXPA 2CHAB 3TK6A 1G36A 3GCTG 1A5HA 4Q7ZA 1C5PA 1SGCA 1JIRA 1QRWA 1C2HA 1HAPH 1F92A 4UFDH 4DIIH 1MTVA 1C1MA 1C2JA 1T7CA 3LONA 3UY9A 1TPOA 1GPZA 5HYOA 3GDVA 3A89A 1EZSC 3TVJB 1H8IH 4YT6H 1W13U 4GVUA 1KLIH 2ZDNA 4UFEH 1FMGA 1S84A 5L6NH 1LPZB 4U2WA 3PO1C 1FY8E 2BQ6B 2GCTC 2IOTA 3LPRA 4UE7H 2YNAA 5DJ7A 4BNRA 3BSQA 3RXDA 2JH6D 1QJ1B 1P57B 2WUBA 4GSOA 2UUKB 1OWIA 1P01A 1TWXB 2BOHB 1HLTH 2QAAA 4K8YA 1OOKB 4TPYA 3E90B 1DPOA 1SGFG 5F6MA 1GHYH 1VGCB 1S5SA 1SGYE 3VEQB 3BTME 1JWTA 2Z6BD 2ZHDA 1O5DH 1YC0A 1UTNA 3T25A 2BD8A 1DANH 2I6SA 3GCHB 1O30A 2FOGA 1C1TA 1AE8H 2OD3B 1Y5UT 4KTCA 4XFQA 3A7ZA 5L2YH 2GTBA 2LPRA 1LQDB 1QA7A 1F0SA 1EASA 3RXMA 1XUGA 2FI3E 2O8WA 1DX5M 5LPFA 1JBUH 1ZMLA 1O5EH 1TBRH 2GV6A 1VITH 2R0KA 2GGVB 1EPTA 1NFWA 1ZSJA 2BDGA 4K69A 1S0QA 1O3HA 2ZPRA 1Z6EA 3NKKA 2ZHFH 1GBTA 3RXRA 1AVXA 2BD5A 4NWKA 3TGJE 1G3BA 2TGTA 2DUCA 3AAVA 3HKJB 1D3TB 1GJ4H 3SJIA 1BRCE 1DSUA 1M9UA 1LVMA 4AB9A 4AN7A 5DP9A 1D9IA 1TA2A 4NA7A 3LH1A 2J95A 3N7OA 2CXVA 1P2IA 4I33A 1VITG 2BZ6H 3S7HB 1CE5A 4XDEA 1LCYA 1BMAA 1QJ7B 3RXIA 1MTNB 5C1YA 1O2KA 1PPZA 4HGCA 3TJVA 4YOGA 3PO1B 1BTWA 5A0BA 2HNTE 4Y71A 5ESTE 1TNLA 2QIQA 2VIDA 1C2EA 1G2MA 2UWLA 1O35A 1XUFA 2G4TA 1ZRBA 3M7UA 5C5OA 1DWCH 2ZG0H 5H4IB 2BDYA 1C2IA 1CHOG 3TU7H 1C5QA 4AZ2B 1Z1JA 3ZZ6A 4VGCB 1UCYH 1LHDH 2FX6A 4ISHH 1FUJA 4WWYA 3FANA 2XYAA 4MNWA 3A8AA 3BTQE 5CE1A 2ODQA 3MYWA 3U9AH 2GCHG 4NIXA 3SGBE 2ZU5A 5GCHF 2QC2A 2V6NA 1ELVA 1G3DA 1K1PA 4X6NA 2FTMA 2FOAA 2ZGHA 4ISOA 1SGNE 2EA3A 4Y6DA 1O5AB 2Y5GA 1MU8B 1PQ8A 4GCHF 7ESTE 1EOLA 1CQQA 1O3LA 1Z1IA 4X2YA 3GCNA 2SFAA 5EOKA 3RUOA 1C1NA 1C5RA 3K9XB 1C5VA 1IQHA 1FY1A 1RFNA 3U8TH 1AHTH 3ZVGA 1XUHA 1Y3XA 1V2TT 2BYAX 1WSSH 1MUEB 3E0NB 4B2CA 1ELDE 4DOQA 2FPZA 4CREA 2XWAA 2VH0A 1FNIA 2CF9H 2OLGA 4U30A 2ZZUH 1F5LA 1KLTA 4XE4A 1C5OH 1UK2A 1ELTA 6CHAB 2QXJA 3FP8E 1V2RT 3QDZB 1ELAA 1UVOA 1FQ3A 1TQ0B 1TNIA 1BBRH 1ZTLA 3MOCA 3P8GA 2P16A 2VVCA 2TPIZ 3Q00A 1O3PB 2K1QA 1K1MA 2EEKA 3SW2B 2HNTF 1ZSLA 2XC4A 3L3TA 1SGQE 3P70B 4AYVB 1D3DB 5E2OA 3RXQA 2NU1E 2ZCLP 1QA0A 3SGAE 3MWIU 1XMNB 1PYTD 1MKXH 4E7RG 3TGIE 4BAMB 1TYNA 2G4UA 3U8OH 4BAQB 3P95A 2Z9IA 1VCWA 1GMDF 2BDIA 1F0RA 2XNIA 1BTYA 2FS9A 5K0HA 1O3MA 2VWMA 3AW1A 1KXAA 3ATMA 1P05A 3BF6H 1V2NT 3A7WA 3HK3B 1GG6B 1TALA 5TCCA 3SV8A 2VINA 1XM1A 4ISNA 3ODDA 1Y3YA 1C2FA 3Q3XA 1TGSZ 1MZDA 3OYPA 4X8TH 3I29A 1GVZA 2C90B 1GHWH 5EXNA 4UDWH 3RXEA 3K65B 2GV7A 2CJIA 2FMJA 4WXVA 3SNAA 2ZDMA 9ESTA 1ELFA 8ESTE 3FZZA 3S69A 3P8NA 3DFJA 1CBWB 2D1JA 2BDAA 3HGPA 4NG9H 1QTFA 1GDNA 1O2JA 3M36A 3E6PH 4A6LA 2ZFQH 3AAUA 1O5CB 3UPEA 3GY7A 9LPRA 5LPEA 2GMTB 5J4QA 4IW4E 1W7GH 3QZQA 2FIRH 2BVSH 1OKXA 2ESTE 1YPEH 3VB3A 1HAIH 1YM0A 2GZ7A 1HJAC 2P3FH 4XBBA 4XSKU 1O3CA 3PMBB 4WH8A 3IWMA 4ZKNU 1ANEA 2ODPA 2HOBA 1XUJA 4E05H 1IQFA 1QBNA 4X0WU 1BJUA 2BLQA 2P93A 3PMJA 3PTNA 4B71A 4IS5A 1O33A 1PPCE 4FU7A 1UCYE 1K28D 2QA9E 1SHHB 3MO3A 1NO9H 3TLOA 1AO5A 1BTPA 3MH5A 3MNCA 2ODYB 1E38B 1QY6A 3TPIZ 1TGCA 1BOQA 3R0FA 1GDQA 1HAVA 3KN2A 4ZHLU 1EKBB 1DITH 1VITF 3SU1A 2ZHQH 3BN9A 1E36B 2WYJA 3RXHA 1TNHA 2OBQA 1Z8IB 4BAHB 1TMTH 3ZZ3A 2A2QH 1P09A 1E35B 2BM2A 4MNVA 3A81A 3P8FA 4GAWA 1MAXA 4TWWA 5DK1A 3E3TA 4MQAA 2JETB 1OX1A 3SQHE 1AVWA 2A5KA 3RXAA 1QL8A 1O2OA 2FS8A 4AFQA 4Q80A 1P9UA 3UNQA 2VWLA 4CRFA 3UQVA 1GBCA 1BTZA 4A1XA 1LMWB 2AMQA 4IGDA 2ULLA 3SJOA 2DE8A 2THFB 1K1OA 4OGYA 1KIGH 1GGDC 1BUIA 4NIVA 3RXBA 4ESTE 1YCPH 1NFYA 5ESBA 2AERH 3PM3A 2F9OA 1O3EA 2A7HA 3EA7A 1LDTT 5SGAE 1BBRE 4WY3A 2FYQA 4K2YA 4HI3A 3ZZCA 3SUFA 5FCKA 1ZPZA 2Z9LA 5GJ4B 3M7TA 2Z7FE 1GCTB 5F8TA 5E0JA 2Y82A 2G00A 3CS0A 3SUDA 3SU4A 4ABAA 1SHYA 1KLJH 1BDAA 3LC5A 2BX3A 1TE0A 5C1UA 3HK6B 1V2UT 1C1RA 3JZ1B 7KMEH 1NFXA 1LHGH 1YLCA 2PV9B 2OC0A 3TK9A 4JCNA 1SGPE 1SFIA 4K60A 2W3KA 1WUNH 3UOUA 1SL3A 4IBLH 1OP2A 4U01A 2PKSC 1ORFA 1CA0C 1HAYB 1TAWA 2OXSA 3HGNA 1GL0E 2Y6TA 2D8WA 1ZYOA 1WYKA 4FVBA 2OINA 2A4RA 1TNJA 1O39A 3VGCC 1RIWC 5LPRA 2QF0A 2A5AA 1J8AA 1NU9A 2Q6DA 1GI9B 3RMOH 3RMNH 4YO9A 1UVTH 2BX4A 1KY9A 1P2KA 3ZVFA 4NWLA 2SGQE 1NRPH 4OS6A 2XBVA 3SUGA 4CRCA 3GY8A 3K6ZA 3VB6A 1IQIA 1V2JT 3RU4T 2BDHA 2FOCA 3D49H 1GHBG 5EQQA 1B0FA 1GBAA 3SNEA 2OQUA 5FBIA 1P04A 1CGIE 5CHAB 2PSXA 1A0JA 2V35A 2BOKA 3U8RH 1C1VH 3MNXA 4I7YH 4IN1A 5L2ZH 1ZHPA 5DP6A 3RXJA 4CRAA 3O8CA 1C5XB 1PJPA 2NU3E 5EW2H 2PGBB 4NCYA 4AORA 1HXFH 1MH0A 2TGAA 1P3CA 1SQAA 4ZUHA 1EB1H 4X8UH 3LGIA 2ANWA 4Y8ZA 1HUTH 1GHAG 1H9IE 1IHSH 2SGDE 1N1LA 2ZHEH 2WPHS 1L1GA 3TNSA 2Z9JA 4E7NA 1ZOMA 3NCLA 3F9GA 2Z3CA 1FIWA 1TRMA 5F8ZA 2ZTXA 1Q2WA 1NU7B 4INKA 1C1WH 5C20A 1P8VC 2A4QA 2BD9A 1GMHG 1C2KA 1CSOE 3UFAA 2OC8A 2FLBH 1EX3A 3A88A 1SGEE 2G5VA 2ALVA 1PYTC 1AMHA 1TPSA 4FUDA 3M3SA 3Q3YA 1V3XA 2PKSB 3LJJA 1AZZA 1CA0B 1UTPA 2JH0D 1A3EH 3T27A 1A46H 2SGAA 3BEFB 3Q77A 1TA6A 4GHQA 1GJDB 3VGCB 1GI4A 3ZYEA 4CRBA 1Y3VA 1PPBH 2ZFSA 3EGKH 4SGAE 1P9SA 3TJNA 1TX7A 2FODA 4ZHAA 1L0ZA 3LH3A 1OYTH 4AFSA 1HAZB 5FPYA 2XC0A 2CN0H 4K1EA 2PW8H 2AEIH 3MNSA 2PGQB 1BTHH 3LGWA 1E37B 3RXOA 1EAXA 1XX9A 2H6MA 5JB8S 1HNEE 1VJ9U 1D6WA 1FJSA 3L33A 1SGRE 1GBEA 4INHA 2JKHA 1E0FD 3P8OA 3MO6A 1A0HB 2FI4E 3RLYH 4K3JA 2XCFA 1TLDA 4B1TA 1GI3A 1SVPA 2VGCC 1HYLA 1PPHE 2QN5T 5HXFA 1RS0A 2GT8A 2H9EH 1GJBB 3SV6A 2ZDKA 1DVAH 3IITA 3FP7E 4NSVA 2AYWA 5C1XA 3GYMA 2G52A 1GI7B 3STIA 2ASUB 2XBWA 4Z0KA 3EYDA 4NIWA 2AGIX 1UK4A 3FP6E 3QN7A 4NZLA 4CRGA 5FAHA 2R3UA 4AOQA 2ZHWH 3LGVA 2ZQ1A 3AASA 1AIXH 1QB1A 1QCPA 1CHGA 1MBMA 1QL9A 1VZQH 3SZNA 4QT8C 1U6QA 1LKAA 4DIHH 1DWBH 4WJG2 1X7AC 1AVGH 5DP8A 1FI8A 3NXPA 1V2QT 3A82A 4Y11E 3DD2H 2FP7B 3DHKH 1C2LA 1CGHA 1YPKH 2ZPSA 2W7UA 2SNVA 1Y3WA 3RM0H 1ABJH 1O31A 1GMCF 3T62A 5E2PA 1T8LA 5TJXA 1PQ5A 4CHAC 4ABJA 4TY6A 4A7IB 5AFZH 1F0TA 1LTOA 2O8MA 1MU6B 3RLWH 2XCNA 3AW0A 1C5WB 2OQ5A 3DFLA 3C27B 1ZGVA 1PFXC 2BLOA 1TONA 1BB0B 1K2I1 4K5ZA 1HBTH 1C5YB 2Y7ZA 3RDZA 4OS1A 1FLEE 1BMNH 4I8GA 5ETXA 4Y10E 4BAOB 2VIPA 1T8MA 1GJAB 3SV2H 3TH4H 1QHRB 4OS5A 2C8WB 1W2KH 1P0SH 1ZTJA 1UTMA 1THPB 2VGCB 2TBSA 2ZPQA 1KTSB 2AMPA 2BVRH 3KGPA 1J9CH 2NU2E 3BTFE 1V2ST 2ZF0H 1P2MA 4Q2KA 1HIAB 4BXWA 2BMGB 5T6GA 1UTLM 3ZV9A 2DE9A 4TY7A 1XKBC 1IOEA 5JPMH 4ZHMU 3VXFH 1OWDA 2PUXB 1XVMA 2VVVA 2WPMS 2WV4A 1RTKA 4Y8XA 5HM9A 2R2MB 3TGKE 1D3PB 3TJOA 1LO6A 5IYTA 3ATLA 4JZFH 4AGKA 1AD8H 2Z3DA 2ZU3A 1SQOA 4Y0ZE 4AG2A 1F7ZA 1YGCH 3A83A 2GCTB 3NK8A 2BD3A 3TK5A 3PROA 3ZZ9A 4ABEA 1GHAF 4X1RU 1O2HA 1HJ8A 5A8ZA 5AFYH 1KXFA 3BV9B 4JYTA 4NIYA 4UD9H 2SNWA 4NFEA 2GKVE 2QXIA 3Q76A 4IC5A 3A7VA 1J17T 2FOFA 3F9HA 3DT0H 3M5NA 4A1TA 2BLVA 4X1QU 3BTTE 1O38A 3PWBA 2C3SA 1UTOA 2SGEE 1A5GH 3SORA 1GMHF 1WV7H 1XKAC 5A8YA 2SGPE 1YPGH 1DXPA 1LPGB 4UFGH 2BY8X 3SO3A 2ZFFH 4FU9A 3MMGA 4FUEA 1K1IA 1ETTH 1D4PB 3SU6A 4CBOA 2PFEA 2A32A 5T3HA 1ESBA 2ZQ2A 2ANYA 1W3CA 2G5NA 3UTUH 4AB8A 1AU8A 1ZR0A 1D6RA 1O2RA 4H6TA 4D9RA 5F03A 2Z94A 6LPRA 2BTCE 3M7QA 8GCHF 2H1UA 4TWYA 1F0UA 1OYQA 1QBVH 1QURH 5FPSA 5EODA 2ZDLA 4JK5A 1SG8B 1EJMA 2GX4A 4BXSA 1KYNA 1BTUA 1EZUC 1N8OC 1P11E 4AG1A 1QR3E 4OGXA 1UK3A 4Y8YA 1SOZA 1LVOA 3ZVEA 4INLA 3GDUA 2FDAA 2G8TA 1C5LH 2PTNA 4H6SB 1FY3A 3QTOH 3TJUA 3CP7A 3UR6A 3HPTB 4UONA 2XC5A 2V0BA 3KQEA 1AB9C 4RKJB 1ZSKA 2FESH 4PROA 3A84A 1A1RA 1EJAA 3GCTF 2GDDA 4TYDA 4KP0A 2QY0B 4ABFA 4WF8A 4AX9H 2O9QA 2B5TB 2P59A 1A3BH 6GCHG 1SGFA 2GZ8A 2ZNKH 5C2ZA 2F9NA 3UOPA 1EP6A 2ZEBA 2HALA 1IQEA 1ZMJA 5DO4H 3U69H 2AFQB 1K21H 1YPHC 2HWLB 2HGTH 2AIQA 2ZIQH 5EQSA 4X1SU 1NFUA 3LGUA 3HKIB 4FVDA 1TFXA 4O3UA 4X6MA 3PLPA 1C4U2 3GY2A 4NA9H 4H4FA 1AI8H 1O37A 1GJ8B 1QGFA 1MTWA 3PMHB 1FY5A 1HDTH 4JYVH 2HPQH 4O9VA 5T6DA 2A4GA 1ZGIA 3VB7A 2NU4E 2Y81A 4I32A 2VNTA 4LZ4B 3LJOA 1OWHA 1QB6A 2P94A 3EA9A 4BAKB 1Y5BT 1N8OB 5AHGH 3ZV8A 1IHTH 1WU1A 3UWJH 1Y5AT 2VWOA 7GCHG 3SQEE 1BMMH 2BY5X 5HMAA 4DT7B 3L6PA 1V2WT 3STJA 3GDSA 4X1PU 1SBWA 4IMQA 4MPWA 3RMMH 1L1JA 2D2DA 1EUFA 1DSTA 1T4UH 1CT4E 1GJ9B 1EPTC 1AB9B 2RG3A 1O2VA 2ZWLH 1BQYA 3I78A 5A0AE 3VPKA 4FUBA 4MPXA 1TX6A 1QJ6B 2F83A 3RU4D 3EDXB 2ZU1A 4ABDA 2JH5D 4OS7A 4Y76A 2O8UA 2ZCKP 3F1SB 2FI5E 3P92A 3T2NA 1A7SA 1QFKH 2XTTB 2Z9GA 3RP2A 4JYUH 1ZTKA 2SGFE 1CT0E 1VCQA 2XBXA 1AFQC 1HJ9A 1TX8A 4GUXA 1HFDA 1YYY1 1P2NA 1YPMH 2AGGX 2PR3A 3TITA 2ZFTA 1ID5H 1NS3A 1TNKA 2J2UA 4R0IA 1G37A 3A86A 5IDKA 1XXDA 1ZZZA 1C1QA 5E0HA 3ZVAA 3OU0A 1AQ7A 4NA8A 8LPRA 1CA8B 4JZEH 2BDBA 3T26A 3UIRA 1GCDA 1CHOF 1O2TA 4A5TS 1GWAA 1WAYB 5BPEA 2ZA5A 1FONA 2QGRA 6ESTA 2CGAA 1TGTA 5EPYA 1N6XA 1S6FA 2OTVA 2XBYA 1ZHMA 2GCHF 4A1VA 1NRQH 3URCA 1UHBB 1YKTA 1YPLH 2FYRA 1WTGH 1G9IE 4HZHA 4DY7B 1F5RA 1C5NH 2EI7A 2H9HA 3GCOA 4FU8A 4GHTA 4AYYB 1EAWA 1HAGE 1G30B 1SLWB 1C9PA 2FO9A 4Z6AH 3M3TA 3K6YA 1O0DH 1SR5C 1B0EA 2A0QB 4ZKSU 3PB1E 1K1LA 4D7GA 2VJ1A 3O8DA 1HJAB 1HCGA 1O2SA 2RCEA 1HXEH 1Z8RA 1BJVA 1ETSH 1BCUH 4OS4A 2Y7XA 5HGGA 1O5FH 1NT1A 1W0YH 4FUFA 1CO7E 1EPTB 1MBQA 4ASHA 2WYGA 3B9FH 3D62A 3RXKA 2H9TH 3SHCH 1XVOA 3BG4C 2ZFPH 3C1KA 2ANKH 3MI4A 2VH6A 2A7CA 4FUHA 1JRTA 1O5GH 4D76A 5EXMA 3S7KB 1XUIA 1DLKB 3F9EA 1MTSA 1SGDE 2F91A 4GPGA 1ELCA 1GVKB 1IQMA 4B76A 1OWJA 1NPMA 1OWEA 4LK4A 1DY8A 4X2VA 1P03A 3NUMA 3SNCA 2PSYA 3M61U 1ABIH 2H2ZA 4J1YA 1CVWH 1O3DA 2KAIB 1C5ZB 1ELGA 1RXPA 1ESAA 2FLRH 1H4WA 1TQ7B 2HVXA 4WH6A 1O3JA 1C2GA 3BEIB 2ZU2A 3SJ9A 4YLQH 1WCZA 1ETRH 2STAE 1RTLA 4LZ1H 4X6OA 1QBOA 3A7XA 2FWWA 1G2LA 5C5NA 1OWKA 1TPAE 1AKSB 3PMAB 2EI8A 1W12U 1BMLA 4F4OC 3E1XB 1TGBA 1SI5H 3KNXA 3QUMP 2EI6A 2R9PA 2UUJB 3GY4A 3SJ8A 1GGDB 5DGJA 2F9BH 1NROH 4MPVA 1TGNA 1O2WA 4ZKOU 1A2CH 1C5MD 2M5TA 3CS7A 4SGBE 2PTCE 1SPJA 2BD2A 4O03A 3BTHE 1GBJA 3LU9B 3RC6A 1RRKA 1UTQA 3P6ZB 3RM2H 2CHAC 1BTXA 1TOCB 2Y5FA 1SB1H 4WXIA 1ZJKA 3S0NA 2ZFRH 5T6FA 4ZMAH 1O2NA 3S9AA 1ACBE 1O3GA 3BTKE 1UCYK 4B2BA 3PYHA 2J38A 5I25A 1MKWH 2ZECA 1O32A 3SI3H 1H1BA 2FXRA 1TRNA 1GJ6A 1BRBE 3M5MA 5A2MH 5E0GA 1HAHH 2C8ZB 3I77A 3UUZA 5FX5A 2WV5A 1O3AA 2P3UB 4MNXA 1BRAA 1TBQH 5GCHG 1TBZH 3RXTA 3GY3A 1GBIA 1H9HE 1RIWB 2AH4X 1HRTH 1ELEE 3O8RA 3SU2A 1HPGA 1LVBA 4I31A 3M5OA 3PLBA 1DUEA 1GHZA 1T4VH 3ZZ8A 4JZIA 2F9VA 1C1UH 4DJZB 1BA8B 3RXVA 5AF9H 1W11U 2P8OC 2I6QA 1GI2A 1YPHE 1GHXH 1A4WH 2STBE 3M3VA 1NC6A 3GCHC 2FTLE 1L1NA 2Z3EA 2ZP0H 1HB0B 1TIOA 2Q6FA 2W3IA 4CH2B 2P3TB 1BT7A 1WQSA 1Q3XA 4FUIA 2PLXA 3FFGA 1BBRK 4JK6A 1GJ7B 1MQ5A 3GYLB 4WMEA 2W5EA 2BQWB 4X1NU 3SUEA 2H5CA 3SJKA 3KEEA 1ZHRA 3BIVH 3CENA 3KQDA 2O8LA 1WQVH 3V3MA 1RTFB 1ZLRA 1B7XB 1ANDA 1ARBA 2VIOA 5JB9S 1P12E 4FUCA 4E06H 4Y7BA 1MKXK 3FAOA 3ZZDA 1IQJA 2B0FA 5C3NA 4D8NA 4ABHA 1A0LA 3QGJA 1W8BH 1PPGE 4ISIH 1IAUA 2BXTH 2W7SA 2ZO3H 2R2WU 4DG4A 1BIOA 2J92A 5FHTA 2XWBI 3UR9A 1EQ9A 4O3TA 1GMDG 1MTNC 4UEHH 4X8VH 4B75A 2VVUA 3SHAH 3KQCA 4MTBA 4KELA 5B6OA 4D7FA 5A0CA 3BG8A 3VB4A 4JMYA 3UNRA 1IQGA 4AGJA 1NESE 1UHBA 2PUQH 2ZGXH 1S81A 2QCYA 1LQEA 3U1IB 1BZXE 3RMLH 4VGCC 5CMXH 1FXYA 1HV7A 2R0LA 4YLUA 1O34A 1W10U 3M37A 2G51A 2A4OA 2XRCA 1O3BA 2UUFB 4B74A 3ATIA 2P8OB 4HFPB 1O3FA 1YF4A 1QQ4A 3LDXH 1QB9A 1O2QA 2J9NA 1CT2E 1C1OA 1O2IA 1Z71A 1G3CA 4I8LA 1F2SE 2C4FH 5DPAA 4CR9A 1S0RA 3OSYA 2GT7A 2YOLA 1MMJN 1T32A 1W7XH 1EJNA 1TRYA 3LOXA 3KHVA 3VB5A 2W26A 2V3OH 3VXEH 4CH8B 1DS2E 1V2PT 3ATKA 1CGJE 3MU5A 4I8JA 4RSPA 1DICA 1O2MA 2RA0A 1DOJA 5GXPA 1JXPA 3F68H 3Q3KA 3W95A 1GHBF 3B8JA 5E8EH 4I8HA 2TRMA 1S82A 3BTGE 3KCGH 1T8OA 4FUJA 1HAVB 1PPEE 5BRRE 2ZGCA 1FV9A 4HTCH 3RXFA 1K22H 1VR1H 5DG6A 3OY6U 3RC5A 1B5GH 2J4IA 4YTAA 3MH7A 1W14U 3ELAH 2UWPA 3ZZ4A 2FOEA 6CHAC 1KDQB 1GI5A 1LHEH 1NY22 1P2JA 1TB6H 2BXUH 1A5IA 1ZPCA 4ZAEA 2BD7A 2BHGA 2HRVA 1ARCA 5ABWA 2KAIA 4IC6A 1V6DA 3T29A 1GBLA 4MVNA 2Q6GA 1FAXA 1A61H 4YM9A 5JBAS 1EB2A 3VFEA 3PLKA 3M35A 4Q7XA 2Q1JA 3KL6A 1PQ7A 2Z9KA 3ZZAA 1AWFH 2G81E 1AKSA 2AMDA 2ILNA 4YOIA 1Q31A 3KIDU 4CHAB 5LGOA 3MU4A 1DLEA 1QQUA 2ZCHP 3QLPH 5FXLA 1C2MA 3BEUA 2RDLA 1O2UA 3QZRA 3ZVDA 2ZGJA 3EE0B 1LPKB 5EXLA 3W94A 3QO6A 3PTBA 1EXFA 4NSYA 2HPPH 3ZYDA 2D26C 1FN6A 1YCPK 3A7TA 3B23B 1KSNA 3FVFB 2ALPA 3NPSA 1IQNA 4BOHA 1INCA 4LXBH 4NGAH 1AE5A 5DKMA 3T28A 1VJAU 3A7YA 4Q7YA 1C2DA 2J94A 2UUYA 4UFFH 1EAUA 1FY4A 1E34B 1N6YA 1OP8A 1GG6C 3OTJE 1Z8GA 1SLXB 1JOUB 1BHXF 2B8OH 2PKAB 2H5DA 5J4SA 2WPIS 3MO9A 3S9CA 3H5CB 3TH2H 3PWCA 4ZH8A 1KXBA 5GWZA 4DGJA 1G32B 1GJ5H 4X6PA 3MTYA 5FBEA 1C5UA 1Z8JB 4WMFA 1GBFA 2UWOA 3LC3A 1PPFE 5LH8A 1TNGA 2GDEH 1WBGB 5FCRA 1CBWC 3D23A 3IG6B 1XXFA 3MFJA 2HLCA 4YZUA 3A8BA 3SNDA 2GMTC 1IQLA 2A5IA 1KTTB 1BITA 3ZVCA 3NZIA 5L30H 2FOMB 1SGIB 1ZMNA 1SLUB 4DCDA 4KGAA 5TCAA 5G4BA 4MLFB 1LKBA 2EC9H 5JDUB 2A7JA 3PV4A 1SLVB 3QK1A 1GBBA 1DM4B 1FAKH 1EOJA 2R3YA 2ZGBH 1Y59T 1FPCH 5JBTA 1QL7A 4BTIB 3DUXH 2ZDVH 1C1PA 3M5LA 4MNYA 3SOSA 4ABGA 4YT7H 3RXSA 2WPLS 1AY6H 1FDPA 1DUAA 1HAOH 1V2OT 1MZAA 3MU1A 3A8DA 3A87A 3H7TA 1UTKA 1O2ZA 3MH4A 5EU8A 1GBMA 1KXEA 1SGTA 2BVXH 5A8XA 2GD4B 4WMDA 4KTSA 1DT2A 3ZVBA 3U1JB 1T8NA 1KXDA 1THSH 3LIWA 4NFFA 1QRZA 3LGYA 3TNTA 2B9LA 1D3QB 2ZTZA 3E16B 2VWNA 4M7GA 3QGNB 1C5TA 3RXUA 4FXGH 4J2YB 2ZI2H 1GI6A 1GI8B 1L4ZA 3GOVB 1V2VT 5EW1H 3SU3A 5FX6A 3BTWE 2CF8H 3RXGA 4U32A 2JETC 3SI4H 1GI0A 1FZZA 3A80A 2PHBA 5FPTA 1JRSA 3WY8A 4THNH 4D9QA 3HATH 2BZAA 2F9UA 1C9TA 2OP9A 4OS2A 3G01A 1MKWK 1OP0A 1TMBH 4I8KA 1KXCA 4JZ1A 1WTHD 4B2AA 3O8BA 2A2XH 1GL1A 2A1DB 3TIUA 1GJCB 1ANCA 1LVYA 3RXCA 1W0ZU 2OBOA 4RKOB 3K2UA 4ISLA 3UWIA 2YNBA 1O3IA 4ZXYH 2J34A 1UO6A 3DA9B 1MAYA 1OSSA 4K1TA 2FOBA 4DW2U 1FPHH 1SQTA 3FZDA 1GCTC 3BTDE 3P17H 1YCPM 2Y80A 3H7OA 5EPNA 1RD3B 1P3EA 1DDJA 1V2MT 3RU4E 3V0XA 1ESTA 1S85A 1TOMH 1GBKA 1MTUA 2WUCA 1ANBA 2AIPA 3ATWA 1MD8A 1MCVA 3QWCH 5F8XA 2B7DH 4H42U 1K1NA 1MQ6A 3MU0A 1AUJA 1GI1A 3EAJA 4YOJA 1PQAA 4F49A 3OY5U 1AFEH 1O2YA 1H9LB 1SSXA 1TPPA 1MD7A 2QXGA 2Y5HA 5PTPA 1HIAA 3F9FA 3D65E 1GBDA 1F5KU 3URDA 4BANB 1K9OE 1AZ8A 4Y7AA 1NM6A 4MDSA 3ESTA 2VIVA 2BQ7B 4LOYH 3QX5H 1KDQA 2LNCA 1SC8U 1Y8TA 2FOHA 2VIQA 2ZU4A 4NZQA 2QXHA 5CHAC 2F9PA 1NTPA 4AFZA 3V12A 3SU5A 2XXLA 8KME2 1SFQB 1QNJA 5DP5A 1Z6JH 2QF3A 3EQ0H 2WPJS 3V13A 5EQRA 1RJXB 1DWEH 2TGPZ 3ENSB 2NWNA 5I46H 2V3HH 2O8TA 3NWUA 2ZTYA 1EZQA 3ZZ5A 5DP4A 1K1JA 3BIUH 2WPKS 3LGTA 1EAIA 1L4DA 5GIBA 2BDCA
chains in the Genus database with same CATH superfamily
3ZZ7A 2A31A 4BTTB 1T31A 2XW9A 4CBNA 1P2OA 2F3CE 1P10A 1GMCG 1UVUH 3SV9A 1O2GH 3A85A 3OEED 2WINI 5K7RA 5JBCS 5GDSH 2A45B 1NRSH 5EGMA 3WW7A 2OC1A 7LPRA 1YLDA 2BLWA 2VIWA 1DE7H 3AVZA 2IN2A 2HNTC 3V7TA 1BRUP 2C93B 1HAXB 1MCTA 1S83A 1AGJA 1C4V2 2FZZA 4RT0A 1COWD 3SN8A 3GY6A 1O3OA 4GLYA 1O5BB 1P02A 5DP7A 2PKAA 5A09A 1KMHB 1E1RD 2NU0E 2TGDA 4IMZA 1OS8A 2QV1A 4ZROA 4Y0YE 1AFQB 1GVLA 2P95A 3ITIA 5JYIA 2GVFA 3UB0A 1O2XA 3MHWU 5HM2A 2OCVB 1J15A 4IN2A 5HIZA 2QYIA 4ZXXH 1FN8A 1NBME 4TPIZ 3GICB 1J14A 5JBBS 2VU8E 1C1SA 1GHVH 2BY6X 5AVDA 1YLNA 3ZZBA 4Y79A 1UJ1A 1O3NA 1C5SA 4CRDA 2GZ9A 1RGQA 2BD4A 1JIMA 1UTJA 3F0OA 3F6UH 3MU8A 1ELBA 1V2KT 2AS9A 6GCHF 4B73A 2FX4A 4AFUA 3SU0A 1BHXB 1Z7KA 1DXWA 3A8CA 2G55A 1IQKA 4KKDA 2VB0A 4XBDA 2ZKSA 5GPIB 1EZXC 1O3KA 2RA3A 3UQOA 3U98H 2BY7X 1TMUH 3E91A 2ZC9H 3BTEE 1CU1A 1SMFE 1UMAH 1ZRKA 3LKWA 4X2XA 2GP9B 3EA8A 3MH6A 2KR7A 1O2LA 2LELA 3E0PB 1NZQH 1DFPA 2CMYA 3UREA 5DP3A 1JMOH 1OPHB 3RC4A 1Y3UA 5EG4A 4XBCA 4ABIA 3T5FH 4K1SA 4ZKRU 3LT3A 4ACAA 2CV3A 4A92A 1L2EA 3OX7U 3SV7A 4K8BA 1J16A 1DY9A 2BY9X 1ZPBA 1V2LT 1LHFH 1QRXA 2OUAA 3S9BA 1P2QA 3BG4B 4RN6A 4R8TB 1TABE 7GCHF 1C4Y2 5T1VA 2ZDAH 3SNBA 1OHHD 1AUTC 1SOTA 3QTVH 3RXLA 1P06A 1GBHA 2EQNA 1NRNH 1NRRH 1ZJDA 1EATA 2ANMH 2IJOB 4Q4LA 4GCHG 1XUKA 1UVPA 2HLDD 4WVPE 5C67A 1VGCC 3UNSA 4CR5A 1G3EA 4OM9A 3GISB 4DVAU 1FIZA 1O2PA 2IPHA 2BB4A 4ABBA 2C8YB 4O97A 2TIOA 3SGQE 2KCPA 4YESB 8GCHG 4MG3A 1QIXB 2AGEX 1YPJH 4DURA 2C8XB 4BTUB 4XOJA 1AWHB 2QF4A 1HGTH 1GDUA 1O36A 1YBWA 4MPUA 2PWXA 1H8DH 4X8SH 1UVSH 1OXGA 1NN6A 1S6HA 3SBKA 4X2WA 1EP5A 3R3GB 4JZDH 4KTUA 1THRH 2FM2A 2OC7A 3KQBA 3ODFA 3MNBA 1WOFA 3E8LA 5F53A 1DWDH 1YP9A 4FUGA 1VCPA 3TH3H 3GY5A 1LHCH 3JZ2B 1AN1E 2FEQH 3KF2A 3RXPA 2CHAB 3F0PA 4FETA 5CHBA 1G36A 3GCTG 3TK6A 1A5HA 4Q7ZA 1C5PA 1SGCA 2JIZD 3F3BA 1JIRA 1QRWA 1C2HA 1HAPH 1F92A 4UFDH 4DIIH 5C0UA 1MTVA 1C1MA 1C2JA 1T7CA 3LONA 3UY9A 1TPOA 1GPZA 5HYOA 3GDVA 3A89A 1EZSC 3TVJB 1H8IH 2CK3D 4YT6H 1W13U 4GVUA 1KLIH 2ZDNA 4UFEH 1FMGA 1S84A 2JJ2D 5L6NH 1LPZB 4U2WA 3PO1C 1FY8E 2BQ6B 2GCTC 2IOTA 3LPRA 4UE7H 2YNAA 5DJ7A 4BNRA 3BSQA 3RXDA 2JH6D 1QJ1B 1P57B 2WUBA 4GSOA 2UUKB 1OWIA 1P01A 1TWXB 2BOHB 1HLTH 2QAAA 4K8YA 1OOKB 4TPYA 3E90B 1DPOA 1SGFG 5F6MA 1GHYH 1VGCB 1S5SA 1SGYE 3VEQB 3BTME 1JWTA 2Z6BD 2ZHDA 1O5DH 1YC0A 1UTNA 3T25A 2BD8A 1DANH 2I6SA 3GCHB 5EJZA 1O30A 2FOGA 1C1TA 1AE8H 2OD3B 1Y5UT 4KTCA 4XFQA 3A7ZA 5L2YH 2GTBA 2LPRA 1LQDB 1QA7A 1F0SA 1EASA 3RXMA 1XUGA 2FI3E 2O8WA 1DX5M 5LPFA 1JBUH 1ZMLA 1O5EH 1TBRH 2GV6A 1VITH 2R0KA 2GGVB 1SQRA 1EPTA 1NFWA 1ZSJA 2BDGA 4K69A 2KX4A 1S0QA 1O3HA 2ZPRA 1Z6EA 3NKKA 2M2AA 2ZHFH 1GBTA 5KEDA 3RXRA 1AVXA 2BD5A 4NWKA 3TGJE 1G3BA 2TGTA 2DUCA 2J98A 3AAVA 3HKJB 1D3TB 1GJ4H 3SJIA 1BRCE 1DSUA 1M9UA 1LVMA 4AB9A 4AN7A 5DP9A 1D9IA 1TA2A 4NA7A 3LH1A 2J95A 3N7OA 2CXVA 1P2IA 4I33A 1VITG 2BZ6H 2HVYB 3S7HB 1CE5A 4XDEA 1LCYA 1BMAA 1QJ7B 3RXIA 1MTNB 5C1YA 1O2KA 1PPZA 4HGCA 3TJVA 4YOGA 3PO1B 1BTWA 2KZ4A 5A0BA 2HNTE 4Y71A 5ESTE 1TNLA 2QIQA 2VIDA 1C2EA 1G2MA 2UWLA 1O35A 1XUFA 2G4TA 1ZRBA 3M7UA 5C5OA 1DWCH 2ZG0H 5H4IB 2BDYA 1C2IA 1CHOG 3TU7H 1C5QA 4AZ2B 1Z1JA 3ZZ6A 4VGCB 1UCYH 1LHDH 2FX6A 4ISHH 1FUJA 4WWYA 3FANA 2XYAA 4MNWA 3A8AA 3BTQE 5CE1A 2ODQA 3MYWA 3U9AH 2GCHG 4NIXA 3SGBE 2ZU5A 5GCHF 2QC2A 2V6NA 1ELVA 1G3DA 1K1PA 4X6NA 2FTMA 2FOAA 2ZGHA 4ISOA 1SGNE 1W0KD 2EA3A 4Y6DA 1O5AB 2Y5GA 2QE7D 1MU8B 1PQ8A 4GCHF 7ESTE 1EOLA 1CQQA 1O3LA 1Z1IA 4X2YA 3GCNA 2SFAA 5EOKA 3RUOA 1C1NA 1C5RA 3K9XB 1C5VA 1IQHA 1FY1A 1RFNA 3U8TH 1AHTH 3ZVGA 1XUHA 1Y3XA 1V2TT 2BYAX 1WSSH 1MUEB 3E0NB 4B2CA 1ELDE 4DOQA 2FPZA 4CREA 2XWAA 1FX0B 2VH0A 1FNIA 2CF9H 2OLGA 4U30A 3FO8D 2ZZUH 1F5LA 1KLTA 4XE4A 1C5OH 1UK2A 1ELTA 6CHAB 1E79D 2QXJA 3FP8E 1V2RT 3QDZB 1ELAA 1W0JD 1UVOA 3WWBA 1FQ3A 1TQ0B 1TNIA 1BBRH 1ZTLA 3MOCA 3P8GA 2P16A 2VVCA 2TPIZ 3Q00A 1O3PB 2K1QA 1K1MA 2EEKA 2WHXA 3SW2B 2HNTF 1ZSLA 2XC4A 3L3TA 1SGQE 3P70B 4AYVB 1D3DB 5E2OA 3RXQA 2NU1E 2YMSD 2ZCLP 1QA0A 3SGAE 2RFKC 3MWIU 1XMNB 1PYTD 1MKXH 4E7RG 3TGIE 4BAMB 1TYNA 2G4UA 3U8OH 4BAQB 1WDIA 3P95A 2Z9IA 1VCWA 1GMDF 2BDIA 1F0RA 2XNIA 1BTYA 2FS9A 5K0HA 1O3MA 2VWMA 3AW1A 1KXAA 3ATMA 1P05A 3BF6H 5GNDA 1V2NT 3A7WA 3HK3B 1GG6B 1TALA 5TCCA 3SV8A 2VINA 1XM1A 4ISNA 3ODDA 1Y3YA 1C2FA 3Q3XA 1TGSZ 1MZDA 3OYPA 2JJ1D 4X8TH 3I29A 1GVZA 2C90B 1GHWH 5EXNA 4UDWH 3RXEA 3K65B 2GV7A 2CJIA 2FMJA 4WXVA 3SNAA 2ZDMA 4Q63A 9ESTA 1ELFA 8ESTE 3FZZA 3S69A 3P8NA 2V7QD 3DFJA 1CBWB 2D1JA 2BDAA 3HGPA 4NG9H 1QTFA 1GDNA 1O2JA 3M36A 3E6PH 4A6LA 2ZFQH 3AAUA 1O5CB 5HKKD 3UPEA 3GY7A 3FN8A 9LPRA 5LPEA 2GMTB 5J4QA 4IW4E 3OFND 1W7GH 3QZQA 3VG8A 2FIRH 2BVSH 1OKXA 2ESTE 1YPEH 3VB3A 1HAIH 1YM0A 2GZ7A 1HJAC 2P3FH 4XBBA 4XSKU 1O3CA 3PMBB 4WH8A 3IWMA 4ZKNU 1ANEA 4F48B 2ODPA 2HOBA 1XUJA 4E05H 1IQFA 1QBNA 4X0WU 1BJUA 2BLQA 2P93A 3PMJA 3PTNA 4B71A 4IS5A 1O33A 1PPCE 4FU7A 1UCYE 1K28D 2QA9E 1SHHB 3OE7D 3MO3A 1NO9H 3TLOA 1AO5A 1BTPA 3MH5A 3MNCA 2ODYB 1E38B 1QY6A 3TPIZ 1TGCA 1BOQA 3R0FA 1GDQA 1HAVA 3KN2A 4ZHLU 1EKBB 1DITH 1VITF 3SU1A 2ZHQH 3BN9A 1E36B 2WYJA 3RXHA 1TNHA 2OBQA 1Z8IB 4BAHB 1TMTH 3ZZ3A 2A2QH 1P09A 1E35B 2BM2A 4MNVA 3A81A 3P8FA 4GAWA 1MAXA 4TWWA 5DK1A 3E3TA 4MQAA 2J5UA 2JETB 1OX1A 3SQHE 1AVWA 2A5KA 3RXAA 1QL8A 1O2OA 2FS8A 4AFQA 4Q80A 1P9UA 3UNQA 2VWLA 4CRFA 3UQVA 1GBCA 1BTZA 4A1XA 1LMWB 2AMQA 4IGDA 2ULLA 3SJOA 2DE8A 2THFB 1K1OA 4B6EA 4OGYA 1KIGH 1GGDC 1BUIA 4NIVA 3RXBA 4ESTE 1YCPH 1NFYA 5ESBA 2AERH 3PM3A 2F9OA 1O3EA 2A7HA 3EA7A 1LDTT 5SGAE 1BBRE 4WY3A 2FYQA 4K2YA 4HI3A 3ZZCA 3SUFA 1UW7A 5FCKA 1ZPZA 2Z9LA 3FKSD 5GJ4B 3M7TA 2Z7FE 1GCTB 5F8TA 5E0JA 2Y82A 2G00A 3CS0A 3SUDA 3SU4A 4ABAA 1SHYA 1KLJH 1BDAA 3LC5A 2BX3A 1TE0A 5C1UA 3HK6B 1V2UT 1C1RA 3JZ1B 7KMEH 1NFXA 1LHGH 1YLCA 2PV9B 2OC0A 3TK9A 4JCNA 2WZQA 1SGPE 1SFIA 4K60A 2W3KA 1WUNH 3UOUA 1SL3A 4IBLH 1OP2A 4U01A 2PKSC 1ORFA 1CA0C 1HAYB 1TAWA 2OXSA 3HGNA 1GL0E 2Y6TA 2D8WA 2KCYA 1ZYOA 1WYKA 4FVBA 2OINA 2A4RA 1TNJA 1O39A 3VGCC 1RIWC 5LPRA 2QF0A 2RDEA 2A5AA 1J8AA 1NU9A 2Q6DA 1GI9B 3RMOH 3RMNH 4YO9A 1UVTH 2BX4A 1KY9A 1P2KA 5CDFE 3ZVFA 4NWLA 2SGQE 1NRPH 4OS6A 2XBVA 3SUGA 4CRCA 3GY8A 3K6ZA 3VB6A 1IQIA 1V2JT 3RU4T 2BDHA 2FOCA 3D49H 1GHBG 5EQQA 1B0FA 1GBAA 3SNEA 2OQUA 5FBIA 1P04A 1CGIE 5CHAB 2PSXA 1A0JA 2V35A 2BOKA 3U8RH 1C1VH 3MNXA 4I7YH 4IN1A 5L2ZH 5HIYA 1ZHPA 5DP6A 3RXJA 4CRAA 3O8CA 1C5XB 1PJPA 2NU3E 5EW2H 2PGBB 4NCYA 4AORA 3WWFA 1HXFH 1MH0A 2F43B 2TGAA 1P3CA 1SQAA 4ZUHA 1EB1H 4X8UH 3LGIA 2ANWA 4Y8ZA 1HUTH 1GHAG 1H9IE 1IHSH 2SGDE 1N1LA 2ZHEH 2WPHS 1L1GA 3TNSA 2Z9JA 4E7NA 4I86A 1ZOMA 3NCLA 3F9GA 2Z3CA 1FIWA 1TRMA 5F8ZA 2ZTXA 4Z1MD 1Q2WA 1NU7B 4INKA 1C1WH 5C20A 1P8VC 2A4QA 2BD9A 1GMHG 1C2KA 2IJD1 3CNRA 1CSOE 3UFAA 2OC8A 3SYJA 2FLBH 2K0QA 1EX3A 2YMSC 3PV2A 3A88A 1SGEE 2G5VA 2ALVA 1PYTC 1AMHA 1TPSA 4FUDA 3M3SA 3Q3YA 1V3XA 2PKSB 3LJJA 1AZZA 1CA0B 1UTPA 2JH0D 1A3EH 3T27A 3EE7A 1A46H 2SGAA 3BEFB 3Q77A 1TA6A 4GHQA 1GJDB 3VGCB 1GI4A 3ZYEA 4ACBA 4CRBA 1Y3VA 1PPBH 2ZFSA 3EGKH 4SGAE 1P9SA 3TJNA 1TX7A 2FODA 4ZHAA 1L0ZA 3LH3A 1OYTH 4AFSA 1HAZB 5FPYA 2XC0A 2CN0H 4K1EA 2PW8H 2AEIH 3MNSA 2PGQB 1BTHH 3LGWA 1E37B 3RXOA 1EAXA 1XX9A 2H6MA 5JB8S 1HNEE 1VJ9U 1D6WA 1FJSA 3L33A 1SGRE 3F2HA 1GBEA 4INHA 2JKHA 1E0FD 3P8OA 3MO6A 1A0HB 2FI4E 3RLYH 4K3JA 2XCFA 1TLDA 4B1TA 1GI3A 1K0HA 1SVPA 2VGCC 1HYLA 1PPHE 2QN5T 5HXFA 1RS0A 2GT8A 2H9EH 1GJBB 5C94A 3SV6A 2ZDKA 1DVAH 3IITA 3FP7E 4NSVA 2AYWA 5C1XA 3GYMA 2G52A 1GI7B 3STIA 2ASUB 2XBWA 4Z0KA 3EYDA 4NIWA 2AGIX 1UK4A 3FP6E 3QN7A 4NZLA 4CRGA 5FAHA 2R3UA 4AOQA 2ZHWH 3LGVA 2W6ID 2ZQ1A 3AASA 3N7DA 1AIXH 1QB1A 1QCPA 1CHGA 1MBMA 1QL9A 1VZQH 3SZNA 4QT8C 1U6QA 1LKAA 4DIHH 1DWBH 4WJG2 1X7AC 1AVGH 5DP8A 1FI8A 3NXPA 1V2QT 3A82A 4Y11E 3DD2H 2FP7B 3DHKH 4RT1A 4TSFD 1C2LA 1CGHA 1YPKH 2YMSB 2ZPSA 2W7UA 2SNVA 1Y3WA 3RM0H 1ABJH 1O31A 1GMCF 3T62A 5E2PA 1T8LA 5TJXA 1PQ5A 4P00A 4ABJA 4CHAC 4TY6A 4A7IB 5AFZH 1F0TA 1LTOA 2O8MA 4AC9A 1MU6B 3RLWH 2XCNA 3AW0A 1C5WB 2OQ5A 3DFLA 3C27B 1ZGVA 1PFXC 2BLOA 1TONA 1BB0B 1K2I1 4K5ZA 1HBTH 1C5YB 2Y7ZA 3RDZA 4OS1A 1FLEE 1BMNH 1WXRA 4I8GA 3F2GA 5ETXA 4Y10E 4BAOB 2VIPA 4F55A 1T8MA 1GJAB 3SV2H 3TH4H 1QHRB 4OS5A 2C8WB 3N7EA 1W2KH 1P0SH 1ZTJA 1UTMA 1THPB 3PRDA 2VGCB 2TBSA 2ZPQA 1KTSB 2AMPA 2BVRH 3KGPA 1J9CH 2NU2E 3BTFE 1V2ST 2ZF0H 1P2MA 4Q2KA 1HIAB 4BXWA 2BMGB 5T6GA 1UTLM 3ZV9A 2DE9A 4TY7A 1XKBC 1IOEA 5JPMH 4ZHMU 3VXFH 1OWDA 2PUXB 1XVMA 2VVVA 2WPMS 2WV4A 1RTKA 4Y8XA 5HM9A 2R2MB 2K8IA 3TGKE 1D3PB 3TJOA 1LO6A 5IYTA 4P02A 3ATLA 4JZFH 4AGKA 1AD8H 2Z3DA 3KQ5A 2ZU3A 3UAIC 1SQOA 4Y0ZE 4AG2A 1F7ZA 1YGCH 3A83A 2GCTB 3NK8A 2BD3A 3TK5A 3PROA 3ZZ9A 4ABEA 1GHAF 4X1RU 1O2HA 1HJ8A 5A8ZA 5AFYH 1KXFA 3BV9B 4JYTA 4NIYA 4UD9H 2SNWA 4NFEA 3KYFA 2GKVE 2QXIA 3Q76A 4IC5A 2OK5A 3A7VA 1J17T 2FOFA 3F9HA 3DT0H 3M5NA 4A1TA 2BLVA 4X1QU 3BTTE 1O38A 3PWBA 2C3SA 1UTOA 2SGEE 1A5GH 3SORA 1GMHF 1WV7H 1XKAC 5A8YA 2SGPE 1YPGH 1DXPA 1LPGB 4UFGH 2BY8X 3SO3A 2ZFFH 4FU9A 3MMGA 4FUEA 1K1IA 1ETTH 1D4PB 3SU6A 4CBOA 2PFEA 2A32A 5T3HA 1ESBA 2ZQ2A 2ANYA 1W3CA 2G5NA 3UTUH 4AB8A 5DSFA 1AU8A 1ZR0A 1D6RA 1H8HD 1O2RA 4H6TA 4D9RA 5F03A 2IPQX 3DSGA 2Z94A 6LPRA 2BTCE 3M7QA 8GCHF 2H1UA 4TWYA 1F0UA 1OYQA 1QBVH 1QURH 5FPSA 2GJGA 5EODA 2ZDLA 4JK5A 1SG8B 1EJMA 2GX4A 4BXSA 1KYNA 1BTUA 1EZUC 1N8OC 1P11E 4AG1A 1QR3E 4OGXA 1UK3A 4Y8YA 1SOZA 1LVOA 3ZVEA 4INLA 3GDUA 2FDAA 2G8TA 1C5LH 2PTNA 4H6SB 1FY3A 3QTOH 3TJUA 3CP7A 3UR6A 3HPTB 4UONA 2XC5A 2V0BA 3KQEA 1AB9C 1YWUA 4RKJB 1ZSKA 2FESH 4PROA 3A84A 1A1RA 1EJAA 3GCTF 2GDDA 4TYDA 4KP0A 2QY0B 4ABFA 4WF8A 4AX9H 2O9QA 2B5TB 5IK2D 1E1QD 2P59A 5KGOA 1A3BH 6GCHG 1SGFA 5EJLA 2GZ8A 2ZNKH 5C2ZA 2F9NA 3UOPA 5C0TA 1EP6A 2ZEBA 2HALA 1IQEA 1ZMJA 5DO4H 3U69H 2AFQB 1K21H 1YPHC 2HWLB 2HGTH 2AIQA 2ZIQH 5EQSA 4X1SU 1NFUA 3LGUA 3HKIB 4FVDA 1TFXA 4O3UA 4B6FA 4X6MA 3PLPA 1C4U2 3GY2A 4NA9H 4H4FA 1AI8H 1O37A 1GJ8B 1QGFA 1MTWA 3PMHB 1FY5A 1HDTH 4JYVH 2HPQH 4O9VA 5T6DA 2A4GA 1ZGIA 3VB7A 2NU4E 2Y81A 4I32A 2VNTA 4LZ4B 3LJOA 1QZ8A 1OWHA 1QB6A 2P94A 3EA9A 2L6OA 4BAKB 1Y5BT 1N8OB 5AHGH 3ZV8A 1IHTH 1WU1A 3UWJH 1Y5AT 2VWOA 7GCHG 3SQEE 1BMMH 2BY5X 5HMAA 4DT7B 3L6PA 1V2WT 3STJA 3GDSA 4X1PU 1SBWA 4IMQA 4MPWA 3RMMH 1L1JA 2D2DA 1EUFA 1DSTA 1T4UH 1CT4E 1GJ9B 3OTPA 1EPTC 1AB9B 2RG3A 1O2VA 2ZWLH 1BQYA 1VKYA 3I78A 5DN6D 5A0AE 3VPKA 4FUBA 4MPXA 1TX6A 1QJ6B 2F83A 3RU4D 3EDXB 5KECA 2ZU1A 4ABDA 2JH5D 4OS7A 2WV9A 4Y76A 2O8UA 2ZCKP 3F1SB 2FI5E 3P92A 3T2NA 1A7SA 1QFKH 2XTTB 2Z9GA 3RP2A 4JYUH 1ZTKA 2SGFE 1CT0E 1VCQA 2XBXA 1AFQC 1HJ9A 1TX8A 4GUXA 1HFDA 1YYY1 2XOKD 1P2NA 1YPMH 2AGGX 2PR3A 3TITA 5B6LA 2ZFTA 1ID5H 1NS3A 1TNKA 2J2UA 4R0IA 1G37A 3A86A 5IDKA 1XXDA 1ZZZA 1C1QA 5E0HA 3ZVAA 3OU0A 4ZCNA 1AQ7A 3PV5A 4NA8A 8LPRA 1CA8B 4JZEH 2BDBA 3T26A 3UIRA 1GCDA 1CHOF 1O2TA 4A5TS 2KCOA 1GWAA 1WAYB 5BPEA 2ZA5A 1FONA 2QGRA 6ESTA 2CGAA 1TGTA 5EPYA 1N6XA 1S6FA 2OTVA 2XBYA 1ZHMA 2GCHF 4A1VA 1NRQH 3FOAA 3URCA 1UHBB 1YKTA 1YPLH 2FYRA 1WTGH 1G9IE 4HZHA 4DY7B 1F5RA 1C5NH 2EI7A 2W6JD 2H9HA 3GCOA 4FU8A 4GHTA 4AYYB 1EAWA 1HAGE 1G30B 1SLWB 1C9PA 2FO9A 4Z6AH 3M3TA 3K6YA 1O0DH 1SR5C 1B0EA 2A0QB 2V3MA 4ZKSU 3PB1E 1K1LA 4D7GA 2VJ1A 3O8DA 1HJAB 1HCGA 1O2SA 2RCEA 1HXEH 1Z8RA 1BJVA 1ETSH 1BCUH 4OS4A 2Y7XA 5HGGA 1O5FH 1NT1A 1W0YH 4FUFA 1CO7E 1EPTB 1MBQA 4ASHA 2WYGA 3B9FH 3D62A 3RXKA 2H9TH 3SHCH 1XVOA 3BG4C 2ZFPH 3C1KA 4XRNA 2ANKH 3MI4A 2VH6A 2A7CA 4FUHA 1JRTA 1O5GH 4D76A 2J98B 5EXMA 3S7KB 3OAAD 1XUIA 1DLKB 3F9EA 1MTSA 1SGDE 2F91A 4GPGA 1ELCA 1GVKB 2VBCA 1IQMA 4B76A 1OWJA 1NPMA 1OWEA 4LK4A 1DY8A 4X2VA 1P03A 3NUMA 3SNCA 1NBMD 2PSYA 3M61U 1ABIH 2H2ZA 4J1YA 1CVWH 1O3DA 2KAIB 1C5ZB 1ELGA 1RXPA 1ESAA 2FLRH 1H4WA 1TQ7B 2HVXA 4WH6A 1O3JA 1C2GA 3BEIB 2ZU2A 3SJ9A 4YLQH 1WCZA 1ETRH 2STAE 1RTLA 4LZ1H 4X6OA 1QBOA 3H09A 3A7XA 2FWWA 1G2LA 5C5NA 1OWKA 1TPAE 1AKSB 3PMAB 2EI8A 1W12U 1BMFD 1BMLA 4F4OC 3E1XB 1TGBA 1SI5H 3KNXA 3QUMP 2EI6A 2R9PA 2UUJB 3GY4A 3SJ8A 1GGDB 2WSSD 2F9BH 5DGJA 1NROH 2XNDD 4MPVA 1TGNA 1O2WA 4ZKOU 1A2CH 1C5MD 2M5TA 3CS7A 4SGBE 2PTCE 1SPJA 2BD2A 4O03A 3BTHE 1GBJA 3LU9B 3RC6A 1RRKA 1UTQA 3P6ZB 3RM2H 2CHAC 1BTXA 1TOCB 2Y5FA 1SB1H 3MQKC 4WXIA 1ZJKA 3S0NA 2ZFRH 5T6FA 4ZMAH 1O2NA 3S9AA 1ACBE 1O3GA 3BTKE 1UCYK 4B2BA 3PYHA 2J38A 5I25A 1MKWH 2ZECA 1O32A 3SI3H 1H1BA 2FXRA 1TRNA 3ZIAD 1GJ6A 1BRBE 3OEHD 3M5MA 5A2MH 5E0GA 1HAHH 2C8ZB 3I77A 3UUZA 5FX5A 2WV5A 1O3AA 2P3UB 4MNXA 1BRAA 1TBQH 5GCHG 1TBZH 3RXTA 3GY3A 1GBIA 1H9HE 1RIWB 2AH4X 1HRTH 1ELEE 3O8RA 3SU2A 1HPGA 1LVBA 4I31A 3M5OA 3PLBA 1DUEA 1GHZA 1T4VH 3ZZ8A 4JZIA 2F9VA 1C1UH 4DJZB 1BA8B 3RXVA 5AF9H 3NRLA 1W11U 2P8OC 2I6QA 1GI2A 3SZEA 1YPHE 1GHXH 1A4WH 2STBE 3M3VA 1NC6A 3GCHC 2FTLE 1L1NA 2Z3EA 2ZP0H 1HB0B 1TIOA 2Q6FA 2W3IA 4CH2B 2P3TB 1BT7A 1WQSA 1Q3XA 4FUIA 5FL7D 2PLXA 3FFGA 1BBRK 4JK6A 1GJ7B 1MQ5A 3GYLB 4WMEA 2W5EA 2BQWB 4X1NU 3SUEA 3F2FA 2H5CA 3SJKA 4FOUC 3KEEA 1ZHRA 3BIVH 3CENA 3KQDA 2O8LA 1WQVH 3V3MA 1RTFB 1ZLRA 1B7XB 1ANDA 1ARBA 2VIOA 5JB9S 1P12E 4FUCA 4E06H 4Y7BA 1MKXK 2J97A 3FAOA 3ZZDA 4M9FA 1IQJA 2B0FA 5C3NA 4D8NA 4ABHA 1A0LA 3DSPA 1W8BH 3QGJA 1PPGE 4ISIH 1IAUA 2BXTH 2W7SA 2ZO3H 2R2WU 4DG4A 1BIOA 2J92A 5FHTA 2XWBI 3UR9A 1EQ9A 4O3TA 1GMDG 1MTNC 2KCAA 4UEHH 4X8VH 4B75A 2VVUA 3SHAH 3KQCA 4MTBA 4KELA 1H8ED 2QF5A 5B6OA 4D7FA 5A0CA 3BG8A 3VB4A 4JMYA 3UNRA 1IQGA 4AGJA 1NESE 1UHBA 3W1EA 2PUQH 4XD7D 2ZGXH 1S81A 2QCYA 1LQEA 3U1IB 1BZXE 3RMLH 4VGCC 5CMXH 1FXYA 1HV7A 2R0LA 4YLUA 1O34A 1W10U 3M37A 2G51A 2A4OA 2XRCA 2PP6A 1O3BA 2UUFB 4B74A 3ATIA 2P8OB 4HFPB 1O3FA 1YF4A 1QQ4A 3LDXH 1QB9A 1O2QA 2J9NA 1CT2E 1C1OA 1O2IA 1Z71A 1G3CA 4I8LA 1F2SE 2C4FH 5DPAA 2AHME 1S0RA 3OSYA 2GT7A 4CR9A 2YOLA 1MMJN 1T32A 3DSOA 1W7XH 1EJNA 1TRYA 3LOXA 3KHVA 3VB5A 2W26A 2V3OH 3VXEH 4CH8B 1DS2E 1V2PT 2L74A 1CGJE 3ATKA 3MU5A 4I8JA 4RSPA 1DICA 1O2MA 2RA0A 1DOJA 5GXPA 1JXPA 3F68H 3Q3KA 3W95A 1GHBF 3B8JA 5E8EH 4I8HA 2TRMA 1S82A 3BTGE 3KCGH 1T8OA 4FUJA 1HAVB 1PPEE 5BRRE 2ZGCA 1FV9A 4HTCH 3RXFA 5EJ1A 1K22H 3DCLA 1VR1H 5DG6A 3OY6U 3RC5A 1B5GH 2J4IA 4YTAA 3MH7A 1W14U 3ELAH 2UWPA 3ZZ4A 2FOEA 6CHAC 1KDQB 1GI5A 1LHEH 1NY22 1P2JA 1TB6H 2BXUH 1A5IA 1ZPCA 4ZAEA 2BD7A 2BHGA 2HRVA 1ARCA 5ABWA 2KAIA 4IC6A 1V6DA 3T29A 1GBLA 4MVNA 2Q6GA 1FAXA 1A61H 4YM9A 5JBAS 1EB2A 3VFEA 3PLKA 3M35A 4Q7XA 2Q1JA 3KL6A 1PQ7A 2Z9KA 3ZZAA 1AWFH 2G81E 1AKSA 2AMDA 2ILNA 4YOIA 1Q31A 3KIDU 4CHAB 1YY3A 5LGOA 1EFRD 3MU4A 1DLEA 1QQUA 2ZCHP 3QLPH 5FXLA 1C2MA 3BEUA 2RDLA 1O2UA 3QZRA 3ZVDA 2ZGJA 3EE0B 1LPKB 5EXLA 3W94A 3QO6A 3PTBA 1EXFA 4NSYA 2HPPH 3ZYDA 2D26C 1FN6A 1YCPK 3A7TA 3B23B 1KSNA 3FVFB 2ALPA 3NPSA 1IQNA 4BOHA 1INCA 4LXBH 4NGAH 1AE5A 5DKMA 3T28A 1VJAU 3A7YA 4Q7YA 1C2DA 2J94A 2UUYA 4UFFH 1EAUA 1FY4A 1E34B 1N6YA 3GS9A 1OP8A 1GG6C 2EY4C 3OTJE 1Z8GA 1SLXB 1JOUB 1BHXF 2B8OH 2F4LA 2JDID 2H5DA 2PKAB 5J4SA 2WPIS 3MO9A 3S9CA 3H5CB 3TH2H 3PWCA 4ZH8A 1KXBA 5GWZA 4DGJA 1G32B 1GJ5H 4X6PA 3MTYA 5FBEA 1C5UA 1Z8JB 4WMFA 1GBFA 2UWOA 3LC3A 1PPFE 5LH8A 1TNGA 2GDEH 1S6LA 1WBGB 5FCRA 1CBWC 3D23A 3IG6B 1XXFA 3MFJA 2HLCA 4YZUA 3U28C 3A8BA 3SNDA 1SKYE 2GMTC 1IQLA 2A5IA 1KTTB 1BITA 3ZVCA 3NZIA 5L30H 2FOMB 1SGIB 1ZMNA 1SLUB 4DCDA 4KGAA 5TCAA 5G4BA 4MLFB 1LKBA 2EC9H 5JDUB 2A7JA 3PV4A 1SLVB 3QK1A 1GBBA 5C17A 1DM4B 1FAKH 1EOJA 2R3YA 2ZGBH 1Y59T 1FPCH 5JBTA 1QL7A 4BTIB 3DUXH 2ZDVH 1C1PA 3M5LA 4MNYA 3SOSA 4ABGA 4YT7H 3RXSA 2WPLS 1AY6H 1FDPA 1DUAA 1HAOH 1V2OT 1MZAA 3MU1A 3A8DA 3A87A 3H7TA 1UTKA 1O2ZA 3MH4A 5EU8A 1GBMA 1KXEA 1SGTA 2BVXH 5A8XA 2GD4B 4WMDA 4KTSA 1DT2A 3ZVBA 4DT4A 3U1JB 1T8NA 1KXDA 1THSH 3LIWA 4NFFA 1QRZA 3LGYA 3TNTA 2B9LA 1D3QB 2ZTZA 3E16B 2VWNA 4M7GA 3QGNB 1C5TA 3RXUA 4FXGH 4J2YB 2ZI2H 1GI6A 1GI8B 1L4ZA 3GOVB 1V2VT 5EW1H 3SU3A 5FX6A 3BTWE 2CF8H 3RXGA 4U32A 2JETC 3SI4H 1GI0A 1FZZA 3A80A 2PHBA 5FPTA 1JRSA 3WY8A 4THNH 4D9QA 3HATH 2BZAA 2F9UA 1C9TA 2OP9A 4OS2A 3G01A 4YXWD 1MKWK 1OP0A 1TMBH 4I8KA 1KXCA 3N99A 1WTHD 4JZ1A 4B2AA 3O8BA 2A2XH 1GL1A 2A1DB 3TIUA 1GJCB 1ANCA 1MABB 1LVYA 3RXCA 1W0ZU 2OBOA 4RKOB 3K2UA 4ISLA 3UWIA 2YNBA 1O3IA 4ZXYH 2J34A 2LP6A 1UO6A 3DA9B 1MAYA 1OSSA 4K1TA 2FOBA 4DW2U 1FPHH 3AK5A 1SQTA 3FZDA 1GCTC 3BTDE 3P17H 1YCPM 2Y80A 4RI0A 3H7OA 4TT3D 5EPNA 1RD3B 1P3EA 1DDJA 1V2MT 3RU4E 3V0XA 1ESTA 1S85A 1TOMH 1GBKA 1MTUA 2WUCA 1ANBA 2AIPA 3ATWA 1MD8A 1MCVA 3QWCH 5F8XA 2B7DH 4H42U 1K1NA 1MQ6A 3MU0A 1AUJA 1GI1A 3EAJA 4YOJA 1PQAA 4F49A 3OY5U 1AFEH 1O2YA 1H9LB 1SSXA 1TPPA 1MD7A 2QXGA 2KFWA 2Y5HA 4ASUD 5PTPA 1HIAA 3KYGA 3F9FA 3D65E 1GBDA 1F5KU 3URDA 4BANB 1K9OE 1AZ8A 4Y7AA 1NM6A 4MDSA 3ESTA 2VIVA 2BQ7B 4LOYH 3QX5H 4HG6A 1KDQA 2LNCA 1SC8U 1Y8TA 2FOHA 2VIQA 2ZU4A 4NZQA 2QXHA 5CHAC 2F9PA 1NTPA 4AFZA 3V12A 3SU5A 2XXLA 8KME2 1SFQB 1QNJA 5DP5A 1Z6JH 2QF3A 3EQ0H 2WPJS 3V13A 5EQRA 3PRBA 1RJXB 1DWEH 2TGPZ 3ENSB 2NWNA 5I46H 2V3HH 2O8TA 3NWUA 2ZTYA 1EZQA 2KM0A 3ZZ5A 2WPDD 5DP4A 1K1JA 3BIUH 2WPKS 5EIYA 3LGTA 1EAIA 1L4DA 5GIBA 2BDCA
chains in the Genus database with same CATH topology
3ZZ7A 2A31A 4BTTB 1T31A 2XW9A 4CBNA 1P2OA 2F3CE 1P10A 1GMCG 1UVUH 3SV9A 1O2GH 3A85A 2WINI 5K7RA 5JBCS 5GDSH 2A45B 1NRSH 5EGMA 2OC1A 7LPRA 1YLDA 2BLWA 2VIWA 1DE7H 3AVZA 2IN2A 2HNTC 3V7TA 1BRUP 2C93B 1HAXB 1MCTA 1S83A 1AGJA 1C4V2 2FZZA 3SN8A 3GY6A 1O3OA 4GLYA 1O5BB 1P02A 5DP7A 2PKAA 5A09A 2NU0E 2TGDA 4IMZA 1OS8A 2QV1A 4ZROA 4Y0YE 1AFQB 1GVLA 2P95A 3ITIA 5JYIA 2GVFA 1O2XA 3MHWU 5HM2A 2OCVB 1J15A 4IN2A 2QYIA 4ZXXH 1FN8A 4TPIZ 3GICB 1J14A 5JBBS 2VU8E 1C1SA 1GHVH 2BY6X 5AVDA 3ZZBA 4Y79A 1UJ1A 1O3NA 1C5SA 4CRDA 2GZ9A 1RGQA 2BD4A 1JIMA 1UTJA 3F6UH 3MU8A 1ELBA 1V2KT 2AS9A 6GCHF 4B73A 2FX4A 4AFUA 3SU0A 1BHXB 1Z7KA 1DXWA 3A8CA 2G55A 1IQKA 4KKDA 2VB0A 4XBDA 2ZKSA 5GPIB 1EZXC 1O3KA 2RA3A 3UQOA 3U98H 2BY7X 1TMUH 3E91A 2ZC9H 3BTEE 1CU1A 1SMFE 1UMAH 1ZRKA 3LKWA 4X2XA 2GP9B 3EA8A 3MH6A 1O2LA 3E0PB 1NZQH 1DFPA 2CMYA 3UREA 5DP3A 1JMOH 1OPHB 3RC4A 1Y3UA 5EG4A 4XBCA 4ABIA 3T5FH 4K1SA 4ZKRU 3LT3A 2CV3A 4A92A 1L2EA 3OX7U 3SV7A 4K8BA 1J16A 1DY9A 2BY9X 1ZPBA 1V2LT 1LHFH 1QRXA 2OUAA 3S9BA 1P2QA 3BG4B 4RN6A 4R8TB 1TABE 7GCHF 1C4Y2 2ZDAH 3SNBA 1AUTC 1SOTA 3QTVH 3RXLA 1P06A 1GBHA 1NRNH 1NRRH 1ZJDA 1EATA 2ANMH 2IJOB 4GCHG 1XUKA 1UVPA 4WVPE 5C67A 1VGCC 3UNSA 4CR5A 1G3EA 3GISB 4DVAU 1FIZA 1O2PA 2IPHA 2BB4A 4ABBA 2C8YB 4O97A 2TIOA 3SGQE 4YESB 8GCHG 4MG3A 1QIXB 2AGEX 1YPJH 4DURA 2C8XB 4BTUB 4XOJA 1AWHB 1HGTH 1GDUA 1O36A 1YBWA 4MPUA 2PWXA 1H8DH 4X8SH 1UVSH 1OXGA 1NN6A 1S6HA 3SBKA 4X2WA 1EP5A 3R3GB 4JZDH 4KTUA 1THRH 2FM2A 2OC7A 3KQBA 3ODFA 3MNBA 1WOFA 3E8LA 1DWDH 1YP9A 4FUGA 1VCPA 3TH3H 3GY5A 1LHCH 3JZ2B 1AN1E 2FEQH 3KF2A 3RXPA 2CHAB 3TK6A 1G36A 3GCTG 1A5HA 4Q7ZA 1C5PA 1SGCA 1JIRA 1QRWA 1C2HA 1HAPH 1F92A 4UFDH 4DIIH 1MTVA 1C1MA 1C2JA 1T7CA 3LONA 3UY9A 1TPOA 1GPZA 5HYOA 3GDVA 3A89A 1EZSC 3TVJB 1H8IH 4YT6H 1W13U 4GVUA 1KLIH 2ZDNA 4UFEH 1FMGA 1S84A 5L6NH 1LPZB 4U2WA 3PO1C 1FY8E 2BQ6B 2GCTC 2IOTA 3LPRA 4UE7H 2YNAA 5DJ7A 4BNRA 3BSQA 3RXDA 2JH6D 1QJ1B 1P57B 2WUBA 4GSOA 2UUKB 1OWIA 1P01A 1TWXB 2BOHB 1HLTH 2QAAA 4K8YA 1OOKB 4TPYA 3E90B 1DPOA 1SGFG 5F6MA 1GHYH 1VGCB 1S5SA 1SGYE 3VEQB 3BTME 1JWTA 2Z6BD 2ZHDA 1O5DH 1YC0A 1UTNA 3T25A 2BD8A 1DANH 2I6SA 3GCHB 1O30A 2FOGA 1C1TA 1AE8H 2OD3B 1Y5UT 4KTCA 4XFQA 3A7ZA 5L2YH 2GTBA 2LPRA 1LQDB 1QA7A 1F0SA 1EASA 3RXMA 1XUGA 2FI3E 2O8WA 1DX5M 5LPFA 1JBUH 1ZMLA 1O5EH 1TBRH 2GV6A 1VITH 2R0KA 2GGVB 1EPTA 1NFWA 1ZSJA 2BDGA 4K69A 1S0QA 1O3HA 2ZPRA 1Z6EA 3NKKA 2ZHFH 1GBTA 3RXRA 1AVXA 2BD5A 4NWKA 3TGJE 1G3BA 2TGTA 2DUCA 3AAVA 3HKJB 1D3TB 1GJ4H 3SJIA 1BRCE 1DSUA 1M9UA 1LVMA 4AB9A 4AN7A 5DP9A 1D9IA 1TA2A 4NA7A 3LH1A 2J95A 3N7OA 2CXVA 1P2IA 4I33A 1VITG 2BZ6H 3S7HB 1CE5A 4XDEA 1LCYA 1BMAA 1QJ7B 3RXIA 1MTNB 5C1YA 1O2KA 1PPZA 4HGCA 3TJVA 4YOGA 3PO1B 1BTWA 5A0BA 2HNTE 4Y71A 5ESTE 1TNLA 2QIQA 2VIDA 1C2EA 1G2MA 2UWLA 1O35A 1XUFA 2G4TA 1ZRBA 3M7UA 5C5OA 1DWCH 2ZG0H 5H4IB 2BDYA 1C2IA 1CHOG 3TU7H 1C5QA 4AZ2B 1Z1JA 3ZZ6A 4VGCB 1UCYH 1LHDH 2FX6A 4ISHH 1FUJA 4WWYA 3FANA 2XYAA 4MNWA 3A8AA 3BTQE 5CE1A 2ODQA 3MYWA 3U9AH 2GCHG 4NIXA 3SGBE 2ZU5A 5GCHF 2QC2A 2V6NA 1ELVA 1G3DA 1K1PA 4X6NA 2FTMA 2FOAA 2ZGHA 4ISOA 1SGNE 2EA3A 4Y6DA 1O5AB 2Y5GA 1MU8B 1PQ8A 4GCHF 7ESTE 1EOLA 1CQQA 1O3LA 1Z1IA 4X2YA 3GCNA 2SFAA 5EOKA 3RUOA 1C1NA 1C5RA 3K9XB 1C5VA 1IQHA 1FY1A 1RFNA 3U8TH 1AHTH 3ZVGA 1XUHA 1Y3XA 1V2TT 2BYAX 1WSSH 1MUEB 3E0NB 4B2CA 1ELDE 4DOQA 2FPZA 4CREA 2XWAA 2VH0A 1FNIA 2CF9H 2OLGA 4U30A 2ZZUH 1F5LA 1KLTA 4XE4A 1C5OH 1UK2A 1ELTA 6CHAB 2QXJA 3FP8E 1V2RT 3QDZB 1ELAA 1UVOA 1FQ3A 1TQ0B 1TNIA 1BBRH 1ZTLA 3MOCA 3P8GA 2P16A 2VVCA 2TPIZ 3Q00A 1O3PB 2K1QA 1K1MA 2EEKA 3SW2B 2HNTF 1ZSLA 2XC4A 3L3TA 1SGQE 3P70B 4AYVB 1D3DB 5E2OA 3RXQA 2NU1E 2ZCLP 1QA0A 3SGAE 3MWIU 1XMNB 1PYTD 1MKXH 4E7RG 3TGIE 4BAMB 1TYNA 2G4UA 3U8OH 4BAQB 3P95A 2Z9IA 1VCWA 1GMDF 2BDIA 1F0RA 2XNIA 1BTYA 2FS9A 5K0HA 1O3MA 2VWMA 3AW1A 1KXAA 3ATMA 1P05A 3BF6H 1V2NT 3A7WA 3HK3B 1GG6B 1TALA 5TCCA 3SV8A 2VINA 1XM1A 4ISNA 3ODDA 1Y3YA 1C2FA 3Q3XA 1TGSZ 1MZDA 3OYPA 4X8TH 3I29A 1GVZA 2C90B 1GHWH 5EXNA 4UDWH 3RXEA 3K65B 2GV7A 2CJIA 2FMJA 4WXVA 3SNAA 2ZDMA 9ESTA 1ELFA 8ESTE 3FZZA 3S69A 3P8NA 3DFJA 1CBWB 2D1JA 2BDAA 3HGPA 4NG9H 1QTFA 1GDNA 1O2JA 3M36A 3E6PH 4A6LA 2ZFQH 3AAUA 1O5CB 3UPEA 3GY7A 9LPRA 5LPEA 2GMTB 5J4QA 4IW4E 1W7GH 3QZQA 2FIRH 2BVSH 1OKXA 2ESTE 1YPEH 3VB3A 1HAIH 1YM0A 2GZ7A 1HJAC 2P3FH 4XBBA 4XSKU 1O3CA 3PMBB 4WH8A 3IWMA 4ZKNU 1ANEA 2ODPA 2HOBA 1XUJA 4E05H 1IQFA 1QBNA 4X0WU 1BJUA 2BLQA 2P93A 3PMJA 3PTNA 4B71A 4IS5A 1O33A 1PPCE 4FU7A 1UCYE 1K28D 2QA9E 1SHHB 3MO3A 1NO9H 3TLOA 1AO5A 1BTPA 3MH5A 3MNCA 2ODYB 1E38B 1QY6A 3TPIZ 1TGCA 1BOQA 3R0FA 1GDQA 1HAVA 3KN2A 4ZHLU 1EKBB 1DITH 1VITF 3SU1A 2ZHQH 3BN9A 1E36B 2WYJA 3RXHA 1TNHA 2OBQA 1Z8IB 4BAHB 1TMTH 3ZZ3A 2A2QH 1P09A 1E35B 2BM2A 4MNVA 3A81A 3P8FA 4GAWA 1MAXA 4TWWA 5DK1A 3E3TA 4MQAA 2JETB 1OX1A 3SQHE 1AVWA 2A5KA 3RXAA 1QL8A 1O2OA 2FS8A 4AFQA 4Q80A 1P9UA 3UNQA 2VWLA 4CRFA 3UQVA 1GBCA 1BTZA 4A1XA 1LMWB 2AMQA 4IGDA 2ULLA 3SJOA 2DE8A 2THFB 1K1OA 4OGYA 1KIGH 1GGDC 1BUIA 4NIVA 3RXBA 4ESTE 1YCPH 1NFYA 5ESBA 2AERH 3PM3A 2F9OA 1O3EA 2A7HA 3EA7A 1LDTT 5SGAE 1BBRE 4WY3A 2FYQA 4K2YA 4HI3A 3ZZCA 3SUFA 5FCKA 1ZPZA 2Z9LA 5GJ4B 3M7TA 2Z7FE 1GCTB 5F8TA 5E0JA 2Y82A 2G00A 3CS0A 3SUDA 3SU4A 4ABAA 1SHYA 1KLJH 1BDAA 3LC5A 2BX3A 1TE0A 5C1UA 3HK6B 1V2UT 1C1RA 3JZ1B 7KMEH 1NFXA 1LHGH 1YLCA 2PV9B 2OC0A 3TK9A 4JCNA 1SGPE 1SFIA 4K60A 2W3KA 1WUNH 3UOUA 1SL3A 4IBLH 1OP2A 4U01A 2PKSC 1ORFA 1CA0C 1HAYB 1TAWA 2OXSA 3HGNA 1GL0E 2Y6TA 2D8WA 1ZYOA 1WYKA 4FVBA 2OINA 2A4RA 1TNJA 1O39A 3VGCC 1RIWC 5LPRA 2QF0A 2A5AA 1J8AA 1NU9A 2Q6DA 1GI9B 3RMOH 3RMNH 4YO9A 1UVTH 2BX4A 1KY9A 1P2KA 3ZVFA 4NWLA 2SGQE 1NRPH 4OS6A 2XBVA 3SUGA 4CRCA 3GY8A 3K6ZA 3VB6A 1IQIA 1V2JT 3RU4T 2BDHA 2FOCA 3D49H 1GHBG 5EQQA 1B0FA 1GBAA 3SNEA 2OQUA 5FBIA 1P04A 1CGIE 5CHAB 2PSXA 1A0JA 2V35A 2BOKA 3U8RH 1C1VH 3MNXA 4I7YH 4IN1A 5L2ZH 1ZHPA 5DP6A 3RXJA 4CRAA 3O8CA 1C5XB 1PJPA 2NU3E 5EW2H 2PGBB 4NCYA 4AORA 1HXFH 1MH0A 2TGAA 1P3CA 1SQAA 4ZUHA 1EB1H 4X8UH 3LGIA 2ANWA 4Y8ZA 1HUTH 1GHAG 1H9IE 1IHSH 2SGDE 1N1LA 2ZHEH 2WPHS 1L1GA 3TNSA 2Z9JA 4E7NA 1ZOMA 3NCLA 3F9GA 2Z3CA 1FIWA 1TRMA 5F8ZA 2ZTXA 1Q2WA 1NU7B 4INKA 1C1WH 5C20A 1P8VC 2A4QA 2BD9A 1GMHG 1C2KA 1CSOE 3UFAA 2OC8A 2FLBH 1EX3A 3A88A 1SGEE 2G5VA 2ALVA 1PYTC 1AMHA 1TPSA 4FUDA 3M3SA 3Q3YA 1V3XA 2PKSB 3LJJA 1AZZA 1CA0B 1UTPA 2JH0D 1A3EH 3T27A 1A46H 2SGAA 3BEFB 3Q77A 1TA6A 4GHQA 1GJDB 3VGCB 1GI4A 3ZYEA 4CRBA 1Y3VA 1PPBH 2ZFSA 3EGKH 4SGAE 1P9SA 3TJNA 1TX7A 2FODA 4ZHAA 1L0ZA 3LH3A 1OYTH 4AFSA 1HAZB 5FPYA 2XC0A 2CN0H 4K1EA 2PW8H 2AEIH 3MNSA 2PGQB 1BTHH 3LGWA 1E37B 3RXOA 1EAXA 1XX9A 2H6MA 5JB8S 1HNEE 1VJ9U 1D6WA 1FJSA 3L33A 1SGRE 1GBEA 4INHA 2JKHA 1E0FD 3P8OA 3MO6A 1A0HB 2FI4E 3RLYH 4K3JA 2XCFA 1TLDA 4B1TA 1GI3A 1SVPA 2VGCC 1HYLA 1PPHE 2QN5T 5HXFA 1RS0A 2GT8A 2H9EH 1GJBB 3SV6A 2ZDKA 1DVAH 3IITA 3FP7E 4NSVA 2AYWA 5C1XA 3GYMA 2G52A 1GI7B 3STIA 2ASUB 2XBWA 4Z0KA 3EYDA 4NIWA 2AGIX 1UK4A 3FP6E 3QN7A 4NZLA 4CRGA 5FAHA 2R3UA 4AOQA 2ZHWH 3LGVA 2ZQ1A 3AASA 1AIXH 1QB1A 1QCPA 1CHGA 1MBMA 1QL9A 1VZQH 3SZNA 4QT8C 1U6QA 1LKAA 4DIHH 1DWBH 4WJG2 1X7AC 1AVGH 5DP8A 1FI8A 3NXPA 1V2QT 3A82A 4Y11E 3DD2H 2FP7B 3DHKH 1C2LA 1CGHA 1YPKH 2ZPSA 2W7UA 2SNVA 1Y3WA 3RM0H 1ABJH 1O31A 1GMCF 3T62A 5E2PA 1T8LA 5TJXA 1PQ5A 4CHAC 4ABJA 4TY6A 4A7IB 5AFZH 1F0TA 1LTOA 2O8MA 1MU6B 3RLWH 2XCNA 3AW0A 1C5WB 2OQ5A 3DFLA 3C27B 1ZGVA 1PFXC 2BLOA 1TONA 1BB0B 1K2I1 4K5ZA 1HBTH 1C5YB 2Y7ZA 3RDZA 4OS1A 1FLEE 1BMNH 4I8GA 5ETXA 4Y10E 4BAOB 2VIPA 1T8MA 1GJAB 3SV2H 3TH4H 1QHRB 4OS5A 2C8WB 1W2KH 1P0SH 1ZTJA 1UTMA 1THPB 2VGCB 2TBSA 2ZPQA 1KTSB 2AMPA 2BVRH 3KGPA 1J9CH 2NU2E 3BTFE 1V2ST 2ZF0H 1P2MA 4Q2KA 1HIAB 4BXWA 2BMGB 5T6GA 1UTLM 3ZV9A 2DE9A 4TY7A 1XKBC 1IOEA 5JPMH 4ZHMU 3VXFH 1OWDA 2PUXB 1XVMA 2VVVA 2WPMS 2WV4A 1RTKA 4Y8XA 5HM9A 2R2MB 3TGKE 1D3PB 3TJOA 1LO6A 5IYTA 3ATLA 4JZFH 4AGKA 1AD8H 2Z3DA 2ZU3A 1SQOA 4Y0ZE 4AG2A 1F7ZA 1YGCH 3A83A 2GCTB 3NK8A 2BD3A 3TK5A 3PROA 3ZZ9A