2B9LA

Crystal structure of prophenoloxidase activating factor-ii from the beetle holotrichia diomphalia
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
394
structure length
372
Chain Sequence
b'GHMAVVNIFGNASEYIPPGYEAPLGALTALPRCGTGADQGKKVCIVYHRCDGVTNTVTPEEVINTTGEGIFDIRENANECESYLDVCCGLPPVVPVLKPSFCGIRNERGLDFKITGQTNEAEYGEFPWMVAVLKANEEQLVCGGSLIAPSVVLTGAHCVNSYQSNLDAIKIRAGEWDTLTEKERLPYQERKIRQVIIHSNFNPKTVVNDVALLLLDRPLVQADNIGTICLPQQSQIFDSTECFASGWGKKEFGSRHRYSNILKKIQLPTVDRDKCQADLRNTRLGLKFVLDQTFVCAGGEQGKDTCTGDGGSPLFCPDPRNPSRYMQMGIVAWGIGCGDENVPGVYANVAHFRNWIDQEMQAKGLSTTPYVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords prophenoloxidase activating factor
publication title Crystal structure of a clip-domain serine protease and functional roles of the clip domains.
pubmed doi rcsb
source organism Holotrichia diomphalia
molecule tags Immune system/protein binding
total genus 88
structure length 372
sequence length 394
ec nomenclature
pdb deposition date 2005-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF18322 CLIP_1 Serine protease Clip domain PPAF-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2b9lA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2b9lA01
1PQ5A 1AY6H 1OWHA 2WV5A 5DP8A 2VVUA 2Q6GA 2GD4B 1A4WH 3DT0H 2FS8A 3DA9B 3A7VA 3BEFB 3GCHB 1L4DA 4H4FA 4ESTE 2ZHFH 1A1RA 3TK9A 5T6DA 3UOPA 4ABFA 1QB6A 2OXSA 2VGCB 5AVDA 4BAOB 4GHTA 3ZV9A 4NWLA 3STIA 2ZI2H 3URDA 1SGRE 2P3FH 3RXKA 2XWBI 1O5BB 1C1SA 2A4OA 2FEQH 5ESTE 1O3HA 1SLVB 5L2YH 1TPSA 1BBRK 4IS5A 1BTHH 2P16A 4FU8A 1SL3A 1TGBA 2ZDKA 5HXFA 2WPLS 3HPTB 1GMHG 1W3CA 1GI1A 1C1UH 1H8DH 5FPSA 1YBWA 8GCHF 5FBEA 1GG6B 2SGQE 3SU4A 2XCNA 2VIOA 1SG8B 2VWNA 1T31A 4XBDA 1SOZA 1TOMH 3MU8A 3BG4C 3MFJA 1INCA 2EA3A 1TPOA 1VCPA 1BOQA 2H9TH 1XM1A 2ESTE 3HATH 5JDUB 1ETRH 1EZXC 1AUTC 2JKHA 1QHRB 2VVCA 5F03A 1EXFA 3MI4A 2BXUH 1GBCA 1QQ4A 2XXLA 1O2UA 3MWIU 1C1RA 1ZGIA 4RKJB 5TCCA 1OPHB 1ZYOA 1LCYA 2GCTB 1O35A 1ESTA 2BDGA 1RJXB 2QGRA 4FUEA 2BMGB 5EXNA 1QL8A 1LO6A 2ASUB 1CE5A 2UUYA 1G32B 1SGEE 3BV9B 4RSPA 4WMFA 3SUDA 3TVJB 1XUFA 3BF6H 2F9NA 3LJJA 3ZZCA 3UREA 5DP9A 4AB8A 4Z0KA 1GI2A 3RXSA 2G00A 1GCTB 4MPVA 4R8TB 4X6PA 1UVTH 2J92A 3M5NA 2Z3CA 2TRMA 3M37A 1LVBA 5GDSH 3MNBA 2JETC 4BXSA 3PV4A 5A0AE 2FI4E 1S84A 2Z9IA 4AORA 1F92A 2O8LA 3GY2A 2FP7B 4BTTB 1T8NA 1BTXA 3SJ8A 1YPHE 1DY8A 3MHWU 2AGIX 1ORFA 5FPTA 1TRYA 2PSXA 1JRSA 1C5VA 5HM2A 3RLYH 2AERH 3PMAB 5JYIA 2UUJB 3QGNB 2BDYA 3U1JB 3EA8A 5E8EH 1IQNA 2HWLB 1BZXE 1P2JA 4NIVA 2AS9A 3SQHE 1UHBB 1OS8A 1PJPA 5JBTA 1QJ1B 3H5CB 3AAUA 3GY8A 4CR9A 1JWTA 1XUHA 2FESH 1HIAA 5JB8S 3K65B 4A1VA 1SGYE 4X6OA 1W8BH 3P6ZB 3SBKA 1H4WA 3TJUA 2FMJA 1ANEA 1A2CH 4INLA 8ESTE 5A0BA 2JH0D 4CRDA 2ILNA 1P0SH 1GJAB 3GY3A 4H6TA 1F0RA 1ARCA 1C1OA 1J8AA 2R2WU 3A7XA 1P2OA 3K6YA 1QBVH 1T8OA 1MTVA 6CHAB 1BRUP 1GHBG 3V3MA 1S0RA 2HRVA 2OLGA 3CS7A 2FOFA 3C27B 1MTSA 4NFEA 2PUXB 3VB4A 1O2VA 2ANKH 3ATKA 2F9UA 5EW1H 4J1YA 3AASA 2V3HH 1E34B 3GCOA 1ESAA 3MU5A 1ABJH 2GZ9A 5J4SA 1W13U 2GX4A 3S9CA 4AG2A 1DWEH 3LU9B 1JOUB 2CN0H 2J9NA 4OS5A 3GYMA 1O3KA 3Q00A 1IQLA 2H6MA 1D4PB 2SNWA 4UONA 1CT4E 1HAOH 2IOTA 3GDUA 1ZPCA 1H9HE 1ELTA 3R0FA 1YP9A 1PYTD 3VPKA 4M7GA 4AB9A 1DE7H 1OOKB 3SJIA 1AHTH 1E37B 3GY5A 3IITA 5LPRA 1A46H 4IMQA 4AYYB 1C5ZB 1F0UA 2FM2A 2H1UA 2ZCLP 3TH4H 4MPXA 1PQ8A 1TRNA 1KXBA 3RUOA 2VVVA 1YPLH 3HKIB 2B9LA 3LKWA 1C5XB 1DPOA 1J14A 4H6SB 1SLXB 4BTIB 1O2YA 1TNHA 3BTQE 2TGPZ 2CHAB 5DGJA 3KQEA 2P93A 1GHAF 1HV7A 2LNCA 3LIWA 3ODFA 2A45B 5EG4A 1SGPE 4Y8ZA 1NO9H 4IGDA 1D3DB 4ZXYH 1C2EA 1BRCE 1UJ1A 1EASA 1AZZA 2GDDA 1W11U 3UR6A 5B6OA 1IQHA 3MH4A 1TA2A 4ABIA 2BY5X 1E0FD 3L3TA 1BUIA 1C4U2 1MD8A 6ESTA 1SI5H 3RXQA 3KIDU 3V0XA 3A7ZA 1G36A 3SHAH 5T6GA 3KF2A 3S7KB 5C20A 5DP5A 2VIQA 3A83A 3VFEA 2A5AA 4FUJA 1IQFA 3I77A 1VGCB 5JBCS 3M35A 1XUJA 4ZKNU 2FODA 3RU4E 3ATMA 3OTJE 1DM4B 1DUAA 1JXPA 3SI3H 1LHGH 4DJZB 1V2TT 1NU9A 4AZ2B 3AW0A 3MTYA 2ZDAH 3S69A 3ATIA 2ODYB 1GGDC 3T28A 4Z6AH 3U8TH 1HFDA 2GMTC 3SU6A 3SUEA 4K1SA 1LHCH 1IQMA 1O2QA 1YLCA 1MTWA 1SGDE 1GHAG 1AB9C 1P09A 2FOCA 4XOJA 1C2FA 3FVFB 1NFWA 4YOIA 1V2OT 1JIMA 1FY4A 1ZHRA 2NU0E 3F9EA 3S9BA 2BOKA 3TGJE 4VGCC 3LC5A 1W7GH 5HMAA 1DANH 3KNXA 2TGDA 3RXCA 1E38B 1O2ZA 1P04A 4CRGA 2VJ1A 4X0WU 1FXYA 1ELEE 3O8DA 2NU1E 4X6NA 1IQEA 2BY7X 1UTMA 1QIXB 1HAVB 2G55A 1V2NT 1H9IE 1TMBH 4D8NA 4FUHA 2HNTE 5CE1A 1ZJDA 2J95A 2SGEE 1A5GH 1CHOF 1DS2E 4ISOA 4DCDA 2WPMS 2CF8H 2C8YB 3UY9A 5F8XA 1LVOA 1GJCB 4WWYA 1QQUA 2ZDVH 3SU2A 1VITH 3NKKA 3EAJA 2D1JA 1UTKA 5F6MA 1P02A 3SHCH 3FP8E 4GCHF 1O2IA 1UVUH 1A3BH 3MNXA 1ZLRA 3GY4A 1OP0A 4UE7H 1G3CA 3QGJA 3QN7A 4IN2A 3ITIA 1QJ6B 1GDUA 1T8LA 5DJ7A 2F9PA 1HJAB 1KXDA 3QDZB 3STJA 4XDEA 1A3EH 3SORA 3U9AH 3Q3KA 4BANB 3PTNA 3QZQA 1MCVA 2BD7A 3TK5A 3ZZBA 5F8ZA 4A1XA 1NM6A 4A7IB 1SQOA 1PYTC 1TNGA 1WOFA 1W2KH 1HYLA 3BTME 3PYHA 4X2YA 4HGCA 4XBCA 3UR9A 1G3EA 2ZFQH 4HI3A 2BQWB 3FFGA 5DG6A 4B2CA 5FBIA 1LHEH 3S0NA 1SFIA 2AGGX 3SU1A 1FDPA 3ZYDA 1D6WA 2CXVA 4I8LA 1NRQH 4CBNA 3BTGE 2TIOA 1TBQH 3GDSA 1TX7A 4YTAA 3N7OA 1UHBA 1SGNE 1RIWC 4YESB 1QGFA 2QC2A 1RXPA 1LQDB 1GDQA 3OY6U 1C5UA 1G37A 1FJSA 1SPJA 3ZYEA 1O5GH 4X2XA 2FYQA 1EUFA 2P3TB 3BIVH 2J34A 1KXAA 3P70B 1XUIA 3RM2H 5LPFA 3JZ2B 2ZZUH 1BTWA 5G4BA 3AVZA 2VGCC 5FX5A 2ANMH 4Q2KA 1TBZH 1FIWA 4U32A 1SOTA 2XC0A 4NSVA 1SGCA 2PTNA 2CV3A 1TGCA 1TYNA 1OWKA 1NPMA 2WUCA 2VIWA 3ZVGA 1K1LA 3TGIE 1GHZA 3PMBB 1V2KT 5HM9A 2A2QH 1L4ZA 2BM2A 4ZKRU 1ETTH 1PPCE 1W14U 2GDEH 2V6NA 1C2JA 1B0EA 1LHFH 1F5KU 1P2IA 3M3VA 5EQRA 2H5DA 2PLXA 1GG6C 1KXFA 1V3XA 1UTQA 1XKAC 1GBKA 1AE8H 3QLPH 1QR3E 5DP7A 2G5NA 2G81E 2QXJA 3RMOH 4NG9H 3LC3A 3VGCC 4YO9A 3A84A 5T3HA 1O2JA 1RTKA 4O97A 4ZKSU 2SGFE 2A0QB 2YOLA 1GI6A 3BTDE 1P2QA 1K1OA 5IDKA 1CBWB 1ZMLA 2J94A 3EQ0H 5FHTA 4X2VA 1GI5A 2BVXH 1LQEA 2V3OH 1QB9A 1IQGA 1GJ6A 2W3KA 1Y5UT 3D23A 3W95A 2VIVA 2OC8A 2RA3A 2JH6D 1QRWA 1UVSH 5A8YA 4MNXA 1WCZA 1ELDE 1V2JT 1KXCA 3SUGA 4BOHA 4OS7A 4BTUB 7KMEH 4A6LA 1ZMNA 4MVNA 1V2MT 3PO1B 2ZIQH 3RXRA 2LPRA 1GCTC 1OXGA 1Z8JB 1KYNA 2OBQA 2RA0A 6GCHG 1L0ZA 4KTCA 1GBBA 1O30A 2ZC9H 5FX6A 3SU3A 1P57B 1NROH 4E7NA 1B7XB 5CHAB 2Q1JA 1Y5AT 5L2ZH 2WV4A 1C2LA 3K2UA 3S7HB 4X1NU 3MO3A 1J17T 2ZKSA 3OY5U 1GI3A 3SUFA 1ARBA 3SNCA 3E91A 2AEIH 1NN6A 5I25A 2XBXA 2P94A 1O38A 2VWMA 2A7JA 5C2ZA 2B5TB 2VH6A 2ZHEH 4O9VA 1H9LB 2VWLA 4X1QU 3M5MA 3QK1A 3CP7A 5GCHG 1O3CA 2BLQA 1Q3XA 3KCGH 1TPPA 2XWAA 5DPAA 1O3DA 1BIOA 1C5QA 1PPHE 4ZHMU 5GWZA 4O3UA 1SSXA 4ZH8A 1TNIA 1KIGH 1QJ7B 2HOBA 1PPGE 2B0FA 5EPYA 4INHA 2J38A 2WPKS 2FX4A 2BD2A 3ENSB 1KTSB 1GMCG 3IWMA 1HNEE 3RXFA 1SQTA 2OC7A 1ELFA 4LZ4B 2Y5GA 2BY8X 2BQ6B 4LOYH 2HGTH 1VZQH 4Y8XA 2OQUA 1FY1A 4UEHH 2V35A 4UDWH 3LGUA 3HK3B 1F0TA 6CHAC 1EOLA 3M7QA 2XBYA 4X1RU 4HFPB 4DIIH 2PWXA 3D65E 3FAOA 1ZPBA 3S9AA 1EAUA 3E3TA 3MO6A 4ISLA 1Y5BT 3D49H 2QXHA 2ZU3A 1OWIA 1FN8A 3GCTG 1ELCA 1HAYB 3PLPA 5E2PA 1TONA 3ODDA 3RXJA 4TWYA 2FZZA 3SW2B 2BB4A 2FX6A 4OGXA 4DG4A 5E0JA 1UCYE 1QNJA 2BDCA 4AG1A 1NRNH 4F49A 4X8UH 2IN2A 2STBE 1Z8RA 1QRXA 3UOUA 3BTWE 3PMJA 1DFPA 4TPIZ 3QZRA 5FCRA 1V2QT 2J2UA 2R9PA 4JK5A 4UFFH 4Q80A 3AW1A 9LPRA 2ANYA 1JMOH 2Z7FE 3UWIA 1HAVA 4K2YA 1FY3A 1CA0C 1HAGE 2ZU5A 3UFAA 3UUZA 1VCQA 4JMYA 2ZA5A 4AX9H 3PM3A 2OTVA 4NZQA 3SNAA 2SGPE 1P9UA 1Y3UA 1QA0A 1IHSH 4I32A 4CR5A 5DP3A 1D3QB 1JBUH 3GCNA 2OINA 4R0IA 3E90B 3Q3XA 5DKMA 3ZZAA 1TQ0B 4JYUH 3KHVA 2BHGA 2CHAC 1SGIB 1ZHMA 2Q6FA 2Y81A 4Y71A 1FQ3A 1IAUA 1MTNB 5LGOA 7LPRA 1MAXA 4D9QA 4YZUA 4DOQA 4A1TA 1GVZA 1KLJH 7ESTE 5FPYA 1O2HA 2BYAX 1ANCA 4E06H 2OD3B 1GHVH 2BDHA 2ODPA 3RC6A 1AUJA 3L33A 2QY0B 1FAXA 1XVMA 3RMMH 5JPMH 1BMLA 1BHXF 1S5SA 4Q7ZA 1BITA 1BCUH 8GCHG 3UIRA 3K9XB 1VJAU 4BXWA 4A5TS 1TOCB 3TIUA 2FTMA 3PWCA 2PHBA 1SGTA 2ODQA 1GBHA 1NFXA 1TABE 2O8MA 3RU4T 4AGKA 1BJUA 1GMDF 4AOQA 4IBLH 2BQ7B 4K3JA 2UUKB 3LH3A 1Q2WA 2NU2E 4PROA 4BAHB 2PR3A 1O2TA 1CGHA 2QYIA 3ZZ9A 1KSNA 1MKXH 3AAVA 4WMDA 1MMJN 1C2GA 3EA7A 4MPUA 3BTTE 6LPRA 4CBOA 3ZZ3A 1XUGA 4AFSA 2C93B 1HJ9A 1C5MD 1VGCC 3M61U 4ABGA 2Z3DA 1CO7E 1P03A 3I78A 5L6NH 4IMZA 1N1LA 4YT6H 3NCLA 3ZVFA 1NESE 4ZMAH 3VB6A 4MPWA 1TFXA 2BDAA 2R0LA 2FLRH 3T2NA 5BRRE 2I6QA 5ETXA 4B76A 3E1XB 4H42U 4I7YH 4TPYA 4Y7BA 4I8HA 4X2WA 1Y3WA 4JZEH 1O3EA 4I8JA 1BTPA 1P10A 1IHTH 1ETSH 3T5FH 1TNKA 2D2DA 1GBJA 5EQQA 2ZQ1A 1Z6EA 2PTCE 1OKXA 3H7OA 4FUBA 4NGAH 4ZHAA 1WU1A 1NFYA 5AFZH 1C9TA 4Y11E 2EC9H 2EI8A 2UWLA 4Y0ZE 1P01A 2C8XB 2Z9KA 4NA9H 2BLVA 4FUFA 3UPEA 1EB2A 1QBOA 2Y80A 5EU8A 1P12E 2ALVA 4WVPE 2ZGBH 3BTFE 4AFUA 1AE5A 1S83A 4J2YB 5AFYH 4NFFA 1C5WB 1EATA 1O2MA 2AH4X 3PB1E 4FUDA 4QT8C 1T7CA 1Z71A 1DWDH 1G3DA 1P05A 1WV7H 4K1TA 1DLKB 4IC5A 3KGPA 1Z1IA 1QCPA 2C3SA 4OS6A 1G9IE 1OSSA 2Z6BD 2BOHB 2FOMB 5HYOA 1BMNH 3BEIB 1YCPH 4WXVA 2C8ZB 2VH0A 1Z6JH 1GI4A 3PTBA 5EW2H 1HAZB 1GI9B 1O5FH 3MH7A 5C1XA 2F83A 3IG6B 1PPZA 3F9GA 5F8TA 1TRMA 3RU4D 2VIPA 4OS4A 2FLBH 3RXEA 2GZ8A 2QF0A 5FXLA 1O2RA 3SGBE 4CRFA 1S6HA 1TQ7B 1HJAC 3RC4A 3MH6A 3BTKE 1CHGA 1Y59T 3PMHB 1G2MA 3SU5A 1QFKH 2W5EA 3P92A 2PSYA 1MTUA 1C2MA 1GJDB 1JIRA 2HALA 1YGCH 3MOCA 1YM0A 2FYRA 1K1PA 4NIXA 5ESBA 2WYGA 2A2XH 3HK6B 1GPZA 2ZDMA 1WBGB 1EJMA 2ZFSA 2AYWA 1HAPH 3P8OA 2QV1A 3SJOA 4Y10E 4CRCA 1NU7B 1C2KA 3TK6A 5HGGA 1LVMA 1ZJKA 1IQJA 2XBVA 3BTEE 3R3GB 1EP5A 1SHHB 1HXFH 2BDBA 4K8YA 1GL0E 1CA8B 1O3PB 1KXEA 3B23B 3P8FA 3V12A 4UD9H 3JZ1B 4FU7A 1VR1H 3ZV8A 3DFJA 2O8UA 4MQAA 3NZIA 3TLOA 3MYWA 1FPCH 5FAHA 4CRAA 1TLDA 1ZSKA 1V2ST 3SV9A 1PPFE 3WY8A 1MQ5A 1OX1A 1F5RA 4DW2U 2TGTA 2ZNKH 7GCHF 1WSSH 1GDNA 1O3GA 1QL9A 2EI6A 1G2LA 2ZQ2A 3RXGA 1WTGH 4FUGA 2QXIA 1HUTH 1JRTA 2P59A 3U8OH 1CSOE 1A7SA 1KDQB 4ZKOU 1P3EA 3VXFH 1K1IA 4BAMB 1QB1A 2OBOA 3G01A 1YPGH 3V13A 3DFLA 1V2PT 5TCAA 3RXDA 2PUQH 2PKAB 2BLWA 1L1GA 1K1JA 1L1JA 3FANA 4K5ZA 1O2WA 4I33A 2FOHA 1RRKA 1DXPA 3A80A 1EAWA 1MU8B 3LPRA 1THPB 1O2GH 1CBWC 5EODA 1O3OA 3VEQB 2AMQA 2FIRH 1O39A 4HZHA 1AWFH 2WPJS 4YT7H 4UFEH 1YLDA 2WINI 1AFEH 1GBMA 2R3UA 3FZZA 3ELAH 1YKTA 3E16B 4F4OC 1DUEA 1V2LT 3M5LA 3MU0A 3BSQA 3EDXB 2ZG0H 2BZ6H 1UTLM 3KQDA 2BX3A 4WXIA 5L30H 1AI8H 1UVOA 1NY22 1AKSB 3GYLB 1C2HA 5AHGH 3PO1C 1D9IA 1ESBA 2WYJA 1C5TA 1UCYH 3OSYA 2XCFA 1MUEB 1HDTH 2G4UA 2QAAA 1FI8A 2DE9A 3SU0A 1C5RA 1NZQH 3U1IB 2W3IA 3EE0B 4E05H 1C1MA 1K22H 2BVSH 2BD5A 1C5NH 3LGWA 3RXMA 5CHAC 1WYKA 7GCHG 2PKSB 2GVFA 3GISB 1PQ7A 4BAQB 2P3UB 4GUXA 1HCGA 4YOJA 1SLWB 2B7DH 1A5HA 3M36A 2RG3A 1V6DA 1GBAA 1N6XA 1GBIA 4TY6A 1EAIA 1DWBH 4U30A 3TPIZ 2THFB 2A7HA 2QCYA 3RXTA 2Y7ZA 4MNWA 1YPJH 2W7UA 3LDXH 1GI7B 1CGIE 4ZXXH 4ABEA 2ZPQA 2JH5D 3GCHC 5LH8A 1C4Y2 1GJ8B 2A32A 4X1SU 3L6PA 1LHDH 1FY8E 1MU6B 1CHOG 1Y8TA 3MU1A 2XW9A 1BQYA 1SFQB 2R3YA 3A7TA 4ISHH 4OGYA 3F6UH 1BA8B 3RXBA 1W12U 2FO9A 1GGDB 4ABHA 4GCHG 5T6FA 4YLUA 1Z1JA 4MNYA 1ELGA 4U01A 1E36B 1O5AB 4K1EA 5I46H 4B71A 2BX4A 4B2AA 4WJG2 4CRBA 1O2XA 1P11E 2A4GA 1ELBA 3QO6A 1O3MA 2VINA 4BNRA 2PFEA 2ZHWH 4FU9A 2TPIZ 3K6ZA 3MNSA 3SNBA 1BHXB 1LPZB 1UVPA 1XX9A 2I6SA 4K69A 2PGQB 1LKAA 1SBWA 3SZNA 2Z3EA 5JBAS 2F91A 5E0HA 3RDZA 2OUAA 2BY6X 3BIUH 2OC0A 2BZAA 1HGTH 2XC5A 2A5KA 1ELVA 1C2IA 2W26A 2OC1A 5EOKA 3GICB 4I31A 2C8WB 3TGKE 1BTZA 4D7GA 3Q76A 4NZLA 2ZU1A 1O2PA 3TJVA 3SO3A 1LVYA 1GL1A 3RXIA 2GCTC 1IOEA 1HXEH 2F9OA 1F5LA 2UWPA 1VITF 1GHXH 1AIXH 2UUFB 3FP7E 3SV8A 1LPGB 4B74A 3RMLH 2GV6A 2CGAA 1HAXB 3PROA 4I8GA 1XXDA 1QL7A 1OP8A 2GV7A 2H2ZA 2QF3A 2ZGCA 1FIZA 1FNIA 1DLEA 3ZVBA 3TNTA 1SB1H 1U6QA 1O0DH 4AGJA 3LOXA 1F7ZA 1P2NA 4NWKA 3PWBA 3SV7A 3BN9A 2D8WA 1ZRBA 5ABWA 2AMDA 2K1QA 1QA7A 4E7RG 1D3PB 3A7WA 2QA9E 1GJBB 3W94A 2Y6TA 1GMHF 1AZ8A 2ZU2A 1MTNC 1FZZA 3O8BA 5JBBS 5EGMA 3CENA 1S6FA 1J15A 2A1DB 4JZDH 1KY9A 1O2OA 1RTFB 4GHQA 4WY3A 3P8GA 1FPHH 1XXFA 1L2EA 1MD7A 3H7TA 5DO4H 2M5TA 3T25A 2GCHF 1UK3A 3E0NB 4YM9A 2H5CA 1ANDA 3QTOH 3TH2H 5C67A 2ZTZA 3RXOA 3E8LA 3RXLA 1EJAA 2RDLA 1FLEE 2R0KA 2AIQA 4CHAB 5C1UA 1O2LA 4LZ1H 1RS0A 1AVGH 3VXEH 2P95A 1GJ7B 1K1NA 2GT8A 1TAWA 4XSKU 2Y5FA 1AO5A 1Y3VA 1BJVA 4X8VH 1OWJA 2EI7A 1NFUA 4WH6A 2FOGA 1ZPZA 1VITG 1EPTB 2VWOA 2OQ5A 1VCWA 1V2VT 1DITH 4FVDA 3A88A 1XUKA 4FUCA 1O2SA 3KL6A 1C5SA 2CF9H 1EZSC 1MKWH 5EXMA 1MZAA 1MKXK 1FV9A 4B1TA 1O34A 4U2WA 1O5CB 1J9CH 4B75A 2A31A 3RC5A 3NUMA 3SNEA 1OYTH 3UNRA 1S81A 1A0LA 2P8OB 1C1VH 2OCVB 2XNIA 3T29A 1C1PA 3HGNA 1HLTH 2QN5T 1IQIA 3SGQE 5DP6A 1XKBC 1TMTH 1A0JA 2VB0A 3RP2A 3VGCB 1KDQA 2ALPA 2BD3A 1ABIH 1N8OB 4MTBA 3V7TA 1NRRH 1GBFA 4MDSA 1Y3XA 1A5IA 4Q7YA 3OYPA 5EPNA 2GCHG 1HPGA 1HAHH 2H9EH 2PKAA 3Q77A 2ZWLH 4MNVA 4ABJA 1FN6A 5C1YA 2G52A 1EOJA 2IJOB 4XE4A 2ZGHA 1PPBH 3I29A 1WUNH 2ZFRH 4O03A 1FUJA 2NWNA 2J4IA 1BRBE 2A7CA 2GGVB 1S0QA 3RXUA 1GHBF 4X8TH 3SV2H 1UTPA 3O8CA 2F3CE 2CJIA 3LGYA 1CVWH 2PV9B 1SQAA 3EA9A 5JB9S 3T27A 3BG8A 3ZVEA 2ZFTA 1W7XH 1SGFG 1AFQB 1OWEA 4MG3A 2OP9A 1F0SA 1GBTA 3A87A 1V2UT 4IN1A 3QTVH 4OS1A 3A8CA 1AKSA 3A7YA 4ABAA 1SGFA 3RXVA 2ZCKP 2G4TA 3P17H 4ZROA 5K0HA 1UTOA 4JZ1A 2EEKA 4KTUA 2O8TA 2KAIB 5E0GA 3FP6E 4KKDA 3SJKA 4NSYA 1MQ6A 1L1NA 4DIHH 3LGVA 1PQAA 2GTBA 1YCPK 4YOGA 1LPKB 3M5OA 1YCPM 2FS9A 2XRCA 1EP6A 1AWHB 1UTJA 4NIWA 2ZP0H 3B9FH 2FI5E 1P9SA 1BDAA 4ISNA 1K1MA 2C90B 1BBRH 4JZIA 3ZZ8A 2WPHS 1WTHD 2HPPH 4WMEA 4D9RA 9ESTA 1KTTB 3VB3A 3QWCH 2Q6DA 1K2I1 2ZDLA 1C1QA 2A4RA 1EJNA 4O3TA 5C5OA 1TNLA 5BPEA 2BDIA 2FI3E 1X7AC 4KTSA 1ZTKA 4ZHLU 1IQKA 1FY5A 3A85A 1SR5C 1BMAA 1C5YB 2G51A 2BTCE 3DD2H 1BTYA 1TMUH 5AF9H 1GBLA 4X8SH 2VU8E 3MO9A 2H9HA 1G3BA 2TBSA 1O3BA 2FTLE 2WUBA 4Q7XA 1EQ9A 1PFXC 2Z9JA 2ZHQH 1AVWA 1DICA 5H4IB 1E35B 1AMHA 2Z94A 1TGSZ 4TYDA 2AMPA 3BG4B 5GPIB 1P8VC 1QTFA 5EXLA 1W0ZU 4SGBE 3KEEA 2QXGA 1ZSLA 2ZECA 4B2BA 3P8NA 1ANBA 1MBMA 3UNQA 1ZMJA 1MCTA 1LKBA 4FXGH 1EZQA 1O2KA 3LGIA 1DXWA 1GMDG 2B8OH 4JYTA 5EQSA 3PLKA 3C1KA 8KME2 2Y82A 1F2SE 2ZGXH 2ULLA 5A8ZA 1CA0B 1THSH 4AYVB 1A61H 8LPRA 3QX5H 3RMNH 4DT7B 1M9UA 3NPSA 3F68H 3SV6A 1CU1A 4RKOB 2SGAA 3NK8A 2DE8A 1WAYB 1TNJA 1GBEA 1SVPA 1WQVH 3TH3H 1O3AA 1DOJA 3SI4H 2AFQB 3ZZ4A 3Q3YA 3EYDA 1TALA 2STAE 1THRH 3RM0H 1GBDA 1ZR0A 2W7SA 3RXPA 2FOBA 2YNBA 1AD8H 1T32A 2JETB 1Y3YA 1DWCH 2ZFPH 3ZZ5A 1GI0A 1Q31A 1EX3A 5CMXH 3SQEE 1ZOMA 3RLWH 5J4QA 2BY9X 1WQSA 1O3IA 3OX7U 1HB0B 1YC0A 4NCYA 5C3NA 4Y7AA 1YPHC 1W0YH 2F9VA 1O3FA 1DVAH 1EB1H 2HNTF 1HJ8A 5GJ4B 1O32A 2PKSC 1C5LH 2AIPA 2HPQH 4YLQH 1LDTT 1DSUA 1P3CA 1SC8U 3B8JA 3ZVDA 5GXPA 3UQVA 1XMNB 3ATWA 1SHYA 5GIBA 1PPEE 3F1SB 1O37A 3LGTA 4JZFH 1RD3B 4TY7A 2UWOA 1KLIH 1H1BA 3LT3A 1UCYK 4CH8B 1O5EH 2Y7XA 3ATLA 2F9BH 3URCA 4LK4A 4A92A 5FCKA 2A5IA 3LH1A 1YF4A 1K9OE 3RXAA 3U8RH 3GOVB 3HKJB 2HLCA 2FOAA 2SNVA 4KGAA 3FZDA 4Y6DA 3TJOA 1ACBE 3NXPA 1MH0A 1SGQE 2R2MB 1NS3A 3A86A 1A0HB 1EPTA 2IPHA 2FDAA 3TJNA 2RCEA 3KN2A 3OU0A 4DVAU 1C1TA 1SMFE 3TU7H 4FUIA 2PW8H 3A89A 1SLUB 1P06A 3ZVAA 1O3LA 2BD8A 1T4VH 1KLTA 1TGTA 3SN8A 1UO6A 1EZUC 3LJOA 4IC6A 1TGNA 1QY6A 1K28D 1TX8A 3D62A 3MMGA 3DUXH 4MLFB 4GPGA 1EAXA 3T62A 5DP4A 1OP2A 3ZVCA 4D7FA 1T8MA 3F9FA 5IYTA 1O3NA 1TPAE 1C5PA 1YPMH 2GP9B 3KQBA 1ZHPA 2GZ7A 3LONA 2WPIS 1O31A 5C5NA 2TGAA 1RGQA 3U69H 1RFNA 2PGBB 1O5DH 3O8RA 3VB7A 1O3JA 3T26A 1Z8IB 1BBRE 1S85A 2AGEX 1VJ9U 3F9HA 4WF8A 1S82A 2ZTXA 4INKA 3DHKH 2ZGJA 3M3SA 5A2MH 1H8IH 2GKVE 1NRSH 2FWWA 1GHYH 1AU8A 5SGAE 2FOEA 1BTUA 2C4FH 3GDVA 1BT7A 4DY7B 1FONA 1BB0B 1D6RA 1OWDA 4XFQA 4GVUA 3GY7A 1QBNA 3ZZ6A 2O8WA 1AQ7A 2ZF0H 3RXHA 1ZSJA 2HVXA 1TBRH 3BTHE 3UWJH 5A09A 2YNAA 3PLBA 2XBWA 2BLOA 1LMWB 1AN1E 1NT1A 1C1WH 1LTOA 3UQOA 1DT2A 2FPZA 2Y5HA 2BVRH 2SFAA 3M3TA 4JK6A 4AFQA 2VNTA 4X1PU 1YPEH 4NA8A 4DGJA 5PTPA 3SOSA 2KAIA 5DK1A 3NWUA 5TJXA 1ZZZA 1GHWH 1NC6A 1TWXB 1T4UH 1O33A 4KP0A 4ABDA 3E0PB 1GJ5H 1HAIH 1J16A 2ZPRA 4B73A 1HIAB 4GLYA 2ZTYA 2ZU4A 5E2OA 2QIQA 4CH2B 4KELA 3A8AA 4LXBH 3MU4A 1V2WT 1GJ9B 2XC4A 2Z9GA 4IW4E 1YPKH 3A81A 2DUCA 3ESTA 4CHAC 1B5GH 2ZHDA 4GAWA 1Z8GA 1K21H 1MBQA 1TIOA 1TB6H 1DSTA 2XYAA 4GSOA 3BEUA 2GMTB 3A8BA 4UFGH 4D76A 3SNDA 1UK4A 1FAKH 2G5VA 4NIYA 3ZZ7A 2SGDE 1ZTJA 4K60A 2BD9A 4DURA 1P2MA 2NU3E 1EPTC 1ZGVA 1GJ4H 3TNSA 4SGAE 6GCHF 1AB9B 2GT7A 1QURH 2ZPSA 1AVXA 1UMAH 1NRPH 4Y0YE 1W10U 4XBBA 1CT0E 2FXRA 4NA7A 1TX6A 1MZDA 3KQCA 4VGCB 1C9PA 4JCNA 1C5OH 1GVLA 4WH8A 1P2KA 5A0CA 2XTTB 1CT2E 5A8XA 3SGAE 3UTUH 1TE0A 2P8OC 3CS0A 3MNCA 1XVOA 4UFDH 5K7RA 2ZEBA 4AFZA 1HBTH 5GCHF 4FVBA 4AN7A 1UK2A 2HNTC 1C1NA 1GI8B 1HRTH 4ZUHA 4ABBA 4X6MA 1N8OC 3EGKH 1MKWK 3GY6A 1EKBB 4HTCH 1Z7KA 3MH5A 5LPEA 3M7TA 2V0BA 3A82A 1ELAA 1DDJA 1GMCF 1TA6A 1O2NA 4OS2A 1FMGA 3SJ9A 2ZO3H 2CMYA 4Y8YA 2ZCHP 2ANWA 1ID5H 4Y76A 1V2RT 4THNH 4CREA 3ZZDA 1O36A 2VIDA 1DY9A 2BD4A 4K8BA 1GWAA 1BMMH 2A4QA 1ZRKA 2NU4E 1AGJA 3VB5A 2O9QA 3U98H 4I8KA 1AFQC 1GCDA 4BAKB 1BRAA 1YYY1 1CGJE 1OYQA 3QUMP 1RTLA 2G8TA 2ZFFH 3P95A 3UNSA 3E6PH 1CQQA 3GCTF 4ASHA 4TWWA 2D26C 3A8DA 1G30B 4JYVH 2BXTH 2Z9LA 1B0FA 1C2DA 1NTPA 1GVKB 1QRZA 3HGPA 4Y79A 4ZAEA 1C4V2 2ZDNA 1ZTLA 1N6YA 1RIWB 1DX5M 3TITA 3M7UA 1MAYA 4ISIH 1UTNA 1D3TB 4RN6A
chains in the Genus database with same CATH superfamily
1PQ5A 1AY6H 1OWHA 2WV5A 5DP8A 2VVUA 2Q6GA 3PRBA 2GD4B 1A4WH 3DT0H 2FS8A 3DA9B 3A7VA 3BEFB 3GCHB 1L4DA 4H4FA 4ESTE 2ZHFH 1A1RA 2JJ2D 3TK9A 2F4LA 5T6DA 3UOPA 4ABFA 1QB6A 2OXSA 2VGCB 5AVDA 4BAOB 4GHTA 3ZV9A 4NWLA 3STIA 2ZI2H 3URDA 1SGRE 2P3FH 2KR7A 3RXKA 1SQRA 2XWBI 1O5BB 1C1SA 2A4OA 2FEQH 5ESTE 1O3HA 1SLVB 5L2YH 1TPSA 1BBRK 4IS5A 4AC9A 1BTHH 2P16A 3F3BA 4FU8A 1SL3A 1TGBA 2ZDKA 3DSGA 5HXFA 2WPLS 3HPTB 1GMHG 1W3CA 1GI1A 1C1UH 1H8DH 5FPSA 1YBWA 8GCHF 5FBEA 1GG6B 2SGQE 3SU4A 2XCNA 2VIOA 1SG8B 2VWNA 1K0HA 1T31A 4XBDA 1SOZA 1TOMH 3MU8A 3BG4C 3MFJA 1UW7A 1INCA 2EA3A 1TPOA 1VCPA 1BOQA 2H9TH 1XM1A 2ESTE 3HATH 5JDUB 1ETRH 1EZXC 1AUTC 2JKHA 1QHRB 1W0JD 2VVCA 5F03A 5HIZA 1EXFA 3MI4A 2BXUH 1GBCA 1QQ4A 2XXLA 1O2UA 3MWIU 1C1RA 1ZGIA 4RKJB 5TCCA 1OPHB 1ZYOA 1LCYA 2GCTB 1O35A 1ESTA 2BDGA 1RJXB 2QGRA 4FUEA 2BMGB 5EXNA 1QL8A 1LO6A 2ASUB 1CE5A 2UUYA 1G32B 1SGEE 3BV9B 4RSPA 4WMFA 3SUDA 3TVJB 1XUFA 3BF6H 2F9NA 3LJJA 3ZZCA 3UREA 5DP9A 4AB8A 4Z0KA 1GI2A 3RXSA 2G00A 1GCTB 4MPVA 4R8TB 4X6PA 1UVTH 2J92A 3M5NA 2Z3CA 2TRMA 3M37A 3U28C 1LVBA 5GDSH 3MNBA 2JETC 4BXSA 1OHHD 3PV4A 5A0AE 2FI4E 1S84A 2Z9IA 4AORA 1F92A 2O8LA 3GY2A 2FP7B 4BTTB 1T8NA 1BTXA 3SJ8A 3DCLA 1YPHE 1DY8A 3MHWU 2AGIX 1ORFA 5FPTA 1TRYA 2PSXA 1JRSA 1C5VA 5HM2A 3RLYH 2AERH 3PMAB 5JYIA 2UUJB 3QGNB 2BDYA 3U1JB 3EA8A 5E8EH 1IQNA 2HWLB 5EJZA 1BZXE 1P2JA 4NIVA 2AS9A 3SQHE 1UHBB 1OS8A 1PJPA 5JBTA 1QJ1B 3H5CB 3AAUA 3GY8A 4CR9A 1JWTA 1XUHA 2FESH 1HIAA 5JB8S 3K65B 4A1VA 1SGYE 4X6OA 1W8BH 3P6ZB 3SBKA 3OEHD 1H4WA 3TJUA 2FMJA 1ANEA 1A2CH 4INLA 8ESTE 5A0BA 2JH0D 4CRDA 2ILNA 1P0SH 1GJAB 3GY3A 4H6TA 1F0RA 2WSSD 1ARCA 1C1OA 1J8AA 2R2WU 3A7XA 1P2OA 3K6YA 1QBVH 1T8OA 1MTVA 6CHAB 1BRUP 1GHBG 3V3MA 1S0RA 2HRVA 2OLGA 3CS7A 2FOFA 3C27B 1MTSA 4NFEA 2PUXB 3VB4A 1O2VA 2ANKH 4XD7D 3ATKA 2F9UA 5EW1H 4J1YA 3AASA 2V3HH 1E34B 3GCOA 1ESAA 3MU5A 1ABJH 2GZ9A 5J4SA 1W13U 2GX4A 3S9CA 4AG2A 1DWEH 1NBMD 3LU9B 1JOUB 2CN0H 2J9NA 4OS5A 3GYMA 1O3KA 3Q00A 1IQLA 2H6MA 1D4PB 2SNWA 4UONA 1CT4E 1HAOH 2IOTA 3GDUA 2JDID 1ZPCA 1H9HE 1ELTA 3R0FA 1YP9A 1PYTD 3VPKA 4M7GA 4AB9A 1DE7H 1OOKB 3SJIA 1AHTH 1E37B 3GY5A 3IITA 5LPRA 1A46H 4IMQA 4AYYB 1C5ZB 1F0UA 2FM2A 2H1UA 2ZCLP 3TH4H 4MPXA 1PQ8A 1TRNA 1KXBA 3RUOA 2VVVA 1YPLH 3HKIB 2B9LA 3LKWA 1C5XB 1DPOA 1J14A 4H6SB 1SLXB 4BTIB 1O2YA 1TNHA 3BTQE 2TGPZ 2CHAB 5DGJA 3KQEA 2P93A 1GHAF 1HV7A 2LNCA 3LIWA 3ODFA 2A45B 5EG4A 1SGPE 4Y8ZA 1NO9H 1W0KD 1D3DB 4IGDA 4ZXYH 1C2EA 1BRCE 1UJ1A 1EASA 1AZZA 2GDDA 1W11U 3UR6A 5B6OA 1IQHA 3MH4A 1TA2A 2WV9A 4ABIA 2OK5A 2BY5X 1E0FD 3L3TA 2RDEA 1BUIA 1C4U2 1MD8A 6ESTA 1SI5H 3RXQA 2RFKC 3KIDU 3V0XA 3A7ZA 1G36A 3SHAH 5T6GA 3KF2A 3S7KB 5C20A 5DP5A 2VIQA 3A83A 2KX4A 3VFEA 2A5AA 4FUJA 1IQFA 3I77A 1VGCB 5JBCS 3M35A 4B6FA 1XUJA 4ZKNU 2FODA 3RU4E 3ATMA 3OTJE 1DM4B 1DUAA 1JXPA 3SI3H 1LHGH 4DJZB 1V2TT 1NU9A 4AZ2B 3AW0A 3MTYA 2ZDAH 3S69A 3ATIA 2ODYB 1GGDC 3T28A 4Z6AH 2PP6A 3U8TH 1HFDA 2GMTC 3SU6A 3SUEA 3SYJA 4K1SA 1LHCH 1IQMA 1O2QA 1YLCA 1MTWA 1SGDE 1GHAG 1AB9C 1P09A 2FOCA 5KEDA 4XOJA 1C2FA 3FVFB 1NFWA 4YOIA 1V2OT 1JIMA 1FY4A 1ZHRA 2NU0E 3F9EA 3S9BA 2BOKA 3TGJE 4VGCC 3LC5A 1W7GH 5HMAA 1DANH 3KNXA 2TGDA 3RXCA 1E38B 2AHME 1O2ZA 1P04A 4CRGA 2VJ1A 4X0WU 1FXYA 1ELEE 3O8DA 2NU1E 4X6NA 1IQEA 2BY7X 1UTMA 1QIXB 3W1EA 1HAVB 2G55A 1V2NT 1H9IE 1TMBH 4Q63A 3NRLA 4D8NA 4FUHA 2HNTE 5CE1A 1ZJDA 2J95A 2SGEE 1A5GH 1CHOF 1DS2E 4ISOA 2GJGA 4DCDA 2WPMS 2CF8H 2C8YB 3UY9A 5F8XA 3OEED 1LVOA 1GJCB 4WWYA 1QQUA 2ZDVH 3SU2A 1VITH 3NKKA 3EAJA 2D1JA 1UTKA 5F6MA 1P02A 3SHCH 3FP8E 4GCHF 1O2IA 1UVUH 1A3BH 3MNXA 4DT4A 1ZLRA 3GY4A 1OP0A 4UE7H 1G3CA 3QGJA 3QN7A 4IN2A 3ITIA 2J97A 1QJ6B 1GDUA 1T8LA 5DJ7A 2F9PA 1HJAB 1KXDA 3F2HA 3QDZB 4XDEA 3STJA 1A3EH 4P00A 3SORA 3U9AH 3Q3KA 4BANB 3PTNA 3QZQA 1MCVA 2BD7A 3TK5A 3ZZBA 5F8ZA 2LELA 4A1XA 1NM6A 4A7IB 1SQOA 1PYTC 1TNGA 1WOFA 1W2KH 1HYLA 3BTME 3PYHA 4X2YA 4HGCA 4XBCA 3UR9A 1G3EA 2ZFQH 4HI3A 2BQWB 3FFGA 5DG6A 4B2CA 5FBIA 1LHEH 3S0NA 1SFIA 2AGGX 3SU1A 1FDPA 3ZYDA 1D6WA 2CXVA 4I8LA 1NRQH 4CBNA 3BTGE 2TIOA 1TBQH 3GDSA 1TX7A 4YTAA 3N7OA 1UHBA 1SGNE 1RIWC 3OE7D 4YESB 1QGFA 2QC2A 1RXPA 1LQDB 1GDQA 3OY6U 1C5UA 1G37A 1FJSA 1SPJA 3ZYEA 1O5GH 4X2XA 2FYQA 1EUFA 2P3TB 3BIVH 2J34A 1KXAA 3P70B 1XUIA 1QZ8A 3RM2H 5LPFA 3JZ2B 2ZZUH 2XNDD 1BTWA 5G4BA 3AVZA 2VGCC 5FX5A 2JJ1D 2ANMH 2QE7D 4Q2KA 1TBZH 1FIWA 4U32A 1SOTA 2XC0A 4NSVA 1SGCA 2PTNA 2CV3A 1TGCA 5KGOA 1TYNA 1OWKA 1NPMA 2WUCA 2VIWA 3ZVGA 1K1LA 3TGIE 1GHZA 3PMBB 1V2KT 5HM9A 2A2QH 1L4ZA 2BM2A 4ZKRU 1ETTH 1PPCE 1W14U 2GDEH 4YXWD 3F2FA 2V6NA 1C2JA 1B0EA 2JIZD 1LHFH 1F5KU 1P2IA 3M3VA 5EQRA 2L6OA 2H5DA 2PLXA 1GG6C 1KXFA 1V3XA 1UTQA 1XKAC 1GBKA 1AE8H 3QLPH 1COWD 1QR3E 5DP7A 2G5NA 2G81E 2QXJA 3RMOH 4NG9H 3LC3A 3VGCC 4YO9A 3A84A 5T3HA 1O2JA 1RTKA 4O97A 4ZKSU 2SGFE 2A0QB 2YOLA 1GI6A 3BTDE 1P2QA 1K1OA 5IDKA 1CBWB 1ZMLA 2J94A 3EQ0H 5FHTA 2KFWA 4X2VA 1GI5A 2BVXH 1LQEA 2V3OH 1QB9A 1IQGA 1GJ6A 2W3KA 4XRNA 1Y5UT 3D23A 3FKSD 3W95A 1S6LA 2VIVA 2OC8A 2RA3A 2JH6D 1QRWA 1UVSH 5A8YA 4MNXA 1WCZA 1ELDE 1V2JT 1KXCA 3SUGA 4BOHA 4OS7A 4BTUB 7KMEH 4A6LA 1ZMNA 4MVNA 1V2MT 3PO1B 2ZIQH 3RXRA 2LPRA 1MABB 1GCTC 1OXGA 1Z8JB 1KYNA 2OBQA 2RA0A 6GCHG 1L0ZA 4KTCA 1GBBA 1O30A 2ZC9H 5FX6A 3SU3A 1P57B 1NROH 4ACAA 4E7NA 1B7XB 5CHAB 2Q1JA 2WHXA 1Y5AT 5L2ZH 2WV4A 1C2LA 2KCPA 3K2UA 3S7HB 4X1NU 3MO3A 1J17T 2ZKSA 3OY5U 1GI3A 3SUFA 1ARBA 3SNCA 3E91A 2AEIH 1NN6A 5I25A 2XBXA 2P94A 1O38A 2VWMA 2A7JA 5C2ZA 2B5TB 2VH6A 2ZHEH 4O9VA 1H9LB 2VWLA 4X1QU 3M5MA 3QK1A 3CP7A 5GCHG 1O3CA 2BLQA 1Q3XA 3KCGH 1TPPA 2XWAA 5DPAA 1O3DA 1BIOA 1C5QA 1PPHE 4ZHMU 5GWZA 4O3UA 1SSXA 1E79D 4ZH8A 1TNIA 1KIGH 1QJ7B 2HOBA 1PPGE 2B0FA 5EPYA 4INHA 2J38A 2WPKS 2FX4A 2BD2A 3ENSB 5HKKD 1KTSB 1GMCG 3IWMA 1HNEE 3RXFA 1SQTA 2OC7A 1ELFA 4LZ4B 2Y5GA 2BY8X 2BQ6B 4LOYH 2HGTH 1VZQH 4Y8XA 2OQUA 1FY1A 4UEHH 2V35A 4UDWH 3LGUA 3HK3B 1F0TA 5EJLA 6CHAC 1EOLA 3M7QA 1EFRD 2XBYA 4X1RU 4HFPB 4DIIH 2PWXA 3D65E 3FAOA 1ZPBA 4ASUD 3S9AA 1EAUA 3E3TA 3MO6A 4RI0A 4ISLA 1Y5BT 3D49H 2QXHA 2ZU3A 1OWIA 1FN8A 3GCTG 1ELCA 1HAYB 3PLPA 5E2PA 1TONA 3ODDA 2KM0A 4TWYA 2FZZA 3RXJA 2BB4A 3SW2B 2FX6A 4OGXA 4DG4A 5E0JA 1UCYE 1QNJA 2BDCA 4AG1A 1NRNH 4F49A 4X8UH 2IN2A 2STBE 5C0TA 1Z8RA 2WZQA 1QRXA 3UOUA 3BTWE 3PMJA 1DFPA 4TPIZ 3QZRA 5FCRA 1V2QT 2J2UA 2R9PA 4JK5A 4UFFH 4Q80A 3AW1A 9LPRA 2ANYA 1JMOH 2Z7FE 3UWIA 1HAVA 4K2YA 1FY3A 1CA0C 1HAGE 2ZU5A 3UFAA 3UUZA 1VCQA 4JMYA 2ZA5A 5HIYA 4AX9H 3PM3A 2OTVA 4NZQA 3SNAA 2SGPE 1P9UA 1Y3UA 1QA0A 3PRDA 1IHSH 4I32A 4CR5A 5DP3A 1E1RD 3FO8D 1D3QB 1JBUH 3GCNA 2OINA 4R0IA 3E90B 3Q3XA 5DKMA 3ZZAA 1TQ0B 4F55A 4JYUH 3KHVA 2BHGA 2CHAC 1SGIB 1ZHMA 2Q6FA 2Y81A 4Y71A 1FQ3A 1IAUA 1MTNB 5LGOA 7LPRA 1MAXA 4D9QA 4YZUA 4DOQA 4A1TA 1GVZA 1KLJH 7ESTE 5FPYA 1O2HA 2BYAX 1ANCA 2V3MA 4E06H 2OD3B 1GHVH 2BDHA 2ODPA 3RC6A 1AUJA 3L33A 2QY0B 1FAXA 1XVMA 3CNRA 3RMMH 5JPMH 1BMLA 1BHXF 1S5SA 4Q7ZA 5EIYA 4M9FA 1BITA 1BCUH 8GCHG 3UIRA 3K9XB 1VJAU 4BXWA 4A5TS 1TOCB 3TIUA 2FTMA 3PWCA 2PHBA 1SGTA 1GBHA 1NFXA 1TABE 2O8MA 2ODQA 3RU4T 4AGKA 1BJUA 1GMDF 4AOQA 4IBLH 2BQ7B 4K3JA 2UUKB 3LH3A 1Q2WA 2NU2E 4PROA 4BAHB 2PR3A 1O2TA 3KQ5A 1CGHA 2QYIA 3ZZ9A 1KSNA 1MKXH 3AAVA 4WMDA 1MMJN 1C2GA 2IPQX 3EA7A 4MPUA 3BTTE 6LPRA 4CBOA 3ZZ3A 1XUGA 4AFSA 2C93B 1HJ9A 1C5MD 1VGCC 3M61U 4ABGA 2Z3DA 1CO7E 1P03A 3I78A 5L6NH 4IMZA 1N1LA 4YT6H 3NCLA 3ZVFA 1NESE 4ZMAH 3VB6A 4MPWA 1TFXA 2BDAA 2R0LA 2FLRH 3T2NA 5BRRE 2I6QA 5ETXA 4B76A 3H09A 3E1XB 4H42U 4I7YH 4TPYA 4Y7BA 4I8HA 4X2WA 3F0PA 1Y3WA 4JZEH 1O3EA 4I8JA 1BTPA 1P10A 3ZIAD 1IHTH 1ETSH 3T5FH 1TNKA 2D2DA 1GBJA 1VKYA 5EQQA 2ZQ1A 1Z6EA 2PTCE 1OKXA 3H7OA 4FUBA 4NGAH 4ZHAA 1WU1A 1NFYA 5AFZH 1C9TA 4Y11E 2EC9H 2EI8A 2UWLA 4Y0ZE 1P01A 2C8XB 2Z9KA 4NA9H 2BLVA 4FUFA 3UPEA 1EB2A 1QBOA 2Y80A 5EU8A 1P12E 2ALVA 4WVPE 2ZGBH 3BTFE 4AFUA 1AE5A 1S83A 4J2YB 5AFYH 2J98B 4NFFA 1C5WB 1EATA 1O2MA 2AH4X 3PB1E 4FUDA 4QT8C 1T7CA 1Z71A 1DWDH 1G3DA 1P05A 1WV7H 4K1TA 1DLKB 4IC5A 4RT1A 3KGPA 1Z1IA 1QCPA 2C3SA 5KECA 4OS6A 1G9IE 1OSSA 2Z6BD 2BOHB 2FOMB 1FX0B 5HYOA 4FETA 1BMNH 3OAAD 3BEIB 1YCPH 4WXVA 2C8ZB 2VH0A 1Z6JH 1GI4A 3PTBA 2YMSD 4TSFD 5EW2H 1HAZB 1GI9B 1O5FH 3MH7A 5C1XA 2F83A 3IG6B 1PPZA 3KYGA 4FOUC 3F9GA 5F8TA 1TRMA 3RU4D 2VIPA 1NBME 4OS4A 2FLBH 3RXEA 2GZ8A 2QF0A 5FXLA 1O2RA 2KZ4A 3SGBE 4CRFA 1S6HA 3PV5A 1TQ7B 1HJAC 3RC4A 3MH6A 3BTKE 1CHGA 1Y59T 3PMHB 1G2MA 3SU5A 1QFKH 2W5EA 3P92A 2PSYA 1MTUA 1C2MA 1GJDB 1JIRA 2HALA 1YGCH 3MOCA 1YM0A 2FYRA 1K1PA 2J5UA 4NIXA 5ESBA 2WYGA 2A2XH 3HK6B 1GPZA 2ZDMA 1WBGB 1EJMA 2ZFSA 1WDIA 4P02A 2AYWA 1HAPH 3P8OA 3FOAA 2QV1A 3SJOA 4Y10E 2EY4C 4CRCA 1NU7B 1C2KA 3TK6A 5HGGA 1LVMA 1ZJKA 1IQJA 2XBVA 3BTEE 3R3GB 2XOKD 1EP5A 1SHHB 1HXFH 3SZEA 2BDBA 4K8YA 1GL0E 1CA8B 1O3PB 1KXEA 3B23B 3P8FA 3V12A 4UD9H 3JZ1B 4FU7A 1VR1H 3ZV8A 3DFJA 2O8UA 4MQAA 3NZIA 3TLOA 3MYWA 1FPCH 5FAHA 4CRAA 1TLDA 1ZSKA 1V2ST 3SV9A 1PPFE 3WY8A 1MQ5A 1H8ED 1OX1A 1F5RA 4DW2U 2TGTA 2ZNKH 7GCHF 1WSSH 1GDNA 1O3GA 1QL9A 2EI6A 1G2LA 2ZQ2A 3RXGA 1WTGH 4FUGA 2QXIA 3MQKC 3DSOA 1HUTH 4OM9A 1JRTA 2P59A 3U8OH 3GS9A 1CSOE 1A7SA 1KDQB 4ZKOU 1P3EA 3VXFH 1K1IA 4BAMB 1QB1A 2OBOA 3G01A 1YPGH 3V13A 3DFLA 1V2PT 5TCAA 3RXDA 2PUQH 2PKAB 2BLWA 1L1GA 1K1JA 1L1JA 3FANA 4K5ZA 1O2WA 4I33A 2FOHA 1RRKA 1DXPA 3A80A 1EAWA 1MU8B 3LPRA 1THPB 1O2GH 1CBWC 5EODA 1O3OA 3VEQB 2AMQA 2FIRH 1O39A 4HZHA 1AWFH 2QF5A 2WPJS 4YT7H 4UFEH 1YLDA 2WINI 1AFEH 1GBMA 1KMHB 2R3UA 3FZZA 3ELAH 1YKTA 3E16B 4F4OC 1DUEA 1V2LT 3M5LA 3MU0A 3BSQA 3EDXB 2ZG0H 2BZ6H 1UTLM 3KQDA 2BX3A 4WXIA 5L30H 1AI8H 1UVOA 2QF4A 1NY22 1AKSB 3GYLB 1C2HA 5AHGH 3PO1C 1D9IA 1YWUA 1ESBA 2WYJA 1C5TA 1UCYH 3OSYA 2XCFA 1MUEB 1HDTH 2G4UA 2QAAA 1FI8A 2DE9A 3SU0A 1C5RA 1NZQH 3U1IB 2W3IA 3EE0B 4E05H 1C1MA 1K22H 2BVSH 2BD5A 1C5NH 3LGWA 3RXMA 5CHAC 1WYKA 7GCHG 2PKSB 2GVFA 3GISB 1PQ7A 4BAQB 2P3UB 4GUXA 1HCGA 4YOJA 1SLWB 2B7DH 1A5HA 1SKYE 3M36A 2RG3A 1V6DA 1GBAA 1N6XA 1GBIA 4TY6A 3N7EA 1EAIA 1DWBH 4U30A 3TPIZ 2THFB 5T1VA 2A7HA 2QCYA 3RXTA 2Y7ZA 1BMFD 4MNWA 1YPJH 2W7UA 3LDXH 1GI7B 1CGIE 4ZXXH 4ABEA 2ZPQA 4F48B 2JH5D 3GCHC 5LH8A 1C4Y2 1GJ8B 2A32A 4X1SU 3L6PA 1LHDH 1FY8E 1MU6B 1CHOG 2LP6A 1Y8TA 3MU1A 2XW9A 1BQYA 1SFQB 2R3YA 3A7TA 4ISHH 4OGYA 3F6UH 1BA8B 3RXBA 2K0QA 1W12U 2FO9A 1GGDB 4ABHA 4GCHG 5T6FA 4YLUA 1Z1JA 4MNYA 1ELGA 4U01A 1E36B 1O5AB 4K1EA 5I46H 4B71A 2BX4A 4I86A 4B2AA 4WJG2 4CRBA 1O2XA 1P11E 2A4GA 1ELBA 3QO6A 1O3MA 2VINA 4BNRA 2PFEA 2ZHWH 4FU9A 2TPIZ 3K6ZA 3MNSA 3SNBA 1BHXB 1LPZB 1UVPA 1XX9A 2I6SA 4K69A 2PGQB 1LKAA 1SBWA 3SZNA 2Z3EA 5JBAS 2F91A 5E0HA 3RDZA 2OUAA 2BY6X 3BIUH 2OC0A 2BZAA 1HGTH 2XC5A 2A5KA 1ELVA 5F53A 1C2IA 2J98A 2W26A 2OC1A 5EOKA 3GICB 4I31A 2C8WB 3TGKE 1BTZA 4D7GA 3Q76A 4NZLA 2ZU1A 1O2PA 3TJVA 3SO3A 1LVYA 1GL1A 3RXIA 2GCTC 1IOEA 1HXEH 2CK3D 2F9OA 1F5LA 2UWPA 1VITF 1GHXH 1AIXH 2UUFB 3FP7E 3SV8A 1LPGB 4B74A 3RMLH 2GV6A 2CGAA 1HAXB 3PROA 4I8GA 1XXDA 1QL7A 1OP8A 2GV7A 2H2ZA 2QF3A 2ZGCA 1FIZA 1FNIA 1DLEA 3ZVBA 3TNTA 1SB1H 1U6QA 1O0DH 4ZCNA 4AGJA 3LOXA 1F7ZA 1P2NA 4NWKA 3PWBA 3SV7A 3BN9A 2D8WA 2K8IA 1ZRBA 1E1QD 5ABWA 2AMDA 2K1QA 1QA7A 4E7RG 1D3PB 3A7WA 2QA9E 1GJBB 3W94A 2Y6TA 1GMHF 1AZ8A 2ZU2A 1MTNC 1FZZA 3O8BA 5JBBS 5EGMA 3CENA 1S6FA 1J15A 4Z1MD 2A1DB 4JZDH 1KY9A 1O2OA 1RTFB 4GHQA 4WY3A 3P8GA 1FPHH 1XXFA 1L2EA 1MD7A 3H7TA 5DO4H 2M5TA 3T25A 2GCHF 1UK3A 3E0NB 4YM9A 2L74A 2H5CA 2YMSB 1ANDA 3QTOH 3TH2H 5C67A 2ZTZA 3RXOA 3E8LA 3RXLA 1EJAA 3VG8A 2RDLA 1FLEE 2R0KA 2AIQA 4CHAB 5C1UA 1O2LA 2WPDD 4LZ1H 1RS0A 1AVGH 3VXEH 2P95A 4HG6A 1GJ7B 1K1NA 2GT8A 1TAWA 4XSKU 2Y5FA 1AO5A 1Y3VA 1BJVA 4X8VH 1OWJA 3N7DA 2EI7A 1NFUA 2HVYB 4WH6A 2FOGA 1ZPZA 1VITG 1EPTB 2VWOA 2OQ5A 1VCWA 1V2VT 1DITH 5DN6D 4FVDA 3A88A 1XUKA 4FUCA 1O2SA 3KL6A 1C5SA 2CF9H 1EZSC 1MKWH 5EXMA 1MZAA 1MKXK 1FV9A 4B1TA 4RT0A 1O34A 4U2WA 1O5CB 1J9CH 4B75A 5FL7D 2A31A 3RC5A 3NUMA 3SNEA 1OYTH 3UNRA 1S81A 1A0LA 2P8OB 1C1VH 2OCVB 2XNIA 3T29A 1C1PA 3PV2A 3HGNA 1HLTH 2QN5T 1IQIA 3SGQE 5DP6A 1XKBC 1TMTH 1A0JA 2VB0A 3RP2A 3VGCB 5C0UA 1KDQA 2ALPA 2BD3A 1ABIH 1N8OB 4MTBA 3V7TA 1NRRH 1GBFA 4MDSA 1Y3XA 1A5IA 4Q7YA 3OYPA 5EPNA 5B6LA 3AK5A 2GCHG 1HPGA 1HAHH 2H9EH 2PKAA 3Q77A 2ZWLH 3EE7A 4MNVA 4ABJA 1FN6A 5C1YA 2G52A 1EOJA 2IJOB 4XE4A 1H8HD 2ZGHA 1PPBH 3I29A 1WUNH 2ZFRH 4O03A 1FUJA 2NWNA 2J4IA 1BRBE 2A7CA 2GGVB 1S0QA 3RXUA 1GHBF 4X8TH 3SV2H 1UTPA 3O8CA 2F3CE 2CJIA 3LGYA 1CVWH 2PV9B 1SQAA 3EA9A 5JB9S 3T27A 3BG8A 3ZVEA 2ZFTA 1W7XH 1SGFG 1AFQB 1OWEA 4MG3A 2OP9A 1F0SA 1GBTA 3A87A 1V2UT 4IN1A 3QTVH 4OS1A 3A8CA 1AKSA 3A7YA 4ABAA 1SGFA 3RXVA 2W6ID 2ZCKP 2G4TA 3P17H 4ZROA 5K0HA 1UTOA 4JZ1A 2EEKA 4KTUA 2O8TA 2KAIB 5E0GA 3FP6E 4KKDA 3SJKA 4NSYA 1MQ6A 3WWFA 1L1NA 4DIHH 3LGVA 1PQAA 2GTBA 1YCPK 4YOGA 1LPKB 3M5OA 1YCPM 2FS9A 2XRCA 1EP6A 1AWHB 1UTJA 4NIWA 2ZP0H 3B9FH 2FI5E 1P9SA 1BDAA 4ISNA 1K1MA 2C90B 1BBRH 4JZIA 3ZZ8A 2WPHS 1WTHD 2HPPH 4WMEA 4D9RA 9ESTA 1KTTB 3VB3A 3QWCH 2Q6DA 1K2I1 3WW7A 2ZDLA 1C1QA 2A4RA 1EJNA 4O3TA 5C5OA 1TNLA 5BPEA 2BDIA 2FI3E 1X7AC 4KTSA 1ZTKA 4ZHLU 1IQKA 1FY5A 3A85A 1SR5C 5C94A 5EJ1A 1BMAA 1C5YB 2G51A 2BTCE 5GNDA 3DD2H 1BTYA 1TMUH 5AF9H 1GBLA 4X8SH 2VU8E 3MO9A 2H9HA 1G3BA 2TBSA 1O3BA 2FTLE 2WUBA 4Q7XA 1EQ9A 1PFXC 2Z9JA 2ZHQH 4TT3D 1AVWA 1DICA 5H4IB 1E35B 1AMHA 2Z94A 1TGSZ 4TYDA 2AMPA 3BG4B 5GPIB 1P8VC 2IJD1 1QTFA 2EQNA 5EXLA 1W0ZU 4SGBE 3KEEA 2QXGA 1ZSLA 2ZECA 4B2BA 3P8NA 1ANBA 1MBMA 3UNQA 1ZMJA 1MCTA 1LKBA 4FXGH 1EZQA 1O2KA 3LGIA 1DXWA 1GMDG 2B8OH 4JYTA 5EQSA 3PLKA 2V7QD 3C1KA 8KME2 2Y82A 1F2SE 2ZGXH 2ULLA 5A8ZA 1CA0B 1THSH 4AYVB 1A61H 8LPRA 3QX5H 3RMNH 4DT7B 1M9UA 3NPSA 3F68H 3SV6A 1CU1A 4RKOB 2SGAA 3NK8A 2DE8A 1WAYB 3UAIC 1TNJA 1GBEA 1SVPA 1WQVH 3TH3H 1O3AA 1DOJA 3SI4H 2AFQB 3ZZ4A 3Q3YA 3EYDA 1TALA 2STAE 1THRH 3RM0H 1GBDA 1ZR0A 2W7SA 3RXPA 2FOBA 2YNBA 1AD8H 1T32A 2JETB 1Y3YA 1DWCH 2ZFPH 3ZZ5A 1GI0A 1Q31A 1EX3A 5CMXH 3SQEE 1ZOMA 3RLWH 5J4QA 2BY9X 1WQSA 1O3IA 3OX7U 1HB0B 1YC0A 4NCYA 5C3NA 4Y7AA 1YPHC 1W0YH 2F9VA 1O3FA 1DVAH 1EB1H 2HNTF 1HJ8A 5GJ4B 1O32A 3N99A 2PKSC 1C5LH 2AIPA 2HPQH 4YLQH 1LDTT 1DSUA 1P3CA 1SC8U 3B8JA 3ZVDA 5GXPA 3UQVA 1XMNB 3ATWA 1SHYA 5GIBA 1PPEE 3F1SB 1O37A 3LGTA 4JZFH 1RD3B 4TY7A 2UWOA 1KLIH 1H1BA 3LT3A 1UCYK 4CH8B 1O5EH 2Y7XA 3F0OA 3ATLA 4ACBA 2F9BH 3URCA 4LK4A 4A92A 5FCKA 2A5IA 3LH1A 1YF4A 1K9OE 3RXAA 3U8RH 3GOVB 3HKJB 2HLCA 2FOAA 2SNVA 3DSPA 3FZDA 4KGAA 4Y6DA 3TJOA 1ACBE 3NXPA 1MH0A 1SGQE 2R2MB 1NS3A 3A86A 1A0HB 1EPTA 2IPHA 2FDAA 3TJNA 2RCEA 3KN2A 5CDFE 3OU0A 5C17A 4DVAU 1C1TA 1SMFE 3TU7H 4FUIA 2PW8H 3A89A 1SLUB 1P06A 3ZVAA 1O3LA 2BD8A 1T4VH 1KLTA 1TGTA 3SN8A 1UO6A 1EZUC 3LJOA 4IC6A 1TGNA 1QY6A 1K28D 1TX8A 3D62A 3MMGA 3DUXH 4MLFB 4GPGA 1EAXA 3T62A 5DP4A 1OP2A 3ZVCA 4D7FA 1T8MA 3F9FA 5IYTA 1O3NA 1TPAE 1C5PA 2HLDD 1YPMH 2GP9B 3KQBA 1ZHPA 2GZ7A 3LONA 4Q4LA 2WPIS 1O31A 5C5NA 2TGAA 1RGQA 3U69H 1RFNA 3OTPA 5DSFA 2PGBB 1O5DH 3O8RA 3VB7A 1O3JA 3T26A 1Z8IB 1BBRE 1S85A 2AGEX 1VJ9U 3F9HA 4WF8A 1S82A 2ZTXA 4INKA 3DHKH 2ZGJA 2KCOA 3M3SA 5A2MH 1H8IH 2GKVE 1NRSH 2FWWA 1GHYH 1AU8A 5SGAE 2FOEA 1BTUA 2C4FH 3GDVA 1BT7A 4DY7B 1FONA 1BB0B 1D6RA 1OWDA 4XFQA 4GVUA 3F2GA 3GY7A 1QBNA 3ZZ6A 3OFND 2O8WA 1AQ7A 2ZF0H 3RXHA 1ZSJA 2HVXA 1TBRH 5CHBA 3BTHE 3UWJH 5A09A 2YNAA 3PLBA 2XBWA 2BLOA 1LMWB 1AN1E 1NT1A 1C1WH 1LTOA 3UQOA 1DT2A 2FPZA 2Y5HA 2BVRH 2SFAA 3M3TA 4JK6A 4AFQA 3UB0A 2VNTA 4X1PU 1YPEH 4NA8A 4DGJA 5PTPA 3SOSA 2KAIA 5DK1A 3NWUA 5TJXA 1ZZZA 1GHWH 1NC6A 1TWXB 1T4UH 1O33A 4KP0A 4ABDA 3E0PB 1GJ5H 1HAIH 1J16A 2ZPRA 4B73A 1HIAB 4GLYA 2ZTYA 2ZU4A 5E2OA 2QIQA 4CH2B 4KELA 3A8AA 4LXBH 3MU4A 2YMSC 1V2WT 1GJ9B 2XC4A 2Z9GA 4IW4E 1YPKH 3A81A 2DUCA 2VBCA 3ESTA 4CHAC 1B5GH 2ZHDA 4GAWA 1Z8GA 1K21H 1MBQA 1TIOA 1TB6H 1DSTA 2XYAA 4GSOA 3BEUA 2GMTB 3A8BA 4UFGH 4D76A 3SNDA 1UK4A 1FAKH 2G5VA 4NIYA 3ZZ7A 2M2AA 1ZTJA 2SGDE 4K60A 2BD9A 4DURA 1P2MA 2NU3E 1EPTC 1ZGVA 1GJ4H 3TNSA 4SGAE 6GCHF 1AB9B 2GT7A 1QURH 2ZPSA 1AVXA 1UMAH 1NRPH 4Y0YE 1W10U 4XBBA 1CT0E 2FXRA 2W6JD 4NA7A 1TX6A 1MZDA 3KQCA 4VGCB 1C9PA 4JCNA 1C5OH 1GVLA 4WH8A 1P2KA 5A0CA 2XTTB 1CT2E 5A8XA 3SGAE 3WWBA 3UTUH 3FN8A 1TE0A 2P8OC 3CS0A 3MNCA 1XVOA 4UFDH 5K7RA 2ZEBA 4AFZA 1HBTH 5GCHF 4FVBA 4AN7A 1UK2A 5IK2D 2HNTC 1C1NA 1GI8B 1HRTH 4ZUHA 4ABBA 4X6MA 1N8OC 3EGKH 1MKWK 3GY6A 1EKBB 4HTCH 1Z7KA 3MH5A 5LPEA 3M7TA 2V0BA 1WXRA 3A82A 1ELAA 1DDJA 1GMCF 1TA6A 1O2NA 4OS2A 1FMGA 3SJ9A 2ZO3H 2CMYA 4Y8YA 2ZCHP 2ANWA 3KYFA 1ID5H 4Y76A 1V2RT 4THNH 4CREA 3ZZDA 1O36A 2VIDA 1DY9A 2BD4A 4K8BA 2KCYA 1GWAA 1BMMH 2A4QA 1ZRKA 2NU4E 1AGJA 3VB5A 2O9QA 3U98H 4I8KA 1AFQC 1GCDA 2F43B 4BAKB 1BRAA 1YYY1 1CGJE 1OYQA 1YLNA 3QUMP 1RTLA 2G8TA 2ZFFH 3P95A 3UNSA 1YY3A 3E6PH 1CQQA 3GCTF 4ASHA 4TWWA 2D26C 3A8DA 1G30B 4JYVH 2BXTH 2Z9LA 1B0FA 1C2DA 1NTPA 1GVKB 1QRZA 3HGPA 4Y79A 4ZAEA 1C4V2 2ZDNA 1ZTLA 1N6YA 1RIWB 1DX5M 3TITA 3M7UA 1MAYA 4ISIH 4B6EA 1UTNA 2KCAA 1D3TB 4RN6A
chains in the Genus database with same CATH topology
1PQ5A 1AY6H 1OWHA 2WV5A 5DP8A 2VVUA 2Q6GA 2GD4B 1A4WH 3DT0H 2FS8A 3DA9B 3A7VA 3BEFB 3GCHB 1L4DA 4H4FA 4ESTE 2ZHFH 1A1RA 3TK9A 5T6DA 3UOPA 4ABFA 1QB6A 2OXSA 2VGCB 5AVDA 4BAOB 4GHTA 3ZV9A 4NWLA 3STIA 2ZI2H 3URDA 1SGRE 2P3FH 3RXKA 2XWBI 1O5BB 1C1SA 2A4OA 2FEQH 5ESTE 1O3HA 1SLVB 5L2YH 1TPSA 1BBRK 4IS5A 1BTHH 2P16A 4FU8A 1SL3A 1TGBA 2ZDKA 5HXFA 2WPLS 3HPTB 1GMHG 1W3CA 1GI1A 1C1UH 1H8DH 5FPSA 1YBWA 8GCHF 5FBEA 1GG6B 2SGQE 3SU4A 2XCNA 2VIOA 1SG8B 2VWNA 1T31A 4XBDA 1SOZA 1TOMH 3MU8A 3BG4C 3MFJA 1INCA 2EA3A 1TPOA 1VCPA 1BOQA 2H9TH 1XM1A 2ESTE 3HATH 5JDUB 1ETRH 1EZXC 1AUTC 2JKHA 1QHRB 2VVCA 5F03A 1EXFA 3MI4A 2BXUH 1GBCA 1QQ4A 2XXLA 1O2UA 3MWIU 1C1RA 1ZGIA 4RKJB 5TCCA 1OPHB 1ZYOA 1LCYA 2GCTB 1O35A 1ESTA 2BDGA 1RJXB 2QGRA 4FUEA 2BMGB 5EXNA 1QL8A 1LO6A 2ASUB 1CE5A 2UUYA 1G32B 1SGEE 3BV9B 4RSPA 4WMFA 3SUDA 3TVJB 1XUFA 3BF6H 2F9NA 3LJJA 3ZZCA 3UREA 5DP9A 4AB8A 4Z0KA 1GI2A 3RXSA 2G00A 1GCTB 4MPVA 4R8TB 4X6PA 1UVTH 2J92A 3M5NA 2Z3CA 2TRMA 3M37A 1LVBA 5GDSH 3MNBA 2JETC 4BXSA 3PV4A 5A0AE 2FI4E 1S84A 2Z9IA 4AORA 1F92A 2O8LA 3GY2A 2FP7B 4BTTB 1T8NA 1BTXA 3SJ8A 1YPHE 1DY8A 3MHWU 2AGIX 1ORFA 5FPTA 1TRYA 2PSXA 1JRSA 1C5VA 5HM2A 3RLYH 2AERH 3PMAB 5JYIA 2UUJB 3QGNB 2BDYA 3U1JB 3EA8A 5E8EH 1IQNA 2HWLB 1BZXE 1P2JA 4NIVA 2AS9A 3SQHE 1UHBB 1OS8A 1PJPA 5JBTA 1QJ1B 3H5CB 3AAUA 3GY8A 4CR9A 1JWTA 1XUHA 2FESH 1HIAA 5JB8S 3K65B 4A1VA 1SGYE 4X6OA 1W8BH 3P6ZB 3SBKA 1H4WA 3TJUA 2FMJA 1ANEA 1A2CH 4INLA 8ESTE 5A0BA 2JH0D 4CRDA 2ILNA 1P0SH 1GJAB 3GY3A 4H6TA 1F0RA 1ARCA 1C1OA 1J8AA 2R2WU 3A7XA 1P2OA 3K6YA 1QBVH 1T8OA 1MTVA 6CHAB 1BRUP 1GHBG 3V3MA 1S0RA 2HRVA 2OLGA 3CS7A 2FOFA 3C27B 1MTSA 4NFEA 2PUXB 3VB4A 1O2VA 2ANKH 3ATKA 2F9UA 5EW1H 4J1YA 3AASA 2V3HH 1E34B 3GCOA 1ESAA 3MU5A 1ABJH 2GZ9A 5J4SA 1W13U 2GX4A 3S9CA 4AG2A 1DWEH 3LU9B 1JOUB 2CN0H 2J9NA 4OS5A 3GYMA 1O3KA 3Q00A 1IQLA 2H6MA 1D4PB 2SNWA 4UONA 1CT4E 1HAOH 2IOTA 3GDUA 1ZPCA 1H9HE 1ELTA 3R0FA 1YP9A 1PYTD 3VPKA 4M7GA 4AB9A 1DE7H 1OOKB 3SJIA 1AHTH 1E37B 3GY5A 3IITA 5LPRA 1A46H 4IMQA 4AYYB 1C5ZB 1F0UA 2FM2A 2H1UA 2ZCLP 3TH4H 4MPXA 1PQ8A 1TRNA 1KXBA 3RUOA 2VVVA 1YPLH 3HKIB 2B9LA 3LKWA 1C5XB 1DPOA 1J14A 4H6SB 1SLXB 4BTIB 1O2YA 1TNHA 3BTQE 2TGPZ 2CHAB 5DGJA 3KQEA 2P93A 1GHAF 1HV7A 2LNCA 3LIWA 3ODFA 2A45B 5EG4A 1SGPE 4Y8ZA 1NO9H 4IGDA 1D3DB 4ZXYH 1C2EA 1BRCE 1UJ1A 1EASA 1AZZA 2GDDA 1W11U 3UR6A 5B6OA 1IQHA 3MH4A 1TA2A 4ABIA 2BY5X 1E0FD 3L3TA 1BUIA 1C4U2 1MD8A 6ESTA 1SI5H 3RXQA 3KIDU 3V0XA 3A7ZA 1G36A 3SHAH 5T6GA 3KF2A 3S7KB 5C20A 5DP5A 2VIQA 3A83A 3VFEA 2A5AA 4FUJA 1IQFA 3I77A 1VGCB 5JBCS 3M35A 1XUJA 4ZKNU 2FODA 3RU4E 3ATMA 3OTJE 1DM4B 1DUAA 1JXPA 3SI3H 1LHGH 4DJZB 1V2TT 1NU9A 4AZ2B 3AW0A 3MTYA 2ZDAH 3S69A 3ATIA 2ODYB 1GGDC 3T28A 4Z6AH 3U8TH 1HFDA 2GMTC 3SU6A 3SUEA 4K1SA 1LHCH 1IQMA 1O2QA 1YLCA 1MTWA 1SGDE 1GHAG 1AB9C 1P09A 2FOCA 4XOJA 1C2FA 3FVFB 1NFWA 4YOIA 1V2OT 1JIMA 1FY4A 1ZHRA 2NU0E 3F9EA 3S9BA 2BOKA 3TGJE 4VGCC 3LC5A 1W7GH 5HMAA 1DANH 3KNXA 2TGDA 3RXCA 1E38B 1O2ZA 1P04A 4CRGA 2VJ1A 4X0WU 1FXYA 1ELEE 3O8DA 2NU1E 4X6NA 1IQEA 2BY7X 1UTMA 1QIXB 1HAVB 2G55A 1V2NT 1H9IE 1TMBH 4D8NA 4FUHA 2HNTE 5CE1A 1ZJDA 2J95A 2SGEE 1A5GH 1CHOF 1DS2E 4ISOA 4DCDA 2WPMS 2CF8H 2C8YB 3UY9A 5F8XA 1LVOA 1GJCB 4WWYA 1QQUA 2ZDVH 3SU2A 1VITH 3NKKA 3EAJA 2D1JA 1UTKA 5F6MA 1P02A 3SHCH 3FP8E 4GCHF 1O2IA 1UVUH 1A3BH 3MNXA 1ZLRA 3GY4A 1OP0A 4UE7H 1G3CA 3QGJA 3QN7A 4IN2A 3ITIA 1QJ6B 1GDUA 1T8LA 5DJ7A 2F9PA 1HJAB 1KXDA 3QDZB 3STJA 4XDEA 1A3EH 3SORA 3U9AH 3Q3KA 4BANB 3PTNA 3QZQA 1MCVA 2BD7A 3TK5A 3ZZBA 5F8ZA 4A1XA 1NM6A 4A7IB 1SQOA 1PYTC 1TNGA 1WOFA 1W2KH 1HYLA 3BTME 3PYHA 4X2YA 4HGCA 4XBCA 3UR9A 1G3EA 2ZFQH 4HI3A 2BQWB 3FFGA 5DG6A 4B2CA 5FBIA 1LHEH 3S0NA 1SFIA 2AGGX 3SU1A 1FDPA 3ZYDA 1D6WA 2CXVA 4I8LA 1NRQH 4CBNA 3BTGE 2TIOA 1TBQH 3GDSA 1TX7A 4YTAA 3N7OA 1UHBA 1SGNE 1RIWC 4YESB 1QGFA 2QC2A 1RXPA 1LQDB 1GDQA 3OY6U 1C5UA 1G37A 1FJSA 1SPJA 3ZYEA 1O5GH 4X2XA 2FYQA 1EUFA 2P3TB 3BIVH 2J34A 1KXAA 3P70B 1XUIA 3RM2H 5LPFA 3JZ2B 2ZZUH 1BTWA 5G4BA 3AVZA 2VGCC 5FX5A 2ANMH 4Q2KA 1TBZH 1FIWA 4U32A 1SOTA 2XC0A 4NSVA 1SGCA 2PTNA 2CV3A 1TGCA 1TYNA 1OWKA 1NPMA 2WUCA 2VIWA 3ZVGA 1K1LA 3TGIE 1GHZA 3PMBB 1V2KT 5HM9A 2A2QH 1L4ZA 2BM2A 4ZKRU 1ETTH 1PPCE 1W14U 2GDEH 2V6NA 1C2JA 1B0EA 1LHFH 1F5KU 1P2IA 3M3VA 5EQRA 2H5DA 2PLXA 1GG6C 1KXFA 1V3XA 1UTQA 1XKAC 1GBKA 1AE8H 3QLPH 1QR3E 5DP7A 2G5NA 2G81E 2QXJA 3RMOH 4NG9H 3LC3A 3VGCC 4YO9A 3A84A 5T3HA 1O2JA 1RTKA 4O97A 4ZKSU 2SGFE 2A0QB 2YOLA 1GI6A 3BTDE 1P2QA 1K1OA 5IDKA 1CBWB 1ZMLA 2J94A 3EQ0H 5FHTA 4X2VA 1GI5A 2BVXH 1LQEA 2V3OH 1QB9A 1IQGA 1GJ6A 2W3KA 1Y5UT 3D23A 3W95A 2VIVA 2OC8A 2RA3A 2JH6D 1QRWA 1UVSH 5A8YA 4MNXA 1WCZA 1ELDE 1V2JT 1KXCA 3SUGA 4BOHA 4OS7A 4BTUB 7KMEH 4A6LA 1ZMNA 4MVNA 1V2MT 3PO1B 2ZIQH 3RXRA 2LPRA 1GCTC 1OXGA 1Z8JB 1KYNA 2OBQA 2RA0A 6GCHG 1L0ZA 4KTCA 1GBBA 1O30A 2ZC9H 5FX6A 3SU3A 1P57B 1NROH 4E7NA 1B7XB 5CHAB 2Q1JA 1Y5AT 5L2ZH 2WV4A 1C2LA 3K2UA 3S7HB 4X1NU 3MO3A 1J17T 2ZKSA 3OY5U 1GI3A 3SUFA 1ARBA 3SNCA 3E91A 2AEIH 1NN6A 5I25A 2XBXA 2P94A 1O38A 2VWMA 2A7JA 5C2ZA 2B5TB 2VH6A 2ZHEH 4O9VA 1H9LB 2VWLA 4X1QU 3M5MA 3QK1A 3CP7A 5GCHG 1O3CA 2BLQA 1Q3XA 3KCGH 1TPPA 2XWAA 5DPAA 1O3DA 1BIOA 1C5QA 1PPHE 4ZHMU 5GWZA 4O3UA 1SSXA 4ZH8A 1TNIA 1KIGH 1QJ7B 2HOBA 1PPGE 2B0FA 5EPYA 4INHA 2J38A 2WPKS 2FX4A 2BD2A 3ENSB 1KTSB 1GMCG 3IWMA 1HNEE 3RXFA 1SQTA 2OC7A 1ELFA 4LZ4B 2Y5GA 2BY8X 2BQ6B 4LOYH 2HGTH 1VZQH 4Y8XA 2OQUA 1FY1A 4UEHH 2V35A 4UDWH 3LGUA 3HK3B 1F0TA 6CHAC 1EOLA 3M7QA 2XBYA 4X1RU 4HFPB 4DIIH 2PWXA 3D65E 3FAOA 1ZPBA 3S9AA 1EAUA 3E3TA 3MO6A 4ISLA 1Y5BT 3D49H 2QXHA 2ZU3A 1OWIA 1FN8A 3GCTG 1ELCA 1HAYB 3PLPA 5E2PA 1TONA 3ODDA 3RXJA 4TWYA 2FZZA 3SW2B 2BB4A 2FX6A 4OGXA 4DG4A 5E0JA 1UCYE 1QNJA 2BDCA 4AG1A 1NRNH 4F49A 4X8UH 2IN2A 2STBE 1Z8RA 1QRXA 3UOUA 3BTWE 3PMJA 1DFPA 4TPIZ 3QZRA 5FCRA 1V2QT 2J2UA 2R9PA 4JK5A 4UFFH 4Q80A 3AW1A 9LPRA 2ANYA 1JMOH 2Z7FE 3UWIA 1HAVA 4K2YA 1FY3A 1CA0C 1HAGE 2ZU5A 3UFAA 3UUZA 1VCQA 4JMYA 2ZA5A 4AX9H 3PM3A 2OTVA 4NZQA 3SNAA 2SGPE 1P9UA 1Y3UA 1QA0A 1IHSH 4I32A 4CR5A 5DP3A 1D3QB 1JBUH 3GCNA 2OINA 4R0IA 3E90B 3Q3XA 5DKMA 3ZZAA 1TQ0B 4JYUH 3KHVA 2BHGA 2CHAC 1SGIB 1ZHMA 2Q6FA 2Y81A 4Y71A 1FQ3A 1IAUA 1MTNB 5LGOA 7LPRA 1MAXA 4D9QA 4YZUA 4DOQA 4A1TA 1GVZA 1KLJH 7ESTE 5FPYA 1O2HA 2BYAX 1ANCA 4E06H 2OD3B 1GHVH 2BDHA 2ODPA 3RC6A 1AUJA 3L33A 2QY0B 1FAXA 1XVMA 3RMMH 5JPMH 1BMLA 1BHXF 1S5SA 4Q7ZA 1BITA 1BCUH 8GCHG 3UIRA 3K9XB 1VJAU 4BXWA 4A5TS 1TOCB 3TIUA 2FTMA 3PWCA 2PHBA 1SGTA 2ODQA 1GBHA 1NFXA 1TABE 2O8MA 3RU4T 4AGKA 1BJUA 1GMDF 4AOQA 4IBLH 2BQ7B 4K3JA 2UUKB 3LH3A 1Q2WA 2NU2E 4PROA 4BAHB 2PR3A 1O2TA 1CGHA 2QYIA 3ZZ9A 1KSNA 1MKXH 3AAVA 4WMDA 1MMJN 1C2GA 3EA7A 4MPUA 3BTTE 6LPRA 4CBOA 3ZZ3A 1XUGA 4AFSA 2C93B 1HJ9A 1C5MD 1VGCC 3M61U 4ABGA 2Z3DA 1CO7E 1P03A 3I78A 5L6NH 4IMZA 1N1LA 4YT6H 3NCLA 3ZVFA 1NESE 4ZMAH 3VB6A 4MPWA 1TFXA 2BDAA 2R0LA 2FLRH 3T2NA 5BRRE 2I6QA 5ETXA 4B76A 3E1XB 4H42U 4I7YH 4TPYA 4Y7BA 4I8HA 4X2WA 1Y3WA 4JZEH 1O3EA 4I8JA 1BTPA 1P10A 1IHTH 1ETSH 3T5FH 1TNKA 2D2DA 1GBJA 5EQQA 2ZQ1A 1Z6EA 2PTCE 1OKXA 3H7OA 4FUBA 4NGAH 4ZHAA 1WU1A 1NFYA 5AFZH 1C9TA 4Y11E 2EC9H 2EI8A 2UWLA 4Y0ZE 1P01A 2C8XB 2Z9KA 4NA9H 2BLVA 4FUFA 3UPEA 1EB2A 1QBOA 2Y80A 5EU8A 1P12E 2ALVA 4WVPE 2ZGBH 3BTFE 4AFUA 1AE5A 1S83A 4J2YB 5AFYH 4NFFA 1C5WB 1EATA 1O2MA 2AH4X 3PB1E 4FUDA 4QT8C 1T7CA 1Z71A 1DWDH 1G3DA 1P05A 1WV7H 4K1TA 1DLKB 4IC5A 3KGPA 1Z1IA 1QCPA 2C3SA 4OS6A 1G9IE 1OSSA 2Z6BD 2BOHB 2FOMB 5HYOA 1BMNH 3BEIB 1YCPH 4WXVA 2C8ZB 2VH0A 1Z6JH 1GI4A 3PTBA 5EW2H 1HAZB 1GI9B 1O5FH 3MH7A 5C1XA 2F83A 3IG6B 1PPZA 3F9GA 5F8TA 1TRMA 3RU4D 2VIPA 4OS4A 2FLBH 3RXEA 2GZ8A 2QF0A 5FXLA 1O2RA 3SGBE 4CRFA 1S6HA 1TQ7B 1HJAC 3RC4A 3MH6A 3BTKE 1CHGA 1Y59T 3PMHB 1G2MA 3SU5A 1QFKH 2W5EA 3P92A 2PSYA 1MTUA 1C2MA 1GJDB 1JIRA 2HALA 1YGCH 3MOCA 1YM0A 2FYRA 1K1PA 4NIXA 5ESBA 2WYGA 2A2XH 3HK6B 1GPZA 2ZDMA 1WBGB 1EJMA 2ZFSA 2AYWA 1HAPH 3P8OA 2QV1A 3SJOA 4Y10E 4CRCA 1NU7B 1C2KA 3TK6A