2B9LA

Crystal structure of prophenoloxidase activating factor-ii from the beetle holotrichia diomphalia
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
394
structure length
372
Chain Sequence
GHMAVVNIFGNASEYIPPGYEAPLGALTALPRCGTGADQGKKVCIVYHRCDGVTNTVTPEEVINTTGEGIFDIRENANECESYLDVCCGLPPVVPVLKPSFCGIRNERGLDFKITGQTNEAEYGEFPWMVAVLKANEEQLVCGGSLIAPSVVLTGAHCVNSYQSNLDAIKIRAGEWDTLTEKERLPYQERKIRQVIIHSNFNPKTVVNDVALLLLDRPLVQADNIGTICLPQQSQIFDSTECFASGWGKKEFGSRHRYSNILKKIQLPTVDRDKCQADLRNTRLGLKFVLDQTFVCAGGEQGKDTCTGDGGSPLFCPDPRNPSRYMQMGIVAWGIGCGDENVPGVYANVAHFRNWIDQEMQAKGLSTTPYVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/protein binding
molecule keywords prophenoloxidase activating factor
publication title Crystal structure of a clip-domain serine protease and functional roles of the clip domains.
pubmed doi rcsb
source organism Holotrichia diomphalia
total genus 88
structure length 372
sequence length 394
ec nomenclature
pdb deposition date 2005-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF18322 CLIP_1 Serine protease Clip domain PPAF-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2b9lA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2b9lA01
2ZCHP 2AMDA 1P2MA 1EAUA 2JETC 3P95A 3P92A 3LGYA 4R8TB 2OBOA 3GDSA 2SGQE 2GZ9A 3NCLA 1TWXB 1O2PA 1CBWB 3MNCA 2O8WA 1NFXA 5JBCS 2GVFA 1DE7H 1PYTC 1V2MT 1KXEA 1J14A 1U6QA 1GMHF 1DSUA 1MCVA 4NA7A 1LHFH 2O8UA 3PO1C 5GJ4B 4ABDA 5AHGH 3IITA 1Z8GA 5DP4A 1EAXA 1GHXH 1TFXA 4DOQA 1ZLRA 4K1EA 1FY1A 1GCTC 3EDXB 3Q3YA 2AFQB 3H7OA 4LOYH 1AGJA 5FHTA 1XMNB 2PW8H 1FJSA 4Z0KA 3QZRA 3HKJB 5E8EH 1OS8A 2RA3A 2VWMA 3LC3A 3U9AH 1DXWA 3CENA 4XBDA 1E38B 3GISB 1VITG 2XW9A 3BIVH 1WV7H 2TGTA 4UEHH 4GLYA 1MAXA 1RS0A 3A7ZA 2V3HH 2LPRA 2ZA5A 1HBTH 4XE4A 3H5CB 4GPGA 1ELCA 4MQAA 1K2I1 2GMTB 2WINI 5FXLA 3ESTA 4CBOA 2H6MA 1C1OA 1SQTA 4X2VA 5AVDA 1DVAH 4AFUA 5F6MA 4CH2B 5EGMA 3RMNH 3K6YA 2M5TA 4NZLA 1ANBA 3ELAH 1AI8H 1P9UA 3TPIZ 1AZ8A 2GCTC 1JBUH 5GCHF 4D7GA 1W12U 2HPPH 1HYLA 1SI5H 2QC2A 1MKWH 3QO6A 2ZZUH 2PKAB 2VWNA 1ID5H 4ZHAA 1HIAA 4Y10E 1SOTA 1EXFA 1ELFA 5DG6A 1WQSA 4XOJA 1ELGA 4YT6H 2CMYA 3EAJA 4K3JA 2P3UB 1P2QA 1UTPA 1XVOA 1MKXH 4RKOB 4BAHB 3LU9B 2GTBA 2BD3A 4BAKB 1ETTH 1GBBA 3MH5A 1ZPBA 2ILNA 3FANA 3ZZ8A 4B75A 1XX9A 3BTHE 1GHBF 1SHHB 3ZZBA 3FP7E 4I8HA 4WXIA 5JBBS 3L6PA 3D49H 1O2GH 5IYTA 1QA7A 3A85A 2BYAX 1E34B 3B8JA 2R9PA 3RMMH 1NTPA 5L2YH 1D3DB 2GCHF 2Z3DA 1ZMLA 4AG1A 3W95A 5J4QA 5A2MH 3DUXH 3LH3A 1UO6A 1KDQA 3ATIA 5SGAE 1DUAA 3O8RA 5A0CA 2Z6BD 2H5CA 3N7OA 4BXWA 4FUIA 1QRXA 4JYVH 2ZFRH 1AUJA 3O8BA 3F1SB 5FBIA 3T27A 3RXDA 3VB7A 1O35A 3MFJA 1P09A 4YOGA 2WYGA 1OYQA 1AVWA 1THPB 1T4VH 1RFNA 1L1GA 3S9CA 1Y3WA 2NU3E 3SNDA 1H8IH 3A82A 4Y6DA 4WVPE 2VINA 3DA9B 5FPTA 1GBCA 2VWLA 3SU3A 1GGDC 4R0IA 2JETB 2H9TH 1OWIA 4AG2A 9ESTA 1O3DA 3F6UH 1S81A 1ZOMA 3LJJA 1E36B 2WV4A 2QA9E 1P3CA 2ZHDA 1V2QT 3UR9A 2SGFE 1SR5C 5HXFA 4K1TA 4IN2A 2BLVA 3GY3A 1C1TA 3PO1B 1NS3A 2SNWA 4IC5A 4K2YA 4FUEA 4YO9A 5JPMH 1AMHA 1GCTB 2TRMA 1C5PA 1G37A 1O2KA 2J95A 4NWKA 2WPHS 1GI0A 1RGQA 2RA0A 1XKBC 4DJZB 3KN2A 4CHAC 1K1LA 3MU1A 1OSSA 4Y11E 2B5TB 1CA8B 3BSQA 4DGJA 3TH3H 1EX3A 1PQ5A 3KQDA 1HJ8A 4RN6A 3NPSA 2BDAA 1ZSLA 1ARBA 3LJOA 1OP0A 7ESTE 2FEQH 5F8ZA 2ZHFH 2D1JA 1GJ4H 1ETRH 2XC4A 4ISNA 1XUJA 2BX3A 1GBJA 1NM6A 1QY6A 3SNBA 3PTNA 1O2HA 4D9QA 1ABIH 9LPRA 2FI3E 1O34A 3PLPA 2ZQ2A 5A8XA 1BHXF 4JYTA 1S6FA 4X1PU 4X8VH 1Y3VA 1C9TA 2XBWA 7GCHG 1GG6C 2PKAA 3MU5A 4ABHA 4YESB 5FBEA 2O8MA 2Y81A 1XXFA 2FESH 4Y8XA 3V13A 1DOJA 3IWMA 1QFKH 2XBYA 3KQBA 2V0BA 1MD8A 1WYKA 4OGXA 3ZVCA 2GT8A 2BD4A 1O2VA 2ZQ1A 8GCHG 3HGPA 3M3VA 2FS8A 2BZAA 1BTZA 2A4GA 1PYTD 1CVWH 4I8LA 4Q2KA 4WF8A 1HAOH 1QURH 3RMOH 3RU4D 1V2WT 2OLGA 1YKTA 3NK8A 2FI4E 2OXSA 2BVRH 1V2OT 1GVLA 4WH6A 5EXLA 4KTSA 1CT2E 3AASA 4AYYB 1D6WA 1GMHG 1OPHB 1YPKH 3QWCH 3E1XB 1W0YH 4GVUA 5FCRA 4X1RU 2BY8X 2UUYA 3RXFA 3SI3H 3TVJB 1HJAC 1NU7B 2VGCC 4TWWA 2ZU3A 3T28A 5LPEA 2A2XH 3V3MA 2HLCA 1FPHH 1QA0A 2AGEX 1MTWA 3S69A 2PUQH 4X1SU 2ZGHA 4I8KA 4UFDH 4ISIH 4MPXA 2G4TA 1GJ7B 1UVOA 3QGJA 4B71A 1ZPCA 1DUEA 1DLKB 1TLDA 3RUOA 4O9VA 4SGAE 1UTMA 2FLRH 1BTYA 2G5VA 3RM0H 1GBIA 3UY9A 1LKBA 1HAXB 1P2JA 3ZVDA 4AORA 2DUCA 2ASUB 1GHVH 4UD9H 5BPEA 5ESTE 1C2IA 3SNCA 3K2UA 2NU4E 3RC4A 1AHTH 1BTUA 1NRSH 2PV9B 1BMLA 3AVZA 2A45B 1SGDE 1FY3A 1KY9A 2Q1JA 3PROA 3MO3A 1QL7A 1EOJA 1F92A 1GGDB 1AQ7A 1Z1JA 1P12E 2Y5FA 1AUTC 3A8CA 3K9XB 5E2PA 5C1XA 1BMNH 4YLUA 4FVDA 7KMEH 3MNSA 1GMDF 1TNLA 4YOIA 3OSYA 2J9NA 4A92A 2QAAA 2BDYA 2C3SA 3UFAA 2SFAA 1C1NA 6LPRA 1O2YA 4ABEA 4U2WA 5EW2H 5L30H 4JK6A 1HXFH 1THSH 2AEIH 3SU1A 3T62A 3ZV9A 4ABBA 2ZG0H 1TGNA 2ZDNA 1SGYE 1CHOG 1TIOA 1GJAB 2HNTF 2V3OH 3VPKA 4LZ4B 5EQSA 2BXUH 1V2ST 3UREA 4ABGA 2CJIA 1QQ4A 4XBCA 3QN7A 3TU7H 1TMUH 1YGCH 4MNWA 3SHCH 4ZXYH 1A3EH 1BTHH 4INLA 3R3GB 4YOJA 1SGRE 1ESBA 2W3KA 5EXMA 3GCNA 1IQKA 1SGTA 1SGCA 3E0NB 2JH0D 1O5FH 2BD2A 1CU1A 2G51A 3P8FA 1G2LA 1N6XA 4F49A 4H6SB 1V2UT 2ZEBA 1XVMA 1AO5A 1P57B 1C5OH 1IAUA 2LNCA 1OXGA 1K1IA 1ZSJA 1GCDA 5K0HA 2XBVA 1T8LA 1WBGB 1MH0A 2H5DA 1O2OA 2ZIQH 1OOKB 1GG6B 4E7NA 2XC5A 1TABE 1P9SA 1HV7A 1YPJH 2A7CA 3GY8A 3SU4A 1NRNH 3SGBE 1CSOE 1LPZB 1HRTH 2FX6A 1GDUA 1G3BA 2BVSH 1AVGH 3A88A 1K28D 3A7YA 4D9RA 4AFSA 1NRPH 3C1KA 4IW4E 5CMXH 3TJVA 4H6TA 1VCQA 3FAOA 4NIYA 4O03A 5T6FA 1GHZA 3A8DA 1TX6A 1TALA 3O8DA 1NC6A 1O2IA 3M35A 2VJ1A 1L4DA 1LTOA 1YP9A 2BDBA 1DFPA 1D3PB 2IPHA 1MUEB 2OC1A 3RLWH 1C2MA 3SJ9A 1Y3UA 3UNSA 2FODA 1SGPE 1EP6A 2F9PA 3BV9B 1C2DA 1TA2A 3S0NA 1HAHH 1D4PB 2ZECA 2D2DA 5T6GA 3I29A 1O2QA 3TJNA 1SFIA 3TH2H 1V6DA 1RJXB 1TPPA 2P59A 2PTNA 6GCHF 2G55A 3RXUA 3ATLA 4FU8A 2ZP0H 1TNIA 5DK1A 1NZQH 1DX5M 1IQIA 5DP8A 1MQ5A 2SGEE 3IG6B 5EG4A 1Y5UT 1S84A 2UWOA 5J4SA 1YYY1 3SJKA 1LCYA 2VIOA 1BTPA 1ANEA 4MLFB 4FUFA 1C5WB 1IHTH 4HGCA 3Q3XA 1GI1A 3R0FA 1H9LB 1O2WA 4IN1A 2PKSC 1HB0B 1LVMA 3PWCA 2BY6X 1GJCB 1L2EA 1MBQA 4B2CA 3O8CA 3TK5A 2JKHA 1F7ZA 1PPBH 1O3GA 5EU8A 1N8OC 2ZHEH 1C2FA 3EQ0H 1O3HA 3ENSB 2XNIA 4B2BA 1EAIA 1OWJA 1ELTA 1T31A 1TMTH 3M5MA 4THNH 2FOCA 2XCFA 4FUJA 1FY4A 2AS9A 3VGCB 2FYQA 3RXSA 1F5LA 3BEIB 5JBAS 3KIDU 2VU8E 1FY5A 1EZQA 5L2ZH 2FIRH 1PPHE 2H2ZA 2Y5HA 5JB9S 5DP3A 3DFJA 2BOKA 2GD4B 5LGOA 1MTSA 1C1VH 1W14U 1HAVB 2ZKSA 4CH8B 3M36A 4YT7H 3SJOA 3ITIA 1LHDH 3UWJH 2OBQA 3RXMA 3U1IB 1T8MA 1P11E 1BQYA 1CT4E 1B5GH 4U01A 3UUZA 2FZZA 4JZ1A 1H8DH 1BTWA 1TPOA 1P05A 4E05H 3ATKA 2A7HA 2R0LA 1W13U 4JZDH 3U8OH 5A09A 3UIRA 2F9NA 1EPTC 2BD9A 5GPIB 4MNYA 1EAWA 3FFGA 1NFYA 4K60A 1CA0C 1O2SA 4WMEA 1O3BA 3A7VA 2ZGJA 4X6PA 3SBKA 3T25A 3ZZ6A 2SNVA 3FP8E 1DY8A 3LT3A 3UWIA 1QB1A 6CHAC 1GJDB 1Z8JB 2H9EH 3RXKA 1V2KT 1XUHA 2WPKS 2ZDMA 3PLBA 1TQ0B 1S6HA 3NXPA 1HAIH 2BM2A 5ETXA 5TJXA 3U8RH 3KNXA 3SV6A 2BQ7B 4X6NA 1O2LA 4IMZA 1CGJE 2A1DB 2PLXA 3LKWA 2AIQA 3TK6A 3S7HB 2P8OC 2R2MB 2ZU2A 1GI4A 1VR1H 2B0FA 2ZPQA 1SGEE 1GBMA 2ALPA 3M3TA 4OS5A 3T5FH 1TRMA 8ESTE 3BG4C 4TWYA 1AIXH 2CV3A 3SU6A 1TGSZ 5A8ZA 1L4ZA 3ZVFA 1AVXA 1HLTH 3KL6A 1E0FD 3B23B 1GHYH 2F9VA 3DFLA 3V0XA 1F0TA 1AB9B 1T8NA 5GIBA 2JH5D 2NU0E 1C2KA 3E3TA 1C1UH 1FIWA 1GHWH 1TNHA 3TNSA 3BF6H 3STIA 1WUNH 1FUJA 1PPGE 1N1LA 2ZU4A 3UOPA 3HK3B 4OS2A 3PTBA 4E06H 4VGCB 1W10U 4BXSA 3VFEA 1N6YA 3VB6A 1C5NH 1K1PA 3MNBA 1QJ7B 1QL8A 5JDUB 4ZKSU 4YM9A 3HATH 1RIWC 1JRSA 1QCPA 3ZZ9A 1C1SA 2K1QA 1QRWA 1UCYH 1EOLA 3E6PH 3M3SA 2Y5GA 1C5TA 2OQ5A 1O2NA 1L0ZA 5JYIA 1SSXA 1FZZA 5E0HA 1SC8U 4ZH8A 3GCTF 1UK4A 4UONA 2R2WU 1O2XA 2ZHWH 2PKSB 1GHAF 1V2VT 1XUGA 3RXQA 1JRTA 5FX6A 4Y76A 2R3YA 1K1OA 3SU2A 3QTOH 1GBDA 1O2MA 1BTXA 3LPRA 1MCTA 1O3OA 1NN6A 2I6SA 1D3QB 2A7JA 3W94A 3T29A 4U30A 4FXGH 2HWLB 1HAVA 1HFDA 1C5ZB 3G01A 4GSOA 1LKAA 2A31A 1D3TB 1TB6H 4TY7A 5EW1H 1Y3XA 2BB4A 2PWXA 1QL9A 3STJA 2P93A 1TAWA 2WUBA 1OYTH 1BRBE 5FPSA 1ZMJA 4FUHA 3PMHB 1EB2A 1GJ8B 4X1QU 1KTSB 2ZTZA 2OQUA 1MU6B 1ZGIA 1LQDB 1GBHA 4FVBA 4JCNA 2FTMA 2B7DH 3NUMA 4ASHA 4Y7AA 1UK3A 1O2RA 2DE8A 1CT0E 2F9BH 3A81A 3UOUA 2XWAA 2FP7B 2PGBB 1EPTB 1Z8RA 3GICB 3MMGA 3GDVA 1C2LA 1AY6H 2YNBA 4Q7XA 2P94A 3MHWU 3RLYH 1C1MA 2A5IA 3OY5U 3RMLH 1ELBA 1FMGA 1SLXB 3SUEA 1IQHA 1F0SA 1WCZA 4LZ1H 1SQAA 2XBXA 2Z94A 3TNTA 5I25A 2HALA 3V7TA 3ZZ3A 3GCHC 4K5ZA 1O2UA 1QB6A 4Y8ZA 1C1WH 5F8XA 1C2JA 3RP2A 1SGFG 1EJAA 1O36A 1TA6A 4ZKNU 1V3XA 3RXHA 1ESTA 2FDAA 2AH4X 3SORA 3QGNB 1NY22 5T3HA 1A0LA 1XUFA 1K1MA 4AGJA 1P04A 2FTLE 4ZHLU 1AU8A 1BMMH 4HTCH 4M7GA 1PQAA 2HNTE 2ZDKA 3AAVA 2FWWA 3ZZAA 1C4U2 3BTTE 4U32A 2GT7A 1P2OA 3HKIB 3LC5A 2XRCA 2VVUA 3LIWA 4MDSA 2WUCA 4GCHF 1VCPA 5HM9A 3A86A 4MPWA 1TBZH 3UTUH 2F91A 1YPHC 1C5MD 4NZQA 3A89A 1MZDA 5E0GA 2J2UA 2A2QH 1MU8B 4A5TS 2QXIA 1MTNC 1C9PA 1DT2A 4AOQA 4X2WA 1FV9A 2GCTB 4AX9H 1WTHD 1W7GH 1KXFA 2IJOB 3GOVB 1OWDA 1SMFE 1IHSH 1DSTA 4WJG2 1F5RA 3MH4A 2A4QA 3E91A 1HAYB 4A1TA 1P2NA 2ZI2H 5AF9H 1UCYK 5EQQA 4D8NA 1RIWB 3JZ1B 3LDXH 1E35B 1TX8A 2HVXA 1ETSH 3P8OA 5TCCA 1P10A 3OY6U 2J92A 1T32A 3KCGH 1LVOA 1SGFA 1UVUH 3BIUH 1GVZA 2FOHA 1W0ZU 2AERH 1GBKA 1UTQA 4DVAU 4X2XA 3MU0A 4KTUA 1EKBB 4DCDA 1P02A 1Z7KA 4DG4A 1BA8B 1OP2A 3PMJA 1AWFH 1BBRK 1NFUA 2VIVA 1EUFA 4Y79A 2G5NA 3A84A 1INCA 1O3EA 1C5VA 2OINA 4WMDA 1GJ6A 3MNXA 1NU9A 4CRFA 1A5IA 1UVTH 4AB8A 1GJ9B 1EASA 1TBQH 2ODQA 1O33A 2BLQA 1XXDA 1DWCH 4O3TA 3F68H 3SW2B 3E8LA 1QR3E 5L6NH 3OX7U 2SGPE 2ZU1A 1HGTH 1C1RA 1TOMH 3PV4A 3SU5A 4KELA 2OCVB 1A61H 1TRYA 4IGDA 3BTME 3B9FH 1ZTLA 4NWLA 1SGNE 1O2JA 1EQ9A 1ARCA 5E2OA 1D6RA 4JMYA 2THFB 5FCKA 1Z71A 1CGHA 1SLVB 2F9OA 1NT1A 2NU2E 2PSXA 2AGIX 1IQFA 1EPTA 1QBOA 1VITH 3HGNA 2ESTE 1QNJA 2FOFA 1FAXA 2VIPA 1GI7B 2WV5A 2QYIA 4NCYA 5EODA 2J94A 1IQMA 2A4OA 1FI8A 2CN0H 1G9IE 1H9HE 1PQ7A 1XKAC 2ANMH 2F9UA 4IC6A 4MTBA 3SUDA 4FUGA 3ZZCA 1A2CH 5GCHG 3GYLB 5CHAC 2OP9A 1TE0A 1T4UH 2OC8A 1VITF 3L33A 2DE9A 2ODYB 2EC9H 4IBLH 1KLIH 3MOCA 2Z9JA 4NGAH 2TIOA 2PSYA 4DW2U 3PB1E 2G81E 3SQHE 5C1UA 1QJ6B 4YLQH 1OWHA 1BMAA 2BHGA 3GCHB 3PWBA 3TK9A 2BLWA 1T7CA 3JZ2B 2VB0A 1O39A 3NWUA 4K69A 2ZFSA 1DWEH 3GCTG 4UE7H 1ZHMA 1IQNA 1GI5A 2ZFTA 4CHAB 2Y7XA 4TPYA 3CS7A 2XCNA 3H7TA 3K6ZA 1GHBG 2FX4A 2HNTC 2D26C 1QRZA 3BG8A 3F9EA 4AB9A 2D8WA 1G32B 2CXVA 1HCGA 2GCHG 4NSYA 1O3MA 2AMPA 2FXRA 3DD2H 2A4RA 3RDZA 1YM0A 2IOTA 1BB0B 1DANH 1MD7A 3DT0H 2GZ8A 1CBWC 1ORFA 2H1UA 1W11U 4MPVA 4AGKA 1DXPA 2ZFQH 1MTNB 2XTTB 1HAGE 2FI5E 4QT8C 3SU0A 1UK2A 2QXGA 1BHXB 4JZEH 4CRCA 1TNKA 1A0HB 1YPEH 2W26A 1QBNA 1NESE 1YLDA 2EI8A 2ZPSA 1JWTA 2PGQB 5DJ7A 1O3PB 1RTFB 1ZSKA 2ZWLH 1S82A 4INKA 3TGKE 4CR9A 4JZIA 1YCPK 2BDGA 3RXBA 3LGVA 1LDTT 3RXCA 1BITA 1LQEA 1V2TT 4I8GA 2BD5A 4Q80A 1DICA 2WPLS 1V2PT 4UDWH 3ZVEA 3RC6A 5A8YA 2GDDA 2VVVA 3RXRA 4A1XA 1TGTA 1UTKA 4B1TA 1A5HA 3T2NA 5B6OA 1ZTKA 3A80A 1AFQC 1G3EA 2Z3CA 3HPTB 5C67A 4MVNA 2SGAA 4A1VA 1FN6A 2CF9H 2RDLA 1LHEH 1HJAB 3KQEA 3A8AA 3K65B 2VGCB 1C2EA 1NO9H 1WU1A 2BDCA 1KIGH 3MYWA 4NA9H 3SUGA 2QF0A 3D62A 1O3AA 5HMAA 1C5SA 3VB4A 1CQQA 2F83A 1C2GA 1S83A 1BRCE 2BD8A 3SNEA 4B2AA 1ZTJA 2CHAC 5LPFA 1WTGH 2WPJS 1ANCA 3EGKH 3BTFE 1GBLA 8LPRA 1J8AA 2H9HA 2O9QA 1V2LT 2BTCE 4B76A 5FPYA 1SG8B 1KLTA 4KP0A 5LH8A 1ZZZA 3SNAA 3ZYEA 1OKXA 1F0UA 2EA3A 4MG3A 1DWDH 1TPAE 4Y7BA 1ZPZA 1WAYB 4MNVA 4K8BA 3I77A 5DKMA 1ELDE 1MQ6A 2PTCE 1GDQA 3M7UA 2BDIA 3SGQE 2P16A 2BY9X 1UCYE 1JMOH 4CRDA 2Q6DA 1C1PA 2RG3A 1EZSC 2GKVE 1AD8H 1TMBH 1HXEH 4ISLA 3TGIE 3M5LA 5FAHA 4AFZA 5C5NA 5DO4H 3MO9A 2A5KA 2EI6A 1NROH 4WWYA 1PPFE 5JBTA 1C2HA 3EA8A 2Y6TA 4DIIH 1TX7A 5FX5A 1RD3B 1SPJA 2G00A 1A7SA 1TONA 3P17H 1J15A 5GXPA 2STBE 1D9IA 3MU4A 4SGBE 1FPCH 1JXPA 3F9GA 1TOCB 4OS1A 1FIZA 1S85A 2ZPRA 1QGFA 1GBFA 2OC7A 1VZQH 1C5LH 2Y82A 1P2IA 8GCHF 2VIWA 5BRRE 3HK6B 3RXEA 2CF8H 2HGTH 3GY6A 1MTUA 3PM3A 1KXAA 1SL3A 1Y5BT 3QK1A 4ABJA 3KF2A 2C8XB 4ZUHA 5F8TA 1RRKA 1YC0A 3D23A 1ZJDA 4Y0ZE 3SJIA 1IQGA 3M37A 3E0PB 4Q7YA 3U8TH 3TJOA 3ZVBA 1K9OE 2Z9GA 3KEEA 1KYNA 2W7SA 2UWLA 4GHQA 1ABJH 4JYUH 4TYDA 3BTQE 3Q76A 1BRUP 1YLCA 4OS7A 4BTUB 1O5GH 5C20A 4ZHMU 3VXEH 3TLOA 2J34A 2VNTA 3AAUA 1S5SA 1SB1H 1FONA 3ZZ5A 1FQ3A 1Q3XA 2FPZA 1LMWB 2PUXB 3LGUA 3NKKA 1GL1A 1VCWA 1DM4B 5I46H 1GMDG 4K8YA 1O3KA 3ZZ4A 1O31A 4PROA 4A7IB 4MNXA 2ZCKP 4BAOB 4ESTE 3ZVGA 1IQEA 2C8ZB 3LH1A 1LPKB 1GI2A 3SHAH 1P8VC 1YPHE 2BDHA 4YZUA 1AFQB 2QF3A 1UTOA 2Q6GA 1OWKA 3ZZ7A 1TGCA 2Z7FE 4JK5A 4AZ2B 1BIOA 3RXPA 3QDZB 4OS4A 3A7WA 5LPRA 4BNRA 1SGQE 4MPUA 1BJVA 1ESAA 3FP6E 3TJUA 3QTVH 1SOZA 1EJMA 1UHBB 1LVBA 1ELEE 2CHAB 3URCA 1A3BH 1C5QA 2ZNKH 3BTEE 1PQ8A 5K7RA 3FVFB 1A4WH 2G8TA 2UWPA 2ZGCA 3BN9A 4I7YH 1G2MA 1EJNA 2ZDVH 3SJ8A 4BOHA 1O0DH 2IN2A 1XUKA 1P01A 3EA7A 1IOEA 3U98H 3SV8A 2GP9B 3UPEA 1HPGA 3GDUA 4NSVA 2F3CE 3UQOA 3TH4H 1GI3A 1JIRA 4BAQB 2FMJA 4NFEA 1FLEE 1YPGH 2VH6A 3GYMA 1GI8B 2FYRA 1N8OB 2FOEA 5DP6A 3VB3A 1BBRH 1CHOF 2ZGBH 4BANB 3BEFB 1Z6JH 3OU0A 1Y3YA 1Z8IB 1CGIE 1V2RT 4WMFA 3VB5A 2ZCLP 3ZV8A 4TY6A 1P03A 4ABAA 1FN8A 2VVCA 1NRQH 1A1RA 3QZQA 1BOQA 5IDKA 2QXHA 2TGPZ 1LHGH 3PMBB 1TNGA 2GV7A 2FS9A 3VXFH 4I32A 2BD7A 1HAPH 1GI9B 4XBBA 1THRH 4AFQA 2KAIB 1GJ5H 1GL0E 1QTFA 3OTJE 1DPOA 1L1JA 4FU7A 3ZVAA 3PMAB 1EP5A 2G4UA 2P3TB 2XC0A 1FAKH 1A0JA 1EZXC 2V35A 4I33A 1O5BB 1S0RA 5E0JA 2R3UA 2ZFFH 2ULLA 5GWZA 1TNJA 2GGVB 1AKSB 2NWNA 3MH7A 5EPNA 2GX4A 2B9LA 2QV1A 2XWBI 1CA0B 2C4FH 6GCHG 3LONA 2P3FH 6CHAB 1UTJA 2GZ7A 2ODPA 1CHGA 1IQJA 2HOBA 3GY4A 1F2SE 3A7XA 5T6DA 3TGJE 2WPMS 4ZROA 1FDPA 4J2YB 1YPMH 1K22H 1PPEE 1NFWA 5HGGA 3TITA 3FZZA 3PLKA 4NA8A 2P8OB 4ZAEA 3SV7A 1ZJKA 1M9UA 4O3UA 1BRAA 1TGBA 4LK4A 3M5NA 4HI3A 2QGRA 1UTLM 3BG4B 4Y71A 2ZDAH 2UUKB 3Q77A 1AE8H 4ABIA 3KGPA 2AIPA 1UJ1A 4OS6A 3SQEE 4DY7B 2O8LA 4X2YA 2BQWB 4JZFH 1A5GH 4CRBA 1BDAA 1Z1IA 2Z9LA 5CE1A 5A0AE 4K1SA 2OTVA 3RXAA 1FXYA 2J38A 5EOKA 4KKDA 1CO7E 1MBMA 3F9FA 1Y8TA 4WXVA 1GBTA 3SUFA 1A46H 2FLBH 1YPLH 3MU8A 3FZDA 1Q31A 1BZXE 1AWHB 1O32A 2ANYA 2J4IA 1GMCF 4FUDA 1DITH 2BXTH 4UFGH 1EATA 1UHBA 2Q6FA 4OGYA 1QQUA 4CRAA 2QIQA 3EE0B 1SGIB 1O3CA 1PPCE 5F03A 1F5KU 4E7RG 2AMQA 2UUJB 4TPIZ 1K1NA 1P3EA 5A0BA 3I78A 2QN5T 1DS2E 3RXVA 3SV9A 3BTWE 4HZHA 3ATMA 1YCPH 4ISOA 1MKWK 1V2NT 1YF4A 4NIVA 3T26A 1AZZA 4X6OA 1Z6EA 2STAE 3VEQB 2FOMB 1J16A 2C90B 1TRNA 4BAMB 1C5YB 1O5EH 1SQOA 1O37A 4ISHH 1CE5A 1KSNA 2VIQA 2Z3EA 1BJUA 1ZHPA 3M5OA 4GUXA 1MKXK 2PR3A 5HYOA 2FOGA 1W2KH 5ABWA 1UVSH 2GV6A 4F4OC 4H4FA 5DP7A 1EZUC 4GHTA 3RXJA 4A6LA 1ZRKA 3SO3A 4XFQA 4LXBH 3DHKH 8KME2 2A32A 4X8TH 1QBVH 3RC5A 3UNQA 1ACBE 2GDEH 5DPAA 1TPSA 3P70B 5DGJA 5DP5A 2VWOA 2KAIA 4Y8YA 2A5AA 2YOLA 2QXJA 1QIXB 3QUMP 5TCAA 3Q3KA 1SBWA 3BTKE 3P8GA 5AFYH 2C8WB 2PFEA 3SN8A 1OX1A 4CR5A 1VJAU 3A8BA 3Q00A 5EPYA 4CBNA 1H1BA 1H4WA 1LO6A 1UVPA 4H42U 3S9AA 1ZR0A 1PJPA 1AKSA 1W3CA 1DDJA 4XDEA 2I6QA 2BY5X 4FUBA 1GPZA 1KTTB 1ZRBA 4NIXA 1C4Y2 2WYJA 4X6MA 4Z6AH 3GY2A 5DP9A 3F9HA 3QX5H 2BX4A 2OC0A 1IQLA 3OYPA 4X8UH 2YNAA 3SOSA 1QJ1B 2R0KA 4WH8A 1T8OA 2QCYA 2CGAA 2WPIS 1GVKB 1VGCC 1TBRH 4IS5A 3CP7A 1JIMA 3ATWA 4NG9H 4FU9A 3E90B 3URDA 3LGTA 1O2TA 1E37B 3ODDA 1J17T 2W7UA 4ZMAH 2FM2A 1PFXC 2ALVA 1C4V2 1PPZA 1GBAA 2AGGX 1H9IE 2G52A 3VGCC 4X0WU 3M7TA 4J1YA 1P06A 2BVXH 1WQVH 1TQ7B 4DT7B 4O97A 5C5OA 1B0FA 1LPGB 1S0QA 3NZIA 1GHAG 2FOBA 3PYHA 1ZGVA 1O3IA 2ANKH 3C27B 3E16B 1B7XB 1OP8A 2QY0B 1ZYOA 1C5RA 1SVPA 1P0SH 3A83A 1G3DA 1W8BH 3LGIA 1HUTH 3MTYA 1F0RA 4RKJB 3SI4H 3A7TA 4ZXXH 4I31A 2AYWA 2ZDLA 3QLPH 1O3JA 3CS0A 2FOAA 1GI6A 1K1JA 1O5DH 4DIHH 1JOUB 3P8NA 2Z9KA 3UQVA 4AN7A 3D65E 1VJ9U 2ZTYA 1O3LA 1O3NA 1GBEA 2TPIZ 1W7XH 2BMGB 1G30B 1K21H 1SHYA 2XYAA 2Z9IA 1ZMNA 1GJBB 3MWIU 4FUCA 4CREA 1UTNA 3AW1A 2BLOA 2NU1E 1ZHRA 2P95A 5EXNA 3LOXA 2BZ6H 2BQ6B 3MH6A 3M61U 4BTTB 1ELVA 4I8JA 1LHCH 1FY8E 3RU4E 3WY8A 2TBSA 2B8OH 4X1NU 1O5CB 1Q2WA 3ODFA 1WOFA 4XSKU 1HJ9A 1DY9A 2C8YB 2BOHB 5PTPA 2BY7X 3S7KB 3BTDE 3GCOA 5GDSH 3SV2H 1MTVA 4ABFA 5EQRA 1V2JT 2RCEA 2PHBA 3MO6A 4Q7ZA 1X7AC 2Y80A 1NRRH 4AYVB 3BEUA 4UFEH 1AE5A 4GAWA 2ZGXH 3RM2H 3RU4T 2OUAA 4D76A 1BUIA 3AW0A 1Y5AT 2Y7ZA 4IMQA 3LGWA 1J9CH 1AB9C 1HNEE 1TYNA 1SLUB 2ZF0H 4X8SH 1KXBA 2GMTC 1AN1E 1HDTH 1ANDA 2W3IA 3SZNA 1P2KA 1RTKA 1GDNA 2XXLA 2ZHQH 1OWEA 1RTLA 2C93B 3KQCA 1G36A 4VGCC 1C1QA 3EA9A 2EEKA 5C2ZA 4NFFA 2UUFB 4Y0YE 1O2ZA 4WY3A 6ESTA 1FNIA 3UR6A 4DURA 3P6ZB 7LPRA 1B0EA 3ZZDA 4HFPB 3RXOA 1YCPM 5C1YA 4ZKOU 1KXDA 4GCHG 3U69H 4CRGA 4D7FA 1HAZB 5H4IB 1QB9A 1SLWB 1MAYA 1GWAA 3GY5A 3KHVA 1C5XB 2JH6D 2TGDA 1C5UA 1GMCG 3RXIA 2ZU5A 3GY7A 4NIWA 2VH0A 3RXGA 4INHA 1O5AB 3EYDA 2A0QB 1HIAB 1BCUH 1XM1A 5CHAB 5JB8S 1XUIA 1DWBH 2VIDA 4BTIB 3UNRA 1SFQB 1VGCB 3U1JB 1L1NA 1YBWA 1WSSH 2ANWA 1KLJH 1KXCA 1O38A 2O8TA 1RXPA 5AFZH 1EB1H 5HM2A 3S9BA 2FO9A 4B73A 4KTCA 3A87A 1G3CA 1O30A 1MZAA 4YTAA 2W5EA 2OD3B 2ZO3H 5ESBA 1BT7A 3RXTA 2TGAA 3RXLA 3ZYDA 1NPMA 5C3NA 1ELAA 1O3FA 7GCHF 4B74A 2ZTXA 3SGAE 4KGAA 2HPQH 1DLEA 4UFFH 1AFEH 2ZC9H 1BBRE 1UMAH 2ZFPH 1KDQB 3MI4A 3BTGE 2EI7A 1MMJN 1QHRB 2HRVA 4ZKRU 1LVYA 3L3TA 1Y59T 5G4BA 3TIUA 3M7QA 2V6NA 3V12A 4RSPA 2SGDE
chains in the Genus database with same CATH superfamily
2ZCHP 2AMDA 1P2MA 1EAUA 2JETC 3P95A 3P92A 3LGYA 4R8TB 2OBOA 3GDSA 2SGQE 2GZ9A 3NCLA 1TWXB 1O2PA 1CBWB 3MNCA 2O8WA 1NFXA 5JBCS 2GVFA 1DE7H 1PYTC 1V2MT 1KXEA 1J14A 1U6QA 1GMHF 1DSUA 1MCVA 4NA7A 1LHFH 2O8UA 3PO1C 5GJ4B 4ABDA 5AHGH 3IITA 1Z8GA 5DP4A 1EAXA 1GHXH 1TFXA 4DOQA 1ZLRA 4K1EA 1FY1A 1GCTC 2K0QA 3EDXB 3Q3YA 2AFQB 3H7OA 4LOYH 1AGJA 2J5UA 5FHTA 1XMNB 2PW8H 1FJSA 4Z0KA 3QZRA 4ACBA 3HKJB 5E8EH 1OS8A 1S6LA 2RA3A 2VWMA 3LC3A 3U9AH 1DXWA 3CENA 4XBDA 1E38B 3GISB 1VITG 2XW9A 3BIVH 1WV7H 2TGTA 4UEHH 4GLYA 1MAXA 2KCYA 1RS0A 3A7ZA 2V3HH 2LPRA 3PV5A 2ZA5A 1HBTH 4XE4A 3H5CB 4GPGA 2YMSD 1ELCA 4MQAA 2AHME 1K2I1 2GMTB 2WINI 5FXLA 3ESTA 4CBOA 2H6MA 1C1OA 4I86A 1SQTA 4X2VA 5AVDA 1DVAH 4AFUA 5F6MA 4CH2B 5EGMA 3RMNH 3K6YA 2M5TA 4NZLA 1ANBA 3ELAH 1AI8H 1P9UA 3TPIZ 1AZ8A 2GCTC 1JBUH 5GCHF 4D7GA 1W12U 2HPPH 1HYLA 1SI5H 2QC2A 1MKWH 3QO6A 2ZZUH 2PKAB 2VWNA 1ID5H 4ZHAA 1HIAA 4Y10E 1SOTA 1EXFA 1ELFA 5DG6A 1WQSA 4XOJA 1ELGA 4YT6H 2CMYA 4XD7D 3EAJA 4K3JA 2P3UB 1P2QA 1UTPA 1XVOA 1MKXH 4RKOB 4BAHB 3LU9B 2GTBA 2BD3A 4BAKB 1ETTH 1GBBA 3MH5A 1ZPBA 2ILNA 2F43B 3FANA 3ZZ8A 4B75A 1XX9A 3BTHE 1GHBF 1SHHB 3ZZBA 3FP7E 4I8HA 4WXIA 5JBBS 3L6PA 3D49H 3FO8D 1O2GH 5IYTA 1QA7A 3A85A 2BYAX 1E34B 3B8JA 2R9PA 3RMMH 1NTPA 5L2YH 1D3DB 2GCHF 2Z3DA 1ZMLA 4AG1A 3W95A 5J4QA 5A2MH 3DUXH 3LH3A 1UO6A 1KDQA 3ATIA 4B6FA 1DUAA 5SGAE 3O8RA 5A0CA 3ZIAD 2Z6BD 2H5CA 3N7OA 4BXWA 4FUIA 1QRXA 4JYVH 2ZFRH 1AUJA 3O8BA 3F1SB 5FBIA 3T27A 3RXDA 3VB7A 1O35A 3MFJA 1P09A 4YOGA 2WYGA 1OYQA 1AVWA 1THPB 1T4VH 1RFNA 1L1GA 3S9CA 1Y3WA 2NU3E 3SNDA 1H8IH 3A82A 4Y6DA 4WVPE 2VINA 5HKKD 3DA9B 5FPTA 1GBCA 2VWLA 2W6ID 3SU3A 1GGDC 4R0IA 2JETB 2H9TH 1OWIA 4AG2A 9ESTA 1O3DA 3F6UH 1S81A 1ZOMA 3LJJA 1E36B 2WV4A 2QA9E 1P3CA 2ZHDA 1V2QT 3UR9A 2SGFE 1SR5C 5HXFA 4K1TA 4IN2A 2BLVA 3GY3A 1C1TA 3PO1B 1NS3A 2SNWA 4IC5A 4K2YA 4FUEA 4YO9A 5JPMH 1AMHA 1GCTB 2TRMA 1C5PA 1G37A 1O2KA 2J95A 4NWKA 2WPHS 1GI0A 5F53A 1RGQA 2RA0A 1XKBC 4DJZB 2KFWA 3KN2A 4CHAC 1K1LA 3MU1A 1OSSA 4Y11E 2B5TB 1CA8B 3BSQA 4DGJA 3TH3H 1EX3A 1PQ5A 3KQDA 1HJ8A 4RN6A 4F55A 3NPSA 2BDAA 1ZSLA 1ARBA 3LJOA 1OP0A 7ESTE 2FEQH 3OTPA 5F8ZA 2ZHFH 2D1JA 1GJ4H 1ETRH 2XC4A 4ISNA 1XUJA 2BX3A 1GBJA 1E1QD 1NM6A 1QY6A 3SNBA 3PTNA 1O2HA 4D9QA 1ABIH 9LPRA 2FI3E 1O34A 3PLPA 2ZQ2A 5A8XA 1BHXF 4JYTA 1S6FA 4X1PU 4X8VH 1Y3VA 1C9TA 2VBCA 4XRNA 2XBWA 7GCHG 1GG6C 2PKAA 3MU5A 4ABHA 4YESB 5FBEA 2O8MA 2Y81A 1XXFA 2FESH 4Y8XA 3V13A 1DOJA 3IWMA 2JJ1D 1QFKH 2XBYA 3KQBA 2V0BA 1MD8A 1WYKA 4OGXA 3ZVCA 2IPQX 2GT8A 2BD4A 1O2VA 2ZQ1A 8GCHG 3HGPA 3M3VA 2FS8A 2BZAA 1BTZA 2A4GA 1PYTD 1CVWH 4I8LA 4Q2KA 4WF8A 1HAOH 1QURH 3RMOH 1YLNA 3RU4D 1V2WT 4RT0A 2OLGA 1YKTA 3NK8A 2FI4E 2OXSA 2BVRH 1V2OT 1GVLA 4WH6A 5EXLA 4KTSA 1CT2E 3AASA 4AYYB 1D6WA 1GMHG 1OPHB 1YPKH 1W0JD 3QWCH 3E1XB 1W0YH 4GVUA 5FCRA 4X1RU 2BY8X 2UUYA 3RXFA 2IJD1 3SI3H 3TVJB 1HJAC 1NU7B 2VGCC 4TWWA 2ZU3A 3NRLA 3T28A 2A2XH 5LPEA 3V3MA 2HLCA 1FPHH 1QA0A 2AGEX 1MTWA 3S69A 2PUQH 4X1SU 2ZGHA 4I8KA 4UFDH 4ISIH 4MPXA 2G4TA 2KX4A 2KCAA 1GJ7B 2KZ4A 1UVOA 3QGJA 4B71A 1ZPCA 1DUEA 1DLKB 1TLDA 3RUOA 4O9VA 4SGAE 1UTMA 2FLRH 1BTYA 2G5VA 3RM0H 1GBIA 3UY9A 1LKBA 1HAXB 4F48B 1P2JA 5T1VA 3ZVDA 4AORA 2DUCA 2ASUB 3KYFA 1GHVH 4UD9H 5BPEA 5ESTE 1C2IA 3SNCA 3K2UA 2NU4E 3RC4A 1AHTH 1BTUA 1NRSH 2PV9B 2QF5A 1BMLA 3AVZA 2A45B 1SGDE 1FY3A 1KY9A 2Q1JA 3F0PA 3PROA 3MO3A 1QL7A 1EOJA 1F92A 1GGDB 1AQ7A 1Z1JA 1P12E 2Y5FA 3SZEA 1E1RD 1AUTC 1SKYE 3A8CA 3K9XB 5E2PA 3N7DA 5C1XA 1BMNH 4YLUA 4FVDA 7KMEH 3MNSA 1GMDF 1TNLA 4YOIA 3OSYA 2J9NA 4A92A 2QAAA 4ACAA 2BDYA 2C3SA 3UFAA 5KECA 2SFAA 4FETA 1C1NA 2YMSC 6LPRA 1O2YA 4ABEA 3WWBA 3N7EA 4U2WA 5EW2H 5CDFE 5L30H 4JK6A 1HXFH 1THSH 2AEIH 3SU1A 3T62A 3ZV9A 4ABBA 2ZG0H 1TGNA 2ZDNA 1SGYE 1CHOG 1TIOA 1GJAB 2HNTF 2V3OH 3VPKA 4LZ4B 5EQSA 2BXUH 1V2ST 3UREA 4ABGA 2CJIA 1QQ4A 4XBCA 3QN7A 3TU7H 1TMUH 1YGCH 4MNWA 3SHCH 4ZXYH 1A3EH 1BTHH 4INLA 3R3GB 4YOJA 2HLDD 1SGRE 1ESBA 2W3KA 5EXMA 3GCNA 1IQKA 1SGTA 1SGCA 1WXRA 3E0NB 2JH0D 1O5FH 2BD2A 1CU1A 2G51A 3P8FA 1G2LA 1N6XA 4F49A 4H6SB 2L6OA 1V2UT 2ZEBA 1XVMA 1AO5A 1P57B 1C5OH 1IAUA 2LNCA 1OXGA 1K1IA 1ZSJA 1GCDA 5K0HA 2XBVA 1T8LA 1WBGB 1MABB 1MH0A 2H5DA 1O2OA 2ZIQH 1OOKB 1GG6B 2QE7D 4E7NA 2XC5A 1TABE 1P9SA 1HV7A 1YPJH 2A7CA 3GY8A 3SU4A 1NRNH 3SGBE 1CSOE 1LPZB 1HRTH 2FX6A 1GDUA 1G3BA 2BVSH 1AVGH 3A88A 1K28D 3A7YA 4D9RA 4AFSA 1NRPH 3C1KA 2M2AA 4IW4E 5CMXH 3TJVA 4H6TA 1VCQA 3FAOA 4NIYA 4O03A 5T6FA 2HVYB 1GHZA 5EJZA 3A8DA 1TX6A 1TALA 3O8DA 1NC6A 1O2IA 3M35A 2VJ1A 1L4DA 1LTOA 1YP9A 2BDBA 1DFPA 1D3PB 2IPHA 1MUEB 2OC1A 3RLWH 1C2MA 3SJ9A 1Y3UA 3UNSA 2FODA 1SGPE 1EP6A 2F9PA 3BV9B 1C2DA 1TA2A 3S0NA 1HAHH 1D4PB 2ZECA 2D2DA 5T6GA 3I29A 1O2QA 3TJNA 1SFIA 3TH2H 1V6DA 1RJXB 1TPPA 2P59A 2PTNA 6GCHF 2G55A 3RXUA 3ATLA 4FU8A 1OHHD 2ZP0H 1TNIA 5DK1A 1NZQH 1DX5M 1IQIA 5DP8A 1MQ5A 2SGEE 3IG6B 5EG4A 1Y5UT 3F2FA 1S84A 2UWOA 5J4SA 1YYY1 3SJKA 1LCYA 2VIOA 3CNRA 1BTPA 1ANEA 4MLFB 4FUFA 1C5WB 1IHTH 4HGCA 3Q3XA 1GI1A 3R0FA 1H9LB 1O2WA 4IN1A 2PKSC 1HB0B 1LVMA 3PWCA 2BY6X 1GJCB 1L2EA 1MBQA 4B2CA 3O8CA 2WPDD 3TK5A 2JKHA 1F7ZA 1PPBH 1O3GA 5EU8A 1N8OC 2ZHEH 1C2FA 3EQ0H 1O3HA 3ENSB 2XNIA 4B2BA 1EAIA 1OWJA 1ELTA 1T31A 1TMTH 3M5MA 4THNH 2FOCA 2XCFA 4FUJA 1FY4A 2AS9A 3VGCB 2FYQA 3RXSA 1F5LA 3BEIB 5JBAS 3KIDU 2VU8E 1FY5A 1EZQA 5L2ZH 1YWUA 2FIRH 1PPHE 2H2ZA 2Y5HA 2YMSB 5JB9S 5DP3A 3DFJA 2BOKA 2GD4B 5LGOA 1MTSA 1C1VH 1W14U 1HAVB 2ZKSA 4CH8B 3M36A 4YT7H 3SJOA 3ITIA 3OE7D 1LHDH 3UWJH 2OBQA 3RXMA 2XNDD 3U1IB 1T8MA 1P11E 1BQYA 1CT4E 1B5GH 4U01A 3UUZA 2FZZA 4JZ1A 4Q4LA 1H8DH 1BTWA 1TPOA 1P05A 4E05H 3ATKA 2A7HA 2R0LA 1W13U 4JZDH 3U8OH 5A09A 3UIRA 2F9NA 1EPTC 2BD9A 5GPIB 4MNYA 1EAWA 3FFGA 1NFYA 4K60A 1CA0C 1O2SA 4WMEA 1O3BA 3A7VA 2ZGJA 4X6PA 3SBKA 3T25A 3ZZ6A 2SNVA 3FP8E 1DY8A 3LT3A 3UWIA 1QB1A 6CHAC 1GJDB 1Z8JB 2H9EH 3RXKA 1V2KT 1XUHA 2WPKS 2ZDMA 3PLBA 1TQ0B 1S6HA 3NXPA 4TT3D 1HAIH 5IK2D 2BM2A 5ETXA 5TJXA 3U8RH 3KNXA 3SV6A 2BQ7B 4X6NA 1O2LA 4IMZA 3H09A 1CGJE 2A1DB 2PLXA 3LKWA 2AIQA 3TK6A 3S7HB 2P8OC 2R2MB 2ZU2A 1GI4A 1VR1H 2B0FA 2ZPQA 3F3BA 1SGEE 1GBMA 3WWFA 2ALPA 3M3TA 4OS5A 3T5FH 1TRMA 8ESTE 3BG4C 4TWYA 1AIXH 2CV3A 3PV2A 4DT4A 3SU6A 1TGSZ 5A8ZA 1L4ZA 3ZVFA 1AVXA 1HLTH 3KL6A 1E0FD 3B23B 1GHYH 2F9VA 3DFLA 3V0XA 1F0TA 1AB9B 1T8NA 5GIBA 2JH5D 2NU0E 1C2KA 3E3TA 1C1UH 1FIWA 1GHWH 1TNHA 3TNSA 3BF6H 3STIA 1WUNH 1FUJA 1PPGE 1N1LA 2ZU4A 3UOPA 3HK3B 4OS2A 3PTBA 4E06H 2K8IA 2QF4A 1W10U 4VGCB 4BXSA 3VFEA 1N6YA 3VB6A 1C5NH 1K1PA 3MNBA 1QJ7B 1QL8A 5JDUB 4ZKSU 4YM9A 3HATH 1RIWC 1YY3A 2JIZD 1JRSA 1QCPA 3ZZ9A 1C1SA 2K1QA 1QRWA 1UCYH 1EOLA 3E6PH 3M3SA 2Y5GA 1C5TA 2OQ5A 1O2NA 1L0ZA 5JYIA 1SSXA 1FZZA 5E0HA 1SC8U 4ZH8A 3GCTF 1UK4A 4UONA 2R2WU 1O2XA 2ZHWH 2PKSB 1GHAF 1V2VT 1XUGA 2KCPA 3RXQA 1JRTA 5FX6A 4Y76A 2R3YA 1K1OA 3SU2A 3QTOH 4ASUD 1GBDA 1O2MA 1BTXA 3LPRA 1MCTA 1O3OA 1NN6A 2I6SA 1D3QB 2A7JA 3W94A 3T29A 4U30A 4FXGH 2HWLB 1HAVA 1HFDA 1C5ZB 3G01A 4GSOA 1LKAA 2A31A 1D3TB 1TB6H 4TY7A 5EW1H 1Y3XA 2BB4A 2PWXA 1QL9A 3STJA 2P93A 1TAWA 2WUBA 1OYTH 1BRBE 5FPSA 1ZMJA 4FUHA 3PMHB 1EB2A 1GJ8B 4X1QU 1KTSB 2ZTZA 4AC9A 2OQUA 1MU6B 1ZGIA 2GJGA 1LQDB 1GBHA 4FVBA 4JCNA 2FTMA 2B7DH 3NUMA 4ASHA 2WSSD 4Y7AA 1UK3A 1O2RA 2DE8A 1CT0E 2F9BH 3UB0A 3A81A 3UOUA 2XWAA 2FP7B 2PGBB 1EPTB 1Z8RA 3GICB 3MMGA 3GDVA 1C2LA 1AY6H 2YNBA 4Q7XA 2P94A 3MHWU 3RLYH 1C1MA 2A5IA 2JJ2D 3OY5U 1KMHB 3RMLH 4HG6A 1FX0B 1ELBA 1FMGA 1SLXB 3SUEA 1IQHA 1F0SA 1WCZA 4LZ1H 1SQAA 2XBXA 2Z94A 3TNTA 5I25A 2HALA 3V7TA 3ZZ3A 3GCHC 4K5ZA 1O2UA 1QB6A 4Y8ZA 1C1WH 3SYJA 5F8XA 1C2JA 3RP2A 1SGFG 1EJAA 1E79D 1O36A 1TA6A 2WHXA 4ZKNU 1V3XA 3DSGA 3RXHA 1ESTA 2FDAA 2AH4X 3SORA 3U28C 3QGNB 1NY22 5T3HA 1A0LA 1XUFA 1K1MA 4AGJA 1P04A 2FTLE 4ZHLU 1AU8A 1BMMH 4HTCH 4M7GA 1PQAA 1WDIA 2HNTE 2ZDKA 3AAVA 2FWWA 3ZZAA 1C4U2 3BTTE 4U32A 2GT7A 1P2OA 3HKIB 3LC5A 2XRCA 2VVUA 3F2HA 3LIWA 4MDSA 2WUCA 4GCHF 1VCPA 5HM9A 3A86A 4YXWD 4MPWA 1TBZH 3UTUH 2F91A 1YPHC 1C5MD 4NZQA 3A89A 1MZDA 5E0GA 2J2UA 2A2QH 1MU8B 4A5TS 2QXIA 1MTNC 1C9PA 1DT2A 5FL7D 4X2WA 4AOQA 1FV9A 2GCTB 4AX9H 1WTHD 1W7GH 1KXFA 2IJOB 3GOVB 1OWDA 1SMFE 1IHSH 1DSTA 4WJG2 1F5RA 3MH4A 2A4QA 3E91A 1HAYB 4A1TA 1P2NA 2ZI2H 5AF9H 1UCYK 5EQQA 4D8NA 1RIWB 3JZ1B 3LDXH 1E35B 1TX8A 2HVXA 1ETSH 3P8OA 5TCCA 1P10A 3OY6U 2J92A 1T32A 3KCGH 1LVOA 1SGFA 1UVUH 3BIUH 1GVZA 2FOHA 1W0ZU 2AERH 1GBKA 1UTQA 4DVAU 4X2XA 3MU0A 4KTUA 1EKBB 4DCDA 1P02A 3AK5A 1Z7KA 4DG4A 4Z1MD 1BA8B 1OP2A 3PMJA 1AWFH 1BBRK 1NFUA 2VIVA 1EUFA 4Y79A 2G5NA 3A84A 1INCA 1O3EA 1SQRA 5HIZA 1C5VA 2OINA 4WMDA 1GJ6A 3KYGA 3MNXA 1NU9A 4CRFA 1A5IA 1UVTH 5DSFA 1GJ9B 1EASA 1TBQH 2ODQA 1O33A 2BLQA 1XXDA 4AB8A 1DWCH 4O3TA 3F68H 3SW2B 3E8LA 1QR3E 5L6NH 3OX7U 2SGPE 2ZU1A 1HGTH 2EY4C 1C1RA 5EJLA 1TOMH 3PV4A 3SU5A 4KELA 2OCVB 1A61H 1TRYA 4IGDA 3BTME 3B9FH 1BMFD 1ZTLA 4NWLA 1SGNE 1O2JA 1EQ9A 1ARCA 5E2OA 1D6RA 4JMYA 1W0KD 2THFB 1NBME 5FCKA 1Z71A 1CGHA 2J98B 1SLVB 2F9OA 1NT1A 2NU2E 2PSXA 2AGIX 1IQFA 1EPTA 1QBOA 1VITH 3HGNA 2ESTE 1QNJA 2FOFA 1FAXA 2F4LA 2VIPA 1GI7B 2WV5A 2QYIA 4NCYA 5EODA 2J94A 1IQMA 3DCLA 2A4OA 1FI8A 2CN0H 1G9IE 1K0HA 1H9HE 1H8HD 1PQ7A 1XKAC 2ANMH 2F9UA 3OAAD 4IC6A 4MTBA 3SUDA 4FUGA 3ZZCA 1A2CH 5GCHG 3GYLB 5CHAC 2OP9A 1TE0A 1T4UH 2OC8A 1VITF 3FN8A 3L33A 2DE9A 2ODYB 2EC9H 4IBLH 1KLIH 3MOCA 2Z9JA 4NGAH 2TIOA 2PSYA 4M9FA 4DW2U 3PB1E 2G81E 3SQHE 5C1UA 1QJ6B 4YLQH 1OWHA 1BMAA 2BHGA 3EE7A 3GCHB 3PWBA 3TK9A 2BLWA 1T7CA 3JZ2B 2VB0A 1O39A 3NWUA 4K69A 2ZFSA 1DWEH 3GCTG 4UE7H 1ZHMA 1IQNA 1GI5A 2ZFTA 4CHAB 2Y7XA 4TPYA 3CS7A 3F0OA 2XCNA 3H7TA 3K6ZA 1GHBG 2FX4A 2HNTC 2D26C 1QRZA 3BG8A 3F9EA 4AB9A 2D8WA 1G32B 2CXVA 1HCGA 2GCHG 4NSYA 1O3MA 2AMPA 2FXRA 3DD2H 2A4RA 3RDZA 1YM0A 2IOTA 1BB0B 1DANH 1MD7A 3DT0H 2GZ8A 1CBWC 1ORFA 2H1UA 1W11U 4MPVA 4AGKA 1DXPA 2ZFQH 1MTNB 2XTTB 1HAGE 2FI5E 4QT8C 3SU0A 1UK2A 2QXGA 1BHXB 4JZEH 4CRCA 1TNKA 1A0HB 1YPEH 2W26A 1QBNA 1NESE 1YLDA 2EI8A 2ZPSA 1JWTA 2PGQB 5DJ7A 1O3PB 1RTFB 1ZSKA 2ZWLH 1S82A 4INKA 3TGKE 4CR9A 4JZIA 1YCPK 2BDGA 3RXBA 3LGVA 1LDTT 3RXCA 1BITA 1LQEA 1V2TT 4I8GA 2BD5A 4Q80A 1DICA 2WPLS 1V2PT 4UDWH 3ZVEA 3RC6A 5A8YA 2GDDA 2VVVA 3RXRA 4A1XA 1TGTA 1UTKA 2EQNA 4B1TA 1A5HA 3T2NA 5B6OA 1ZTKA 3A80A 1AFQC 1G3EA 2Z3CA 3HPTB 5C67A 4MVNA 2SGAA 4A1VA 1FN6A 2CF9H 2RDLA 1LHEH 1HJAB 3KQEA 4P02A 3A8AA 3K65B 2VGCB 1C2EA 1NO9H 1WU1A 2BDCA 1KIGH 3MYWA 2LP6A 4NA9H 3SUGA 2QF0A 3D62A 1O3AA 5HMAA 2J98A 5KEDA 1C5SA 3VB4A 1CQQA 2F83A 1C2GA 1S83A 1BRCE 2BD8A 3SNEA 4B2AA 1ZTJA 2CHAC 5LPFA 1WTGH 2WPJS 1ANCA 5EJ1A 3EGKH 3BTFE 1GBLA 2V3MA 5B6LA 8LPRA 3GS9A 1J8AA 2H9HA 2O9QA 1V2LT 2BTCE 4B76A 5FPYA 1SG8B 1KLTA 4KP0A 5LH8A 1ZZZA 3SNAA 3ZYEA 1OKXA 1F0UA 2EA3A 4MG3A 1DWDH 1TPAE 4Y7BA 2CK3D 1ZPZA 1WAYB 4MNVA 4K8BA 5C17A 3I77A 5DKMA 1ELDE 1MQ6A 2PTCE 1GDQA 3M7UA 2BDIA 3SGQE 2P16A 2BY9X 1UCYE 1JMOH 4CRDA 2Q6DA 1C1PA 5DN6D 2KM0A 2RG3A 1EZSC 2GKVE 1AD8H 1TMBH 1HXEH 4ISLA 3TGIE 3M5LA 3OFND 5FAHA 4AFZA 5C5NA 5DO4H 3MO9A 2A5KA 2EI6A 1NROH 4WWYA 1PPFE 5JBTA 1C2HA 3EA8A 2Y6TA 4DIIH 1TX7A 5FX5A 1RD3B 1SPJA 2G00A 1A7SA 1TONA 4ZCNA 3P17H 1J15A 5GXPA 2STBE 1D9IA 5GNDA 3MU4A 4SGBE 1FPCH 1JXPA 3F9GA 1TOCB 4OS1A 1FIZA 1S85A 5C94A 2ZPRA 1QGFA 1GBFA 2OC7A 1VZQH 1C5LH 2Y82A 1P2IA 8GCHF 2VIWA 5BRRE 3HK6B 3RXEA 2CF8H 2HGTH 3DSPA 3GY6A 1MTUA 3PM3A 3KQ5A 1KXAA 1SL3A 1Y5BT 3QK1A 4ABJA 3KF2A 2C8XB 4ZUHA 5F8TA 1RRKA 1YC0A 3D23A 1ZJDA 4Y0ZE 3SJIA 1IQGA 3M37A 3E0PB 4Q7YA 3U8TH 3TJOA 3ZVBA 1K9OE 2Z9GA 3KEEA 1KYNA 2W7SA 2UWLA 4GHQA 1ABJH 4JYUH 4TYDA 3BTQE 3Q76A 1BRUP 1YLCA 4OS7A 4BTUB 1O5GH 5C20A 4ZHMU 3VXEH 3TLOA 2J34A 2VNTA 3AAUA 1S5SA 1SB1H 1FONA 3ZZ5A 1FQ3A 1Q3XA 2FPZA 1LMWB 2PUXB 3LGUA 3NKKA 1GL1A 1VCWA 1DM4B 5I46H 1GMDG 4K8YA 1O3KA 3ZZ4A 1O31A 4PROA 4A7IB 4MNXA 2ZCKP 4BAOB 4ESTE 3ZVGA 1IQEA 2C8ZB 3LH1A 1LPKB 4B6EA 1GI2A 3SHAH 1P8VC 1YPHE 2BDHA 4YZUA 1AFQB 2QF3A 1UTOA 2Q6GA 1COWD 3OEED 1OWKA 3ZZ7A 1TGCA 2Z7FE 4JK5A 4AZ2B 1BIOA 3RXPA 3QDZB 4OS4A 3A7WA 5LPRA 2V7QD 4BNRA 1SGQE 4MPUA 1BJVA 1ESAA 3FP6E 3TJUA 3QTVH 1SOZA 1EJMA 1UHBB 1LVBA 1ELEE 2CHAB 3URCA 1A3BH 1C5QA 3MQKC 2ZNKH 3BTEE 1PQ8A 5K7RA 3FVFB 1A4WH 2G8TA 3FOAA 2UWPA 2ZGCA 3BN9A 2RFKC 4I7YH 1G2MA 1EJNA 2ZDVH 3SJ8A 4BOHA 1O0DH 2IN2A 1XUKA 1P01A 3EA7A 1IOEA 3U98H 3SV8A 2GP9B 3UPEA 1HPGA 3GDUA 4NSVA 2F3CE 3UQOA 3TH4H 1GI3A 1JIRA 4BAQB 5C0UA 2FMJA 3PRDA 4NFEA 1UW7A 1FLEE 1YPGH 2VH6A 3GYMA 1GI8B 2FYRA 1N8OB 2FOEA 5DP6A 3VB3A 1BBRH 1CHOF 2ZGBH 4BANB 3BEFB 1Z6JH 3OU0A 1Y3YA 1Z8IB 4RT1A 1CGIE 1V2RT 4WMFA 3VB5A 2ZCLP 3ZV8A 4TY6A 1P03A 4ABAA 1FN8A 2VVCA 1NRQH 1A1RA 3QZQA 1BOQA 4RI0A 5IDKA 2QXHA 2TGPZ 1LHGH 3PMBB 1TNGA 2GV7A 2FS9A 3VXFH 4I32A 2BD7A 1HAPH 1GI9B 4XBBA 1THRH 4AFQA 2KAIB 1GJ5H 1GL0E 1QTFA 3OTJE 1DPOA 4P00A 1L1JA 4FU7A 3ZVAA 3OEHD 3PMAB 1EP5A 2G4UA 2P3TB 2XC0A 1FAKH 1A0JA 1EZXC 2V35A 4I33A 1O5BB 1S0RA 5E0JA 2R3UA 2ZFFH 2ULLA 5GWZA 1TNJA 2GGVB 1AKSB 2NWNA 3MH7A 5EPNA 2GX4A 2B9LA 2QV1A 2XWBI 2WV9A 1CA0B 2C4FH 6GCHG 1NBMD 2P3FH 3LONA 6CHAB 1UTJA 2GZ7A 2L74A 4FOUC 2ODPA 1CHGA 1IQJA 5EIYA 2HOBA 3GY4A 1F2SE 3A7XA 5T6DA 3TGJE 2WPMS 4ZROA 1FDPA 4J2YB 1YPMH 1K22H 1PPEE 1NFWA 5HGGA 3TITA 3FZZA 3PLKA 4NA8A 2RDEA 2P8OB 4ZAEA 3SV7A 1ZJKA 1M9UA 4O3UA 1BRAA 1TGBA 4LK4A 3M5NA 4HI3A 2PP6A 2QGRA 1UTLM 3BG4B 4Y71A 2ZDAH 2UUKB 3Q77A 1AE8H 3N99A 3KGPA 4ABIA 2AIPA 1UJ1A 4OS6A 3SQEE 4DY7B 2O8LA 4X2YA 2BQWB 4JZFH 1A5GH 4CRBA 1BDAA 1Z1IA 2Z9LA 5CE1A 5A0AE 4K1SA 2OTVA 3RXAA 1FXYA 2J38A 5EOKA 4KKDA 1CO7E 1MBMA 3F9FA 1Y8TA 4WXVA 1GBTA 3SUFA 1A46H 2FLBH 1YPLH 3MU8A 3FZDA 1Q31A 1BZXE 1AWHB 1O32A 2ANYA 2J4IA 1GMCF 4FUDA 1DITH 2BXTH 4UFGH 2JDID 1EATA 1UHBA 2Q6FA 4OGYA 1QQUA 2XOKD 4CRAA 2QIQA 3EE0B 1SGIB 1O3CA 1PPCE 5F03A 1F5KU 4E7RG 2AMQA 2UUJB 4TPIZ 1K1NA 1P3EA 5A0BA 3I78A 2QN5T 1DS2E 3RXVA 3SV9A 3BTWE 4HZHA 3ATMA 1YCPH 4ISOA 1MKWK 1V2NT 1YF4A 4NIVA 3T26A 1AZZA 4X6OA 1Z6EA 2STAE 3VEQB 2FOMB 5KGOA 1J16A 2C90B 1TRNA 4BAMB 1C5YB 1O5EH 1SQOA 3VG8A 1O37A 4ISHH 1CE5A 1KSNA 2VIQA 2Z3EA 1BJUA 1ZHPA 3M5OA 4GUXA 1MKXK 2PR3A 5HYOA 2FOGA 1W2KH 5ABWA 1UVSH 2GV6A 4F4OC 4H4FA 5DP7A 1EZUC 4GHTA 3RXJA 4A6LA 1ZRKA 3SO3A 4XFQA 4LXBH 3DHKH 8KME2 2A32A 4X8TH 1QBVH 3RC5A 3UNQA 1ACBE 2GDEH 3WW7A 5DPAA 1TPSA 3P70B 5DGJA 5DP5A 2VWOA 2KAIA 4Y8YA 2A5AA 2YOLA 5C0TA 2QXJA 1QIXB 3QUMP 5TCAA 3Q3KA 1SBWA 3BTKE 3P8GA 5AFYH 2C8WB 2PFEA 3SN8A 1OX1A 4CR5A 1VJAU 2WZQA 3A8BA 3Q00A 5EPYA 4CBNA 1H1BA 1H4WA 1LO6A 1UVPA 4H42U 3S9AA 1ZR0A 1PJPA 1AKSA 1W3CA 1DDJA 4XDEA 2I6QA 2BY5X 4FUBA 1GPZA 1KTTB 1ZRBA 4NIXA 1C4Y2 2WYJA 4X6MA 4Z6AH 3GY2A 5DP9A 3F9HA 3QX5H 2BX4A 2OC0A 1IQLA 3OYPA 4X8UH 2YNAA 3SOSA 1QJ1B 2R0KA 4WH8A 1T8OA 1H8ED 2QCYA 2CGAA 2WPIS 1GVKB 1VGCC 1TBRH 4IS5A 3CP7A 1JIMA 3ATWA 4NG9H 4FU9A 3E90B 3URDA 3LGTA 1O2TA 1E37B 3ODDA 1J17T 2W7UA 4ZMAH 2FM2A 1PFXC 2ALVA 1C4V2 1PPZA 1GBAA 2AGGX 1H9IE 2G52A 3VGCC 4X0WU 3M7TA 4J1YA 1P06A 2BVXH 1WQVH 1TQ7B 4DT7B 4O97A 5C5OA 1B0FA 1LPGB 1S0QA 3NZIA 1GHAG 2FOBA 3PYHA 1ZGVA 1O3IA 2ANKH 3C27B 3E16B 1B7XB 1OP8A 2QY0B 1ZYOA 1C5RA 1SVPA 1P0SH 3A83A 3F2GA 3UAIC 1G3DA 1W8BH 3LGIA 1HUTH 3MTYA 1F0RA 2LELA 3DSOA 4RKJB 3SI4H 3A7TA 4ZXXH 4I31A 2AYWA 2ZDLA 3QLPH 1O3JA 3CS0A 2FOAA 1GI6A 1K1JA 1O5DH 4DIHH 1JOUB 3P8NA 2Z9KA 3UQVA 4AN7A 3D65E 1VJ9U 2ZTYA 1O3LA 1O3NA 1GBEA 2W6JD 2TPIZ 1W7XH 2BMGB 1G30B 1K21H 1SHYA 2XYAA 2Z9IA 5CHBA 1ZMNA 1GJBB 3MWIU 4FUCA 4CREA 1UTNA 3AW1A 2BLOA 2NU1E 1ZHRA 2P95A 5EXNA 3LOXA 2BZ6H 2BQ6B 3MH6A 3M61U 4BTTB 1ELVA 2J97A 4I8JA 1LHCH 1FY8E 3RU4E 3WY8A 2TBSA 2B8OH 4X1NU 4OM9A 1O5CB 1Q2WA 3ODFA 1WOFA 4XSKU 1HJ9A 3W1EA 1DY9A 2KCOA 2C8YB 2BOHB 1VKYA 2BY7X 5PTPA 3S7KB 3BTDE 3GCOA 5GDSH 3SV2H 1MTVA 4ABFA 5EQRA 1V2JT 2RCEA 2PHBA 3MO6A 4Q7ZA 1X7AC 2Y80A 1NRRH 4AYVB 3BEUA 4UFEH 1AE5A 4GAWA 2ZGXH 3RM2H 3RU4T 2OUAA 4D76A 1BUIA 3AW0A 1Y5AT 2Y7ZA 3PRBA 4IMQA 3LGWA 1J9CH 1AB9C 1HNEE 1TYNA 1SLUB 1EFRD 2ZF0H 4X8SH 1KXBA 2GMTC 1AN1E 1HDTH 1ANDA 2W3IA 3SZNA 1P2KA 1RTKA 1GDNA 2XXLA 2ZHQH 1OWEA 1RTLA 2C93B 3KQCA 1G36A 4VGCC 1C1QA 3EA9A 2EEKA 5C2ZA 4NFFA 2UUFB 4Y0YE 1O2ZA 4WY3A 6ESTA 1FNIA 3UR6A 4DURA 3P6ZB 7LPRA 1B0EA 3ZZDA 4HFPB 3RXOA 1YCPM 5C1YA 4ZKOU 1KXDA 4GCHG 3U69H 4CRGA 4D7FA 1HAZB 5H4IB 1QB9A 1SLWB 1MAYA 1GWAA 3GY5A 3KHVA 1C5XB 2JH6D 2TGDA 1C5UA 1GMCG 3RXIA 1QZ8A 2ZU5A 3GY7A 4NIWA 2VH0A 3RXGA 2KR7A 4INHA 1O5AB 3EYDA 2A0QB 1HIAB 1BCUH 1XM1A 5CHAB 5JB8S 1XUIA 1DWBH 2VIDA 4BTIB 3UNRA 1SFQB 1VGCB 3U1JB 4TSFD 1L1NA 1YBWA 1WSSH 2ANWA 1KLJH 1KXCA 1O38A 2O8TA 1RXPA 5AFZH 1EB1H 5HM2A 3FKSD 3S9BA 2FO9A 4B73A 4KTCA 5HIYA 3A87A 1G3CA 1O30A 1MZAA 4YTAA 2W5EA 2OD3B 2ZO3H 5ESBA 1BT7A 3RXTA 2TGAA 3RXLA 3ZYDA 1NPMA 5C3NA 1ELAA 1O3FA 4Q63A 7GCHF 4B74A 2ZTXA 3SGAE 4KGAA 2HPQH 1DLEA 4UFFH 1AFEH 2ZC9H 1BBRE 1UMAH 2ZFPH 1KDQB 3MI4A 3BTGE 2EI7A 2OK5A 1MMJN 1QHRB 2HRVA 4ZKRU 1LVYA 3L3TA 1Y59T 5G4BA 3TIUA 3M7QA 2V6NA 3V12A 4RSPA 2SGDE
chains in the Genus database with same CATH topology
2ZCHP 2AMDA 1P2MA 1EAUA 2JETC 3P95A 3P92A 3LGYA 4R8TB 2OBOA 3GDSA 2SGQE 2GZ9A 3NCLA 1TWXB 1O2PA 1CBWB 3MNCA 2O8WA 1NFXA 5JBCS 2GVFA 1DE7H 1PYTC 1V2MT 1KXEA 1J14A 1U6QA 1GMHF 1DSUA 1MCVA 4NA7A 1LHFH 2O8UA 3PO1C 5GJ4B 4ABDA 5AHGH 3IITA 1Z8GA 5DP4A 1EAXA 1GHXH 1TFXA 4DOQA 1ZLRA 4K1EA 1FY1A 1GCTC 3EDXB 3Q3YA 2AFQB 3H7OA 4LOYH 1AGJA 5FHTA 1XMNB 2PW8H 1FJSA 4Z0KA 3QZRA 3HKJB 5E8EH 1OS8A 2RA3A 2VWMA 3LC3A 3U9AH 1DXWA 3CENA 4XBDA 1E38B 3GISB 1VITG 2XW9A 3BIVH 1WV7H 2TGTA 4UEHH 4GLYA 1MAXA 1RS0A 3A7ZA 2V3HH 2LPRA 2ZA5A 1HBTH 4XE4A 3H5CB 4GPGA 1ELCA 4MQAA 1K2I1 2GMTB 2WINI 5FXLA 3ESTA 4CBOA 2H6MA 1C1OA 1SQTA 4X2VA 5AVDA 1DVAH 4AFUA 5F6MA 4CH2B 5EGMA 3RMNH 3K6YA 2M5TA 4NZLA 1ANBA 3ELAH 1AI8H 1P9UA 3TPIZ 1AZ8A 2GCTC 1JBUH 5GCHF 4D7GA 1W12U 2HPPH 1HYLA 1SI5H 2QC2A 1MKWH 3QO6A 2ZZUH 2PKAB 2VWNA 1ID5H 4ZHAA 1HIAA 4Y10E 1SOTA 1EXFA 1ELFA 5DG6A 1WQSA 4XOJA 1ELGA 4YT6H 2CMYA 3EAJA 4K3JA 2P3UB 1P2QA 1UTPA 1XVOA 1MKXH 4RKOB 4BAHB 3LU9B 2GTBA 2BD3A 4BAKB 1ETTH 1GBBA 3MH5A 1ZPBA 2ILNA 3FANA 3ZZ8A 4B75A 1XX9A 3BTHE 1GHBF 1SHHB 3ZZBA 3FP7E 4I8HA 4WXIA 5JBBS 3L6PA 3D49H 1O2GH 5IYTA 1QA7A 3A85A 2BYAX 1E34B 3B8JA 2R9PA 3RMMH 1NTPA 5L2YH 1D3DB 2GCHF 2Z3DA 1ZMLA 4AG1A 3W95A 5J4QA 5A2MH 3DUXH 3LH3A 1UO6A 1KDQA 3ATIA 5SGAE 1DUAA 3O8RA 5A0CA 2Z6BD 2H5CA 3N7OA 4BXWA 4FUIA 1QRXA 4JYVH 2ZFRH 1AUJA 3O8BA 3F1SB 5FBIA 3T27A 3RXDA 3VB7A 1O35A 3MFJA 1P09A 4YOGA 2WYGA 1OYQA 1AVWA 1THPB 1T4VH 1RFNA 1L1GA 3S9CA 1Y3WA 2NU3E 3SNDA 1H8IH 3A82A 4Y6DA 4WVPE 2VINA 3DA9B 5FPTA 1GBCA 2VWLA 3SU3A 1GGDC 4R0IA 2JETB 2H9TH 1OWIA 4AG2A 9ESTA 1O3DA 3F6UH 1S81A 1ZOMA 3LJJA 1E36B 2WV4A 2QA9E 1P3CA 2ZHDA 1V2QT 3UR9A 2SGFE 1SR5C 5HXFA 4K1TA 4IN2A 2BLVA 3GY3A 1C1TA 3PO1B 1NS3A 2SNWA 4IC5A 4K2YA 4FUEA 4YO9A 5JPMH 1AMHA 1GCTB 2TRMA 1C5PA 1G37A 1O2KA 2J95A 4NWKA 2WPHS 1GI0A 1RGQA 2RA0A 1XKBC 4DJZB 3KN2A 4CHAC 1K1LA 3MU1A 1OSSA 4Y11E 2B5TB 1CA8B 3BSQA 4DGJA 3TH3H 1EX3A 1PQ5A 3KQDA 1HJ8A 4RN6A 3NPSA 2BDAA 1ZSLA 1ARBA 3LJOA 1OP0A 7ESTE 2FEQH 5F8ZA 2ZHFH 2D1JA 1GJ4H 1ETRH 2XC4A 4ISNA 1XUJA 2BX3A 1GBJA 1NM6A 1QY6A 3SNBA 3PTNA 1O2HA 4D9QA 1ABIH 9LPRA 2FI3E 1O34A 3PLPA 2ZQ2A 5A8XA 1BHXF 4JYTA 1S6FA 4X1PU 4X8VH 1Y3VA 1C9TA 2XBWA 7GCHG 1GG6C 2PKAA 3MU5A 4ABHA 4YESB 5FBEA 2O8MA 2Y81A 1XXFA 2FESH 4Y8XA 3V13A 1DOJA 3IWMA 1QFKH 2XBYA 3KQBA 2V0BA 1MD8A 1WYKA 4OGXA 3ZVCA 2GT8A 2BD4A 1O2VA 2ZQ1A 8GCHG 3HGPA 3M3VA 2FS8A 2BZAA 1BTZA 2A4GA 1PYTD 1CVWH 4I8LA 4Q2KA 4WF8A 1HAOH 1QURH 3RMOH 3RU4D 1V2WT 2OLGA 1YKTA 3NK8A 2FI4E 2OXSA 2BVRH 1V2OT 1GVLA 4WH6A 5EXLA 4KTSA 1CT2E 3AASA 4AYYB 1D6WA 1GMHG 1OPHB 1YPKH 3QWCH 3E1XB 1W0YH 4GVUA 5FCRA 4X1RU 2BY8X 2UUYA 3RXFA 3SI3H 3TVJB 1HJAC 1NU7B 2VGCC 4TWWA 2ZU3A 3T28A 5LPEA 2A2XH 3V3MA 2HLCA 1FPHH 1QA0A 2AGEX 1MTWA 3S69A 2PUQH 4X1SU 2ZGHA 4I8KA 4UFDH 4ISIH 4MPXA 2G4TA 1GJ7B 1UVOA 3QGJA 4B71A 1ZPCA 1DUEA 1DLKB 1TLDA 3RUOA 4O9VA 4SGAE 1UTMA 2FLRH 1BTYA 2G5VA 3RM0H 1GBIA 3UY9A 1LKBA 1HAXB 1P2JA 3ZVDA 4AORA 2DUCA 2ASUB 1GHVH 4UD9H 5BPEA 5ESTE 1C2IA 3SNCA 3K2UA 2NU4E 3RC4A 1AHTH 1BTUA 1NRSH 2PV9B 1BMLA 3AVZA 2A45B 1SGDE 1FY3A 1KY9A 2Q1JA 3PROA 3MO3A 1QL7A 1EOJA 1F92A 1GGDB 1AQ7A 1Z1JA 1P12E 2Y5FA 1AUTC 3A8CA 3K9XB 5E2PA 5C1XA 1BMNH 4YLUA 4FVDA 7KMEH 3MNSA 1GMDF 1TNLA 4YOIA 3OSYA 2J9NA 4A92A 2QAAA 2BDYA 2C3SA 3UFAA 2SFAA 1C1NA 6LPRA 1O2YA 4ABEA 4U2WA 5EW2H 5L30H 4JK6A 1HXFH 1THSH 2AEIH 3SU1A 3T62A 3ZV9A 4ABBA 2ZG0H 1TGNA 2ZDNA 1SGYE 1CHOG 1TIOA 1GJAB 2HNTF 2V3OH 3VPKA 4LZ4B 5EQSA 2BXUH 1V2ST 3UREA 4ABGA 2CJIA 1QQ4A 4XBCA 3QN7A 3TU7H 1TMUH 1YGCH 4MNWA 3SHCH 4ZXYH 1A3EH 1BTHH 4INLA 3R3GB 4YOJA 1SGRE 1ESBA 2W3KA 5EXMA 3GCNA 1IQKA 1SGTA 1SGCA 3E0NB 2JH0D 1O5FH 2BD2A 1CU1A 2G51A 3P8FA 1G2LA 1N6XA 4F49A 4H6SB 1V2UT 2ZEBA 1XVMA 1AO5A 1P57B 1C5OH 1IAUA 2LNCA 1OXGA 1K1IA 1ZSJA 1GCDA 5K0HA 2XBVA 1T8LA 1WBGB 1MH0A 2H5DA 1O2OA 2ZIQH 1OOKB 1GG6B 4E7NA 2XC5A 1TABE 1P9SA 1HV7A 1YPJH 2A7CA 3GY8A 3SU4A 1NRNH 3SGBE 1CSOE 1LPZB 1HRTH 2FX6A 1GDUA 1G3BA 2BVSH 1AVGH 3A88A 1K28D 3A7YA 4D9RA 4AFSA 1NRPH 3C1KA 4IW4E 5CMXH 3TJVA 4H6TA 1VCQA 3FAOA 4NIYA 4O03A 5T6FA 1GHZA 3A8DA 1TX6A 1TALA 3O8DA 1NC6A 1O2IA 3M35A 2VJ1A 1L4DA 1LTOA 1YP9A 2BDBA 1DFPA 1D3PB 2IPHA 1MUEB 2OC1A 3RLWH 1C2MA 3SJ9A 1Y3UA 3UNSA 2FODA 1SGPE 1EP6A 2F9PA 3BV9B 1C2DA 1TA2A 3S0NA 1HAHH 1D4PB 2ZECA 2D2DA 5T6GA 3I29A 1O2QA 3TJNA 1SFIA 3TH2H 1V6DA 1RJXB 1TPPA 2P59A 2PTNA 6GCHF 2G55A 3RXUA 3ATLA 4FU8A 2ZP0H 1TNIA 5DK1A 1NZQH 1DX5M 1IQIA 5DP8A 1MQ5A 2SGEE 3IG6B 5EG4A 1Y5UT 1S84A 2UWOA 5J4SA 1YYY1 3SJKA 1LCYA 2VIOA 1BTPA 1ANEA 4MLFB 4FUFA 1C5WB 1IHTH 4HGCA 3Q3XA 1GI1A 3R0FA 1H9LB 1O2WA 4IN1A 2PKSC 1HB0B 1LVMA 3PWCA 2BY6X 1GJCB 1L2EA 1MBQA 4B2CA 3O8CA 3TK5A 2JKHA 1F7ZA 1PPBH 1O3GA 5EU8A 1N8OC 2ZHEH 1C2FA 3EQ0H 1O3HA 3ENSB 2XNIA 4B2BA 1EAIA 1OWJA 1ELTA 1T31A 1TMTH 3M5MA 4THNH 2FOCA 2XCFA 4FUJA 1FY4A 2AS9A 3VGCB 2FYQA 3RXSA 1F5LA 3BEIB 5JBAS 3KIDU 2VU8E 1FY5A 1EZQA 5L2ZH 2FIRH 1PPHE 2H2ZA 2Y5HA 5JB9S 5DP3A 3DFJA 2BOKA 2GD4B 5LGOA 1MTSA 1C1VH 1W14U 1HAVB 2ZKSA 4CH8B 3M36A 4YT7H 3SJOA 3ITIA 1LHDH 3UWJH 2OBQA 3RXMA 3U1IB 1T8MA 1P11E 1BQYA 1CT4E 1B5GH 4U01A 3UUZA 2FZZA 4JZ1A 1H8DH 1BTWA 1TPOA 1P05A 4E05H 3ATKA 2A7HA 2R0LA 1W13U 4JZDH 3U8OH 5A09A 3UIRA 2F9NA 1EPTC 2BD9A 5GPIB 4MNYA 1EAWA 3FFGA 1NFYA 4K60A 1CA0C 1O2SA 4WMEA 1O3BA 3A7VA 2ZGJA 4X6PA 3SBKA 3T25A 3ZZ6A 2SNVA 3FP8E 1DY8A 3LT3A 3UWIA 1QB1A 6CHAC 1GJDB 1Z8JB 2H9EH 3RXKA 1V2KT 1XUHA 2WPKS 2ZDMA 3PLBA 1TQ0B 1S6HA 3NXPA 1HAIH 2BM2A 5ETXA 5TJXA 3U8RH 3KNXA 3SV6A 2BQ7B 4X6NA 1O2LA 4IMZA 1CGJE 2A1DB 2PLXA 3LKWA 2AIQA 3TK6A 3S7HB 2P8OC 2R2MB 2ZU2A 1GI4A 1VR1H 2B0FA 2ZPQA 1SGEE 1GBMA 2ALPA 3M3TA 4OS5A 3T5FH 1TRMA 8ESTE 3BG4C 4TWYA 1AIXH 2CV3A 3SU6A 1TGSZ 5A8ZA 1L4ZA 3ZVFA 1AVXA 1HLTH 3KL6A 1E0FD 3B23B 1GHYH 2F9VA 3DFLA 3V0XA 1F0TA 1AB9B 1T8NA 5GIBA 2JH5D 2NU0E 1C2KA 3E3TA 1C1UH 1FIWA 1GHWH 1TNHA 3TNSA 3BF6H 3STIA 1WUNH 1FUJA 1PPGE 1N1LA 2ZU4A 3UOPA 3HK3B 4OS2A 3PTBA 4E06H 4VGCB 1W10U 4BXSA 3VFEA 1N6YA 3VB6A 1C5NH 1K1PA 3MNBA 1QJ7B 1QL8A 5JDUB 4ZKSU 4YM9A 3HATH 1RIWC 1JRSA 1QCPA 3ZZ9A 1C1SA 2K1QA 1QRWA 1UCYH 1EOLA 3E6PH 3M3SA 2Y5GA 1C5TA 2OQ5A 1O2NA 1L0ZA 5JYIA 1SSXA 1FZZA 5E0HA 1SC8U 4ZH8A 3GCTF 1UK4A 4UONA 2R2WU 1O2XA 2ZHWH 2PKSB 1GHAF 1V2VT 1XUGA 3RXQA 1JRTA 5FX6A 4Y76A 2R3YA 1K1OA 3SU2A 3QTOH 1GBDA 1O2MA 1BTXA 3LPRA 1MCTA 1O3OA 1NN6A 2I6SA 1D3QB 2A7JA 3W94A 3T29A 4U30A 4FXGH 2HWLB 1HAVA 1HFDA 1C5ZB 3G01A 4GSOA 1LKAA 2A31A 1D3TB 1TB6H 4TY7A 5EW1H 1Y3XA 2BB4A 2PWXA 1QL9A 3STJA 2P93A 1TAWA 2WUBA 1OYTH 1BRBE 5FPSA 1ZMJA 4FUHA 3PMHB 1EB2A 1GJ8B 4X1QU 1KTSB 2ZTZA 2OQUA 1MU6B 1ZGIA 1LQDB 1GBHA 4FVBA 4JCNA 2FTMA 2B7DH 3NUMA 4ASHA 4Y7AA 1UK3A 1O2RA 2DE8A 1CT0E 2F9BH 3A81A 3UOUA 2XWAA 2FP7B 2PGBB 1EPTB 1Z8RA 3GICB 3MMGA 3GDVA 1C2LA 1AY6H 2YNBA 4Q7XA 2P94A 3MHWU 3RLYH 1C1MA 2A5IA 3OY5U 3RMLH 1ELBA 1FMGA 1SLXB 3SUEA 1IQHA 1F0SA 1WCZA 4LZ1H 1SQAA 2XBXA 2Z94A 3TNTA 5I25A 2HALA 3V7TA 3ZZ3A 3GCHC 4K5ZA 1O2UA 1QB6A 4Y8ZA 1C1WH 5F8XA 1C2JA 3RP2A 1SGFG 1EJAA 1O36A 1TA6A 4ZKNU 1V3XA 3RXHA 1ESTA 2FDAA 2AH4X 3SORA 3QGNB 1NY22 5T3HA 1A0LA 1XUFA 1K1MA 4AGJA 1P04A 2FTLE 4ZHLU 1AU8A 1BMMH 4HTCH 4M7GA 1PQAA 2HNTE 2ZDKA 3AAVA 2FWWA 3ZZAA 1C4U2 3BTTE 4U32A 2GT7A 1P2OA 3HKIB 3LC5A 2XRCA 2VVUA 3LIWA 4MDSA 2WUCA 4GCHF 1VCPA 5HM9A 3A86A 4MPWA 1TBZH 3UTUH 2F91A 1YPHC 1C5MD 4NZQA 3A89A 1MZDA 5E0GA 2J2UA 2A2QH 1MU8B 4A5TS 2QXIA 1MTNC 1C9PA 1DT2A 4AOQA 4X2WA 1FV9A 2GCTB 4AX9H 1WTHD 1W7GH 1KXFA 2IJOB 3GOVB 1OWDA 1SMFE 1IHSH 1DSTA 4WJG2 1F5RA 3MH4A 2A4QA 3E91A 1HAYB 4A1TA 1P2NA 2ZI2H 5AF9H 1UCYK 5EQQA 4D8NA 1RIWB 3JZ1B 3LDXH 1E35B 1TX8A 2HVXA 1ETSH 3P8OA 5TCCA 1P10A 3OY6U 2J92A 1T32A 3KCGH 1LVOA 1SGFA 1UVUH 3BIUH 1GVZA 2FOHA 1W0ZU 2AERH 1GBKA 1UTQA 4DVAU 4X2XA 3MU0A 4KTUA 1EKBB 4DCDA 1P02A 1Z7KA 4DG4A 1BA8B 1OP2A 3PMJA 1AWFH 1BBRK 1NFUA 2VIVA 1EUFA 4Y79A 2G5NA 3A84A 1INCA 1O3EA 1C5VA 2OINA 4WMDA 1GJ6A 3MNXA 1NU9A 4CRFA 1A5IA 1UVTH 4AB8A 1GJ9B 1EASA